BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFF038J23

Length=631
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_006338147.1|  PREDICTED: protein phosphatase 1 regulatory ...    120   3e-52   Solanum tuberosum [potatoes]
ref|XP_004239265.1|  PREDICTED: protein phosphatase 1 regulatory ...    122   3e-50   Solanum lycopersicum
ref|XP_009763167.1|  PREDICTED: protein phosphatase 1 regulatory ...    121   3e-50   Nicotiana sylvestris
ref|XP_009607849.1|  PREDICTED: protein phosphatase 1 regulatory ...    119   5e-49   Nicotiana tomentosiformis
ref|XP_010095367.1|  Protein phosphatase 1 regulatory subunit pprA      118   5e-48   Morus notabilis
gb|AET05214.2|  protein phosphatase 1 regulatory subunit 7              117   8e-48   Medicago truncatula
ref|XP_003630738.1|  Protein phosphatase 1 regulatory subunit           117   9e-48   
gb|KHN16632.1|  Protein phosphatase 1 regulatory subunit 7              120   1e-47   Glycine soja [wild soybean]
gb|KHG22032.1|  Protein phosphatase 1 regulatory subunit pprA           120   2e-47   Gossypium arboreum [tree cotton]
ref|XP_011093997.1|  PREDICTED: protein phosphatase 1 regulatory ...    123   2e-47   
ref|XP_006451264.1|  hypothetical protein CICLE_v10008855mg             114   4e-47   Citrus clementina [clementine]
gb|KDO66519.1|  hypothetical protein CISIN_1g018662mg                   114   4e-47   Citrus sinensis [apfelsine]
gb|KDO66518.1|  hypothetical protein CISIN_1g018662mg                   114   5e-47   Citrus sinensis [apfelsine]
gb|KJB83109.1|  hypothetical protein B456_013G229800                    121   8e-47   Gossypium raimondii
gb|KJB83105.1|  hypothetical protein B456_013G229800                    120   8e-47   Gossypium raimondii
ref|NP_001242512.1|  uncharacterized protein LOC100782492               120   8e-47   
ref|XP_006381757.1|  hypothetical protein POPTR_0006s17720g             109   1e-46   Populus trichocarpa [western balsam poplar]
ref|NP_001242821.1|  uncharacterized protein LOC100781548               117   2e-46   
gb|KHN41663.1|  Protein phosphatase 1 regulatory subunit pprA           117   8e-46   Glycine soja [wild soybean]
emb|CDP03273.1|  unnamed protein product                                112   1e-45   Coffea canephora [robusta coffee]
ref|XP_002514241.1|  protein phosphatases pp1 regulatory subunit,...    110   1e-45   
ref|XP_004287462.1|  PREDICTED: protein phosphatase 1 regulatory ...    115   2e-45   Fragaria vesca subsp. vesca
ref|XP_004503473.1|  PREDICTED: protein phosphatase 1 regulatory ...    112   3e-45   
gb|KJB65013.1|  hypothetical protein B456_010G076100                    116   5e-45   Gossypium raimondii
ref|XP_004503472.1|  PREDICTED: protein phosphatase 1 regulatory ...    112   5e-45   
gb|KJB83108.1|  hypothetical protein B456_013G229800                    120   7e-45   Gossypium raimondii
gb|KFK26188.1|  hypothetical protein AALP_AA8G214000                    109   8e-45   Arabis alpina [alpine rockcress]
ref|XP_004139355.1|  PREDICTED: protein phosphatase 1 regulatory ...    114   5e-44   Cucumis sativus [cucumbers]
ref|XP_008458673.1|  PREDICTED: protein phosphatase 1 regulatory ...    112   6e-44   Cucumis melo [Oriental melon]
ref|XP_010535961.1|  PREDICTED: protein phosphatase 1 regulatory ...    105   1e-43   Tarenaya hassleriana [spider flower]
emb|CDY42285.1|  BnaC02g08910D                                          114   1e-43   Brassica napus [oilseed rape]
ref|XP_010249563.1|  PREDICTED: protein phosphatase 1 regulatory ...    116   2e-43   Nelumbo nucifera [Indian lotus]
ref|XP_010049636.1|  PREDICTED: protein phosphatase 1 regulatory ...    116   4e-43   Eucalyptus grandis [rose gum]
ref|XP_010253998.1|  PREDICTED: protein phosphatase 1 regulatory ...    113   4e-43   Nelumbo nucifera [Indian lotus]
ref|XP_006400530.1|  hypothetical protein EUTSA_v10014089mg             113   6e-43   Eutrema salsugineum [saltwater cress]
gb|KDP42237.1|  hypothetical protein JCGZ_02967                         109   8e-43   Jatropha curcas
emb|CDY44934.1|  BnaA02g04390D                                          112   9e-43   Brassica napus [oilseed rape]
gb|AAM61087.1|  unknown                                                 109   1e-42   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010420782.1|  PREDICTED: protein phosphatase 1 regulatory ...    109   2e-42   Camelina sativa [gold-of-pleasure]
ref|XP_009126382.1|  PREDICTED: LOW QUALITY PROTEIN: protein phos...    111   2e-42   Brassica rapa
ref|XP_009120865.1|  PREDICTED: protein phosphatase 1 regulatory ...    112   2e-42   Brassica rapa
emb|CDX92510.1|  BnaA10g15490D                                          112   2e-42   
ref|NP_197469.1|  leucine-rich repeat-containing protein                109   2e-42   Arabidopsis thaliana [mouse-ear cress]
gb|KJB83107.1|  hypothetical protein B456_013G229800                    105   3e-42   Gossypium raimondii
ref|XP_006288189.1|  hypothetical protein CARUB_v10001424mg             108   3e-42   Capsella rubella
ref|XP_010925562.1|  PREDICTED: protein phosphatase 1 regulatory ...    110   5e-42   
ref|XP_010493045.1|  PREDICTED: protein phosphatase 1 regulatory ...    107   6e-42   Camelina sativa [gold-of-pleasure]
ref|XP_010454252.1|  PREDICTED: protein phosphatase 1 regulatory ...    108   7e-42   Camelina sativa [gold-of-pleasure]
gb|EEC72782.1|  hypothetical protein OsI_06455                          118   8e-42   Oryza sativa Indica Group [Indian rice]
ref|NP_001046364.1|  Os02g0230100                                       118   9e-42   
emb|CDY58975.1|  BnaC09g38010D                                          112   9e-42   Brassica napus [oilseed rape]
ref|XP_003571803.1|  PREDICTED: protein phosphatase 1 regulatory ...    114   1e-41   Brachypodium distachyon [annual false brome]
ref|XP_002451818.1|  hypothetical protein SORBIDRAFT_04g008200          112   2e-41   Sorghum bicolor [broomcorn]
ref|XP_009405606.1|  PREDICTED: protein phosphatase 1 regulatory ...    108   3e-41   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_002871899.1|  leucine-rich repeat family protein                 107   3e-41   
ref|XP_004951389.1|  PREDICTED: protein phosphatase 1 regulatory ...    114   3e-41   Setaria italica
ref|XP_009102238.1|  PREDICTED: protein phosphatase 1 regulatory ...    111   9e-41   Brassica rapa
ref|XP_009125770.1|  PREDICTED: protein phosphatase 1 regulatory ...    112   1e-40   Brassica rapa
emb|CDY47338.1|  BnaCnng14750D                                          110   1e-40   Brassica napus [oilseed rape]
emb|CDX89753.1|  BnaC03g46670D                                          110   1e-40   
gb|AIE39577.1|  protein phosphatase 1 regulatory subunit                102   1e-40   Humulus lupulus [common hop]
ref|XP_008791657.1|  PREDICTED: protein phosphatase 1 regulatory ...    107   3e-40   Phoenix dactylifera
ref|XP_008791675.1|  PREDICTED: protein phosphatase 1 regulatory ...    107   3e-40   
emb|CDY42421.1|  BnaC02g22870D                                          109   3e-40   Brassica napus [oilseed rape]
ref|XP_002283839.1|  PREDICTED: protein phosphatase 1 regulatory ...    119   4e-40   Vitis vinifera
emb|CDX87941.1|  BnaC03g54550D                                          110   4e-40   
emb|CAN64835.1|  hypothetical protein VITISV_020599                     119   4e-40   Vitis vinifera
ref|XP_006647096.1|  PREDICTED: protein phosphatase 1 regulatory ...    114   6e-40   Oryza brachyantha
ref|XP_006853636.1|  hypothetical protein AMTR_s00056p00073840          102   6e-40   Amborella trichopoda
emb|CDY44436.1|  BnaC07g24740D                                          110   7e-40   Brassica napus [oilseed rape]
ref|NP_001136450.1|  uncharacterized protein LOC100216558               113   7e-40   Zea mays [maize]
ref|XP_008794123.1|  PREDICTED: protein phosphatase 1 regulatory ...    109   1e-38   
ref|XP_010688296.1|  PREDICTED: protein phosphatase 1 regulatory ...    117   2e-38   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_007202248.1|  hypothetical protein PRUPE_ppa008819mg           92.8    5e-38   
gb|EMS46865.1|  Protein phosphatase 1 regulatory subunit pprA         95.5    1e-35   Triticum urartu
gb|EMT13288.1|  Protein phosphatase 1 regulatory subunit pprA         95.5    5e-35   
ref|XP_001772164.1|  predicted protein                                94.0    2e-33   
emb|CDY17937.1|  BnaC04g02820D                                          110   2e-32   Brassica napus [oilseed rape]
ref|XP_002987569.1|  hypothetical protein SELMODRAFT_183219           91.3    1e-31   Selaginella moellendorffii
ref|XP_002992834.1|  hypothetical protein SELMODRAFT_187027           91.3    1e-31   Selaginella moellendorffii
emb|CDY71037.1|  BnaUnng04160D                                          102   2e-31   Brassica napus [oilseed rape]
ref|XP_001766453.1|  predicted protein                                84.3    3e-30   
gb|EYU27278.1|  hypothetical protein MIMGU_mgv1a0098171mg               122   5e-30   Erythranthe guttata [common monkey flower]
gb|KJB83106.1|  hypothetical protein B456_013G229800                    120   2e-29   Gossypium raimondii
ref|XP_007160299.1|  hypothetical protein PHAVU_002G310000g             117   1e-27   Phaseolus vulgaris [French bean]
ref|XP_007160300.1|  hypothetical protein PHAVU_002G310000g             117   2e-27   Phaseolus vulgaris [French bean]
ref|XP_009147161.1|  PREDICTED: protein phosphatase 1 regulatory ...    113   1e-26   
gb|KJB10119.1|  hypothetical protein B456_001G184800                    111   1e-26   Gossypium raimondii
ref|XP_002324444.1|  hypothetical protein POPTR_0018s09320g             110   2e-25   
ref|XP_011048326.1|  PREDICTED: protein phosphatase 1 regulatory ...    110   4e-25   Populus euphratica
gb|KJB62255.1|  hypothetical protein B456_009G408400                    108   5e-25   Gossypium raimondii
ref|XP_011008944.1|  PREDICTED: protein phosphatase 1 regulatory ...    107   5e-24   Populus euphratica
ref|XP_006585909.1|  PREDICTED: protein phosphatase 1 regulatory ...    101   5e-23   
gb|EPS60921.1|  hypothetical protein M569_13879                         103   7e-23   Genlisea aurea
ref|XP_008364658.1|  PREDICTED: protein phosphatase 1 regulatory ...    101   6e-22   
ref|XP_008356664.1|  PREDICTED: protein phosphatase 1 regulatory ...    100   1e-21   
ref|XP_008387197.1|  PREDICTED: protein phosphatase 1 regulatory ...  99.8    2e-21   
ref|XP_009352536.1|  PREDICTED: protein phosphatase 1 regulatory ...  98.6    5e-21   Pyrus x bretschneideri [bai li]
ref|XP_008242516.1|  PREDICTED: protein phosphatase 1 regulatory ...  94.7    1e-19   Prunus mume [ume]
ref|XP_011468505.1|  PREDICTED: protein phosphatase 1 regulatory ...  62.0    2e-17   Fragaria vesca subsp. vesca
ref|XP_005646296.1|  L domain-like protein                            60.5    2e-16   Coccomyxa subellipsoidea C-169
gb|EYU27277.1|  hypothetical protein MIMGU_mgv1a0098172mg             75.5    3e-14   Erythranthe guttata [common monkey flower]
ref|XP_001700674.1|  predicted protein                                52.0    7e-13   Chlamydomonas reinhardtii
gb|KIY98793.1|  Protein phosphatase 1 regulatory subunit 7            51.2    6e-12   Monoraphidium neglectum
ref|XP_002947065.1|  hypothetical protein VOLCADRAFT_103293           48.5    3e-11   Volvox carteri f. nagariensis
gb|EPY83362.1|  hypothetical protein CB1_000575003                    62.0    2e-10   Camelus ferus
ref|XP_638758.1|  hypothetical protein DDB_G0284039                   53.9    6e-10   Dictyostelium discoideum AX4
ref|XP_011399381.1|  Protein phosphatase 1 regulatory subunit pprA    57.0    7e-10   Auxenochlorella protothecoides
dbj|GAM28146.1|  hypothetical protein SAMD00019534_113220             49.3    2e-09   Acytostelium subglobosum LB1
ref|XP_004357043.1|  Protein phosphatase 1                            49.3    2e-09   Cavenderia fasciculata
dbj|BAB26554.1|  unnamed protein product                              58.9    3e-09   Mus musculus [mouse]
ref|XP_006749060.1|  PREDICTED: protein phosphatase 1 regulatory ...  58.2    4e-09   
dbj|BAE26253.1|  unnamed protein product                              58.2    5e-09   Mus musculus [mouse]
ref|XP_008589407.1|  PREDICTED: protein phosphatase 1 regulatory ...  58.5    5e-09   Galeopterus variegatus [Malayan flying lemur]
ref|NP_075689.1|  protein phosphatase 1 regulatory subunit 7          58.5    6e-09   Mus musculus [mouse]
ref|XP_005005741.1|  PREDICTED: protein phosphatase 1 regulatory ...  57.8    7e-09   Cavia porcellus [guinea pig]
ref|NP_001124579.1|  protein phosphatase 1 regulatory subunit 7       58.2    7e-09   Pongo abelii [orang utan]
gb|EDL39961.1|  protein phosphatase 1, regulatory (inhibitor) sub...  58.5    7e-09   Mus musculus [mouse]
ref|XP_010345586.1|  PREDICTED: protein phosphatase 1 regulatory ...  56.6    7e-09   Saimiri boliviensis boliviensis
ref|XP_004637422.1|  PREDICTED: protein phosphatase 1 regulatory ...  58.2    8e-09   Octodon degus
ref|XP_011228084.1|  PREDICTED: protein phosphatase 1 regulatory ...  57.8    8e-09   Ailuropoda melanoleuca
ref|XP_007085111.1|  PREDICTED: protein phosphatase 1 regulatory ...  57.4    9e-09   Panthera tigris altaica
ref|XP_002923185.1|  PREDICTED: protein phosphatase 1 regulatory ...  58.2    9e-09   Ailuropoda melanoleuca
ref|XP_006935810.1|  PREDICTED: protein phosphatase 1 regulatory ...  57.4    9e-09   Felis catus [cat]
ref|XP_011228085.1|  PREDICTED: protein phosphatase 1 regulatory ...  57.8    9e-09   
ref|XP_010375307.1|  PREDICTED: protein phosphatase 1 regulatory ...  57.0    1e-08   Rhinopithecus roxellana
ref|XP_004743831.1|  PREDICTED: protein phosphatase 1 regulatory ...  57.4    1e-08   Mustela putorius furo [black ferret]
ref|XP_007085112.1|  PREDICTED: protein phosphatase 1 regulatory ...  57.8    1e-08   Panthera tigris altaica
ref|XP_003991355.1|  PREDICTED: protein phosphatase 1 regulatory ...  57.8    1e-08   Felis catus [cat]
ref|XP_009442993.1|  PREDICTED: protein phosphatase 1 regulatory ...  57.0    1e-08   Pan troglodytes
ref|XP_011228086.1|  PREDICTED: protein phosphatase 1 regulatory ...  57.8    1e-08   Ailuropoda melanoleuca
ref|XP_006989656.1|  PREDICTED: protein phosphatase 1 regulatory ...  56.2    1e-08   
ref|XP_004637423.1|  PREDICTED: protein phosphatase 1 regulatory ...  57.8    1e-08   Octodon degus
ref|XP_004809710.1|  PREDICTED: protein phosphatase 1 regulatory ...  57.4    1e-08   
ref|XP_009236625.1|  PREDICTED: protein phosphatase 1 regulatory ...  57.4    1e-08   Pongo abelii [orang utan]
ref|XP_003474608.2|  PREDICTED: protein phosphatase 1 regulatory ...  57.4    1e-08   Cavia porcellus [guinea pig]
ref|NP_001269339.1|  protein phosphatase 1 regulatory subunit 7 i...  57.0    1e-08   Homo sapiens [man]
ref|XP_005005742.1|  PREDICTED: protein phosphatase 1 regulatory ...  57.8    1e-08   Cavia porcellus [guinea pig]
ref|XP_010375308.1|  PREDICTED: protein phosphatase 1 regulatory ...  57.0    1e-08   Rhinopithecus roxellana
ref|XP_008998061.1|  PREDICTED: protein phosphatase 1 regulatory ...  57.0    1e-08   Callithrix jacchus [common marmoset]
ref|XP_004412755.1|  PREDICTED: protein phosphatase 1 regulatory ...  57.0    1e-08   Odobenus rosmarus divergens
gb|EFB16581.1|  hypothetical protein PANDA_012295                     58.2    1e-08   Ailuropoda melanoleuca
ref|XP_008827369.1|  PREDICTED: protein phosphatase 1 regulatory ...  57.0    1e-08   Nannospalax galili
gb|AAP88899.1|  protein phosphatase 1, regulatory subunit 7           57.0    1e-08   synthetic construct
ref|XP_005339689.1|  PREDICTED: protein phosphatase 1 regulatory ...  57.4    1e-08   Ictidomys tridecemlineatus
ref|XP_003798301.1|  PREDICTED: protein phosphatase 1 regulatory ...  57.0    1e-08   Otolemur garnettii
ref|XP_009442994.1|  PREDICTED: protein phosphatase 1 regulatory ...  57.0    1e-08   Pan troglodytes
gb|ERE82036.1|  anoctamin-7                                           56.6    2e-08   Cricetulus griseus [Chinese hamsters]
ref|XP_010604935.1|  PREDICTED: protein phosphatase 1 regulatory ...  57.4    2e-08   
ref|XP_004412756.1|  PREDICTED: protein phosphatase 1 regulatory ...  57.4    2e-08   Odobenus rosmarus divergens
ref|NP_001271924.1|  uncharacterized protein LOC101925067             57.0    2e-08   Macaca fascicularis [crab eating macaque]
ref|NP_001269340.1|  protein phosphatase 1 regulatory subunit 7 i...  57.0    2e-08   Homo sapiens [man]
ref|XP_003798302.1|  PREDICTED: protein phosphatase 1 regulatory ...  57.4    2e-08   Otolemur garnettii
ref|XP_001090766.1|  PREDICTED: protein phosphatase 1 regulatory ...  56.6    2e-08   
ref|XP_003936819.1|  PREDICTED: protein phosphatase 1 regulatory ...  57.0    2e-08   Saimiri boliviensis boliviensis
ref|XP_004743828.1|  PREDICTED: protein phosphatase 1 regulatory ...  57.4    2e-08   Mustela putorius furo [black ferret]
ref|XP_009442992.1|  PREDICTED: protein phosphatase 1 regulatory ...  57.0    2e-08   Pan troglodytes
ref|XP_001158701.1|  PREDICTED: protein phosphatase 1 regulatory ...  56.6    2e-08   Pan troglodytes
ref|XP_009236626.1|  PREDICTED: protein phosphatase 1 regulatory ...  57.0    2e-08   
gb|EHH21837.1|  hypothetical protein EGK_04990                        57.0    2e-08   Macaca mulatta [rhesus macaque]
ref|XP_004743829.1|  PREDICTED: protein phosphatase 1 regulatory ...  57.4    2e-08   Mustela putorius furo [black ferret]
ref|XP_009236624.1|  PREDICTED: protein phosphatase 1 regulatory ...  57.4    2e-08   
ref|XP_534627.3|  PREDICTED: protein phosphatase 1 regulatory sub...  56.6    2e-08   
ref|XP_006165231.1|  PREDICTED: protein phosphatase 1 regulatory ...  56.2    2e-08   Tupaia chinensis
gb|EHH55313.1|  hypothetical protein EGM_04495                        57.0    2e-08   Macaca fascicularis [crab eating macaque]
ref|XP_009236623.1|  PREDICTED: protein phosphatase 1 regulatory ...  57.0    2e-08   Pongo abelii [orang utan]
ref|XP_002799157.1|  PREDICTED: protein phosphatase 1 regulatory ...  56.6    2e-08   
ref|XP_010599015.1|  PREDICTED: protein phosphatase 1 regulatory ...  57.0    2e-08   Loxodonta africana [African bush elephant]
ref|XP_001158513.1|  PREDICTED: protein phosphatase 1 regulatory ...  56.6    2e-08   Pan troglodytes
ref|NP_002703.1|  protein phosphatase 1 regulatory subunit 7 isof...  56.6    2e-08   Homo sapiens [man]
ref|XP_003278941.1|  PREDICTED: protein phosphatase 1 regulatory ...  56.6    2e-08   Nomascus leucogenys [White-cheeked Gibbon]
ref|XP_010604936.1|  PREDICTED: protein phosphatase 1 regulatory ...  57.4    2e-08   Fukomys damarensis [Damara mole rat]
ref|XP_005574921.1|  PREDICTED: protein phosphatase 1 regulatory ...  56.6    2e-08   Macaca fascicularis [crab eating macaque]
ref|NP_001269341.1|  protein phosphatase 1 regulatory subunit 7 i...  57.0    2e-08   Homo sapiens [man]
ref|XP_009181801.1|  PREDICTED: protein phosphatase 1 regulatory ...  57.0    2e-08   
ref|NP_001269343.1|  protein phosphatase 1 regulatory subunit 7 i...  57.0    2e-08   Homo sapiens [man]
ref|XP_004743830.1|  PREDICTED: protein phosphatase 1 regulatory ...  57.4    2e-08   Mustela putorius furo [black ferret]
ref|XP_010946501.1|  PREDICTED: protein phosphatase 1 regulatory ...  55.5    2e-08   Camelus bactrianus [camel]
ref|XP_006989655.1|  PREDICTED: protein phosphatase 1 regulatory ...  56.2    2e-08   Peromyscus maniculatus bairdii
ref|NP_001269338.1|  protein phosphatase 1 regulatory subunit 7 i...  56.6    2e-08   Homo sapiens [man]
ref|XP_005361434.1|  PREDICTED: protein phosphatase 1 regulatory ...  56.6    2e-08   
ref|XP_005077258.1|  PREDICTED: protein phosphatase 1 regulatory ...  55.8    3e-08   
ref|XP_004905710.1|  PREDICTED: protein phosphatase 1 regulatory ...  56.2    3e-08   
ref|XP_003639940.2|  PREDICTED: protein phosphatase 1 regulatory ...  56.6    3e-08   
ref|XP_006209213.1|  PREDICTED: protein phosphatase 1 regulatory ...  55.8    3e-08   Vicugna pacos
ref|XP_010986780.1|  PREDICTED: protein phosphatase 1 regulatory ...  55.8    3e-08   
ref|XP_006181900.1|  PREDICTED: protein phosphatase 1 regulatory ...  56.2    3e-08   Camelus ferus
ref|NP_001269342.1|  protein phosphatase 1 regulatory subunit 7 i...  57.0    3e-08   Homo sapiens [man]
ref|XP_008576592.1|  PREDICTED: protein phosphatase 1 regulatory ...  55.5    3e-08   Galeopterus variegatus [Malayan flying lemur]
ref|XP_007127867.1|  PREDICTED: protein phosphatase 1 regulatory ...  55.1    3e-08   
ref|XP_004667874.1|  PREDICTED: protein phosphatase 1 regulatory ...  56.6    3e-08   Jaculus jaculus
ref|XP_004905709.1|  PREDICTED: protein phosphatase 1 regulatory ...  56.2    3e-08   
ref|XP_005636023.1|  PREDICTED: protein phosphatase 1 regulatory ...  56.2    3e-08   
ref|XP_004905712.1|  PREDICTED: protein phosphatase 1 regulatory ...  56.2    3e-08   
ref|XP_004905711.1|  PREDICTED: protein phosphatase 1 regulatory ...  55.8    3e-08   
ref|XP_005636024.1|  PREDICTED: protein phosphatase 1 regulatory ...  56.2    3e-08   
ref|XP_006209214.1|  PREDICTED: protein phosphatase 1 regulatory ...  56.2    3e-08   Vicugna pacos
ref|XP_005077259.1|  PREDICTED: protein phosphatase 1 regulatory ...  56.2    3e-08   
ref|XP_007342271.1|  L domain-like protein                            47.8    3e-08   
ref|XP_007127868.1|  PREDICTED: protein phosphatase 1 regulatory ...  55.5    4e-08   
ref|XP_007470013.1|  PREDICTED: protein phosphatase 1 regulatory ...  55.8    4e-08   Lipotes vexillifer [baiji]
ref|XP_004667875.1|  PREDICTED: protein phosphatase 1 regulatory ...  56.6    4e-08   Jaculus jaculus
ref|XP_007470012.1|  PREDICTED: protein phosphatase 1 regulatory ...  55.8    4e-08   Lipotes vexillifer [baiji]
ref|XP_007127864.1|  PREDICTED: protein phosphatase 1 regulatory ...  55.5    4e-08   Physeter catodon
ref|XP_004905713.1|  PREDICTED: protein phosphatase 1 regulatory ...  56.2    4e-08   
ref|XP_007470011.1|  PREDICTED: protein phosphatase 1 regulatory ...  55.8    4e-08   Lipotes vexillifer [baiji]
ref|XP_004262575.1|  PREDICTED: protein phosphatase 1 regulatory ...  55.8    4e-08   Orcinus orca [Orca]
ref|XP_004262576.1|  PREDICTED: protein phosphatase 1 regulatory ...  56.2    5e-08   
ref|XP_004316990.1|  PREDICTED: protein phosphatase 1 regulatory ...  56.2    5e-08   
ref|XP_007127866.1|  PREDICTED: protein phosphatase 1 regulatory ...  55.5    5e-08   
ref|XP_007470014.1|  PREDICTED: protein phosphatase 1 regulatory ...  55.8    5e-08   Lipotes vexillifer [baiji]
ref|XP_007127865.1|  PREDICTED: protein phosphatase 1 regulatory ...  55.5    5e-08   Physeter catodon
ref|XP_007184913.1|  PREDICTED: protein phosphatase 1 regulatory ...  55.5    5e-08   Balaenoptera acutorostrata scammoni
ref|XP_007184914.1|  PREDICTED: protein phosphatase 1 regulatory ...  55.8    5e-08   Balaenoptera acutorostrata scammoni
ref|XP_007184915.1|  PREDICTED: protein phosphatase 1 regulatory ...  55.5    6e-08   
ref|XP_007127869.1|  PREDICTED: protein phosphatase 1 regulatory ...  56.2    6e-08   
ref|XP_005411198.1|  PREDICTED: protein phosphatase 1 regulatory ...  55.1    6e-08   Chinchilla lanigera
ref|XP_008765584.1|  PREDICTED: protein phosphatase 1 regulatory ...  53.9    6e-08   Rattus norvegicus [brown rat]
ref|XP_007184916.1|  PREDICTED: protein phosphatase 1 regulatory ...  55.8    7e-08   Balaenoptera acutorostrata scammoni
ref|XP_008688738.1|  PREDICTED: protein phosphatase 1 regulatory ...  55.1    7e-08   Ursus maritimus [white bear]
ref|XP_008048042.1|  PREDICTED: protein phosphatase 1 regulatory ...  55.5    7e-08   Carlito syrichta
ref|XP_008048043.1|  PREDICTED: protein phosphatase 1 regulatory ...  55.5    7e-08   Carlito syrichta
ref|XP_005411199.1|  PREDICTED: protein phosphatase 1 regulatory ...  55.1    8e-08   
ref|XP_004484409.1|  PREDICTED: protein phosphatase 1 regulatory ...  54.7    8e-08   Dasypus novemcinctus
ref|XP_005411200.1|  PREDICTED: protein phosphatase 1 regulatory ...  55.5    8e-08   
ref|XP_008048044.1|  PREDICTED: protein phosphatase 1 regulatory ...  55.5    8e-08   Carlito syrichta
ref|XP_007965162.1|  PREDICTED: protein phosphatase 1 regulatory ...  53.5    9e-08   Chlorocebus sabaeus
ref|XP_007965161.1|  PREDICTED: protein phosphatase 1 regulatory ...  53.9    9e-08   Chlorocebus sabaeus
ref|XP_004597479.1|  PREDICTED: protein phosphatase 1 regulatory ...  54.7    1e-07   Ochotona princeps [southern American pika]
ref|NP_001009825.1|  protein phosphatase 1 regulatory subunit 7       53.9    1e-07   Rattus norvegicus [brown rat]
ref|XP_004597480.1|  PREDICTED: protein phosphatase 1 regulatory ...  54.7    1e-07   Ochotona princeps [southern American pika]
ref|XP_005610822.1|  PREDICTED: protein phosphatase 1 regulatory ...  53.9    1e-07   
ref|XP_004484408.1|  PREDICTED: protein phosphatase 1 regulatory ...  54.7    1e-07   Dasypus novemcinctus
ref|XP_007965159.1|  PREDICTED: protein phosphatase 1 regulatory ...  53.5    1e-07   Chlorocebus sabaeus
ref|XP_007965158.1|  PREDICTED: protein phosphatase 1 regulatory ...  53.5    2e-07   Chlorocebus sabaeus
ref|XP_005610824.1|  PREDICTED: protein phosphatase 1 regulatory ...  53.9    2e-07   
gb|EDL91951.1|  protein phosphatase 1, regulatory (inhibitor) sub...  54.3    2e-07   Rattus norvegicus [brown rat]
ref|XP_008525423.1|  PREDICTED: protein phosphatase 1 regulatory ...  53.9    2e-07   Equus przewalskii [Przewalski horse]
ref|XP_007965163.1|  PREDICTED: protein phosphatase 1 regulatory ...  53.9    2e-07   Chlorocebus sabaeus
ref|XP_005610823.1|  PREDICTED: protein phosphatase 1 regulatory ...  53.9    2e-07   
ref|XP_009313105.1|  putative protein phosphatase 1, regulatory s...  55.5    2e-07   Trypanosoma grayi
ref|XP_005610821.1|  PREDICTED: protein phosphatase 1 regulatory ...  53.5    2e-07   
ref|XP_004427806.1|  PREDICTED: protein phosphatase 1 regulatory ...  52.8    2e-07   Ceratotherium simum simum [southern square-lipped rhinoceros]
gb|KFP26891.1|  Protein phosphatase 1 regulatory subunit 7            58.2    2e-07   Colius striatus
ref|XP_005959711.1|  PREDICTED: protein phosphatase 1 regulatory ...  59.7    3e-07   
ref|XP_004427807.1|  PREDICTED: protein phosphatase 1 regulatory ...  53.1    3e-07   
ref|XP_003499326.2|  PREDICTED: protein phosphatase 1 regulatory ...  52.4    4e-07   Cricetulus griseus [Chinese hamsters]
ref|XP_004003485.1|  PREDICTED: protein phosphatase 1 regulatory ...  58.9    5e-07   
gb|KGL84526.1|  Protein phosphatase 1 regulatory subunit 7            56.2    6e-07   Tinamus guttatus
emb|CCW69103.1|  unnamed protein product                              50.8    9e-07   Phytomonas sp. isolate Hart1
ref|XP_004386537.1|  PREDICTED: protein phosphatase 1 regulatory ...  57.8    1e-06   
ref|XP_006077196.1|  PREDICTED: protein phosphatase 1 regulatory ...  57.8    1e-06   
ref|XP_011309313.1|  PREDICTED: protein phosphatase 1 regulatory ...  52.0    1e-06   Fopius arisanus
ref|XP_006077195.1|  PREDICTED: protein phosphatase 1 regulatory ...  57.4    1e-06   
gb|EOA94784.1|  Protein phosphatase 1 regulatory subunit 7            57.0    1e-06   Anas platyrhynchos [duck]
ref|XP_008470645.1|  PREDICTED: protein phosphatase 1 regulatory ...  57.4    2e-06   Diaphorina citri
ref|XP_004386536.1|  PREDICTED: protein phosphatase 1 regulatory ...  57.4    2e-06   Trichechus manatus latirostris
ref|XP_006077194.1|  PREDICTED: protein phosphatase 1 regulatory ...  57.4    2e-06   Bubalus bubalis [domestic water buffalo]
ref|XP_005205095.1|  PREDICTED: protein phosphatase 1 regulatory ...  57.0    2e-06   Bos taurus [bovine]
ref|XP_011374591.1|  PREDICTED: protein phosphatase 1 regulatory ...  57.0    2e-06   
ref|XP_004994200.1|  hypothetical protein PTSG_04882                  43.5    2e-06   Salpingoeca rosetta
ref|XP_006909973.1|  PREDICTED: protein phosphatase 1 regulatory ...  57.0    2e-06   Pteropus alecto
ref|XP_006875267.1|  PREDICTED: protein phosphatase 1 regulatory ...  57.0    2e-06   Chrysochloris asiatica
ref|XP_006875268.1|  PREDICTED: protein phosphatase 1 regulatory ...  57.0    2e-06   Chrysochloris asiatica
ref|NP_001029410.1|  protein phosphatase 1 regulatory subunit 7       57.0    2e-06   Bos taurus [bovine]
ref|XP_007939645.1|  PREDICTED: protein phosphatase 1 regulatory ...  56.6    2e-06   Orycteropus afer afer
ref|XP_011329941.1|  PREDICTED: protein phosphatase 1 regulatory ...  52.4    2e-06   Ooceraea biroi
ref|XP_011329940.1|  PREDICTED: protein phosphatase 1 regulatory ...  52.4    2e-06   Ooceraea biroi
gb|ELR52253.1|  Protein phosphatase 1 regulatory subunit 7            57.0    2e-06   Bos mutus
ref|XP_011506057.1|  PREDICTED: protein phosphatase 1 regulatory ...  51.6    2e-06   Ceratosolen solmsi marchali
ref|XP_005678916.1|  PREDICTED: protein phosphatase 1 regulatory ...  56.2    3e-06   
ref|XP_001637000.1|  predicted protein                                49.7    3e-06   Nematostella vectensis
ref|XP_005844814.1|  hypothetical protein CHLNCDRAFT_56306            56.6    3e-06   Chlorella variabilis
ref|XP_005901563.1|  PREDICTED: protein phosphatase 1 regulatory ...  56.6    3e-06   
ref|XP_010223506.1|  PREDICTED: protein phosphatase 1 regulatory ...  55.5    3e-06   Tinamus guttatus
ref|XP_007939636.1|  PREDICTED: protein phosphatase 1 regulatory ...  56.6    3e-06   Orycteropus afer afer
ref|XP_005028921.1|  PREDICTED: protein phosphatase 1 regulatory ...  56.6    3e-06   
ref|XP_009526623.1|  hypothetical protein PHYSODRAFT_502348           56.2    3e-06   Phytophthora sojae
ref|XP_008892784.1|  hypothetical protein PPTG_01292                  56.2    3e-06   Phytophthora parasitica INRA-310
gb|ETM45543.1|  hypothetical protein L914_09442                       56.2    3e-06   
gb|ETI45747.1|  hypothetical protein F443_09768                       56.2    3e-06   
ref|XP_010205344.1|  PREDICTED: protein phosphatase 1 regulatory ...  55.5    3e-06   
gb|ETL92238.1|  hypothetical protein L917_09407                       56.2    3e-06   
ref|XP_008202085.1|  PREDICTED: protein phosphatase 1 regulatory ...  50.4    4e-06   
gb|KDO20340.1|  hypothetical protein SPRG_13486                       55.8    4e-06   
ref|XP_008250385.1|  PREDICTED: protein phosphatase 1 regulatory ...  55.8    4e-06   
ref|XP_004701754.1|  PREDICTED: protein phosphatase 1 regulatory ...  55.8    5e-06   
ref|XP_008250383.1|  PREDICTED: protein phosphatase 1 regulatory ...  55.8    5e-06   
gb|KFP06298.1|  Protein phosphatase 1 regulatory subunit 7            55.1    6e-06   
emb|CCC90342.1|  putative protein phosphatase 1, regulatory subunit   55.5    6e-06   
dbj|BAN20537.1|  protein phosphatases pp1 regulatory subunit          55.5    7e-06   
ref|XP_007532041.1|  PREDICTED: protein phosphatase 1 regulatory ...  55.1    8e-06   
gb|KFQ45773.1|  Protein phosphatase 1 regulatory subunit 7            54.7    8e-06   
ref|XP_007667358.1|  PREDICTED: protein phosphatase 1 regulatory ...  54.7    8e-06   
ref|XP_007532040.1|  PREDICTED: protein phosphatase 1 regulatory ...  55.1    9e-06   
gb|KFV75595.1|  Protein phosphatase 1 regulatory subunit 7            54.7    1e-05   
ref|XP_007067430.1|  PREDICTED: protein phosphatase 1 regulatory ...  54.7    1e-05   
ref|XP_009009789.1|  hypothetical protein HELRODRAFT_63747            45.4    1e-05   
ref|XP_005301181.1|  PREDICTED: protein phosphatase 1 regulatory ...  54.7    1e-05   
emb|CDJ97929.1|  Leucine-rich repeat domain containing protein        54.7    1e-05   
ref|XP_009688823.1|  PREDICTED: protein phosphatase 1 regulatory ...  54.7    1e-05   
ref|XP_004620684.1|  PREDICTED: protein phosphatase 1 regulatory ...  54.7    1e-05   
ref|XP_008499068.1|  PREDICTED: protein phosphatase 1 regulatory ...  54.7    1e-05   
ref|XP_009087555.1|  PREDICTED: protein phosphatase 1 regulatory ...  54.7    1e-05   
ref|XP_005151059.1|  PREDICTED: protein phosphatase 1 regulatory ...  54.7    1e-05   
ref|XP_007067428.1|  PREDICTED: protein phosphatase 1 regulatory ...  54.7    1e-05   
ref|XP_005151058.1|  PREDICTED: protein phosphatase 1 regulatory ...  54.7    1e-05   
ref|XP_002585418.1|  leucine-rich repeat protein 8, LRR8              54.3    1e-05   
ref|XP_005050840.1|  PREDICTED: protein phosphatase 1 regulatory ...  54.3    1e-05   
ref|XP_007067429.1|  PREDICTED: protein phosphatase 1 regulatory ...  54.3    1e-05   
ref|XP_009087553.1|  PREDICTED: protein phosphatase 1 regulatory ...  54.3    1e-05   
ref|XP_005050838.1|  PREDICTED: protein phosphatase 1 regulatory ...  54.3    1e-05   
ref|XP_009087554.1|  PREDICTED: protein phosphatase 1 regulatory ...  54.3    1e-05   
ref|XP_002631442.1|  Hypothetical protein CBG03304                    54.3    1e-05   
ref|XP_005050839.1|  PREDICTED: protein phosphatase 1 regulatory ...  54.3    2e-05   
ref|XP_005151057.1|  PREDICTED: protein phosphatase 1 regulatory ...  54.3    2e-05   
ref|NP_001232178.1|  putative protein phosphatase 1 regulatory su...  54.3    2e-05   
gb|ETW56420.1|  hypothetical protein PFUGPA_01593                     54.3    2e-05   
ref|XP_009087552.1|  PREDICTED: protein phosphatase 1 regulatory ...  54.3    2e-05   
gb|KFO34437.1|  Protein phosphatase 1 regulatory subunit 7            53.9    2e-05   
ref|XP_009087551.1|  PREDICTED: protein phosphatase 1 regulatory ...  54.3    2e-05   
ref|XP_001608442.1|  protein phosphatases PP1 regulatory subunit ...  54.3    2e-05   
emb|CCD82423.1|  putative protein phosphatases pp1 regulatory sub...  54.3    2e-05   
ref|XP_010023285.1|  PREDICTED: protein phosphatase 1 regulatory ...  54.3    2e-05   
gb|AAX83388.1|  Sds                                                   54.3    2e-05   
ref|XP_006136770.1|  PREDICTED: LOW QUALITY PROTEIN: protein phos...  54.3    2e-05   
ref|XP_005529693.1|  PREDICTED: protein phosphatase 1 regulatory ...  54.3    2e-05   
ref|XP_005529692.1|  PREDICTED: protein phosphatase 1 regulatory ...  53.9    2e-05   
ref|XP_005301179.1|  PREDICTED: protein phosphatase 1 regulatory ...  53.9    2e-05   
gb|KFW92858.1|  Protein phosphatase 1 regulatory subunit 7            52.8    2e-05   
emb|CDO64758.1|  leucine-rich repeat protein                          53.9    2e-05   
ref|XP_005529691.1|  PREDICTED: protein phosphatase 1 regulatory ...  53.9    2e-05   
ref|XP_007427574.1|  PREDICTED: protein phosphatase 1 regulatory ...  53.9    2e-05   
ref|XP_005489568.1|  PREDICTED: protein phosphatase 1 regulatory ...  53.9    2e-05   
gb|KFP73093.1|  Protein phosphatase 1 regulatory subunit 7            53.5    3e-05   
ref|XP_005425122.1|  PREDICTED: protein phosphatase 1 regulatory ...  53.5    3e-05   
ref|NP_001230831.1|  protein phosphatase 1, regulatory (inhibitor...  53.5    3e-05   
ref|XP_006034956.1|  PREDICTED: protein phosphatase 1 regulatory ...  53.5    3e-05   
ref|XP_952959.1|  protein phosphatase regulator subunit               49.3    3e-05   
ref|XP_005654258.1|  PREDICTED: protein phosphatase 1, regulatory...  53.5    3e-05   
ref|XP_003766276.1|  PREDICTED: protein phosphatase 1 regulatory ...  53.5    3e-05   
gb|KFW86207.1|  Protein phosphatase 1 regulatory subunit 7            53.1    3e-05   
gb|ETW48884.1|  hypothetical protein PFMALIP_03024                    53.5    3e-05   
gb|KDR07843.1|  Protein phosphatase 1 regulatory subunit 7            53.5    3e-05   
ref|XP_009081911.1|  PREDICTED: protein phosphatase 1 regulatory ...  53.5    3e-05   
ref|XP_005101397.1|  PREDICTED: protein phosphatase 1 regulatory ...  53.1    4e-05   
ref|XP_006267104.1|  PREDICTED: protein phosphatase 1 regulatory ...  53.1    4e-05   
gb|KFQ34232.1|  Protein phosphatase 1 regulatory subunit 7            53.1    4e-05   
gb|KFQ95235.1|  Protein phosphatase 1 regulatory subunit 7            53.1    4e-05   
ref|XP_001687598.1|  protein phosphatase type 1 regulator-like pr...  53.1    4e-05   
ref|XP_001463083.1|  protein phosphatase type 1 regulator-like pr...  53.1    4e-05   
gb|KFR17132.1|  Protein phosphatase 1 regulatory subunit 7            52.8    4e-05   
gb|KFZ52816.1|  Protein phosphatase 1 regulatory subunit 7            52.8    4e-05   
ref|XP_008616913.1|  hypothetical protein SDRG_12616                  53.1    4e-05   
ref|XP_003218361.2|  PREDICTED: protein phosphatase 1 regulatory ...  53.1    4e-05   
gb|KFQ81479.1|  Protein phosphatase 1 regulatory subunit 7            52.8    5e-05   
ref|XP_008928436.1|  PREDICTED: protein phosphatase 1 regulatory ...  53.1    5e-05   
gb|EFX78432.1|  hypothetical protein DAPPUDRAFT_213002                52.8    5e-05   
gb|KFW07444.1|  Protein phosphatase 1 regulatory subunit 7            52.8    5e-05   
gb|KFV45408.1|  Protein phosphatase 1 regulatory subunit 7            52.8    5e-05   
gb|KFO10292.1|  Protein phosphatase 1 regulatory subunit 7            52.8    5e-05   
gb|KFO81206.1|  Protein phosphatase 1 regulatory subunit 7            52.8    5e-05   
gb|KFQ01277.1|  Protein phosphatase 1 regulatory subunit 7            52.8    5e-05   
gb|KFO55968.1|  Protein phosphatase 1 regulatory subunit 7            52.8    5e-05   
ref|XP_010181263.1|  PREDICTED: protein phosphatase 1 regulatory ...  52.8    5e-05   
gb|AAX86874.1|  leucine-rich-repeat protein 1                         52.4    5e-05   
gb|KFV71827.1|  Protein phosphatase 1 regulatory subunit 7            52.8    5e-05   
gb|KFV12544.1|  Protein phosphatase 1 regulatory subunit 7            52.8    5e-05   
ref|XP_003737915.1|  PREDICTED: protein phosphatase 1 regulatory ...  52.8    5e-05   
gb|KFO92599.1|  Protein phosphatase 1 regulatory subunit 7            52.8    5e-05   
gb|KFP43701.1|  Protein phosphatase 1 regulatory subunit 7            52.8    5e-05   
gb|KFU88952.1|  Protein phosphatase 1 regulatory subunit 7            52.8    5e-05   
gb|KFM10885.1|  Protein phosphatase 1 regulatory subunit 7            52.4    6e-05   
ref|XP_010703882.1|  protein phosphatase type 1 regulator-like pr...  52.8    6e-05   
ref|XP_009461081.1|  PREDICTED: protein phosphatase 1 regulatory ...  52.8    6e-05   
ref|XP_009461079.1|  PREDICTED: protein phosphatase 1 regulatory ...  52.8    6e-05   
gb|KGL99702.1|  Protein phosphatase 1 regulatory subunit 7            52.4    6e-05   
gb|KFV58870.1|  Protein phosphatase 1 regulatory subunit 7            52.4    6e-05   
ref|XP_009461083.1|  PREDICTED: protein phosphatase 1 regulatory ...  52.8    6e-05   
ref|XP_001561934.1|  protein phosphatase type 1 regulator-like pr...  52.8    6e-05   
ref|XP_009461080.1|  PREDICTED: protein phosphatase 1 regulatory ...  52.8    6e-05   
gb|KFQ59509.1|  Protein phosphatase 1 regulatory subunit 7            52.4    6e-05   
gb|KFP20670.1|  Protein phosphatase 1 regulatory subunit 7            52.4    6e-05   
gb|KFW66484.1|  Protein phosphatase 1 regulatory subunit 7            52.4    6e-05   
gb|KFV14027.1|  Protein phosphatase 1 regulatory subunit 7            52.4    6e-05   
gb|KFP63532.1|  Protein phosphatase 1 regulatory subunit 7            52.4    6e-05   
ref|XP_009913784.1|  PREDICTED: protein phosphatase 1 regulatory ...  52.4    7e-05   
gb|KDQ14279.1|  hypothetical protein BOTBODRAFT_174788                39.3    7e-05   
ref|XP_009979370.1|  PREDICTED: protein phosphatase 1 regulatory ...  52.4    7e-05   
ref|XP_009975292.1|  PREDICTED: protein phosphatase 1 regulatory ...  52.4    7e-05   
ref|XP_009904679.1|  PREDICTED: protein phosphatase 1 regulatory ...  52.4    7e-05   
ref|XP_009904678.1|  PREDICTED: protein phosphatase 1 regulatory ...  52.4    7e-05   
ref|XP_003700688.1|  PREDICTED: protein phosphatase 1 regulatory ...  48.1    7e-05   
ref|XP_009566008.1|  PREDICTED: protein phosphatase 1 regulatory ...  52.4    7e-05   
ref|XP_005708659.1|  protein phosphatase 1                            52.4    7e-05   
ref|XP_010299549.1|  PREDICTED: protein phosphatase 1 regulatory ...  52.4    7e-05   
ref|XP_010139038.1|  PREDICTED: protein phosphatase 1 regulatory ...  52.4    7e-05   
ref|XP_009913783.1|  PREDICTED: protein phosphatase 1 regulatory ...  52.4    7e-05   
ref|XP_008553431.1|  PREDICTED: protein phosphatase 1 regulatory ...  52.4    7e-05   
ref|XP_009941052.1|  PREDICTED: protein phosphatase 1 regulatory ...  52.4    7e-05   
ref|XP_004221486.1|  protein phosphatases PP1 regulatory subunit ...  52.4    7e-05   
ref|XP_009282497.1|  PREDICTED: protein phosphatase 1 regulatory ...  52.4    7e-05   
ref|XP_010559561.1|  PREDICTED: protein phosphatase 1 regulatory ...  52.4    7e-05   
ref|XP_009566010.1|  PREDICTED: protein phosphatase 1 regulatory ...  52.4    7e-05   
ref|XP_008627750.1|  PREDICTED: protein phosphatase 1 regulatory ...  52.4    7e-05   
ref|XP_005236902.1|  PREDICTED: protein phosphatase 1 regulatory ...  52.4    7e-05   
ref|XP_009566007.1|  PREDICTED: protein phosphatase 1 regulatory ...  52.4    8e-05   
ref|XP_009904676.1|  PREDICTED: protein phosphatase 1 regulatory ...  52.4    8e-05   
ref|XP_010291986.1|  PREDICTED: protein phosphatase 1 regulatory ...  52.4    8e-05   
ref|XP_010122352.1|  PREDICTED: protein phosphatase 1 regulatory ...  52.4    8e-05   
ref|XP_009995028.1|  PREDICTED: protein phosphatase 1 regulatory ...  52.4    8e-05   
ref|XP_009904677.1|  PREDICTED: protein phosphatase 1 regulatory ...  52.4    8e-05   
ref|XP_009578926.1|  PREDICTED: protein phosphatase 1 regulatory ...  52.4    8e-05   
ref|XP_009566009.1|  PREDICTED: protein phosphatase 1 regulatory ...  52.4    8e-05   
ref|XP_010559560.1|  PREDICTED: protein phosphatase 1 regulatory ...  52.4    8e-05   
gb|KFZ45411.1|  Protein phosphatase 1 regulatory subunit 7            52.0    8e-05   
ref|XP_009282498.1|  PREDICTED: protein phosphatase 1 regulatory ...  52.4    8e-05   
ref|XP_005436297.1|  PREDICTED: protein phosphatase 1 regulatory ...  52.4    8e-05   
ref|XP_009321459.1|  PREDICTED: protein phosphatase 1 regulatory ...  52.4    8e-05   
ref|XP_005236901.1|  PREDICTED: protein phosphatase 1 regulatory ...  52.4    8e-05   
ref|XP_009695432.1|  PREDICTED: protein phosphatase 1 regulatory ...  52.4    8e-05   
gb|EMC77914.1|  Protein phosphatase 1 regulatory subunit 7            52.0    8e-05   
ref|XP_009891372.1|  PREDICTED: protein phosphatase 1 regulatory ...  52.4    9e-05   
ref|XP_002899652.1|  protein phosphatase 1 regulatory subunit, pu...  52.0    9e-05   
ref|XP_009816501.1|  PREDICTED: protein phosphatase 1 regulatory ...  52.0    9e-05   
gb|AAW26002.1|  SJCHGC02345 protein                                   51.2    9e-05   
ref|XP_009642749.1|  PREDICTED: protein phosphatase 1 regulatory ...  52.0    1e-04   
ref|XP_001609827.1|  protein phosphatase 1, regulatory (inhibitor...  52.0    1e-04   
gb|KFM57874.1|  Protein phosphatase 1 regulatory subunit 7            52.0    1e-04   
ref|XP_002766372.1|  leucine-rich-repeat protein 4.2, putative        50.8    1e-04   
gb|KDO16430.1|  hypothetical protein SPRG_18044                       52.4    1e-04   
ref|XP_009477570.1|  PREDICTED: protein phosphatase 1 regulatory ...  52.0    1e-04   
gb|KFQ29382.1|  Protein phosphatase 1 regulatory subunit 7            51.6    1e-04   
ref|NP_001264359.1|  protein phosphatase 1 regulatory subunit 7 i...  52.0    1e-04   
ref|WP_042239922.1|  hypothetical protein                             39.3    1e-04   
ref|NP_001264357.1|  protein phosphatase 1 regulatory subunit 7 i...  52.0    1e-04   
emb|CDU16766.1|  leucine-rich repeat protein                          51.6    1e-04   
emb|CBH10924.1|  protein phosphatase 1, regulatory subunit,putative   52.0    1e-04   
ref|NP_001264358.1|  protein phosphatase 1 regulatory subunit 7 i...  52.0    1e-04   
ref|XP_008817166.1|  hypothetical protein C922_03352                  51.6    1e-04   
ref|XP_844733.1|  protein phosphatase 1, regulatory subunit           52.0    1e-04   
ref|XP_005501596.1|  PREDICTED: protein phosphatase 1 regulatory ...  51.6    1e-04   
gb|ELV12248.1|  Protein phosphatase 1 regulatory subunit 7            48.5    1e-04   
ref|XP_010080283.1|  PREDICTED: protein phosphatase 1 regulatory ...  51.6    1e-04   
ref|XP_005501597.1|  PREDICTED: protein phosphatase 1 regulatory ...  51.6    1e-04   
gb|ETB58863.1|  hypothetical protein YYC_03628                        51.6    1e-04   
ref|XP_010163982.1|  PREDICTED: protein phosphatase 1 regulatory ...  51.6    1e-04   
emb|CDS46012.1|  leucine-rich repeat protein                          51.6    1e-04   
gb|EUD71550.1|  hypothetical protein YYG_02963                        51.6    1e-04   
ref|XP_003872011.1|  protein phosphatase type 1 regulator-like pr...  51.6    1e-04   
ref|XP_003289118.1|  hypothetical protein DICPUDRAFT_79885            51.6    1e-04   
dbj|GAA98844.1|  hypothetical protein E5Q_05532                       41.6    1e-04   
gb|EPY28664.1|  protein phosphatase type 1 regulator-like protein     51.6    2e-04   
ref|XP_008938227.1|  PREDICTED: protein phosphatase 1 regulatory ...  51.6    2e-04   
ref|XP_010714814.1|  PREDICTED: protein phosphatase 1 regulatory ...  51.2    2e-04   
ref|XP_010714813.1|  PREDICTED: protein phosphatase 1 regulatory ...  51.2    2e-04   
ref|XP_008625764.1|  hypothetical protein YYE_03897                   51.2    2e-04   
gb|EPY30664.1|  protein phosphatase type 1 regulator-like protein     51.2    2e-04   
ref|XP_003209089.1|  PREDICTED: protein phosphatase 1 regulatory ...  51.2    2e-04   
ref|XP_003209088.1|  PREDICTED: protein phosphatase 1 regulatory ...  51.2    2e-04   
gb|EPY31454.1|  protein phosphatase type 1 regulator-like protein     51.2    2e-04   
gb|KFQ06942.1|  Protein phosphatase 1 regulatory subunit 7            50.8    2e-04   
ref|XP_010152797.1|  PREDICTED: protein phosphatase 1 regulatory ...  50.1    2e-04   
gb|KFQ89094.1|  Protein phosphatase 1 regulatory subunit 7            50.8    2e-04   
gb|KIC75240.1|  Leucine-rich repeat protein SHOC-2                    38.5    2e-04   
ref|XP_005857754.1|  PREDICTED: protein phosphatase 1 regulatory ...  40.8    2e-04   
ref|XP_003978239.1|  PREDICTED: protein phosphatase 1 regulatory ...  50.8    2e-04   
ref|XP_009945165.1|  PREDICTED: protein phosphatase 1 regulatory ...  50.8    2e-04   
ref|XP_974981.1|  PREDICTED: protein phosphatase 1 regulatory sub...  50.8    2e-04   
gb|EFA08734.1|  hypothetical protein TcasGA2_TC006409                 50.8    2e-04   
gb|EFZ22271.1|  hypothetical protein SINV_14234                       45.4    3e-04   
emb|CDI85821.1|  hypothetical protein, conserved                      50.8    3e-04   
ref|XP_011167818.1|  PREDICTED: protein phosphatase 1 regulatory ...  45.4    3e-04   
ref|XP_009692543.1|  protein phosphatase regulator subunit            50.4    3e-04   
ref|XP_001364455.2|  PREDICTED: protein phosphatase 1 regulatory ...  50.8    3e-04   
ref|XP_005857753.1|  PREDICTED: protein phosphatase 1 regulatory ...  40.4    3e-04   
gb|EPQ02384.1|  Protein phosphatase 1 regulatory subunit 7            40.8    3e-04   
emb|CDR95147.1|  protein phosphatase 1, regulatory (inhibitor) su...  50.4    3e-04   
emb|CDJ65858.1|  hypothetical protein, conserved                      50.4    3e-04   
ref|XP_008136695.1|  PREDICTED: protein phosphatase 1 regulatory ...  40.4    3e-04   
ref|NP_001155729.1|  protein phosphatases pp1 regulatory subunit-...  50.4    3e-04   
ref|XP_003978238.1|  PREDICTED: protein phosphatase 1 regulatory ...  50.4    3e-04   
emb|CDJ41257.1|  hypothetical protein, conserved                      50.4    4e-04   
ref|XP_010493047.1|  PREDICTED: protein phosphatase 1 regulatory ...  49.3    4e-04   
ref|NP_001006731.1|  protein phosphatase 1 regulatory subunit 7       50.1    4e-04   
ref|WP_042239619.1|  leucine rich repeat protein                      37.4    4e-04   
ref|XP_008332239.1|  PREDICTED: protein phosphatase 1 regulatory ...  50.1    4e-04   
emb|CDJ50323.1|  hypothetical protein, conserved                      50.1    5e-04   
ref|XP_730501.1|  protein phosphatase-1 regulatory subunit 7 alpha2   50.4    5e-04   
ref|XP_004225569.1|  PREDICTED: protein phosphatase 1 regulatory ...  44.3    5e-04   
gb|KFP73107.1|  Protein phosphatase 1 regulatory subunit 7            49.7    5e-04   
ref|XP_002125791.1|  PREDICTED: protein phosphatase 1 regulatory ...  44.3    5e-04   
ref|XP_002261847.1|  hypothetical protein                             49.7    6e-04   
gb|KIY68170.1|  L domain-like protein                                 39.3    6e-04   
ref|XP_011433082.1|  PREDICTED: protein phosphatase 1 regulatory ...  49.7    6e-04   
gb|EKC21650.1|  Protein phosphatase 1 regulatory subunit 7            49.7    6e-04   
ref|XP_007813973.1|  protein phosphatases PP1 regulatory subunit ...  49.7    6e-04   
ref|XP_658029.1|  hypothetical protein AN0425.2                       50.1    6e-04   
emb|CDS45293.1|  leucine-rich repeat protein                          49.7    6e-04   
ref|XP_011436214.1|  PREDICTED: protein phosphatase 1 regulatory ...  49.7    6e-04   



>ref|XP_006338147.1| PREDICTED: protein phosphatase 1 regulatory subunit pprA-like 
[Solanum tuberosum]
Length=332

 Score =   120 bits (301),  Expect(2) = 3e-52, Method: Compositional matrix adjust.
 Identities = 70/89 (79%), Positives = 79/89 (89%), Gaps = 0/89 (0%)
 Frame = +2

Query  365  GVSIFKKLLVFDVSFNEITSPSGLSKVSSTLKELYVSNNQIAKIEEIEHFHELQILELGS  544
             V IFKKLLVFDVSFNEI+S SGLSKVSSTL+ELYVS N++ K+EEIEHFHELQILELGS
Sbjct  108  DVVIFKKLLVFDVSFNEISSLSGLSKVSSTLRELYVSKNEVTKMEEIEHFHELQILELGS  167

Query  545  NKLRVMenlqtltnlxelwlGRNRIRAIN  631
            N+LR+ME L+ L NL ELWLGRNRIR +N
Sbjct  168  NRLRIMELLENLKNLQELWLGRNRIRIVN  196


 Score =   112 bits (279),  Expect(2) = 3e-52, Method: Compositional matrix adjust.
 Identities = 79/109 (72%), Positives = 86/109 (79%), Gaps = 1/109 (1%)
 Frame = +3

Query  63   SDSTPDNGETSSSSPTVLDLTSFQlhdldsvdlpsslseldlTANRLSALDPRISHLSNL  242
            SD  P + +T S S TVLDLTSFQLHDLDSV+LP SL+ELDLT NRLSALDPRI  L NL
Sbjct  8    SDEKP-SSDTMSESATVLDLTSFQLHDLDSVELPPSLTELDLTTNRLSALDPRIGQLPNL  66

Query  243  NKFSLRQNLITDAALEPLSSWHTISQLEELVLRDNQLKKIPVLAYLRNF  389
             K SLRQNLITDAA+EPLSSW  IS LEELVLRDNQLKKIP +   +  
Sbjct  67   KKLSLRQNLITDAAVEPLSSWQLISHLEELVLRDNQLKKIPDVVIFKKL  115



>ref|XP_004239265.1| PREDICTED: protein phosphatase 1 regulatory subunit pprA [Solanum 
lycopersicum]
Length=332

 Score =   122 bits (305),  Expect(2) = 3e-50, Method: Compositional matrix adjust.
 Identities = 71/89 (80%), Positives = 79/89 (89%), Gaps = 0/89 (0%)
 Frame = +2

Query  365  GVSIFKKLLVFDVSFNEITSPSGLSKVSSTLKELYVSNNQIAKIEEIEHFHELQILELGS  544
             V IFKKLLVFDVSFNEI+S SGLSKVSSTL+ELYVS N++ K+EEIEHFHELQILELGS
Sbjct  108  NVVIFKKLLVFDVSFNEISSLSGLSKVSSTLRELYVSKNEVTKMEEIEHFHELQILELGS  167

Query  545  NKLRVMenlqtltnlxelwlGRNRIRAIN  631
            N+LRVME L+ L NL ELWLGRNRIR +N
Sbjct  168  NRLRVMELLENLKNLQELWLGRNRIRTVN  196


 Score =   103 bits (258),  Expect(2) = 3e-50, Method: Compositional matrix adjust.
 Identities = 73/113 (65%), Positives = 84/113 (74%), Gaps = 1/113 (1%)
 Frame = +3

Query  51   HGHPSDSTPDNGETSSSSPTVLDLTSFQlhdldsvdlpsslseldlTANRLSALDPRISH  230
                SD  P +  TS S+ T+LDLTS+QL DL+SV+LP SL+ELDLT NRLSALDPRI  
Sbjct  4    QSENSDGKPSSDPTSESA-TLLDLTSYQLRDLESVELPPSLTELDLTTNRLSALDPRIGQ  62

Query  231  LSNLNKFSLRQNLITDAALEPLSSWHTISQLEELVLRDNQLKKIPVLAYLRNF  389
            L NL K SLRQNLITDA++ PLSSW  IS LEELVLRDNQLKKIP +   +  
Sbjct  63   LPNLKKLSLRQNLITDASVVPLSSWQLISDLEELVLRDNQLKKIPNVVIFKKL  115



>ref|XP_009763167.1| PREDICTED: protein phosphatase 1 regulatory subunit pprA [Nicotiana 
sylvestris]
Length=319

 Score =   121 bits (304),  Expect(2) = 3e-50, Method: Compositional matrix adjust.
 Identities = 71/89 (80%), Positives = 79/89 (89%), Gaps = 0/89 (0%)
 Frame = +2

Query  365  GVSIFKKLLVFDVSFNEITSPSGLSKVSSTLKELYVSNNQIAKIEEIEHFHELQILELGS  544
             V IFKKLLVFDVSFNEI+S +GLSKVSSTL+ELYVS N+I K+EEIEHFHELQILELGS
Sbjct  95   DVEIFKKLLVFDVSFNEISSLNGLSKVSSTLRELYVSKNEITKMEEIEHFHELQILELGS  154

Query  545  NKLRVMenlqtltnlxelwlGRNRIRAIN  631
            N+LRVME L+ L NL ELWLGRNRIR +N
Sbjct  155  NRLRVMELLENLKNLQELWLGRNRIRTVN  183


 Score =   104 bits (259),  Expect(2) = 3e-50, Method: Compositional matrix adjust.
 Identities = 69/89 (78%), Positives = 80/89 (90%), Gaps = 0/89 (0%)
 Frame = +3

Query  99   SSPTVLDLTSFQlhdldsvdlpsslseldlTANRLSALDPRISHLSNLNKFSLRQNLITD  278
            ++PTVLDLTS+QLHDL+SV+LP SL+ELDLT NRLSALDPRI+ L NL K SLRQNL+TD
Sbjct  6    AAPTVLDLTSYQLHDLNSVELPPSLTELDLTTNRLSALDPRIAQLPNLKKLSLRQNLLTD  65

Query  279  AALEPLSSWHTISQLEELVLRDNQLKKIP  365
            AA+EPLSS H IS +EE+VLRDNQLKKIP
Sbjct  66   AAVEPLSSSHVISDIEEIVLRDNQLKKIP  94



>ref|XP_009607849.1| PREDICTED: protein phosphatase 1 regulatory subunit pprA [Nicotiana 
tomentosiformis]
Length=319

 Score =   119 bits (299),  Expect(2) = 5e-49, Method: Compositional matrix adjust.
 Identities = 69/89 (78%), Positives = 79/89 (89%), Gaps = 0/89 (0%)
 Frame = +2

Query  365  GVSIFKKLLVFDVSFNEITSPSGLSKVSSTLKELYVSNNQIAKIEEIEHFHELQILELGS  544
             V IFKKLLVFDVSFNEI+S +GLSKVSSTL++LYVS N++ K+EEIEHFHELQILELGS
Sbjct  95   DVEIFKKLLVFDVSFNEISSLNGLSKVSSTLRDLYVSKNELTKMEEIEHFHELQILELGS  154

Query  545  NKLRVMenlqtltnlxelwlGRNRIRAIN  631
            N+LRVME L+ L NL ELWLGRNRIR +N
Sbjct  155  NRLRVMELLENLKNLQELWLGRNRIRTVN  183


 Score =   102 bits (253),  Expect(2) = 5e-49, Method: Compositional matrix adjust.
 Identities = 67/89 (75%), Positives = 79/89 (89%), Gaps = 0/89 (0%)
 Frame = +3

Query  99   SSPTVLDLTSFQlhdldsvdlpsslseldlTANRLSALDPRISHLSNLNKFSLRQNLITD  278
            ++PTVLDLTS+QLHDL+S++LP SL+ELDLT NRLSALDPRI+ L NL K SLRQNL+TD
Sbjct  6    AAPTVLDLTSYQLHDLNSLELPPSLTELDLTTNRLSALDPRIAQLPNLKKLSLRQNLLTD  65

Query  279  AALEPLSSWHTISQLEELVLRDNQLKKIP  365
             A+EPLSS H IS +EE+VLRDNQLKKIP
Sbjct  66   TAVEPLSSSHVISDIEEIVLRDNQLKKIP  94



>ref|XP_010095367.1| Protein phosphatase 1 regulatory subunit pprA [Morus notabilis]
 gb|EXB59786.1| Protein phosphatase 1 regulatory subunit pprA [Morus notabilis]
Length=340

 Score =   118 bits (295),  Expect(2) = 5e-48, Method: Compositional matrix adjust.
 Identities = 71/88 (81%), Positives = 80/88 (91%), Gaps = 0/88 (0%)
 Frame = +2

Query  368  VSIFKKLLVFDVSFNEITSPSGLSKVSSTLKELYVSNNQIAKIEEIEHFHELQILELGSN  547
             SIFK+LLVFDVSFNEIT+  GLS VS+TLKELYVS N++ KIEEI+HFHELQILELGSN
Sbjct  117  ASIFKRLLVFDVSFNEITALHGLSNVSNTLKELYVSKNEVPKIEEIDHFHELQILELGSN  176

Query  548  KLRVMenlqtltnlxelwlGRNRIRAIN  631
            +LRVMENLQ LTNL ELWLGRNRI+A+N
Sbjct  177  RLRVMENLQNLTNLQELWLGRNRIKAVN  204


 Score =   100 bits (248),  Expect(2) = 5e-48, Method: Compositional matrix adjust.
 Identities = 67/88 (76%), Positives = 78/88 (89%), Gaps = 0/88 (0%)
 Frame = +3

Query  102  SPTVLDLTSFQlhdldsvdlpsslseldlTANRLSALDPRISHLSNLNKFSLRQNLITDA  281
            S TVLDLTSFQLHDLDSV+LP+SL+ELDLTANRLS+LDPRI +LSNL K SLRQNL+ DA
Sbjct  28   SSTVLDLTSFQLHDLDSVELPTSLTELDLTANRLSSLDPRIGNLSNLKKLSLRQNLVYDA  87

Query  282  ALEPLSSWHTISQLEELVLRDNQLKKIP  365
            A+EP+S WH ++ LEELV RDN+L KIP
Sbjct  88   AVEPISHWHALAGLEELVFRDNKLTKIP  115



>gb|AET05214.2| protein phosphatase 1 regulatory subunit 7 [Medicago truncatula]
Length=335

 Score =   117 bits (294),  Expect(2) = 8e-48, Method: Compositional matrix adjust.
 Identities = 71/89 (80%), Positives = 79/89 (89%), Gaps = 0/89 (0%)
 Frame = +2

Query  365  GVSIFKKLLVFDVSFNEITSPSGLSKVSSTLKELYVSNNQIAKIEEIEHFHELQILELGS  544
             VSIFKKLLVFDVSFNEI S  G+S+V +TLKELYVS N++ KIEEIEHFH+LQILELGS
Sbjct  111  DVSIFKKLLVFDVSFNEIASLHGVSRVCNTLKELYVSKNEVTKIEEIEHFHQLQILELGS  170

Query  545  NKLRVMenlqtltnlxelwlGRNRIRAIN  631
            NKLRVMENLQTL NL ELWLGRNRI+ +N
Sbjct  171  NKLRVMENLQTLVNLQELWLGRNRIKVVN  199


 Score =   100 bits (248),  Expect(2) = 8e-48, Method: Compositional matrix adjust.
 Identities = 69/96 (72%), Positives = 82/96 (85%), Gaps = 0/96 (0%)
 Frame = +3

Query  102  SPTVLDLTSFQlhdldsvdlpsslseldlTANRLSALDPRISHLSNLNKFSLRQNLITDA  281
            S T+LDLTS+QLHDLDSV+LPS+L+ELDLTANRLS LDPRI+ LS+L   SLRQNLITDA
Sbjct  23   SSTLLDLTSYQLHDLDSVELPSNLTELDLTANRLSTLDPRIAQLSDLKNLSLRQNLITDA  82

Query  282  ALEPLSSWHTISQLEELVLRDNQLKKIPVLAYLRNF  389
            A+ PLSSW+T+S LEELVLRDNQLK IP ++  +  
Sbjct  83   AVVPLSSWNTLSSLEELVLRDNQLKNIPDVSIFKKL  118



>ref|XP_003630738.1| Protein phosphatase 1 regulatory subunit [Medicago truncatula]
Length=329

 Score =   117 bits (294),  Expect(2) = 9e-48, Method: Compositional matrix adjust.
 Identities = 71/89 (80%), Positives = 79/89 (89%), Gaps = 0/89 (0%)
 Frame = +2

Query  365  GVSIFKKLLVFDVSFNEITSPSGLSKVSSTLKELYVSNNQIAKIEEIEHFHELQILELGS  544
             VSIFKKLLVFDVSFNEI S  G+S+V +TLKELYVS N++ KIEEIEHFH+LQILELGS
Sbjct  105  DVSIFKKLLVFDVSFNEIASLHGVSRVCNTLKELYVSKNEVTKIEEIEHFHQLQILELGS  164

Query  545  NKLRVMenlqtltnlxelwlGRNRIRAIN  631
            NKLRVMENLQTL NL ELWLGRNRI+ +N
Sbjct  165  NKLRVMENLQTLVNLQELWLGRNRIKVVN  193


 Score =   100 bits (248),  Expect(2) = 9e-48, Method: Compositional matrix adjust.
 Identities = 69/96 (72%), Positives = 82/96 (85%), Gaps = 0/96 (0%)
 Frame = +3

Query  102  SPTVLDLTSFQlhdldsvdlpsslseldlTANRLSALDPRISHLSNLNKFSLRQNLITDA  281
            S T+LDLTS+QLHDLDSV+LPS+L+ELDLTANRLS LDPRI+ LS+L   SLRQNLITDA
Sbjct  17   SSTLLDLTSYQLHDLDSVELPSNLTELDLTANRLSTLDPRIAQLSDLKNLSLRQNLITDA  76

Query  282  ALEPLSSWHTISQLEELVLRDNQLKKIPVLAYLRNF  389
            A+ PLSSW+T+S LEELVLRDNQLK IP ++  +  
Sbjct  77   AVVPLSSWNTLSSLEELVLRDNQLKNIPDVSIFKKL  112



>gb|KHN16632.1| Protein phosphatase 1 regulatory subunit 7 [Glycine soja]
Length=330

 Score =   120 bits (300),  Expect(2) = 1e-47, Method: Compositional matrix adjust.
 Identities = 70/88 (80%), Positives = 82/88 (93%), Gaps = 0/88 (0%)
 Frame = +2

Query  368  VSIFKKLLVFDVSFNEITSPSGLSKVSSTLKELYVSNNQIAKIEEIEHFHELQILELGSN  547
            V++FKKLLVFDV+FNEI+S  GLS+VS TLKELYVSNN++AKIEEIEHFH+LQILELGSN
Sbjct  107  VTVFKKLLVFDVAFNEISSLHGLSRVSDTLKELYVSNNEVAKIEEIEHFHQLQILELGSN  166

Query  548  KLRVMenlqtltnlxelwlGRNRIRAIN  631
            KLRVMENLQ+L NL ELWLG+NRI+ +N
Sbjct  167  KLRVMENLQSLENLQELWLGQNRIKVVN  194


 Score = 97.4 bits (241),  Expect(2) = 1e-47, Method: Compositional matrix adjust.
 Identities = 69/96 (72%), Positives = 80/96 (83%), Gaps = 0/96 (0%)
 Frame = +3

Query  102  SPTVLDLTSFQlhdldsvdlpsslseldlTANRLSALDPRISHLSNLNKFSLRQNLITDA  281
            S T+LDL+S+QLHDLDSV+LP SL+ELDLTANRLS LDPRI +LS+L K SLRQNLITDA
Sbjct  18   SSTLLDLSSYQLHDLDSVELPPSLTELDLTANRLSTLDPRIGNLSHLKKLSLRQNLITDA  77

Query  282  ALEPLSSWHTISQLEELVLRDNQLKKIPVLAYLRNF  389
            A+ PLSSW+ IS LEELVLRDNQLK IP +   +  
Sbjct  78   AVLPLSSWNAISSLEELVLRDNQLKNIPDVTVFKKL  113



>gb|KHG22032.1| Protein phosphatase 1 regulatory subunit pprA [Gossypium arboreum]
Length=332

 Score =   120 bits (302),  Expect(2) = 2e-47, Method: Compositional matrix adjust.
 Identities = 71/88 (81%), Positives = 79/88 (90%), Gaps = 0/88 (0%)
 Frame = +2

Query  368  VSIFKKLLVFDVSFNEITSPSGLSKVSSTLKELYVSNNQIAKIEEIEHFHELQILELGSN  547
            VS+FKKLLVFDVSFNEITS  G+SKVSSTLKELYVS N++ K+EEI+H HELQILELGSN
Sbjct  115  VSLFKKLLVFDVSFNEITSLHGMSKVSSTLKELYVSKNEVTKMEEIDHLHELQILELGSN  174

Query  548  KLRVMenlqtltnlxelwlGRNRIRAIN  631
            +LRVMENLQ  T L ELWLGRNRI+AIN
Sbjct  175  RLRVMENLQNFTKLEELWLGRNRIKAIN  202


 Score = 95.9 bits (237),  Expect(2) = 2e-47, Method: Compositional matrix adjust.
 Identities = 73/126 (58%), Positives = 90/126 (71%), Gaps = 5/126 (4%)
 Frame = +3

Query  12   LHSPMDPSPGTSTHGHPSDSTPDNGETSSSSPTVLDLTSFQlhdldsvdlpsslseldlT  191
            + +  +P P T+     SD      E   SS T LDLTSFQLHDLDSV+LPSSL+ELDLT
Sbjct  1    MQNQTEPPPETN-----SDKDDQAMEFDLSSTTALDLTSFQLHDLDSVELPSSLTELDLT  55

Query  192  ANRLSALDPRISHLSNLNKFSLRQNLITDAALEPLSSWHTISQLEELVLRDNQLKKIPVL  371
            ANRLS LDPRI++L NL K S RQNLI DAA+E +SSW ++S LEELVLRDN+L K+P +
Sbjct  56   ANRLSKLDPRIANLINLRKLSFRQNLIDDAAIESISSWGSLSGLEELVLRDNKLTKVPDV  115

Query  372  AYLRNF  389
            +  +  
Sbjct  116  SLFKKL  121



>ref|XP_011093997.1| PREDICTED: protein phosphatase 1 regulatory subunit pprA [Sesamum 
indicum]
Length=353

 Score =   123 bits (309),  Expect(2) = 2e-47, Method: Compositional matrix adjust.
 Identities = 73/89 (82%), Positives = 81/89 (91%), Gaps = 0/89 (0%)
 Frame = +2

Query  365  GVSIFKKLLVFDVSFNEITSPSGLSKVSSTLKELYVSNNQIAKIEEIEHFHELQILELGS  544
             VSIFK LLVFDVSFNEI+S +GLSKVS+TLKELYVS N++ KIEEIEHFH+LQILELGS
Sbjct  107  DVSIFKVLLVFDVSFNEISSLNGLSKVSNTLKELYVSKNEVTKIEEIEHFHQLQILELGS  166

Query  545  NKLRVMenlqtltnlxelwlGRNRIRAIN  631
            NKLRVMENL+ L+ L ELWLGRNRIRAIN
Sbjct  167  NKLRVMENLENLSTLQELWLGRNRIRAIN  195


 Score = 92.8 bits (229),  Expect(2) = 2e-47, Method: Compositional matrix adjust.
 Identities = 70/110 (64%), Positives = 85/110 (77%), Gaps = 3/110 (3%)
 Frame = +3

Query  63   SDSTPDNGE---TSSSSPTVLDLTSFQlhdldsvdlpsslseldlTANRLSALDPRISHL  233
            S + PDN +    S +  TVLDL+S QLHDLDSV+LP SL+ELDLTANRL+ALD RIS L
Sbjct  3    SATRPDNHDPNVESDAESTVLDLSSCQLHDLDSVELPPSLTELDLTANRLTALDSRISQL  62

Query  234  SNLNKFSLRQNLITDAALEPLSSWHTISQLEELVLRDNQLKKIPVLAYLR  383
            +NL K SLRQNL+ D  + PLSSW +IS L+ELVLRDNQLKKIP ++  +
Sbjct  63   ANLKKLSLRQNLLNDEGVLPLSSWTSISALQELVLRDNQLKKIPDVSIFK  112



>ref|XP_006451264.1| hypothetical protein CICLE_v10008855mg [Citrus clementina]
 ref|XP_006494312.1| PREDICTED: protein phosphatase 1 regulatory subunit pprA-like 
[Citrus sinensis]
 gb|ESR64504.1| hypothetical protein CICLE_v10008855mg [Citrus clementina]
Length=337

 Score =   114 bits (286),  Expect(2) = 4e-47, Method: Compositional matrix adjust.
 Identities = 69/89 (78%), Positives = 77/89 (87%), Gaps = 0/89 (0%)
 Frame = +2

Query  365  GVSIFKKLLVFDVSFNEITSPSGLSKVSSTLKELYVSNNQIAKIEEIEHFHELQILELGS  544
             VSIFKKL VFDVSFNEITS  GLS V+ TLKELYVS N++ K+EEIEHFH+LQILE GS
Sbjct  113  DVSIFKKLSVFDVSFNEITSSHGLSNVTDTLKELYVSKNEVPKMEEIEHFHDLQILEFGS  172

Query  545  NKLRVMenlqtltnlxelwlGRNRIRAIN  631
            N+LRVMENLQ LTNL ELWLGRNRI+ +N
Sbjct  173  NRLRVMENLQNLTNLQELWLGRNRIKVVN  201


 Score =   101 bits (251),  Expect(2) = 4e-47, Method: Compositional matrix adjust.
 Identities = 67/107 (63%), Positives = 83/107 (78%), Gaps = 0/107 (0%)
 Frame = +3

Query  69   STPDNGETSSSSPTVLDLTSFQlhdldsvdlpsslseldlTANRLSALDPRISHLSNLNK  248
            + PD       S TVLDLTSFQLHDLDSV+ P++L+ELDLTANRL++LD RISHLSNL K
Sbjct  14   TNPDQAVEIDLSNTVLDLTSFQLHDLDSVEFPTNLTELDLTANRLTSLDSRISHLSNLKK  73

Query  249  FSLRQNLITDAALEPLSSWHTISQLEELVLRDNQLKKIPVLAYLRNF  389
             SLRQNLI DAA+EP+S W  ++ LEEL+LRDN+L KIP ++  +  
Sbjct  74   LSLRQNLIDDAAIEPISRWDALAGLEELILRDNKLMKIPDVSIFKKL  120



>gb|KDO66519.1| hypothetical protein CISIN_1g018662mg [Citrus sinensis]
Length=330

 Score =   114 bits (285),  Expect(2) = 4e-47, Method: Compositional matrix adjust.
 Identities = 69/89 (78%), Positives = 77/89 (87%), Gaps = 0/89 (0%)
 Frame = +2

Query  365  GVSIFKKLLVFDVSFNEITSPSGLSKVSSTLKELYVSNNQIAKIEEIEHFHELQILELGS  544
             VSIFKKL VFDVSFNEITS  GLS V+ TLKELYVS N++ K+EEIEHFH+LQILE GS
Sbjct  113  DVSIFKKLSVFDVSFNEITSSHGLSNVTDTLKELYVSKNEVPKMEEIEHFHDLQILEFGS  172

Query  545  NKLRVMenlqtltnlxelwlGRNRIRAIN  631
            N+LRVMENLQ LTNL ELWLGRNRI+ +N
Sbjct  173  NRLRVMENLQNLTNLQELWLGRNRIKVVN  201


 Score =   100 bits (250),  Expect(2) = 4e-47, Method: Compositional matrix adjust.
 Identities = 67/107 (63%), Positives = 83/107 (78%), Gaps = 0/107 (0%)
 Frame = +3

Query  69   STPDNGETSSSSPTVLDLTSFQlhdldsvdlpsslseldlTANRLSALDPRISHLSNLNK  248
            + PD       S TVLDLTSFQLHDLDSV+ P++L+ELDLTANRL++LD RISHLSNL K
Sbjct  14   TNPDQAVEIDLSNTVLDLTSFQLHDLDSVEFPTNLTELDLTANRLTSLDSRISHLSNLKK  73

Query  249  FSLRQNLITDAALEPLSSWHTISQLEELVLRDNQLKKIPVLAYLRNF  389
             SLRQNLI DAA+EP+S W  ++ LEEL+LRDN+L KIP ++  +  
Sbjct  74   LSLRQNLIDDAAIEPISRWDALAGLEELILRDNKLMKIPDVSIFKKL  120



>gb|KDO66518.1| hypothetical protein CISIN_1g018662mg [Citrus sinensis]
Length=352

 Score =   114 bits (285),  Expect(2) = 5e-47, Method: Compositional matrix adjust.
 Identities = 69/88 (78%), Positives = 77/88 (88%), Gaps = 0/88 (0%)
 Frame = +2

Query  368  VSIFKKLLVFDVSFNEITSPSGLSKVSSTLKELYVSNNQIAKIEEIEHFHELQILELGSN  547
            VSIFKKL VFDVSFNEITS  GLS V+ TLKELYVS N++ K+EEIEHFH+LQILE GSN
Sbjct  114  VSIFKKLSVFDVSFNEITSSHGLSNVTDTLKELYVSKNEVPKMEEIEHFHDLQILEFGSN  173

Query  548  KLRVMenlqtltnlxelwlGRNRIRAIN  631
            +LRVMENLQ LTNL ELWLGRNRI+ +N
Sbjct  174  RLRVMENLQNLTNLQELWLGRNRIKVVN  201


 Score =   100 bits (250),  Expect(2) = 5e-47, Method: Compositional matrix adjust.
 Identities = 67/107 (63%), Positives = 83/107 (78%), Gaps = 0/107 (0%)
 Frame = +3

Query  69   STPDNGETSSSSPTVLDLTSFQlhdldsvdlpsslseldlTANRLSALDPRISHLSNLNK  248
            + PD       S TVLDLTSFQLHDLDSV+ P++L+ELDLTANRL++LD RISHLSNL K
Sbjct  14   TNPDQAVEIDLSNTVLDLTSFQLHDLDSVEFPTNLTELDLTANRLTSLDSRISHLSNLKK  73

Query  249  FSLRQNLITDAALEPLSSWHTISQLEELVLRDNQLKKIPVLAYLRNF  389
             SLRQNLI DAA+EP+S W  ++ LEEL+LRDN+L KIP ++  +  
Sbjct  74   LSLRQNLIDDAAIEPISRWDALAGLEELILRDNKLMKIPDVSIFKKL  120



>gb|KJB83109.1| hypothetical protein B456_013G229800 [Gossypium raimondii]
Length=365

 Score =   121 bits (303),  Expect(2) = 8e-47, Method: Compositional matrix adjust.
 Identities = 71/89 (80%), Positives = 79/89 (89%), Gaps = 0/89 (0%)
 Frame = +2

Query  365  GVSIFKKLLVFDVSFNEITSPSGLSKVSSTLKELYVSNNQIAKIEEIEHFHELQILELGS  544
             VS+FKKLLVFDVSFNEITS  G+SKVSSTLKELYVS N++ K+EEI+H HELQILELGS
Sbjct  114  DVSLFKKLLVFDVSFNEITSLHGMSKVSSTLKELYVSKNEVTKMEEIDHLHELQILELGS  173

Query  545  NKLRVMenlqtltnlxelwlGRNRIRAIN  631
            N+LRVMENLQ  T L ELWLGRNRI+AIN
Sbjct  174  NRLRVMENLQNFTKLEELWLGRNRIKAIN  202


 Score = 93.6 bits (231),  Expect(2) = 8e-47, Method: Compositional matrix adjust.
 Identities = 72/126 (57%), Positives = 90/126 (71%), Gaps = 5/126 (4%)
 Frame = +3

Query  12   LHSPMDPSPGTSTHGHPSDSTPDNGETSSSSPTVLDLTSFQlhdldsvdlpsslseldlT  191
            + +  +P P T+     SD      E   SS T LDLTSFQLHDLDSV+LPSSL+ELDLT
Sbjct  1    MQNQTEPPPETN-----SDKDDQAIEFDLSSTTALDLTSFQLHDLDSVELPSSLTELDLT  55

Query  192  ANRLSALDPRISHLSNLNKFSLRQNLITDAALEPLSSWHTISQLEELVLRDNQLKKIPVL  371
            ANRLS LDPRI++L NL K S +QNLI DAA+E +SSW ++S LEELVLRDN+L K+P +
Sbjct  56   ANRLSKLDPRIANLINLRKLSFQQNLIDDAAIESISSWDSLSGLEELVLRDNKLMKVPDV  115

Query  372  AYLRNF  389
            +  +  
Sbjct  116  SLFKKL  121



>gb|KJB83105.1| hypothetical protein B456_013G229800 [Gossypium raimondii]
Length=338

 Score =   120 bits (302),  Expect(2) = 8e-47, Method: Compositional matrix adjust.
 Identities = 71/89 (80%), Positives = 79/89 (89%), Gaps = 0/89 (0%)
 Frame = +2

Query  365  GVSIFKKLLVFDVSFNEITSPSGLSKVSSTLKELYVSNNQIAKIEEIEHFHELQILELGS  544
             VS+FKKLLVFDVSFNEITS  G+SKVSSTLKELYVS N++ K+EEI+H HELQILELGS
Sbjct  114  DVSLFKKLLVFDVSFNEITSLHGMSKVSSTLKELYVSKNEVTKMEEIDHLHELQILELGS  173

Query  545  NKLRVMenlqtltnlxelwlGRNRIRAIN  631
            N+LRVMENLQ  T L ELWLGRNRI+AIN
Sbjct  174  NRLRVMENLQNFTKLEELWLGRNRIKAIN  202


 Score = 93.6 bits (231),  Expect(2) = 8e-47, Method: Compositional matrix adjust.
 Identities = 72/126 (57%), Positives = 90/126 (71%), Gaps = 5/126 (4%)
 Frame = +3

Query  12   LHSPMDPSPGTSTHGHPSDSTPDNGETSSSSPTVLDLTSFQlhdldsvdlpsslseldlT  191
            + +  +P P T+     SD      E   SS T LDLTSFQLHDLDSV+LPSSL+ELDLT
Sbjct  1    MQNQTEPPPETN-----SDKDDQAIEFDLSSTTALDLTSFQLHDLDSVELPSSLTELDLT  55

Query  192  ANRLSALDPRISHLSNLNKFSLRQNLITDAALEPLSSWHTISQLEELVLRDNQLKKIPVL  371
            ANRLS LDPRI++L NL K S +QNLI DAA+E +SSW ++S LEELVLRDN+L K+P +
Sbjct  56   ANRLSKLDPRIANLINLRKLSFQQNLIDDAAIESISSWDSLSGLEELVLRDNKLMKVPDV  115

Query  372  AYLRNF  389
            +  +  
Sbjct  116  SLFKKL  121



>ref|NP_001242512.1| uncharacterized protein LOC100782492 [Glycine max]
 gb|ACU21286.1| unknown [Glycine max]
Length=330

 Score =   120 bits (300),  Expect(2) = 8e-47, Method: Compositional matrix adjust.
 Identities = 70/88 (80%), Positives = 82/88 (93%), Gaps = 0/88 (0%)
 Frame = +2

Query  368  VSIFKKLLVFDVSFNEITSPSGLSKVSSTLKELYVSNNQIAKIEEIEHFHELQILELGSN  547
            V++FKKLLVFDV+FNEI+S  GLS+VS TLKELYVSNN++AKIEEIEHFH+LQILELGSN
Sbjct  107  VTVFKKLLVFDVAFNEISSLHGLSRVSDTLKELYVSNNEVAKIEEIEHFHQLQILELGSN  166

Query  548  KLRVMenlqtltnlxelwlGRNRIRAIN  631
            KLRVMENLQ+L NL ELWLG+NRI+ +N
Sbjct  167  KLRVMENLQSLENLQELWLGQNRIKVVN  194


 Score = 94.7 bits (234),  Expect(2) = 8e-47, Method: Compositional matrix adjust.
 Identities = 68/88 (77%), Positives = 77/88 (88%), Gaps = 0/88 (0%)
 Frame = +3

Query  102  SPTVLDLTSFQlhdldsvdlpsslseldlTANRLSALDPRISHLSNLNKFSLRQNLITDA  281
            S T+LDL+S+ LHDLDSV+LP SL+ELDLTANRLS LDPRI +LS+L K SLRQNLITDA
Sbjct  18   SSTLLDLSSYLLHDLDSVELPPSLTELDLTANRLSTLDPRIGNLSHLKKLSLRQNLITDA  77

Query  282  ALEPLSSWHTISQLEELVLRDNQLKKIP  365
            A+ PLSSW+ IS LEELVLRDNQLK IP
Sbjct  78   AVLPLSSWNAISSLEELVLRDNQLKNIP  105



>ref|XP_006381757.1| hypothetical protein POPTR_0006s17720g [Populus trichocarpa]
 gb|ERP59554.1| hypothetical protein POPTR_0006s17720g [Populus trichocarpa]
Length=337

 Score =   109 bits (272),  Expect(2) = 1e-46, Method: Compositional matrix adjust.
 Identities = 62/86 (72%), Positives = 74/86 (86%), Gaps = 0/86 (0%)
 Frame = +2

Query  374  IFKKLLVFDVSFNEITSPSGLSKVSSTLKELYVSNNQIAKIEEIEHFHELQILELGSNKL  553
            IFK LLVFDVSFNEITS  GLSK S+TLKELYVS N++ KIEEI+H ++LQILELGSN+L
Sbjct  116  IFKSLLVFDVSFNEITSLHGLSKASNTLKELYVSKNEVTKIEEIDHLYQLQILELGSNRL  175

Query  554  RVMenlqtltnlxelwlGRNRIRAIN  631
            RVMEN+   T+L ELW+GRNRI+ +N
Sbjct  176  RVMENMGNFTSLQELWMGRNRIKVVN  201


 Score =   104 bits (260),  Expect(2) = 1e-46, Method: Compositional matrix adjust.
 Identities = 69/88 (78%), Positives = 78/88 (89%), Gaps = 0/88 (0%)
 Frame = +3

Query  102  SPTVLDLTSFQlhdldsvdlpsslseldlTANRLSALDPRISHLSNLNKFSLRQNLITDA  281
            S TVLDLTSFQLHDL+SV+L  SL+ELDLTANRLS+LDPRI+HLSNL K SLRQNLI DA
Sbjct  25   SSTVLDLTSFQLHDLNSVELSPSLTELDLTANRLSSLDPRIAHLSNLIKLSLRQNLIDDA  84

Query  282  ALEPLSSWHTISQLEELVLRDNQLKKIP  365
            A+EP S W +IS L+ELVLRDN+LKKIP
Sbjct  85   AIEPFSRWDSISGLQELVLRDNKLKKIP  112



>ref|NP_001242821.1| uncharacterized protein LOC100781548 [Glycine max]
 gb|ACU18623.1| unknown [Glycine max]
Length=330

 Score =   117 bits (292),  Expect(2) = 2e-46, Method: Compositional matrix adjust.
 Identities = 69/88 (78%), Positives = 80/88 (91%), Gaps = 0/88 (0%)
 Frame = +2

Query  368  VSIFKKLLVFDVSFNEITSPSGLSKVSSTLKELYVSNNQIAKIEEIEHFHELQILELGSN  547
            VS+FKKLLVFDV+FNEI+S  GLS+VS TLKELYVS N++A IEEIEHFH+LQ+LELGSN
Sbjct  107  VSVFKKLLVFDVAFNEISSLHGLSRVSDTLKELYVSKNEVAMIEEIEHFHQLQLLELGSN  166

Query  548  KLRVMenlqtltnlxelwlGRNRIRAIN  631
            KLRVMENLQ+L NL ELWLGRNRI+ +N
Sbjct  167  KLRVMENLQSLENLQELWLGRNRIKVVN  194


 Score = 96.3 bits (238),  Expect(2) = 2e-46, Method: Compositional matrix adjust.
 Identities = 71/107 (66%), Positives = 85/107 (79%), Gaps = 1/107 (1%)
 Frame = +3

Query  69   STPDNGETSSSSPTVLDLTSFQlhdldsvdlpsslseldlTANRLSALDPRISHLSNLNK  248
            + P N E   SS T+LDLTS+QLHDLDSV+LP SL+ELDLTANRLS LDPRI +LS+L K
Sbjct  8    AVPVNDEDDPSS-TLLDLTSYQLHDLDSVELPPSLTELDLTANRLSTLDPRIGNLSHLQK  66

Query  249  FSLRQNLITDAALEPLSSWHTISQLEELVLRDNQLKKIPVLAYLRNF  389
             SLRQNLI+DAA+ PLSSW+ +S LEELVLRDNQ K IP ++  +  
Sbjct  67   LSLRQNLISDAAVLPLSSWNALSSLEELVLRDNQFKNIPDVSVFKKL  113



>gb|KHN41663.1| Protein phosphatase 1 regulatory subunit pprA [Glycine soja]
Length=330

 Score =   117 bits (292),  Expect(2) = 8e-46, Method: Compositional matrix adjust.
 Identities = 69/88 (78%), Positives = 80/88 (91%), Gaps = 0/88 (0%)
 Frame = +2

Query  368  VSIFKKLLVFDVSFNEITSPSGLSKVSSTLKELYVSNNQIAKIEEIEHFHELQILELGSN  547
            VS+FKKLLVFDV+FNEI+S  GLS+VS TLKELYVS N++A IEEIEHFH+LQ+LELGSN
Sbjct  107  VSVFKKLLVFDVAFNEISSLHGLSRVSDTLKELYVSKNEVAMIEEIEHFHQLQLLELGSN  166

Query  548  KLRVMenlqtltnlxelwlGRNRIRAIN  631
            KLRVMENLQ+L NL ELWLGRNRI+ +N
Sbjct  167  KLRVMENLQSLENLQELWLGRNRIKVVN  194


 Score = 94.4 bits (233),  Expect(2) = 8e-46, Method: Compositional matrix adjust.
 Identities = 70/107 (65%), Positives = 84/107 (79%), Gaps = 1/107 (1%)
 Frame = +3

Query  69   STPDNGETSSSSPTVLDLTSFQlhdldsvdlpsslseldlTANRLSALDPRISHLSNLNK  248
            + P N E   SS T+LDLTS+QLHDLDSV+LP SL+ELDLTANRLS LDPRI +LS+L K
Sbjct  8    AVPVNDEDDPSS-TLLDLTSYQLHDLDSVELPPSLTELDLTANRLSTLDPRIGNLSHLQK  66

Query  249  FSLRQNLITDAALEPLSSWHTISQLEELVLRDNQLKKIPVLAYLRNF  389
             SLRQNL +DAA+ PLSSW+ +S LEELVLRDNQ K IP ++  +  
Sbjct  67   LSLRQNLFSDAAVLPLSSWNALSSLEELVLRDNQFKNIPDVSVFKKL  113



>emb|CDP03273.1| unnamed protein product [Coffea canephora]
Length=323

 Score =   112 bits (279),  Expect(2) = 1e-45, Method: Compositional matrix adjust.
 Identities = 67/88 (76%), Positives = 76/88 (86%), Gaps = 0/88 (0%)
 Frame = +2

Query  368  VSIFKKLLVFDVSFNEITSPSGLSKVSSTLKELYVSNNQIAKIEEIEHFHELQILELGSN  547
            VSIFKKLLVFDVSFNEI +  GLSKVS+TL+ELYVS N++ K+EEI+HFH LQILELGSN
Sbjct  100  VSIFKKLLVFDVSFNEIPTLQGLSKVSTTLRELYVSKNEVTKMEEIDHFHALQILELGSN  159

Query  548  KLRVMenlqtltnlxelwlGRNRIRAIN  631
             LRVMENLQ L NL ELWLGRNR + +N
Sbjct  160  NLRVMENLQNLINLQELWLGRNRFKTVN  187


 Score = 98.6 bits (244),  Expect(2) = 1e-45, Method: Compositional matrix adjust.
 Identities = 69/104 (66%), Positives = 82/104 (79%), Gaps = 4/104 (4%)
 Frame = +3

Query  78   DNGETSSSSPTVLDLTSFQlhdldsvdlpsslseldlTANRLSALDPRISHLSNLNKFSL  257
            D GE    +PTVLDLTS+QL DLDSVDLP SL+ELDLTANRLS LDPRI+ LSNL K SL
Sbjct  7    DGGE----NPTVLDLTSYQLRDLDSVDLPPSLTELDLTANRLSKLDPRIAQLSNLKKLSL  62

Query  258  RQNLITDAALEPLSSWHTISQLEELVLRDNQLKKIPVLAYLRNF  389
            RQNL  D+ +EPL++ H I+ LEELVLRDNQLKK+P ++  +  
Sbjct  63   RQNLFDDSGVEPLATSHLIADLEELVLRDNQLKKVPDVSIFKKL  106



>ref|XP_002514241.1| protein phosphatases pp1 regulatory subunit, putative [Ricinus 
communis]
 gb|EEF48195.1| protein phosphatases pp1 regulatory subunit, putative [Ricinus 
communis]
Length=312

 Score =   110 bits (274),  Expect(2) = 1e-45, Method: Compositional matrix adjust.
 Identities = 66/88 (75%), Positives = 78/88 (89%), Gaps = 0/88 (0%)
 Frame = +2

Query  368  VSIFKKLLVFDVSFNEITSPSGLSKVSSTLKELYVSNNQIAKIEEIEHFHELQILELGSN  547
            V+IFK LLVFDVSFNEI S +GLSKVS+TLKELYVS N++ K+EEI+H ++LQ+LELGSN
Sbjct  114  VTIFKSLLVFDVSFNEIRSLNGLSKVSNTLKELYVSKNEVTKMEEIDHLYQLQMLELGSN  173

Query  548  KLRVMenlqtltnlxelwlGRNRIRAIN  631
            +LRVMENLQ LT L ELWLGRNRI+ IN
Sbjct  174  RLRVMENLQNLTTLQELWLGRNRIKTIN  201


 Score =   100 bits (248),  Expect(2) = 1e-45, Method: Compositional matrix adjust.
 Identities = 65/88 (74%), Positives = 73/88 (83%), Gaps = 0/88 (0%)
 Frame = +3

Query  102  SPTVLDLTSFQlhdldsvdlpsslseldlTANRLSALDPRISHLSNLNKFSLRQNLITDA  281
            S T+LDLTSFQLHDLDSV+L   L ELDLTANRLS LDPRI+HLSNL K SLRQNL+ DA
Sbjct  25   SSTILDLTSFQLHDLDSVELSPGLIELDLTANRLSRLDPRIAHLSNLKKLSLRQNLVDDA  84

Query  282  ALEPLSSWHTISQLEELVLRDNQLKKIP  365
            A++P S W  +S LEELVLRDN+L KIP
Sbjct  85   AIQPFSGWEELSGLEELVLRDNKLMKIP  112



>ref|XP_004287462.1| PREDICTED: protein phosphatase 1 regulatory subunit pprA [Fragaria 
vesca subsp. vesca]
Length=336

 Score =   115 bits (289),  Expect(2) = 2e-45, Method: Compositional matrix adjust.
 Identities = 65/88 (74%), Positives = 76/88 (86%), Gaps = 0/88 (0%)
 Frame = +2

Query  368  VSIFKKLLVFDVSFNEITSPSGLSKVSSTLKELYVSNNQIAKIEEIEHFHELQILELGSN  547
             SIFKKLLVFDVSFNEITS  G+SKVS  LKELYVS N++ KIEEI+H HELQILELGSN
Sbjct  113  ASIFKKLLVFDVSFNEITSLQGMSKVSGGLKELYVSKNEVTKIEEIDHLHELQILELGSN  172

Query  548  KLRVMenlqtltnlxelwlGRNRIRAIN  631
            +LRVM++L+ +T L ELWLGRNRI+ +N
Sbjct  173  RLRVMQSLENMTKLQELWLGRNRIKVVN  200


 Score = 94.4 bits (233),  Expect(2) = 2e-45, Method: Compositional matrix adjust.
 Identities = 68/103 (66%), Positives = 82/103 (80%), Gaps = 3/103 (3%)
 Frame = +3

Query  57   HPSDSTPDNGETSSSSPTVLDLTSFQlhdldsvdlpsslseldlTANRLSALDPRISHLS  236
            H    T D+G+   SS TVLDLTS QLHDL+SV+LP SL+ELDLTANRLS+LD RI+ LS
Sbjct  12   HDDPMTEDDGD---SSATVLDLTSCQLHDLNSVELPPSLTELDLTANRLSSLDTRIAALS  68

Query  237  NLNKFSLRQNLITDAALEPLSSWHTISQLEELVLRDNQLKKIP  365
            NL K S RQNL  D+A+EP+S+W  +S LEELVLRDN+L+KIP
Sbjct  69   NLTKLSFRQNLFEDSAVEPISAWTALSGLEELVLRDNKLRKIP  111



>ref|XP_004503473.1| PREDICTED: protein phosphatase 1 regulatory subunit pprA-like 
isoform X2 [Cicer arietinum]
 ref|XP_004503474.1| PREDICTED: protein phosphatase 1 regulatory subunit pprA-like 
isoform X3 [Cicer arietinum]
Length=327

 Score =   112 bits (280),  Expect(2) = 3e-45, Method: Compositional matrix adjust.
 Identities = 69/89 (78%), Positives = 77/89 (87%), Gaps = 0/89 (0%)
 Frame = +2

Query  365  GVSIFKKLLVFDVSFNEITSPSGLSKVSSTLKELYVSNNQIAKIEEIEHFHELQILELGS  544
             V+IF KLL+FDVSFNEITS  GLS+VS+TL ELYVS N+I KIEEI+HFH+L ILELGS
Sbjct  103  DVTIFNKLLLFDVSFNEITSLHGLSRVSNTLNELYVSKNEITKIEEIDHFHQLHILELGS  162

Query  545  NKLRVMenlqtltnlxelwlGRNRIRAIN  631
            NKLRVMENLQ L NL ELWLGRNRI+ IN
Sbjct  163  NKLRVMENLQNLVNLQELWLGRNRIKIIN  191


 Score = 96.7 bits (239),  Expect(2) = 3e-45, Method: Compositional matrix adjust.
 Identities = 68/88 (77%), Positives = 78/88 (89%), Gaps = 0/88 (0%)
 Frame = +3

Query  102  SPTVLDLTSFQlhdldsvdlpsslseldlTANRLSALDPRISHLSNLNKFSLRQNLITDA  281
            S T+LDLTS+QLHDLDSVDLP +L+ELDLTANRLS LDPRIS LS+L K SLRQNLITD+
Sbjct  15   SSTLLDLTSYQLHDLDSVDLPPNLTELDLTANRLSTLDPRISQLSHLKKLSLRQNLITDS  74

Query  282  ALEPLSSWHTISQLEELVLRDNQLKKIP  365
            A+ PLSSW+ +S LEE+VLRDNQLK IP
Sbjct  75   AVYPLSSWNALSSLEEIVLRDNQLKNIP  102



>gb|KJB65013.1| hypothetical protein B456_010G076100 [Gossypium raimondii]
Length=338

 Score =   116 bits (291),  Expect(2) = 5e-45, Method: Compositional matrix adjust.
 Identities = 69/89 (78%), Positives = 76/89 (85%), Gaps = 0/89 (0%)
 Frame = +2

Query  365  GVSIFKKLLVFDVSFNEITSPSGLSKVSSTLKELYVSNNQIAKIEEIEHFHELQILELGS  544
             V IFKKLLVFDVSFNEITS  GLSK SST+KELYVS N++ K+EEI+H HELQILELGS
Sbjct  114  DVGIFKKLLVFDVSFNEITSLQGLSKASSTIKELYVSKNEVTKMEEIDHLHELQILELGS  173

Query  545  NKLRVMenlqtltnlxelwlGRNRIRAIN  631
            N+LRVMENLQ  T L ELWLGRNRI+ IN
Sbjct  174  NRLRVMENLQNFTKLQELWLGRNRIKVIN  202


 Score = 92.0 bits (227),  Expect(2) = 5e-45, Method: Compositional matrix adjust.
 Identities = 64/114 (56%), Positives = 81/114 (71%), Gaps = 4/114 (4%)
 Frame = +3

Query  60   PSDSTPDNG----ETSSSSPTVLDLTSFQlhdldsvdlpsslseldlTANRLSALDPRIS  227
            P ++ PD      E   SS T+LDLTSFQL DLDSV+LP +L +LDLT NRLS LD RI+
Sbjct  8    PVEANPDQDDQTVEIDLSSITILDLTSFQLPDLDSVELPPNLIDLDLTTNRLSNLDSRIA  67

Query  228  HLSNLNKFSLRQNLITDAALEPLSSWHTISQLEELVLRDNQLKKIPVLAYLRNF  389
            +L NL K S RQNL  DAA+EP+SSW +++ LEEL+LRDN+L KIP +   +  
Sbjct  68   NLINLRKLSFRQNLFNDAAIEPISSWESLTGLEELILRDNKLTKIPDVGIFKKL  121



>ref|XP_004503472.1| PREDICTED: protein phosphatase 1 regulatory subunit pprA-like 
isoform X1 [Cicer arietinum]
Length=352

 Score =   112 bits (280),  Expect(2) = 5e-45, Method: Compositional matrix adjust.
 Identities = 69/88 (78%), Positives = 77/88 (88%), Gaps = 0/88 (0%)
 Frame = +2

Query  368  VSIFKKLLVFDVSFNEITSPSGLSKVSSTLKELYVSNNQIAKIEEIEHFHELQILELGSN  547
            V+IF KLL+FDVSFNEITS  GLS+VS+TL ELYVS N+I KIEEI+HFH+L ILELGSN
Sbjct  104  VTIFNKLLLFDVSFNEITSLHGLSRVSNTLNELYVSKNEITKIEEIDHFHQLHILELGSN  163

Query  548  KLRVMenlqtltnlxelwlGRNRIRAIN  631
            KLRVMENLQ L NL ELWLGRNRI+ IN
Sbjct  164  KLRVMENLQNLVNLQELWLGRNRIKIIN  191


 Score = 95.9 bits (237),  Expect(2) = 5e-45, Method: Compositional matrix adjust.
 Identities = 68/88 (77%), Positives = 78/88 (89%), Gaps = 0/88 (0%)
 Frame = +3

Query  102  SPTVLDLTSFQlhdldsvdlpsslseldlTANRLSALDPRISHLSNLNKFSLRQNLITDA  281
            S T+LDLTS+QLHDLDSVDLP +L+ELDLTANRLS LDPRIS LS+L K SLRQNLITD+
Sbjct  15   SSTLLDLTSYQLHDLDSVDLPPNLTELDLTANRLSTLDPRISQLSHLKKLSLRQNLITDS  74

Query  282  ALEPLSSWHTISQLEELVLRDNQLKKIP  365
            A+ PLSSW+ +S LEE+VLRDNQLK IP
Sbjct  75   AVYPLSSWNALSSLEEIVLRDNQLKNIP  102



>gb|KJB83108.1| hypothetical protein B456_013G229800 [Gossypium raimondii]
Length=337

 Score =   120 bits (302),  Expect(2) = 7e-45, Method: Compositional matrix adjust.
 Identities = 71/89 (80%), Positives = 79/89 (89%), Gaps = 0/89 (0%)
 Frame = +2

Query  365  GVSIFKKLLVFDVSFNEITSPSGLSKVSSTLKELYVSNNQIAKIEEIEHFHELQILELGS  544
             VS+FKKLLVFDVSFNEITS  G+SKVSSTLKELYVS N++ K+EEI+H HELQILELGS
Sbjct  113  DVSLFKKLLVFDVSFNEITSLHGMSKVSSTLKELYVSKNEVTKMEEIDHLHELQILELGS  172

Query  545  NKLRVMenlqtltnlxelwlGRNRIRAIN  631
            N+LRVMENLQ  T L ELWLGRNRI+AIN
Sbjct  173  NRLRVMENLQNFTKLEELWLGRNRIKAIN  201


 Score = 87.0 bits (214),  Expect(2) = 7e-45, Method: Compositional matrix adjust.
 Identities = 71/126 (56%), Positives = 89/126 (71%), Gaps = 6/126 (5%)
 Frame = +3

Query  12   LHSPMDPSPGTSTHGHPSDSTPDNGETSSSSPTVLDLTSFQlhdldsvdlpsslseldlT  191
            + +  +P P T+     SD      E   SS T LDLTSFQLHDLDSV+LPSSL+ELDLT
Sbjct  1    MQNQTEPPPETN-----SDKDDQAIEFDLSSTTALDLTSFQLHDLDSVELPSSLTELDLT  55

Query  192  ANRLSALDPRISHLSNLNKFSLRQNLITDAALEPLSSWHTISQLEELVLRDNQLKKIPVL  371
            ANRLS LDPRI++L NL K S +QNLI DAA+E +SSW ++S L ELVLRDN+L K+P +
Sbjct  56   ANRLSKLDPRIANLINLRKLSFQQNLIDDAAIESISSWDSLSGL-ELVLRDNKLMKVPDV  114

Query  372  AYLRNF  389
            +  +  
Sbjct  115  SLFKKL  120



>gb|KFK26188.1| hypothetical protein AALP_AA8G214000 [Arabis alpina]
Length=334

 Score =   109 bits (272),  Expect(2) = 8e-45, Method: Compositional matrix adjust.
 Identities = 65/88 (74%), Positives = 74/88 (84%), Gaps = 0/88 (0%)
 Frame = +2

Query  368  VSIFKKLLVFDVSFNEITSPSGLSKVSSTLKELYVSNNQIAKIEEIEHFHELQILELGSN  547
            +SIF KLLVFDVSFNEITS  GLSK SSTLKELYVS N++ KI EIEH  +LQILELGSN
Sbjct  111  ISIFSKLLVFDVSFNEITSLQGLSKASSTLKELYVSKNEVNKIMEIEHLLDLQILELGSN  170

Query  548  KLRVMenlqtltnlxelwlGRNRIRAIN  631
            +LRVMEN++  T L ELWLGRNRI+ +N
Sbjct  171  RLRVMENMENFTKLEELWLGRNRIKVVN  198


 Score = 98.6 bits (244),  Expect(2) = 8e-45, Method: Compositional matrix adjust.
 Identities = 66/107 (62%), Positives = 81/107 (76%), Gaps = 0/107 (0%)
 Frame = +3

Query  45   STHGHPSDSTPDNGETSSSSPTVLDLTSFQlhdldsvdlpsslseldlTANRLSALDPRI  224
            S+ G P+   P + E    S  VLDL+S+QLH LD+V+LPS+L+ELDLTANRLS LD RI
Sbjct  3    SSDGSPAREKPQSMEIDDDSGNVLDLSSYQLHSLDTVELPSTLTELDLTANRLSGLDSRI  62

Query  225  SHLSNLNKFSLRQNLITDAALEPLSSWHTISQLEELVLRDNQLKKIP  365
            S LS+L K SLRQNLI D+ +EPLS W  +S LEELVLRDN+L K+P
Sbjct  63   SQLSSLKKLSLRQNLIDDSGVEPLSRWEALSDLEELVLRDNKLGKVP  109



>ref|XP_004139355.1| PREDICTED: protein phosphatase 1 regulatory subunit pprA-like 
[Cucumis sativus]
 ref|XP_004157884.1| PREDICTED: protein phosphatase 1 regulatory subunit pprA-like 
[Cucumis sativus]
 gb|KGN60590.1| hypothetical protein Csa_2G000970 [Cucumis sativus]
Length=333

 Score =   114 bits (284),  Expect(2) = 5e-44, Method: Compositional matrix adjust.
 Identities = 67/89 (75%), Positives = 80/89 (90%), Gaps = 0/89 (0%)
 Frame = +2

Query  365  GVSIFKKLLVFDVSFNEITSPSGLSKVSSTLKELYVSNNQIAKIEEIEHFHELQILELGS  544
              SIFK+LLVFDVSFNEITS  GLSKVS+TLKELYVS N++ K+EE++HF +LQILELGS
Sbjct  107  DASIFKRLLVFDVSFNEITSLHGLSKVSNTLKELYVSKNEVTKMEELDHFLQLQILELGS  166

Query  545  NKLRVMenlqtltnlxelwlGRNRIRAIN  631
            N+LRVMEN++ LTNL ELWLGRNRI+A+N
Sbjct  167  NRLRVMENMENLTNLQELWLGRNRIKAVN  195


 Score = 91.3 bits (225),  Expect(2) = 5e-44, Method: Compositional matrix adjust.
 Identities = 64/86 (74%), Positives = 74/86 (86%), Gaps = 0/86 (0%)
 Frame = +3

Query  108  TVLDLTSFQlhdldsvdlpsslseldlTANRLSALDPRISHLSNLNKFSLRQNLITDAAL  287
            T LDLTSFQLHDLDS++LPSSL+ELDLTANRL+ LDPRI  LSNL K SLRQNLI +AA+
Sbjct  21   TFLDLTSFQLHDLDSIELPSSLTELDLTANRLTNLDPRIGELSNLKKLSLRQNLINNAAV  80

Query  288  EPLSSWHTISQLEELVLRDNQLKKIP  365
            E LS W+ +S LEEL+LRDNQ+ KIP
Sbjct  81   ESLSHWNALSGLEELILRDNQMTKIP  106



>ref|XP_008458673.1| PREDICTED: protein phosphatase 1 regulatory subunit pprA [Cucumis 
melo]
Length=333

 Score =   112 bits (280),  Expect(2) = 6e-44, Method: Compositional matrix adjust.
 Identities = 66/88 (75%), Positives = 80/88 (91%), Gaps = 0/88 (0%)
 Frame = +2

Query  368  VSIFKKLLVFDVSFNEITSPSGLSKVSSTLKELYVSNNQIAKIEEIEHFHELQILELGSN  547
             SIFK+LLVFDVSFNEITS  GLS VS+TLKELYVS N+++K+EE++HF +LQILELGSN
Sbjct  108  ASIFKRLLVFDVSFNEITSLHGLSTVSNTLKELYVSKNEVSKMEELDHFLQLQILELGSN  167

Query  548  KLRVMenlqtltnlxelwlGRNRIRAIN  631
            +LRVMEN++ LTNL ELWLGRNRI+A+N
Sbjct  168  RLRVMENMENLTNLQELWLGRNRIKAVN  195


 Score = 92.8 bits (229),  Expect(2) = 6e-44, Method: Compositional matrix adjust.
 Identities = 64/86 (74%), Positives = 75/86 (87%), Gaps = 0/86 (0%)
 Frame = +3

Query  108  TVLDLTSFQlhdldsvdlpsslseldlTANRLSALDPRISHLSNLNKFSLRQNLITDAAL  287
            TVLDLTS+QLHDLDS++LPSSL+ELDLTANRL+ LDPRI  LSNL K SLRQNLI +AA+
Sbjct  21   TVLDLTSYQLHDLDSIELPSSLTELDLTANRLTNLDPRIGELSNLKKLSLRQNLINNAAV  80

Query  288  EPLSSWHTISQLEELVLRDNQLKKIP  365
            E LS W+ +S LEEL+LRDNQ+ KIP
Sbjct  81   ESLSRWNALSGLEELILRDNQMTKIP  106



>ref|XP_010535961.1| PREDICTED: protein phosphatase 1 regulatory subunit 7 [Tarenaya 
hassleriana]
Length=343

 Score =   105 bits (263),  Expect(2) = 1e-43, Method: Compositional matrix adjust.
 Identities = 63/88 (72%), Positives = 74/88 (84%), Gaps = 0/88 (0%)
 Frame = +2

Query  368  VSIFKKLLVFDVSFNEITSPSGLSKVSSTLKELYVSNNQIAKIEEIEHFHELQILELGSN  547
            +SIF KLLVFD+SFNEI S  GL+K SS LKELYVS N+++K+ EIEH H LQILELGSN
Sbjct  120  ISIFTKLLVFDISFNEIPSLEGLAKASSMLKELYVSKNEVSKMVEIEHLHNLQILELGSN  179

Query  548  KLRVMenlqtltnlxelwlGRNRIRAIN  631
            +LRVMENL+ LT L ELWLGRNRI+ +N
Sbjct  180  RLRVMENLENLTKLEELWLGRNRIKVVN  207


 Score = 98.2 bits (243),  Expect(2) = 1e-43, Method: Compositional matrix adjust.
 Identities = 68/116 (59%), Positives = 84/116 (72%), Gaps = 8/116 (7%)
 Frame = +3

Query  42   TSTHGHPSDS-TPDNGETSSS-------SPTVLDLTSFQlhdldsvdlpsslseldlTAN  197
            +S +  PS S   D+G+T          S  VLDLTSFQLH L++VDL ++L+ELDLTAN
Sbjct  3    SSCNAPPSTSPAVDHGDTEEQAVVEIDDSAYVLDLTSFQLHSLEAVDLRATLTELDLTAN  62

Query  198  RLSALDPRISHLSNLNKFSLRQNLITDAALEPLSSWHTISQLEELVLRDNQLKKIP  365
            RLS LDPR+  LSNL K SLRQNL+ DA +EPLS W T+S LEEL+LRDN+L K+P
Sbjct  63   RLSTLDPRVEKLSNLKKLSLRQNLVDDAGVEPLSRWATLSGLEELILRDNKLTKVP  118



>emb|CDY42285.1| BnaC02g08910D [Brassica napus]
Length=318

 Score =   114 bits (285),  Expect(2) = 1e-43, Method: Compositional matrix adjust.
 Identities = 68/89 (76%), Positives = 77/89 (87%), Gaps = 0/89 (0%)
 Frame = +2

Query  365  GVSIFKKLLVFDVSFNEITSPSGLSKVSSTLKELYVSNNQIAKIEEIEHFHELQILELGS  544
             VSIF +LLVFDVSFNEITS  GLSK SSTLKELYVS N++ KI EIEH H+LQILELGS
Sbjct  94   DVSIFSRLLVFDVSFNEITSLEGLSKASSTLKELYVSKNEVNKIMEIEHLHDLQILELGS  153

Query  545  NKLRVMenlqtltnlxelwlGRNRIRAIN  631
            N+LRVMEN++TLT L ELWLGRNRI+ +N
Sbjct  154  NRLRVMENMETLTKLEELWLGRNRIKVVN  182


 Score = 89.7 bits (221),  Expect(2) = 1e-43, Method: Compositional matrix adjust.
 Identities = 61/88 (69%), Positives = 71/88 (81%), Gaps = 0/88 (0%)
 Frame = +3

Query  102  SPTVLDLTSFQlhdldsvdlpsslseldlTANRLSALDPRISHLSNLNKFSLRQNLITDA  281
            S  VLDLTS QLH LDS++LP +L ELDLTANRLS LD RI+HLS L K SLRQNLI D+
Sbjct  6    SGDVLDLTSCQLHSLDSIELPPTLIELDLTANRLSELDSRIAHLSMLKKLSLRQNLIEDS  65

Query  282  ALEPLSSWHTISQLEELVLRDNQLKKIP  365
            A+EPLS W  +S LEEL+LRDN+L K+P
Sbjct  66   AVEPLSRWDALSDLEELILRDNKLAKVP  93



>ref|XP_010249563.1| PREDICTED: protein phosphatase 1 regulatory subunit pprA [Nelumbo 
nucifera]
Length=337

 Score =   116 bits (291),  Expect(2) = 2e-43, Method: Compositional matrix adjust.
 Identities = 69/88 (78%), Positives = 79/88 (90%), Gaps = 0/88 (0%)
 Frame = +2

Query  368  VSIFKKLLVFDVSFNEITSPSGLSKVSSTLKELYVSNNQIAKIEEIEHFHELQILELGSN  547
             SIFK LLVFD+SFNEI S +GLSKVS+TLKELYVS N++ KIEE++HFHELQILELGSN
Sbjct  114  ASIFKSLLVFDISFNEIPSLNGLSKVSNTLKELYVSKNEVTKIEELDHFHELQILELGSN  173

Query  548  KLRVMenlqtltnlxelwlGRNRIRAIN  631
            +LRVMENLQ LT+L ELWLGRNRIR +N
Sbjct  174  RLRVMENLQNLTHLQELWLGRNRIRTVN  201


 Score = 86.7 bits (213),  Expect(2) = 2e-43, Method: Compositional matrix adjust.
 Identities = 60/101 (59%), Positives = 75/101 (74%), Gaps = 0/101 (0%)
 Frame = +3

Query  63   SDSTPDNGETSSSSPTVLDLTSFQlhdldsvdlpsslseldlTANRLSALDPRISHLSNL  242
            ++   + G    +S + LDLTS+QLHDLD ++LP SL ELDLT NRLS LDPRI+ L+ L
Sbjct  12   NNGASEGGNVEENSLSYLDLTSYQLHDLDGIELPPSLIELDLTTNRLSTLDPRIALLAQL  71

Query  243  NKFSLRQNLITDAALEPLSSWHTISQLEELVLRDNQLKKIP  365
             K SLRQNL  DA +EP+S W +IS L+ELVLRDN+L KIP
Sbjct  72   KKLSLRQNLFDDAGIEPISRWDSISGLQELVLRDNRLTKIP  112



>ref|XP_010049636.1| PREDICTED: protein phosphatase 1 regulatory subunit pprA [Eucalyptus 
grandis]
 gb|KCW82375.1| hypothetical protein EUGRSUZ_C03782 [Eucalyptus grandis]
Length=338

 Score =   116 bits (291),  Expect(2) = 4e-43, Method: Compositional matrix adjust.
 Identities = 69/89 (78%), Positives = 77/89 (87%), Gaps = 0/89 (0%)
 Frame = +2

Query  365  GVSIFKKLLVFDVSFNEITSPSGLSKVSSTLKELYVSNNQIAKIEEIEHFHELQILELGS  544
            G  IFK+LLVFDVSFNEI S SGLSKVSSTLKELYVS N++ KIEEI+HF +LQILELGS
Sbjct  114  GAHIFKRLLVFDVSFNEIPSLSGLSKVSSTLKELYVSKNEVPKIEEIDHFTDLQILELGS  173

Query  545  NKLRVMenlqtltnlxelwlGRNRIRAIN  631
            N+LRVMENLQ L  L ELWLGRNRI+ +N
Sbjct  174  NRLRVMENLQNLVKLQELWLGRNRIKTVN  202


 Score = 85.5 bits (210),  Expect(2) = 4e-43, Method: Compositional matrix adjust.
 Identities = 63/108 (58%), Positives = 74/108 (69%), Gaps = 2/108 (2%)
 Frame = +3

Query  48   THGHPSDSTPDNG--ETSSSSPTVLDLTSFQlhdldsvdlpsslseldlTANRLSALDPR  221
            T   P+   P     E    +  VLDLTS QLHDL SV+LP +L+ELDLTANRL++LDPR
Sbjct  6    TESAPAGDDPATATVEDEGLAAAVLDLTSCQLHDLTSVELPPTLTELDLTANRLASLDPR  65

Query  222  ISHLSNLNKFSLRQNLITDAALEPLSSWHTISQLEELVLRDNQLKKIP  365
            I  LSNL K SLRQNLI DA    +S W  +S LEELVLRDN+L K+P
Sbjct  66   IGQLSNLKKLSLRQNLIDDATAAAISGWEALSGLEELVLRDNKLTKLP  113



>ref|XP_010253998.1| PREDICTED: protein phosphatase 1 regulatory subunit pprA-like 
[Nelumbo nucifera]
 ref|XP_010253999.1| PREDICTED: protein phosphatase 1 regulatory subunit pprA-like 
[Nelumbo nucifera]
Length=338

 Score =   113 bits (283),  Expect(2) = 4e-43, Method: Compositional matrix adjust.
 Identities = 65/88 (74%), Positives = 80/88 (91%), Gaps = 0/88 (0%)
 Frame = +2

Query  368  VSIFKKLLVFDVSFNEITSPSGLSKVSSTLKELYVSNNQIAKIEEIEHFHELQILELGSN  547
            VSIFK LLVFDVSFNEI+S +GLSK+++TLKELYVS N++ K+EE++HFH+LQILELGSN
Sbjct  115  VSIFKSLLVFDVSFNEISSLNGLSKITNTLKELYVSKNEVTKMEELDHFHDLQILELGSN  174

Query  548  KLRVMenlqtltnlxelwlGRNRIRAIN  631
            +LRV+ENLQ L +L ELWLGRNRIR +N
Sbjct  175  RLRVIENLQNLAHLQELWLGRNRIRTVN  202


 Score = 88.6 bits (218),  Expect(2) = 4e-43, Method: Compositional matrix adjust.
 Identities = 64/113 (57%), Positives = 79/113 (70%), Gaps = 4/113 (4%)
 Frame = +3

Query  51   HGHPSDSTPDNGETSSSSPTVLDLTSFQlhdldsvdlpsslseldlTANRLSALDPRISH  230
            HG     T +     +SS + LDLTS+QLHDLD ++LP SL ELDLTANRL  LDPRI+ 
Sbjct  13   HGASEGGTVE----ENSSCSYLDLTSYQLHDLDGIELPPSLFELDLTANRLCTLDPRIAL  68

Query  231  LSNLNKFSLRQNLITDAALEPLSSWHTISQLEELVLRDNQLKKIPVLAYLRNF  389
            L  L K  LRQNL  DA +EP+S W +IS LEELVLRDN+LKKIP ++  ++ 
Sbjct  69   LRELKKLYLRQNLFDDAGIEPISRWDSISALEELVLRDNRLKKIPDVSIFKSL  121



>ref|XP_006400530.1| hypothetical protein EUTSA_v10014089mg [Eutrema salsugineum]
 gb|ESQ41983.1| hypothetical protein EUTSA_v10014089mg [Eutrema salsugineum]
Length=328

 Score =   113 bits (282),  Expect(2) = 6e-43, Method: Compositional matrix adjust.
 Identities = 65/89 (73%), Positives = 75/89 (84%), Gaps = 0/89 (0%)
 Frame = +2

Query  365  GVSIFKKLLVFDVSFNEITSPSGLSKVSSTLKELYVSNNQIAKIEEIEHFHELQILELGS  544
             +SIF KLLVFD+SFNEITS  GLSK SSTLKELYVS N++ KI EIEH H+LQILELGS
Sbjct  104  DISIFSKLLVFDLSFNEITSLQGLSKASSTLKELYVSKNEVNKIAEIEHLHDLQILELGS  163

Query  545  NKLRVMenlqtltnlxelwlGRNRIRAIN  631
            N+LRVMEN++  T L ELWLGRNRI+ +N
Sbjct  164  NRLRVMENMENFTKLEELWLGRNRIKVVN  192


 Score = 88.2 bits (217),  Expect(2) = 6e-43, Method: Compositional matrix adjust.
 Identities = 61/88 (69%), Positives = 71/88 (81%), Gaps = 0/88 (0%)
 Frame = +3

Query  102  SPTVLDLTSFQlhdldsvdlpsslseldlTANRLSALDPRISHLSNLNKFSLRQNLITDA  281
            S  VLDLTS QLH LDSV+LP +L+ELDLTANRLS LD RI+ LS L K SLRQNLI D+
Sbjct  16   SENVLDLTSCQLHSLDSVELPPTLTELDLTANRLSGLDSRIAQLSTLKKLSLRQNLIDDS  75

Query  282  ALEPLSSWHTISQLEELVLRDNQLKKIP  365
            A+EPLS W  +S LEEL+LRDN+L K+P
Sbjct  76   AVEPLSRWDALSDLEELILRDNKLAKVP  103



>gb|KDP42237.1| hypothetical protein JCGZ_02967 [Jatropha curcas]
Length=337

 Score =   109 bits (273),  Expect(2) = 8e-43, Method: Compositional matrix adjust.
 Identities = 67/88 (76%), Positives = 77/88 (88%), Gaps = 0/88 (0%)
 Frame = +2

Query  368  VSIFKKLLVFDVSFNEITSPSGLSKVSSTLKELYVSNNQIAKIEEIEHFHELQILELGSN  547
            VSIFK LLVFDVSFNEI S  GLSK S+TLKELYVS N++ K+EEI+H ++LQILELGSN
Sbjct  114  VSIFKSLLVFDVSFNEIRSLQGLSKASNTLKELYVSKNEVTKMEEIDHLYQLQILELGSN  173

Query  548  KLRVMenlqtltnlxelwlGRNRIRAIN  631
            +LRVMENL+ LTNL ELWLGRNRI+ IN
Sbjct  174  RLRVMENLKNLTNLQELWLGRNRIKTIN  201


 Score = 91.7 bits (226),  Expect(2) = 8e-43, Method: Compositional matrix adjust.
 Identities = 65/96 (68%), Positives = 77/96 (80%), Gaps = 0/96 (0%)
 Frame = +3

Query  102  SPTVLDLTSFQlhdldsvdlpsslseldlTANRLSALDPRISHLSNLNKFSLRQNLITDA  281
            S +VLDLTSFQLHDL SV+L  SL+ELDLT+NRLS+LD RI HLSNL K SLRQNLI DA
Sbjct  25   SSSVLDLTSFQLHDLGSVELSPSLTELDLTSNRLSSLDSRILHLSNLKKLSLRQNLIDDA  84

Query  282  ALEPLSSWHTISQLEELVLRDNQLKKIPVLAYLRNF  389
            A+EPLSS   +  LEELVLRDN+L KIP ++  ++ 
Sbjct  85   AIEPLSSCEPLVGLEELVLRDNKLIKIPDVSIFKSL  120



>emb|CDY44934.1| BnaA02g04390D [Brassica napus]
Length=318

 Score =   112 bits (280),  Expect(2) = 9e-43, Method: Compositional matrix adjust.
 Identities = 66/89 (74%), Positives = 76/89 (85%), Gaps = 0/89 (0%)
 Frame = +2

Query  365  GVSIFKKLLVFDVSFNEITSPSGLSKVSSTLKELYVSNNQIAKIEEIEHFHELQILELGS  544
             VSIF +LLVFDVSFNEITS  G+SK SSTLKELYVS N++ KI EIEH H+LQILELGS
Sbjct  94   DVSIFSRLLVFDVSFNEITSLEGISKASSTLKELYVSKNEVNKIMEIEHLHDLQILELGS  153

Query  545  NKLRVMenlqtltnlxelwlGRNRIRAIN  631
            N+LRVMEN++ LT L ELWLGRNRI+ +N
Sbjct  154  NRLRVMENMENLTKLEELWLGRNRIKVVN  182


 Score = 88.6 bits (218),  Expect(2) = 9e-43, Method: Compositional matrix adjust.
 Identities = 61/88 (69%), Positives = 70/88 (80%), Gaps = 0/88 (0%)
 Frame = +3

Query  102  SPTVLDLTSFQlhdldsvdlpsslseldlTANRLSALDPRISHLSNLNKFSLRQNLITDA  281
            S  VLDLTS QLH LDSV+LP +L ELDLTANRLS LD RI+HLS L K SLRQNLI D+
Sbjct  6    SGDVLDLTSCQLHSLDSVELPPTLIELDLTANRLSELDSRIAHLSMLKKLSLRQNLIEDS  65

Query  282  ALEPLSSWHTISQLEELVLRDNQLKKIP  365
            A+EPLS W  +  LEEL+LRDN+L K+P
Sbjct  66   AVEPLSRWDALCDLEELILRDNKLAKVP  93



>gb|AAM61087.1| unknown [Arabidopsis thaliana]
Length=328

 Score =   109 bits (273),  Expect(2) = 1e-42, Method: Compositional matrix adjust.
 Identities = 65/89 (73%), Positives = 74/89 (83%), Gaps = 0/89 (0%)
 Frame = +2

Query  365  GVSIFKKLLVFDVSFNEITSPSGLSKVSSTLKELYVSNNQIAKIEEIEHFHELQILELGS  544
             VSIF KLLV+D+SFNEITS  G+SK SSTLKELYVS N++ KI EIEH H LQILELGS
Sbjct  104  DVSIFTKLLVYDISFNEITSLEGISKASSTLKELYVSKNEVNKIMEIEHLHNLQILELGS  163

Query  545  NKLRVMenlqtltnlxelwlGRNRIRAIN  631
            N+LRVMENL+  T L ELWLGRNRI+ +N
Sbjct  164  NRLRVMENLENFTKLEELWLGRNRIKVVN  192


 Score = 90.9 bits (224),  Expect(2) = 1e-42, Method: Compositional matrix adjust.
 Identities = 64/101 (63%), Positives = 75/101 (74%), Gaps = 0/101 (0%)
 Frame = +3

Query  63   SDSTPDNGETSSSSPTVLDLTSFQlhdldsvdlpsslseldlTANRLSALDPRISHLSNL  242
            SD   +  E    S  VLDLTS+QLH LD+V+LP +L ELDLTANRLS LD RI+ LS L
Sbjct  3    SDKEEEPLEEIGDSNNVLDLTSYQLHSLDTVELPPNLIELDLTANRLSGLDSRIAQLSTL  62

Query  243  NKFSLRQNLITDAALEPLSSWHTISQLEELVLRDNQLKKIP  365
             K SLRQNLI D+A+EPLS W  +S LEELVLRDN+L K+P
Sbjct  63   KKLSLRQNLIDDSAVEPLSHWDALSDLEELVLRDNKLAKVP  103



>ref|XP_010420782.1| PREDICTED: protein phosphatase 1 regulatory subunit pprA-like 
[Camelina sativa]
Length=328

 Score =   109 bits (273),  Expect(2) = 2e-42, Method: Compositional matrix adjust.
 Identities = 66/93 (71%), Positives = 76/93 (82%), Gaps = 0/93 (0%)
 Frame = +2

Query  353  EENSGVSIFKKLLVFDVSFNEITSPSGLSKVSSTLKELYVSNNQIAKIEEIEHFHELQIL  532
            E+   VSIF KLLVFD+SFNEITS  GLSK +S+LKELYVS N++ KI EIEH H LQIL
Sbjct  100  EKVPDVSIFSKLLVFDISFNEITSLEGLSKATSSLKELYVSKNEVNKIMEIEHLHNLQIL  159

Query  533  ELGSNKLRVMenlqtltnlxelwlGRNRIRAIN  631
            ELGSN+LRVMENL+  T L ELWLGRNRI+ +N
Sbjct  160  ELGSNRLRVMENLENFTILEELWLGRNRIKVVN  192


 Score = 90.5 bits (223),  Expect(2) = 2e-42, Method: Compositional matrix adjust.
 Identities = 60/88 (68%), Positives = 73/88 (83%), Gaps = 0/88 (0%)
 Frame = +3

Query  102  SPTVLDLTSFQlhdldsvdlpsslseldlTANRLSALDPRISHLSNLNKFSLRQNLITDA  281
            S  VLDLTS+QLH LD+V+LP++L+ELDLTANRLS LD RI+ LS L K SLRQNLI D+
Sbjct  16   SSNVLDLTSYQLHSLDTVELPTTLTELDLTANRLSGLDSRIAQLSALKKLSLRQNLIDDS  75

Query  282  ALEPLSSWHTISQLEELVLRDNQLKKIP  365
             +EPLS W  +S LEELVLRDN+L+K+P
Sbjct  76   GVEPLSRWDALSDLEELVLRDNKLEKVP  103



>ref|XP_009126382.1| PREDICTED: LOW QUALITY PROTEIN: protein phosphatase 1 regulatory 
subunit pprA-like [Brassica rapa]
Length=318

 Score =   111 bits (278),  Expect(2) = 2e-42, Method: Compositional matrix adjust.
 Identities = 66/88 (75%), Positives = 75/88 (85%), Gaps = 0/88 (0%)
 Frame = +2

Query  365  GVSIFKKLLVFDVSFNEITSPSGLSKVSSTLKELYVSNNQIAKIEEIEHFHELQILELGS  544
             VSIF +LLVFDVSFNEITS  GLSK SSTLKELYVS N++ KI EIEH H+LQILELGS
Sbjct  94   DVSIFSRLLVFDVSFNEITSLEGLSKASSTLKELYVSKNEVNKIMEIEHLHDLQILELGS  153

Query  545  NKLRVMenlqtltnlxelwlGRNRIRAI  628
            N+LRVMEN++ LT L ELWLGRNRI+ +
Sbjct  154  NRLRVMENMENLTKLEELWLGRNRIKVV  181


 Score = 88.6 bits (218),  Expect(2) = 2e-42, Method: Compositional matrix adjust.
 Identities = 60/88 (68%), Positives = 70/88 (80%), Gaps = 0/88 (0%)
 Frame = +3

Query  102  SPTVLDLTSFQlhdldsvdlpsslseldlTANRLSALDPRISHLSNLNKFSLRQNLITDA  281
            S  VLDLTS QLH LDS++LP +L ELDLTANRLS LD RI+HLS L K SLRQNLI D+
Sbjct  6    SGDVLDLTSCQLHSLDSIELPPTLIELDLTANRLSELDSRIAHLSMLKKLSLRQNLIEDS  65

Query  282  ALEPLSSWHTISQLEELVLRDNQLKKIP  365
            A+EPLS W  +  LEEL+LRDN+L K+P
Sbjct  66   AVEPLSRWDALCDLEELILRDNKLAKVP  93



>ref|XP_009120865.1| PREDICTED: protein phosphatase 1 regulatory subunit pprA [Brassica 
rapa]
Length=328

 Score =   112 bits (281),  Expect(2) = 2e-42, Method: Compositional matrix adjust.
 Identities = 65/89 (73%), Positives = 74/89 (83%), Gaps = 0/89 (0%)
 Frame = +2

Query  365  GVSIFKKLLVFDVSFNEITSPSGLSKVSSTLKELYVSNNQIAKIEEIEHFHELQILELGS  544
              +IF KLLVFDVSFNEITS  GLSK SSTLKELYVS N++ KI EIEH H+LQILELGS
Sbjct  104  DTAIFSKLLVFDVSFNEITSLQGLSKASSTLKELYVSKNEVNKIMEIEHLHDLQILELGS  163

Query  545  NKLRVMenlqtltnlxelwlGRNRIRAIN  631
            N+LRVMEN++  T L ELWLGRNRI+ +N
Sbjct  164  NRLRVMENMENFTKLDELWLGRNRIKVVN  192


 Score = 87.4 bits (215),  Expect(2) = 2e-42, Method: Compositional matrix adjust.
 Identities = 59/88 (67%), Positives = 70/88 (80%), Gaps = 0/88 (0%)
 Frame = +3

Query  102  SPTVLDLTSFQlhdldsvdlpsslseldlTANRLSALDPRISHLSNLNKFSLRQNLITDA  281
            S  VLDLTS QLH LD+++LP +L ELDLTANRLS LD RI+ LS L K SLRQNLI D+
Sbjct  16   SDNVLDLTSCQLHTLDAIELPPTLIELDLTANRLSELDSRIAQLSALKKLSLRQNLIDDS  75

Query  282  ALEPLSSWHTISQLEELVLRDNQLKKIP  365
            A+EPLS W  +S LEEL+LRDN+L K+P
Sbjct  76   AVEPLSRWDALSDLEELILRDNKLAKVP  103



>emb|CDX92510.1| BnaA10g15490D [Brassica napus]
Length=328

 Score =   112 bits (280),  Expect(2) = 2e-42, Method: Compositional matrix adjust.
 Identities = 65/89 (73%), Positives = 74/89 (83%), Gaps = 0/89 (0%)
 Frame = +2

Query  365  GVSIFKKLLVFDVSFNEITSPSGLSKVSSTLKELYVSNNQIAKIEEIEHFHELQILELGS  544
              +IF KLLVFDVSFNEITS  GLSK SSTLKELYVS N++ KI EIEH H+LQILELGS
Sbjct  104  DTAIFSKLLVFDVSFNEITSLQGLSKASSTLKELYVSKNEVNKIMEIEHLHDLQILELGS  163

Query  545  NKLRVMenlqtltnlxelwlGRNRIRAIN  631
            N+LRVMEN++  T L ELWLGRNRI+ +N
Sbjct  164  NRLRVMENMENFTKLDELWLGRNRIKVVN  192


 Score = 87.4 bits (215),  Expect(2) = 2e-42, Method: Compositional matrix adjust.
 Identities = 59/88 (67%), Positives = 70/88 (80%), Gaps = 0/88 (0%)
 Frame = +3

Query  102  SPTVLDLTSFQlhdldsvdlpsslseldlTANRLSALDPRISHLSNLNKFSLRQNLITDA  281
            S  VLDLTS QLH LD+++LP +L ELDLTANRLS LD RI+ LS L K SLRQNLI D+
Sbjct  16   SDNVLDLTSCQLHTLDAIELPPTLIELDLTANRLSELDSRIAQLSALKKLSLRQNLIDDS  75

Query  282  ALEPLSSWHTISQLEELVLRDNQLKKIP  365
            A+EPLS W  +S LEEL+LRDN+L K+P
Sbjct  76   AVEPLSRWDALSDLEELILRDNKLAKVP  103



>ref|NP_197469.1| leucine-rich repeat-containing protein [Arabidopsis thaliana]
 gb|AAO24571.1| At5g19680 [Arabidopsis thaliana]
 dbj|BAF00080.1| hypothetical protein [Arabidopsis thaliana]
 gb|AED92737.1| leucine-rich repeat-containing protein [Arabidopsis thaliana]
Length=328

 Score =   109 bits (273),  Expect(2) = 2e-42, Method: Compositional matrix adjust.
 Identities = 65/89 (73%), Positives = 74/89 (83%), Gaps = 0/89 (0%)
 Frame = +2

Query  365  GVSIFKKLLVFDVSFNEITSPSGLSKVSSTLKELYVSNNQIAKIEEIEHFHELQILELGS  544
             VSIF KLLV+D+SFNEITS  G+SK SSTLKELYVS N++ KI EIEH H LQILELGS
Sbjct  104  DVSIFTKLLVYDISFNEITSLEGISKASSTLKELYVSKNEVNKIMEIEHLHNLQILELGS  163

Query  545  NKLRVMenlqtltnlxelwlGRNRIRAIN  631
            N+LRVMENL+  T L ELWLGRNRI+ +N
Sbjct  164  NRLRVMENLENFTKLEELWLGRNRIKVVN  192


 Score = 90.1 bits (222),  Expect(2) = 2e-42, Method: Compositional matrix adjust.
 Identities = 62/93 (67%), Positives = 72/93 (77%), Gaps = 0/93 (0%)
 Frame = +3

Query  87   ETSSSSPTVLDLTSFQlhdldsvdlpsslseldlTANRLSALDPRISHLSNLNKFSLRQN  266
            E    S  VLDLTS+QLH LD+V+LP +L ELDLTANRLS LD RI+ LS L K SLRQN
Sbjct  11   EEIGDSNNVLDLTSYQLHSLDTVELPPNLIELDLTANRLSGLDSRIAQLSTLKKLSLRQN  70

Query  267  LITDAALEPLSSWHTISQLEELVLRDNQLKKIP  365
            LI D+A+EPLS W  +S LEELVLRDN+L K+P
Sbjct  71   LIDDSAVEPLSHWDALSDLEELVLRDNKLAKVP  103



>gb|KJB83107.1| hypothetical protein B456_013G229800 [Gossypium raimondii]
Length=289

 Score =   105 bits (263),  Expect(2) = 3e-42, Method: Compositional matrix adjust.
 Identities = 51/64 (80%), Positives = 58/64 (91%), Gaps = 0/64 (0%)
 Frame = +2

Query  365  GVSIFKKLLVFDVSFNEITSPSGLSKVSSTLKELYVSNNQIAKIEEIEHFHELQILELGS  544
             VS+FKKLLVFDVSFNEITS  G+SKVSSTLKELYVS N++ K+EEI+H HELQILELGS
Sbjct  114  DVSLFKKLLVFDVSFNEITSLHGMSKVSSTLKELYVSKNEVTKMEEIDHLHELQILELGS  173

Query  545  NKLR  556
            N+LR
Sbjct  174  NRLR  177


 Score = 93.6 bits (231),  Expect(2) = 3e-42, Method: Compositional matrix adjust.
 Identities = 72/126 (57%), Positives = 90/126 (71%), Gaps = 5/126 (4%)
 Frame = +3

Query  12   LHSPMDPSPGTSTHGHPSDSTPDNGETSSSSPTVLDLTSFQlhdldsvdlpsslseldlT  191
            + +  +P P T+     SD      E   SS T LDLTSFQLHDLDSV+LPSSL+ELDLT
Sbjct  1    MQNQTEPPPETN-----SDKDDQAIEFDLSSTTALDLTSFQLHDLDSVELPSSLTELDLT  55

Query  192  ANRLSALDPRISHLSNLNKFSLRQNLITDAALEPLSSWHTISQLEELVLRDNQLKKIPVL  371
            ANRLS LDPRI++L NL K S +QNLI DAA+E +SSW ++S LEELVLRDN+L K+P +
Sbjct  56   ANRLSKLDPRIANLINLRKLSFQQNLIDDAAIESISSWDSLSGLEELVLRDNKLMKVPDV  115

Query  372  AYLRNF  389
            +  +  
Sbjct  116  SLFKKL  121



>ref|XP_006288189.1| hypothetical protein CARUB_v10001424mg [Capsella rubella]
 gb|EOA21087.1| hypothetical protein CARUB_v10001424mg [Capsella rubella]
Length=328

 Score =   108 bits (270),  Expect(2) = 3e-42, Method: Compositional matrix adjust.
 Identities = 65/88 (74%), Positives = 73/88 (83%), Gaps = 0/88 (0%)
 Frame = +2

Query  368  VSIFKKLLVFDVSFNEITSPSGLSKVSSTLKELYVSNNQIAKIEEIEHFHELQILELGSN  547
            VSIF KLLVFD+SFNEITS  G SK SS+LKELYVS N++ KI EIEH H LQILELGSN
Sbjct  105  VSIFSKLLVFDISFNEITSLEGTSKASSSLKELYVSKNEVNKIMEIEHLHNLQILELGSN  164

Query  548  KLRVMenlqtltnlxelwlGRNRIRAIN  631
            +LRVMENL+  T L ELWLGRNRI+ +N
Sbjct  165  RLRVMENLENFTKLEELWLGRNRIKVVN  192


 Score = 90.5 bits (223),  Expect(2) = 3e-42, Method: Compositional matrix adjust.
 Identities = 61/88 (69%), Positives = 71/88 (81%), Gaps = 0/88 (0%)
 Frame = +3

Query  102  SPTVLDLTSFQlhdldsvdlpsslseldlTANRLSALDPRISHLSNLNKFSLRQNLITDA  281
            S  VLDLTS+QLH LD+V+LP +L+ELDLTANRLS LD RI+ LS L K SLRQNLI DA
Sbjct  16   SGNVLDLTSYQLHSLDTVELPPTLTELDLTANRLSGLDSRIAQLSALKKLSLRQNLIDDA  75

Query  282  ALEPLSSWHTISQLEELVLRDNQLKKIP  365
             +EPLS W  +S LEELVLRDN+L K+P
Sbjct  76   GVEPLSRWEALSDLEELVLRDNKLAKVP  103



>ref|XP_010925562.1| PREDICTED: protein phosphatase 1 regulatory subunit 7 [Elaeis 
guineensis]
Length=330

 Score =   110 bits (274),  Expect(2) = 5e-42, Method: Compositional matrix adjust.
 Identities = 68/88 (77%), Positives = 79/88 (90%), Gaps = 0/88 (0%)
 Frame = +2

Query  368  VSIFKKLLVFDVSFNEITSPSGLSKVSSTLKELYVSNNQIAKIEEIEHFHELQILELGSN  547
            V IFK LLVFDVSFNEI+S +GLSKVS+TL+ELYVS N++ K+EE+EH H L+ILELGSN
Sbjct  107  VGIFKNLLVFDVSFNEISSLNGLSKVSNTLEELYVSKNEVTKMEELEHLHALRILELGSN  166

Query  548  KLRVMenlqtltnlxelwlGRNRIRAIN  631
            +LRVMENLQTLTNL ELWLGRNRIR +N
Sbjct  167  RLRVMENLQTLTNLQELWLGRNRIRTVN  194


 Score = 88.6 bits (218),  Expect(2) = 5e-42, Method: Compositional matrix adjust.
 Identities = 58/98 (59%), Positives = 71/98 (72%), Gaps = 0/98 (0%)
 Frame = +3

Query  96   SSSPTVLDLTSFQlhdldsvdlpsslseldlTANRLSALDPRISHLSNLNKFSLRQNLIT  275
             S    LDLTSFQLHDL  V++P S+ ELDLTANRL+ LDPRI  LS+L K  LRQNL  
Sbjct  16   ESQVRCLDLTSFQLHDLGEVEIPESIEELDLTANRLTKLDPRIGLLSHLRKLYLRQNLFD  75

Query  276  DAALEPLSSWHTISQLEELVLRDNQLKKIPVLAYLRNF  389
            D  +EP+S W+TIS L ELVLRDN+L+K+P +   +N 
Sbjct  76   DEGVEPISRWNTISGLHELVLRDNKLRKVPDVGIFKNL  113



>ref|XP_010493045.1| PREDICTED: protein phosphatase 1 regulatory subunit pprA-like 
[Camelina sativa]
Length=328

 Score =   107 bits (268),  Expect(2) = 6e-42, Method: Compositional matrix adjust.
 Identities = 63/88 (72%), Positives = 74/88 (84%), Gaps = 0/88 (0%)
 Frame = +2

Query  368  VSIFKKLLVFDVSFNEITSPSGLSKVSSTLKELYVSNNQIAKIEEIEHFHELQILELGSN  547
            +SIF KLLVFD+SFNEITS  GLSK +++LKELYVS N++ KI EIEH H LQILELGSN
Sbjct  105  ISIFSKLLVFDISFNEITSLEGLSKATTSLKELYVSKNEVNKIMEIEHLHNLQILELGSN  164

Query  548  KLRVMenlqtltnlxelwlGRNRIRAIN  631
            +LRVMENL+  T L ELWLGRNRI+ +N
Sbjct  165  RLRVMENLENFTILEELWLGRNRIKVVN  192


 Score = 90.1 bits (222),  Expect(2) = 6e-42, Method: Compositional matrix adjust.
 Identities = 60/88 (68%), Positives = 72/88 (82%), Gaps = 0/88 (0%)
 Frame = +3

Query  102  SPTVLDLTSFQlhdldsvdlpsslseldlTANRLSALDPRISHLSNLNKFSLRQNLITDA  281
            S  VLDLTS+QLH LD+V+LP++L ELDLTANRLS LD RI+ LS L K SLRQNLI D+
Sbjct  16   SSNVLDLTSYQLHSLDTVELPTTLIELDLTANRLSGLDSRIAQLSALKKLSLRQNLIDDS  75

Query  282  ALEPLSSWHTISQLEELVLRDNQLKKIP  365
             +EPLS W  +S LEELVLRDN+L+K+P
Sbjct  76   GVEPLSRWDALSDLEELVLRDNKLEKVP  103



>ref|XP_010454252.1| PREDICTED: protein phosphatase 1 regulatory subunit pprA-like 
[Camelina sativa]
Length=328

 Score =   108 bits (271),  Expect(2) = 7e-42, Method: Compositional matrix adjust.
 Identities = 65/93 (70%), Positives = 76/93 (82%), Gaps = 0/93 (0%)
 Frame = +2

Query  353  EENSGVSIFKKLLVFDVSFNEITSPSGLSKVSSTLKELYVSNNQIAKIEEIEHFHELQIL  532
            E+   +SIF KLLVFD+SFNEITS  GLSK +S+LKELYVS N++ KI EIEH H LQIL
Sbjct  100  EKVPDISIFSKLLVFDISFNEITSLEGLSKATSSLKELYVSKNEVNKIMEIEHLHNLQIL  159

Query  533  ELGSNKLRVMenlqtltnlxelwlGRNRIRAIN  631
            ELGSN+LRVMENL+  T L ELWLGRNRI+ +N
Sbjct  160  ELGSNRLRVMENLENFTILEELWLGRNRIKVVN  192


 Score = 89.0 bits (219),  Expect(2) = 7e-42, Method: Compositional matrix adjust.
 Identities = 60/88 (68%), Positives = 72/88 (82%), Gaps = 0/88 (0%)
 Frame = +3

Query  102  SPTVLDLTSFQlhdldsvdlpsslseldlTANRLSALDPRISHLSNLNKFSLRQNLITDA  281
            S  VLDLTS+QLH LD+V+LP +L+ELDLTANRLS LD RI+ LS L K SLRQNLI D+
Sbjct  16   SSNVLDLTSYQLHSLDTVELPPTLTELDLTANRLSGLDTRIAQLSALKKLSLRQNLIDDS  75

Query  282  ALEPLSSWHTISQLEELVLRDNQLKKIP  365
             +EPLS W  +S LEELVLRDN+L+K+P
Sbjct  76   GVEPLSRWDALSDLEELVLRDNKLEKVP  103



>gb|EEC72782.1| hypothetical protein OsI_06455 [Oryza sativa Indica Group]
Length=333

 Score =   118 bits (296),  Expect(2) = 8e-42, Method: Compositional matrix adjust.
 Identities = 71/88 (81%), Positives = 79/88 (90%), Gaps = 0/88 (0%)
 Frame = +2

Query  368  VSIFKKLLVFDVSFNEITSPSGLSKVSSTLKELYVSNNQIAKIEEIEHFHELQILELGSN  547
             SIFK LLVFDVSFNEI+S  GLSKVSSTLKELYVS N++AK+EE+EHFH LQILELGSN
Sbjct  110  ASIFKGLLVFDVSFNEISSLKGLSKVSSTLKELYVSKNEVAKMEELEHFHALQILELGSN  169

Query  548  KLRVMenlqtltnlxelwlGRNRIRAIN  631
            +LRVMENL+TL NL ELWLGRNRI+ IN
Sbjct  170  RLRVMENLETLANLQELWLGRNRIKTIN  197


 Score = 79.3 bits (194),  Expect(2) = 8e-42, Method: Compositional matrix adjust.
 Identities = 58/113 (51%), Positives = 71/113 (63%), Gaps = 9/113 (8%)
 Frame = +3

Query  27   DPSPGTSTHGHPSDSTPDNGETSSSSPTVLDLTSFQlhdldsvdlpsslseldlTANRLS  206
            DP    S+   P +   D           LDLTS QLHDL  V++P +L ELDLTANRL+
Sbjct  5    DPVYAPSSSAEPMEVEADQ---------CLDLTSCQLHDLSEVEIPPTLEELDLTANRLA  55

Query  207  ALDPRISHLSNLNKFSLRQNLITDAALEPLSSWHTISQLEELVLRDNQLKKIP  365
            A+DPRI  L  L K S RQNL+ DAA+ PLS+W  I+ L+ELV RDN+L  IP
Sbjct  56   AVDPRIGRLPGLRKLSFRQNLLDDAAVAPLSTWADIAGLQELVFRDNKLTTIP  108



>ref|NP_001046364.1| Os02g0230100 [Oryza sativa Japonica Group]
 dbj|BAD26172.1| putative sds22+ [Oryza sativa Japonica Group]
 dbj|BAF08278.1| Os02g0230100 [Oryza sativa Japonica Group]
 dbj|BAG95066.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEE56607.1| hypothetical protein OsJ_05977 [Oryza sativa Japonica Group]
Length=333

 Score =   118 bits (296),  Expect(2) = 9e-42, Method: Compositional matrix adjust.
 Identities = 71/88 (81%), Positives = 79/88 (90%), Gaps = 0/88 (0%)
 Frame = +2

Query  368  VSIFKKLLVFDVSFNEITSPSGLSKVSSTLKELYVSNNQIAKIEEIEHFHELQILELGSN  547
             SIFK LLVFDVSFNEI+S  GLSKVSSTLKELYVS N++AK+EE+EHFH LQILELGSN
Sbjct  110  ASIFKGLLVFDVSFNEISSLKGLSKVSSTLKELYVSKNEVAKMEELEHFHALQILELGSN  169

Query  548  KLRVMenlqtltnlxelwlGRNRIRAIN  631
            +LRVMENL+TL NL ELWLGRNRI+ IN
Sbjct  170  RLRVMENLETLANLQELWLGRNRIKTIN  197


 Score = 79.3 bits (194),  Expect(2) = 9e-42, Method: Compositional matrix adjust.
 Identities = 56/105 (53%), Positives = 71/105 (68%), Gaps = 1/105 (1%)
 Frame = +3

Query  54   GHPSDSTPDNGET-SSSSPTVLDLTSFQlhdldsvdlpsslseldlTANRLSALDPRISH  230
            G P D+     E+    +   LDLTS QLHDL  V++P +L EL+LTANRL+A+DPRI  
Sbjct  4    GDPVDAPAAAAESMEVEADQCLDLTSCQLHDLSEVEIPPTLEELELTANRLAAVDPRIGR  63

Query  231  LSNLNKFSLRQNLITDAALEPLSSWHTISQLEELVLRDNQLKKIP  365
            L  L K S RQNL+ DAA+ PLS+W  I+ L+ELV RDN+L  IP
Sbjct  64   LPGLRKLSFRQNLLDDAAVAPLSTWADIAGLQELVFRDNKLTTIP  108



>emb|CDY58975.1| BnaC09g38010D [Brassica napus]
Length=328

 Score =   112 bits (280),  Expect(2) = 9e-42, Method: Compositional matrix adjust.
 Identities = 65/89 (73%), Positives = 74/89 (83%), Gaps = 0/89 (0%)
 Frame = +2

Query  365  GVSIFKKLLVFDVSFNEITSPSGLSKVSSTLKELYVSNNQIAKIEEIEHFHELQILELGS  544
              +IF KLLVFDVSFNEITS  GLSK SSTLKELYVS N++ KI EIEH H+LQILELGS
Sbjct  104  DTAIFSKLLVFDVSFNEITSLQGLSKASSTLKELYVSKNEVNKIMEIEHLHDLQILELGS  163

Query  545  NKLRVMenlqtltnlxelwlGRNRIRAIN  631
            N+LRVMEN++  T L ELWLGRNRI+ +N
Sbjct  164  NRLRVMENMENFTKLDELWLGRNRIKVVN  192


 Score = 85.1 bits (209),  Expect(2) = 9e-42, Method: Compositional matrix adjust.
 Identities = 56/88 (64%), Positives = 68/88 (77%), Gaps = 0/88 (0%)
 Frame = +3

Query  102  SPTVLDLTSFQlhdldsvdlpsslseldlTANRLSALDPRISHLSNLNKFSLRQNLITDA  281
            S  V+DLTS QLH LD+++L  +L ELDLTANRLS LD RI+ LS L K  LRQNLI D+
Sbjct  16   SDNVVDLTSCQLHTLDAIELRPTLIELDLTANRLSELDSRIAQLSALKKLYLRQNLIDDS  75

Query  282  ALEPLSSWHTISQLEELVLRDNQLKKIP  365
            A+EPLS W  +S LEEL+LRDN+L K+P
Sbjct  76   AVEPLSRWDALSDLEELILRDNKLAKVP  103



>ref|XP_003571803.1| PREDICTED: protein phosphatase 1 regulatory subunit pprA [Brachypodium 
distachyon]
Length=339

 Score =   114 bits (284),  Expect(2) = 1e-41, Method: Compositional matrix adjust.
 Identities = 69/88 (78%), Positives = 81/88 (92%), Gaps = 0/88 (0%)
 Frame = +2

Query  368  VSIFKKLLVFDVSFNEITSPSGLSKVSSTLKELYVSNNQIAKIEEIEHFHELQILELGSN  547
             SIFK LLVFDVSFNEI+S +GLSKVSST+KE+YVS N++AK+EE++HFH L++LELGSN
Sbjct  116  ASIFKGLLVFDVSFNEISSLNGLSKVSSTVKEIYVSKNEVAKMEELDHFHALELLELGSN  175

Query  548  KLRVMenlqtltnlxelwlGRNRIRAIN  631
            +LRVMENLQTLTNL ELWLGRNRIR IN
Sbjct  176  RLRVMENLQTLTNLQELWLGRNRIRTIN  203


 Score = 83.6 bits (205),  Expect(2) = 1e-41, Method: Compositional matrix adjust.
 Identities = 62/115 (54%), Positives = 76/115 (66%), Gaps = 8/115 (7%)
 Frame = +3

Query  21   PMDPSPGTSTHGHPSDSTPDNGETSSSSPTVLDLTSFQlhdldsvdlpsslseldlTANR  200
            P DP   T   G P+   P+       +   LDLTS QLHDL  V++PSSL ELDLTANR
Sbjct  8    PGDPKT-TVVGGEPTVEVPE-------ADLCLDLTSCQLHDLCEVEIPSSLEELDLTANR  59

Query  201  LSALDPRISHLSNLNKFSLRQNLITDAALEPLSSWHTISQLEELVLRDNQLKKIP  365
            L+++DPRI  L  L K S RQNL+ D A+ PLS+W  I+ L+ELVLRDN+L KIP
Sbjct  60   LASVDPRIGRLPGLRKLSFRQNLLDDDAVAPLSTWDAIAGLQELVLRDNKLTKIP  114



>ref|XP_002451818.1| hypothetical protein SORBIDRAFT_04g008200 [Sorghum bicolor]
 gb|EES04794.1| hypothetical protein SORBIDRAFT_04g008200 [Sorghum bicolor]
Length=344

 Score =   112 bits (281),  Expect(2) = 2e-41, Method: Compositional matrix adjust.
 Identities = 68/88 (77%), Positives = 79/88 (90%), Gaps = 0/88 (0%)
 Frame = +2

Query  368  VSIFKKLLVFDVSFNEITSPSGLSKVSSTLKELYVSNNQIAKIEEIEHFHELQILELGSN  547
              IFK LLVFDVSFNEI+S +G+SKVSS LKELYVS N++AK+EE+EH H L+ILELGSN
Sbjct  121  AGIFKGLLVFDVSFNEISSLTGMSKVSSKLKELYVSKNEVAKMEELEHLHALEILELGSN  180

Query  548  KLRVMenlqtltnlxelwlGRNRIRAIN  631
            +LRVMENL+TLTNL ELWLGRNRIRA+N
Sbjct  181  RLRVMENLETLTNLQELWLGRNRIRAVN  208


 Score = 83.6 bits (205),  Expect(2) = 2e-41, Method: Compositional matrix adjust.
 Identities = 54/84 (64%), Positives = 67/84 (80%), Gaps = 0/84 (0%)
 Frame = +3

Query  114  LDLTSFQlhdldsvdlpsslseldlTANRLSALDPRISHLSNLNKFSLRQNLITDAALEP  293
            LDLTS+QLHDL  V++P +L E+DLTANRLS++DPRI  L  L K S RQNL+ D A+ P
Sbjct  36   LDLTSYQLHDLSEVEIPPTLEEVDLTANRLSSVDPRIGQLPRLRKLSFRQNLLEDDAVAP  95

Query  294  LSSWHTISQLEELVLRDNQLKKIP  365
            LSSW TI+ L+ELVLRDN+L +IP
Sbjct  96   LSSWETIAGLQELVLRDNKLTRIP  119



>ref|XP_009405606.1| PREDICTED: protein phosphatase 1 regulatory subunit pprA-like 
[Musa acuminata subsp. malaccensis]
Length=348

 Score =   108 bits (271),  Expect(2) = 3e-41, Method: Compositional matrix adjust.
 Identities = 67/87 (77%), Positives = 78/87 (90%), Gaps = 0/87 (0%)
 Frame = +2

Query  368  VSIFKKLLVFDVSFNEITSPSGLSKVSSTLKELYVSNNQIAKIEEIEHFHELQILELGSN  547
            VSIFK LLVFDVSFNEI+S +GLS V++TLKELYVS N++ K+EE+EH H LQILELGSN
Sbjct  125  VSIFKNLLVFDVSFNEISSLNGLSNVANTLKELYVSKNEVNKMEELEHLHSLQILELGSN  184

Query  548  KLRVMenlqtltnlxelwlGRNRIRAI  628
            +LRVMENL+TLTNL ELWLGRNRIR +
Sbjct  185  RLRVMENLETLTNLQELWLGRNRIRMV  211


 Score = 87.4 bits (215),  Expect(2) = 3e-41, Method: Compositional matrix adjust.
 Identities = 62/121 (51%), Positives = 75/121 (62%), Gaps = 0/121 (0%)
 Frame = +3

Query  27   DPSPGTSTHGHPSDSTPDNGETSSSSPTVLDLTSFQlhdldsvdlpsslseldlTANRLS  206
            +P       G PS       E +      LDLTSFQLHDL  VD+P  L ELDLT NRLS
Sbjct  11   EPLGIGGGGGRPSAGEEQVAEEAELQGRCLDLTSFQLHDLSEVDIPDDLVELDLTTNRLS  70

Query  207  ALDPRISHLSNLNKFSLRQNLITDAALEPLSSWHTISQLEELVLRDNQLKKIPVLAYLRN  386
             LDPR+  LS L K SLRQNL  D  +EP+S W+ I+ L ELVLRDN+L+KIP ++  +N
Sbjct  71   RLDPRVGLLSQLRKLSLRQNLFDDDGVEPISRWNVIAGLHELVLRDNKLRKIPDVSIFKN  130

Query  387  F  389
             
Sbjct  131  L  131



>ref|XP_002871899.1| leucine-rich repeat family protein [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH48158.1| leucine-rich repeat family protein [Arabidopsis lyrata subsp. 
lyrata]
Length=328

 Score =   107 bits (268),  Expect(2) = 3e-41, Method: Compositional matrix adjust.
 Identities = 64/89 (72%), Positives = 73/89 (82%), Gaps = 0/89 (0%)
 Frame = +2

Query  365  GVSIFKKLLVFDVSFNEITSPSGLSKVSSTLKELYVSNNQIAKIEEIEHFHELQILELGS  544
             ++IF KLLVFD+SFNEITS  G SK SSTLKELYVS N++ KI EIEH H LQILELGS
Sbjct  104  DINIFTKLLVFDISFNEITSLEGTSKASSTLKELYVSKNEVNKIVEIEHLHNLQILELGS  163

Query  545  NKLRVMenlqtltnlxelwlGRNRIRAIN  631
            N+LRVMENL+  T L ELWLGRNRI+ +N
Sbjct  164  NRLRVMENLENFTKLEELWLGRNRIKVVN  192


 Score = 88.2 bits (217),  Expect(2) = 3e-41, Method: Compositional matrix adjust.
 Identities = 60/93 (65%), Positives = 70/93 (75%), Gaps = 0/93 (0%)
 Frame = +3

Query  87   ETSSSSPTVLDLTSFQlhdldsvdlpsslseldlTANRLSALDPRISHLSNLNKFSLRQN  266
            E    S  VLDLTS+QLH LD+V+L  +L ELDLTANRLS LD RI+ LS L K SLRQN
Sbjct  11   EEIGDSSNVLDLTSYQLHSLDTVELLPTLIELDLTANRLSGLDSRIAQLSTLKKLSLRQN  70

Query  267  LITDAALEPLSSWHTISQLEELVLRDNQLKKIP  365
            LI D+A+EPLS W  +S LE LVLRDN+L K+P
Sbjct  71   LIDDSAVEPLSHWDALSDLEVLVLRDNKLAKVP  103



>ref|XP_004951389.1| PREDICTED: protein phosphatase 1 regulatory subunit pprA-like 
[Setaria italica]
Length=343

 Score =   114 bits (285),  Expect(2) = 3e-41, Method: Compositional matrix adjust.
 Identities = 69/88 (78%), Positives = 78/88 (89%), Gaps = 0/88 (0%)
 Frame = +2

Query  368  VSIFKKLLVFDVSFNEITSPSGLSKVSSTLKELYVSNNQIAKIEEIEHFHELQILELGSN  547
             SIFK LL+FDVSFNEI+S +GLSKVSSTLKELYVS N++ K+EE+EHFH L+ILELGSN
Sbjct  120  ASIFKGLLIFDVSFNEISSLTGLSKVSSTLKELYVSKNEVPKMEELEHFHALEILELGSN  179

Query  548  KLRVMenlqtltnlxelwlGRNRIRAIN  631
             LRVMENL TLTNL ELWLGRNRIR +N
Sbjct  180  GLRVMENLGTLTNLQELWLGRNRIRTVN  207


 Score = 81.6 bits (200),  Expect(2) = 3e-41, Method: Compositional matrix adjust.
 Identities = 52/85 (61%), Positives = 67/85 (79%), Gaps = 0/85 (0%)
 Frame = +3

Query  111  VLDLTSFQlhdldsvdlpsslseldlTANRLSALDPRISHLSNLNKFSLRQNLITDAALE  290
             LDLTS+QLHDL  V++P +L E+DLTANRL+++DPRI  L+ L K S RQNL+ D A+ 
Sbjct  34   CLDLTSYQLHDLSEVEIPPTLEEVDLTANRLTSVDPRIGRLAGLRKISFRQNLLDDDAVA  93

Query  291  PLSSWHTISQLEELVLRDNQLKKIP  365
            PLSSW  I+ L+ELVLRDN+L +IP
Sbjct  94   PLSSWDAIAGLQELVLRDNKLTRIP  118



>ref|XP_009102238.1| PREDICTED: protein phosphatase 1 regulatory subunit pprA-like 
[Brassica rapa]
Length=309

 Score =   111 bits (277),  Expect(2) = 9e-41, Method: Compositional matrix adjust.
 Identities = 65/92 (71%), Positives = 77/92 (84%), Gaps = 0/92 (0%)
 Frame = +2

Query  356  ENSGVSIFKKLLVFDVSFNEITSPSGLSKVSSTLKELYVSNNQIAKIEEIEHFHELQILE  535
            E   +SIF +LLVFDVSFNEITS  GLSK SSTLKELYVS N++ KI EIE+ H+LQILE
Sbjct  107  EVPDISIFSRLLVFDVSFNEITSLEGLSKASSTLKELYVSKNEVYKIMEIEYLHDLQILE  166

Query  536  LGSNKLRVMenlqtltnlxelwlGRNRIRAIN  631
            LGSN+LRVM N+++LT L ELWLGRNRI+ +N
Sbjct  167  LGSNRLRVMVNMESLTKLEELWLGRNRIKVVN  198


 Score = 83.2 bits (204),  Expect(2) = 9e-41, Method: Compositional matrix adjust.
 Identities = 39/59 (66%), Positives = 47/59 (80%), Gaps = 0/59 (0%)
 Frame = +3

Query  189  TANRLSALDPRISHLSNLNKFSLRQNLITDAALEPLSSWHTISQLEELVLRDNQLKKIP  365
            T NRLS LD RI+HLS L K SLRQNLI D+A+EPLS W  +S LEEL+LRDN+L ++P
Sbjct  51   TVNRLSELDSRIAHLSMLKKLSLRQNLIEDSAVEPLSRWDALSDLEELILRDNKLAEVP  109



>ref|XP_009125770.1| PREDICTED: protein phosphatase 1 regulatory subunit pprA-like 
[Brassica rapa]
Length=280

 Score =   112 bits (280),  Expect(2) = 1e-40, Method: Compositional matrix adjust.
 Identities = 65/92 (71%), Positives = 77/92 (84%), Gaps = 0/92 (0%)
 Frame = +2

Query  356  ENSGVSIFKKLLVFDVSFNEITSPSGLSKVSSTLKELYVSNNQIAKIEEIEHFHELQILE  535
            E   +SIF +LLVFDVSFNEITS  GLSK SSTLKELYVS N++ KI EIE+ H+LQILE
Sbjct  107  EVPDISIFSRLLVFDVSFNEITSCEGLSKASSTLKELYVSKNEVYKIMEIEYLHDLQILE  166

Query  536  LGSNKLRVMenlqtltnlxelwlGRNRIRAIN  631
            LGSN+LRVM N+++LT L ELWLGRNRI+ +N
Sbjct  167  LGSNRLRVMVNMESLTKLEELWLGRNRIKVVN  198


 Score = 82.0 bits (201),  Expect(2) = 1e-40, Method: Compositional matrix adjust.
 Identities = 38/59 (64%), Positives = 47/59 (80%), Gaps = 0/59 (0%)
 Frame = +3

Query  189  TANRLSALDPRISHLSNLNKFSLRQNLITDAALEPLSSWHTISQLEELVLRDNQLKKIP  365
            T NRLS LD RI+HLS L K SLRQNLI D+A+EPLS W  +S LE+L+LRDN+L ++P
Sbjct  51   TVNRLSELDSRIAHLSMLKKLSLRQNLIEDSAVEPLSRWDALSDLEKLILRDNKLAEVP  109



>emb|CDY47338.1| BnaCnng14750D [Brassica napus]
Length=394

 Score =   110 bits (276),  Expect(2) = 1e-40, Method: Compositional matrix adjust.
 Identities = 65/92 (71%), Positives = 76/92 (83%), Gaps = 0/92 (0%)
 Frame = +2

Query  356  ENSGVSIFKKLLVFDVSFNEITSPSGLSKVSSTLKELYVSNNQIAKIEEIEHFHELQILE  535
            E   +SIF +LLVFDVSFNEITS  GLSK SSTLKELYVS N++ KI EIEH H+LQILE
Sbjct  100  EVPDISIFSRLLVFDVSFNEITSLEGLSKASSTLKELYVSKNEVNKIMEIEHLHDLQILE  159

Query  536  LGSNKLRVMenlqtltnlxelwlGRNRIRAIN  631
            LGSN+L VM N+++LT L ELWLGRNRI+ +N
Sbjct  160  LGSNRLWVMVNMESLTKLEELWLGRNRIKVVN  191


 Score = 83.2 bits (204),  Expect(2) = 1e-40, Method: Compositional matrix adjust.
 Identities = 39/59 (66%), Positives = 47/59 (80%), Gaps = 0/59 (0%)
 Frame = +3

Query  189  TANRLSALDPRISHLSNLNKFSLRQNLITDAALEPLSSWHTISQLEELVLRDNQLKKIP  365
            T NRLS LD RI+HLS L K SLRQNLI D+A+EPLS W  +S LEEL+LRDN+L ++P
Sbjct  44   TVNRLSELDSRIAHLSMLKKLSLRQNLIEDSAVEPLSRWDALSDLEELILRDNKLAEVP  102



>emb|CDX89753.1| BnaC03g46670D [Brassica napus]
Length=394

 Score =   110 bits (276),  Expect(2) = 1e-40, Method: Compositional matrix adjust.
 Identities = 65/92 (71%), Positives = 76/92 (83%), Gaps = 0/92 (0%)
 Frame = +2

Query  356  ENSGVSIFKKLLVFDVSFNEITSPSGLSKVSSTLKELYVSNNQIAKIEEIEHFHELQILE  535
            E   +SIF +LLVFDVSFNEITS  GLSK SSTLKELYVS N++ KI EIEH H+LQILE
Sbjct  100  EVPDISIFSRLLVFDVSFNEITSLEGLSKASSTLKELYVSKNEVNKIMEIEHLHDLQILE  159

Query  536  LGSNKLRVMenlqtltnlxelwlGRNRIRAIN  631
            LGSN+L VM N+++LT L ELWLGRNRI+ +N
Sbjct  160  LGSNRLWVMVNMESLTKLEELWLGRNRIKVVN  191


 Score = 82.8 bits (203),  Expect(2) = 1e-40, Method: Compositional matrix adjust.
 Identities = 39/59 (66%), Positives = 47/59 (80%), Gaps = 0/59 (0%)
 Frame = +3

Query  189  TANRLSALDPRISHLSNLNKFSLRQNLITDAALEPLSSWHTISQLEELVLRDNQLKKIP  365
            T NRLS LD RI+HLS L K SLRQNLI D+A+EPLS W  +S LEEL+LRDN+L ++P
Sbjct  44   TVNRLSELDSRIAHLSMLKKLSLRQNLIEDSAVEPLSRWDALSDLEELILRDNKLAEVP  102



>gb|AIE39577.1| protein phosphatase 1 regulatory subunit, partial [Humulus lupulus]
Length=138

 Score =   102 bits (253),  Expect(2) = 1e-40, Method: Compositional matrix adjust.
 Identities = 50/64 (78%), Positives = 57/64 (89%), Gaps = 0/64 (0%)
 Frame = +2

Query  365  GVSIFKKLLVFDVSFNEITSPSGLSKVSSTLKELYVSNNQIAKIEEIEHFHELQILELGS  544
             VSIFK LL+FDVSFNEIT+  GLSKVS+TLKELYVS N++ KIEEI+H HELQILELGS
Sbjct  75   DVSIFKSLLIFDVSFNEITTLHGLSKVSNTLKELYVSKNEVLKIEEIDHLHELQILELGS  134

Query  545  NKLR  556
            N+LR
Sbjct  135  NRLR  138


 Score = 91.7 bits (226),  Expect(2) = 1e-40, Method: Compositional matrix adjust.
 Identities = 42/67 (63%), Positives = 56/67 (84%), Gaps = 0/67 (0%)
 Frame = +3

Query  189  TANRLSALDPRISHLSNLNKFSLRQNLITDAALEPLSSWHTISQLEELVLRDNQLKKIPV  368
            TANRLS+LDPRI++LSNL K SLRQNLI DAA+EP+SSWH +S +E+L+ RDN+L KIP 
Sbjct  16   TANRLSSLDPRIANLSNLKKLSLRQNLIEDAAVEPISSWHALSDIEDLIFRDNKLTKIPD  75

Query  369  LAYLRNF  389
            ++  ++ 
Sbjct  76   VSIFKSL  82



>ref|XP_008791657.1| PREDICTED: protein phosphatase 1 regulatory subunit pprA-like 
isoform X1 [Phoenix dactylifera]
Length=329

 Score =   107 bits (266),  Expect(2) = 3e-40, Method: Compositional matrix adjust.
 Identities = 66/88 (75%), Positives = 78/88 (89%), Gaps = 0/88 (0%)
 Frame = +2

Query  368  VSIFKKLLVFDVSFNEITSPSGLSKVSSTLKELYVSNNQIAKIEEIEHFHELQILELGSN  547
            VSIFK LLVFDVSFNEI+S +GLSK+S+TL+ELYVS N++ K+EE+EH   L+ILELGSN
Sbjct  106  VSIFKTLLVFDVSFNEISSLNGLSKISNTLEELYVSKNEVTKMEELEHLDALRILELGSN  165

Query  548  KLRVMenlqtltnlxelwlGRNRIRAIN  631
            +LRVMENLQTL NL ELWLGRNRIR +N
Sbjct  166  RLRVMENLQTLKNLQELWLGRNRIRMVN  193


 Score = 85.9 bits (211),  Expect(2) = 3e-40, Method: Compositional matrix adjust.
 Identities = 59/97 (61%), Positives = 73/97 (75%), Gaps = 0/97 (0%)
 Frame = +3

Query  99   SSPTVLDLTSFQlhdldsvdlpsslseldlTANRLSALDPRISHLSNLNKFSLRQNLITD  278
            S  + LDLTSFQLHDL  VD+P SL ELDLTANRL+ LDPRI  LS+L K SLRQNL+ D
Sbjct  16   SELSCLDLTSFQLHDLGEVDIPESLVELDLTANRLTKLDPRIGLLSHLRKLSLRQNLMDD  75

Query  279  AALEPLSSWHTISQLEELVLRDNQLKKIPVLAYLRNF  389
              + P+S W+TIS L ELVLRDN+L++IP ++  +  
Sbjct  76   EGVAPISQWNTISGLRELVLRDNKLREIPDVSIFKTL  112



>ref|XP_008791675.1| PREDICTED: protein phosphatase 1 regulatory subunit pprA-like 
isoform X2 [Phoenix dactylifera]
Length=267

 Score =   107 bits (266),  Expect(2) = 3e-40, Method: Compositional matrix adjust.
 Identities = 66/88 (75%), Positives = 78/88 (89%), Gaps = 0/88 (0%)
 Frame = +2

Query  368  VSIFKKLLVFDVSFNEITSPSGLSKVSSTLKELYVSNNQIAKIEEIEHFHELQILELGSN  547
            VSIFK LLVFDVSFNEI+S +GLSK+S+TL+ELYVS N++ K+EE+EH   L+ILELGSN
Sbjct  106  VSIFKTLLVFDVSFNEISSLNGLSKISNTLEELYVSKNEVTKMEELEHLDALRILELGSN  165

Query  548  KLRVMenlqtltnlxelwlGRNRIRAIN  631
            +LRVMENLQTL NL ELWLGRNRIR +N
Sbjct  166  RLRVMENLQTLKNLQELWLGRNRIRMVN  193


 Score = 85.5 bits (210),  Expect(2) = 3e-40, Method: Compositional matrix adjust.
 Identities = 59/89 (66%), Positives = 70/89 (79%), Gaps = 0/89 (0%)
 Frame = +3

Query  99   SSPTVLDLTSFQlhdldsvdlpsslseldlTANRLSALDPRISHLSNLNKFSLRQNLITD  278
            S  + LDLTSFQLHDL  VD+P SL ELDLTANRL+ LDPRI  LS+L K SLRQNL+ D
Sbjct  16   SELSCLDLTSFQLHDLGEVDIPESLVELDLTANRLTKLDPRIGLLSHLRKLSLRQNLMDD  75

Query  279  AALEPLSSWHTISQLEELVLRDNQLKKIP  365
              + P+S W+TIS L ELVLRDN+L++IP
Sbjct  76   EGVAPISQWNTISGLRELVLRDNKLREIP  104



>emb|CDY42421.1| BnaC02g22870D [Brassica napus]
Length=394

 Score =   109 bits (272),  Expect(2) = 3e-40, Method: Compositional matrix adjust.
 Identities = 64/92 (70%), Positives = 76/92 (83%), Gaps = 0/92 (0%)
 Frame = +2

Query  356  ENSGVSIFKKLLVFDVSFNEITSPSGLSKVSSTLKELYVSNNQIAKIEEIEHFHELQILE  535
            E   +SIF ++LVFDVSFNEITS  GLSK SSTLKELYVS N++ KI EIEH H+LQILE
Sbjct  100  EVPDISIFSRVLVFDVSFNEITSLEGLSKASSTLKELYVSKNEVNKIMEIEHLHDLQILE  159

Query  536  LGSNKLRVMenlqtltnlxelwlGRNRIRAIN  631
            LGSN+L VM N+++LT L ELWLGRNRI+ +N
Sbjct  160  LGSNRLSVMVNMESLTKLEELWLGRNRIKVVN  191


 Score = 83.2 bits (204),  Expect(2) = 3e-40, Method: Compositional matrix adjust.
 Identities = 39/59 (66%), Positives = 47/59 (80%), Gaps = 0/59 (0%)
 Frame = +3

Query  189  TANRLSALDPRISHLSNLNKFSLRQNLITDAALEPLSSWHTISQLEELVLRDNQLKKIP  365
            T NRLS LD RI+HLS L K SLRQNLI D+A+EPLS W  +S LEEL+LRDN+L ++P
Sbjct  44   TVNRLSELDSRIAHLSMLKKLSLRQNLIEDSAVEPLSRWDALSDLEELILRDNKLAEVP  102



>ref|XP_002283839.1| PREDICTED: protein phosphatase 1 regulatory subunit pprA [Vitis 
vinifera]
 emb|CBI28014.3| unnamed protein product [Vitis vinifera]
Length=333

 Score =   119 bits (298),  Expect(2) = 4e-40, Method: Compositional matrix adjust.
 Identities = 71/88 (81%), Positives = 81/88 (92%), Gaps = 0/88 (0%)
 Frame = +2

Query  368  VSIFKKLLVFDVSFNEITSPSGLSKVSSTLKELYVSNNQIAKIEEIEHFHELQILELGSN  547
            VSIFKKLLVFDVSFNEI+S +GL+KVS+TLKELYVS N++  +EEI+HFHELQILELGSN
Sbjct  109  VSIFKKLLVFDVSFNEISSLNGLAKVSNTLKELYVSKNEVTTMEEIDHFHELQILELGSN  168

Query  548  KLRVMenlqtltnlxelwlGRNRIRAIN  631
            +LRVMENLQTLT L ELWLGRNRIR +N
Sbjct  169  RLRVMENLQTLTKLKELWLGRNRIRVVN  196


 Score = 73.2 bits (178),  Expect(2) = 4e-40, Method: Compositional matrix adjust.
 Identities = 59/96 (61%), Positives = 74/96 (77%), Gaps = 0/96 (0%)
 Frame = +3

Query  102  SPTVLDLTSFQlhdldsvdlpsslseldlTANRLSALDPRISHLSNLNKFSLRQNLITDA  281
            S TVLDLTS+QLH L+S+D+P +L+ELDLTANRL+ LD RI  LSNL K SLRQNL+ DA
Sbjct  20   SSTVLDLTSYQLHSLESIDIPFNLTELDLTANRLTVLDSRIGLLSNLKKLSLRQNLLDDA  79

Query  282  ALEPLSSWHTISQLEELVLRDNQLKKIPVLAYLRNF  389
             ++ +S W  IS LEELVLRDN+L KIP ++  +  
Sbjct  80   GVDMISGWDAISGLEELVLRDNKLTKIPDVSIFKKL  115



>emb|CDX87941.1| BnaC03g54550D [Brassica napus]
Length=394

 Score =   110 bits (276),  Expect(2) = 4e-40, Method: Compositional matrix adjust.
 Identities = 65/92 (71%), Positives = 76/92 (83%), Gaps = 0/92 (0%)
 Frame = +2

Query  356  ENSGVSIFKKLLVFDVSFNEITSPSGLSKVSSTLKELYVSNNQIAKIEEIEHFHELQILE  535
            E   +SIF +LLVFDVSFNEITS  GLSK SSTLKELYVS N++ KI EIEH H+LQILE
Sbjct  100  EVPDISIFSRLLVFDVSFNEITSLEGLSKASSTLKELYVSKNEVNKIMEIEHLHDLQILE  159

Query  536  LGSNKLRVMenlqtltnlxelwlGRNRIRAIN  631
            LGSN+L VM N+++LT L ELWLGRNRI+ +N
Sbjct  160  LGSNRLWVMVNMESLTKLEELWLGRNRIKVVN  191


 Score = 81.3 bits (199),  Expect(2) = 4e-40, Method: Compositional matrix adjust.
 Identities = 38/58 (66%), Positives = 46/58 (79%), Gaps = 0/58 (0%)
 Frame = +3

Query  192  ANRLSALDPRISHLSNLNKFSLRQNLITDAALEPLSSWHTISQLEELVLRDNQLKKIP  365
             NRLS LD RI+HLS L K SLRQNLI D+A+EPLS W  +S LEEL+LRDN+L ++P
Sbjct  45   VNRLSELDSRIAHLSMLKKLSLRQNLIEDSAVEPLSRWDALSDLEELILRDNKLAEVP  102



>emb|CAN64835.1| hypothetical protein VITISV_020599 [Vitis vinifera]
Length=324

 Score =   119 bits (297),  Expect(2) = 4e-40, Method: Compositional matrix adjust.
 Identities = 71/88 (81%), Positives = 81/88 (92%), Gaps = 0/88 (0%)
 Frame = +2

Query  368  VSIFKKLLVFDVSFNEITSPSGLSKVSSTLKELYVSNNQIAKIEEIEHFHELQILELGSN  547
            VSIFKKLLVFDVSFNEI+S +GL+KVS+TLKELYVS N++  +EEI+HFHELQILELGSN
Sbjct  100  VSIFKKLLVFDVSFNEISSLNGLAKVSNTLKELYVSKNEVTTMEEIDHFHELQILELGSN  159

Query  548  KLRVMenlqtltnlxelwlGRNRIRAIN  631
            +LRVMENLQTLT L ELWLGRNRIR +N
Sbjct  160  RLRVMENLQTLTKLKELWLGRNRIRVVN  187


 Score = 72.8 bits (177),  Expect(2) = 4e-40, Method: Compositional matrix adjust.
 Identities = 59/96 (61%), Positives = 74/96 (77%), Gaps = 0/96 (0%)
 Frame = +3

Query  102  SPTVLDLTSFQlhdldsvdlpsslseldlTANRLSALDPRISHLSNLNKFSLRQNLITDA  281
            S TVLDLTS+QLH L+S+D+P +L+ELDLTANRL+ LD RI  LSNL K SLRQNL+ DA
Sbjct  11   SSTVLDLTSYQLHSLESIDIPFNLTELDLTANRLTVLDSRIGLLSNLKKLSLRQNLLDDA  70

Query  282  ALEPLSSWHTISQLEELVLRDNQLKKIPVLAYLRNF  389
             ++ +S W  IS LEELVLRDN+L KIP ++  +  
Sbjct  71   GVDMISGWDAISGLEELVLRDNKLTKIPDVSIFKKL  106



>ref|XP_006647096.1| PREDICTED: protein phosphatase 1 regulatory subunit pprA-like 
[Oryza brachyantha]
Length=334

 Score =   114 bits (285),  Expect(2) = 6e-40, Method: Compositional matrix adjust.
 Identities = 69/88 (78%), Positives = 78/88 (89%), Gaps = 0/88 (0%)
 Frame = +2

Query  368  VSIFKKLLVFDVSFNEITSPSGLSKVSSTLKELYVSNNQIAKIEEIEHFHELQILELGSN  547
             SIFK L+VFDVSFNEI+S  GLSKVSSTLKELYVS N++AK+EE+EHFH L ILELGSN
Sbjct  111  ASIFKGLVVFDVSFNEISSLKGLSKVSSTLKELYVSKNEVAKMEELEHFHALDILELGSN  170

Query  548  KLRVMenlqtltnlxelwlGRNRIRAIN  631
            +LRVMENL+TL NL ELWLGRNRI+ IN
Sbjct  171  RLRVMENLETLANLQELWLGRNRIKTIN  198


 Score = 77.0 bits (188),  Expect(2) = 6e-40, Method: Compositional matrix adjust.
 Identities = 53/85 (62%), Positives = 64/85 (75%), Gaps = 0/85 (0%)
 Frame = +3

Query  111  VLDLTSFQlhdldsvdlpsslseldlTANRLSALDPRISHLSNLNKFSLRQNLITDAALE  290
             LDLTS QLHDL  V++P +L ELDLTANRL+A+DPRI  L  L K S RQNL+ DAA+ 
Sbjct  25   CLDLTSCQLHDLSEVEIPPTLEELDLTANRLAAVDPRIGRLPALRKLSFRQNLLDDAAVA  84

Query  291  PLSSWHTISQLEELVLRDNQLKKIP  365
            PLS+W  I+ L+ELV RDN+L  IP
Sbjct  85   PLSTWAGIAGLQELVFRDNKLTTIP  109



>ref|XP_006853636.1| hypothetical protein AMTR_s00056p00073840 [Amborella trichopoda]
 gb|ERN15103.1| hypothetical protein AMTR_s00056p00073840 [Amborella trichopoda]
Length=347

 Score =   102 bits (253),  Expect(2) = 6e-40, Method: Compositional matrix adjust.
 Identities = 63/87 (72%), Positives = 75/87 (86%), Gaps = 0/87 (0%)
 Frame = +2

Query  368  VSIFKKLLVFDVSFNEITSPSGLSKVSSTLKELYVSNNQIAKIEEIEHFHELQILELGSN  547
            VSIF+ LLVFD SFNEI+S  G+SKVSS L+ELYVS N++ K+ E++H HEL+ILELGSN
Sbjct  124  VSIFRNLLVFDASFNEISSLEGVSKVSSMLQELYVSKNEVTKMVELDHLHELRILELGSN  183

Query  548  KLRVMenlqtltnlxelwlGRNRIRAI  628
            +LRVMENLQ LTNL ELWLGRNRIR +
Sbjct  184  RLRVMENLQNLTNLQELWLGRNRIREV  210


 Score = 89.7 bits (221),  Expect(2) = 6e-40, Method: Compositional matrix adjust.
 Identities = 67/121 (55%), Positives = 79/121 (65%), Gaps = 7/121 (6%)
 Frame = +3

Query  48   THGHPSDSTPDNG-------ETSSSSPTVLDLTSFQlhdldsvdlpsslseldlTANRLS  206
            ++G  ++   +NG       E S  S   LDLTSFQLHDL  V+LPSSL ELDLTANRLS
Sbjct  10   SNGAKAEEVLNNGAKTEEAPEDSIDSANYLDLTSFQLHDLQGVELPSSLVELDLTANRLS  69

Query  207  ALDPRISHLSNLNKFSLRQNLITDAALEPLSSWHTISQLEELVLRDNQLKKIPVLAYLRN  386
            +LDPRI  L  L K  LRQNL +D  +EPL  W  IS L ELVLRDN+L KIP ++  RN
Sbjct  70   SLDPRIGQLRQLKKLFLRQNLFSDEGVEPLCHWTAISGLLELVLRDNKLTKIPDVSIFRN  129

Query  387  F  389
             
Sbjct  130  L  130



>emb|CDY44436.1| BnaC07g24740D [Brassica napus]
Length=297

 Score =   110 bits (275),  Expect(2) = 7e-40, Method: Compositional matrix adjust.
 Identities = 65/92 (71%), Positives = 76/92 (83%), Gaps = 0/92 (0%)
 Frame = +2

Query  356  ENSGVSIFKKLLVFDVSFNEITSPSGLSKVSSTLKELYVSNNQIAKIEEIEHFHELQILE  535
            E   +SIF +LLVFDVSFNEITS  GLSK SSTLKELYVS N++ KI EIEH H+LQILE
Sbjct  100  EVPDISIFSRLLVFDVSFNEITSLEGLSKASSTLKELYVSKNEVNKIMEIEHLHDLQILE  159

Query  536  LGSNKLRVMenlqtltnlxelwlGRNRIRAIN  631
            LGSN+L VM N+++LT L ELWLGRNRI+ +N
Sbjct  160  LGSNRLWVMVNMESLTKLEELWLGRNRIKVVN  191


 Score = 80.9 bits (198),  Expect(2) = 7e-40, Method: Compositional matrix adjust.
 Identities = 38/59 (64%), Positives = 46/59 (78%), Gaps = 0/59 (0%)
 Frame = +3

Query  189  TANRLSALDPRISHLSNLNKFSLRQNLITDAALEPLSSWHTISQLEELVLRDNQLKKIP  365
            T NRLS LD RI+HLS L K SLRQ LI D+A+EPLS W  +S LEEL+LRDN+L ++P
Sbjct  44   TVNRLSELDSRIAHLSMLKKLSLRQTLIEDSAVEPLSRWDALSDLEELILRDNKLAEVP  102



>ref|NP_001136450.1| uncharacterized protein LOC100216558 [Zea mays]
 gb|ACF81958.1| unknown [Zea mays]
 gb|AFW65997.1| hypothetical protein ZEAMMB73_087922 [Zea mays]
Length=352

 Score =   113 bits (283),  Expect(2) = 7e-40, Method: Compositional matrix adjust.
 Identities = 69/88 (78%), Positives = 79/88 (90%), Gaps = 0/88 (0%)
 Frame = +2

Query  368  VSIFKKLLVFDVSFNEITSPSGLSKVSSTLKELYVSNNQIAKIEEIEHFHELQILELGSN  547
              IFK LLVFDVSFNEI+S +GLSKVS  LKELYVS N++AK+EE+EHFH L+ILELGSN
Sbjct  129  AGIFKDLLVFDVSFNEISSLTGLSKVSIKLKELYVSKNEVAKMEELEHFHALEILELGSN  188

Query  548  KLRVMenlqtltnlxelwlGRNRIRAIN  631
            +LRVMENL+TLTNL ELWLGRNRIRA+N
Sbjct  189  RLRVMENLETLTNLQELWLGRNRIRAVN  216


 Score = 78.2 bits (191),  Expect(2) = 7e-40, Method: Compositional matrix adjust.
 Identities = 50/84 (60%), Positives = 66/84 (79%), Gaps = 0/84 (0%)
 Frame = +3

Query  114  LDLTSFQlhdldsvdlpsslseldlTANRLSALDPRISHLSNLNKFSLRQNLITDAALEP  293
            LDLTS+QLHDL  V++P +L E+DLTANRLS++DPRI  L +L K S RQNL+ D A+ P
Sbjct  44   LDLTSYQLHDLSEVEIPPTLEEVDLTANRLSSVDPRIGQLPHLRKLSFRQNLLDDDAVAP  103

Query  294  LSSWHTISQLEELVLRDNQLKKIP  365
            L+SW  I+ L+E V+RDN+L +IP
Sbjct  104  LTSWEAIAGLKEFVIRDNKLTRIP  127



>ref|XP_008794123.1| PREDICTED: protein phosphatase 1 regulatory subunit pprA-like 
[Phoenix dactylifera]
 ref|XP_008794124.1| PREDICTED: protein phosphatase 1 regulatory subunit pprA-like 
[Phoenix dactylifera]
Length=330

 Score =   109 bits (272),  Expect(2) = 1e-38, Method: Compositional matrix adjust.
 Identities = 68/88 (77%), Positives = 79/88 (90%), Gaps = 0/88 (0%)
 Frame = +2

Query  368  VSIFKKLLVFDVSFNEITSPSGLSKVSSTLKELYVSNNQIAKIEEIEHFHELQILELGSN  547
            VSIFK LLVFDVSFNEI+S +GLSKVS+TL+ELYVS N++ K+EE+EH H L+ILELGSN
Sbjct  107  VSIFKNLLVFDVSFNEISSLNGLSKVSNTLEELYVSKNEVTKMEELEHLHALRILELGSN  166

Query  548  KLRVMenlqtltnlxelwlGRNRIRAIN  631
             LR+MENLQTLTNL ELWLGRNRIR +N
Sbjct  167  NLRIMENLQTLTNLQELWLGRNRIRMVN  194


 Score = 77.8 bits (190),  Expect(2) = 1e-38, Method: Compositional matrix adjust.
 Identities = 60/98 (61%), Positives = 72/98 (73%), Gaps = 0/98 (0%)
 Frame = +3

Query  96   SSSPTVLDLTSFQlhdldsvdlpsslseldlTANRLSALDPRISHLSNLNKFSLRQNLIT  275
             S    LDLTSFQLHDL  V++P SL ELDLTANRL+ LDPRI  L +L K SLRQNL  
Sbjct  16   ESQVHCLDLTSFQLHDLGEVEIPESLEELDLTANRLTKLDPRIGLLLHLKKLSLRQNLFD  75

Query  276  DAALEPLSSWHTISQLEELVLRDNQLKKIPVLAYLRNF  389
            D  +EP+S W+TIS L ELVLRDN+L+KIP ++  +N 
Sbjct  76   DDGVEPISGWNTISGLHELVLRDNKLRKIPDVSIFKNL  113



>ref|XP_010688296.1| PREDICTED: protein phosphatase 1 regulatory subunit pprA [Beta 
vulgaris subsp. vulgaris]
Length=338

 Score =   117 bits (292),  Expect(2) = 2e-38, Method: Compositional matrix adjust.
 Identities = 71/88 (81%), Positives = 81/88 (92%), Gaps = 0/88 (0%)
 Frame = +2

Query  368  VSIFKKLLVFDVSFNEITSPSGLSKVSSTLKELYVSNNQIAKIEEIEHFHELQILELGSN  547
            VSI+K L+VFDVSFNEI+S SGLSKVS+TLKELYVS N++ KIEEIEHFH+L ILELGSN
Sbjct  115  VSIYKDLVVFDVSFNEISSLSGLSKVSNTLKELYVSKNEVTKIEEIEHFHKLLILELGSN  174

Query  548  KLRVMenlqtltnlxelwlGRNRIRAIN  631
            KLRVMENL+TL NL ELWLGRNRI+A+N
Sbjct  175  KLRVMENLETLINLQELWLGRNRIKAVN  202


 Score = 69.3 bits (168),  Expect(2) = 2e-38, Method: Compositional matrix adjust.
 Identities = 67/113 (59%), Positives = 80/113 (71%), Gaps = 2/113 (2%)
 Frame = +3

Query  57   HPSDSTPDNGETSSSSPTV--LDLTSFQlhdldsvdlpsslseldlTANRLSALDPRISH  230
            H  D      E +  S T+  LDLTS+QLHDLDSV+LP SL+ELDLTANRLS LDPRI  
Sbjct  9    HSDDLHLATNEENDDSETLISLDLTSYQLHDLDSVELPPSLTELDLTANRLSQLDPRICL  68

Query  231  LSNLNKFSLRQNLITDAALEPLSSWHTISQLEELVLRDNQLKKIPVLAYLRNF  389
            LS+L K SLRQNL  DA ++ LS  H IS LEELVLRDN+L KIP ++  ++ 
Sbjct  69   LSHLKKLSLRQNLFDDAGIQSLSHSHAISSLEELVLRDNKLMKIPDVSIYKDL  121



>ref|XP_007202248.1| hypothetical protein PRUPE_ppa008819mg [Prunus persica]
 gb|EMJ03447.1| hypothetical protein PRUPE_ppa008819mg [Prunus persica]
Length=318

 Score = 92.8 bits (229),  Expect(2) = 5e-38, Method: Compositional matrix adjust.
 Identities = 69/88 (78%), Positives = 78/88 (89%), Gaps = 0/88 (0%)
 Frame = +2

Query  368  VSIFKKLLVFDVSFNEITSPSGLSKVSSTLKELYVSNNQIAKIEEIEHFHELQILELGSN  547
            V+IF KLLVFDVSFNEITS  GLSKVSS LKELYVS N++AKIEEI+H HEL ILELGSN
Sbjct  95   VTIFIKLLVFDVSFNEITSLHGLSKVSSKLKELYVSKNEVAKIEEIDHLHELLILELGSN  154

Query  548  KLRVMenlqtltnlxelwlGRNRIRAIN  631
            +LRVMENLQ +T+L ELWLGRNRI+ +N
Sbjct  155  RLRVMENLQNMTHLQELWLGRNRIKVVN  182


 Score = 92.4 bits (228),  Expect(2) = 5e-38, Method: Compositional matrix adjust.
 Identities = 61/88 (69%), Positives = 76/88 (86%), Gaps = 0/88 (0%)
 Frame = +3

Query  102  SPTVLDLTSFQlhdldsvdlpsslseldlTANRLSALDPRISHLSNLNKFSLRQNLITDA  281
            S TVLDLTSFQLHDL+S++LP +L+ELD+TANRL++LD RI+ LS+L K SLRQNLI DA
Sbjct  6    SSTVLDLTSFQLHDLESIELPPTLTELDVTANRLTSLDTRIATLSSLKKLSLRQNLIEDA  65

Query  282  ALEPLSSWHTISQLEELVLRDNQLKKIP  365
            A+EP+S W  +S +EELVLRDN+L KIP
Sbjct  66   AVEPISRWDALSGIEELVLRDNKLTKIP  93



>gb|EMS46865.1| Protein phosphatase 1 regulatory subunit pprA [Triticum urartu]
Length=285

 Score = 95.5 bits (236),  Expect(2) = 1e-35, Method: Compositional matrix adjust.
 Identities = 45/63 (71%), Positives = 56/63 (89%), Gaps = 0/63 (0%)
 Frame = +2

Query  368  VSIFKKLLVFDVSFNEITSPSGLSKVSSTLKELYVSNNQIAKIEEIEHFHELQILELGSN  547
             SIFK LLVFDVSFNE++S +GLSKVSST+KELY S N++ K+EE+EHFH L++LELGSN
Sbjct  111  ASIFKGLLVFDVSFNELSSLNGLSKVSSTVKELYFSKNEVPKMEELEHFHALELLELGSN  170

Query  548  KLR  556
            +LR
Sbjct  171  RLR  173


 Score = 81.3 bits (199),  Expect(2) = 1e-35, Method: Compositional matrix adjust.
 Identities = 54/85 (64%), Positives = 66/85 (78%), Gaps = 0/85 (0%)
 Frame = +3

Query  111  VLDLTSFQlhdldsvdlpsslseldlTANRLSALDPRISHLSNLNKFSLRQNLITDAALE  290
             LDLTS QLHDL  V++P +L ELDLTANRL+A+DPRISHL  L K S RQNL+ D A+ 
Sbjct  25   CLDLTSCQLHDLSEVEIPPTLEELDLTANRLTAVDPRISHLPRLRKLSFRQNLLDDDAVA  84

Query  291  PLSSWHTISQLEELVLRDNQLKKIP  365
            PL +W  I+ L+E+VLRDN+L KIP
Sbjct  85   PLFTWDAIAGLQEIVLRDNKLTKIP  109



>gb|EMT13288.1| Protein phosphatase 1 regulatory subunit pprA [Aegilops tauschii]
Length=285

 Score = 95.5 bits (236),  Expect(2) = 5e-35, Method: Compositional matrix adjust.
 Identities = 45/63 (71%), Positives = 56/63 (89%), Gaps = 0/63 (0%)
 Frame = +2

Query  368  VSIFKKLLVFDVSFNEITSPSGLSKVSSTLKELYVSNNQIAKIEEIEHFHELQILELGSN  547
             SIFK LLVFDVSFNE++S +GLSKVSST+KELY S N++ K+EE+EHFH L++LELGSN
Sbjct  111  ASIFKGLLVFDVSFNELSSLNGLSKVSSTVKELYFSKNEVPKMEELEHFHALELLELGSN  170

Query  548  KLR  556
            +LR
Sbjct  171  RLR  173


 Score = 79.7 bits (195),  Expect(2) = 5e-35, Method: Compositional matrix adjust.
 Identities = 53/85 (62%), Positives = 65/85 (76%), Gaps = 0/85 (0%)
 Frame = +3

Query  111  VLDLTSFQlhdldsvdlpsslseldlTANRLSALDPRISHLSNLNKFSLRQNLITDAALE  290
             LDLTS QLHDL  V++P +L ELDLTANRL+A+DPRI HL  L K S RQNL+ D A+ 
Sbjct  25   CLDLTSCQLHDLSEVEIPPTLEELDLTANRLTAVDPRIGHLPRLRKLSFRQNLLDDDAVA  84

Query  291  PLSSWHTISQLEELVLRDNQLKKIP  365
            PL +W  I+ L+E+VLRDN+L KIP
Sbjct  85   PLFTWDAIAGLQEIVLRDNKLIKIP  109



>ref|XP_001772164.1| predicted protein [Physcomitrella patens]
 gb|EDQ62977.1| predicted protein [Physcomitrella patens]
Length=358

 Score = 94.0 bits (232),  Expect(2) = 2e-33, Method: Compositional matrix adjust.
 Identities = 54/89 (61%), Positives = 72/89 (81%), Gaps = 0/89 (0%)
 Frame = +2

Query  365  GVSIFKKLLVFDVSFNEITSPSGLSKVSSTLKELYVSNNQIAKIEEIEHFHELQILELGS  544
            G+S F +LL+ DVSFN+++S +GLS VSS+L ELY+SNN+I KI E+EH   L++LELGS
Sbjct  133  GLSTFVELLLLDVSFNKVSSMNGLSDVSSSLTELYLSNNEIEKIVEMEHLTNLRVLELGS  192

Query  545  NKLRVMenlqtltnlxelwlGRNRIRAIN  631
            NK+RVME L  L  L +LWLGRNRI+++N
Sbjct  193  NKIRVMERLDQLKELQQLWLGRNRIQSVN  221


 Score = 75.5 bits (184),  Expect(2) = 2e-33, Method: Compositional matrix adjust.
 Identities = 56/93 (60%), Positives = 71/93 (76%), Gaps = 0/93 (0%)
 Frame = +3

Query  96   SSSPTVLDLTSFQlhdldsvdlpsslseldlTANRLSALDPRISHLSNLNKFSLRQNLIT  275
            +    +LDLTSFQLHDL  VDLPS L ELDLTANRL+++DPRIS+LS+L K S  QNL+ 
Sbjct  43   AKEEKILDLTSFQLHDLTDVDLPSFLEELDLTANRLTSIDPRISNLSHLQKLSFEQNLLA  102

Query  276  DAALEPLSSWHTISQLEELVLRDNQLKKIPVLA  374
            D+AL   + + T+  L+ELVLRDN+L KIP L+
Sbjct  103  DSALTEFNQFTTLKGLKELVLRDNKLLKIPGLS  135



>emb|CDY17937.1| BnaC04g02820D [Brassica napus]
Length=335

 Score =   110 bits (276),  Expect(2) = 2e-32, Method: Compositional matrix adjust.
 Identities = 65/92 (71%), Positives = 76/92 (83%), Gaps = 0/92 (0%)
 Frame = +2

Query  356  ENSGVSIFKKLLVFDVSFNEITSPSGLSKVSSTLKELYVSNNQIAKIEEIEHFHELQILE  535
            E   +SIF +LLVFDVSFNEITS  GLSK SSTLKELYVS N++ KI EIEH H+LQILE
Sbjct  41   EVPDISIFSRLLVFDVSFNEITSLEGLSKASSTLKELYVSKNEVNKIMEIEHLHDLQILE  100

Query  536  LGSNKLRVMenlqtltnlxelwlGRNRIRAIN  631
            LGSN+L VM N+++LT L ELWLGRNRI+ +N
Sbjct  101  LGSNRLWVMVNMESLTKLEELWLGRNRIKVVN  132


 Score = 55.5 bits (132),  Expect(2) = 2e-32, Method: Compositional matrix adjust.
 Identities = 25/42 (60%), Positives = 32/42 (76%), Gaps = 0/42 (0%)
 Frame = +3

Query  240  LNKFSLRQNLITDAALEPLSSWHTISQLEELVLRDNQLKKIP  365
            L K SLRQ LI  +A+EPLS W  +S LEEL+LRDN+L ++P
Sbjct  2    LKKLSLRQTLIEASAVEPLSRWDALSDLEELILRDNKLAEVP  43



>ref|XP_002987569.1| hypothetical protein SELMODRAFT_183219 [Selaginella moellendorffii]
 gb|EFJ11405.1| hypothetical protein SELMODRAFT_183219 [Selaginella moellendorffii]
Length=317

 Score = 91.3 bits (225),  Expect(2) = 1e-31, Method: Compositional matrix adjust.
 Identities = 50/88 (57%), Positives = 70/88 (80%), Gaps = 0/88 (0%)
 Frame = +2

Query  368  VSIFKKLLVFDVSFNEITSPSGLSKVSSTLKELYVSNNQIAKIEEIEHFHELQILELGSN  547
            V    +L+VFDVSFNE+TS  G++KV S L+ELY+S N+I K+E++EH  EL++LELGSN
Sbjct  95   VGGLSELVVFDVSFNELTSLDGMNKVCSKLRELYLSKNEIVKMEQLEHMQELRLLELGSN  154

Query  548  KLRVMenlqtltnlxelwlGRNRIRAIN  631
            ++RV+E ++ +  L ELWLGRNRIR +N
Sbjct  155  RIRVLEGIENMKRLEELWLGRNRIRTVN  182


 Score = 72.4 bits (176),  Expect(2) = 1e-31, Method: Compositional matrix adjust.
 Identities = 53/86 (62%), Positives = 64/86 (74%), Gaps = 0/86 (0%)
 Frame = +3

Query  108  TVLDLTSFQlhdldsvdlpsslseldlTANRLSALDPRISHLSNLNKFSLRQNLITDAAL  287
             VLDLTS QLHDL  V+LP  L ELDLTANRLS LD R+ HLS L K SLRQNL+ D A+
Sbjct  8    AVLDLTSSQLHDLSDVNLPPGLVELDLTANRLSFLDQRMQHLSRLKKLSLRQNLLADDAV  67

Query  288  EPLSSWHTISQLEELVLRDNQLKKIP  365
            + L  W ++  L+ELVLRDN+L ++P
Sbjct  68   QALGEWPSLFGLQELVLRDNKLTRLP  93



>ref|XP_002992834.1| hypothetical protein SELMODRAFT_187027 [Selaginella moellendorffii]
 gb|EFJ06124.1| hypothetical protein SELMODRAFT_187027 [Selaginella moellendorffii]
Length=317

 Score = 91.3 bits (225),  Expect(2) = 1e-31, Method: Compositional matrix adjust.
 Identities = 50/88 (57%), Positives = 70/88 (80%), Gaps = 0/88 (0%)
 Frame = +2

Query  368  VSIFKKLLVFDVSFNEITSPSGLSKVSSTLKELYVSNNQIAKIEEIEHFHELQILELGSN  547
            V    +L+VFDVSFNE+TS  G++KV S L+ELY+S N+I K+E++EH  EL++LELGSN
Sbjct  95   VGGLSELVVFDVSFNELTSLDGMNKVCSKLRELYLSKNEIVKMEQLEHMQELRLLELGSN  154

Query  548  KLRVMenlqtltnlxelwlGRNRIRAIN  631
            ++RV+E ++ +  L ELWLGRNRIR +N
Sbjct  155  RIRVLEGIENMKRLEELWLGRNRIRTVN  182


 Score = 72.4 bits (176),  Expect(2) = 1e-31, Method: Compositional matrix adjust.
 Identities = 53/86 (62%), Positives = 64/86 (74%), Gaps = 0/86 (0%)
 Frame = +3

Query  108  TVLDLTSFQlhdldsvdlpsslseldlTANRLSALDPRISHLSNLNKFSLRQNLITDAAL  287
             VLDLTS QLHDL  V+LP  L ELDLTANRLS LD R+ HLS L K SLRQNL+ D A+
Sbjct  8    AVLDLTSSQLHDLSDVNLPPGLVELDLTANRLSFLDQRMQHLSRLKKLSLRQNLLADDAV  67

Query  288  EPLSSWHTISQLEELVLRDNQLKKIP  365
            + L  W ++  L+ELVLRDN+L ++P
Sbjct  68   QALGEWPSLFGLQELVLRDNKLTRLP  93



>emb|CDY71037.1| BnaUnng04160D [Brassica napus]
Length=229

 Score =   102 bits (253),  Expect(2) = 2e-31, Method: Compositional matrix adjust.
 Identities = 65/98 (66%), Positives = 75/98 (77%), Gaps = 6/98 (6%)
 Frame = +2

Query  356  ENSGVSIFKKLLVFDVSFNEITSPSGLSKVSSTLKELYVSNNQIAKIEEIEHFHELQILE  535
            E   +SIF +LLVFDVSFNEITS  GLSK SSTLKELYVS N++ KI EIEH H+LQILE
Sbjct  41   EVPDISIFSRLLVFDVSFNEITSLEGLSKASSTLKELYVSTNEVNKIMEIEHLHDLQILE  100

Query  536  LGSNKL------RVMenlqtltnlxelwlGRNRIRAIN  631
            LGSN+L       VM N+++LT L ELWLGRNRI+  N
Sbjct  101  LGSNRLWVYSFIHVMVNMESLTKLEELWLGRNRIKVSN  138


 Score = 60.8 bits (146),  Expect(2) = 2e-31, Method: Compositional matrix adjust.
 Identities = 27/42 (64%), Positives = 34/42 (81%), Gaps = 0/42 (0%)
 Frame = +3

Query  240  LNKFSLRQNLITDAALEPLSSWHTISQLEELVLRDNQLKKIP  365
            L K SLRQNLI D+A+EPLS W  +S LEEL+LRDN+L ++P
Sbjct  2    LKKLSLRQNLIEDSAVEPLSRWDALSDLEELILRDNKLAEVP  43



>ref|XP_001766453.1| predicted protein [Physcomitrella patens]
 gb|EDQ68781.1| predicted protein [Physcomitrella patens]
Length=319

 Score = 84.3 bits (207),  Expect(2) = 3e-30, Method: Compositional matrix adjust.
 Identities = 47/82 (57%), Positives = 66/82 (80%), Gaps = 0/82 (0%)
 Frame = +2

Query  386  LLVFDVSFNEITSPSGLSKVSSTLKELYVSNNQIAKIEEIEHFHELQILELGSNKLRVMe  565
            L + DVS+N+++S +G+S +SS+L ELY+S N+I KIEEIEH   L++LELGSN++RVME
Sbjct  101  LTLLDVSYNKVSSMNGMSAISSSLTELYLSKNEIGKIEEIEHLTRLRVLELGSNRIRVME  160

Query  566  nlqtltnlxelwlGRNRIRAIN  631
             L  L  L +LWLGRNRI+++N
Sbjct  161  GLDQLKELQQLWLGRNRIQSVN  182


 Score = 74.7 bits (182),  Expect(2) = 3e-30, Method: Compositional matrix adjust.
 Identities = 55/96 (57%), Positives = 69/96 (72%), Gaps = 0/96 (0%)
 Frame = +3

Query  111  VLDLTSFQlhdldsvdlpsslseldlTANRLSALDPRISHLSNLNKFSLRQNLITDAALE  290
            +LDLTSFQL DL  VDLP  + ELDLT NRL+++DPRI++LS+L K S  QNL+ D A+ 
Sbjct  9    ILDLTSFQLQDLTDVDLPLYIEELDLTTNRLTSIDPRIANLSHLQKLSFEQNLLADDAVS  68

Query  291  PLSSWHTISQLEELVLRDNQLKKIPVLAYLRNFWYL  398
             LS    +S L+ELVLRDN+L KIP L+ L N   L
Sbjct  69   VLSPCTALSDLKELVLRDNKLLKIPELSNLVNLTLL  104



>gb|EYU27278.1| hypothetical protein MIMGU_mgv1a0098171mg, partial [Erythranthe 
guttata]
Length=238

 Score =   122 bits (305),  Expect = 5e-30, Method: Compositional matrix adjust.
 Identities = 73/88 (83%), Positives = 79/88 (90%), Gaps = 0/88 (0%)
 Frame = +2

Query  368  VSIFKKLLVFDVSFNEITSPSGLSKVSSTLKELYVSNNQIAKIEEIEHFHELQILELGSN  547
            VSIFK LLVFDVSFNEI+S  GLSKVS+ LKELYVS N++ K+EEIEHFHELQILELGSN
Sbjct  15   VSIFKMLLVFDVSFNEISSLDGLSKVSNALKELYVSKNEVTKMEEIEHFHELQILELGSN  74

Query  548  KLRVMenlqtltnlxelwlGRNRIRAIN  631
            KLRVMENLQ L+ L ELWLGRNRIRAIN
Sbjct  75   KLRVMENLQNLSLLQELWLGRNRIRAIN  102



>gb|KJB83106.1| hypothetical protein B456_013G229800 [Gossypium raimondii]
Length=229

 Score =   120 bits (300),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 71/88 (81%), Positives = 79/88 (90%), Gaps = 0/88 (0%)
 Frame = +2

Query  368  VSIFKKLLVFDVSFNEITSPSGLSKVSSTLKELYVSNNQIAKIEEIEHFHELQILELGSN  547
            VS+FKKLLVFDVSFNEITS  G+SKVSSTLKELYVS N++ K+EEI+H HELQILELGSN
Sbjct  6    VSLFKKLLVFDVSFNEITSLHGMSKVSSTLKELYVSKNEVTKMEEIDHLHELQILELGSN  65

Query  548  KLRVMenlqtltnlxelwlGRNRIRAIN  631
            +LRVMENLQ  T L ELWLGRNRI+AIN
Sbjct  66   RLRVMENLQNFTKLEELWLGRNRIKAIN  93



>ref|XP_007160299.1| hypothetical protein PHAVU_002G310000g [Phaseolus vulgaris]
 gb|ESW32293.1| hypothetical protein PHAVU_002G310000g [Phaseolus vulgaris]
Length=330

 Score =   117 bits (293),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 69/89 (78%), Positives = 80/89 (90%), Gaps = 0/89 (0%)
 Frame = +2

Query  365  GVSIFKKLLVFDVSFNEITSPSGLSKVSSTLKELYVSNNQIAKIEEIEHFHELQILELGS  544
             VSIF+KLLVFDVSFN+I+S  G +KVS TLKELYVS N++AKIEEI+HFH+LQILELGS
Sbjct  107  DVSIFQKLLVFDVSFNQISSLHGCAKVSDTLKELYVSKNEVAKIEEIDHFHQLQILELGS  166

Query  545  NKLRVMenlqtltnlxelwlGRNRIRAIN  631
            NKLRVMENLQ+L NL ELWLGRNRI+ +N
Sbjct  167  NKLRVMENLQSLANLQELWLGRNRIKVVN  195


 Score = 94.7 bits (234),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 65/114 (57%), Positives = 86/114 (75%), Gaps = 0/114 (0%)
 Frame = +3

Query  102  SPTVLDLTSFQlhdldsvdlpsslseldlTANRLSALDPRISHLSNLNKFSLRQNLITDA  281
            S T+LDLTS+QLHDLDSV+LP +L+ELDLTANRLS LDPRI++LS+L K SLRQNL+TDA
Sbjct  19   SSTILDLTSYQLHDLDSVELPPTLTELDLTANRLSTLDPRIANLSHLKKLSLRQNLVTDA  78

Query  282  ALEPLSSWHTISQLEELVLRDNQLKKIPVLAYLRNFWYLMFRSTKLHHLADCPR  443
             + PLSSW+ ++ L+ELVLRDNQL+ IP ++  +          ++  L  C +
Sbjct  79   TVLPLSSWNALASLDELVLRDNQLRNIPDVSIFQKLLVFDVSFNQISSLHGCAK  132



>ref|XP_007160300.1| hypothetical protein PHAVU_002G310000g [Phaseolus vulgaris]
 gb|ESW32294.1| hypothetical protein PHAVU_002G310000g [Phaseolus vulgaris]
Length=358

 Score =   117 bits (293),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 69/89 (78%), Positives = 80/89 (90%), Gaps = 0/89 (0%)
 Frame = +2

Query  365  GVSIFKKLLVFDVSFNEITSPSGLSKVSSTLKELYVSNNQIAKIEEIEHFHELQILELGS  544
             VSIF+KLLVFDVSFN+I+S  G +KVS TLKELYVS N++AKIEEI+HFH+LQILELGS
Sbjct  135  DVSIFQKLLVFDVSFNQISSLHGCAKVSDTLKELYVSKNEVAKIEEIDHFHQLQILELGS  194

Query  545  NKLRVMenlqtltnlxelwlGRNRIRAIN  631
            NKLRVMENLQ+L NL ELWLGRNRI+ +N
Sbjct  195  NKLRVMENLQSLANLQELWLGRNRIKVVN  223


 Score = 79.0 bits (193),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 65/142 (46%), Positives = 86/142 (61%), Gaps = 28/142 (20%)
 Frame = +3

Query  102  SPTVLDLTSFQlhdldsvdlpsslseldlTANRLSALDPRISHLSNLNKFSLRQNLITDA  281
            S T+LDLTS+QLHDLDSV+LP +L+ELDLTANRLS LDPRI++LS+L K SLRQNL+TDA
Sbjct  19   SSTILDLTSYQLHDLDSVELPPTLTELDLTANRLSTLDPRIANLSHLKKLSLRQNLVTDA  78

Query  282  ALEPLSSWHTISQL----------------------------EELVLRDNQLKKIPVLAY  377
             + PLSSW+ ++ L                            +ELVLRDNQL+ IP ++ 
Sbjct  79   TVLPLSSWNALASLDVYRLSLCLEGLTTFFQTHLFYSFLFYMQELVLRDNQLRNIPDVSI  138

Query  378  LRNFWYLMFRSTKLHHLADCPR  443
             +          ++  L  C +
Sbjct  139  FQKLLVFDVSFNQISSLHGCAK  160



>ref|XP_009147161.1| PREDICTED: protein phosphatase 1 regulatory subunit 7-like [Brassica 
rapa]
Length=239

 Score =   113 bits (282),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 66/92 (72%), Positives = 77/92 (84%), Gaps = 0/92 (0%)
 Frame = +2

Query  356  ENSGVSIFKKLLVFDVSFNEITSPSGLSKVSSTLKELYVSNNQIAKIEEIEHFHELQILE  535
            E   +SIF +LLVFDVSFNEITS  GLSK SSTLKELYVS N++ KI EIEH H+LQILE
Sbjct  37   EVPDISIFSRLLVFDVSFNEITSLEGLSKASSTLKELYVSKNEVNKIMEIEHLHDLQILE  96

Query  536  LGSNKLRVMenlqtltnlxelwlGRNRIRAIN  631
            LGSN+LRVM N+++LT L ELWLGRNRI+ +N
Sbjct  97   LGSNRLRVMVNMESLTKLEELWLGRNRIKVVN  128



>gb|KJB10119.1| hypothetical protein B456_001G184800, partial [Gossypium raimondii]
Length=174

 Score =   111 bits (277),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 67/88 (76%), Positives = 76/88 (86%), Gaps = 0/88 (0%)
 Frame = +2

Query  368  VSIFKKLLVFDVSFNEITSPSGLSKVSSTLKELYVSNNQIAKIEEIEHFHELQILELGSN  547
            V IFKKLLVFDVSFNEITS  GLSK SST+KELYVS N++ K+EEI+H HELQILELGS+
Sbjct  15   VVIFKKLLVFDVSFNEITSLQGLSKASSTIKELYVSKNEVTKMEEIDHLHELQILELGSH  74

Query  548  KLRVMenlqtltnlxelwlGRNRIRAIN  631
            KLRV+ENLQ  T L ELWLGRN+I+ IN
Sbjct  75   KLRVIENLQNFTKLQELWLGRNQIKVIN  102



>ref|XP_002324444.1| hypothetical protein POPTR_0018s09320g [Populus trichocarpa]
 gb|EEF03009.1| hypothetical protein POPTR_0018s09320g [Populus trichocarpa]
Length=336

 Score =   110 bits (276),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 64/86 (74%), Positives = 76/86 (88%), Gaps = 0/86 (0%)
 Frame = +2

Query  374  IFKKLLVFDVSFNEITSPSGLSKVSSTLKELYVSNNQIAKIEEIEHFHELQILELGSNKL  553
            IFK LLVFDVSFNEITS  GLSKVS+TLKELYVS N++ KIEEI+H ++LQILELGSN+L
Sbjct  115  IFKNLLVFDVSFNEITSLHGLSKVSNTLKELYVSKNEVTKIEEIDHLYQLQILELGSNRL  174

Query  554  RVMenlqtltnlxelwlGRNRIRAIN  631
            RVME++Q  T+L ELWLGRNRI+ +N
Sbjct  175  RVMESMQNFTSLQELWLGRNRIKVVN  200


 Score =   105 bits (262),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 79/132 (60%), Positives = 95/132 (72%), Gaps = 10/132 (8%)
 Frame = +3

Query  60   PSDSTPDNGETSSS---SPTVLDLTSFQlhdldsvdlpsslseldlTANRLSALDPRISH  230
            P+ S P+  + +     S T+LDLTSFQLHDL SVDL SSL+ELDLTANRLS+LDPRI+H
Sbjct  7    PNGSNPEADDQTVEIDPSSTILDLTSFQLHDLSSVDLSSSLAELDLTANRLSSLDPRIAH  66

Query  231  LSNLNKFSLRQNLITDAALEPLSSWHTISQLEELVLRDNQLKKIPVLAYLRNFWYLMF--  404
            LSNL K SLRQNLI DAA+EP S W ++S L+ELVLRDN+LKKIP     +N   L+F  
Sbjct  67   LSNLKKLSLRQNLIDDAAVEPFSRWDSLSALQELVLRDNKLKKIPDSGIFKNL--LVFDV  124

Query  405  ---RSTKLHHLA  431
                 T LH L+
Sbjct  125  SFNEITSLHGLS  136



>ref|XP_011048326.1| PREDICTED: protein phosphatase 1 regulatory subunit pprA-like 
[Populus euphratica]
 ref|XP_011048327.1| PREDICTED: protein phosphatase 1 regulatory subunit pprA-like 
[Populus euphratica]
Length=336

 Score =   110 bits (275),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 66/86 (77%), Positives = 76/86 (88%), Gaps = 0/86 (0%)
 Frame = +2

Query  374  IFKKLLVFDVSFNEITSPSGLSKVSSTLKELYVSNNQIAKIEEIEHFHELQILELGSNKL  553
            IFK LLVFDVSFNEITS  GLSKVS+TLKELYVS N++ KIEEI+H ++LQILELGSN+L
Sbjct  115  IFKNLLVFDVSFNEITSLHGLSKVSNTLKELYVSKNEVTKIEEIDHLYQLQILELGSNRL  174

Query  554  RVMenlqtltnlxelwlGRNRIRAIN  631
            RVMEN+Q  TNL ELWLGRNRI+ +N
Sbjct  175  RVMENMQNFTNLQELWLGRNRIKVVN  200


 Score =   106 bits (264),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 77/115 (67%), Positives = 88/115 (77%), Gaps = 7/115 (6%)
 Frame = +3

Query  102  SPTVLDLTSFQlhdldsvdlpsslseldlTANRLSALDPRISHLSNLNKFSLRQNLITDA  281
            S TVLDLTSFQLHDL SVDL SSL+ELDLTANRLS+LDPRI+HLSNL K SLRQNLI DA
Sbjct  24   SSTVLDLTSFQLHDLSSVDLSSSLTELDLTANRLSSLDPRIAHLSNLKKLSLRQNLIVDA  83

Query  282  ALEPLSSWHTISQLEELVLRDNQLKKIPVLAYLRNFWYLMF-----RSTKLHHLA  431
            A+EP S W ++S L+ELVLRDN+LKKIP     +N   L+F       T LH L+
Sbjct  84   AVEPFSRWDSLSALQELVLRDNKLKKIPDSGIFKNL--LVFDVSFNEITSLHGLS  136



>gb|KJB62255.1| hypothetical protein B456_009G408400 [Gossypium raimondii]
Length=243

 Score =   108 bits (270),  Expect = 5e-25, Method: Compositional matrix adjust.
 Identities = 66/88 (75%), Positives = 73/88 (83%), Gaps = 1/88 (1%)
 Frame = +2

Query  368  VSIFKKLLVFDVSFNEITSPSGLSKVSSTLKELYVSNNQIAKIEEIEHFHELQILELGSN  547
            V IFKKLLVFDVSFNEITS  GLSK SST+KELY S N++  +EEI+H HELQILELGSN
Sbjct  38   VGIFKKLLVFDVSFNEITSLQGLSKTSSTIKELY-SKNEVTNMEEIDHLHELQILELGSN  96

Query  548  KLRVMenlqtltnlxelwlGRNRIRAIN  631
            +LRVME LQ  T L ELWLGRNRI+ IN
Sbjct  97   RLRVMEKLQNFTKLQELWLGRNRIKVIN  124



>ref|XP_011008944.1| PREDICTED: protein phosphatase 1 regulatory subunit pprA-like 
[Populus euphratica]
Length=337

 Score =   107 bits (267),  Expect = 5e-24, Method: Compositional matrix adjust.
 Identities = 63/86 (73%), Positives = 75/86 (87%), Gaps = 0/86 (0%)
 Frame = +2

Query  374  IFKKLLVFDVSFNEITSPSGLSKVSSTLKELYVSNNQIAKIEEIEHFHELQILELGSNKL  553
            IFK LLVFDVSFNEITS  GLSKVS+TLKELYVS N+  KIEEI+H ++L+ILELGSN+L
Sbjct  116  IFKNLLVFDVSFNEITSLHGLSKVSNTLKELYVSKNEATKIEEIDHLYQLRILELGSNRL  175

Query  554  RVMenlqtltnlxelwlGRNRIRAIN  631
            RVMEN+  LT+L ELW+GRNRI+ +N
Sbjct  176  RVMENMGNLTSLQELWMGRNRIKVVN  201


 Score =   106 bits (265),  Expect = 8e-24, Method: Compositional matrix adjust.
 Identities = 76/115 (66%), Positives = 88/115 (77%), Gaps = 7/115 (6%)
 Frame = +3

Query  102  SPTVLDLTSFQlhdldsvdlpsslseldlTANRLSALDPRISHLSNLNKFSLRQNLITDA  281
            S TVLDLTSFQLHDL+SV+L  SL+ELDLTANRLS+LDPRI+HLSNL K SLRQNLI DA
Sbjct  25   SSTVLDLTSFQLHDLNSVELSPSLTELDLTANRLSSLDPRIAHLSNLKKLSLRQNLIDDA  84

Query  282  ALEPLSSWHTISQLEELVLRDNQLKKIPVLAYLRNFWYLMF-----RSTKLHHLA  431
            A+EP S W +IS L+ELVLRDN+LKKIP     +N   L+F       T LH L+
Sbjct  85   AIEPFSRWDSISGLQELVLRDNKLKKIPDSGIFKNL--LVFDVSFNEITSLHGLS  137



>ref|XP_006585909.1| PREDICTED: protein phosphatase 1 regulatory subunit 7-like isoform 
X1 [Glycine max]
Length=158

 Score =   101 bits (251),  Expect = 5e-23, Method: Compositional matrix adjust.
 Identities = 55/95 (58%), Positives = 67/95 (71%), Gaps = 4/95 (4%)
 Frame = +2

Query  275  RRRARASFVVAHHFPTRGTSAQG*SAEENSGVSIFKKLLVFDVSFNEITSPSGLSKVSST  454
            R+    + VV   F   G S    + E    V +FKKLLVF+V+FNEI+S  G S+VS T
Sbjct  61   RQNLITNAVVLPFFSQNGLS----TLENIPDVGVFKKLLVFNVAFNEISSLHGFSRVSDT  116

Query  455  LKELYVSNNQIAKIEEIEHFHELQILELGSNKLRV  559
            LKELYVS N++AKIEEIEHFH+LQ+LELGSNKL V
Sbjct  117  LKELYVSKNEVAKIEEIEHFHQLQLLELGSNKLWV  151



>gb|EPS60921.1| hypothetical protein M569_13879, partial [Genlisea aurea]
Length=330

 Score =   103 bits (258),  Expect = 7e-23, Method: Compositional matrix adjust.
 Identities = 69/111 (62%), Positives = 82/111 (74%), Gaps = 0/111 (0%)
 Frame = +3

Query  66   DSTPDNGETSSSSPTVLDLTSFQlhdldsvdlpsslseldlTANRLSALDPRISHLSNLN  245
            D  P++G     + TVLDLTS QL DLDSV+LP++L+E+DLTANRL+ LD RISHLS L 
Sbjct  7    DHRPEDGGNDEEAETVLDLTSCQLRDLDSVELPATLTEIDLTANRLTELDGRISHLSRLK  66

Query  246  KFSLRQNLITDAALEPLSSWHTISQLEELVLRDNQLKKIPVLAYLRNFWYL  398
            K SLRQNL  DA + PLSSW TIS L+ELVLRDNQLKKIP +   +    L
Sbjct  67   KLSLRQNLFDDAGVSPLSSWTTISSLQELVLRDNQLKKIPDVGIFKGLLVL  117


 Score =   103 bits (258),  Expect = 7e-23, Method: Compositional matrix adjust.
 Identities = 64/87 (74%), Positives = 75/87 (86%), Gaps = 0/87 (0%)
 Frame = +2

Query  368  VSIFKKLLVFDVSFNEITSPSGLSKVSSTLKELYVSNNQIAKIEEIEHFHELQILELGSN  547
            V IFK LLV D SFN+I+S +GLS  S+TLKELYVS N++ +IEEIEH  EL+ILELGSN
Sbjct  108  VGIFKGLLVLDASFNDISSLNGLSSASTTLKELYVSKNELTRIEEIEHLQELKILELGSN  167

Query  548  KLRVMenlqtltnlxelwlGRNRIRAI  628
            KL+VMENLQ+LT+L ELWLGRNRIRAI
Sbjct  168  KLKVMENLQSLTSLQELWLGRNRIRAI  194



>ref|XP_008364658.1| PREDICTED: protein phosphatase 1 regulatory subunit pprA-like 
[Malus domestica]
 ref|XP_008364659.1| PREDICTED: protein phosphatase 1 regulatory subunit pprA-like 
[Malus domestica]
Length=339

 Score =   101 bits (252),  Expect = 6e-22, Method: Compositional matrix adjust.
 Identities = 80/143 (56%), Positives = 96/143 (67%), Gaps = 12/143 (8%)
 Frame = +3

Query  12   LHSPMDPSPGTSTHGHPSDSTPDNGETSSSSPTVLDLTSFQlhdldsvdlpsslseldlT  191
            L  P DP+P      H   +  D+     SS TVLDLTSFQLHDLDSV+LP SL+ELD T
Sbjct  6    LAPPPDPNP----EEHDDQTAEDD-----SSSTVLDLTSFQLHDLDSVELPPSLTELDJT  56

Query  192  ANRLSALDPRISHLSNLNKFSLRQNLITDAALEPLSSWHTISQLEELVLRDNQLKKIP--  365
            ANRL++LD RI++LSNL K SLRQNLI DAA+EP+S W  +S LEELVLRDN+L KIP  
Sbjct  57   ANRLTSLDTRIANLSNLKKLSLRQNLIDDAAVEPISGWDALSGLEELVLRDNKLGKIPDV  116

Query  366  -VLAYLRNFWYLMFRSTKLHHLA  431
             +   L  F +     T LH L+
Sbjct  117  SIFTKLLVFDFSFNEITSLHGLS  139


 Score = 81.3 bits (199),  Expect = 7e-15, Method: Compositional matrix adjust.
 Identities = 67/88 (76%), Positives = 75/88 (85%), Gaps = 0/88 (0%)
 Frame = +2

Query  368  VSIFKKLLVFDVSFNEITSPSGLSKVSSTLKELYVSNNQIAKIEEIEHFHELQILELGSN  547
            VSIF KLLVFD SFNEITS  GLSKV+ TLKELYVS N++ KIEEIEH HEL ILELGSN
Sbjct  116  VSIFTKLLVFDFSFNEITSLHGLSKVTXTLKELYVSKNEVTKIEEIEHLHELLILELGSN  175

Query  548  KLRVMenlqtltnlxelwlGRNRIRAIN  631
            +LRVME+LQ +T L ELWLGRNRI+ +N
Sbjct  176  RLRVMESLQNMTKLQELWLGRNRIKVVN  203



>ref|XP_008356664.1| PREDICTED: protein phosphatase 1 regulatory subunit pprA-like 
[Malus domestica]
 ref|XP_008356665.1| PREDICTED: protein phosphatase 1 regulatory subunit pprA-like 
[Malus domestica]
Length=339

 Score =   100 bits (249),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 79/138 (57%), Positives = 95/138 (69%), Gaps = 12/138 (9%)
 Frame = +3

Query  27   DPSPGTSTHGHPSDSTPDNGETSSSSPTVLDLTSFQlhdldsvdlpsslseldlTANRLS  206
            DP+P      H   +  D+     SS TVLDLTSFQLHDLDSV+LP SL+ELDLTANRL+
Sbjct  11   DPNP----EEHDDQTAEDD-----SSSTVLDLTSFQLHDLDSVELPPSLTELDLTANRLT  61

Query  207  ALDPRISHLSNLNKFSLRQNLITDAALEPLSSWHTISQLEELVLRDNQLKKIP---VLAY  377
            +LD RI++LSNL K SLRQNLI DAA+EP+S W  +S LEELVLRDN+L KIP   +   
Sbjct  62   SLDTRIANLSNLKKLSLRQNLIDDAAVEPISGWDALSGLEELVLRDNKLGKIPDVSIFTK  121

Query  378  LRNFWYLMFRSTKLHHLA  431
            L  F +     T LH L+
Sbjct  122  LLVFDFSFNEITSLHGLS  139


 Score = 79.3 bits (194),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 66/88 (75%), Positives = 74/88 (84%), Gaps = 0/88 (0%)
 Frame = +2

Query  368  VSIFKKLLVFDVSFNEITSPSGLSKVSSTLKELYVSNNQIAKIEEIEHFHELQILELGSN  547
            VSIF KLLVFD SFNEITS  GLSKV+ T KELYVS N++ KIEEIEH HEL ILELGSN
Sbjct  116  VSIFTKLLVFDFSFNEITSLHGLSKVTGTXKELYVSKNEVTKIEEIEHLHELLILELGSN  175

Query  548  KLRVMenlqtltnlxelwlGRNRIRAIN  631
            +LRVME+LQ +T L ELWLGRNRI+ +N
Sbjct  176  RLRVMESLQNMTKLQELWLGRNRIKVVN  203



>ref|XP_008387197.1| PREDICTED: protein phosphatase 1 regulatory subunit pprA [Malus 
domestica]
 ref|XP_008387204.1| PREDICTED: protein phosphatase 1 regulatory subunit pprA [Malus 
domestica]
Length=339

 Score = 99.8 bits (247),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 75/113 (66%), Positives = 84/113 (74%), Gaps = 3/113 (3%)
 Frame = +3

Query  102  SPTVLDLTSFQlhdldsvdlpsslseldlTANRLSALDPRISHLSNLNKFSLRQNLITDA  281
            S TVLDLTSFQLHDLDSV+LP SL+ELDLTANRL+ LDPRI+ LSNL K SLRQNLI DA
Sbjct  27   SSTVLDLTSFQLHDLDSVELPPSLTELDLTANRLTGLDPRIATLSNLKKLSLRQNLIEDA  86

Query  282  ALEPLSSWHTISQLEELVLRDNQLKKIP---VLAYLRNFWYLMFRSTKLHHLA  431
            A+EP+S W  +S LEELVLRDN+L KIP   +   L  F       T LH LA
Sbjct  87   AVEPISGWDALSGLEELVLRDNKLGKIPDVSIFTKLLVFDVSFNEITLLHGLA  139


 Score = 81.3 bits (199),  Expect = 7e-15, Method: Compositional matrix adjust.
 Identities = 70/88 (80%), Positives = 77/88 (88%), Gaps = 0/88 (0%)
 Frame = +2

Query  368  VSIFKKLLVFDVSFNEITSPSGLSKVSSTLKELYVSNNQIAKIEEIEHFHELQILELGSN  547
            VSIF KLLVFDVSFNEIT   GL+KV+STLKELYVS N++ KIEEIEH HEL ILELGSN
Sbjct  116  VSIFTKLLVFDVSFNEITLLHGLAKVTSTLKELYVSKNEVTKIEEIEHLHELLILELGSN  175

Query  548  KLRVMenlqtltnlxelwlGRNRIRAIN  631
            +LRVMENLQTLT L ELWLGRNRI+ +N
Sbjct  176  RLRVMENLQTLTKLQELWLGRNRIKVVN  203



>ref|XP_009352536.1| PREDICTED: protein phosphatase 1 regulatory subunit pprA [Pyrus 
x bretschneideri]
 ref|XP_009352537.1| PREDICTED: protein phosphatase 1 regulatory subunit pprA [Pyrus 
x bretschneideri]
Length=339

 Score = 98.6 bits (244),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 81/143 (57%), Positives = 95/143 (66%), Gaps = 12/143 (8%)
 Frame = +3

Query  12   LHSPMDPSPGTSTHGHPSDSTPDNGETSSSSPTVLDLTSFQlhdldsvdlpsslseldlT  191
            L  P DP+P      H   +  DN     SS TVL LTSFQLHDLDSV+LP SL+ELDLT
Sbjct  6    LAPPPDPNP----EEHDDQTAGDN-----SSSTVLHLTSFQLHDLDSVELPPSLTELDLT  56

Query  192  ANRLSALDPRISHLSNLNKFSLRQNLITDAALEPLSSWHTISQLEELVLRDNQLKKIP--  365
            ANRL+ LD RI++LSNL K SLRQNLI DAA+EP+S W  +S LEELVLRDN+L KIP  
Sbjct  57   ANRLTILDTRIANLSNLKKLSLRQNLIDDAAVEPISGWDALSGLEELVLRDNKLGKIPDV  116

Query  366  -VLAYLRNFWYLMFRSTKLHHLA  431
             +   L  F +     T LH L+
Sbjct  117  SIFTKLLVFDFSFNEITSLHGLS  139


 Score = 82.4 bits (202),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 67/88 (76%), Positives = 76/88 (86%), Gaps = 0/88 (0%)
 Frame = +2

Query  368  VSIFKKLLVFDVSFNEITSPSGLSKVSSTLKELYVSNNQIAKIEEIEHFHELQILELGSN  547
            VSIF KLLVFD SFNEITS  GLSKV+STLKELYVS N++ KIEEIEH HEL ILELGSN
Sbjct  116  VSIFTKLLVFDFSFNEITSLHGLSKVTSTLKELYVSKNEVTKIEEIEHLHELLILELGSN  175

Query  548  KLRVMenlqtltnlxelwlGRNRIRAIN  631
            +LRVME+LQ +T L ELWLGRNR++ +N
Sbjct  176  RLRVMESLQNMTKLQELWLGRNRVKVVN  203



>ref|XP_008242516.1| PREDICTED: protein phosphatase 1 regulatory subunit pprA [Prunus 
mume]
 ref|XP_008242517.1| PREDICTED: protein phosphatase 1 regulatory subunit pprA [Prunus 
mume]
Length=339

 Score = 94.7 bits (234),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 76/139 (55%), Positives = 91/139 (65%), Gaps = 3/139 (2%)
 Frame = +3

Query  24   MDPSPGTSTHGHPSDSTPDNGETSSSSPTVLDLTSFQlhdldsvdlpsslseldlTANRL  203
            MD   G S     S+   D       S TVLDLTSFQLHDLDS++LP SL+ELD+TANRL
Sbjct  1    MDDQTGASPPAPNSEGYDDPTMEDDPSSTVLDLTSFQLHDLDSIELPPSLTELDVTANRL  60

Query  204  SALDPRISHLSNLNKFSLRQNLITDAALEPLSSWHTISQLEELVLRDNQLKKIP---VLA  374
            ++LD RI+ LS+L K SLRQNLI DAA+EP+S W  +S LEELVLRDN+L KIP   +  
Sbjct  61   TSLDTRIATLSSLKKLSLRQNLIEDAAVEPISRWDALSGLEELVLRDNKLTKIPDVTIFI  120

Query  375  YLRNFWYLMFRSTKLHHLA  431
             L  F       T LH L+
Sbjct  121  KLLVFDVSFNEITSLHGLS  139


 Score = 92.8 bits (229),  Expect = 6e-19, Method: Compositional matrix adjust.
 Identities = 69/88 (78%), Positives = 78/88 (89%), Gaps = 0/88 (0%)
 Frame = +2

Query  368  VSIFKKLLVFDVSFNEITSPSGLSKVSSTLKELYVSNNQIAKIEEIEHFHELQILELGSN  547
            V+IF KLLVFDVSFNEITS  GLSKVSS LKELYVS N++AKIEEI+H HEL ILELGSN
Sbjct  116  VTIFIKLLVFDVSFNEITSLHGLSKVSSKLKELYVSKNEVAKIEEIDHLHELLILELGSN  175

Query  548  KLRVMenlqtltnlxelwlGRNRIRAIN  631
            +LRVMENLQ +T+L ELWLGRNRI+ +N
Sbjct  176  RLRVMENLQNMTHLQELWLGRNRIKVVN  203



>ref|XP_011468505.1| PREDICTED: protein phosphatase 1 regulatory subunit pprA-like 
[Fragaria vesca subsp. vesca]
Length=155

 Score = 62.0 bits (149),  Expect(2) = 2e-17, Method: Compositional matrix adjust.
 Identities = 31/43 (72%), Positives = 36/43 (84%), Gaps = 0/43 (0%)
 Frame = +2

Query  368  VSIFKKLLVFDVSFNEITSPSGLSKVSSTLKELYVSNNQIAKI  496
             SIFKKLLVFD SFNEITS  G+SKVS++LKELYV  N++ KI
Sbjct  110  ASIFKKLLVFDFSFNEITSLQGMSKVSNSLKELYVLKNEVTKI  152


 Score = 54.3 bits (129),  Expect(2) = 2e-17, Method: Compositional matrix adjust.
 Identities = 46/76 (61%), Positives = 54/76 (71%), Gaps = 5/76 (7%)
 Frame = +3

Query  99   SSPTVLDLTSFQlhdldsvdlpsslseldlTANRLSALDPRISHLSNLNKFSLRQNLITD  278
            SS TVLDL S QLHDL+SVDLP SL     TANRLS+LD  I+ L NL K S RQNL  D
Sbjct  36   SSSTVLDLISCQLHDLNSVDLPPSL-----TANRLSSLDTHIATLFNLTKLSFRQNLFKD  90

Query  279  AALEPLSSWHTISQLE  326
            AA+EP+S+W  +  L+
Sbjct  91   AAVEPISAWIALFGLK  106



>ref|XP_005646296.1| L domain-like protein [Coccomyxa subellipsoidea C-169]
 gb|EIE21752.1| L domain-like protein [Coccomyxa subellipsoidea C-169]
Length=329

 Score = 60.5 bits (145),  Expect(2) = 2e-16, Method: Compositional matrix adjust.
 Identities = 44/86 (51%), Positives = 59/86 (69%), Gaps = 1/86 (1%)
 Frame = +2

Query  377  FKKLLVFDVSFNEITSPSGLSKVSST-LKELYVSNNQIAKIEEIEHFHELQILELGSNKL  553
            F  L   ++S+N+I S   L  + ST L +LYV+NN + KIE ++ F  L++LELGSNK+
Sbjct  103  FTSLQRLELSYNQIQSLQPLLSLGSTVLSDLYVANNAVQKIEAVQQFTNLRMLELGSNKI  162

Query  554  RVMenlqtltnlxelwlGRNRIRAIN  631
            R M  L+ LTNL ELWLGRNRI  I+
Sbjct  163  REMTGLEGLTNLQELWLGRNRIAEIS  188


 Score = 52.4 bits (124),  Expect(2) = 2e-16, Method: Compositional matrix adjust.
 Identities = 28/59 (47%), Positives = 39/59 (66%), Gaps = 2/59 (3%)
 Frame = +3

Query  189  TANRLSALDPRISHLSNLNKFSLRQNLITDAALEPLSSWHTISQLEELVLRDNQLKKIP  365
            T NRL ALDPR+  L+ L   SLRQNL++D      S++  +  L+ELVL DN +++IP
Sbjct  42   TTNRLRALDPRLLALTGLQTLSLRQNLLSDVGQLGNSAFRAV--LKELVLHDNHIEEIP  98



>gb|EYU27277.1| hypothetical protein MIMGU_mgv1a0098172mg, partial [Erythranthe 
guttata]
Length=93

 Score = 75.5 bits (184),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 58/90 (64%), Positives = 67/90 (74%), Gaps = 2/90 (2%)
 Frame = +3

Query  57   HPSDSTPDNGETSSSSPTVLDLTSFQlhdldsvdlpsslseldlTANRLSALDPRISHLS  236
             P D  P  GE  + S T LDLTS QL DL SV+LP +L+ELDLTANRL+ALDPRISHLS
Sbjct  6    RPDDQDP-AGENDAES-TFLDLTSCQLRDLASVELPPNLTELDLTANRLTALDPRISHLS  63

Query  237  NLNKFSLRQNLITDAALEPLSSWHTISQLE  326
            NL K SLRQNL  D  + PLS+WH+IS L+
Sbjct  64   NLKKLSLRQNLFNDDGVLPLSAWHSISSLQ  93



>ref|XP_001700674.1| predicted protein [Chlamydomonas reinhardtii]
 gb|EDO97912.1| predicted protein [Chlamydomonas reinhardtii]
Length=315

 Score = 52.0 bits (123),  Expect(2) = 7e-13, Method: Compositional matrix adjust.
 Identities = 38/86 (44%), Positives = 60/86 (70%), Gaps = 1/86 (1%)
 Frame = +2

Query  377  FKKLLVFDVSFNEITSPSGLSKVSST-LKELYVSNNQIAKIEEIEHFHELQILELGSNKL  553
            F +L   + S+N+I +   L+ + ST L+ELYV++N++  +  + H   L +LELGSN++
Sbjct  91   FTELRRLECSYNQIRNLLPLADLDSTKLEELYVASNKVTAMAALSHLGALTLLELGSNRI  150

Query  554  RVMenlqtltnlxelwlGRNRIRAIN  631
            R +EN++TLT L ELWLGRNRI  ++
Sbjct  151  RAIENIETLTGLRELWLGRNRIAKVD  176


 Score = 48.9 bits (115),  Expect(2) = 7e-13, Method: Compositional matrix adjust.
 Identities = 29/61 (48%), Positives = 36/61 (59%), Gaps = 2/61 (3%)
 Frame = +3

Query  189  TANRLSALDPRISHLSNLNKFSLRQNLITDAALEPLSSWHTISQLEELVLRDNQLKKIPV  368
            TANRL  +DPRI  L  L   + RQNLI +A+   LS+      +E+L LRDN L  IP 
Sbjct  30   TANRLRTIDPRILGLQGLRSINFRQNLIANAS--ALSTSCAKGAMEDLELRDNHLSVIPS  87

Query  369  L  371
            L
Sbjct  88   L  88



>gb|KIY98793.1| Protein phosphatase 1 regulatory subunit 7 [Monoraphidium neglectum]
Length=341

 Score = 51.2 bits (121),  Expect(2) = 6e-12, Method: Compositional matrix adjust.
 Identities = 29/62 (47%), Positives = 38/62 (61%), Gaps = 8/62 (13%)
 Frame = +3

Query  189  TANRLSALDPRISHLSNLNKFSLRQNLITDAALEPLSSWHTIS---QLEELVLRDNQLKK  359
            TANRL  +DPR+  L  L   + RQNL+TD     +S+W + S    LE+L  RDNQL +
Sbjct  55   TANRLKEVDPRLLALKGLRSLNFRQNLLTD-----VSAWDSCSCKGTLEDLEFRDNQLTQ  109

Query  360  IP  365
            IP
Sbjct  110  IP  111


 Score = 45.8 bits (107),  Expect(2) = 6e-12, Method: Compositional matrix adjust.
 Identities = 35/85 (41%), Positives = 52/85 (61%), Gaps = 1/85 (1%)
 Frame = +2

Query  377  FKKLLVFDVSFNEITSPSGLSKVS-STLKELYVSNNQIAKIEEIEHFHELQILELGSNKL  553
            F  L   + S+NEI S   ++ +S + L+ELYV+ N+I  I  +     L +LELGSN++
Sbjct  116  FVALRRLEFSYNEIRSLEPVASLSCAPLRELYVAANKITAIAGLSSLTALTVLELGSNRI  175

Query  554  RVMenlqtltnlxelwlGRNRIRAI  628
            R +E L+    L ELWLGRNR+  +
Sbjct  176  RQVEGLEAQGALVELWLGRNRLERV  200



>ref|XP_002947065.1| hypothetical protein VOLCADRAFT_103293 [Volvox carteri f. nagariensis]
 gb|EFJ51655.1| hypothetical protein VOLCADRAFT_103293 [Volvox carteri f. nagariensis]
Length=363

 Score = 48.5 bits (114),  Expect(2) = 3e-11, Method: Compositional matrix adjust.
 Identities = 44/91 (48%), Positives = 56/91 (62%), Gaps = 8/91 (9%)
 Frame = +3

Query  108  TVLDLTSFQlhdldsvdlpsslseldlTANRLSALDPRISHLSNLNKFSLRQNLITDAAL  287
            T LDLT++ L DL SVD+ SSL+ +DLTANRL  +DPRI  L  L   + RQNL+ +   
Sbjct  13   TELDLTNYHLPDLTSVDIESSLTAIDLTANRLRTIDPRILQLQGLRSINFRQNLLAN---  69

Query  288  EPLSSWHT---ISQLEELVLRDNQLKKIPVL  371
              +S+W T      LE+L  RDN L  IP L
Sbjct  70   --VSAWSTGECKGALEDLEFRDNHLSTIPCL  98


 Score = 46.6 bits (109),  Expect(2) = 3e-11, Method: Compositional matrix adjust.
 Identities = 40/86 (47%), Positives = 59/86 (69%), Gaps = 1/86 (1%)
 Frame = +2

Query  377  FKKLLVFDVSFNEITSPSGLSKV-SSTLKELYVSNNQIAKIEEIEHFHELQILELGSNKL  553
            F +L   D S+N+I +   L+ + SS L+ELYV+NN++  I  + H   L +LELGSN++
Sbjct  101  FLQLRRLDCSYNQIRNLLPLADLNSSKLEELYVANNKVTAIAALSHLTSLTLLELGSNRI  160

Query  554  RVMenlqtltnlxelwlGRNRIRAIN  631
            RV+E + +LT L ELWLGRNRI  ++
Sbjct  161  RVIEGIASLTGLQELWLGRNRITNVD  186



>gb|EPY83362.1| hypothetical protein CB1_000575003 [Camelus ferus]
Length=975

 Score = 62.0 bits (149),  Expect(2) = 2e-10, Method: Composition-based stats.
 Identities = 39/79 (49%), Positives = 60/79 (76%), Gaps = 1/79 (1%)
 Frame = +2

Query  383  KLLVFDVSFNEITSPSGLSKVSSTLKELYVSNNQIAKIEEIEHFHELQILELGSNKLRVM  562
            +L + D+SFN + +  G+ K++  LK+L++ NN+I KIE I   H+LQ+LELGSN++R +
Sbjct  190  ELEILDISFNLLRNIEGIDKLTR-LKKLFLVNNKINKIENISTLHQLQMLELGSNRIRAI  248

Query  563  enlqtltnlxelwlGRNRI  619
            EN+ TLTNL  L+LG+N+I
Sbjct  249  ENIDTLTNLESLFLGKNKI  267


 Score = 30.0 bits (66),  Expect(2) = 2e-10, Method: Compositional matrix adjust.
 Identities = 20/56 (36%), Positives = 26/56 (46%), Gaps = 5/56 (9%)
 Frame = +3

Query  231  LSNLNKFSLRQNLITDAALEPLSSWHTISQLEELVLRDNQLKKIPVLAYLRNFWYL  398
            L  +    LRQNLI     + + +   +  L EL L DNQ+KKI  L  L     L
Sbjct  144  LKKVKTLCLRQNLI-----KCIENLEELQSLRELDLYDNQIKKIENLEALTELEIL  194



>ref|XP_638758.1| hypothetical protein DDB_G0284039 [Dictyostelium discoideum AX4]
 sp|Q54Q39.1|PP1R7_DICDI RecName: Full=Protein phosphatase 1 regulatory subunit pprA [Dictyostelium 
discoideum]
 gb|EAL65360.1| hypothetical protein DDB_G0284039 [Dictyostelium discoideum AX4]
Length=336

 Score = 53.9 bits (128),  Expect(2) = 6e-10, Method: Compositional matrix adjust.
 Identities = 42/85 (49%), Positives = 57/85 (67%), Gaps = 1/85 (1%)
 Frame = +2

Query  377  FKKLLVFDVSFNEITSPSGLS-KVSSTLKELYVSNNQIAKIEEIEHFHELQILELGSNKL  553
            F+ L   D+SFNEI     LS K    +KELY++NN+I KIE ++    ++ LELGSN+L
Sbjct  113  FQSLTYLDLSFNEIRIVENLSIKDIPKIKELYLANNKITKIENLQELVPIKNLELGSNRL  172

Query  554  RVMenlqtltnlxelwlGRNRIRAI  628
            R +ENL+ L N+  LWLGRN+I  I
Sbjct  173  REIENLENLVNIETLWLGRNKITEI  197


 Score = 36.6 bits (83),  Expect(2) = 6e-10, Method: Compositional matrix adjust.
 Identities = 22/59 (37%), Positives = 32/59 (54%), Gaps = 5/59 (8%)
 Frame = +3

Query  222  ISHLSNLNKFSLRQNLITDAALEPLSSWHTISQLEELVLRDNQLKKIPVLAYLRNFWYL  398
            I+HL NL K   RQNLI     E + +   + +LE L L DN+L+ I  +   ++  YL
Sbjct  66   INHLKNLKKLCFRQNLI-----EKIENIDQLKELESLDLYDNKLQVIENIKDFQSLTYL  119



>ref|XP_011399381.1| Protein phosphatase 1 regulatory subunit pprA [Auxenochlorella 
protothecoides]
 gb|KFM26449.1| Protein phosphatase 1 regulatory subunit pprA [Auxenochlorella 
protothecoides]
Length=285

 Score = 57.0 bits (136),  Expect(2) = 7e-10, Method: Compositional matrix adjust.
 Identities = 38/86 (44%), Positives = 52/86 (60%), Gaps = 1/86 (1%)
 Frame = +2

Query  377  FKKLLVFDVSFNEITSPSGLSKVSST-LKELYVSNNQIAKIEEIEHFHELQILELGSNKL  553
            F  L   D+S+N+  S   LS +    L  LY + N+IA +E I H   L++L+LGSN+L
Sbjct  61   FFSLTNLDMSYNQFVSLEALSSLPGPRLTHLYCAANKIASMEGIAHLESLRVLDLGSNRL  120

Query  554  RVMenlqtltnlxelwlGRNRIRAIN  631
            R +E L+ +  L  LWLGRNRI  IN
Sbjct  121  RCIEGLEGMCLLDSLWLGRNRITQIN  146


 Score = 33.5 bits (75),  Expect(2) = 7e-10, Method: Compositional matrix adjust.
 Identities = 18/39 (46%), Positives = 25/39 (64%), Gaps = 1/39 (3%)
 Frame = +3

Query  189  TANRLSALDPRISHLSNLNKFSLRQNLITDA-ALEPLSS  302
            TANRL +++  +  L  L K  LRQNL+T A  +E L+S
Sbjct  7    TANRLKSIEAALLRLDGLTKLCLRQNLLTSAEEVEALAS  45



>dbj|GAM28146.1| hypothetical protein SAMD00019534_113220 [Acytostelium subglobosum 
LB1]
Length=335

 Score = 49.3 bits (116),  Expect(2) = 2e-09, Method: Compositional matrix adjust.
 Identities = 38/82 (46%), Positives = 53/82 (65%), Gaps = 1/82 (1%)
 Frame = +2

Query  386  LLVFDVSFNEITSPSGL-SKVSSTLKELYVSNNQIAKIEEIEHFHELQILELGSNKLRVM  562
            L   D+SFNEI     L +K    LKELY++NN+I +++ +E    L  LELGSN+ R +
Sbjct  116  LTYLDLSFNEIRVIENLHAKEMPQLKELYLANNKITEMQNLEELVTLSNLELGSNRFREI  175

Query  563  enlqtltnlxelwlGRNRIRAI  628
            +NL  L N+  LWLGRN+I +I
Sbjct  176  KNLDKLVNVKTLWLGRNKITSI  197


 Score = 40.0 bits (92),  Expect(2) = 2e-09, Method: Compositional matrix adjust.
 Identities = 28/70 (40%), Positives = 38/70 (54%), Gaps = 6/70 (9%)
 Frame = +3

Query  189  TANRLSALDPRISHLSNLNKFSLRQNLITDAALEPLSSWHTISQLEELVLRDNQLKKIPV  368
            T +++  +D  ISHL NL K  LRQNLI +     +    T+  L+ L L DN+L+ I  
Sbjct  56   TNDKIKRMD-NISHLVNLKKLCLRQNLIAE-----IECVDTLVSLQHLDLYDNKLQAIKN  109

Query  369  LAYLRNFWYL  398
            L  L N  YL
Sbjct  110  LNNLPNLTYL  119



>ref|XP_004357043.1| Protein phosphatase 1 [Dictyostelium fasciculatum]
 gb|EGG18220.1| Protein phosphatase 1 [Dictyostelium fasciculatum]
Length=365

 Score = 49.3 bits (116),  Expect(2) = 2e-09, Method: Compositional matrix adjust.
 Identities = 37/82 (45%), Positives = 53/82 (65%), Gaps = 1/82 (1%)
 Frame = +2

Query  386  LLVFDVSFNEITSPSGL-SKVSSTLKELYVSNNQIAKIEEIEHFHELQILELGSNKLRVM  562
            L   D+SFNE+     L SK    LKELY++NN+I+++E +     ++ LELGSN+ R +
Sbjct  146  LTYLDISFNELRVIENLTSKQLPILKELYLANNKISEMENLSELTGIKCLELGSNRFREI  205

Query  563  enlqtltnlxelwlGRNRIRAI  628
            +NL  L N+  LWLGRN+I  I
Sbjct  206  KNLNELINVETLWLGRNKITTI  227


 Score = 39.3 bits (90),  Expect(2) = 2e-09, Method: Compositional matrix adjust.
 Identities = 25/59 (42%), Positives = 33/59 (56%), Gaps = 5/59 (8%)
 Frame = +3

Query  222  ISHLSNLNKFSLRQNLITDAALEPLSSWHTISQLEELVLRDNQLKKIPVLAYLRNFWYL  398
            I+HL  L K  LRQN+I     + + +  T+  L EL L DNQ+KKI  +  L N  YL
Sbjct  96   INHLVQLKKLCLRQNMI-----QVIENVDTLVSLVELDLYDNQIKKIENINNLPNLTYL  149



>dbj|BAB26554.1| unnamed protein product [Mus musculus]
Length=284

 Score = 58.9 bits (141),  Expect(2) = 3e-09, Method: Compositional matrix adjust.
 Identities = 40/81 (49%), Positives = 61/81 (75%), Gaps = 1/81 (1%)
 Frame = +2

Query  377  FKKLLVFDVSFNEITSPSGLSKVSSTLKELYVSNNQIAKIEEIEHFHELQILELGSNKLR  556
              +L V D+SFN + +  G+ K++  LK+L++ NN+I KIE I + H+LQ+LELGSN++R
Sbjct  142  LTELEVLDISFNMLRNIEGIDKLTQ-LKKLFLVNNKINKIENISNLHQLQMLELGSNRIR  200

Query  557  VMenlqtltnlxelwlGRNRI  619
             +EN+ TLTNL  L+LG+N+I
Sbjct  201  AIENIDTLTNLESLFLGKNKI  221


 Score = 29.6 bits (65),  Expect(2) = 3e-09, Method: Compositional matrix adjust.
 Identities = 20/56 (36%), Positives = 26/56 (46%), Gaps = 5/56 (9%)
 Frame = +3

Query  231  LSNLNKFSLRQNLITDAALEPLSSWHTISQLEELVLRDNQLKKIPVLAYLRNFWYL  398
            L  +    LRQNLI     + + +   +  L EL L DNQ+KKI  L  L     L
Sbjct  98   LKKVKSLCLRQNLI-----KCIENLEELQSLRELDLYDNQIKKIENLEALTELEVL  148



>ref|XP_006749060.1| PREDICTED: protein phosphatase 1 regulatory subunit 7-like [Leptonychotes 
weddellii]
Length=289

 Score = 58.2 bits (139),  Expect(2) = 4e-09, Method: Compositional matrix adjust.
 Identities = 38/81 (47%), Positives = 62/81 (77%), Gaps = 1/81 (1%)
 Frame = +2

Query  377  FKKLLVFDVSFNEITSPSGLSKVSSTLKELYVSNNQIAKIEEIEHFHELQILELGSNKLR  556
              +L + D+SFN + +  G+ K++  LK+L++ NN+I+KIE I + H+LQ+LELGSN++R
Sbjct  141  LTQLEILDISFNLLRNIEGVEKLTQ-LKKLFLVNNKISKIENISNLHQLQMLELGSNRIR  199

Query  557  VMenlqtltnlxelwlGRNRI  619
             +EN+ TLT+L  L+LG+N+I
Sbjct  200  AIENIDTLTSLESLFLGKNKI  220


 Score = 29.6 bits (65),  Expect(2) = 4e-09, Method: Compositional matrix adjust.
 Identities = 20/56 (36%), Positives = 26/56 (46%), Gaps = 5/56 (9%)
 Frame = +3

Query  231  LSNLNKFSLRQNLITDAALEPLSSWHTISQLEELVLRDNQLKKIPVLAYLRNFWYL  398
            L  +    LRQNLI     + + +   +  L EL L DNQ+KKI  L  L     L
Sbjct  97   LKKVKTLCLRQNLI-----KCIENLEELQSLRELDLYDNQIKKIENLEALTQLEIL  147



>dbj|BAE26253.1| unnamed protein product [Mus musculus]
Length=361

 Score = 58.2 bits (139),  Expect(2) = 5e-09, Method: Compositional matrix adjust.
 Identities = 40/81 (49%), Positives = 61/81 (75%), Gaps = 1/81 (1%)
 Frame = +2

Query  377  FKKLLVFDVSFNEITSPSGLSKVSSTLKELYVSNNQIAKIEEIEHFHELQILELGSNKLR  556
              +L V D+SFN + +  G+ K++  LK+L++ NN+I KIE I + H+LQ+LELGSN++R
Sbjct  142  LTELEVLDISFNMLRNIEGIDKLTQ-LKKLFLVNNKINKIENISNLHQLQMLELGSNRIR  200

Query  557  VMenlqtltnlxelwlGRNRI  619
             +EN+ TLTNL  L+LG+N+I
Sbjct  201  AIENIDTLTNLESLFLGKNKI  221


 Score = 29.3 bits (64),  Expect(2) = 5e-09, Method: Compositional matrix adjust.
 Identities = 20/56 (36%), Positives = 26/56 (46%), Gaps = 5/56 (9%)
 Frame = +3

Query  231  LSNLNKFSLRQNLITDAALEPLSSWHTISQLEELVLRDNQLKKIPVLAYLRNFWYL  398
            L  +    LRQNLI     + + +   +  L EL L DNQ+KKI  L  L     L
Sbjct  98   LKKVKSLCLRQNLI-----KCIENLEELQSLRELDLYDNQIKKIENLEALTELEVL  148



>ref|XP_008589407.1| PREDICTED: protein phosphatase 1 regulatory subunit 7-like, partial 
[Galeopterus variegatus]
Length=236

 Score = 58.5 bits (140),  Expect(2) = 5e-09, Method: Compositional matrix adjust.
 Identities = 37/76 (49%), Positives = 60/76 (79%), Gaps = 1/76 (1%)
 Frame = +2

Query  392  VFDVSFNEITSPSGLSKVSSTLKELYVSNNQIAKIEEIEHFHELQILELGSNKLRVMenl  571
            + D+SFN + +  G+ K++  LK+L++ NN+I+KIE I + H+LQ+LELGSN++R +EN+
Sbjct  69   ILDISFNLLRNIEGIDKLTQ-LKKLFLVNNKISKIENISNLHQLQMLELGSNRIRAIENI  127

Query  572  qtltnlxelwlGRNRI  619
             TLT+L  L+LG+N+I
Sbjct  128  DTLTSLESLFLGKNKI  143


 Score = 28.9 bits (63),  Expect(2) = 5e-09, Method: Compositional matrix adjust.
 Identities = 22/56 (39%), Positives = 26/56 (46%), Gaps = 5/56 (9%)
 Frame = +3

Query  231  LSNLNKFSLRQNLITDAALEPLSSWHTISQLEELVLRDNQLKKIPVLAYLRNFWYL  398
            L  +    LRQNLI    +E L    +   L EL L DNQ+KKI  L  L     L
Sbjct  20   LKKVKTLCLRQNLI--KCIENLEELQS---LRELDLYDNQIKKIENLEALTELEIL  70



>ref|NP_075689.1| protein phosphatase 1 regulatory subunit 7 [Mus musculus]
 sp|Q3UM45.2|PP1R7_MOUSE RecName: Full=Protein phosphatase 1 regulatory subunit 7; AltName: 
Full=Protein phosphatase 1 regulatory subunit 22 [Mus 
musculus]
 gb|AAK00624.1|AF222867_1 protein phosphatase-1 regulatory subunit 7 [Mus musculus]
 gb|AAK08624.1| protein phosphatase-1 regulatory subunit 7 [Mus musculus]
 gb|AAH13524.1| Protein phosphatase 1, regulatory (inhibitor) subunit 7 [Mus 
musculus]
 dbj|BAE36954.1| unnamed protein product [Mus musculus]
 gb|EDL39962.1| protein phosphatase 1, regulatory (inhibitor) subunit 7, isoform 
CRA_b [Mus musculus]
Length=361

 Score = 58.5 bits (140),  Expect(2) = 6e-09, Method: Compositional matrix adjust.
 Identities = 40/81 (49%), Positives = 61/81 (75%), Gaps = 1/81 (1%)
 Frame = +2

Query  377  FKKLLVFDVSFNEITSPSGLSKVSSTLKELYVSNNQIAKIEEIEHFHELQILELGSNKLR  556
              +L V D+SFN + +  G+ K++  LK+L++ NN+I KIE I + H+LQ+LELGSN++R
Sbjct  142  LTELEVLDISFNMLRNIEGIDKLTQ-LKKLFLVNNKINKIENISNLHQLQMLELGSNRIR  200

Query  557  VMenlqtltnlxelwlGRNRI  619
             +EN+ TLTNL  L+LG+N+I
Sbjct  201  AIENIDTLTNLESLFLGKNKI  221


 Score = 28.9 bits (63),  Expect(2) = 6e-09, Method: Compositional matrix adjust.
 Identities = 20/56 (36%), Positives = 26/56 (46%), Gaps = 5/56 (9%)
 Frame = +3

Query  231  LSNLNKFSLRQNLITDAALEPLSSWHTISQLEELVLRDNQLKKIPVLAYLRNFWYL  398
            L  +    LRQNLI     + + +   +  L EL L DNQ+KKI  L  L     L
Sbjct  98   LKKVKSLCLRQNLI-----KCIENLEELQSLRELDLYDNQIKKIENLEALTELEVL  148



>ref|XP_005005741.1| PREDICTED: protein phosphatase 1 regulatory subunit 7 isoform 
X2 [Cavia porcellus]
Length=326

 Score = 57.8 bits (138),  Expect(2) = 7e-09, Method: Compositional matrix adjust.
 Identities = 38/81 (47%), Positives = 62/81 (77%), Gaps = 1/81 (1%)
 Frame = +2

Query  377  FKKLLVFDVSFNEITSPSGLSKVSSTLKELYVSNNQIAKIEEIEHFHELQILELGSNKLR  556
              +L + D+SFN + +  G+ K++  LK+L++ NN+I+KIE + + H+LQ+LELGSN++R
Sbjct  135  LTELEILDISFNLLRNIEGIDKLTQ-LKKLFLVNNKISKIENLSNLHQLQMLELGSNRIR  193

Query  557  VMenlqtltnlxelwlGRNRI  619
             +EN+ TLTNL  L+LG+N+I
Sbjct  194  AIENIDTLTNLQSLFLGKNKI  214


 Score = 29.6 bits (65),  Expect(2) = 7e-09, Method: Compositional matrix adjust.
 Identities = 20/56 (36%), Positives = 26/56 (46%), Gaps = 5/56 (9%)
 Frame = +3

Query  231  LSNLNKFSLRQNLITDAALEPLSSWHTISQLEELVLRDNQLKKIPVLAYLRNFWYL  398
            L  +    LRQNLI     + + +   +  L EL L DNQ+KKI  L  L     L
Sbjct  91   LKKVKTLCLRQNLI-----KCIENLEELQSLRELDLYDNQIKKIENLEALTELEIL  141



>ref|NP_001124579.1| protein phosphatase 1 regulatory subunit 7 [Pongo abelii]
 sp|Q5RFS7.1|PP1R7_PONAB RecName: Full=Protein phosphatase 1 regulatory subunit 7; AltName: 
Full=Protein phosphatase 1 regulatory subunit 22 [Pongo 
abelii]
 emb|CAH89380.1| hypothetical protein [Pongo abelii]
Length=360

 Score = 58.2 bits (139),  Expect(2) = 7e-09, Method: Compositional matrix adjust.
 Identities = 39/81 (48%), Positives = 62/81 (77%), Gaps = 1/81 (1%)
 Frame = +2

Query  377  FKKLLVFDVSFNEITSPSGLSKVSSTLKELYVSNNQIAKIEEIEHFHELQILELGSNKLR  556
              +L + D+SFN + +  G+ KV+  LK+L++ NN+I+KIE + + H+LQ+LELGSN++R
Sbjct  141  LTELEILDISFNLLRNIEGVDKVTQ-LKKLFLVNNKISKIENLSNLHQLQMLELGSNRIR  199

Query  557  VMenlqtltnlxelwlGRNRI  619
             +EN+ TLTNL  L+LG+N+I
Sbjct  200  AIENIDTLTNLESLFLGKNKI  220


 Score = 28.9 bits (63),  Expect(2) = 7e-09, Method: Compositional matrix adjust.
 Identities = 19/50 (38%), Positives = 25/50 (50%), Gaps = 5/50 (10%)
 Frame = +3

Query  231  LSNLNKFSLRQNLITDAALEPLSSWHTISQLEELVLRDNQLKKIPVLAYL  380
            L  +    LRQNLI     + + +   +  L EL L DNQ+KKI  L  L
Sbjct  97   LKKVKTLCLRQNLI-----KCIENLEELQSLRELDLYDNQIKKIENLEAL  141



>gb|EDL39961.1| protein phosphatase 1, regulatory (inhibitor) subunit 7, isoform 
CRA_a [Mus musculus]
Length=317

 Score = 58.5 bits (140),  Expect(2) = 7e-09, Method: Compositional matrix adjust.
 Identities = 40/81 (49%), Positives = 61/81 (75%), Gaps = 1/81 (1%)
 Frame = +2

Query  377  FKKLLVFDVSFNEITSPSGLSKVSSTLKELYVSNNQIAKIEEIEHFHELQILELGSNKLR  556
              +L V D+SFN + +  G+ K++  LK+L++ NN+I KIE I + H+LQ+LELGSN++R
Sbjct  98   LTELEVLDISFNMLRNIEGIDKLTQ-LKKLFLVNNKINKIENISNLHQLQMLELGSNRIR  156

Query  557  VMenlqtltnlxelwlGRNRI  619
             +EN+ TLTNL  L+LG+N+I
Sbjct  157  AIENIDTLTNLESLFLGKNKI  177


 Score = 28.5 bits (62),  Expect(2) = 7e-09, Method: Compositional matrix adjust.
 Identities = 19/50 (38%), Positives = 25/50 (50%), Gaps = 5/50 (10%)
 Frame = +3

Query  231  LSNLNKFSLRQNLITDAALEPLSSWHTISQLEELVLRDNQLKKIPVLAYL  380
            L  +    LRQNLI     + + +   +  L EL L DNQ+KKI  L  L
Sbjct  54   LKKVKSLCLRQNLI-----KCIENLEELQSLRELDLYDNQIKKIENLEAL  98



>ref|XP_010345586.1| PREDICTED: protein phosphatase 1 regulatory subunit 7 isoform 
X2 [Saimiri boliviensis boliviensis]
Length=319

 Score = 56.6 bits (135),  Expect(2) = 7e-09, Method: Compositional matrix adjust.
 Identities = 38/81 (47%), Positives = 62/81 (77%), Gaps = 1/81 (1%)
 Frame = +2

Query  377  FKKLLVFDVSFNEITSPSGLSKVSSTLKELYVSNNQIAKIEEIEHFHELQILELGSNKLR  556
              +L + D+SFN + +  G+ K++  LK+L++ NN+I+KIE + + H+LQ+LELGSN++R
Sbjct  141  LTELEILDISFNLLRNIEGVDKLTQ-LKKLFLVNNKISKIENLSNLHQLQMLELGSNRIR  199

Query  557  VMenlqtltnlxelwlGRNRI  619
             +EN+ TLTNL  L+LG+N+I
Sbjct  200  AIENIDTLTNLESLFLGKNKI  220


 Score = 30.0 bits (66),  Expect(2) = 7e-09, Method: Compositional matrix adjust.
 Identities = 20/56 (36%), Positives = 26/56 (46%), Gaps = 5/56 (9%)
 Frame = +3

Query  231  LSNLNKFSLRQNLITDAALEPLSSWHTISQLEELVLRDNQLKKIPVLAYLRNFWYL  398
            L  +    LRQNLI     + + +   +  L EL L DNQ+KKI  L  L     L
Sbjct  97   LKKVKTLCLRQNLI-----KCIENLEELQSLRELDLYDNQIKKIENLEALTELEIL  147



>ref|XP_004637422.1| PREDICTED: protein phosphatase 1 regulatory subunit 7 isoform 
X1 [Octodon degus]
Length=360

 Score = 58.2 bits (139),  Expect(2) = 8e-09, Method: Compositional matrix adjust.
 Identities = 38/81 (47%), Positives = 62/81 (77%), Gaps = 1/81 (1%)
 Frame = +2

Query  377  FKKLLVFDVSFNEITSPSGLSKVSSTLKELYVSNNQIAKIEEIEHFHELQILELGSNKLR  556
              +L + D+SFN + +  G+ K++  LK+L++ NN+I+KIE + + H+LQ+LELGSN++R
Sbjct  141  LTELEILDISFNLLRTIEGIDKLTQ-LKKLFLVNNKISKIENLSNLHQLQMLELGSNRIR  199

Query  557  VMenlqtltnlxelwlGRNRI  619
             +EN+ TLTNL  L+LG+N+I
Sbjct  200  AIENIDTLTNLESLFLGKNKI  220


 Score = 28.9 bits (63),  Expect(2) = 8e-09, Method: Compositional matrix adjust.
 Identities = 19/50 (38%), Positives = 25/50 (50%), Gaps = 5/50 (10%)
 Frame = +3

Query  231  LSNLNKFSLRQNLITDAALEPLSSWHTISQLEELVLRDNQLKKIPVLAYL  380
            L  +    LRQNLI     + + +   +  L EL L DNQ+KKI  L  L
Sbjct  97   LKKVKTLCLRQNLI-----KCIENLEELQSLRELDLYDNQIKKIENLEAL  141



>ref|XP_011228084.1| PREDICTED: protein phosphatase 1 regulatory subunit 7 isoform 
X1 [Ailuropoda melanoleuca]
Length=364

 Score = 57.8 bits (138),  Expect(2) = 8e-09, Method: Compositional matrix adjust.
 Identities = 38/81 (47%), Positives = 61/81 (75%), Gaps = 1/81 (1%)
 Frame = +2

Query  377  FKKLLVFDVSFNEITSPSGLSKVSSTLKELYVSNNQIAKIEEIEHFHELQILELGSNKLR  556
              +L + D+SFN + +  G+ K++  LK L++ NN+I+KIE I + H+LQ+LELGSN++R
Sbjct  145  LTQLEILDISFNLLRNIEGVDKLTR-LKRLFLVNNKISKIENISNLHQLQMLELGSNRIR  203

Query  557  VMenlqtltnlxelwlGRNRI  619
             +EN+ TLT+L  L+LG+N+I
Sbjct  204  AIENIDTLTSLESLFLGKNKI  224


 Score = 28.9 bits (63),  Expect(2) = 8e-09, Method: Compositional matrix adjust.
 Identities = 20/56 (36%), Positives = 26/56 (46%), Gaps = 5/56 (9%)
 Frame = +3

Query  231  LSNLNKFSLRQNLITDAALEPLSSWHTISQLEELVLRDNQLKKIPVLAYLRNFWYL  398
            L  +    LRQNLI     + + +   +  L EL L DNQ+KKI  L  L     L
Sbjct  101  LKKVKTLCLRQNLI-----KCIENLEELQSLRELDLYDNQIKKIENLEALTQLEIL  151



>ref|XP_007085111.1| PREDICTED: protein phosphatase 1 regulatory subunit 7 isoform 
X1 [Panthera tigris altaica]
Length=364

 Score = 57.4 bits (137),  Expect(2) = 9e-09, Method: Compositional matrix adjust.
 Identities = 38/81 (47%), Positives = 61/81 (75%), Gaps = 1/81 (1%)
 Frame = +2

Query  377  FKKLLVFDVSFNEITSPSGLSKVSSTLKELYVSNNQIAKIEEIEHFHELQILELGSNKLR  556
              +L + D+SFN + +  G+ K++  LK+L++ NN+I+KIE I   H+LQ+LELGSN++R
Sbjct  145  LTQLEILDISFNLLRNIEGVDKLTR-LKKLFLVNNKISKIENISSLHQLQMLELGSNRIR  203

Query  557  VMenlqtltnlxelwlGRNRI  619
             +EN+ TLT+L  L+LG+N+I
Sbjct  204  AIENIDTLTSLESLFLGKNKI  224


 Score = 29.3 bits (64),  Expect(2) = 9e-09, Method: Compositional matrix adjust.
 Identities = 20/56 (36%), Positives = 26/56 (46%), Gaps = 5/56 (9%)
 Frame = +3

Query  231  LSNLNKFSLRQNLITDAALEPLSSWHTISQLEELVLRDNQLKKIPVLAYLRNFWYL  398
            L  +    LRQNLI     + + +   +  L EL L DNQ+KKI  L  L     L
Sbjct  101  LKKVKSLCLRQNLI-----KCIENLEELQSLRELDLYDNQIKKIENLEALTQLEIL  151



>ref|XP_002923185.1| PREDICTED: protein phosphatase 1 regulatory subunit 7 isoform 
X2 [Ailuropoda melanoleuca]
Length=360

 Score = 58.2 bits (139),  Expect(2) = 9e-09, Method: Compositional matrix adjust.
 Identities = 38/81 (47%), Positives = 61/81 (75%), Gaps = 1/81 (1%)
 Frame = +2

Query  377  FKKLLVFDVSFNEITSPSGLSKVSSTLKELYVSNNQIAKIEEIEHFHELQILELGSNKLR  556
              +L + D+SFN + +  G+ K++  LK L++ NN+I+KIE I + H+LQ+LELGSN++R
Sbjct  141  LTQLEILDISFNLLRNIEGVDKLTR-LKRLFLVNNKISKIENISNLHQLQMLELGSNRIR  199

Query  557  VMenlqtltnlxelwlGRNRI  619
             +EN+ TLT+L  L+LG+N+I
Sbjct  200  AIENIDTLTSLESLFLGKNKI  220


 Score = 28.9 bits (63),  Expect(2) = 9e-09, Method: Compositional matrix adjust.
 Identities = 19/50 (38%), Positives = 25/50 (50%), Gaps = 5/50 (10%)
 Frame = +3

Query  231  LSNLNKFSLRQNLITDAALEPLSSWHTISQLEELVLRDNQLKKIPVLAYL  380
            L  +    LRQNLI     + + +   +  L EL L DNQ+KKI  L  L
Sbjct  97   LKKVKTLCLRQNLI-----KCIENLEELQSLRELDLYDNQIKKIENLEAL  141



>ref|XP_006935810.1| PREDICTED: protein phosphatase 1 regulatory subunit 7 isoform 
X1 [Felis catus]
Length=364

 Score = 57.4 bits (137),  Expect(2) = 9e-09, Method: Compositional matrix adjust.
 Identities = 38/81 (47%), Positives = 61/81 (75%), Gaps = 1/81 (1%)
 Frame = +2

Query  377  FKKLLVFDVSFNEITSPSGLSKVSSTLKELYVSNNQIAKIEEIEHFHELQILELGSNKLR  556
              +L + D+SFN + +  G+ K++  LK+L++ NN+I+KIE I   H+LQ+LELGSN++R
Sbjct  145  LTQLEILDISFNLLRNIEGVDKLTR-LKKLFLVNNKISKIENISSLHQLQMLELGSNRIR  203

Query  557  VMenlqtltnlxelwlGRNRI  619
             +EN+ TLT+L  L+LG+N+I
Sbjct  204  AIENIDTLTSLESLFLGKNKI  224


 Score = 29.3 bits (64),  Expect(2) = 9e-09, Method: Compositional matrix adjust.
 Identities = 20/56 (36%), Positives = 26/56 (46%), Gaps = 5/56 (9%)
 Frame = +3

Query  231  LSNLNKFSLRQNLITDAALEPLSSWHTISQLEELVLRDNQLKKIPVLAYLRNFWYL  398
            L  +    LRQNLI     + + +   +  L EL L DNQ+KKI  L  L     L
Sbjct  101  LKKVKSLCLRQNLI-----KCIENLEELQSLRELDLYDNQIKKIENLEALTQLEIL  151



>ref|XP_011228085.1| PREDICTED: protein phosphatase 1 regulatory subunit 7 isoform 
X3 [Ailuropoda melanoleuca]
Length=350

 Score = 57.8 bits (138),  Expect(2) = 9e-09, Method: Compositional matrix adjust.
 Identities = 38/79 (48%), Positives = 61/79 (77%), Gaps = 1/79 (1%)
 Frame = +2

Query  383  KLLVFDVSFNEITSPSGLSKVSSTLKELYVSNNQIAKIEEIEHFHELQILELGSNKLRVM  562
            +L + D+SFN + +  G+ K++  LK L++ NN+I+KIE I + H+LQ+LELGSN++R +
Sbjct  133  QLEILDISFNLLRNIEGVDKLTR-LKRLFLVNNKISKIENISNLHQLQMLELGSNRIRAI  191

Query  563  enlqtltnlxelwlGRNRI  619
            EN+ TLT+L  L+LG+N+I
Sbjct  192  ENIDTLTSLESLFLGKNKI  210


 Score = 28.5 bits (62),  Expect(2) = 9e-09, Method: Compositional matrix adjust.
 Identities = 19/50 (38%), Positives = 25/50 (50%), Gaps = 5/50 (10%)
 Frame = +3

Query  231  LSNLNKFSLRQNLITDAALEPLSSWHTISQLEELVLRDNQLKKIPVLAYL  380
            L  +    LRQNLI     + + +   +  L EL L DNQ+KKI  L  L
Sbjct  87   LKKVKTLCLRQNLI-----KCIENLEELQSLRELDLYDNQIKKIENLEAL  131



>ref|XP_010375307.1| PREDICTED: protein phosphatase 1 regulatory subunit 7 isoform 
X3 [Rhinopithecus roxellana]
Length=295

 Score = 57.0 bits (136),  Expect(2) = 1e-08, Method: Compositional matrix adjust.
 Identities = 38/81 (47%), Positives = 62/81 (77%), Gaps = 1/81 (1%)
 Frame = +2

Query  377  FKKLLVFDVSFNEITSPSGLSKVSSTLKELYVSNNQIAKIEEIEHFHELQILELGSNKLR  556
              +L + D+SFN + +  G+ K++  LK+L++ NN+I+KIE + + H+LQ+LELGSN++R
Sbjct  156  LTELEILDISFNLLRNIEGVDKLTR-LKKLFLVNNKISKIENLSNLHQLQMLELGSNRIR  214

Query  557  VMenlqtltnlxelwlGRNRI  619
             +EN+ TLTNL  L+LG+N+I
Sbjct  215  AIENIDTLTNLESLFLGKNKI  235


 Score = 29.6 bits (65),  Expect(2) = 1e-08, Method: Compositional matrix adjust.
 Identities = 20/56 (36%), Positives = 26/56 (46%), Gaps = 5/56 (9%)
 Frame = +3

Query  231  LSNLNKFSLRQNLITDAALEPLSSWHTISQLEELVLRDNQLKKIPVLAYLRNFWYL  398
            L  +    LRQNLI     + + +   +  L EL L DNQ+KKI  L  L     L
Sbjct  112  LKKVKTLCLRQNLI-----KCIENLEELQSLRELDLYDNQIKKIENLEALTELEIL  162



>ref|XP_004743831.1| PREDICTED: protein phosphatase 1 regulatory subunit 7 isoform 
X4 [Mustela putorius furo]
Length=295

 Score = 57.4 bits (137),  Expect(2) = 1e-08, Method: Compositional matrix adjust.
 Identities = 38/81 (47%), Positives = 61/81 (75%), Gaps = 1/81 (1%)
 Frame = +2

Query  377  FKKLLVFDVSFNEITSPSGLSKVSSTLKELYVSNNQIAKIEEIEHFHELQILELGSNKLR  556
              +L + D+SFN + +  G+ K++  LK+L++ NN+I+KIE I   H+LQ+LELGSN++R
Sbjct  145  LTQLEILDISFNLLRNIEGVDKLTR-LKKLFLVNNKISKIENISTLHQLQMLELGSNRIR  203

Query  557  VMenlqtltnlxelwlGRNRI  619
             +EN+ TLT+L  L+LG+N+I
Sbjct  204  AIENIDTLTSLESLFLGKNKI  224


 Score = 29.3 bits (64),  Expect(2) = 1e-08, Method: Compositional matrix adjust.
 Identities = 20/56 (36%), Positives = 26/56 (46%), Gaps = 5/56 (9%)
 Frame = +3

Query  231  LSNLNKFSLRQNLITDAALEPLSSWHTISQLEELVLRDNQLKKIPVLAYLRNFWYL  398
            L  +    LRQNLI     + + +   +  L EL L DNQ+KKI  L  L     L
Sbjct  101  LKKVKTLCLRQNLI-----KYIENLEELQSLRELDLYDNQIKKIENLEALTQLEIL  151



>ref|XP_007085112.1| PREDICTED: protein phosphatase 1 regulatory subunit 7 isoform 
X2 [Panthera tigris altaica]
Length=360

 Score = 57.8 bits (138),  Expect(2) = 1e-08, Method: Compositional matrix adjust.
 Identities = 38/81 (47%), Positives = 61/81 (75%), Gaps = 1/81 (1%)
 Frame = +2

Query  377  FKKLLVFDVSFNEITSPSGLSKVSSTLKELYVSNNQIAKIEEIEHFHELQILELGSNKLR  556
              +L + D+SFN + +  G+ K++  LK+L++ NN+I+KIE I   H+LQ+LELGSN++R
Sbjct  141  LTQLEILDISFNLLRNIEGVDKLTR-LKKLFLVNNKISKIENISSLHQLQMLELGSNRIR  199

Query  557  VMenlqtltnlxelwlGRNRI  619
             +EN+ TLT+L  L+LG+N+I
Sbjct  200  AIENIDTLTSLESLFLGKNKI  220


 Score = 28.9 bits (63),  Expect(2) = 1e-08, Method: Compositional matrix adjust.
 Identities = 20/56 (36%), Positives = 26/56 (46%), Gaps = 5/56 (9%)
 Frame = +3

Query  231  LSNLNKFSLRQNLITDAALEPLSSWHTISQLEELVLRDNQLKKIPVLAYLRNFWYL  398
            L  +    LRQNLI     + + +   +  L EL L DNQ+KKI  L  L     L
Sbjct  97   LKKVKSLCLRQNLI-----KCIENLEELQSLRELDLYDNQIKKIENLEALTQLEIL  147



>ref|XP_003991355.1| PREDICTED: protein phosphatase 1 regulatory subunit 7 isoform 
X2 [Felis catus]
Length=360

 Score = 57.8 bits (138),  Expect(2) = 1e-08, Method: Compositional matrix adjust.
 Identities = 38/81 (47%), Positives = 61/81 (75%), Gaps = 1/81 (1%)
 Frame = +2

Query  377  FKKLLVFDVSFNEITSPSGLSKVSSTLKELYVSNNQIAKIEEIEHFHELQILELGSNKLR  556
              +L + D+SFN + +  G+ K++  LK+L++ NN+I+KIE I   H+LQ+LELGSN++R
Sbjct  141  LTQLEILDISFNLLRNIEGVDKLTR-LKKLFLVNNKISKIENISSLHQLQMLELGSNRIR  199

Query  557  VMenlqtltnlxelwlGRNRI  619
             +EN+ TLT+L  L+LG+N+I
Sbjct  200  AIENIDTLTSLESLFLGKNKI  220


 Score = 28.9 bits (63),  Expect(2) = 1e-08, Method: Compositional matrix adjust.
 Identities = 20/56 (36%), Positives = 26/56 (46%), Gaps = 5/56 (9%)
 Frame = +3

Query  231  LSNLNKFSLRQNLITDAALEPLSSWHTISQLEELVLRDNQLKKIPVLAYLRNFWYL  398
            L  +    LRQNLI     + + +   +  L EL L DNQ+KKI  L  L     L
Sbjct  97   LKKVKSLCLRQNLI-----KCIENLEELQSLRELDLYDNQIKKIENLEALTQLEIL  147



>ref|XP_009442993.1| PREDICTED: protein phosphatase 1 regulatory subunit 7 isoform 
X4 [Pan troglodytes]
Length=280

 Score = 57.0 bits (136),  Expect(2) = 1e-08, Method: Compositional matrix adjust.
 Identities = 38/81 (47%), Positives = 62/81 (77%), Gaps = 1/81 (1%)
 Frame = +2

Query  377  FKKLLVFDVSFNEITSPSGLSKVSSTLKELYVSNNQIAKIEEIEHFHELQILELGSNKLR  556
              +L + D+SFN + +  G+ K++  LK+L++ NN+I+KIE + + H+LQ+LELGSN++R
Sbjct  141  LTELEILDISFNLLRNIEGVDKLTR-LKKLFLVNNKISKIENLSNLHQLQMLELGSNRIR  199

Query  557  VMenlqtltnlxelwlGRNRI  619
             +EN+ TLTNL  L+LG+N+I
Sbjct  200  AIENIDTLTNLESLFLGKNKI  220


 Score = 29.3 bits (64),  Expect(2) = 1e-08, Method: Compositional matrix adjust.
 Identities = 22/56 (39%), Positives = 26/56 (46%), Gaps = 5/56 (9%)
 Frame = +3

Query  231  LSNLNKFSLRQNLITDAALEPLSSWHTISQLEELVLRDNQLKKIPVLAYLRNFWYL  398
            L  +    LRQNLI    +E L    +   L EL L DNQ+KKI  L  L     L
Sbjct  97   LKKVKNLCLRQNLI--KCIENLEELQS---LRELDLYDNQIKKIENLEALTELEIL  147



>ref|XP_011228086.1| PREDICTED: protein phosphatase 1 regulatory subunit 7 isoform 
X4 [Ailuropoda melanoleuca]
Length=317

 Score = 57.8 bits (138),  Expect(2) = 1e-08, Method: Compositional matrix adjust.
 Identities = 38/81 (47%), Positives = 61/81 (75%), Gaps = 1/81 (1%)
 Frame = +2

Query  377  FKKLLVFDVSFNEITSPSGLSKVSSTLKELYVSNNQIAKIEEIEHFHELQILELGSNKLR  556
              +L + D+SFN + +  G+ K++  LK L++ NN+I+KIE I + H+LQ+LELGSN++R
Sbjct  98   LTQLEILDISFNLLRNIEGVDKLTR-LKRLFLVNNKISKIENISNLHQLQMLELGSNRIR  156

Query  557  VMenlqtltnlxelwlGRNRI  619
             +EN+ TLT+L  L+LG+N+I
Sbjct  157  AIENIDTLTSLESLFLGKNKI  177


 Score = 28.5 bits (62),  Expect(2) = 1e-08, Method: Compositional matrix adjust.
 Identities = 19/50 (38%), Positives = 25/50 (50%), Gaps = 5/50 (10%)
 Frame = +3

Query  231  LSNLNKFSLRQNLITDAALEPLSSWHTISQLEELVLRDNQLKKIPVLAYL  380
            L  +    LRQNLI     + + +   +  L EL L DNQ+KKI  L  L
Sbjct  54   LKKVKTLCLRQNLI-----KCIENLEELQSLRELDLYDNQIKKIENLEAL  98



>ref|XP_006989656.1| PREDICTED: protein phosphatase 1 regulatory subunit 7 isoform 
X2 [Peromyscus maniculatus bairdii]
Length=282

 Score = 56.2 bits (134),  Expect(2) = 1e-08, Method: Compositional matrix adjust.
 Identities = 39/81 (48%), Positives = 60/81 (74%), Gaps = 1/81 (1%)
 Frame = +2

Query  377  FKKLLVFDVSFNEITSPSGLSKVSSTLKELYVSNNQIAKIEEIEHFHELQILELGSNKLR  556
              +L + D+SFN + +  G+ K++  LK+L++ NN+I KIE I   H+LQ+LELGSN++R
Sbjct  141  LTELEILDISFNLLRNIEGIDKLTQ-LKKLFLVNNKINKIENISTLHQLQMLELGSNRIR  199

Query  557  VMenlqtltnlxelwlGRNRI  619
             +EN+ TLTNL  L+LG+N+I
Sbjct  200  AIENIDTLTNLESLFLGKNKI  220


 Score = 30.0 bits (66),  Expect(2) = 1e-08, Method: Compositional matrix adjust.
 Identities = 22/56 (39%), Positives = 26/56 (46%), Gaps = 5/56 (9%)
 Frame = +3

Query  231  LSNLNKFSLRQNLITDAALEPLSSWHTISQLEELVLRDNQLKKIPVLAYLRNFWYL  398
            L  +    LRQNLI    +E L    +   L EL L DNQ+KKI  L  L     L
Sbjct  97   LKKVKSLCLRQNLI--KCIENLEELQS---LRELDLYDNQIKKIENLEALTELEIL  147



>ref|XP_004637423.1| PREDICTED: protein phosphatase 1 regulatory subunit 7 isoform 
X2 [Octodon degus]
Length=317

 Score = 57.8 bits (138),  Expect(2) = 1e-08, Method: Compositional matrix adjust.
 Identities = 38/81 (47%), Positives = 62/81 (77%), Gaps = 1/81 (1%)
 Frame = +2

Query  377  FKKLLVFDVSFNEITSPSGLSKVSSTLKELYVSNNQIAKIEEIEHFHELQILELGSNKLR  556
              +L + D+SFN + +  G+ K++  LK+L++ NN+I+KIE + + H+LQ+LELGSN++R
Sbjct  98   LTELEILDISFNLLRTIEGIDKLTQ-LKKLFLVNNKISKIENLSNLHQLQMLELGSNRIR  156

Query  557  VMenlqtltnlxelwlGRNRI  619
             +EN+ TLTNL  L+LG+N+I
Sbjct  157  AIENIDTLTNLESLFLGKNKI  177


 Score = 28.5 bits (62),  Expect(2) = 1e-08, Method: Compositional matrix adjust.
 Identities = 19/50 (38%), Positives = 25/50 (50%), Gaps = 5/50 (10%)
 Frame = +3

Query  231  LSNLNKFSLRQNLITDAALEPLSSWHTISQLEELVLRDNQLKKIPVLAYL  380
            L  +    LRQNLI     + + +   +  L EL L DNQ+KKI  L  L
Sbjct  54   LKKVKTLCLRQNLI-----KCIENLEELQSLRELDLYDNQIKKIENLEAL  98



>ref|XP_004809710.1| PREDICTED: protein phosphatase 1 regulatory subunit 7 isoform 
X2 [Mustela putorius furo]
Length=291

 Score = 57.4 bits (137),  Expect(2) = 1e-08, Method: Compositional matrix adjust.
 Identities = 38/81 (47%), Positives = 61/81 (75%), Gaps = 1/81 (1%)
 Frame = +2

Query  377  FKKLLVFDVSFNEITSPSGLSKVSSTLKELYVSNNQIAKIEEIEHFHELQILELGSNKLR  556
              +L + D+SFN + +  G+ K++  LK+L++ NN+I+KIE I   H+LQ+LELGSN++R
Sbjct  141  LTQLEILDISFNLLRNIEGVDKLTR-LKKLFLVNNKISKIENISTLHQLQMLELGSNRIR  199

Query  557  VMenlqtltnlxelwlGRNRI  619
             +EN+ TLT+L  L+LG+N+I
Sbjct  200  AIENIDTLTSLESLFLGKNKI  220


 Score = 28.9 bits (63),  Expect(2) = 1e-08, Method: Compositional matrix adjust.
 Identities = 20/56 (36%), Positives = 26/56 (46%), Gaps = 5/56 (9%)
 Frame = +3

Query  231  LSNLNKFSLRQNLITDAALEPLSSWHTISQLEELVLRDNQLKKIPVLAYLRNFWYL  398
            L  +    LRQNLI     + + +   +  L EL L DNQ+KKI  L  L     L
Sbjct  97   LKKVKTLCLRQNLI-----KYIENLEELQSLRELDLYDNQIKKIENLEALTQLEIL  147



>ref|XP_009236625.1| PREDICTED: protein phosphatase 1 regulatory subunit 7 isoform 
X3 [Pongo abelii]
Length=237

 Score = 57.4 bits (137),  Expect(2) = 1e-08, Method: Compositional matrix adjust.
 Identities = 38/81 (47%), Positives = 62/81 (77%), Gaps = 1/81 (1%)
 Frame = +2

Query  377  FKKLLVFDVSFNEITSPSGLSKVSSTLKELYVSNNQIAKIEEIEHFHELQILELGSNKLR  556
              +L + D+SFN + +  G+ K++  LK+L++ NN+I+KIE + + H+LQ+LELGSN++R
Sbjct  98   LTELEILDISFNLLRNIEGVDKLTQ-LKKLFLVNNKISKIENLSNLHQLQMLELGSNRIR  156

Query  557  VMenlqtltnlxelwlGRNRI  619
             +EN+ TLTNL  L+LG+N+I
Sbjct  157  AIENIDTLTNLESLFLGKNKI  177


 Score = 28.9 bits (63),  Expect(2) = 1e-08, Method: Compositional matrix adjust.
 Identities = 22/56 (39%), Positives = 26/56 (46%), Gaps = 5/56 (9%)
 Frame = +3

Query  231  LSNLNKFSLRQNLITDAALEPLSSWHTISQLEELVLRDNQLKKIPVLAYLRNFWYL  398
            L  +    LRQNLI    +E L    +   L EL L DNQ+KKI  L  L     L
Sbjct  54   LKKVKTLCLRQNLI--KCIENLEELQS---LRELDLYDNQIKKIENLEALTELEIL  104



>ref|XP_003474608.2| PREDICTED: protein phosphatase 1 regulatory subunit 7 isoform 
X1 [Cavia porcellus]
Length=354

 Score = 57.4 bits (137),  Expect(2) = 1e-08, Method: Compositional matrix adjust.
 Identities = 38/81 (47%), Positives = 62/81 (77%), Gaps = 1/81 (1%)
 Frame = +2

Query  377  FKKLLVFDVSFNEITSPSGLSKVSSTLKELYVSNNQIAKIEEIEHFHELQILELGSNKLR  556
              +L + D+SFN + +  G+ K++  LK+L++ NN+I+KIE + + H+LQ+LELGSN++R
Sbjct  135  LTELEILDISFNLLRNIEGIDKLTQ-LKKLFLVNNKISKIENLSNLHQLQMLELGSNRIR  193

Query  557  VMenlqtltnlxelwlGRNRI  619
             +EN+ TLTNL  L+LG+N+I
Sbjct  194  AIENIDTLTNLQSLFLGKNKI  214


 Score = 28.9 bits (63),  Expect(2) = 1e-08, Method: Compositional matrix adjust.
 Identities = 19/50 (38%), Positives = 25/50 (50%), Gaps = 5/50 (10%)
 Frame = +3

Query  231  LSNLNKFSLRQNLITDAALEPLSSWHTISQLEELVLRDNQLKKIPVLAYL  380
            L  +    LRQNLI     + + +   +  L EL L DNQ+KKI  L  L
Sbjct  91   LKKVKTLCLRQNLI-----KCIENLEELQSLRELDLYDNQIKKIENLEAL  135



>ref|NP_001269339.1| protein phosphatase 1 regulatory subunit 7 isoform 3 [Homo sapiens]
 ref|XP_008963867.1| PREDICTED: protein phosphatase 1 regulatory subunit 7 isoform 
X3 [Pan paniscus]
 gb|AAD26612.1| protein phosphatase-1 regulatory subunit 7 beta1 [Homo sapiens]
 gb|AAH12397.1| PPP1R7 protein [Homo sapiens]
 gb|AAH13001.1| PPP1R7 protein [Homo sapiens]
 gb|AAP35960.1| protein phosphatase 1, regulatory subunit 7 [Homo sapiens]
 gb|AIC59180.1| PPP1R7, partial [synthetic construct]
Length=280

 Score = 57.0 bits (136),  Expect(2) = 1e-08, Method: Compositional matrix adjust.
 Identities = 38/81 (47%), Positives = 62/81 (77%), Gaps = 1/81 (1%)
 Frame = +2

Query  377  FKKLLVFDVSFNEITSPSGLSKVSSTLKELYVSNNQIAKIEEIEHFHELQILELGSNKLR  556
              +L + D+SFN + +  G+ K++  LK+L++ NN+I+KIE + + H+LQ+LELGSN++R
Sbjct  141  LTELEILDISFNLLRNIEGVDKLTR-LKKLFLVNNKISKIENLSNLHQLQMLELGSNRIR  199

Query  557  VMenlqtltnlxelwlGRNRI  619
             +EN+ TLTNL  L+LG+N+I
Sbjct  200  AIENIDTLTNLESLFLGKNKI  220


 Score = 29.3 bits (64),  Expect(2) = 1e-08, Method: Compositional matrix adjust.
 Identities = 22/56 (39%), Positives = 26/56 (46%), Gaps = 5/56 (9%)
 Frame = +3

Query  231  LSNLNKFSLRQNLITDAALEPLSSWHTISQLEELVLRDNQLKKIPVLAYLRNFWYL  398
            L  +    LRQNLI    +E L    +   L EL L DNQ+KKI  L  L     L
Sbjct  97   LKKVKTLCLRQNLI--KCIENLEELQS---LRELDLYDNQIKKIENLEALTELEIL  147



>ref|XP_005005742.1| PREDICTED: protein phosphatase 1 regulatory subunit 7 isoform 
X3 [Cavia porcellus]
Length=317

 Score = 57.8 bits (138),  Expect(2) = 1e-08, Method: Compositional matrix adjust.
 Identities = 38/81 (47%), Positives = 62/81 (77%), Gaps = 1/81 (1%)
 Frame = +2

Query  377  FKKLLVFDVSFNEITSPSGLSKVSSTLKELYVSNNQIAKIEEIEHFHELQILELGSNKLR  556
              +L + D+SFN + +  G+ K++  LK+L++ NN+I+KIE + + H+LQ+LELGSN++R
Sbjct  98   LTELEILDISFNLLRNIEGIDKLTQ-LKKLFLVNNKISKIENLSNLHQLQMLELGSNRIR  156

Query  557  VMenlqtltnlxelwlGRNRI  619
             +EN+ TLTNL  L+LG+N+I
Sbjct  157  AIENIDTLTNLQSLFLGKNKI  177


 Score = 28.5 bits (62),  Expect(2) = 1e-08, Method: Compositional matrix adjust.
 Identities = 19/50 (38%), Positives = 25/50 (50%), Gaps = 5/50 (10%)
 Frame = +3

Query  231  LSNLNKFSLRQNLITDAALEPLSSWHTISQLEELVLRDNQLKKIPVLAYL  380
            L  +    LRQNLI     + + +   +  L EL L DNQ+KKI  L  L
Sbjct  54   LKKVKTLCLRQNLI-----KCIENLEELQSLRELDLYDNQIKKIENLEAL  98



>ref|XP_010375308.1| PREDICTED: protein phosphatase 1 regulatory subunit 7 isoform 
X4 [Rhinopithecus roxellana]
Length=252

 Score = 57.0 bits (136),  Expect(2) = 1e-08, Method: Compositional matrix adjust.
 Identities = 38/81 (47%), Positives = 62/81 (77%), Gaps = 1/81 (1%)
 Frame = +2

Query  377  FKKLLVFDVSFNEITSPSGLSKVSSTLKELYVSNNQIAKIEEIEHFHELQILELGSNKLR  556
              +L + D+SFN + +  G+ K++  LK+L++ NN+I+KIE + + H+LQ+LELGSN++R
Sbjct  113  LTELEILDISFNLLRNIEGVDKLTR-LKKLFLVNNKISKIENLSNLHQLQMLELGSNRIR  171

Query  557  VMenlqtltnlxelwlGRNRI  619
             +EN+ TLTNL  L+LG+N+I
Sbjct  172  AIENIDTLTNLESLFLGKNKI  192


 Score = 29.3 bits (64),  Expect(2) = 1e-08, Method: Compositional matrix adjust.
 Identities = 20/56 (36%), Positives = 26/56 (46%), Gaps = 5/56 (9%)
 Frame = +3

Query  231  LSNLNKFSLRQNLITDAALEPLSSWHTISQLEELVLRDNQLKKIPVLAYLRNFWYL  398
            L  +    LRQNLI     + + +   +  L EL L DNQ+KKI  L  L     L
Sbjct  69   LKKVKTLCLRQNLI-----KCIENLEELQSLRELDLYDNQIKKIENLEALTELEIL  119



>ref|XP_008998061.1| PREDICTED: protein phosphatase 1 regulatory subunit 7 [Callithrix 
jacchus]
Length=361

 Score = 57.0 bits (136),  Expect(2) = 1e-08, Method: Compositional matrix adjust.
 Identities = 38/81 (47%), Positives = 62/81 (77%), Gaps = 1/81 (1%)
 Frame = +2

Query  377  FKKLLVFDVSFNEITSPSGLSKVSSTLKELYVSNNQIAKIEEIEHFHELQILELGSNKLR  556
              +L + D+SFN + +  G+ K++  LK+L++ NN+I+KIE + + H+LQ+LELGSN++R
Sbjct  142  LTELEILDISFNLLRNIEGVDKLTQ-LKKLFLVNNKISKIENLSNLHQLQMLELGSNRIR  200

Query  557  VMenlqtltnlxelwlGRNRI  619
             +EN+ TLTNL  L+LG+N+I
Sbjct  201  AIENIDTLTNLESLFLGKNKI  221


 Score = 28.9 bits (63),  Expect(2) = 1e-08, Method: Compositional matrix adjust.
 Identities = 22/52 (42%), Positives = 26/52 (50%), Gaps = 8/52 (15%)
 Frame = +3

Query  231  LSNLNKFSLRQNLI--TDAALEPLSSWHTISQLEELVLRDNQLKKIPVLAYL  380
            L  +    LRQNLI   +  +E L S      L EL L DNQ+KKI  L  L
Sbjct  97   LKKVKTLCLRQNLIKCIERVVEELQS------LRELDLXDNQIKKIENLEAL  142



>ref|XP_004412755.1| PREDICTED: protein phosphatase 1 regulatory subunit 7 isoform 
1 [Odobenus rosmarus divergens]
Length=360

 Score = 57.0 bits (136),  Expect(2) = 1e-08, Method: Compositional matrix adjust.
 Identities = 37/81 (46%), Positives = 62/81 (77%), Gaps = 1/81 (1%)
 Frame = +2

Query  377  FKKLLVFDVSFNEITSPSGLSKVSSTLKELYVSNNQIAKIEEIEHFHELQILELGSNKLR  556
              +L + D+SFN + +  G+ K++  LK+L++ NN+I+KIE + + H+LQ+LELGSN++R
Sbjct  141  LTQLEILDISFNLLRNIEGVEKLTR-LKKLFLVNNKISKIENVSNLHQLQMLELGSNRIR  199

Query  557  VMenlqtltnlxelwlGRNRI  619
             +EN+ TLT+L  L+LG+N+I
Sbjct  200  AIENIDTLTSLESLFLGKNKI  220


 Score = 28.9 bits (63),  Expect(2) = 1e-08, Method: Compositional matrix adjust.
 Identities = 20/56 (36%), Positives = 26/56 (46%), Gaps = 5/56 (9%)
 Frame = +3

Query  231  LSNLNKFSLRQNLITDAALEPLSSWHTISQLEELVLRDNQLKKIPVLAYLRNFWYL  398
            L  +    LRQNLI     + + +   +  L EL L DNQ+KKI  L  L     L
Sbjct  97   LKKVKTLCLRQNLI-----KCIENLEELQSLRELDLYDNQIKKIENLEALTQLEIL  147



>gb|EFB16581.1| hypothetical protein PANDA_012295 [Ailuropoda melanoleuca]
Length=282

 Score = 58.2 bits (139),  Expect(2) = 1e-08, Method: Compositional matrix adjust.
 Identities = 38/79 (48%), Positives = 61/79 (77%), Gaps = 1/79 (1%)
 Frame = +2

Query  383  KLLVFDVSFNEITSPSGLSKVSSTLKELYVSNNQIAKIEEIEHFHELQILELGSNKLRVM  562
            +L + D+SFN + +  G+ K++  LK L++ NN+I+KIE I + H+LQ+LELGSN++R +
Sbjct  65   QLEILDISFNLLRNIEGVDKLTR-LKRLFLVNNKISKIENISNLHQLQMLELGSNRIRAI  123

Query  563  enlqtltnlxelwlGRNRI  619
            EN+ TLT+L  L+LG+N+I
Sbjct  124  ENIDTLTSLESLFLGKNKI  142


 Score = 28.1 bits (61),  Expect(2) = 1e-08, Method: Compositional matrix adjust.
 Identities = 19/50 (38%), Positives = 25/50 (50%), Gaps = 5/50 (10%)
 Frame = +3

Query  231  LSNLNKFSLRQNLITDAALEPLSSWHTISQLEELVLRDNQLKKIPVLAYL  380
            L  +    LRQNLI     + + +   +  L EL L DNQ+KKI  L  L
Sbjct  19   LKKVKTLCLRQNLI-----KCIENLEELQSLRELDLYDNQIKKIENLEAL  63



>ref|XP_008827369.1| PREDICTED: protein phosphatase 1 regulatory subunit 7 [Nannospalax 
galili]
Length=360

 Score = 57.0 bits (136),  Expect(2) = 1e-08, Method: Compositional matrix adjust.
 Identities = 39/81 (48%), Positives = 61/81 (75%), Gaps = 1/81 (1%)
 Frame = +2

Query  377  FKKLLVFDVSFNEITSPSGLSKVSSTLKELYVSNNQIAKIEEIEHFHELQILELGSNKLR  556
              +L + D+SFN + +  G+ K++  LK+L++ NN+I KIE I + H+LQ+LELGSN++R
Sbjct  141  LTELEILDISFNLLRNIEGIDKLTQ-LKKLFLVNNKINKIENISNLHQLQMLELGSNRIR  199

Query  557  VMenlqtltnlxelwlGRNRI  619
             +EN+ TLTNL  L+LG+N+I
Sbjct  200  AIENIDTLTNLESLFLGKNKI  220


 Score = 28.9 bits (63),  Expect(2) = 1e-08, Method: Compositional matrix adjust.
 Identities = 20/56 (36%), Positives = 26/56 (46%), Gaps = 5/56 (9%)
 Frame = +3

Query  231  LSNLNKFSLRQNLITDAALEPLSSWHTISQLEELVLRDNQLKKIPVLAYLRNFWYL  398
            L  +    LRQNLI     + + +   +  L EL L DNQ+KKI  L  L     L
Sbjct  97   LKKVKSLCLRQNLI-----KCIENLEELQSLRELDLYDNQIKKIENLEALTELEIL  147



>gb|AAP88899.1| protein phosphatase 1, regulatory subunit 7 [synthetic construct]
Length=281

 Score = 57.0 bits (136),  Expect(2) = 1e-08, Method: Compositional matrix adjust.
 Identities = 38/81 (47%), Positives = 62/81 (77%), Gaps = 1/81 (1%)
 Frame = +2

Query  377  FKKLLVFDVSFNEITSPSGLSKVSSTLKELYVSNNQIAKIEEIEHFHELQILELGSNKLR  556
              +L + D+SFN + +  G+ K++  LK+L++ NN+I+KIE + + H+LQ+LELGSN++R
Sbjct  141  LTELEILDISFNLLRNIEGVDKLTR-LKKLFLVNNKISKIENLSNLHQLQMLELGSNRIR  199

Query  557  VMenlqtltnlxelwlGRNRI  619
             +EN+ TLTNL  L+LG+N+I
Sbjct  200  AIENIDTLTNLESLFLGKNKI  220


 Score = 29.3 bits (64),  Expect(2) = 1e-08, Method: Compositional matrix adjust.
 Identities = 22/56 (39%), Positives = 26/56 (46%), Gaps = 5/56 (9%)
 Frame = +3

Query  231  LSNLNKFSLRQNLITDAALEPLSSWHTISQLEELVLRDNQLKKIPVLAYLRNFWYL  398
            L  +    LRQNLI    +E L    +   L EL L DNQ+KKI  L  L     L
Sbjct  97   LKKVKTLCLRQNLI--KCIENLEELQS---LRELDLYDNQIKKIENLEALTELEIL  147



>ref|XP_005339689.1| PREDICTED: protein phosphatase 1 regulatory subunit 7 [Ictidomys 
tridecemlineatus]
Length=360

 Score = 57.4 bits (137),  Expect(2) = 1e-08, Method: Compositional matrix adjust.
 Identities = 39/81 (48%), Positives = 61/81 (75%), Gaps = 1/81 (1%)
 Frame = +2

Query  377  FKKLLVFDVSFNEITSPSGLSKVSSTLKELYVSNNQIAKIEEIEHFHELQILELGSNKLR  556
              +L + D+SFN + +  G+ K++  LK+L++ NN+I KIE I + H+LQ+LELGSN++R
Sbjct  141  LTQLEILDISFNLLRNIEGIDKLTR-LKKLFLVNNKINKIENISNLHQLQMLELGSNRIR  199

Query  557  VMenlqtltnlxelwlGRNRI  619
             +EN+ TLTNL  L+LG+N+I
Sbjct  200  AIENIDTLTNLESLFLGKNKI  220


 Score = 28.5 bits (62),  Expect(2) = 1e-08, Method: Compositional matrix adjust.
 Identities = 19/50 (38%), Positives = 25/50 (50%), Gaps = 5/50 (10%)
 Frame = +3

Query  231  LSNLNKFSLRQNLITDAALEPLSSWHTISQLEELVLRDNQLKKIPVLAYL  380
            L  +    LRQNLI     + + +   +  L EL L DNQ+KKI  L  L
Sbjct  97   LKKVKTLCLRQNLI-----KCIENLEELQSLRELDLYDNQIKKIENLEAL  141



>ref|XP_003798301.1| PREDICTED: protein phosphatase 1 regulatory subunit 7 isoform 
1 [Otolemur garnettii]
Length=360

 Score = 57.0 bits (136),  Expect(2) = 1e-08, Method: Compositional matrix adjust.
 Identities = 38/81 (47%), Positives = 61/81 (75%), Gaps = 1/81 (1%)
 Frame = +2

Query  377  FKKLLVFDVSFNEITSPSGLSKVSSTLKELYVSNNQIAKIEEIEHFHELQILELGSNKLR  556
              +L V D+SFN + +  G+ K++  LK+L++ NN+I KIE + + H+LQ+LELGSN++R
Sbjct  141  LTELEVLDISFNLLRNIEGIDKLTR-LKKLFLVNNKINKIENVSNLHQLQMLELGSNRIR  199

Query  557  VMenlqtltnlxelwlGRNRI  619
             +EN+ TLT+L  L+LG+N+I
Sbjct  200  AIENIDTLTSLESLFLGKNKI  220


 Score = 28.9 bits (63),  Expect(2) = 1e-08, Method: Compositional matrix adjust.
 Identities = 19/50 (38%), Positives = 25/50 (50%), Gaps = 5/50 (10%)
 Frame = +3

Query  231  LSNLNKFSLRQNLITDAALEPLSSWHTISQLEELVLRDNQLKKIPVLAYL  380
            L  +    LRQNLI     + + +   +  L EL L DNQ+KKI  L  L
Sbjct  97   LKKVKTLCLRQNLI-----KCIENLEELQSLRELDLYDNQIKKIENLEAL  141



>ref|XP_009442994.1| PREDICTED: protein phosphatase 1 regulatory subunit 7 isoform 
X5 [Pan troglodytes]
Length=237

 Score = 57.0 bits (136),  Expect(2) = 1e-08, Method: Compositional matrix adjust.
 Identities = 38/81 (47%), Positives = 62/81 (77%), Gaps = 1/81 (1%)
 Frame = +2

Query  377  FKKLLVFDVSFNEITSPSGLSKVSSTLKELYVSNNQIAKIEEIEHFHELQILELGSNKLR  556
              +L + D+SFN + +  G+ K++  LK+L++ NN+I+KIE + + H+LQ+LELGSN++R
Sbjct  98   LTELEILDISFNLLRNIEGVDKLTR-LKKLFLVNNKISKIENLSNLHQLQMLELGSNRIR  156

Query  557  VMenlqtltnlxelwlGRNRI  619
             +EN+ TLTNL  L+LG+N+I
Sbjct  157  AIENIDTLTNLESLFLGKNKI  177


 Score = 28.9 bits (63),  Expect(2) = 1e-08, Method: Compositional matrix adjust.
 Identities = 22/56 (39%), Positives = 26/56 (46%), Gaps = 5/56 (9%)
 Frame = +3

Query  231  LSNLNKFSLRQNLITDAALEPLSSWHTISQLEELVLRDNQLKKIPVLAYLRNFWYL  398
            L  +    LRQNLI    +E L    +   L EL L DNQ+KKI  L  L     L
Sbjct  54   LKKVKNLCLRQNLI--KCIENLEELQS---LRELDLYDNQIKKIENLEALTELEIL  104



>gb|ERE82036.1| anoctamin-7 [Cricetulus griseus]
Length=1214

 Score = 56.6 bits (135),  Expect(2) = 2e-08, Method: Composition-based stats.
 Identities = 38/79 (48%), Positives = 59/79 (75%), Gaps = 1/79 (1%)
 Frame = +2

Query  383  KLLVFDVSFNEITSPSGLSKVSSTLKELYVSNNQIAKIEEIEHFHELQILELGSNKLRVM  562
            +L + D+SFN + +  G+ K++  LK+L++ NN+I KIE I    +LQ+LELGSN++R +
Sbjct  144  ELEILDISFNLLRNIEGIDKLTR-LKKLFLVNNKINKIENIGTLRQLQMLELGSNRIRAI  202

Query  563  enlqtltnlxelwlGRNRI  619
            EN+ TLTNL  L+LG+N+I
Sbjct  203  ENIDTLTNLESLFLGKNKI  221


 Score = 28.9 bits (63),  Expect(2) = 2e-08, Method: Compositional matrix adjust.
 Identities = 19/50 (38%), Positives = 25/50 (50%), Gaps = 5/50 (10%)
 Frame = +3

Query  231  LSNLNKFSLRQNLITDAALEPLSSWHTISQLEELVLRDNQLKKIPVLAYL  380
            L  +    LRQNLI     + + +   +  L EL L DNQ+KKI  L  L
Sbjct  98   LKKVKSLCLRQNLI-----KCIENLEELQSLRELDLYDNQIKKIENLEAL  142



>ref|XP_010604935.1| PREDICTED: protein phosphatase 1 regulatory subunit 7 isoform 
X1 [Fukomys damarensis]
Length=360

 Score = 57.4 bits (137),  Expect(2) = 2e-08, Method: Compositional matrix adjust.
 Identities = 38/81 (47%), Positives = 62/81 (77%), Gaps = 1/81 (1%)
 Frame = +2

Query  377  FKKLLVFDVSFNEITSPSGLSKVSSTLKELYVSNNQIAKIEEIEHFHELQILELGSNKLR  556
              +L + D+SFN + +  G+ +++  LK+L++ NN+I+KIE I + H+LQ+LELGSN++R
Sbjct  141  LTELEILDISFNLLRNIEGIDQLTQ-LKKLFLVNNKISKIENISNLHQLQMLELGSNRIR  199

Query  557  VMenlqtltnlxelwlGRNRI  619
             +EN+ TLTNL  L+LG+N+I
Sbjct  200  AIENIDTLTNLESLFLGKNKI  220


 Score = 28.5 bits (62),  Expect(2) = 2e-08, Method: Compositional matrix adjust.
 Identities = 19/50 (38%), Positives = 25/50 (50%), Gaps = 5/50 (10%)
 Frame = +3

Query  231  LSNLNKFSLRQNLITDAALEPLSSWHTISQLEELVLRDNQLKKIPVLAYL  380
            L  +    LRQNLI     + + +   +  L EL L DNQ+KKI  L  L
Sbjct  97   LKKVKTLCLRQNLI-----KCIENLEELQSLRELDLYDNQIKKIENLEAL  141



>ref|XP_004412756.1| PREDICTED: protein phosphatase 1 regulatory subunit 7 isoform 
2 [Odobenus rosmarus divergens]
Length=317

 Score = 57.4 bits (137),  Expect(2) = 2e-08, Method: Compositional matrix adjust.
 Identities = 37/81 (46%), Positives = 62/81 (77%), Gaps = 1/81 (1%)
 Frame = +2

Query  377  FKKLLVFDVSFNEITSPSGLSKVSSTLKELYVSNNQIAKIEEIEHFHELQILELGSNKLR  556
              +L + D+SFN + +  G+ K++  LK+L++ NN+I+KIE + + H+LQ+LELGSN++R
Sbjct  98   LTQLEILDISFNLLRNIEGVEKLTR-LKKLFLVNNKISKIENVSNLHQLQMLELGSNRIR  156

Query  557  VMenlqtltnlxelwlGRNRI  619
             +EN+ TLT+L  L+LG+N+I
Sbjct  157  AIENIDTLTSLESLFLGKNKI  177


 Score = 28.5 bits (62),  Expect(2) = 2e-08, Method: Compositional matrix adjust.
 Identities = 19/50 (38%), Positives = 25/50 (50%), Gaps = 5/50 (10%)
 Frame = +3

Query  231  LSNLNKFSLRQNLITDAALEPLSSWHTISQLEELVLRDNQLKKIPVLAYL  380
            L  +    LRQNLI     + + +   +  L EL L DNQ+KKI  L  L
Sbjct  54   LKKVKTLCLRQNLI-----KCIENLEELQSLRELDLYDNQIKKIENLEAL  98



>ref|NP_001271924.1| uncharacterized protein LOC101925067 [Macaca fascicularis]
 ref|XP_003908242.2| PREDICTED: protein phosphatase 1 regulatory subunit 7 isoform 
X1 [Papio anubis]
 ref|XP_010375304.1| PREDICTED: protein phosphatase 1 regulatory subunit 7 isoform 
X1 [Rhinopithecus roxellana]
 dbj|BAE89333.1| unnamed protein product [Macaca fascicularis]
Length=375

 Score = 57.0 bits (136),  Expect(2) = 2e-08, Method: Compositional matrix adjust.
 Identities = 38/81 (47%), Positives = 62/81 (77%), Gaps = 1/81 (1%)
 Frame = +2

Query  377  FKKLLVFDVSFNEITSPSGLSKVSSTLKELYVSNNQIAKIEEIEHFHELQILELGSNKLR  556
              +L + D+SFN + +  G+ K++  LK+L++ NN+I+KIE + + H+LQ+LELGSN++R
Sbjct  156  LTELEILDISFNLLRNIEGVDKLTR-LKKLFLVNNKISKIENLSNLHQLQMLELGSNRIR  214

Query  557  VMenlqtltnlxelwlGRNRI  619
             +EN+ TLTNL  L+LG+N+I
Sbjct  215  AIENIDTLTNLESLFLGKNKI  235


 Score = 28.9 bits (63),  Expect(2) = 2e-08, Method: Compositional matrix adjust.
 Identities = 19/50 (38%), Positives = 25/50 (50%), Gaps = 5/50 (10%)
 Frame = +3

Query  231  LSNLNKFSLRQNLITDAALEPLSSWHTISQLEELVLRDNQLKKIPVLAYL  380
            L  +    LRQNLI     + + +   +  L EL L DNQ+KKI  L  L
Sbjct  112  LKKVKTLCLRQNLI-----KCIENLEELQSLRELDLYDNQIKKIENLEAL  156



>ref|NP_001269340.1| protein phosphatase 1 regulatory subunit 7 isoform 4 [Homo sapiens]
 ref|XP_008963868.1| PREDICTED: protein phosphatase 1 regulatory subunit 7 isoform 
X4 [Pan paniscus]
 gb|AAD26613.1| protein phosphatase-1 regulatory subunit 7 beta2 [Homo sapiens]
Length=237

 Score = 57.0 bits (136),  Expect(2) = 2e-08, Method: Compositional matrix adjust.
 Identities = 38/81 (47%), Positives = 62/81 (77%), Gaps = 1/81 (1%)
 Frame = +2

Query  377  FKKLLVFDVSFNEITSPSGLSKVSSTLKELYVSNNQIAKIEEIEHFHELQILELGSNKLR  556
              +L + D+SFN + +  G+ K++  LK+L++ NN+I+KIE + + H+LQ+LELGSN++R
Sbjct  98   LTELEILDISFNLLRNIEGVDKLTR-LKKLFLVNNKISKIENLSNLHQLQMLELGSNRIR  156

Query  557  VMenlqtltnlxelwlGRNRI  619
             +EN+ TLTNL  L+LG+N+I
Sbjct  157  AIENIDTLTNLESLFLGKNKI  177


 Score = 28.9 bits (63),  Expect(2) = 2e-08, Method: Compositional matrix adjust.
 Identities = 22/56 (39%), Positives = 26/56 (46%), Gaps = 5/56 (9%)
 Frame = +3

Query  231  LSNLNKFSLRQNLITDAALEPLSSWHTISQLEELVLRDNQLKKIPVLAYLRNFWYL  398
            L  +    LRQNLI    +E L    +   L EL L DNQ+KKI  L  L     L
Sbjct  54   LKKVKTLCLRQNLI--KCIENLEELQS---LRELDLYDNQIKKIENLEALTELEIL  104



>ref|XP_003798302.1| PREDICTED: protein phosphatase 1 regulatory subunit 7 isoform 
2 [Otolemur garnettii]
Length=317

 Score = 57.4 bits (137),  Expect(2) = 2e-08, Method: Compositional matrix adjust.
 Identities = 37/76 (49%), Positives = 59/76 (78%), Gaps = 1/76 (1%)
 Frame = +2

Query  392  VFDVSFNEITSPSGLSKVSSTLKELYVSNNQIAKIEEIEHFHELQILELGSNKLRVMenl  571
            V D+SFN + +  G+ K++  LK+L++ NN+I KIE + + H+LQ+LELGSN++R +EN+
Sbjct  103  VLDISFNLLRNIEGIDKLTR-LKKLFLVNNKINKIENVSNLHQLQMLELGSNRIRAIENI  161

Query  572  qtltnlxelwlGRNRI  619
             TLT+L  L+LG+N+I
Sbjct  162  DTLTSLESLFLGKNKI  177


 Score = 28.5 bits (62),  Expect(2) = 2e-08, Method: Compositional matrix adjust.
 Identities = 19/50 (38%), Positives = 25/50 (50%), Gaps = 5/50 (10%)
 Frame = +3

Query  231  LSNLNKFSLRQNLITDAALEPLSSWHTISQLEELVLRDNQLKKIPVLAYL  380
            L  +    LRQNLI     + + +   +  L EL L DNQ+KKI  L  L
Sbjct  54   LKKVKTLCLRQNLI-----KCIENLEELQSLRELDLYDNQIKKIENLEAL  98



>ref|XP_001090766.1| PREDICTED: protein phosphatase 1 regulatory subunit 7-like isoform 
1 [Macaca mulatta]
Length=376

 Score = 56.6 bits (135),  Expect(2) = 2e-08, Method: Compositional matrix adjust.
 Identities = 38/81 (47%), Positives = 62/81 (77%), Gaps = 1/81 (1%)
 Frame = +2

Query  377  FKKLLVFDVSFNEITSPSGLSKVSSTLKELYVSNNQIAKIEEIEHFHELQILELGSNKLR  556
              +L + D+SFN + +  G+ K++  LK+L++ NN+I+KIE + + H+LQ+LELGSN++R
Sbjct  157  LTELEILDISFNLLRNIEGVDKLTR-LKKLFLVNNKISKIENLSNLHQLQMLELGSNRIR  215

Query  557  VMenlqtltnlxelwlGRNRI  619
             +EN+ TLTNL  L+LG+N+I
Sbjct  216  AIENIDTLTNLESLFLGKNKI  236


 Score = 28.9 bits (63),  Expect(2) = 2e-08, Method: Compositional matrix adjust.
 Identities = 19/50 (38%), Positives = 25/50 (50%), Gaps = 5/50 (10%)
 Frame = +3

Query  231  LSNLNKFSLRQNLITDAALEPLSSWHTISQLEELVLRDNQLKKIPVLAYL  380
            L  +    LRQNLI     + + +   +  L EL L DNQ+KKI  L  L
Sbjct  113  LKKVKTLCLRQNLI-----KCIENLEELQSLRELDLYDNQIKKIENLEAL  157



>ref|XP_003936819.1| PREDICTED: protein phosphatase 1 regulatory subunit 7 isoform 
X1 [Saimiri boliviensis boliviensis]
Length=360

 Score = 57.0 bits (136),  Expect(2) = 2e-08, Method: Compositional matrix adjust.
 Identities = 38/81 (47%), Positives = 62/81 (77%), Gaps = 1/81 (1%)
 Frame = +2

Query  377  FKKLLVFDVSFNEITSPSGLSKVSSTLKELYVSNNQIAKIEEIEHFHELQILELGSNKLR  556
              +L + D+SFN + +  G+ K++  LK+L++ NN+I+KIE + + H+LQ+LELGSN++R
Sbjct  141  LTELEILDISFNLLRNIEGVDKLTQ-LKKLFLVNNKISKIENLSNLHQLQMLELGSNRIR  199

Query  557  VMenlqtltnlxelwlGRNRI  619
             +EN+ TLTNL  L+LG+N+I
Sbjct  200  AIENIDTLTNLESLFLGKNKI  220


 Score = 28.9 bits (63),  Expect(2) = 2e-08, Method: Compositional matrix adjust.
 Identities = 20/56 (36%), Positives = 26/56 (46%), Gaps = 5/56 (9%)
 Frame = +3

Query  231  LSNLNKFSLRQNLITDAALEPLSSWHTISQLEELVLRDNQLKKIPVLAYLRNFWYL  398
            L  +    LRQNLI     + + +   +  L EL L DNQ+KKI  L  L     L
Sbjct  97   LKKVKTLCLRQNLI-----KCIENLEELQSLRELDLYDNQIKKIENLEALTELEIL  147



>ref|XP_004743828.1| PREDICTED: protein phosphatase 1 regulatory subunit 7 isoform 
X1 [Mustela putorius furo]
Length=364

 Score = 57.4 bits (137),  Expect(2) = 2e-08, Method: Compositional matrix adjust.
 Identities = 38/79 (48%), Positives = 61/79 (77%), Gaps = 1/79 (1%)
 Frame = +2

Query  383  KLLVFDVSFNEITSPSGLSKVSSTLKELYVSNNQIAKIEEIEHFHELQILELGSNKLRVM  562
            +L + D+SFN + +  G+ K++  LK+L++ NN+I+KIE I   H+LQ+LELGSN++R +
Sbjct  147  QLEILDISFNLLRNIEGVDKLTR-LKKLFLVNNKISKIENISTLHQLQMLELGSNRIRAI  205

Query  563  enlqtltnlxelwlGRNRI  619
            EN+ TLT+L  L+LG+N+I
Sbjct  206  ENIDTLTSLESLFLGKNKI  224


 Score = 28.5 bits (62),  Expect(2) = 2e-08, Method: Compositional matrix adjust.
 Identities = 20/56 (36%), Positives = 26/56 (46%), Gaps = 5/56 (9%)
 Frame = +3

Query  231  LSNLNKFSLRQNLITDAALEPLSSWHTISQLEELVLRDNQLKKIPVLAYLRNFWYL  398
            L  +    LRQNLI     + + +   +  L EL L DNQ+KKI  L  L     L
Sbjct  101  LKKVKTLCLRQNLI-----KYIENLEELQSLRELDLYDNQIKKIENLEALTQLEIL  151



>ref|XP_009442992.1| PREDICTED: protein phosphatase 1 regulatory subunit 7 isoform 
X2 [Pan troglodytes]
Length=344

 Score = 57.0 bits (136),  Expect(2) = 2e-08, Method: Compositional matrix adjust.
 Identities = 37/76 (49%), Positives = 60/76 (79%), Gaps = 1/76 (1%)
 Frame = +2

Query  392  VFDVSFNEITSPSGLSKVSSTLKELYVSNNQIAKIEEIEHFHELQILELGSNKLRVMenl  571
            + D+SFN + +  G+ K++  LK+L++ NN+I+KIE + + H+LQ+LELGSN++R +EN+
Sbjct  130  ILDISFNLLRNIEGVDKLTR-LKKLFLVNNKISKIENLSNLHQLQMLELGSNRIRAIENI  188

Query  572  qtltnlxelwlGRNRI  619
             TLTNL  L+LG+N+I
Sbjct  189  DTLTNLESLFLGKNKI  204


 Score = 28.9 bits (63),  Expect(2) = 2e-08, Method: Compositional matrix adjust.
 Identities = 19/50 (38%), Positives = 25/50 (50%), Gaps = 5/50 (10%)
 Frame = +3

Query  231  LSNLNKFSLRQNLITDAALEPLSSWHTISQLEELVLRDNQLKKIPVLAYL  380
            L  +    LRQNLI     + + +   +  L EL L DNQ+KKI  L  L
Sbjct  81   LKKVKNLCLRQNLI-----KCIENLEELQSLRELDLYDNQIKKIENLEAL  125



>ref|XP_001158701.1| PREDICTED: protein phosphatase 1 regulatory subunit 7 isoform 
X1 [Pan troglodytes]
Length=360

 Score = 56.6 bits (135),  Expect(2) = 2e-08, Method: Compositional matrix adjust.
 Identities = 38/81 (47%), Positives = 62/81 (77%), Gaps = 1/81 (1%)
 Frame = +2

Query  377  FKKLLVFDVSFNEITSPSGLSKVSSTLKELYVSNNQIAKIEEIEHFHELQILELGSNKLR  556
              +L + D+SFN + +  G+ K++  LK+L++ NN+I+KIE + + H+LQ+LELGSN++R
Sbjct  141  LTELEILDISFNLLRNIEGVDKLTR-LKKLFLVNNKISKIENLSNLHQLQMLELGSNRIR  199

Query  557  VMenlqtltnlxelwlGRNRI  619
             +EN+ TLTNL  L+LG+N+I
Sbjct  200  AIENIDTLTNLESLFLGKNKI  220


 Score = 28.9 bits (63),  Expect(2) = 2e-08, Method: Compositional matrix adjust.
 Identities = 19/50 (38%), Positives = 25/50 (50%), Gaps = 5/50 (10%)
 Frame = +3

Query  231  LSNLNKFSLRQNLITDAALEPLSSWHTISQLEELVLRDNQLKKIPVLAYL  380
            L  +    LRQNLI     + + +   +  L EL L DNQ+KKI  L  L
Sbjct  97   LKKVKNLCLRQNLI-----KCIENLEELQSLRELDLYDNQIKKIENLEAL  141



>ref|XP_009236626.1| PREDICTED: protein phosphatase 1 regulatory subunit 7 isoform 
X4 [Pongo abelii]
Length=360

 Score = 57.0 bits (136),  Expect(2) = 2e-08, Method: Compositional matrix adjust.
 Identities = 38/81 (47%), Positives = 62/81 (77%), Gaps = 1/81 (1%)
 Frame = +2

Query  377  FKKLLVFDVSFNEITSPSGLSKVSSTLKELYVSNNQIAKIEEIEHFHELQILELGSNKLR  556
              +L + D+SFN + +  G+ K++  LK+L++ NN+I+KIE + + H+LQ+LELGSN++R
Sbjct  141  LTELEILDISFNLLRNIEGVDKLTQ-LKKLFLVNNKISKIENLSNLHQLQMLELGSNRIR  199

Query  557  VMenlqtltnlxelwlGRNRI  619
             +EN+ TLTNL  L+LG+N+I
Sbjct  200  AIENIDTLTNLESLFLGKNKI  220


 Score = 28.9 bits (63),  Expect(2) = 2e-08, Method: Compositional matrix adjust.
 Identities = 19/50 (38%), Positives = 25/50 (50%), Gaps = 5/50 (10%)
 Frame = +3

Query  231  LSNLNKFSLRQNLITDAALEPLSSWHTISQLEELVLRDNQLKKIPVLAYL  380
            L  +    LRQNLI     + + +   +  L EL L DNQ+KKI  L  L
Sbjct  97   LKKVKTLCLRQNLI-----KCIENLEELQSLRELDLYDNQIKKIENLEAL  141



>gb|EHH21837.1| hypothetical protein EGK_04990 [Macaca mulatta]
Length=346

 Score = 57.0 bits (136),  Expect(2) = 2e-08, Method: Compositional matrix adjust.
 Identities = 37/76 (49%), Positives = 60/76 (79%), Gaps = 1/76 (1%)
 Frame = +2

Query  392  VFDVSFNEITSPSGLSKVSSTLKELYVSNNQIAKIEEIEHFHELQILELGSNKLRVMenl  571
            + D+SFN + +  G+ K++  LK+L++ NN+I+KIE + + H+LQ+LELGSN++R +EN+
Sbjct  132  ILDISFNLLRNIEGVDKLTR-LKKLFLVNNKISKIENLSNLHQLQMLELGSNRIRAIENI  190

Query  572  qtltnlxelwlGRNRI  619
             TLTNL  L+LG+N+I
Sbjct  191  DTLTNLESLFLGKNKI  206


 Score = 28.5 bits (62),  Expect(2) = 2e-08, Method: Compositional matrix adjust.
 Identities = 19/50 (38%), Positives = 25/50 (50%), Gaps = 5/50 (10%)
 Frame = +3

Query  231  LSNLNKFSLRQNLITDAALEPLSSWHTISQLEELVLRDNQLKKIPVLAYL  380
            L  +    LRQNLI     + + +   +  L EL L DNQ+KKI  L  L
Sbjct  83   LKKVKTLCLRQNLI-----KCIENLEELQSLRELDLYDNQIKKIENLEAL  127



>ref|XP_004743829.1| PREDICTED: protein phosphatase 1 regulatory subunit 7 isoform 
X2 [Mustela putorius furo]
 ref|XP_004809709.1| PREDICTED: protein phosphatase 1 regulatory subunit 7 isoform 
X1 [Mustela putorius furo]
Length=360

 Score = 57.4 bits (137),  Expect(2) = 2e-08, Method: Compositional matrix adjust.
 Identities = 38/81 (47%), Positives = 61/81 (75%), Gaps = 1/81 (1%)
 Frame = +2

Query  377  FKKLLVFDVSFNEITSPSGLSKVSSTLKELYVSNNQIAKIEEIEHFHELQILELGSNKLR  556
              +L + D+SFN + +  G+ K++  LK+L++ NN+I+KIE I   H+LQ+LELGSN++R
Sbjct  141  LTQLEILDISFNLLRNIEGVDKLTR-LKKLFLVNNKISKIENISTLHQLQMLELGSNRIR  199

Query  557  VMenlqtltnlxelwlGRNRI  619
             +EN+ TLT+L  L+LG+N+I
Sbjct  200  AIENIDTLTSLESLFLGKNKI  220


 Score = 28.1 bits (61),  Expect(2) = 2e-08, Method: Compositional matrix adjust.
 Identities = 19/50 (38%), Positives = 25/50 (50%), Gaps = 5/50 (10%)
 Frame = +3

Query  231  LSNLNKFSLRQNLITDAALEPLSSWHTISQLEELVLRDNQLKKIPVLAYL  380
            L  +    LRQNLI     + + +   +  L EL L DNQ+KKI  L  L
Sbjct  97   LKKVKTLCLRQNLI-----KYIENLEELQSLRELDLYDNQIKKIENLEAL  141



>ref|XP_009236624.1| PREDICTED: protein phosphatase 1 regulatory subunit 7 isoform 
X2 [Pongo abelii]
Length=292

 Score = 57.4 bits (137),  Expect(2) = 2e-08, Method: Compositional matrix adjust.
 Identities = 37/76 (49%), Positives = 60/76 (79%), Gaps = 1/76 (1%)
 Frame = +2

Query  392  VFDVSFNEITSPSGLSKVSSTLKELYVSNNQIAKIEEIEHFHELQILELGSNKLRVMenl  571
            + D+SFN + +  G+ K++  LK+L++ NN+I+KIE + + H+LQ+LELGSN++R +EN+
Sbjct  78   ILDISFNLLRNIEGVDKLTQ-LKKLFLVNNKISKIENLSNLHQLQMLELGSNRIRAIENI  136

Query  572  qtltnlxelwlGRNRI  619
             TLTNL  L+LG+N+I
Sbjct  137  DTLTNLESLFLGKNKI  152


 Score = 28.1 bits (61),  Expect(2) = 2e-08, Method: Compositional matrix adjust.
 Identities = 19/50 (38%), Positives = 25/50 (50%), Gaps = 5/50 (10%)
 Frame = +3

Query  231  LSNLNKFSLRQNLITDAALEPLSSWHTISQLEELVLRDNQLKKIPVLAYL  380
            L  +    LRQNLI     + + +   +  L EL L DNQ+KKI  L  L
Sbjct  29   LKKVKTLCLRQNLI-----KCIENLEELQSLRELDLYDNQIKKIENLEAL  73



>ref|XP_534627.3| PREDICTED: protein phosphatase 1 regulatory subunit 7-like, partial 
[Canis lupus familiaris]
Length=399

 Score = 56.6 bits (135),  Expect(2) = 2e-08, Method: Compositional matrix adjust.
 Identities = 37/78 (47%), Positives = 61/78 (78%), Gaps = 1/78 (1%)
 Frame = +2

Query  386  LLVFDVSFNEITSPSGLSKVSSTLKELYVSNNQIAKIEEIEHFHELQILELGSNKLRVMe  565
            L + D+SFN + +  G+ K++  L++L++ NN+I+KIE I + H+LQ+LELGSN++R +E
Sbjct  191  LEILDISFNLLRNIEGVDKLTR-LRKLFLVNNKISKIENISNLHQLQMLELGSNRIRAIE  249

Query  566  nlqtltnlxelwlGRNRI  619
            N+ TLT+L  L+LG+N+I
Sbjct  250  NIDTLTSLESLFLGKNKI  267


 Score = 29.3 bits (64),  Expect(2) = 2e-08, Method: Compositional matrix adjust.
 Identities = 21/50 (42%), Positives = 25/50 (50%), Gaps = 5/50 (10%)
 Frame = +3

Query  231  LSNLNKFSLRQNLITDAALEPLSSWHTISQLEELVLRDNQLKKIPVLAYL  380
            L  +    LRQNLI    +E L    +   L EL L DNQ+KKI  L  L
Sbjct  144  LKKVKTLCLRQNLIK--CIENLGELQS---LRELDLYDNQIKKIENLEAL  188



>ref|XP_006165231.1| PREDICTED: protein phosphatase 1 regulatory subunit 7 [Tupaia 
chinensis]
Length=360

 Score = 56.2 bits (134),  Expect(2) = 2e-08, Method: Compositional matrix adjust.
 Identities = 38/81 (47%), Positives = 60/81 (74%), Gaps = 1/81 (1%)
 Frame = +2

Query  377  FKKLLVFDVSFNEITSPSGLSKVSSTLKELYVSNNQIAKIEEIEHFHELQILELGSNKLR  556
              +L V D+SFN + +  G+ K++  LK+L++ NN+I KIE I   H+LQ+LELGSN++R
Sbjct  141  LTELEVLDISFNLLRTIEGVDKLTR-LKKLFLVNNKINKIENISSLHQLQMLELGSNRIR  199

Query  557  VMenlqtltnlxelwlGRNRI  619
             +EN+ +L+NL  L+LG+N+I
Sbjct  200  AIENIDSLSNLESLFLGKNKI  220


 Score = 29.3 bits (64),  Expect(2) = 2e-08, Method: Compositional matrix adjust.
 Identities = 20/56 (36%), Positives = 26/56 (46%), Gaps = 5/56 (9%)
 Frame = +3

Query  231  LSNLNKFSLRQNLITDAALEPLSSWHTISQLEELVLRDNQLKKIPVLAYLRNFWYL  398
            L  +    LRQNLI     + + +   +  L EL L DNQ+KKI  L  L     L
Sbjct  97   LKKVKTLCLRQNLI-----KCIENLEELQSLRELDLYDNQIKKIENLEALTELEVL  147



>gb|EHH55313.1| hypothetical protein EGM_04495, partial [Macaca fascicularis]
Length=345

 Score = 57.0 bits (136),  Expect(2) = 2e-08, Method: Compositional matrix adjust.
 Identities = 38/81 (47%), Positives = 62/81 (77%), Gaps = 1/81 (1%)
 Frame = +2

Query  377  FKKLLVFDVSFNEITSPSGLSKVSSTLKELYVSNNQIAKIEEIEHFHELQILELGSNKLR  556
              +L + D+SFN + +  G+ K++  LK+L++ NN+I+KIE + + H+LQ+LELGSN++R
Sbjct  125  LTELEILDISFNLLRNIEGVDKLTR-LKKLFLVNNKISKIENLSNLHQLQMLELGSNRIR  183

Query  557  VMenlqtltnlxelwlGRNRI  619
             +EN+ TLTNL  L+LG+N+I
Sbjct  184  AIENIDTLTNLESLFLGKNKI  204


 Score = 28.5 bits (62),  Expect(2) = 2e-08, Method: Compositional matrix adjust.
 Identities = 19/50 (38%), Positives = 25/50 (50%), Gaps = 5/50 (10%)
 Frame = +3

Query  231  LSNLNKFSLRQNLITDAALEPLSSWHTISQLEELVLRDNQLKKIPVLAYL  380
            L  +    LRQNLI     + + +   +  L EL L DNQ+KKI  L  L
Sbjct  81   LKKVKTLCLRQNLI-----KCIENLEELQSLRELDLYDNQIKKIDNLEAL  125



>ref|XP_009236623.1| PREDICTED: protein phosphatase 1 regulatory subunit 7 isoform 
X1 [Pongo abelii]
Length=317

 Score = 57.0 bits (136),  Expect(2) = 2e-08, Method: Compositional matrix adjust.
 Identities = 38/81 (47%), Positives = 62/81 (77%), Gaps = 1/81 (1%)
 Frame = +2

Query  377  FKKLLVFDVSFNEITSPSGLSKVSSTLKELYVSNNQIAKIEEIEHFHELQILELGSNKLR  556
              +L + D+SFN + +  G+ K++  LK+L++ NN+I+KIE + + H+LQ+LELGSN++R
Sbjct  98   LTELEILDISFNLLRNIEGVDKLTQ-LKKLFLVNNKISKIENLSNLHQLQMLELGSNRIR  156

Query  557  VMenlqtltnlxelwlGRNRI  619
             +EN+ TLTNL  L+LG+N+I
Sbjct  157  AIENIDTLTNLESLFLGKNKI  177


 Score = 28.5 bits (62),  Expect(2) = 2e-08, Method: Compositional matrix adjust.
 Identities = 19/50 (38%), Positives = 25/50 (50%), Gaps = 5/50 (10%)
 Frame = +3

Query  231  LSNLNKFSLRQNLITDAALEPLSSWHTISQLEELVLRDNQLKKIPVLAYL  380
            L  +    LRQNLI     + + +   +  L EL L DNQ+KKI  L  L
Sbjct  54   LKKVKTLCLRQNLI-----KCIENLEELQSLRELDLYDNQIKKIENLEAL  98



>ref|XP_002799157.1| PREDICTED: protein phosphatase 1 regulatory subunit 7-like isoform 
2 [Macaca mulatta]
Length=317

 Score = 56.6 bits (135),  Expect(2) = 2e-08, Method: Compositional matrix adjust.
 Identities = 38/81 (47%), Positives = 62/81 (77%), Gaps = 1/81 (1%)
 Frame = +2

Query  377  FKKLLVFDVSFNEITSPSGLSKVSSTLKELYVSNNQIAKIEEIEHFHELQILELGSNKLR  556
              +L + D+SFN + +  G+ K++  LK+L++ NN+I+KIE + + H+LQ+LELGSN++R
Sbjct  98   LTELEILDISFNLLRNIEGVDKLTR-LKKLFLVNNKISKIENLSNLHQLQMLELGSNRIR  156

Query  557  VMenlqtltnlxelwlGRNRI  619
             +EN+ TLTNL  L+LG+N+I
Sbjct  157  AIENIDTLTNLESLFLGKNKI  177


 Score = 28.9 bits (63),  Expect(2) = 2e-08, Method: Compositional matrix adjust.
 Identities = 19/50 (38%), Positives = 25/50 (50%), Gaps = 5/50 (10%)
 Frame = +3

Query  231  LSNLNKFSLRQNLITDAALEPLSSWHTISQLEELVLRDNQLKKIPVLAYL  380
            L  +    LRQNLI     + + +   +  L EL L DNQ+KKI  L  L
Sbjct  54   LKKVKTLCLRQNLI-----KCIENLEELQSLRELDLYDNQIKKIENLEAL  98



>ref|XP_010599015.1| PREDICTED: protein phosphatase 1 regulatory subunit 7 [Loxodonta 
africana]
Length=329

 Score = 57.0 bits (136),  Expect(2) = 2e-08, Method: Compositional matrix adjust.
 Identities = 38/76 (50%), Positives = 59/76 (78%), Gaps = 1/76 (1%)
 Frame = +2

Query  392  VFDVSFNEITSPSGLSKVSSTLKELYVSNNQIAKIEEIEHFHELQILELGSNKLRVMenl  571
            + D+SFN + +  G+ K++  LK+L++ NN+I KIE I + H+LQ+LELGSN++R +EN+
Sbjct  146  ILDISFNLLRNIEGIDKLTQ-LKKLFLVNNKINKIENISNLHQLQMLELGSNRIRAIENI  204

Query  572  qtltnlxelwlGRNRI  619
             TLTNL  L+LG+N+I
Sbjct  205  DTLTNLDSLFLGKNKI  220


 Score = 28.5 bits (62),  Expect(2) = 2e-08, Method: Compositional matrix adjust.
 Identities = 21/56 (38%), Positives = 27/56 (48%), Gaps = 5/56 (9%)
 Frame = +3

Query  231  LSNLNKFSLRQNLITDAALEPLSSWHTISQLEELVLRDNQLKKIPVLAYLRNFWYL  398
            L  +    LRQNLI    +E L +  +   L EL L DNQ+KK+  L  L     L
Sbjct  97   LKKVKTLCLRQNLI--KCIENLEALQS---LRELDLYDNQIKKMENLEALTGLEIL  147



>ref|XP_001158513.1| PREDICTED: protein phosphatase 1 regulatory subunit 7 isoform 
X3 [Pan troglodytes]
Length=317

 Score = 56.6 bits (135),  Expect(2) = 2e-08, Method: Compositional matrix adjust.
 Identities = 38/81 (47%), Positives = 62/81 (77%), Gaps = 1/81 (1%)
 Frame = +2

Query  377  FKKLLVFDVSFNEITSPSGLSKVSSTLKELYVSNNQIAKIEEIEHFHELQILELGSNKLR  556
              +L + D+SFN + +  G+ K++  LK+L++ NN+I+KIE + + H+LQ+LELGSN++R
Sbjct  98   LTELEILDISFNLLRNIEGVDKLTR-LKKLFLVNNKISKIENLSNLHQLQMLELGSNRIR  156

Query  557  VMenlqtltnlxelwlGRNRI  619
             +EN+ TLTNL  L+LG+N+I
Sbjct  157  AIENIDTLTNLESLFLGKNKI  177


 Score = 28.5 bits (62),  Expect(2) = 2e-08, Method: Compositional matrix adjust.
 Identities = 19/50 (38%), Positives = 25/50 (50%), Gaps = 5/50 (10%)
 Frame = +3

Query  231  LSNLNKFSLRQNLITDAALEPLSSWHTISQLEELVLRDNQLKKIPVLAYL  380
            L  +    LRQNLI     + + +   +  L EL L DNQ+KKI  L  L
Sbjct  54   LKKVKNLCLRQNLI-----KCIENLEELQSLRELDLYDNQIKKIENLEAL  98



>ref|NP_002703.1| protein phosphatase 1 regulatory subunit 7 isoform 1 [Homo sapiens]
 ref|XP_003813113.1| PREDICTED: protein phosphatase 1 regulatory subunit 7 isoform 
X1 [Pan paniscus]
 ref|XP_004033524.1| PREDICTED: protein phosphatase 1 regulatory subunit 7 isoform 
1 [Gorilla gorilla gorilla]
 sp|Q15435.1|PP1R7_HUMAN RecName: Full=Protein phosphatase 1 regulatory subunit 7; AltName: 
Full=Protein phosphatase 1 regulatory subunit 22 [Homo 
sapiens]
 emb|CAA90626.1| yeast sds22 homolog [Homo sapiens]
 gb|AAD26611.1| protein phosphatase-1 regulatory subunit 7 alpha1 [Homo sapiens]
 gb|AAH00910.1| Protein phosphatase 1, regulatory (inhibitor) subunit 7 [Homo 
sapiens]
 gb|AAV38936.1| protein phosphatase 1, regulatory subunit 7 [Homo sapiens]
 gb|AAX41197.1| protein phosphatase 1 regulatory subunit 7 [synthetic construct]
 gb|EAW71244.1| protein phosphatase 1, regulatory subunit 7, isoform CRA_b [Homo 
sapiens]
 dbj|BAG11439.1| protein phosphatase 1 regulatory subunit 7 [synthetic construct]
 prf||2124310A sds22 gene
Length=360

 Score = 56.6 bits (135),  Expect(2) = 2e-08, Method: Compositional matrix adjust.
 Identities = 38/81 (47%), Positives = 62/81 (77%), Gaps = 1/81 (1%)
 Frame = +2

Query  377  FKKLLVFDVSFNEITSPSGLSKVSSTLKELYVSNNQIAKIEEIEHFHELQILELGSNKLR  556
              +L + D+SFN + +  G+ K++  LK+L++ NN+I+KIE + + H+LQ+LELGSN++R
Sbjct  141  LTELEILDISFNLLRNIEGVDKLTR-LKKLFLVNNKISKIENLSNLHQLQMLELGSNRIR  199

Query  557  VMenlqtltnlxelwlGRNRI  619
             +EN+ TLTNL  L+LG+N+I
Sbjct  200  AIENIDTLTNLESLFLGKNKI  220


 Score = 28.5 bits (62),  Expect(2) = 2e-08, Method: Compositional matrix adjust.
 Identities = 19/50 (38%), Positives = 25/50 (50%), Gaps = 5/50 (10%)
 Frame = +3

Query  231  LSNLNKFSLRQNLITDAALEPLSSWHTISQLEELVLRDNQLKKIPVLAYL  380
            L  +    LRQNLI     + + +   +  L EL L DNQ+KKI  L  L
Sbjct  97   LKKVKTLCLRQNLI-----KCIENLEELQSLRELDLYDNQIKKIENLEAL  141



>ref|XP_003278941.1| PREDICTED: protein phosphatase 1 regulatory subunit 7 isoform 
2 [Nomascus leucogenys]
Length=360

 Score = 56.6 bits (135),  Expect(2) = 2e-08, Method: Compositional matrix adjust.
 Identities = 38/81 (47%), Positives = 62/81 (77%), Gaps = 1/81 (1%)
 Frame = +2

Query  377  FKKLLVFDVSFNEITSPSGLSKVSSTLKELYVSNNQIAKIEEIEHFHELQILELGSNKLR  556
              +L + D+SFN + +  G+ K++  LK+L++ NN+I+KIE + + H+LQ+LELGSN++R
Sbjct  141  LTELEILDISFNLLRNIEGVDKLTR-LKKLFLVNNKISKIENLSNLHQLQMLELGSNRIR  199

Query  557  VMenlqtltnlxelwlGRNRI  619
             +EN+ TLTNL  L+LG+N+I
Sbjct  200  AIENIDTLTNLESLFLGKNKI  220


 Score = 28.5 bits (62),  Expect(2) = 2e-08, Method: Compositional matrix adjust.
 Identities = 19/50 (38%), Positives = 25/50 (50%), Gaps = 5/50 (10%)
 Frame = +3

Query  231  LSNLNKFSLRQNLITDAALEPLSSWHTISQLEELVLRDNQLKKIPVLAYL  380
            L  +    LRQNLI     + + +   +  L EL L DNQ+KKI  L  L
Sbjct  97   LKKVKTLCLRQNLI-----KCIENLEELQSLRELDLYDNQIKKIENLEAL  141



>ref|XP_010604936.1| PREDICTED: protein phosphatase 1 regulatory subunit 7 isoform 
X2 [Fukomys damarensis]
Length=292

 Score = 57.4 bits (137),  Expect(2) = 2e-08, Method: Compositional matrix adjust.
 Identities = 37/76 (49%), Positives = 60/76 (79%), Gaps = 1/76 (1%)
 Frame = +2

Query  392  VFDVSFNEITSPSGLSKVSSTLKELYVSNNQIAKIEEIEHFHELQILELGSNKLRVMenl  571
            + D+SFN + +  G+ +++  LK+L++ NN+I+KIE I + H+LQ+LELGSN++R +EN+
Sbjct  78   ILDISFNLLRNIEGIDQLTQ-LKKLFLVNNKISKIENISNLHQLQMLELGSNRIRAIENI  136

Query  572  qtltnlxelwlGRNRI  619
             TLTNL  L+LG+N+I
Sbjct  137  DTLTNLESLFLGKNKI  152


 Score = 28.1 bits (61),  Expect(2) = 2e-08, Method: Compositional matrix adjust.
 Identities = 19/50 (38%), Positives = 25/50 (50%), Gaps = 5/50 (10%)
 Frame = +3

Query  231  LSNLNKFSLRQNLITDAALEPLSSWHTISQLEELVLRDNQLKKIPVLAYL  380
            L  +    LRQNLI     + + +   +  L EL L DNQ+KKI  L  L
Sbjct  29   LKKVKTLCLRQNLI-----KCIENLEELQSLRELDLYDNQIKKIENLEAL  73



>ref|XP_005574921.1| PREDICTED: protein phosphatase 1 regulatory subunit 7 isoform 
X2 [Macaca fascicularis]
 ref|XP_010375306.1| PREDICTED: protein phosphatase 1 regulatory subunit 7 isoform 
X2 [Rhinopithecus roxellana]
Length=332

 Score = 56.6 bits (135),  Expect(2) = 2e-08, Method: Compositional matrix adjust.
 Identities = 38/81 (47%), Positives = 62/81 (77%), Gaps = 1/81 (1%)
 Frame = +2

Query  377  FKKLLVFDVSFNEITSPSGLSKVSSTLKELYVSNNQIAKIEEIEHFHELQILELGSNKLR  556
              +L + D+SFN + +  G+ K++  LK+L++ NN+I+KIE + + H+LQ+LELGSN++R
Sbjct  113  LTELEILDISFNLLRNIEGVDKLTR-LKKLFLVNNKISKIENLSNLHQLQMLELGSNRIR  171

Query  557  VMenlqtltnlxelwlGRNRI  619
             +EN+ TLTNL  L+LG+N+I
Sbjct  172  AIENIDTLTNLESLFLGKNKI  192


 Score = 28.5 bits (62),  Expect(2) = 2e-08, Method: Compositional matrix adjust.
 Identities = 19/50 (38%), Positives = 25/50 (50%), Gaps = 5/50 (10%)
 Frame = +3

Query  231  LSNLNKFSLRQNLITDAALEPLSSWHTISQLEELVLRDNQLKKIPVLAYL  380
            L  +    LRQNLI     + + +   +  L EL L DNQ+KKI  L  L
Sbjct  69   LKKVKTLCLRQNLI-----KCIENLEELQSLRELDLYDNQIKKIENLEAL  113



>ref|NP_001269341.1| protein phosphatase 1 regulatory subunit 7 isoform 5 [Homo sapiens]
Length=344

 Score = 57.0 bits (136),  Expect(2) = 2e-08, Method: Compositional matrix adjust.
 Identities = 37/76 (49%), Positives = 60/76 (79%), Gaps = 1/76 (1%)
 Frame = +2

Query  392  VFDVSFNEITSPSGLSKVSSTLKELYVSNNQIAKIEEIEHFHELQILELGSNKLRVMenl  571
            + D+SFN + +  G+ K++  LK+L++ NN+I+KIE + + H+LQ+LELGSN++R +EN+
Sbjct  130  ILDISFNLLRNIEGVDKLTR-LKKLFLVNNKISKIENLSNLHQLQMLELGSNRIRAIENI  188

Query  572  qtltnlxelwlGRNRI  619
             TLTNL  L+LG+N+I
Sbjct  189  DTLTNLESLFLGKNKI  204


 Score = 28.5 bits (62),  Expect(2) = 2e-08, Method: Compositional matrix adjust.
 Identities = 19/50 (38%), Positives = 25/50 (50%), Gaps = 5/50 (10%)
 Frame = +3

Query  231  LSNLNKFSLRQNLITDAALEPLSSWHTISQLEELVLRDNQLKKIPVLAYL  380
            L  +    LRQNLI     + + +   +  L EL L DNQ+KKI  L  L
Sbjct  81   LKKVKTLCLRQNLI-----KCIENLEELQSLRELDLYDNQIKKIENLEAL  125



>ref|XP_009181801.1| PREDICTED: protein phosphatase 1 regulatory subunit 7 isoform 
X2 [Papio anubis]
 ref|XP_009181802.1| PREDICTED: protein phosphatase 1 regulatory subunit 7 isoform 
X2 [Papio anubis]
Length=292

 Score = 57.0 bits (136),  Expect(2) = 2e-08, Method: Compositional matrix adjust.
 Identities = 37/76 (49%), Positives = 60/76 (79%), Gaps = 1/76 (1%)
 Frame = +2

Query  392  VFDVSFNEITSPSGLSKVSSTLKELYVSNNQIAKIEEIEHFHELQILELGSNKLRVMenl  571
            + D+SFN + +  G+ K++  LK+L++ NN+I+KIE + + H+LQ+LELGSN++R +EN+
Sbjct  78   ILDISFNLLRNIEGVDKLTR-LKKLFLVNNKISKIENLSNLHQLQMLELGSNRIRAIENI  136

Query  572  qtltnlxelwlGRNRI  619
             TLTNL  L+LG+N+I
Sbjct  137  DTLTNLESLFLGKNKI  152


 Score = 28.1 bits (61),  Expect(2) = 2e-08, Method: Compositional matrix adjust.
 Identities = 19/50 (38%), Positives = 25/50 (50%), Gaps = 5/50 (10%)
 Frame = +3

Query  231  LSNLNKFSLRQNLITDAALEPLSSWHTISQLEELVLRDNQLKKIPVLAYL  380
            L  +    LRQNLI     + + +   +  L EL L DNQ+KKI  L  L
Sbjct  29   LKKVKTLCLRQNLI-----KCIENLEELQSLRELDLYDNQIKKIENLEAL  73



>ref|NP_001269343.1| protein phosphatase 1 regulatory subunit 7 isoform 7 [Homo sapiens]
Length=221

 Score = 57.0 bits (136),  Expect(2) = 2e-08, Method: Compositional matrix adjust.
 Identities = 38/81 (47%), Positives = 62/81 (77%), Gaps = 1/81 (1%)
 Frame = +2

Query  377  FKKLLVFDVSFNEITSPSGLSKVSSTLKELYVSNNQIAKIEEIEHFHELQILELGSNKLR  556
              +L + D+SFN + +  G+ K++  LK+L++ NN+I+KIE + + H+LQ+LELGSN++R
Sbjct  82   LTELEILDISFNLLRNIEGVDKLTR-LKKLFLVNNKISKIENLSNLHQLQMLELGSNRIR  140

Query  557  VMenlqtltnlxelwlGRNRI  619
             +EN+ TLTNL  L+LG+N+I
Sbjct  141  AIENIDTLTNLESLFLGKNKI  161


 Score = 28.5 bits (62),  Expect(2) = 2e-08, Method: Compositional matrix adjust.
 Identities = 20/56 (36%), Positives = 27/56 (48%), Gaps = 5/56 (9%)
 Frame = +3

Query  231  LSNLNKFSLRQNLITDAALEPLSSWHTISQLEELVLRDNQLKKIPVLAYLRNFWYL  398
            L  +    LRQNLI    +E L    ++ +L+   L DNQ+KKI  L  L     L
Sbjct  38   LKKVKTLCLRQNLI--KCIENLEELQSLRELD---LYDNQIKKIENLEALTELEIL  88



>ref|XP_004743830.1| PREDICTED: protein phosphatase 1 regulatory subunit 7 isoform 
X3 [Mustela putorius furo]
Length=317

 Score = 57.4 bits (137),  Expect(2) = 2e-08, Method: Compositional matrix adjust.
 Identities = 38/81 (47%), Positives = 61/81 (75%), Gaps = 1/81 (1%)
 Frame = +2

Query  377  FKKLLVFDVSFNEITSPSGLSKVSSTLKELYVSNNQIAKIEEIEHFHELQILELGSNKLR  556
              +L + D+SFN + +  G+ K++  LK+L++ NN+I+KIE I   H+LQ+LELGSN++R
Sbjct  98   LTQLEILDISFNLLRNIEGVDKLTR-LKKLFLVNNKISKIENISTLHQLQMLELGSNRIR  156

Query  557  VMenlqtltnlxelwlGRNRI  619
             +EN+ TLT+L  L+LG+N+I
Sbjct  157  AIENIDTLTSLESLFLGKNKI  177


 Score = 27.7 bits (60),  Expect(2) = 2e-08, Method: Compositional matrix adjust.
 Identities = 19/50 (38%), Positives = 25/50 (50%), Gaps = 5/50 (10%)
 Frame = +3

Query  231  LSNLNKFSLRQNLITDAALEPLSSWHTISQLEELVLRDNQLKKIPVLAYL  380
            L  +    LRQNLI     + + +   +  L EL L DNQ+KKI  L  L
Sbjct  54   LKKVKTLCLRQNLI-----KYIENLEELQSLRELDLYDNQIKKIENLEAL  98



>ref|XP_010946501.1| PREDICTED: protein phosphatase 1 regulatory subunit 7 [Camelus 
bactrianus]
Length=426

 Score = 55.5 bits (132),  Expect(2) = 2e-08, Method: Compositional matrix adjust.
 Identities = 39/81 (48%), Positives = 60/81 (74%), Gaps = 1/81 (1%)
 Frame = +2

Query  377  FKKLLVFDVSFNEITSPSGLSKVSSTLKELYVSNNQIAKIEEIEHFHELQILELGSNKLR  556
              +L + D+SFN + +  G+ K++  LK+L++ NN+I KIE I   H+LQ+LELGSN++R
Sbjct  141  LTELEILDISFNLLRNIEGIDKLTR-LKKLFLVNNKINKIENISTLHQLQMLELGSNRIR  199

Query  557  VMenlqtltnlxelwlGRNRI  619
             +EN+ TLTNL  L+LG+N+I
Sbjct  200  AIENIDTLTNLESLFLGKNKI  220


 Score = 30.0 bits (66),  Expect(2) = 2e-08, Method: Compositional matrix adjust.
 Identities = 20/56 (36%), Positives = 26/56 (46%), Gaps = 5/56 (9%)
 Frame = +3

Query  231  LSNLNKFSLRQNLITDAALEPLSSWHTISQLEELVLRDNQLKKIPVLAYLRNFWYL  398
            L  +    LRQNLI     + + +   +  L EL L DNQ+KKI  L  L     L
Sbjct  97   LKKVKTLCLRQNLI-----KCIENLEELQSLRELDLYDNQIKKIENLEALTELEIL  147



>ref|XP_006989655.1| PREDICTED: protein phosphatase 1 regulatory subunit 7 isoform 
X1 [Peromyscus maniculatus bairdii]
Length=360

 Score = 56.2 bits (134),  Expect(2) = 2e-08, Method: Compositional matrix adjust.
 Identities = 39/81 (48%), Positives = 60/81 (74%), Gaps = 1/81 (1%)
 Frame = +2

Query  377  FKKLLVFDVSFNEITSPSGLSKVSSTLKELYVSNNQIAKIEEIEHFHELQILELGSNKLR  556
              +L + D+SFN + +  G+ K++  LK+L++ NN+I KIE I   H+LQ+LELGSN++R
Sbjct  141  LTELEILDISFNLLRNIEGIDKLTQ-LKKLFLVNNKINKIENISTLHQLQMLELGSNRIR  199

Query  557  VMenlqtltnlxelwlGRNRI  619
             +EN+ TLTNL  L+LG+N+I
Sbjct  200  AIENIDTLTNLESLFLGKNKI  220


 Score = 28.9 bits (63),  Expect(2) = 2e-08, Method: Compositional matrix adjust.
 Identities = 20/56 (36%), Positives = 26/56 (46%), Gaps = 5/56 (9%)
 Frame = +3

Query  231  LSNLNKFSLRQNLITDAALEPLSSWHTISQLEELVLRDNQLKKIPVLAYLRNFWYL  398
            L  +    LRQNLI     + + +   +  L EL L DNQ+KKI  L  L     L
Sbjct  97   LKKVKSLCLRQNLI-----KCIENLEELQSLRELDLYDNQIKKIENLEALTELEIL  147



>ref|NP_001269338.1| protein phosphatase 1 regulatory subunit 7 isoform 2 [Homo sapiens]
 ref|XP_003813114.1| PREDICTED: protein phosphatase 1 regulatory subunit 7 isoform 
X2 [Pan paniscus]
 ref|XP_004033525.1| PREDICTED: protein phosphatase 1 regulatory subunit 7 isoform 
2 [Gorilla gorilla gorilla]
 ref|XP_004092113.1| PREDICTED: protein phosphatase 1 regulatory subunit 7 [Nomascus 
leucogenys]
 gb|AAD26610.1| protein phosphatase-1 regulatory subunit 7 alpha2 [Homo sapiens]
 gb|EAW71243.1| protein phosphatase 1, regulatory subunit 7, isoform CRA_a [Homo 
sapiens]
 dbj|BAG57395.1| unnamed protein product [Homo sapiens]
Length=317

 Score = 56.6 bits (135),  Expect(2) = 2e-08, Method: Compositional matrix adjust.
 Identities = 38/81 (47%), Positives = 62/81 (77%), Gaps = 1/81 (1%)
 Frame = +2

Query  377  FKKLLVFDVSFNEITSPSGLSKVSSTLKELYVSNNQIAKIEEIEHFHELQILELGSNKLR  556
              +L + D+SFN + +  G+ K++  LK+L++ NN+I+KIE + + H+LQ+LELGSN++R
Sbjct  98   LTELEILDISFNLLRNIEGVDKLTR-LKKLFLVNNKISKIENLSNLHQLQMLELGSNRIR  156

Query  557  VMenlqtltnlxelwlGRNRI  619
             +EN+ TLTNL  L+LG+N+I
Sbjct  157  AIENIDTLTNLESLFLGKNKI  177


 Score = 28.5 bits (62),  Expect(2) = 2e-08, Method: Compositional matrix adjust.
 Identities = 19/50 (38%), Positives = 25/50 (50%), Gaps = 5/50 (10%)
 Frame = +3

Query  231  LSNLNKFSLRQNLITDAALEPLSSWHTISQLEELVLRDNQLKKIPVLAYL  380
            L  +    LRQNLI     + + +   +  L EL L DNQ+KKI  L  L
Sbjct  54   LKKVKTLCLRQNLI-----KCIENLEELQSLRELDLYDNQIKKIENLEAL  98



>ref|XP_005361434.1| PREDICTED: protein phosphatase 1 regulatory subunit 7 [Microtus 
ochrogaster]
Length=303

 Score = 56.6 bits (135),  Expect(2) = 2e-08, Method: Compositional matrix adjust.
 Identities = 37/76 (49%), Positives = 59/76 (78%), Gaps = 1/76 (1%)
 Frame = +2

Query  392  VFDVSFNEITSPSGLSKVSSTLKELYVSNNQIAKIEEIEHFHELQILELGSNKLRVMenl  571
            + D+SFN + +  G+ K++  LK+L++ NN+I+KIE +   H+LQ+LELGSN++R +EN+
Sbjct  78   ILDISFNLLRNIEGIDKLTQ-LKKLFLVNNKISKIENLSTLHQLQMLELGSNRIRAIENI  136

Query  572  qtltnlxelwlGRNRI  619
             TLTNL  L+LG+N+I
Sbjct  137  DTLTNLESLFLGKNKI  152


 Score = 28.5 bits (62),  Expect(2) = 2e-08, Method: Compositional matrix adjust.
 Identities = 19/50 (38%), Positives = 25/50 (50%), Gaps = 5/50 (10%)
 Frame = +3

Query  231  LSNLNKFSLRQNLITDAALEPLSSWHTISQLEELVLRDNQLKKIPVLAYL  380
            L  +    LRQNLI     + + +   +  L EL L DNQ+KKI  L  L
Sbjct  29   LKKVKSLCLRQNLI-----KCIENLEELQSLRELDLYDNQIKKIENLEAL  73



>ref|XP_005077258.1| PREDICTED: protein phosphatase 1 regulatory subunit 7 isoform 
X1 [Mesocricetus auratus]
Length=360

 Score = 55.8 bits (133),  Expect(2) = 3e-08, Method: Compositional matrix adjust.
 Identities = 40/81 (49%), Positives = 60/81 (74%), Gaps = 1/81 (1%)
 Frame = +2

Query  377  FKKLLVFDVSFNEITSPSGLSKVSSTLKELYVSNNQIAKIEEIEHFHELQILELGSNKLR  556
              +L V D+SFN + +  G+ K++  LK+L++ NN+I KIE I   H+LQ+LELGSN++R
Sbjct  141  LTELEVLDISFNLLRNIEGIDKLTR-LKKLFLVNNKINKIENIGTLHQLQMLELGSNRIR  199

Query  557  VMenlqtltnlxelwlGRNRI  619
             +EN+ TLTNL  L+LG+N+I
Sbjct  200  AIENIDTLTNLESLFLGKNKI  220


 Score = 28.9 bits (63),  Expect(2) = 3e-08, Method: Compositional matrix adjust.
 Identities = 20/56 (36%), Positives = 26/56 (46%), Gaps = 5/56 (9%)
 Frame = +3

Query  231  LSNLNKFSLRQNLITDAALEPLSSWHTISQLEELVLRDNQLKKIPVLAYLRNFWYL  398
            L  +    LRQNLI     + + +   +  L EL L DNQ+KKI  L  L     L
Sbjct  97   LKKVKSLCLRQNLI-----KCIENLEELQSLRELDLYDNQIKKIENLEALTELEVL  147



>ref|XP_004905710.1| PREDICTED: protein phosphatase 1 regulatory subunit 7 isoform 
X2 [Heterocephalus glaber]
 ref|XP_004868529.1| PREDICTED: protein phosphatase 1 regulatory subunit 7 isoform 
X2 [Heterocephalus glaber]
Length=355

 Score = 56.2 bits (134),  Expect(2) = 3e-08, Method: Compositional matrix adjust.
 Identities = 37/81 (46%), Positives = 62/81 (77%), Gaps = 1/81 (1%)
 Frame = +2

Query  377  FKKLLVFDVSFNEITSPSGLSKVSSTLKELYVSNNQIAKIEEIEHFHELQILELGSNKLR  556
              +L + D+SFN + +  G+ +++  LK+L++ NN+I+KIE + + H+LQ+LELGSN++R
Sbjct  136  LTELEILDISFNLLRNIEGIDQLTQ-LKKLFLVNNKISKIENLSNLHQLQMLELGSNRIR  194

Query  557  VMenlqtltnlxelwlGRNRI  619
             +EN+ TLTNL  L+LG+N+I
Sbjct  195  AIENIDTLTNLESLFLGKNKI  215


 Score = 28.9 bits (63),  Expect(2) = 3e-08, Method: Compositional matrix adjust.
 Identities = 19/50 (38%), Positives = 25/50 (50%), Gaps = 5/50 (10%)
 Frame = +3

Query  231  LSNLNKFSLRQNLITDAALEPLSSWHTISQLEELVLRDNQLKKIPVLAYL  380
            L  +    LRQNLI     + + +   +  L EL L DNQ+KKI  L  L
Sbjct  92   LKKVKTLCLRQNLI-----KCIENLEELQSLRELDLYDNQIKKIENLEAL  136



>ref|XP_003639940.2| PREDICTED: protein phosphatase 1 regulatory subunit 7 isoform 
X1 [Canis lupus familiaris]
Length=407

 Score = 56.6 bits (135),  Expect(2) = 3e-08, Method: Compositional matrix adjust.
 Identities = 37/78 (47%), Positives = 61/78 (78%), Gaps = 1/78 (1%)
 Frame = +2

Query  386  LLVFDVSFNEITSPSGLSKVSSTLKELYVSNNQIAKIEEIEHFHELQILELGSNKLRVMe  565
            L + D+SFN + +  G+ K++  L++L++ NN+I+KIE I + H+LQ+LELGSN++R +E
Sbjct  191  LEILDISFNLLRNIEGVDKLTR-LRKLFLVNNKISKIENISNLHQLQMLELGSNRIRAIE  249

Query  566  nlqtltnlxelwlGRNRI  619
            N+ TLT+L  L+LG+N+I
Sbjct  250  NIDTLTSLESLFLGKNKI  267


 Score = 28.5 bits (62),  Expect(2) = 3e-08, Method: Compositional matrix adjust.
 Identities = 21/50 (42%), Positives = 25/50 (50%), Gaps = 5/50 (10%)
 Frame = +3

Query  231  LSNLNKFSLRQNLITDAALEPLSSWHTISQLEELVLRDNQLKKIPVLAYL  380
            L  +    LRQNLI    +E L    +   L EL L DNQ+KKI  L  L
Sbjct  144  LKKVKTLCLRQNLIK--CIENLGELQS---LRELDLYDNQIKKIENLEAL  188



>ref|XP_006209213.1| PREDICTED: protein phosphatase 1 regulatory subunit 7 isoform 
X1 [Vicugna pacos]
Length=360

 Score = 55.8 bits (133),  Expect(2) = 3e-08, Method: Compositional matrix adjust.
 Identities = 39/81 (48%), Positives = 60/81 (74%), Gaps = 1/81 (1%)
 Frame = +2

Query  377  FKKLLVFDVSFNEITSPSGLSKVSSTLKELYVSNNQIAKIEEIEHFHELQILELGSNKLR  556
              +L + D+SFN + +  G+ K++  LK+L++ NN+I KIE I   H+LQ+LELGSN++R
Sbjct  141  LTELEILDISFNLLRNIEGIDKLTR-LKKLFLVNNKINKIENISTLHQLQMLELGSNRIR  199

Query  557  VMenlqtltnlxelwlGRNRI  619
             +EN+ TLTNL  L+LG+N+I
Sbjct  200  AIENIDTLTNLESLFLGKNKI  220


 Score = 29.3 bits (64),  Expect(2) = 3e-08, Method: Compositional matrix adjust.
 Identities = 20/56 (36%), Positives = 26/56 (46%), Gaps = 5/56 (9%)
 Frame = +3

Query  231  LSNLNKFSLRQNLITDAALEPLSSWHTISQLEELVLRDNQLKKIPVLAYLRNFWYL  398
            L  +    LRQNLI     + + +   +  L EL L DNQ+KKI  L  L     L
Sbjct  97   LKKVKTLCLRQNLI-----KCIENLEELQSLRELDLYDNQIKKIENLEALTELEIL  147



>ref|XP_010986780.1| PREDICTED: protein phosphatase 1 regulatory subunit 7 isoform 
X1 [Camelus dromedarius]
Length=350

 Score = 55.8 bits (133),  Expect(2) = 3e-08, Method: Compositional matrix adjust.
 Identities = 39/81 (48%), Positives = 60/81 (74%), Gaps = 1/81 (1%)
 Frame = +2

Query  377  FKKLLVFDVSFNEITSPSGLSKVSSTLKELYVSNNQIAKIEEIEHFHELQILELGSNKLR  556
              +L + D+SFN + +  G+ K++  LK+L++ NN+I KIE I   H+LQ+LELGSN++R
Sbjct  131  LTELEILDISFNLLRNIEGIDKLTR-LKKLFLVNNKINKIENISTLHQLQMLELGSNRIR  189

Query  557  VMenlqtltnlxelwlGRNRI  619
             +EN+ TLTNL  L+LG+N+I
Sbjct  190  AIENIDTLTNLESLFLGKNKI  210


 Score = 29.3 bits (64),  Expect(2) = 3e-08, Method: Compositional matrix adjust.
 Identities = 20/56 (36%), Positives = 26/56 (46%), Gaps = 5/56 (9%)
 Frame = +3

Query  231  LSNLNKFSLRQNLITDAALEPLSSWHTISQLEELVLRDNQLKKIPVLAYLRNFWYL  398
            L  +    LRQNLI     + + +   +  L EL L DNQ+KKI  L  L     L
Sbjct  87   LKKVKTLCLRQNLI-----KCIENLEELQSLRELDLYDNQIKKIENLEALTELEIL  137



>ref|XP_006181900.1| PREDICTED: protein phosphatase 1 regulatory subunit 7 [Camelus 
ferus]
 ref|XP_010986781.1| PREDICTED: protein phosphatase 1 regulatory subunit 7 isoform 
X2 [Camelus dromedarius]
Length=346

 Score = 56.2 bits (134),  Expect(2) = 3e-08, Method: Compositional matrix adjust.
 Identities = 39/81 (48%), Positives = 60/81 (74%), Gaps = 1/81 (1%)
 Frame = +2

Query  377  FKKLLVFDVSFNEITSPSGLSKVSSTLKELYVSNNQIAKIEEIEHFHELQILELGSNKLR  556
              +L + D+SFN + +  G+ K++  LK+L++ NN+I KIE I   H+LQ+LELGSN++R
Sbjct  127  LTELEILDISFNLLRNIEGIDKLTR-LKKLFLVNNKINKIENISTLHQLQMLELGSNRIR  185

Query  557  VMenlqtltnlxelwlGRNRI  619
             +EN+ TLTNL  L+LG+N+I
Sbjct  186  AIENIDTLTNLESLFLGKNKI  206


 Score = 28.9 bits (63),  Expect(2) = 3e-08, Method: Compositional matrix adjust.
 Identities = 19/50 (38%), Positives = 25/50 (50%), Gaps = 5/50 (10%)
 Frame = +3

Query  231  LSNLNKFSLRQNLITDAALEPLSSWHTISQLEELVLRDNQLKKIPVLAYL  380
            L  +    LRQNLI     + + +   +  L EL L DNQ+KKI  L  L
Sbjct  83   LKKVKTLCLRQNLI-----KCIENLEELQSLRELDLYDNQIKKIENLEAL  127



>ref|NP_001269342.1| protein phosphatase 1 regulatory subunit 7 isoform 6 [Homo sapiens]
Length=301

 Score = 57.0 bits (136),  Expect(2) = 3e-08, Method: Compositional matrix adjust.
 Identities = 37/76 (49%), Positives = 60/76 (79%), Gaps = 1/76 (1%)
 Frame = +2

Query  392  VFDVSFNEITSPSGLSKVSSTLKELYVSNNQIAKIEEIEHFHELQILELGSNKLRVMenl  571
            + D+SFN + +  G+ K++  LK+L++ NN+I+KIE + + H+LQ+LELGSN++R +EN+
Sbjct  87   ILDISFNLLRNIEGVDKLTR-LKKLFLVNNKISKIENLSNLHQLQMLELGSNRIRAIENI  145

Query  572  qtltnlxelwlGRNRI  619
             TLTNL  L+LG+N+I
Sbjct  146  DTLTNLESLFLGKNKI  161


 Score = 28.1 bits (61),  Expect(2) = 3e-08, Method: Compositional matrix adjust.
 Identities = 19/50 (38%), Positives = 25/50 (50%), Gaps = 5/50 (10%)
 Frame = +3

Query  231  LSNLNKFSLRQNLITDAALEPLSSWHTISQLEELVLRDNQLKKIPVLAYL  380
            L  +    LRQNLI     + + +   +  L EL L DNQ+KKI  L  L
Sbjct  38   LKKVKTLCLRQNLI-----KCIENLEELQSLRELDLYDNQIKKIENLEAL  82



>ref|XP_008576592.1| PREDICTED: protein phosphatase 1 regulatory subunit 7 [Galeopterus 
variegatus]
Length=286

 Score = 55.5 bits (132),  Expect(2) = 3e-08, Method: Compositional matrix adjust.
 Identities = 27/58 (47%), Positives = 45/58 (78%), Gaps = 1/58 (2%)
 Frame = +2

Query  383  KLLVFDVSFNEITSPSGLSKVSSTLKELYVSNNQIAKIEEIEHFHELQILELGSNKLR  556
            +L + D+SFN + +  G+ K++  LK+L++ NN+I+KIE I + H+LQ+LELGSN++R
Sbjct  143  ELEILDISFNLLRNIEGIDKLTQ-LKKLFLVNNKISKIENISNLHQLQMLELGSNRIR  199


 Score = 29.3 bits (64),  Expect(2) = 3e-08, Method: Compositional matrix adjust.
 Identities = 22/56 (39%), Positives = 26/56 (46%), Gaps = 5/56 (9%)
 Frame = +3

Query  231  LSNLNKFSLRQNLITDAALEPLSSWHTISQLEELVLRDNQLKKIPVLAYLRNFWYL  398
            L  +    LRQNLI    +E L    +   L EL L DNQ+KKI  L  L     L
Sbjct  97   LKKVKTLCLRQNLIK--CIENLEELQS---LRELDLYDNQIKKIENLEALTELEIL  147



>ref|XP_007127867.1| PREDICTED: protein phosphatase 1 regulatory subunit 7 isoform 
X4 [Physeter catodon]
Length=336

 Score = 55.1 bits (131),  Expect(2) = 3e-08, Method: Compositional matrix adjust.
 Identities = 38/81 (47%), Positives = 60/81 (74%), Gaps = 1/81 (1%)
 Frame = +2

Query  377  FKKLLVFDVSFNEITSPSGLSKVSSTLKELYVSNNQIAKIEEIEHFHELQILELGSNKLR  556
              +L + D+SFN + +  G+ K++  LK+L++ NN+I KIE +   H+LQ+LELGSN++R
Sbjct  145  LTELEILDISFNLLRNIEGIDKLTR-LKKLFLVNNKIHKIENVSSLHQLQMLELGSNRIR  203

Query  557  VMenlqtltnlxelwlGRNRI  619
             +EN+ TLTNL  L+LG+N+I
Sbjct  204  AIENIDTLTNLESLFLGKNKI  224


 Score = 29.6 bits (65),  Expect(2) = 3e-08, Method: Compositional matrix adjust.
 Identities = 20/56 (36%), Positives = 26/56 (46%), Gaps = 5/56 (9%)
 Frame = +3

Query  231  LSNLNKFSLRQNLITDAALEPLSSWHTISQLEELVLRDNQLKKIPVLAYLRNFWYL  398
            L  +    LRQNLI     + + +   +  L EL L DNQ+KKI  L  L     L
Sbjct  101  LKKVKTLCLRQNLI-----KCIENLEELQSLRELDLYDNQIKKIENLEGLTELEIL  151



>ref|XP_004667874.1| PREDICTED: protein phosphatase 1 regulatory subunit 7 isoform 
X1 [Jaculus jaculus]
Length=360

 Score = 56.6 bits (135),  Expect(2) = 3e-08, Method: Compositional matrix adjust.
 Identities = 38/81 (47%), Positives = 61/81 (75%), Gaps = 1/81 (1%)
 Frame = +2

Query  377  FKKLLVFDVSFNEITSPSGLSKVSSTLKELYVSNNQIAKIEEIEHFHELQILELGSNKLR  556
              +L + D+SFN + +  G+ K++  LK+L++ NN+I+KIE +   H+LQ+LELGSN++R
Sbjct  141  LTELEILDISFNLLRNIEGIDKLTR-LKKLFLVNNKISKIENLSSLHQLQMLELGSNRIR  199

Query  557  VMenlqtltnlxelwlGRNRI  619
             +EN+ TLTNL  L+LG+N+I
Sbjct  200  AIENIDTLTNLESLFLGKNKI  220


 Score = 28.5 bits (62),  Expect(2) = 3e-08, Method: Compositional matrix adjust.
 Identities = 19/50 (38%), Positives = 25/50 (50%), Gaps = 5/50 (10%)
 Frame = +3

Query  231  LSNLNKFSLRQNLITDAALEPLSSWHTISQLEELVLRDNQLKKIPVLAYL  380
            L  +    LRQNLI     + + +   +  L EL L DNQ+KKI  L  L
Sbjct  97   LKKVKTLCLRQNLI-----KCIENLEELQGLRELDLYDNQIKKIENLEAL  141



>ref|XP_004905709.1| PREDICTED: protein phosphatase 1 regulatory subunit 7 isoform 
X1 [Heterocephalus glaber]
 ref|XP_004868528.1| PREDICTED: protein phosphatase 1 regulatory subunit 7 isoform 
X1 [Heterocephalus glaber]
 gb|EHB16176.1| Protein phosphatase 1 regulatory subunit 7 [Heterocephalus glaber]
Length=360

 Score = 56.2 bits (134),  Expect(2) = 3e-08, Method: Compositional matrix adjust.
 Identities = 37/81 (46%), Positives = 62/81 (77%), Gaps = 1/81 (1%)
 Frame = +2

Query  377  FKKLLVFDVSFNEITSPSGLSKVSSTLKELYVSNNQIAKIEEIEHFHELQILELGSNKLR  556
              +L + D+SFN + +  G+ +++  LK+L++ NN+I+KIE + + H+LQ+LELGSN++R
Sbjct  141  LTELEILDISFNLLRNIEGIDQLTQ-LKKLFLVNNKISKIENLSNLHQLQMLELGSNRIR  199

Query  557  VMenlqtltnlxelwlGRNRI  619
             +EN+ TLTNL  L+LG+N+I
Sbjct  200  AIENIDTLTNLESLFLGKNKI  220


 Score = 28.9 bits (63),  Expect(2) = 3e-08, Method: Compositional matrix adjust.
 Identities = 19/50 (38%), Positives = 25/50 (50%), Gaps = 5/50 (10%)
 Frame = +3

Query  231  LSNLNKFSLRQNLITDAALEPLSSWHTISQLEELVLRDNQLKKIPVLAYL  380
            L  +    LRQNLI     + + +   +  L EL L DNQ+KKI  L  L
Sbjct  97   LKKVKTLCLRQNLI-----KCIENLEELQSLRELDLYDNQIKKIENLEAL  141



>ref|XP_005636023.1| PREDICTED: protein phosphatase 1 regulatory subunit 7 isoform 
X2 [Canis lupus familiaris]
Length=411

 Score = 56.2 bits (134),  Expect(2) = 3e-08, Method: Compositional matrix adjust.
 Identities = 37/78 (47%), Positives = 61/78 (78%), Gaps = 1/78 (1%)
 Frame = +2

Query  386  LLVFDVSFNEITSPSGLSKVSSTLKELYVSNNQIAKIEEIEHFHELQILELGSNKLRVMe  565
            L + D+SFN + +  G+ K++  L++L++ NN+I+KIE I + H+LQ+LELGSN++R +E
Sbjct  195  LEILDISFNLLRNIEGVDKLTR-LRKLFLVNNKISKIENISNLHQLQMLELGSNRIRAIE  253

Query  566  nlqtltnlxelwlGRNRI  619
            N+ TLT+L  L+LG+N+I
Sbjct  254  NIDTLTSLESLFLGKNKI  271


 Score = 28.9 bits (63),  Expect(2) = 3e-08, Method: Compositional matrix adjust.
 Identities = 21/50 (42%), Positives = 25/50 (50%), Gaps = 5/50 (10%)
 Frame = +3

Query  231  LSNLNKFSLRQNLITDAALEPLSSWHTISQLEELVLRDNQLKKIPVLAYL  380
            L  +    LRQNLI    +E L    +   L EL L DNQ+KKI  L  L
Sbjct  148  LKKVKTLCLRQNLIK--CIENLGELQS---LRELDLYDNQIKKIENLEAL  192



>ref|XP_004905712.1| PREDICTED: protein phosphatase 1 regulatory subunit 7 isoform 
X4 [Heterocephalus glaber]
 ref|XP_004868531.1| PREDICTED: protein phosphatase 1 regulatory subunit 7 isoform 
X4 [Heterocephalus glaber]
Length=353

 Score = 56.2 bits (134),  Expect(2) = 3e-08, Method: Compositional matrix adjust.
 Identities = 36/76 (47%), Positives = 60/76 (79%), Gaps = 1/76 (1%)
 Frame = +2

Query  392  VFDVSFNEITSPSGLSKVSSTLKELYVSNNQIAKIEEIEHFHELQILELGSNKLRVMenl  571
            + D+SFN + +  G+ +++  LK+L++ NN+I+KIE + + H+LQ+LELGSN++R +EN+
Sbjct  139  ILDISFNLLRNIEGIDQLTQ-LKKLFLVNNKISKIENLSNLHQLQMLELGSNRIRAIENI  197

Query  572  qtltnlxelwlGRNRI  619
             TLTNL  L+LG+N+I
Sbjct  198  DTLTNLESLFLGKNKI  213


 Score = 28.5 bits (62),  Expect(2) = 3e-08, Method: Compositional matrix adjust.
 Identities = 19/50 (38%), Positives = 25/50 (50%), Gaps = 5/50 (10%)
 Frame = +3

Query  231  LSNLNKFSLRQNLITDAALEPLSSWHTISQLEELVLRDNQLKKIPVLAYL  380
            L  +    LRQNLI     + + +   +  L EL L DNQ+KKI  L  L
Sbjct  90   LKKVKTLCLRQNLI-----KCIENLEELQSLRELDLYDNQIKKIENLEAL  134



>ref|XP_004905711.1| PREDICTED: protein phosphatase 1 regulatory subunit 7 isoform 
X3 [Heterocephalus glaber]
 ref|XP_004868530.1| PREDICTED: protein phosphatase 1 regulatory subunit 7 isoform 
X3 [Heterocephalus glaber]
Length=354

 Score = 55.8 bits (133),  Expect(2) = 3e-08, Method: Compositional matrix adjust.
 Identities = 37/81 (46%), Positives = 62/81 (77%), Gaps = 1/81 (1%)
 Frame = +2

Query  377  FKKLLVFDVSFNEITSPSGLSKVSSTLKELYVSNNQIAKIEEIEHFHELQILELGSNKLR  556
              +L + D+SFN + +  G+ +++  LK+L++ NN+I+KIE + + H+LQ+LELGSN++R
Sbjct  135  LTELEILDISFNLLRNIEGIDQLTQ-LKKLFLVNNKISKIENLSNLHQLQMLELGSNRIR  193

Query  557  VMenlqtltnlxelwlGRNRI  619
             +EN+ TLTNL  L+LG+N+I
Sbjct  194  AIENIDTLTNLESLFLGKNKI  214


 Score = 28.9 bits (63),  Expect(2) = 3e-08, Method: Compositional matrix adjust.
 Identities = 19/50 (38%), Positives = 25/50 (50%), Gaps = 5/50 (10%)
 Frame = +3

Query  231  LSNLNKFSLRQNLITDAALEPLSSWHTISQLEELVLRDNQLKKIPVLAYL  380
            L  +    LRQNLI     + + +   +  L EL L DNQ+KKI  L  L
Sbjct  91   LKKVKTLCLRQNLI-----KCIENLEELQSLRELDLYDNQIKKIENLEAL  135



>ref|XP_005636024.1| PREDICTED: protein phosphatase 1 regulatory subunit 7 isoform 
X3 [Canis lupus familiaris]
Length=364

 Score = 56.2 bits (134),  Expect(2) = 3e-08, Method: Compositional matrix adjust.
 Identities = 37/78 (47%), Positives = 61/78 (78%), Gaps = 1/78 (1%)
 Frame = +2

Query  386  LLVFDVSFNEITSPSGLSKVSSTLKELYVSNNQIAKIEEIEHFHELQILELGSNKLRVMe  565
            L + D+SFN + +  G+ K++  L++L++ NN+I+KIE I + H+LQ+LELGSN++R +E
Sbjct  148  LEILDISFNLLRNIEGVDKLTR-LRKLFLVNNKISKIENISNLHQLQMLELGSNRIRAIE  206

Query  566  nlqtltnlxelwlGRNRI  619
            N+ TLT+L  L+LG+N+I
Sbjct  207  NIDTLTSLESLFLGKNKI  224


 Score = 28.5 bits (62),  Expect(2) = 3e-08, Method: Compositional matrix adjust.
 Identities = 21/50 (42%), Positives = 25/50 (50%), Gaps = 5/50 (10%)
 Frame = +3

Query  231  LSNLNKFSLRQNLITDAALEPLSSWHTISQLEELVLRDNQLKKIPVLAYL  380
            L  +    LRQNLI    +E L     +  L EL L DNQ+KKI  L  L
Sbjct  101  LKKVKTLCLRQNLI--KCIENLGE---LQSLRELDLYDNQIKKIENLEAL  145



>ref|XP_006209214.1| PREDICTED: protein phosphatase 1 regulatory subunit 7 isoform 
X2 [Vicugna pacos]
Length=317

 Score = 56.2 bits (134),  Expect(2) = 3e-08, Method: Compositional matrix adjust.
 Identities = 39/81 (48%), Positives = 60/81 (74%), Gaps = 1/81 (1%)
 Frame = +2

Query  377  FKKLLVFDVSFNEITSPSGLSKVSSTLKELYVSNNQIAKIEEIEHFHELQILELGSNKLR  556
              +L + D+SFN + +  G+ K++  LK+L++ NN+I KIE I   H+LQ+LELGSN++R
Sbjct  98   LTELEILDISFNLLRNIEGIDKLTR-LKKLFLVNNKINKIENISTLHQLQMLELGSNRIR  156

Query  557  VMenlqtltnlxelwlGRNRI  619
             +EN+ TLTNL  L+LG+N+I
Sbjct  157  AIENIDTLTNLESLFLGKNKI  177


 Score = 28.5 bits (62),  Expect(2) = 3e-08, Method: Compositional matrix adjust.
 Identities = 19/50 (38%), Positives = 25/50 (50%), Gaps = 5/50 (10%)
 Frame = +3

Query  231  LSNLNKFSLRQNLITDAALEPLSSWHTISQLEELVLRDNQLKKIPVLAYL  380
            L  +    LRQNLI     + + +   +  L EL L DNQ+KKI  L  L
Sbjct  54   LKKVKTLCLRQNLI-----KCIENLEELQSLRELDLYDNQIKKIENLEAL  98



>ref|XP_005077259.1| PREDICTED: protein phosphatase 1 regulatory subunit 7 isoform 
X2 [Mesocricetus auratus]
Length=317

 Score = 56.2 bits (134),  Expect(2) = 3e-08, Method: Compositional matrix adjust.
 Identities = 40/81 (49%), Positives = 60/81 (74%), Gaps = 1/81 (1%)
 Frame = +2

Query  377  FKKLLVFDVSFNEITSPSGLSKVSSTLKELYVSNNQIAKIEEIEHFHELQILELGSNKLR  556
              +L V D+SFN + +  G+ K++  LK+L++ NN+I KIE I   H+LQ+LELGSN++R
Sbjct  98   LTELEVLDISFNLLRNIEGIDKLTR-LKKLFLVNNKINKIENIGTLHQLQMLELGSNRIR  156

Query  557  VMenlqtltnlxelwlGRNRI  619
             +EN+ TLTNL  L+LG+N+I
Sbjct  157  AIENIDTLTNLESLFLGKNKI  177


 Score = 28.5 bits (62),  Expect(2) = 3e-08, Method: Compositional matrix adjust.
 Identities = 19/50 (38%), Positives = 25/50 (50%), Gaps = 5/50 (10%)
 Frame = +3

Query  231  LSNLNKFSLRQNLITDAALEPLSSWHTISQLEELVLRDNQLKKIPVLAYL  380
            L  +    LRQNLI     + + +   +  L EL L DNQ+KKI  L  L
Sbjct  54   LKKVKSLCLRQNLI-----KCIENLEELQSLRELDLYDNQIKKIENLEAL  98



>ref|XP_007342271.1| L domain-like protein [Auricularia delicata TFB-10046 SS5]
 gb|EJD49726.1| L domain-like protein [Auricularia delicata TFB-10046 SS5]
Length=450

 Score = 47.8 bits (112),  Expect(2) = 3e-08, Method: Compositional matrix adjust.
 Identities = 37/80 (46%), Positives = 52/80 (65%), Gaps = 2/80 (3%)
 Frame = +2

Query  383  KLLVFDVSFNEITS-PSGLSKVSSTLKELYVSNNQIAKIEEIEHFHELQILELGSNKLRV  559
            KL   D+SFN + + P GL+   + L  LY   N+IA+I+ + HF  L+ LELG N++R 
Sbjct  227  KLESLDLSFNLLRAVPPGLT-AQTGLTALYFVQNKIARIDHVSHFAALKTLELGGNRIRK  285

Query  560  MenlqtltnlxelwlGRNRI  619
            +ENL  L  L ELWLG+N+I
Sbjct  286  IENLDGLDALEELWLGKNKI  305


 Score = 37.0 bits (84),  Expect(2) = 3e-08, Method: Compositional matrix adjust.
 Identities = 21/41 (51%), Positives = 27/41 (66%), Gaps = 3/41 (7%)
 Frame = +3

Query  240  LNKFSLRQNLITDAALEPLSSWHTISQLEELVLRDNQLKKI  362
            L +  LRQN I++  L+P   W  +S+LEEL L DNQLK I
Sbjct  181  LKRLCLRQNHISE--LDP-EDWDALSELEELDLYDNQLKSI  218



>ref|XP_007127868.1| PREDICTED: protein phosphatase 1 regulatory subunit 7 isoform 
X5 [Physeter catodon]
Length=309

 Score = 55.5 bits (132),  Expect(2) = 4e-08, Method: Compositional matrix adjust.
 Identities = 38/81 (47%), Positives = 60/81 (74%), Gaps = 1/81 (1%)
 Frame = +2

Query  377  FKKLLVFDVSFNEITSPSGLSKVSSTLKELYVSNNQIAKIEEIEHFHELQILELGSNKLR  556
              +L + D+SFN + +  G+ K++  LK+L++ NN+I KIE +   H+LQ+LELGSN++R
Sbjct  145  LTELEILDISFNLLRNIEGIDKLTR-LKKLFLVNNKIHKIENVSSLHQLQMLELGSNRIR  203

Query  557  VMenlqtltnlxelwlGRNRI  619
             +EN+ TLTNL  L+LG+N+I
Sbjct  204  AIENIDTLTNLESLFLGKNKI  224


 Score = 29.3 bits (64),  Expect(2) = 4e-08, Method: Compositional matrix adjust.
 Identities = 20/56 (36%), Positives = 26/56 (46%), Gaps = 5/56 (9%)
 Frame = +3

Query  231  LSNLNKFSLRQNLITDAALEPLSSWHTISQLEELVLRDNQLKKIPVLAYLRNFWYL  398
            L  +    LRQNLI     + + +   +  L EL L DNQ+KKI  L  L     L
Sbjct  101  LKKVKTLCLRQNLI-----KCIENLEELQSLRELDLYDNQIKKIENLEGLTELEIL  151



>ref|XP_007470013.1| PREDICTED: protein phosphatase 1 regulatory subunit 7 isoform 
X3 [Lipotes vexillifer]
Length=362

 Score = 55.8 bits (133),  Expect(2) = 4e-08, Method: Compositional matrix adjust.
 Identities = 36/81 (44%), Positives = 59/81 (73%), Gaps = 1/81 (1%)
 Frame = +2

Query  377  FKKLLVFDVSFNEITSPSGLSKVSSTLKELYVSNNQIAKIEEIEHFHELQILELGSNKLR  556
              +L + D+SFN + +  G+ K++  LK+L++ NN+I KIE +   H+LQ+LELGSN++R
Sbjct  143  LTELEILDISFNLLRNIEGIDKLTR-LKKLFLVNNKINKIENVSSLHQLQMLELGSNRIR  201

Query  557  VMenlqtltnlxelwlGRNRI  619
             +EN+  LT+L  L+LG+N+I
Sbjct  202  AIENIDALTSLESLFLGKNKI  222


 Score = 28.5 bits (62),  Expect(2) = 4e-08, Method: Compositional matrix adjust.
 Identities = 20/56 (36%), Positives = 26/56 (46%), Gaps = 5/56 (9%)
 Frame = +3

Query  231  LSNLNKFSLRQNLITDAALEPLSSWHTISQLEELVLRDNQLKKIPVLAYLRNFWYL  398
            L  +    LRQNLI     + + +   +  L EL L DNQ+KKI  L  L     L
Sbjct  99   LKKVKTLCLRQNLI-----KCIENLEELQSLRELDLYDNQIKKIENLEGLTELEIL  149



>ref|XP_004667875.1| PREDICTED: protein phosphatase 1 regulatory subunit 7 isoform 
X2 [Jaculus jaculus]
Length=317

 Score = 56.6 bits (135),  Expect(2) = 4e-08, Method: Compositional matrix adjust.
 Identities = 38/81 (47%), Positives = 61/81 (75%), Gaps = 1/81 (1%)
 Frame = +2

Query  377  FKKLLVFDVSFNEITSPSGLSKVSSTLKELYVSNNQIAKIEEIEHFHELQILELGSNKLR  556
              +L + D+SFN + +  G+ K++  LK+L++ NN+I+KIE +   H+LQ+LELGSN++R
Sbjct  98   LTELEILDISFNLLRNIEGIDKLTR-LKKLFLVNNKISKIENLSSLHQLQMLELGSNRIR  156

Query  557  VMenlqtltnlxelwlGRNRI  619
             +EN+ TLTNL  L+LG+N+I
Sbjct  157  AIENIDTLTNLESLFLGKNKI  177


 Score = 28.1 bits (61),  Expect(2) = 4e-08, Method: Compositional matrix adjust.
 Identities = 19/50 (38%), Positives = 25/50 (50%), Gaps = 5/50 (10%)
 Frame = +3

Query  231  LSNLNKFSLRQNLITDAALEPLSSWHTISQLEELVLRDNQLKKIPVLAYL  380
            L  +    LRQNLI     + + +   +  L EL L DNQ+KKI  L  L
Sbjct  54   LKKVKTLCLRQNLI-----KCIENLEELQGLRELDLYDNQIKKIENLEAL  98



>ref|XP_007470012.1| PREDICTED: protein phosphatase 1 regulatory subunit 7 isoform 
X2 [Lipotes vexillifer]
Length=369

 Score = 55.8 bits (133),  Expect(2) = 4e-08, Method: Compositional matrix adjust.
 Identities = 36/81 (44%), Positives = 59/81 (73%), Gaps = 1/81 (1%)
 Frame = +2

Query  377  FKKLLVFDVSFNEITSPSGLSKVSSTLKELYVSNNQIAKIEEIEHFHELQILELGSNKLR  556
              +L + D+SFN + +  G+ K++  LK+L++ NN+I KIE +   H+LQ+LELGSN++R
Sbjct  150  LTELEILDISFNLLRNIEGIDKLTR-LKKLFLVNNKINKIENVSSLHQLQMLELGSNRIR  208

Query  557  VMenlqtltnlxelwlGRNRI  619
             +EN+  LT+L  L+LG+N+I
Sbjct  209  AIENIDALTSLESLFLGKNKI  229


 Score = 28.9 bits (63),  Expect(2) = 4e-08, Method: Compositional matrix adjust.
 Identities = 20/56 (36%), Positives = 26/56 (46%), Gaps = 5/56 (9%)
 Frame = +3

Query  231  LSNLNKFSLRQNLITDAALEPLSSWHTISQLEELVLRDNQLKKIPVLAYLRNFWYL  398
            L  +    LRQNLI     + + +   +  L EL L DNQ+KKI  L  L     L
Sbjct  106  LKKVKTLCLRQNLI-----KCIENLEELQSLRELDLYDNQIKKIENLEGLTELEIL  156



>ref|XP_007127864.1| PREDICTED: protein phosphatase 1 regulatory subunit 7 isoform 
X1 [Physeter catodon]
Length=364

 Score = 55.5 bits (132),  Expect(2) = 4e-08, Method: Compositional matrix adjust.
 Identities = 38/81 (47%), Positives = 60/81 (74%), Gaps = 1/81 (1%)
 Frame = +2

Query  377  FKKLLVFDVSFNEITSPSGLSKVSSTLKELYVSNNQIAKIEEIEHFHELQILELGSNKLR  556
              +L + D+SFN + +  G+ K++  LK+L++ NN+I KIE +   H+LQ+LELGSN++R
Sbjct  145  LTELEILDISFNLLRNIEGIDKLTR-LKKLFLVNNKIHKIENVSSLHQLQMLELGSNRIR  203

Query  557  VMenlqtltnlxelwlGRNRI  619
             +EN+ TLTNL  L+LG+N+I
Sbjct  204  AIENIDTLTNLESLFLGKNKI  224


 Score = 28.9 bits (63),  Expect(2) = 4e-08, Method: Compositional matrix adjust.
 Identities = 20/56 (36%), Positives = 26/56 (46%), Gaps = 5/56 (9%)
 Frame = +3

Query  231  LSNLNKFSLRQNLITDAALEPLSSWHTISQLEELVLRDNQLKKIPVLAYLRNFWYL  398
            L  +    LRQNLI     + + +   +  L EL L DNQ+KKI  L  L     L
Sbjct  101  LKKVKTLCLRQNLI-----KCIENLEELQSLRELDLYDNQIKKIENLEGLTELEIL  151



>ref|XP_004905713.1| PREDICTED: protein phosphatase 1 regulatory subunit 7 isoform 
X5 [Heterocephalus glaber]
 ref|XP_004868532.1| PREDICTED: protein phosphatase 1 regulatory subunit 7 isoform 
X5 [Heterocephalus glaber]
Length=292

 Score = 56.2 bits (134),  Expect(2) = 4e-08, Method: Compositional matrix adjust.
 Identities = 36/76 (47%), Positives = 60/76 (79%), Gaps = 1/76 (1%)
 Frame = +2

Query  392  VFDVSFNEITSPSGLSKVSSTLKELYVSNNQIAKIEEIEHFHELQILELGSNKLRVMenl  571
            + D+SFN + +  G+ +++  LK+L++ NN+I+KIE + + H+LQ+LELGSN++R +EN+
Sbjct  78   ILDISFNLLRNIEGIDQLTQ-LKKLFLVNNKISKIENLSNLHQLQMLELGSNRIRAIENI  136

Query  572  qtltnlxelwlGRNRI  619
             TLTNL  L+LG+N+I
Sbjct  137  DTLTNLESLFLGKNKI  152


 Score = 28.1 bits (61),  Expect(2) = 4e-08, Method: Compositional matrix adjust.
 Identities = 19/50 (38%), Positives = 25/50 (50%), Gaps = 5/50 (10%)
 Frame = +3

Query  231  LSNLNKFSLRQNLITDAALEPLSSWHTISQLEELVLRDNQLKKIPVLAYL  380
            L  +    LRQNLI     + + +   +  L EL L DNQ+KKI  L  L
Sbjct  29   LKKVKTLCLRQNLI-----KCIENLEELQSLRELDLYDNQIKKIENLEAL  73



>ref|XP_007470011.1| PREDICTED: protein phosphatase 1 regulatory subunit 7 isoform 
X1 [Lipotes vexillifer]
Length=365

 Score = 55.8 bits (133),  Expect(2) = 4e-08, Method: Compositional matrix adjust.
 Identities = 36/81 (44%), Positives = 59/81 (73%), Gaps = 1/81 (1%)
 Frame = +2

Query  377  FKKLLVFDVSFNEITSPSGLSKVSSTLKELYVSNNQIAKIEEIEHFHELQILELGSNKLR  556
              +L + D+SFN + +  G+ K++  LK+L++ NN+I KIE +   H+LQ+LELGSN++R
Sbjct  146  LTELEILDISFNLLRNIEGIDKLTR-LKKLFLVNNKINKIENVSSLHQLQMLELGSNRIR  204

Query  557  VMenlqtltnlxelwlGRNRI  619
             +EN+  LT+L  L+LG+N+I
Sbjct  205  AIENIDALTSLESLFLGKNKI  225


 Score = 28.5 bits (62),  Expect(2) = 4e-08, Method: Compositional matrix adjust.
 Identities = 20/56 (36%), Positives = 26/56 (46%), Gaps = 5/56 (9%)
 Frame = +3

Query  231  LSNLNKFSLRQNLITDAALEPLSSWHTISQLEELVLRDNQLKKIPVLAYLRNFWYL  398
            L  +    LRQNLI     + + +   +  L EL L DNQ+KKI  L  L     L
Sbjct  102  LKKVKTLCLRQNLI-----KCIENLEELQSLRELDLYDNQIKKIENLEGLTELEIL  152



>ref|XP_004262575.1| PREDICTED: protein phosphatase 1 regulatory subunit 7 isoform 
1 [Orcinus orca]
Length=360

 Score = 55.8 bits (133),  Expect(2) = 4e-08, Method: Compositional matrix adjust.
 Identities = 37/81 (46%), Positives = 60/81 (74%), Gaps = 1/81 (1%)
 Frame = +2

Query  377  FKKLLVFDVSFNEITSPSGLSKVSSTLKELYVSNNQIAKIEEIEHFHELQILELGSNKLR  556
              +L + D+SFN + +  G+ K++  LK+L++ NN+I KIE +   H+LQ+LELGSN++R
Sbjct  141  LTELEILDISFNLLRNIEGIDKLTR-LKKLFLVNNKINKIENVSSLHQLQMLELGSNRIR  199

Query  557  VMenlqtltnlxelwlGRNRI  619
             +EN+ TLT+L  L+LG+N+I
Sbjct  200  AIENIDTLTSLESLFLGKNKI  220


 Score = 28.5 bits (62),  Expect(2) = 4e-08, Method: Compositional matrix adjust.
 Identities = 19/50 (38%), Positives = 25/50 (50%), Gaps = 5/50 (10%)
 Frame = +3

Query  231  LSNLNKFSLRQNLITDAALEPLSSWHTISQLEELVLRDNQLKKIPVLAYL  380
            L  +    LRQNLI     + + +   +  L EL L DNQ+KKI  L  L
Sbjct  97   LKKVKTLCLRQNLI-----KCIENLEELQSLRELDLYDNQIKKIENLEGL  141



>ref|XP_004262576.1| PREDICTED: protein phosphatase 1 regulatory subunit 7 isoform 
2 [Orcinus orca]
Length=317

 Score = 56.2 bits (134),  Expect(2) = 5e-08, Method: Compositional matrix adjust.
 Identities = 37/81 (46%), Positives = 60/81 (74%), Gaps = 1/81 (1%)
 Frame = +2

Query  377  FKKLLVFDVSFNEITSPSGLSKVSSTLKELYVSNNQIAKIEEIEHFHELQILELGSNKLR  556
              +L + D+SFN + +  G+ K++  LK+L++ NN+I KIE +   H+LQ+LELGSN++R
Sbjct  98   LTELEILDISFNLLRNIEGIDKLTR-LKKLFLVNNKINKIENVSSLHQLQMLELGSNRIR  156

Query  557  VMenlqtltnlxelwlGRNRI  619
             +EN+ TLT+L  L+LG+N+I
Sbjct  157  AIENIDTLTSLESLFLGKNKI  177


 Score = 28.1 bits (61),  Expect(2) = 5e-08, Method: Compositional matrix adjust.
 Identities = 19/50 (38%), Positives = 25/50 (50%), Gaps = 5/50 (10%)
 Frame = +3

Query  231  LSNLNKFSLRQNLITDAALEPLSSWHTISQLEELVLRDNQLKKIPVLAYL  380
            L  +    LRQNLI     + + +   +  L EL L DNQ+KKI  L  L
Sbjct  54   LKKVKTLCLRQNLI-----KCIENLEELQSLRELDLYDNQIKKIENLEGL  98



>ref|XP_004316990.1| PREDICTED: protein phosphatase 1 regulatory subunit 7 [Tursiops 
truncatus]
Length=346

 Score = 56.2 bits (134),  Expect(2) = 5e-08, Method: Compositional matrix adjust.
 Identities = 36/76 (47%), Positives = 58/76 (76%), Gaps = 1/76 (1%)
 Frame = +2

Query  392  VFDVSFNEITSPSGLSKVSSTLKELYVSNNQIAKIEEIEHFHELQILELGSNKLRVMenl  571
            + D+SFN + +  G+ K++  LK+L++ NN+I KIE +   H+LQ+LELGSN++R +EN+
Sbjct  132  ILDISFNLLRNIEGIDKLTR-LKKLFLVNNKINKIENVSSLHQLQMLELGSNRIRAIENI  190

Query  572  qtltnlxelwlGRNRI  619
             TLT+L  L+LG+N+I
Sbjct  191  DTLTSLESLFLGKNKI  206


 Score = 28.1 bits (61),  Expect(2) = 5e-08, Method: Compositional matrix adjust.
 Identities = 19/50 (38%), Positives = 25/50 (50%), Gaps = 5/50 (10%)
 Frame = +3

Query  231  LSNLNKFSLRQNLITDAALEPLSSWHTISQLEELVLRDNQLKKIPVLAYL  380
            L  +    LRQNLI     + + +   +  L EL L DNQ+KKI  L  L
Sbjct  83   LKKVKTLCLRQNLI-----KCIENLEELQSLRELDLYDNQIKKIENLEGL  127



>ref|XP_007127866.1| PREDICTED: protein phosphatase 1 regulatory subunit 7 isoform 
X3 [Physeter catodon]
Length=350

 Score = 55.5 bits (132),  Expect(2) = 5e-08, Method: Compositional matrix adjust.
 Identities = 38/79 (48%), Positives = 60/79 (76%), Gaps = 1/79 (1%)
 Frame = +2

Query  383  KLLVFDVSFNEITSPSGLSKVSSTLKELYVSNNQIAKIEEIEHFHELQILELGSNKLRVM  562
            +L + D+SFN + +  G+ K++  LK+L++ NN+I KIE +   H+LQ+LELGSN++R +
Sbjct  133  ELEILDISFNLLRNIEGIDKLTR-LKKLFLVNNKIHKIENVSSLHQLQMLELGSNRIRAI  191

Query  563  enlqtltnlxelwlGRNRI  619
            EN+ TLTNL  L+LG+N+I
Sbjct  192  ENIDTLTNLESLFLGKNKI  210


 Score = 28.5 bits (62),  Expect(2) = 5e-08, Method: Compositional matrix adjust.
 Identities = 20/56 (36%), Positives = 26/56 (46%), Gaps = 5/56 (9%)
 Frame = +3

Query  231  LSNLNKFSLRQNLITDAALEPLSSWHTISQLEELVLRDNQLKKIPVLAYLRNFWYL  398
            L  +    LRQNLI     + + +   +  L EL L DNQ+KKI  L  L     L
Sbjct  87   LKKVKTLCLRQNLI-----KCIENLEELQSLRELDLYDNQIKKIENLEGLTELEIL  137



>ref|XP_007470014.1| PREDICTED: protein phosphatase 1 regulatory subunit 7 isoform 
X4 [Lipotes vexillifer]
Length=317

 Score = 55.8 bits (133),  Expect(2) = 5e-08, Method: Compositional matrix adjust.
 Identities = 36/81 (44%), Positives = 59/81 (73%), Gaps = 1/81 (1%)
 Frame = +2

Query  377  FKKLLVFDVSFNEITSPSGLSKVSSTLKELYVSNNQIAKIEEIEHFHELQILELGSNKLR  556
              +L + D+SFN + +  G+ K++  LK+L++ NN+I KIE +   H+LQ+LELGSN++R
Sbjct  98   LTELEILDISFNLLRNIEGIDKLTR-LKKLFLVNNKINKIENVSSLHQLQMLELGSNRIR  156

Query  557  VMenlqtltnlxelwlGRNRI  619
             +EN+  LT+L  L+LG+N+I
Sbjct  157  AIENIDALTSLESLFLGKNKI  177


 Score = 28.1 bits (61),  Expect(2) = 5e-08, Method: Compositional matrix adjust.
 Identities = 19/50 (38%), Positives = 25/50 (50%), Gaps = 5/50 (10%)
 Frame = +3

Query  231  LSNLNKFSLRQNLITDAALEPLSSWHTISQLEELVLRDNQLKKIPVLAYL  380
            L  +    LRQNLI     + + +   +  L EL L DNQ+KKI  L  L
Sbjct  54   LKKVKTLCLRQNLI-----KCIENLEELQSLRELDLYDNQIKKIENLEGL  98



>ref|XP_007127865.1| PREDICTED: protein phosphatase 1 regulatory subunit 7 isoform 
X2 [Physeter catodon]
Length=360

 Score = 55.5 bits (132),  Expect(2) = 5e-08, Method: Compositional matrix adjust.
 Identities = 38/81 (47%), Positives = 60/81 (74%), Gaps = 1/81 (1%)
 Frame = +2

Query  377  FKKLLVFDVSFNEITSPSGLSKVSSTLKELYVSNNQIAKIEEIEHFHELQILELGSNKLR  556
              +L + D+SFN + +  G+ K++  LK+L++ NN+I KIE +   H+LQ+LELGSN++R
Sbjct  141  LTELEILDISFNLLRNIEGIDKLTR-LKKLFLVNNKIHKIENVSSLHQLQMLELGSNRIR  199

Query  557  VMenlqtltnlxelwlGRNRI  619
             +EN+ TLTNL  L+LG+N+I
Sbjct  200  AIENIDTLTNLESLFLGKNKI  220


 Score = 28.9 bits (63),  Expect(2) = 5e-08, Method: Compositional matrix adjust.
 Identities = 20/56 (36%), Positives = 26/56 (46%), Gaps = 5/56 (9%)
 Frame = +3

Query  231  LSNLNKFSLRQNLITDAALEPLSSWHTISQLEELVLRDNQLKKIPVLAYLRNFWYL  398
            L  +    LRQNLI     + + +   +  L EL L DNQ+KKI  L  L     L
Sbjct  97   LKKVKTLCLRQNLI-----KCIENLEELQSLRELDLYDNQIKKIENLEGLTELEIL  147



>ref|XP_007184913.1| PREDICTED: protein phosphatase 1 regulatory subunit 7 isoform 
X1 [Balaenoptera acutorostrata scammoni]
Length=364

 Score = 55.5 bits (132),  Expect(2) = 5e-08, Method: Compositional matrix adjust.
 Identities = 37/81 (46%), Positives = 59/81 (73%), Gaps = 1/81 (1%)
 Frame = +2

Query  377  FKKLLVFDVSFNEITSPSGLSKVSSTLKELYVSNNQIAKIEEIEHFHELQILELGSNKLR  556
              +L + D+SFN + +  G+ K++  LK+L++ NN+I KIE +   H+LQ+LELGSN++R
Sbjct  145  LTELEILDISFNLLRNIEGIDKLTR-LKKLFLVNNKINKIENVSSLHQLQMLELGSNRIR  203

Query  557  VMenlqtltnlxelwlGRNRI  619
             +EN+  LTNL  L+LG+N+I
Sbjct  204  AIENIDALTNLESLFLGKNKI  224


 Score = 28.5 bits (62),  Expect(2) = 5e-08, Method: Compositional matrix adjust.
 Identities = 20/56 (36%), Positives = 26/56 (46%), Gaps = 5/56 (9%)
 Frame = +3

Query  231  LSNLNKFSLRQNLITDAALEPLSSWHTISQLEELVLRDNQLKKIPVLAYLRNFWYL  398
            L  +    LRQNLI     + + +   +  L EL L DNQ+KKI  L  L     L
Sbjct  101  LKKVKTLCLRQNLI-----KCIENLEELRSLRELDLYDNQIKKIENLEGLTELEIL  151



>ref|XP_007184914.1| PREDICTED: protein phosphatase 1 regulatory subunit 7 isoform 
X2 [Balaenoptera acutorostrata scammoni]
Length=360

 Score = 55.8 bits (133),  Expect(2) = 5e-08, Method: Compositional matrix adjust.
 Identities = 37/81 (46%), Positives = 59/81 (73%), Gaps = 1/81 (1%)
 Frame = +2

Query  377  FKKLLVFDVSFNEITSPSGLSKVSSTLKELYVSNNQIAKIEEIEHFHELQILELGSNKLR  556
              +L + D+SFN + +  G+ K++  LK+L++ NN+I KIE +   H+LQ+LELGSN++R
Sbjct  141  LTELEILDISFNLLRNIEGIDKLTR-LKKLFLVNNKINKIENVSSLHQLQMLELGSNRIR  199

Query  557  VMenlqtltnlxelwlGRNRI  619
             +EN+  LTNL  L+LG+N+I
Sbjct  200  AIENIDALTNLESLFLGKNKI  220


 Score = 28.1 bits (61),  Expect(2) = 5e-08, Method: Compositional matrix adjust.
 Identities = 19/50 (38%), Positives = 25/50 (50%), Gaps = 5/50 (10%)
 Frame = +3

Query  231  LSNLNKFSLRQNLITDAALEPLSSWHTISQLEELVLRDNQLKKIPVLAYL  380
            L  +    LRQNLI     + + +   +  L EL L DNQ+KKI  L  L
Sbjct  97   LKKVKTLCLRQNLI-----KCIENLEELRSLRELDLYDNQIKKIENLEGL  141



>ref|XP_007184915.1| PREDICTED: protein phosphatase 1 regulatory subunit 7 isoform 
X3 [Balaenoptera acutorostrata scammoni]
Length=350

 Score = 55.5 bits (132),  Expect(2) = 6e-08, Method: Compositional matrix adjust.
 Identities = 37/79 (47%), Positives = 59/79 (75%), Gaps = 1/79 (1%)
 Frame = +2

Query  383  KLLVFDVSFNEITSPSGLSKVSSTLKELYVSNNQIAKIEEIEHFHELQILELGSNKLRVM  562
            +L + D+SFN + +  G+ K++  LK+L++ NN+I KIE +   H+LQ+LELGSN++R +
Sbjct  133  ELEILDISFNLLRNIEGIDKLTR-LKKLFLVNNKINKIENVSSLHQLQMLELGSNRIRAI  191

Query  563  enlqtltnlxelwlGRNRI  619
            EN+  LTNL  L+LG+N+I
Sbjct  192  ENIDALTNLESLFLGKNKI  210


 Score = 28.5 bits (62),  Expect(2) = 6e-08, Method: Compositional matrix adjust.
 Identities = 19/50 (38%), Positives = 25/50 (50%), Gaps = 5/50 (10%)
 Frame = +3

Query  231  LSNLNKFSLRQNLITDAALEPLSSWHTISQLEELVLRDNQLKKIPVLAYL  380
            L  +    LRQNLI     + + +   +  L EL L DNQ+KKI  L  L
Sbjct  87   LKKVKTLCLRQNLI-----KCIENLEELRSLRELDLYDNQIKKIENLEGL  131



>ref|XP_007127869.1| PREDICTED: protein phosphatase 1 regulatory subunit 7 isoform 
X6 [Physeter catodon]
Length=292

 Score = 56.2 bits (134),  Expect(2) = 6e-08, Method: Compositional matrix adjust.
 Identities = 37/76 (49%), Positives = 58/76 (76%), Gaps = 1/76 (1%)
 Frame = +2

Query  392  VFDVSFNEITSPSGLSKVSSTLKELYVSNNQIAKIEEIEHFHELQILELGSNKLRVMenl  571
            + D+SFN + +  G+ K++  LK+L++ NN+I KIE +   H+LQ+LELGSN++R +EN+
Sbjct  78   ILDISFNLLRNIEGIDKLTR-LKKLFLVNNKIHKIENVSSLHQLQMLELGSNRIRAIENI  136

Query  572  qtltnlxelwlGRNRI  619
             TLTNL  L+LG+N+I
Sbjct  137  DTLTNLESLFLGKNKI  152


 Score = 27.7 bits (60),  Expect(2) = 6e-08, Method: Compositional matrix adjust.
 Identities = 19/50 (38%), Positives = 25/50 (50%), Gaps = 5/50 (10%)
 Frame = +3

Query  231  LSNLNKFSLRQNLITDAALEPLSSWHTISQLEELVLRDNQLKKIPVLAYL  380
            L  +    LRQNLI     + + +   +  L EL L DNQ+KKI  L  L
Sbjct  29   LKKVKTLCLRQNLI-----KCIENLEELQSLRELDLYDNQIKKIENLEGL  73



>ref|XP_005411198.1| PREDICTED: protein phosphatase 1 regulatory subunit 7 isoform 
X1 [Chinchilla lanigera]
Length=360

 Score = 55.1 bits (131),  Expect(2) = 6e-08, Method: Compositional matrix adjust.
 Identities = 38/81 (47%), Positives = 62/81 (77%), Gaps = 1/81 (1%)
 Frame = +2

Query  377  FKKLLVFDVSFNEITSPSGLSKVSSTLKELYVSNNQIAKIEEIEHFHELQILELGSNKLR  556
              +L V D+SFN + +  G+ K++  LK+L++ NN+I+KIE + + ++LQ+LELGSN++R
Sbjct  141  LTELEVLDISFNLLRNIEGIDKLTQ-LKKLFLVNNKISKIENLSNLNQLQMLELGSNRIR  199

Query  557  VMenlqtltnlxelwlGRNRI  619
             +EN+ TLTNL  L+LG+N+I
Sbjct  200  AIENIDTLTNLESLFLGKNKI  220


 Score = 28.5 bits (62),  Expect(2) = 6e-08, Method: Compositional matrix adjust.
 Identities = 19/50 (38%), Positives = 25/50 (50%), Gaps = 5/50 (10%)
 Frame = +3

Query  231  LSNLNKFSLRQNLITDAALEPLSSWHTISQLEELVLRDNQLKKIPVLAYL  380
            L  +    LRQNLI     + + +   +  L EL L DNQ+KKI  L  L
Sbjct  97   LKKVKTLCLRQNLI-----KCIENLEELQSLRELDLYDNQIKKIENLEAL  141



>ref|XP_008765584.1| PREDICTED: protein phosphatase 1 regulatory subunit 7 isoform 
X1 [Rattus norvegicus]
Length=290

 Score = 53.9 bits (128),  Expect(2) = 6e-08, Method: Compositional matrix adjust.
 Identities = 39/81 (48%), Positives = 59/81 (73%), Gaps = 1/81 (1%)
 Frame = +2

Query  377  FKKLLVFDVSFNEITSPSGLSKVSSTLKELYVSNNQIAKIEEIEHFHELQILELGSNKLR  556
              +L V D+SFN + +  G+ K++  LK+L++ NN+I KIE I    +LQ+LELGSN++R
Sbjct  141  LTELEVLDISFNLLRNIEGIDKLTQ-LKKLFLVNNKINKIENISTLQQLQMLELGSNRIR  199

Query  557  VMenlqtltnlxelwlGRNRI  619
             +EN+ TLTNL  L+LG+N+I
Sbjct  200  AIENIDTLTNLESLFLGKNKI  220


 Score = 29.6 bits (65),  Expect(2) = 6e-08, Method: Compositional matrix adjust.
 Identities = 22/56 (39%), Positives = 26/56 (46%), Gaps = 5/56 (9%)
 Frame = +3

Query  231  LSNLNKFSLRQNLITDAALEPLSSWHTISQLEELVLRDNQLKKIPVLAYLRNFWYL  398
            L  +    LRQNLI    +E L    +   L EL L DNQ+KKI  L  L     L
Sbjct  97   LKKVKSLCLRQNLI--KCIENLDELQS---LRELDLYDNQIKKIENLEALTELEVL  147



>ref|XP_007184916.1| PREDICTED: protein phosphatase 1 regulatory subunit 7 isoform 
X4 [Balaenoptera acutorostrata scammoni]
Length=317

 Score = 55.8 bits (133),  Expect(2) = 7e-08, Method: Compositional matrix adjust.
 Identities = 37/81 (46%), Positives = 59/81 (73%), Gaps = 1/81 (1%)
 Frame = +2

Query  377  FKKLLVFDVSFNEITSPSGLSKVSSTLKELYVSNNQIAKIEEIEHFHELQILELGSNKLR  556
              +L + D+SFN + +  G+ K++  LK+L++ NN+I KIE +   H+LQ+LELGSN++R
Sbjct  98   LTELEILDISFNLLRNIEGIDKLTR-LKKLFLVNNKINKIENVSSLHQLQMLELGSNRIR  156

Query  557  VMenlqtltnlxelwlGRNRI  619
             +EN+  LTNL  L+LG+N+I
Sbjct  157  AIENIDALTNLESLFLGKNKI  177


 Score = 28.1 bits (61),  Expect(2) = 7e-08, Method: Compositional matrix adjust.
 Identities = 19/50 (38%), Positives = 25/50 (50%), Gaps = 5/50 (10%)
 Frame = +3

Query  231  LSNLNKFSLRQNLITDAALEPLSSWHTISQLEELVLRDNQLKKIPVLAYL  380
            L  +    LRQNLI     + + +   +  L EL L DNQ+KKI  L  L
Sbjct  54   LKKVKTLCLRQNLI-----KCIENLEELRSLRELDLYDNQIKKIENLEGL  98



>ref|XP_008688738.1| PREDICTED: protein phosphatase 1 regulatory subunit 7 [Ursus 
maritimus]
Length=338

 Score = 55.1 bits (131),  Expect(2) = 7e-08, Method: Compositional matrix adjust.
 Identities = 37/81 (46%), Positives = 60/81 (74%), Gaps = 1/81 (1%)
 Frame = +2

Query  377  FKKLLVFDVSFNEITSPSGLSKVSSTLKELYVSNNQIAKIEEIEHFHELQILELGSNKLR  556
              +L + D+SFN + +  G+ K++  LK L++ NN+I+KIE I +  +LQ+LELGSN++R
Sbjct  119  LTQLEILDISFNLLRNIEGVDKLTR-LKRLFLVNNKISKIENISNLQQLQMLELGSNRIR  177

Query  557  VMenlqtltnlxelwlGRNRI  619
             +EN+ TLT+L  L+LG+N+I
Sbjct  178  AIENIDTLTSLESLFLGKNKI  198


 Score = 28.5 bits (62),  Expect(2) = 7e-08, Method: Compositional matrix adjust.
 Identities = 19/50 (38%), Positives = 25/50 (50%), Gaps = 5/50 (10%)
 Frame = +3

Query  231  LSNLNKFSLRQNLITDAALEPLSSWHTISQLEELVLRDNQLKKIPVLAYL  380
            L  +    LRQNLI     + + +   +  L EL L DNQ+KKI  L  L
Sbjct  75   LKKVKTLCLRQNLI-----KCIENLEELQSLRELDLYDNQIKKIENLEAL  119



>ref|XP_008048042.1| PREDICTED: protein phosphatase 1 regulatory subunit 7 isoform 
X1 [Tarsius syrichta]
Length=360

 Score = 55.5 bits (132),  Expect(2) = 7e-08, Method: Compositional matrix adjust.
 Identities = 39/81 (48%), Positives = 60/81 (74%), Gaps = 1/81 (1%)
 Frame = +2

Query  377  FKKLLVFDVSFNEITSPSGLSKVSSTLKELYVSNNQIAKIEEIEHFHELQILELGSNKLR  556
              +L + D+SFN + +  G+ K+   LK+L++ NN+I KIE I + H+LQ+LELGSN++R
Sbjct  141  LTELEILDISFNLLRNIEGIDKLIR-LKKLFLVNNKINKIENISNLHQLQMLELGSNRIR  199

Query  557  VMenlqtltnlxelwlGRNRI  619
             +EN+ TLTNL  L+LG+N+I
Sbjct  200  AIENIDTLTNLESLFLGKNKI  220


 Score = 28.1 bits (61),  Expect(2) = 7e-08, Method: Compositional matrix adjust.
 Identities = 19/50 (38%), Positives = 25/50 (50%), Gaps = 5/50 (10%)
 Frame = +3

Query  231  LSNLNKFSLRQNLITDAALEPLSSWHTISQLEELVLRDNQLKKIPVLAYL  380
            L  +    LRQNLI     + + +   +  L EL L DNQ+KKI  L  L
Sbjct  97   LRKVKTLCLRQNLI-----KCIENLEELQSLRELDLYDNQIKKIENLEAL  141



>ref|XP_008048043.1| PREDICTED: protein phosphatase 1 regulatory subunit 7 isoform 
X2 [Tarsius syrichta]
Length=359

 Score = 55.5 bits (132),  Expect(2) = 7e-08, Method: Compositional matrix adjust.
 Identities = 39/81 (48%), Positives = 60/81 (74%), Gaps = 1/81 (1%)
 Frame = +2

Query  377  FKKLLVFDVSFNEITSPSGLSKVSSTLKELYVSNNQIAKIEEIEHFHELQILELGSNKLR  556
              +L + D+SFN + +  G+ K+   LK+L++ NN+I KIE I + H+LQ+LELGSN++R
Sbjct  140  LTELEILDISFNLLRNIEGIDKLIR-LKKLFLVNNKINKIENISNLHQLQMLELGSNRIR  198

Query  557  VMenlqtltnlxelwlGRNRI  619
             +EN+ TLTNL  L+LG+N+I
Sbjct  199  AIENIDTLTNLESLFLGKNKI  219


 Score = 28.1 bits (61),  Expect(2) = 7e-08, Method: Compositional matrix adjust.
 Identities = 19/50 (38%), Positives = 25/50 (50%), Gaps = 5/50 (10%)
 Frame = +3

Query  231  LSNLNKFSLRQNLITDAALEPLSSWHTISQLEELVLRDNQLKKIPVLAYL  380
            L  +    LRQNLI     + + +   +  L EL L DNQ+KKI  L  L
Sbjct  96   LRKVKTLCLRQNLI-----KCIENLEELQSLRELDLYDNQIKKIENLEAL  140



>ref|XP_005411199.1| PREDICTED: protein phosphatase 1 regulatory subunit 7 isoform 
X2 [Chinchilla lanigera]
Length=317

 Score = 55.1 bits (131),  Expect(2) = 8e-08, Method: Compositional matrix adjust.
 Identities = 38/81 (47%), Positives = 62/81 (77%), Gaps = 1/81 (1%)
 Frame = +2

Query  377  FKKLLVFDVSFNEITSPSGLSKVSSTLKELYVSNNQIAKIEEIEHFHELQILELGSNKLR  556
              +L V D+SFN + +  G+ K++  LK+L++ NN+I+KIE + + ++LQ+LELGSN++R
Sbjct  98   LTELEVLDISFNLLRNIEGIDKLTQ-LKKLFLVNNKISKIENLSNLNQLQMLELGSNRIR  156

Query  557  VMenlqtltnlxelwlGRNRI  619
             +EN+ TLTNL  L+LG+N+I
Sbjct  157  AIENIDTLTNLESLFLGKNKI  177


 Score = 28.5 bits (62),  Expect(2) = 8e-08, Method: Compositional matrix adjust.
 Identities = 19/50 (38%), Positives = 25/50 (50%), Gaps = 5/50 (10%)
 Frame = +3

Query  231  LSNLNKFSLRQNLITDAALEPLSSWHTISQLEELVLRDNQLKKIPVLAYL  380
            L  +    LRQNLI     + + +   +  L EL L DNQ+KKI  L  L
Sbjct  54   LKKVKTLCLRQNLI-----KCIENLEELQSLRELDLYDNQIKKIENLEAL  98



>ref|XP_004484409.1| PREDICTED: protein phosphatase 1 regulatory subunit 7 isoform 
2 [Dasypus novemcinctus]
Length=335

 Score = 54.7 bits (130),  Expect(2) = 8e-08, Method: Compositional matrix adjust.
 Identities = 38/81 (47%), Positives = 59/81 (73%), Gaps = 1/81 (1%)
 Frame = +2

Query  377  FKKLLVFDVSFNEITSPSGLSKVSSTLKELYVSNNQIAKIEEIEHFHELQILELGSNKLR  556
              +L V D+SFN + +  G+ K++  LK+L++ NN+I KIE I +  +LQ+LELGSN++R
Sbjct  141  LTELEVLDISFNLLRNIEGIDKLTR-LKKLFLVNNKITKIENISNLDQLQMLELGSNRIR  199

Query  557  VMenlqtltnlxelwlGRNRI  619
             +EN+ TLT L  L+LG+N+I
Sbjct  200  AIENIDTLTRLDSLFLGKNKI  220


 Score = 28.5 bits (62),  Expect(2) = 8e-08, Method: Compositional matrix adjust.
 Identities = 21/56 (38%), Positives = 26/56 (46%), Gaps = 5/56 (9%)
 Frame = +3

Query  231  LSNLNKFSLRQNLITDAALEPLSSWHTISQLEELVLRDNQLKKIPVLAYLRNFWYL  398
            L  +    LRQNLI    +E L    +   L EL L DNQ+KK+  L  L     L
Sbjct  97   LKKVKTLCLRQNLI--KCIENLEGLQS---LRELDLYDNQIKKMENLEALTELEVL  147



>ref|XP_005411200.1| PREDICTED: protein phosphatase 1 regulatory subunit 7 isoform 
X3 [Chinchilla lanigera]
Length=292

 Score = 55.5 bits (132),  Expect(2) = 8e-08, Method: Compositional matrix adjust.
 Identities = 37/76 (49%), Positives = 60/76 (79%), Gaps = 1/76 (1%)
 Frame = +2

Query  392  VFDVSFNEITSPSGLSKVSSTLKELYVSNNQIAKIEEIEHFHELQILELGSNKLRVMenl  571
            V D+SFN + +  G+ K++  LK+L++ NN+I+KIE + + ++LQ+LELGSN++R +EN+
Sbjct  78   VLDISFNLLRNIEGIDKLTQ-LKKLFLVNNKISKIENLSNLNQLQMLELGSNRIRAIENI  136

Query  572  qtltnlxelwlGRNRI  619
             TLTNL  L+LG+N+I
Sbjct  137  DTLTNLESLFLGKNKI  152


 Score = 28.1 bits (61),  Expect(2) = 8e-08, Method: Compositional matrix adjust.
 Identities = 19/50 (38%), Positives = 25/50 (50%), Gaps = 5/50 (10%)
 Frame = +3

Query  231  LSNLNKFSLRQNLITDAALEPLSSWHTISQLEELVLRDNQLKKIPVLAYL  380
            L  +    LRQNLI     + + +   +  L EL L DNQ+KKI  L  L
Sbjct  29   LKKVKTLCLRQNLI-----KCIENLEELQSLRELDLYDNQIKKIENLEAL  73



>ref|XP_008048044.1| PREDICTED: protein phosphatase 1 regulatory subunit 7 isoform 
X3 [Tarsius syrichta]
Length=337

 Score = 55.5 bits (132),  Expect(2) = 8e-08, Method: Compositional matrix adjust.
 Identities = 39/81 (48%), Positives = 60/81 (74%), Gaps = 1/81 (1%)
 Frame = +2

Query  377  FKKLLVFDVSFNEITSPSGLSKVSSTLKELYVSNNQIAKIEEIEHFHELQILELGSNKLR  556
              +L + D+SFN + +  G+ K+   LK+L++ NN+I KIE I + H+LQ+LELGSN++R
Sbjct  118  LTELEILDISFNLLRNIEGIDKLIR-LKKLFLVNNKINKIENISNLHQLQMLELGSNRIR  176

Query  557  VMenlqtltnlxelwlGRNRI  619
             +EN+ TLTNL  L+LG+N+I
Sbjct  177  AIENIDTLTNLESLFLGKNKI  197


 Score = 28.1 bits (61),  Expect(2) = 8e-08, Method: Compositional matrix adjust.
 Identities = 18/44 (41%), Positives = 23/44 (52%), Gaps = 5/44 (11%)
 Frame = +3

Query  249  FSLRQNLITDAALEPLSSWHTISQLEELVLRDNQLKKIPVLAYL  380
              LRQNLI     + + +   +  L EL L DNQ+KKI  L  L
Sbjct  80   LCLRQNLI-----KCIENLEELQSLRELDLYDNQIKKIENLEAL  118



>ref|XP_007965162.1| PREDICTED: protein phosphatase 1 regulatory subunit 7 isoform 
X4 [Chlorocebus sabaeus]
Length=295

 Score = 53.5 bits (127),  Expect(2) = 9e-08, Method: Compositional matrix adjust.
 Identities = 37/81 (46%), Positives = 61/81 (75%), Gaps = 1/81 (1%)
 Frame = +2

Query  377  FKKLLVFDVSFNEITSPSGLSKVSSTLKELYVSNNQIAKIEEIEHFHELQILELGSNKLR  556
              +L + D+SFN + +  G+ K++  LK+L++ NN+I+KIE + +  +LQ+LELGSN++R
Sbjct  156  LTELEILDISFNLLRNIEGVDKLTR-LKKLFLVNNKISKIENLSNLRQLQMLELGSNRIR  214

Query  557  VMenlqtltnlxelwlGRNRI  619
             +EN+ TLTNL  L+LG+N+I
Sbjct  215  AIENIDTLTNLESLFLGKNKI  235


 Score = 29.6 bits (65),  Expect(2) = 9e-08, Method: Compositional matrix adjust.
 Identities = 22/56 (39%), Positives = 26/56 (46%), Gaps = 5/56 (9%)
 Frame = +3

Query  231  LSNLNKFSLRQNLITDAALEPLSSWHTISQLEELVLRDNQLKKIPVLAYLRNFWYL  398
            L  +    LRQNLI    +E L    +   L EL L DNQ+KKI  L  L     L
Sbjct  112  LKKVKTLCLRQNLI--KCIENLEELQS---LRELDLYDNQIKKIENLEALTELEIL  162



>ref|XP_007965161.1| PREDICTED: protein phosphatase 1 regulatory subunit 7 isoform 
X3 [Chlorocebus sabaeus]
Length=301

 Score = 53.9 bits (128),  Expect(2) = 9e-08, Method: Compositional matrix adjust.
 Identities = 37/81 (46%), Positives = 61/81 (75%), Gaps = 1/81 (1%)
 Frame = +2

Query  377  FKKLLVFDVSFNEITSPSGLSKVSSTLKELYVSNNQIAKIEEIEHFHELQILELGSNKLR  556
              +L + D+SFN + +  G+ K++  LK+L++ NN+I+KIE + +  +LQ+LELGSN++R
Sbjct  162  LTELEILDISFNLLRNIEGVDKLTR-LKKLFLVNNKISKIENLSNLRQLQMLELGSNRIR  220

Query  557  VMenlqtltnlxelwlGRNRI  619
             +EN+ TLTNL  L+LG+N+I
Sbjct  221  AIENIDTLTNLESLFLGKNKI  241


 Score = 29.3 bits (64),  Expect(2) = 9e-08, Method: Compositional matrix adjust.
 Identities = 22/56 (39%), Positives = 26/56 (46%), Gaps = 5/56 (9%)
 Frame = +3

Query  231  LSNLNKFSLRQNLITDAALEPLSSWHTISQLEELVLRDNQLKKIPVLAYLRNFWYL  398
            L  +    LRQNLI    +E L    +   L EL L DNQ+KKI  L  L     L
Sbjct  118  LKKVKTLCLRQNLI--KCIENLEELQS---LRELDLYDNQIKKIENLEALTELEIL  168



>ref|XP_004597479.1| PREDICTED: protein phosphatase 1 regulatory subunit 7 isoform 
X1 [Ochotona princeps]
Length=360

 Score = 54.7 bits (130),  Expect(2) = 1e-07, Method: Compositional matrix adjust.
 Identities = 37/81 (46%), Positives = 59/81 (73%), Gaps = 1/81 (1%)
 Frame = +2

Query  377  FKKLLVFDVSFNEITSPSGLSKVSSTLKELYVSNNQIAKIEEIEHFHELQILELGSNKLR  556
              +L + D+SFN + +  G+ K++  LK+L++ NN+I KIE +    ELQ+LELGSN++R
Sbjct  141  LTELEILDISFNLLRNIEGIDKLTR-LKKLFLVNNKITKIENLSALQELQMLELGSNRIR  199

Query  557  VMenlqtltnlxelwlGRNRI  619
             +EN+ TLT+L  L+LG+N+I
Sbjct  200  AIENIDTLTSLQSLFLGKNKI  220


 Score = 28.5 bits (62),  Expect(2) = 1e-07, Method: Compositional matrix adjust.
 Identities = 20/56 (36%), Positives = 26/56 (46%), Gaps = 5/56 (9%)
 Frame = +3

Query  231  LSNLNKFSLRQNLITDAALEPLSSWHTISQLEELVLRDNQLKKIPVLAYLRNFWYL  398
            L  +    LRQNLI     + + +   +  L EL L DNQ+KKI  L  L     L
Sbjct  97   LKKVKTLCLRQNLI-----KCIENLEELRGLRELDLYDNQIKKIENLESLTELEIL  147



>ref|NP_001009825.1| protein phosphatase 1 regulatory subunit 7 [Rattus norvegicus]
 sp|Q5HZV9.1|PP1R7_RAT RecName: Full=Protein phosphatase 1 regulatory subunit 7; AltName: 
Full=Protein phosphatase 1 regulatory subunit 22 [Rattus 
norvegicus]
 gb|AAH88868.1| Protein phosphatase 1, regulatory (inhibitor) subunit 7 [Rattus 
norvegicus]
 gb|EDL91950.1| protein phosphatase 1, regulatory (inhibitor) subunit 7, isoform 
CRA_a [Rattus norvegicus]
Length=360

 Score = 53.9 bits (128),  Expect(2) = 1e-07, Method: Compositional matrix adjust.
 Identities = 39/81 (48%), Positives = 59/81 (73%), Gaps = 1/81 (1%)
 Frame = +2

Query  377  FKKLLVFDVSFNEITSPSGLSKVSSTLKELYVSNNQIAKIEEIEHFHELQILELGSNKLR  556
              +L V D+SFN + +  G+ K++  LK+L++ NN+I KIE I    +LQ+LELGSN++R
Sbjct  141  LTELEVLDISFNLLRNIEGIDKLTQ-LKKLFLVNNKINKIENISTLQQLQMLELGSNRIR  199

Query  557  VMenlqtltnlxelwlGRNRI  619
             +EN+ TLTNL  L+LG+N+I
Sbjct  200  AIENIDTLTNLESLFLGKNKI  220


 Score = 28.9 bits (63),  Expect(2) = 1e-07, Method: Compositional matrix adjust.
 Identities = 22/56 (39%), Positives = 26/56 (46%), Gaps = 5/56 (9%)
 Frame = +3

Query  231  LSNLNKFSLRQNLITDAALEPLSSWHTISQLEELVLRDNQLKKIPVLAYLRNFWYL  398
            L  +    LRQNLI    +E L    +   L EL L DNQ+KKI  L  L     L
Sbjct  97   LKKVKSLCLRQNLI--KCIENLDELQS---LRELDLYDNQIKKIENLEALTELEVL  147



>ref|XP_004597480.1| PREDICTED: protein phosphatase 1 regulatory subunit 7 isoform 
X2 [Ochotona princeps]
Length=317

 Score = 54.7 bits (130),  Expect(2) = 1e-07, Method: Compositional matrix adjust.
 Identities = 37/81 (46%), Positives = 59/81 (73%), Gaps = 1/81 (1%)
 Frame = +2

Query  377  FKKLLVFDVSFNEITSPSGLSKVSSTLKELYVSNNQIAKIEEIEHFHELQILELGSNKLR  556
              +L + D+SFN + +  G+ K++  LK+L++ NN+I KIE +    ELQ+LELGSN++R
Sbjct  98   LTELEILDISFNLLRNIEGIDKLTR-LKKLFLVNNKITKIENLSALQELQMLELGSNRIR  156

Query  557  VMenlqtltnlxelwlGRNRI  619
             +EN+ TLT+L  L+LG+N+I
Sbjct  157  AIENIDTLTSLQSLFLGKNKI  177


 Score = 28.1 bits (61),  Expect(2) = 1e-07, Method: Compositional matrix adjust.
 Identities = 19/50 (38%), Positives = 25/50 (50%), Gaps = 5/50 (10%)
 Frame = +3

Query  231  LSNLNKFSLRQNLITDAALEPLSSWHTISQLEELVLRDNQLKKIPVLAYL  380
            L  +    LRQNLI     + + +   +  L EL L DNQ+KKI  L  L
Sbjct  54   LKKVKTLCLRQNLI-----KCIENLEELRGLRELDLYDNQIKKIENLESL  98



>ref|XP_005610822.1| PREDICTED: protein phosphatase 1 regulatory subunit 7 isoform 
X2 [Equus caballus]
 ref|XP_008525421.1| PREDICTED: protein phosphatase 1 regulatory subunit 7 isoform 
X2 [Equus przewalskii]
Length=306

 Score = 53.9 bits (128),  Expect(2) = 1e-07, Method: Compositional matrix adjust.
 Identities = 38/79 (48%), Positives = 60/79 (76%), Gaps = 1/79 (1%)
 Frame = +2

Query  383  KLLVFDVSFNEITSPSGLSKVSSTLKELYVSNNQIAKIEEIEHFHELQILELGSNKLRVM  562
            +L + D+SFN + +  G+ K++  LK+L++ NN+I KIE I +  +LQ+LELGSN++R +
Sbjct  129  ELEILDISFNLLRNIEGIDKLTR-LKKLFLVNNKINKIENISNLRQLQMLELGSNRIRAI  187

Query  563  enlqtltnlxelwlGRNRI  619
            EN+ TLTNL  L+LG+N+I
Sbjct  188  ENIDTLTNLESLFLGKNKI  206


 Score = 28.9 bits (63),  Expect(2) = 1e-07, Method: Compositional matrix adjust.
 Identities = 21/50 (42%), Positives = 25/50 (50%), Gaps = 5/50 (10%)
 Frame = +3

Query  231  LSNLNKFSLRQNLITDAALEPLSSWHTISQLEELVLRDNQLKKIPVLAYL  380
            L  +    LRQNLI    +E L    +   L EL L DNQ+KKI  L  L
Sbjct  83   LKKVKTLCLRQNLI--KCIENLEELQS---LRELDLYDNQIKKIENLEAL  127



>ref|XP_004484408.1| PREDICTED: protein phosphatase 1 regulatory subunit 7 isoform 
1 [Dasypus novemcinctus]
Length=360

 Score = 54.7 bits (130),  Expect(2) = 1e-07, Method: Compositional matrix adjust.
 Identities = 38/81 (47%), Positives = 59/81 (73%), Gaps = 1/81 (1%)
 Frame = +2

Query  377  FKKLLVFDVSFNEITSPSGLSKVSSTLKELYVSNNQIAKIEEIEHFHELQILELGSNKLR  556
              +L V D+SFN + +  G+ K++  LK+L++ NN+I KIE I +  +LQ+LELGSN++R
Sbjct  141  LTELEVLDISFNLLRNIEGIDKLTR-LKKLFLVNNKITKIENISNLDQLQMLELGSNRIR  199

Query  557  VMenlqtltnlxelwlGRNRI  619
             +EN+ TLT L  L+LG+N+I
Sbjct  200  AIENIDTLTRLDSLFLGKNKI  220


 Score = 27.7 bits (60),  Expect(2) = 1e-07, Method: Compositional matrix adjust.
 Identities = 21/56 (38%), Positives = 26/56 (46%), Gaps = 5/56 (9%)
 Frame = +3

Query  231  LSNLNKFSLRQNLITDAALEPLSSWHTISQLEELVLRDNQLKKIPVLAYLRNFWYL  398
            L  +    LRQNLI    +E L    +   L EL L DNQ+KK+  L  L     L
Sbjct  97   LKKVKTLCLRQNLI--KCIENLEGLQS---LRELDLYDNQIKKMENLEALTELEVL  147



>ref|XP_007965159.1| PREDICTED: protein phosphatase 1 regulatory subunit 7 isoform 
X2 [Chlorocebus sabaeus]
Length=375

 Score = 53.5 bits (127),  Expect(2) = 1e-07, Method: Compositional matrix adjust.
 Identities = 37/81 (46%), Positives = 61/81 (75%), Gaps = 1/81 (1%)
 Frame = +2

Query  377  FKKLLVFDVSFNEITSPSGLSKVSSTLKELYVSNNQIAKIEEIEHFHELQILELGSNKLR  556
              +L + D+SFN + +  G+ K++  LK+L++ NN+I+KIE + +  +LQ+LELGSN++R
Sbjct  156  LTELEILDISFNLLRNIEGVDKLTR-LKKLFLVNNKISKIENLSNLRQLQMLELGSNRIR  214

Query  557  VMenlqtltnlxelwlGRNRI  619
             +EN+ TLTNL  L+LG+N+I
Sbjct  215  AIENIDTLTNLESLFLGKNKI  235


 Score = 28.9 bits (63),  Expect(2) = 1e-07, Method: Compositional matrix adjust.
 Identities = 19/50 (38%), Positives = 25/50 (50%), Gaps = 5/50 (10%)
 Frame = +3

Query  231  LSNLNKFSLRQNLITDAALEPLSSWHTISQLEELVLRDNQLKKIPVLAYL  380
            L  +    LRQNLI     + + +   +  L EL L DNQ+KKI  L  L
Sbjct  112  LKKVKTLCLRQNLI-----KCIENLEELQSLRELDLYDNQIKKIENLEAL  156



>ref|XP_007965158.1| PREDICTED: protein phosphatase 1 regulatory subunit 7 isoform 
X1 [Chlorocebus sabaeus]
Length=381

 Score = 53.5 bits (127),  Expect(2) = 2e-07, Method: Compositional matrix adjust.
 Identities = 37/81 (46%), Positives = 61/81 (75%), Gaps = 1/81 (1%)
 Frame = +2

Query  377  FKKLLVFDVSFNEITSPSGLSKVSSTLKELYVSNNQIAKIEEIEHFHELQILELGSNKLR  556
              +L + D+SFN + +  G+ K++  LK+L++ NN+I+KIE + +  +LQ+LELGSN++R
Sbjct  162  LTELEILDISFNLLRNIEGVDKLTR-LKKLFLVNNKISKIENLSNLRQLQMLELGSNRIR  220

Query  557  VMenlqtltnlxelwlGRNRI  619
             +EN+ TLTNL  L+LG+N+I
Sbjct  221  AIENIDTLTNLESLFLGKNKI  241


 Score = 28.9 bits (63),  Expect(2) = 2e-07, Method: Compositional matrix adjust.
 Identities = 19/50 (38%), Positives = 25/50 (50%), Gaps = 5/50 (10%)
 Frame = +3

Query  231  LSNLNKFSLRQNLITDAALEPLSSWHTISQLEELVLRDNQLKKIPVLAYL  380
            L  +    LRQNLI     + + +   +  L EL L DNQ+KKI  L  L
Sbjct  118  LKKVKTLCLRQNLI-----KCIENLEELQSLRELDLYDNQIKKIENLEAL  162



>ref|XP_005610824.1| PREDICTED: protein phosphatase 1 regulatory subunit 7 isoform 
X4 [Equus caballus]
 ref|XP_008525424.1| PREDICTED: protein phosphatase 1 regulatory subunit 7 isoform 
X5 [Equus przewalskii]
Length=290

 Score = 53.9 bits (128),  Expect(2) = 2e-07, Method: Compositional matrix adjust.
 Identities = 37/76 (49%), Positives = 58/76 (76%), Gaps = 1/76 (1%)
 Frame = +2

Query  392  VFDVSFNEITSPSGLSKVSSTLKELYVSNNQIAKIEEIEHFHELQILELGSNKLRVMenl  571
            + D+SFN + +  G+ K++  LK+L++ NN+I KIE I +  +LQ+LELGSN++R +EN+
Sbjct  132  ILDISFNLLRNIEGIDKLTR-LKKLFLVNNKINKIENISNLRQLQMLELGSNRIRAIENI  190

Query  572  qtltnlxelwlGRNRI  619
             TLTNL  L+LG+N+I
Sbjct  191  DTLTNLESLFLGKNKI  206


 Score = 28.5 bits (62),  Expect(2) = 2e-07, Method: Compositional matrix adjust.
 Identities = 22/56 (39%), Positives = 26/56 (46%), Gaps = 5/56 (9%)
 Frame = +3

Query  231  LSNLNKFSLRQNLITDAALEPLSSWHTISQLEELVLRDNQLKKIPVLAYLRNFWYL  398
            L  +    LRQNLI    +E L    +   L EL L DNQ+KKI  L  L     L
Sbjct  83   LKKVKTLCLRQNLI--KCIENLEELQS---LRELDLYDNQIKKIENLEALTELEIL  133



>gb|EDL91951.1| protein phosphatase 1, regulatory (inhibitor) subunit 7, isoform 
CRA_b [Rattus norvegicus]
Length=317

 Score = 54.3 bits (129),  Expect(2) = 2e-07, Method: Compositional matrix adjust.
 Identities = 39/81 (48%), Positives = 59/81 (73%), Gaps = 1/81 (1%)
 Frame = +2

Query  377  FKKLLVFDVSFNEITSPSGLSKVSSTLKELYVSNNQIAKIEEIEHFHELQILELGSNKLR  556
              +L V D+SFN + +  G+ K++  LK+L++ NN+I KIE I    +LQ+LELGSN++R
Sbjct  98   LTELEVLDISFNLLRNIEGIDKLTQ-LKKLFLVNNKINKIENISTLQQLQMLELGSNRIR  156

Query  557  VMenlqtltnlxelwlGRNRI  619
             +EN+ TLTNL  L+LG+N+I
Sbjct  157  AIENIDTLTNLESLFLGKNKI  177


 Score = 28.1 bits (61),  Expect(2) = 2e-07, Method: Compositional matrix adjust.
 Identities = 21/50 (42%), Positives = 25/50 (50%), Gaps = 5/50 (10%)
 Frame = +3

Query  231  LSNLNKFSLRQNLITDAALEPLSSWHTISQLEELVLRDNQLKKIPVLAYL  380
            L  +    LRQNLI    +E L    +   L EL L DNQ+KKI  L  L
Sbjct  54   LKKVKSLCLRQNLI--KCIENLDELQS---LRELDLYDNQIKKIENLEAL  98



>ref|XP_008525423.1| PREDICTED: protein phosphatase 1 regulatory subunit 7 isoform 
X4 [Equus przewalskii]
Length=296

 Score = 53.9 bits (128),  Expect(2) = 2e-07, Method: Compositional matrix adjust.
 Identities = 38/81 (47%), Positives = 60/81 (74%), Gaps = 1/81 (1%)
 Frame = +2

Query  377  FKKLLVFDVSFNEITSPSGLSKVSSTLKELYVSNNQIAKIEEIEHFHELQILELGSNKLR  556
              +L + D+SFN + +  G+ K++  LK+L++ NN+I KIE I +  +LQ+LELGSN++R
Sbjct  127  LTELEILDISFNLLRNIEGIDKLTR-LKKLFLVNNKINKIENISNLRQLQMLELGSNRIR  185

Query  557  VMenlqtltnlxelwlGRNRI  619
             +EN+ TLTNL  L+LG+N+I
Sbjct  186  AIENIDTLTNLESLFLGKNKI  206


 Score = 28.5 bits (62),  Expect(2) = 2e-07, Method: Compositional matrix adjust.
 Identities = 19/50 (38%), Positives = 25/50 (50%), Gaps = 5/50 (10%)
 Frame = +3

Query  231  LSNLNKFSLRQNLITDAALEPLSSWHTISQLEELVLRDNQLKKIPVLAYL  380
            L  +    LRQNLI     + + +   +  L EL L DNQ+KKI  L  L
Sbjct  83   LKKVKTLCLRQNLI-----KCIENLEELQSLRELDLYDNQIKKIENLEAL  127



>ref|XP_007965163.1| PREDICTED: protein phosphatase 1 regulatory subunit 7 isoform 
X5 [Chlorocebus sabaeus]
Length=292

 Score = 53.9 bits (128),  Expect(2) = 2e-07, Method: Compositional matrix adjust.
 Identities = 36/76 (47%), Positives = 59/76 (78%), Gaps = 1/76 (1%)
 Frame = +2

Query  392  VFDVSFNEITSPSGLSKVSSTLKELYVSNNQIAKIEEIEHFHELQILELGSNKLRVMenl  571
            + D+SFN + +  G+ K++  LK+L++ NN+I+KIE + +  +LQ+LELGSN++R +EN+
Sbjct  78   ILDISFNLLRNIEGVDKLTR-LKKLFLVNNKISKIENLSNLRQLQMLELGSNRIRAIENI  136

Query  572  qtltnlxelwlGRNRI  619
             TLTNL  L+LG+N+I
Sbjct  137  DTLTNLESLFLGKNKI  152


 Score = 28.1 bits (61),  Expect(2) = 2e-07, Method: Compositional matrix adjust.
 Identities = 19/50 (38%), Positives = 25/50 (50%), Gaps = 5/50 (10%)
 Frame = +3

Query  231  LSNLNKFSLRQNLITDAALEPLSSWHTISQLEELVLRDNQLKKIPVLAYL  380
            L  +    LRQNLI     + + +   +  L EL L DNQ+KKI  L  L
Sbjct  29   LKKVKTLCLRQNLI-----KCIENLEELQSLRELDLYDNQIKKIENLEAL  73



>ref|XP_005610823.1| PREDICTED: protein phosphatase 1 regulatory subunit 7 isoform 
X3 [Equus caballus]
 ref|XP_008525422.1| PREDICTED: protein phosphatase 1 regulatory subunit 7 isoform 
X3 [Equus przewalskii]
Length=297

 Score = 53.9 bits (128),  Expect(2) = 2e-07, Method: Compositional matrix adjust.
 Identities = 37/76 (49%), Positives = 58/76 (76%), Gaps = 1/76 (1%)
 Frame = +2

Query  392  VFDVSFNEITSPSGLSKVSSTLKELYVSNNQIAKIEEIEHFHELQILELGSNKLRVMenl  571
            + D+SFN + +  G+ K++  LK+L++ NN+I KIE I +  +LQ+LELGSN++R +EN+
Sbjct  132  ILDISFNLLRNIEGIDKLTR-LKKLFLVNNKINKIENISNLRQLQMLELGSNRIRAIENI  190

Query  572  qtltnlxelwlGRNRI  619
             TLTNL  L+LG+N+I
Sbjct  191  DTLTNLESLFLGKNKI  206


 Score = 28.1 bits (61),  Expect(2) = 2e-07, Method: Compositional matrix adjust.
 Identities = 21/50 (42%), Positives = 25/50 (50%), Gaps = 5/50 (10%)
 Frame = +3

Query  231  LSNLNKFSLRQNLITDAALEPLSSWHTISQLEELVLRDNQLKKIPVLAYL  380
            L  +    LRQNLI    +E L    +   L EL L DNQ+KKI  L  L
Sbjct  83   LKKVKTLCLRQNLI--KCIENLEELQS---LRELDLYDNQIKKIENLEAL  127



>ref|XP_009313105.1| putative protein phosphatase 1, regulatory subunit,putative [Trypanosoma 
grayi]
 gb|KEG08667.1| putative protein phosphatase 1, regulatory subunit,putative [Trypanosoma 
grayi]
Length=402

 Score = 55.5 bits (132),  Expect(2) = 2e-07, Method: Compositional matrix adjust.
 Identities = 39/88 (44%), Positives = 60/88 (68%), Gaps = 1/88 (1%)
 Frame = +2

Query  368  VSIFKKLLVFDVSFNEITSPSGLSKVSSTLKELYVSNNQIAKIEEIEHFHELQILELGSN  547
            V+ F +L   D+S+N+I   SGL  ++ TL+ELY+  N+I +I+ +E    L++LELG N
Sbjct  155  VNAFGRLTKLDLSYNQIREISGLESLAPTLRELYLVENKIKEIKNLEPLVNLELLELGGN  214

Query  548  KLR-VMenlqtltnlxelwlGRNRIRAI  628
            ++R +   L TLT L +LWLG+N+I AI
Sbjct  215  RIREIGPGLATLTKLRQLWLGKNKIVAI  242


 Score = 26.6 bits (57),  Expect(2) = 2e-07, Method: Compositional matrix adjust.
 Identities = 22/66 (33%), Positives = 35/66 (53%), Gaps = 10/66 (15%)
 Frame = +3

Query  198  RLSALDP-RISHLSNLNKFSLRQNLITDAALEPLSSWHTISQLEELVLRDNQLKKIPVLA  374
            RL +LD   +   +     SLR+NL+ +  L P    H  ++LEEL   DN+++K     
Sbjct  83   RLFSLDEVELDKFTECTSLSLRKNLLHE--LSPFPE-HLAARLEELDFFDNKIRK-----  134

Query  375  YLRNFW  392
             LR+F+
Sbjct  135  -LRDFF  139



>ref|XP_005610821.1| PREDICTED: protein phosphatase 1 regulatory subunit 7 isoform 
X1 [Equus caballus]
 ref|XP_008525420.1| PREDICTED: protein phosphatase 1 regulatory subunit 7 isoform 
X1 [Equus przewalskii]
Length=308

 Score = 53.5 bits (127),  Expect(2) = 2e-07, Method: Compositional matrix adjust.
 Identities = 37/76 (49%), Positives = 58/76 (76%), Gaps = 1/76 (1%)
 Frame = +2

Query  392  VFDVSFNEITSPSGLSKVSSTLKELYVSNNQIAKIEEIEHFHELQILELGSNKLRVMenl  571
            + D+SFN + +  G+ K++  LK+L++ NN+I KIE I +  +LQ+LELGSN++R +EN+
Sbjct  132  ILDISFNLLRNIEGIDKLTR-LKKLFLVNNKINKIENISNLRQLQMLELGSNRIRAIENI  190

Query  572  qtltnlxelwlGRNRI  619
             TLTNL  L+LG+N+I
Sbjct  191  DTLTNLESLFLGKNKI  206


 Score = 28.1 bits (61),  Expect(2) = 2e-07, Method: Compositional matrix adjust.
 Identities = 19/50 (38%), Positives = 25/50 (50%), Gaps = 5/50 (10%)
 Frame = +3

Query  231  LSNLNKFSLRQNLITDAALEPLSSWHTISQLEELVLRDNQLKKIPVLAYL  380
            L  +    LRQNLI     + + +   +  L EL L DNQ+KKI  L  L
Sbjct  83   LKKVKTLCLRQNLI-----KCIENLEELQSLRELDLYDNQIKKIENLEAL  127



>ref|XP_004427806.1| PREDICTED: protein phosphatase 1 regulatory subunit 7 isoform 
1 [Ceratotherium simum simum]
Length=360

 Score = 52.8 bits (125),  Expect(2) = 2e-07, Method: Compositional matrix adjust.
 Identities = 37/79 (47%), Positives = 60/79 (76%), Gaps = 1/79 (1%)
 Frame = +2

Query  383  KLLVFDVSFNEITSPSGLSKVSSTLKELYVSNNQIAKIEEIEHFHELQILELGSNKLRVM  562
            +L + D+SFN + +  G+ K++  LK+L++ NN+I KIE + +  +LQ+LELGSN++R +
Sbjct  143  ELEILDISFNLLRNIEGIDKLTR-LKKLFLVNNKINKIENVSNLRQLQMLELGSNRIRAI  201

Query  563  enlqtltnlxelwlGRNRI  619
            EN+ TLTNL  L+LG+N+I
Sbjct  202  ENIDTLTNLESLFLGKNKI  220


 Score = 28.9 bits (63),  Expect(2) = 2e-07, Method: Compositional matrix adjust.
 Identities = 20/56 (36%), Positives = 26/56 (46%), Gaps = 5/56 (9%)
 Frame = +3

Query  231  LSNLNKFSLRQNLITDAALEPLSSWHTISQLEELVLRDNQLKKIPVLAYLRNFWYL  398
            L  +    LRQNLI     + + +   +  L EL L DNQ+KKI  L  L     L
Sbjct  97   LKKVKTLCLRQNLI-----KCIENLEELQSLRELDLYDNQIKKIENLEALTELEIL  147



>gb|KFP26891.1| Protein phosphatase 1 regulatory subunit 7, partial [Colius striatus]
Length=198

 Score = 58.2 bits (139),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 39/88 (44%), Positives = 62/88 (70%), Gaps = 1/88 (1%)
 Frame = +2

Query  365  GVSIFKKLLVFDVSFNEITSPSGLSKVSSTLKELYVSNNQIAKIEEIEHFHELQILELGS  544
            G S+   L V D+SFN +    GL +++  LK+L++ NN+I+KIE + +   LQ+LELGS
Sbjct  2    GTSVLFYLRVLDISFNVLRHIEGLDRLTQ-LKKLFLVNNKISKIENLSNLQMLQMLELGS  60

Query  545  NKLRVMenlqtltnlxelwlGRNRIRAI  628
            N++RV+EN+  L+NL  L+LG+N+I  +
Sbjct  61   NRIRVIENIDALSNLDSLFLGKNKITKL  88



>ref|XP_005959711.1| PREDICTED: protein phosphatase 1 regulatory subunit 7, partial 
[Pantholops hodgsonii]
Length=370

 Score = 59.7 bits (143),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 42/84 (50%), Positives = 63/84 (75%), Gaps = 1/84 (1%)
 Frame = +2

Query  368  VSIFKKLLVFDVSFNEITSPSGLSKVSSTLKELYVSNNQIAKIEEIEHFHELQILELGSN  547
            +    +L V DVSFN + +  G+ K++  LK+L++ NN+I+KIE I   H+LQ+LELGSN
Sbjct  148  LDALTELEVLDVSFNLLRNIEGVDKLTR-LKKLFLVNNKISKIENISSLHQLQMLELGSN  206

Query  548  KLRVMenlqtltnlxelwlGRNRI  619
            ++RV+EN+ TLTNL  L+LG+N+I
Sbjct  207  RIRVIENIDTLTNLESLFLGKNKI  230



>ref|XP_004427807.1| PREDICTED: protein phosphatase 1 regulatory subunit 7 isoform 
2 [Ceratotherium simum simum]
Length=317

 Score = 53.1 bits (126),  Expect(2) = 3e-07, Method: Compositional matrix adjust.
 Identities = 37/79 (47%), Positives = 60/79 (76%), Gaps = 1/79 (1%)
 Frame = +2

Query  383  KLLVFDVSFNEITSPSGLSKVSSTLKELYVSNNQIAKIEEIEHFHELQILELGSNKLRVM  562
            +L + D+SFN + +  G+ K++  LK+L++ NN+I KIE + +  +LQ+LELGSN++R +
Sbjct  100  ELEILDISFNLLRNIEGIDKLTR-LKKLFLVNNKINKIENVSNLRQLQMLELGSNRIRAI  158

Query  563  enlqtltnlxelwlGRNRI  619
            EN+ TLTNL  L+LG+N+I
Sbjct  159  ENIDTLTNLESLFLGKNKI  177


 Score = 28.5 bits (62),  Expect(2) = 3e-07, Method: Compositional matrix adjust.
 Identities = 19/50 (38%), Positives = 25/50 (50%), Gaps = 5/50 (10%)
 Frame = +3

Query  231  LSNLNKFSLRQNLITDAALEPLSSWHTISQLEELVLRDNQLKKIPVLAYL  380
            L  +    LRQNLI     + + +   +  L EL L DNQ+KKI  L  L
Sbjct  54   LKKVKTLCLRQNLI-----KCIENLEELQSLRELDLYDNQIKKIENLEAL  98



>ref|XP_003499326.2| PREDICTED: protein phosphatase 1 regulatory subunit 7 [Cricetulus 
griseus]
 ref|XP_007619820.1| PREDICTED: protein phosphatase 1 regulatory subunit 7 [Cricetulus 
griseus]
Length=361

 Score = 52.4 bits (124),  Expect(2) = 4e-07, Method: Compositional matrix adjust.
 Identities = 38/81 (47%), Positives = 59/81 (73%), Gaps = 1/81 (1%)
 Frame = +2

Query  377  FKKLLVFDVSFNEITSPSGLSKVSSTLKELYVSNNQIAKIEEIEHFHELQILELGSNKLR  556
              +L + D+SFN + +  G+ K++  LK+L++ NN+I KIE I    +LQ+LELGSN++R
Sbjct  142  LTELEILDISFNLLRNIEGIDKLTR-LKKLFLVNNKINKIENIGTLRQLQMLELGSNRIR  200

Query  557  VMenlqtltnlxelwlGRNRI  619
             +EN+ TLTNL  L+LG+N+I
Sbjct  201  AIENIDTLTNLESLFLGKNKI  221


 Score = 28.9 bits (63),  Expect(2) = 4e-07, Method: Compositional matrix adjust.
 Identities = 19/50 (38%), Positives = 25/50 (50%), Gaps = 5/50 (10%)
 Frame = +3

Query  231  LSNLNKFSLRQNLITDAALEPLSSWHTISQLEELVLRDNQLKKIPVLAYL  380
            L  +    LRQNLI     + + +   +  L EL L DNQ+KKI  L  L
Sbjct  98   LKKVKSLCLRQNLI-----KCIENLEELQSLRELDLYDNQIKKIENLEAL  142



>ref|XP_004003485.1| PREDICTED: protein phosphatase 1 regulatory subunit 7 [Ovis aries]
Length=430

 Score = 58.9 bits (141),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 39/84 (46%), Positives = 62/84 (74%), Gaps = 1/84 (1%)
 Frame = +2

Query  368  VSIFKKLLVFDVSFNEITSPSGLSKVSSTLKELYVSNNQIAKIEEIEHFHELQILELGSN  547
            +    +L V D+SFN + +  G+ K++  LK+L++ NN+I+KIE I   H+LQ+LELGSN
Sbjct  208  LDALTELEVLDISFNLLRNIEGVDKLTR-LKKLFLVNNKISKIENISSLHQLQMLELGSN  266

Query  548  KLRVMenlqtltnlxelwlGRNRI  619
            ++RV+EN+  LT+L  L+LG+N+I
Sbjct  267  RIRVIENVDALTSLESLFLGKNKI  290



>gb|KGL84526.1| Protein phosphatase 1 regulatory subunit 7, partial [Tinamus 
guttatus]
Length=140

 Score = 56.2 bits (134),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 27/56 (48%), Positives = 41/56 (73%), Gaps = 1/56 (2%)
 Frame = +2

Query  392  VFDVSFNEITSPSGLSKVSSTLKELYVSNNQIAKIEEIEHFHELQILELGSNKLRV  559
            V D+SFN +    GL +++  LK+L++ NN+I KIE + +  ELQ+LELGSN++RV
Sbjct  78   VLDISFNVLRQIEGLDRLTQ-LKKLFLVNNKIGKIENLSNLQELQMLELGSNRIRV  132



>emb|CCW69103.1| unnamed protein product [Phytomonas sp. isolate Hart1]
Length=404

 Score = 50.8 bits (120),  Expect(2) = 9e-07, Method: Compositional matrix adjust.
 Identities = 26/60 (43%), Positives = 37/60 (62%), Gaps = 0/60 (0%)
 Frame = +2

Query  377  FKKLLVFDVSFNEITSPSGLSKVSSTLKELYVSNNQIAKIEEIEHFHELQILELGSNKLR  556
            F  L+  D S+N+I   SGL  +  TLKELY+  N+I  I+ ++  H L +LELG N +R
Sbjct  160  FSSLVKLDFSYNQIRVISGLETLGETLKELYLVENKIKVIQGLDALHNLVLLELGGNHIR  219


 Score = 28.9 bits (63),  Expect(2) = 9e-07, Method: Compositional matrix adjust.
 Identities = 23/56 (41%), Positives = 32/56 (57%), Gaps = 4/56 (7%)
 Frame = +3

Query  198  RLSALDPR-ISHLSNLNKFSLRQNLITDAALEPLSSWHTISQLEELVLRDNQLKKI  362
            RL +LD    + L+     SLR+NLI    L PL   H  ++LEEL   DN++KK+
Sbjct  80   RLFSLDEVDFTVLTRCTSLSLRKNLI--HGLSPLPI-HLANRLEELDFFDNKIKKV  132



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 906702465875