BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFF038J11

Length=515
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

gb|KDO63405.1|  hypothetical protein CISIN_1g014750mg                   206   8e-62   Citrus sinensis [apfelsine]
gb|AGJ98225.1|  BIN2-like protein PSK8                                  208   9e-62   Petunia x hybrida [garden petunia]
dbj|BAJ33892.1|  unnamed protein product                                204   2e-61   Eutrema halophilum
gb|KDO63403.1|  hypothetical protein CISIN_1g014750mg                   205   4e-61   Citrus sinensis [apfelsine]
ref|XP_002881146.1|  hypothetical protein ARALYDRAFT_902112             205   7e-61   Arabidopsis lyrata subsp. lyrata
gb|KDO63404.1|  hypothetical protein CISIN_1g014750mg                   204   8e-61   Citrus sinensis [apfelsine]
ref|XP_008365741.1|  PREDICTED: shaggy-related protein kinase eta...    205   1e-60   
ref|XP_006468992.1|  PREDICTED: shaggy-related protein kinase zet...    205   1e-60   Citrus sinensis [apfelsine]
ref|XP_006446814.1|  hypothetical protein CICLE_v10015375mg             205   1e-60   Citrus clementina [clementine]
gb|KDO63402.1|  hypothetical protein CISIN_1g014750mg                   205   1e-60   Citrus sinensis [apfelsine]
ref|XP_007215447.1|  hypothetical protein PRUPE_ppa006349mg             204   2e-60   Prunus persica
ref|XP_008228934.1|  PREDICTED: shaggy-related protein kinase eta...    204   2e-60   Prunus mume [ume]
gb|KFK42959.1|  hypothetical protein AALP_AA1G061200                    204   2e-60   Arabis alpina [alpine rockcress]
ref|XP_006294432.1|  hypothetical protein CARUB_v10023447mg             203   2e-60   
ref|XP_006417928.1|  hypothetical protein EUTSA_v10007772mg             204   3e-60   Eutrema salsugineum [saltwater cress]
ref|XP_009365288.1|  PREDICTED: shaggy-related protein kinase eta...    204   3e-60   Pyrus x bretschneideri [bai li]
ref|XP_004243275.1|  PREDICTED: shaggy-related protein kinase eta...    204   4e-60   Solanum lycopersicum
ref|XP_006348884.1|  PREDICTED: shaggy-related protein kinase zet...    204   4e-60   Solanum tuberosum [potatoes]
ref|XP_008343093.1|  PREDICTED: shaggy-related protein kinase eta...    203   4e-60   Malus domestica [apple tree]
ref|XP_002889601.1|  hypothetical protein ARALYDRAFT_470656             203   5e-60   Arabidopsis lyrata subsp. lyrata
gb|EYU30769.1|  hypothetical protein MIMGU_mgv1a006689mg                201   5e-60   Erythranthe guttata [common monkey flower]
dbj|BAH19519.1|  AT1G06390                                              202   8e-60   Arabidopsis thaliana [mouse-ear cress]
ref|NP_172127.1|  shaggy-related protein kinase iota                    202   9e-60   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010522087.1|  PREDICTED: shaggy-related protein kinase iota      202   1e-59   Tarenaya hassleriana [spider flower]
ref|XP_006307671.1|  hypothetical protein CARUB_v10009298mg             202   1e-59   Capsella rubella
emb|CAA64408.1|  shaggy-like kinase dzeta                               202   1e-59   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009593779.1|  PREDICTED: shaggy-related protein kinase eta...    202   1e-59   Nicotiana tomentosiformis
ref|XP_010104417.1|  Shaggy-related protein kinase zeta                 202   1e-59   
ref|NP_180655.1|  Shaggy-related protein kinase zeta                    202   2e-59   Arabidopsis thaliana [mouse-ear cress]
gb|AAM65084.1|  putative shaggy-like protein kinase dzeta               202   2e-59   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009801781.1|  PREDICTED: shaggy-related protein kinase eta...    202   2e-59   Nicotiana sylvestris
ref|XP_004149276.1|  PREDICTED: shaggy-related protein kinase zet...    201   3e-59   Cucumis sativus [cucumbers]
emb|CDP15948.1|  unnamed protein product                                201   3e-59   Coffea canephora [robusta coffee]
ref|XP_008448253.1|  PREDICTED: shaggy-related protein kinase eta...    201   4e-59   Cucumis melo [Oriental melon]
ref|XP_009378929.1|  PREDICTED: shaggy-related protein kinase eta...    201   4e-59   Pyrus x bretschneideri [bai li]
ref|XP_003527338.1|  PREDICTED: shaggy-related protein kinase zet...    201   5e-59   Glycine max [soybeans]
gb|EYU30768.1|  hypothetical protein MIMGU_mgv1a006689mg                201   5e-59   Erythranthe guttata [common monkey flower]
gb|KHN33940.1|  Shaggy-related protein kinase zeta                      200   6e-59   Glycine soja [wild soybean]
gb|KFK31745.1|  hypothetical protein AALP_AA6G153600                    199   1e-58   Arabis alpina [alpine rockcress]
ref|XP_010414192.1|  PREDICTED: shaggy-related protein kinase zet...    199   1e-58   Camelina sativa [gold-of-pleasure]
ref|XP_009141120.1|  PREDICTED: shaggy-related protein kinase zeta      199   1e-58   Brassica rapa
ref|XP_010475366.1|  PREDICTED: shaggy-related protein kinase iot...    199   1e-58   Camelina sativa [gold-of-pleasure]
ref|XP_003540001.1|  PREDICTED: shaggy-related protein kinase zet...    200   1e-58   Glycine max [soybeans]
ref|XP_010486052.1|  PREDICTED: shaggy-related protein kinase iot...    199   1e-58   Camelina sativa [gold-of-pleasure]
ref|XP_010457765.1|  PREDICTED: shaggy-related protein kinase iota      199   1e-58   Camelina sativa [gold-of-pleasure]
ref|XP_010510261.1|  PREDICTED: shaggy-related protein kinase zeta      199   2e-58   Camelina sativa [gold-of-pleasure]
ref|XP_010469777.1|  PREDICTED: shaggy-related protein kinase zet...    198   3e-58   Camelina sativa [gold-of-pleasure]
ref|XP_007132829.1|  hypothetical protein PHAVU_011G128000g             198   3e-58   Phaseolus vulgaris [French bean]
emb|CBI22011.3|  unnamed protein product                                196   4e-58   Vitis vinifera
gb|KHN34245.1|  Shaggy-related protein kinase zeta                      200   4e-58   Glycine soja [wild soybean]
ref|XP_010557131.1|  PREDICTED: shaggy-related protein kinase zet...    198   5e-58   Tarenaya hassleriana [spider flower]
ref|XP_010557132.1|  PREDICTED: shaggy-related protein kinase zet...    198   5e-58   Tarenaya hassleriana [spider flower]
ref|XP_004303195.1|  PREDICTED: shaggy-related protein kinase eta...    198   6e-58   Fragaria vesca subsp. vesca
ref|XP_007048726.1|  GSK3/SHAGGY-like protein kinase 1 isoform 2        197   7e-58   
ref|XP_010100748.1|  Shaggy-related protein kinase eta                  195   1e-57   
ref|XP_007048725.1|  SHAGGY-related protein kinase dZeta isoform 1      196   2e-57   Theobroma cacao [chocolate]
ref|XP_007025343.1|  Kinase superfamily protein isoform 2               196   2e-57   
ref|XP_010657061.1|  PREDICTED: shaggy-related protein kinase eta...    196   2e-57   Vitis vinifera
gb|AES66963.2|  shaggy-like kinase dzeta                                197   2e-57   Medicago truncatula
gb|KDO77888.1|  hypothetical protein CISIN_1g016950mg                   194   2e-57   Citrus sinensis [apfelsine]
ref|XP_003596712.1|  Shaggy-related protein kinase                      196   2e-57   
gb|ACJ85155.1|  unknown                                                 189   2e-57   Medicago truncatula
ref|XP_006449527.1|  hypothetical protein CICLE_v10015608mg             194   7e-57   Citrus clementina [clementine]
ref|XP_006467630.1|  PREDICTED: shaggy-related protein kinase eta...    194   8e-57   Citrus sinensis [apfelsine]
gb|KDO63406.1|  hypothetical protein CISIN_1g014750mg                   193   1e-56   Citrus sinensis [apfelsine]
gb|KDP21116.1|  hypothetical protein JCGZ_21587                         193   2e-56   Jatropha curcas
ref|XP_004487575.1|  PREDICTED: shaggy-related protein kinase zet...    194   2e-56   Cicer arietinum [garbanzo]
ref|XP_011082988.1|  PREDICTED: shaggy-related protein kinase eta       194   3e-56   Sesamum indicum [beniseed]
ref|XP_010689734.1|  PREDICTED: shaggy-related protein kinase eta       193   3e-56   Beta vulgaris subsp. vulgaris [field beet]
ref|NP_001190762.1|  Shaggy-related protein kinase eta                  190   3e-56   
ref|XP_011466966.1|  PREDICTED: shaggy-related protein kinase zet...    192   3e-56   Fragaria vesca subsp. vesca
ref|XP_003633016.1|  PREDICTED: shaggy-related protein kinase eta...    192   3e-56   Vitis vinifera
ref|XP_008365740.1|  PREDICTED: shaggy-related protein kinase zet...    191   4e-56   
ref|XP_009593781.1|  PREDICTED: shaggy-related protein kinase zet...    192   4e-56   
gb|KJB34904.1|  hypothetical protein B456_006G089400                    190   5e-56   Gossypium raimondii
ref|XP_007148030.1|  hypothetical protein PHAVU_006G1745000g            187   6e-56   Phaseolus vulgaris [French bean]
gb|KJB34903.1|  hypothetical protein B456_006G089400                    190   7e-56   Gossypium raimondii
ref|XP_002317404.1|  GSK3/SHAGGY-LIKE protein KINASE 1                  191   7e-56   Populus trichocarpa [western balsam poplar]
ref|XP_011039408.1|  PREDICTED: shaggy-related protein kinase eta...    191   8e-56   Populus euphratica
ref|XP_010529205.1|  PREDICTED: shaggy-related protein kinase eta...    191   1e-55   Tarenaya hassleriana [spider flower]
ref|XP_010274430.1|  PREDICTED: shaggy-related protein kinase eta...    192   1e-55   Nelumbo nucifera [Indian lotus]
ref|XP_008228935.1|  PREDICTED: shaggy-related protein kinase zet...    191   1e-55   Prunus mume [ume]
gb|KJB34905.1|  hypothetical protein B456_006G089400                    190   1e-55   Gossypium raimondii
ref|XP_009365289.1|  PREDICTED: shaggy-related protein kinase zet...    190   2e-55   Pyrus x bretschneideri [bai li]
ref|XP_011466967.1|  PREDICTED: shaggy-related protein kinase zet...    190   2e-55   Fragaria vesca subsp. vesca
emb|CAA64409.1|  shaggy-like kinase etha                                190   2e-55   Arabidopsis thaliana [mouse-ear cress]
dbj|BAJ33611.1|  unnamed protein product                                190   2e-55   Eutrema halophilum
gb|KHG20434.1|  Shaggy-related protein kinase eta                       190   2e-55   Gossypium arboreum [tree cotton]
ref|XP_002870026.1|  hypothetical protein ARALYDRAFT_914806             190   2e-55   Arabidopsis lyrata subsp. lyrata
ref|XP_008789340.1|  PREDICTED: shaggy-related protein kinase eta       191   2e-55   Phoenix dactylifera
ref|NP_193606.1|  Shaggy-related protein kinase eta                     190   3e-55   Arabidopsis thaliana [mouse-ear cress]
gb|EAY96932.1|  hypothetical protein OsI_18850                          185   3e-55   Oryza sativa Indica Group [Indian rice]
gb|KJB34902.1|  hypothetical protein B456_006G089400                    190   3e-55   Gossypium raimondii
ref|XP_008448254.1|  PREDICTED: shaggy-related protein kinase zet...    190   3e-55   
ref|XP_008343095.1|  PREDICTED: shaggy-related protein kinase zet...    190   3e-55   Malus domestica [apple tree]
ref|XP_003526266.1|  PREDICTED: shaggy-related protein kinase eta...    190   3e-55   Glycine max [soybeans]
ref|XP_003522493.1|  PREDICTED: shaggy-related protein kinase eta...    190   3e-55   
emb|CAN73053.1|  hypothetical protein VITISV_015513                     191   3e-55   Vitis vinifera
gb|AAL77705.1|  AT4g18710/F28A21_120                                    190   3e-55   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002522231.1|  Glycogen synthase kinase-3 beta, putative          189   4e-55   Ricinus communis
ref|XP_007136978.1|  hypothetical protein PHAVU_009G089900g             189   4e-55   Phaseolus vulgaris [French bean]
gb|KGN46984.1|  hypothetical protein Csa_6G157100                       191   4e-55   Cucumis sativus [cucumbers]
ref|XP_010246462.1|  PREDICTED: shaggy-related protein kinase eta       190   5e-55   Nelumbo nucifera [Indian lotus]
ref|XP_010538570.1|  PREDICTED: shaggy-related protein kinase eta...    189   5e-55   Tarenaya hassleriana [spider flower]
emb|CDY66894.1|  BnaCnng52760D                                          189   6e-55   Brassica napus [oilseed rape]
ref|XP_008439730.1|  PREDICTED: shaggy-related protein kinase eta       189   6e-55   Cucumis melo [Oriental melon]
ref|XP_010999759.1|  PREDICTED: shaggy-related protein kinase eta       189   6e-55   Populus euphratica
ref|XP_009132133.1|  PREDICTED: shaggy-related protein kinase eta       189   6e-55   Brassica rapa
ref|XP_002305736.1|  hypothetical protein POPTR_0004s05770g             189   6e-55   
ref|XP_010686226.1|  PREDICTED: shaggy-related protein kinase eta       189   7e-55   Beta vulgaris subsp. vulgaris [field beet]
gb|ABK95578.1|  unknown                                                 189   7e-55   Populus trichocarpa [western balsam poplar]
gb|ABG74917.1|  BIN2-like protein                                       189   7e-55   Brassica napus [oilseed rape]
gb|KJB68374.1|  hypothetical protein B456_010G241600                    189   8e-55   Gossypium raimondii
emb|CDO96835.1|  unnamed protein product                                189   8e-55   Coffea canephora [robusta coffee]
gb|KJB68373.1|  hypothetical protein B456_010G241600                    189   9e-55   Gossypium raimondii
ref|XP_009136953.1|  PREDICTED: shaggy-related protein kinase eta...    189   9e-55   Brassica rapa
gb|ACJ84750.1|  unknown                                                 188   1e-54   Medicago truncatula
gb|AFK40474.1|  unknown                                                 188   1e-54   Medicago truncatula
gb|AGV54503.1|  shaggy-related protein kinase eta-like protein          188   1e-54   Phaseolus vulgaris [French bean]
gb|AFK46922.1|  unknown                                                 188   1e-54   Lotus japonicus
gb|KDO77889.1|  hypothetical protein CISIN_1g016950mg                   188   1e-54   Citrus sinensis [apfelsine]
ref|XP_004485912.1|  PREDICTED: shaggy-related protein kinase eta...    188   1e-54   Cicer arietinum [garbanzo]
gb|KJB34899.1|  hypothetical protein B456_006G089300                    188   2e-54   Gossypium raimondii
ref|XP_009144602.1|  PREDICTED: shaggy-related protein kinase zet...    187   2e-54   
ref|XP_007025342.1|  Kinase superfamily protein isoform 1               187   2e-54   
ref|XP_006285118.1|  hypothetical protein CARUB_v10006451mg             187   2e-54   Capsella rubella
ref|XP_007149727.1|  hypothetical protein PHAVU_005G094100g             189   2e-54   Phaseolus vulgaris [French bean]
ref|XP_010052816.1|  PREDICTED: shaggy-related protein kinase eta       188   2e-54   Eucalyptus grandis [rose gum]
ref|XP_009378930.1|  PREDICTED: shaggy-related protein kinase zet...    187   3e-54   Pyrus x bretschneideri [bai li]
emb|CDY34051.1|  BnaC03g62810D                                          187   3e-54   Brassica napus [oilseed rape]
ref|XP_009394828.1|  PREDICTED: shaggy-related protein kinase eta       188   3e-54   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010924595.1|  PREDICTED: shaggy-related protein kinase eta...    188   3e-54   Elaeis guineensis
ref|XP_009619543.1|  PREDICTED: shaggy-related protein kinase eta       187   4e-54   Nicotiana tomentosiformis
ref|XP_009781118.1|  PREDICTED: shaggy-related protein kinase eta       187   4e-54   Nicotiana sylvestris
ref|XP_010920339.1|  PREDICTED: shaggy-related protein kinase eta       187   4e-54   Elaeis guineensis
ref|XP_008790026.1|  PREDICTED: shaggy-related protein kinase eta...    187   5e-54   Phoenix dactylifera
ref|XP_003542973.1|  PREDICTED: shaggy-related protein kinase eta...    186   5e-54   Glycine max [soybeans]
gb|KDO77890.1|  hypothetical protein CISIN_1g016950mg                   186   6e-54   Citrus sinensis [apfelsine]
ref|XP_010655538.1|  PREDICTED: shaggy-related protein kinase eta...    186   7e-54   Vitis vinifera
ref|XP_003546036.1|  PREDICTED: shaggy-related protein kinase eta...    186   7e-54   Glycine max [soybeans]
ref|XP_006449528.1|  hypothetical protein CICLE_v10015608mg             186   7e-54   
gb|AES66964.2|  shaggy-like kinase dzeta                                186   9e-54   Medicago truncatula
ref|XP_010518815.1|  PREDICTED: shaggy-related protein kinase eta...    186   1e-53   Tarenaya hassleriana [spider flower]
ref|XP_010529206.1|  PREDICTED: shaggy-related protein kinase eta...    185   1e-53   Tarenaya hassleriana [spider flower]
ref|XP_009108386.1|  PREDICTED: shaggy-related protein kinase eta...    185   2e-53   Brassica rapa
ref|XP_011085977.1|  PREDICTED: shaggy-related protein kinase eta...    185   3e-53   Sesamum indicum [beniseed]
ref|NP_001054901.1|  Os05g0207500                                       185   3e-53   
emb|CDY62551.1|  BnaA03g58360D                                          181   3e-53   Brassica napus [oilseed rape]
ref|XP_010925615.1|  PREDICTED: shaggy-related protein kinase eta...    185   4e-53   Elaeis guineensis
ref|XP_004293965.1|  PREDICTED: shaggy-related protein kinase eta       184   4e-53   Fragaria vesca subsp. vesca
ref|XP_004233047.1|  PREDICTED: shaggy-related protein kinase eta       184   4e-53   
emb|CDX99437.1|  BnaC01g11150D                                          184   4e-53   
ref|XP_010915474.1|  PREDICTED: shaggy-related protein kinase eta...    185   4e-53   Elaeis guineensis
ref|XP_004134656.1|  PREDICTED: shaggy-related protein kinase eta...    183   9e-53   Cucumis sativus [cucumbers]
gb|KJB34900.1|  hypothetical protein B456_006G089300                    183   1e-52   Gossypium raimondii
ref|XP_009351457.1|  PREDICTED: shaggy-related protein kinase eta       183   1e-52   Pyrus x bretschneideri [bai li]
ref|XP_006833052.1|  hypothetical protein AMTR_s00170p00028260          182   1e-52   
ref|XP_008225315.1|  PREDICTED: shaggy-related protein kinase eta       183   1e-52   Prunus mume [ume]
ref|XP_010439822.1|  PREDICTED: shaggy-related protein kinase eta...    183   1e-52   Camelina sativa [gold-of-pleasure]
ref|XP_007211435.1|  hypothetical protein PRUPE_ppa007161mg             183   1e-52   Prunus persica
ref|XP_010496879.1|  PREDICTED: shaggy-related protein kinase eta...    183   1e-52   Camelina sativa [gold-of-pleasure]
ref|XP_008371494.1|  PREDICTED: shaggy-related protein kinase eta...    183   1e-52   Malus domestica [apple tree]
ref|XP_010449479.1|  PREDICTED: shaggy-related protein kinase eta       183   1e-52   Camelina sativa [gold-of-pleasure]
ref|XP_008383613.1|  PREDICTED: shaggy-related protein kinase eta       183   1e-52   
gb|KCW47359.1|  hypothetical protein EUGRSUZ_K01144                     182   2e-52   Eucalyptus grandis [rose gum]
ref|XP_009352741.1|  PREDICTED: shaggy-related protein kinase eta...    182   2e-52   Pyrus x bretschneideri [bai li]
ref|XP_009394192.1|  PREDICTED: shaggy-related protein kinase eta...    183   2e-52   Musa acuminata subsp. malaccensis [pisang utan]
gb|KHN29604.1|  Shaggy-related protein kinase eta                       182   2e-52   Glycine soja [wild soybean]
emb|CDX78886.1|  BnaA01g09530D                                          182   2e-52   
dbj|BAH57105.1|  AT4G18710                                              182   2e-52   Arabidopsis thaliana [mouse-ear cress]
emb|CDY64921.1|  BnaC07g50210D                                          182   2e-52   Brassica napus [oilseed rape]
gb|KHN07046.1|  Shaggy-related protein kinase eta                       182   2e-52   Glycine soja [wild soybean]
emb|CDY70859.1|  BnaAnng35300D                                          182   3e-52   Brassica napus [oilseed rape]
ref|XP_010538571.1|  PREDICTED: shaggy-related protein kinase eta...    181   4e-52   Tarenaya hassleriana [spider flower]
ref|XP_010035873.1|  PREDICTED: shaggy-related protein kinase eta...    182   4e-52   Eucalyptus grandis [rose gum]
gb|EPS63039.1|  hypothetical protein M569_11747                         180   5e-52   Genlisea aurea
gb|EYU28104.1|  hypothetical protein MIMGU_mgv1a008133mg                181   7e-52   Erythranthe guttata [common monkey flower]
ref|XP_009380485.1|  PREDICTED: shaggy-related protein kinase eta...    182   7e-52   Musa acuminata subsp. malaccensis [pisang utan]
gb|KJB68372.1|  hypothetical protein B456_010G241600                    181   7e-52   Gossypium raimondii
gb|EYU43326.1|  hypothetical protein MIMGU_mgv1a008172mg                181   7e-52   Erythranthe guttata [common monkey flower]
gb|ACJ83284.1|  unknown                                                 175   7e-52   Medicago truncatula
ref|XP_008794094.1|  PREDICTED: shaggy-related protein kinase eta       181   1e-51   Phoenix dactylifera
ref|XP_009396521.1|  PREDICTED: shaggy-related protein kinase eta...    181   2e-51   Musa acuminata subsp. malaccensis [pisang utan]
gb|KHN28622.1|  Shaggy-related protein kinase eta                       179   4e-51   Glycine soja [wild soybean]
ref|XP_002873682.1|  kinase family protein                              180   4e-51   
emb|CAB87631.1|  protein kinase MSK-3-like                              180   4e-51   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010492276.1|  PREDICTED: shaggy-related protein kinase eps...    180   4e-51   Camelina sativa [gold-of-pleasure]
ref|XP_004234083.1|  PREDICTED: shaggy-related protein kinase eta...    179   4e-51   Solanum lycopersicum
ref|XP_006594547.1|  PREDICTED: shaggy-related protein kinase eta...    179   4e-51   
ref|XP_010420109.1|  PREDICTED: shaggy-related protein kinase eps...    180   4e-51   Camelina sativa [gold-of-pleasure]
ref|XP_010453592.1|  PREDICTED: shaggy-related protein kinase eps...    180   4e-51   Camelina sativa [gold-of-pleasure]
ref|XP_006367136.1|  PREDICTED: shaggy-related protein kinase eta...    179   5e-51   Solanum tuberosum [potatoes]
ref|NP_196968.2|  Shaggy-related protein kinase 13                      179   5e-51   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009770234.1|  PREDICTED: shaggy-related protein kinase eta...    179   5e-51   Nicotiana sylvestris
ref|XP_006287860.1|  hypothetical protein CARUB_v10001087mg             179   5e-51   
ref|XP_003540409.1|  PREDICTED: shaggy-related protein kinase zet...    179   5e-51   Glycine max [soybeans]
ref|XP_006399977.1|  hypothetical protein EUTSA_v10013689mg             179   5e-51   Eutrema salsugineum [saltwater cress]
gb|KDO66115.1|  hypothetical protein CISIN_1g0141741mg                  175   6e-51   Citrus sinensis [apfelsine]
gb|KDO66112.1|  hypothetical protein CISIN_1g0141741mg                  175   6e-51   Citrus sinensis [apfelsine]
gb|ACR37222.1|  unknown                                                 171   7e-51   Zea mays [maize]
ref|XP_006594815.1|  PREDICTED: shaggy-related protein kinase zet...    179   8e-51   Glycine max [soybeans]
gb|AEQ94156.1|  shaggy-related protein kinase                           174   9e-51   Elaeis guineensis
ref|XP_010518816.1|  PREDICTED: shaggy-related protein kinase eta...    178   9e-51   Tarenaya hassleriana [spider flower]
ref|XP_009151155.1|  PREDICTED: shaggy-related protein kinase alpha     178   1e-50   Brassica rapa
emb|CDX78587.1|  BnaA03g04990D                                          178   1e-50   
emb|CDX70574.1|  BnaC03g06580D                                          178   1e-50   
ref|XP_009131419.1|  PREDICTED: shaggy-related protein kinase eps...    178   1e-50   Brassica rapa
gb|AEQ94143.1|  putative Glycogen synthase kinase 3                     173   1e-50   Elaeis guineensis
gb|KJB45482.1|  hypothetical protein B456_007G308500                    174   2e-50   Gossypium raimondii
gb|AGJ98224.1|  BIN2-like protein PSK9                                  177   2e-50   Petunia x hybrida [garden petunia]
emb|CDX80585.1|  BnaC07g28590D                                          178   2e-50   
ref|XP_010546768.1|  PREDICTED: shaggy-related protein kinase alpha     178   2e-50   Tarenaya hassleriana [spider flower]
ref|XP_002302794.1|  Glycogen synthase kinase-3 MsK-3 family protein    178   2e-50   Populus trichocarpa [western balsam poplar]
ref|XP_011085978.1|  PREDICTED: shaggy-related protein kinase eta...    177   3e-50   
ref|XP_010550142.1|  PREDICTED: shaggy-related protein kinase eps...    177   3e-50   Tarenaya hassleriana [spider flower]
ref|XP_011003165.1|  PREDICTED: shaggy-related protein kinase alp...    177   3e-50   Populus euphratica
gb|AGK41245.1|  SHAGGY-like kinase                                      177   3e-50   Triticum aestivum [Canadian hard winter wheat]
dbj|BAJ91341.1|  predicted protein                                      177   3e-50   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_010251221.1|  PREDICTED: shaggy-related protein kinase eps...    176   3e-50   Nelumbo nucifera [Indian lotus]
ref|XP_003565257.1|  PREDICTED: shaggy-related protein kinase eta...    177   3e-50   Brachypodium distachyon [annual false brome]
gb|AGJ93555.1|  SHAGGY-like kinase                                      177   3e-50   Triticum aestivum [Canadian hard winter wheat]
gb|EMT19129.1|  Shaggy-related protein kinase iota                      176   4e-50   
ref|XP_004230343.1|  PREDICTED: shaggy-related protein kinase NtK-1     177   4e-50   Solanum lycopersicum
ref|XP_006299606.1|  hypothetical protein CARUB_v10015785mg             177   4e-50   Capsella rubella
gb|EYU34726.1|  hypothetical protein MIMGU_mgv1a007335mg                177   4e-50   Erythranthe guttata [common monkey flower]
ref|XP_008345980.1|  PREDICTED: shaggy-related protein kinase eta       176   4e-50   
emb|CDM82043.1|  unnamed protein product                                177   4e-50   Triticum aestivum [Canadian hard winter wheat]
ref|XP_009629200.1|  PREDICTED: shaggy-related protein kinase NtK...    177   5e-50   Nicotiana tomentosiformis
ref|XP_009588662.1|  PREDICTED: shaggy-related protein kinase eta...    176   5e-50   Nicotiana tomentosiformis
gb|AAM62970.1|  shaggy related protein kinase ASK-GAMMA                 177   5e-50   Arabidopsis thaliana [mouse-ear cress]
gb|AGJ93554.1|  SHAGGY-like kinase                                      177   5e-50   Triticum aestivum [Canadian hard winter wheat]
emb|CAA53181.1|  shaggy related kinase                                  177   5e-50   Arabidopsis thaliana [mouse-ear cress]
ref|NP_568486.1|  Shaggy-related protein kinase alpha                   177   5e-50   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006289925.1|  hypothetical protein CARUB_v10003541mg             177   5e-50   Capsella rubella
emb|CAA04265.1|  shaggy-like kinase alpha                               177   5e-50   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002874323.1|  hypothetical protein ARALYDRAFT_489503             177   6e-50   
ref|XP_010455024.1|  PREDICTED: shaggy-related protein kinase alp...    177   6e-50   Camelina sativa [gold-of-pleasure]
ref|XP_010493927.1|  PREDICTED: shaggy-related protein kinase alp...    177   6e-50   Camelina sativa [gold-of-pleasure]
gb|KDO45354.1|  hypothetical protein CISIN_1g015298mg                   175   6e-50   Citrus sinensis [apfelsine]
gb|ACJ85100.1|  unknown                                                 172   6e-50   Medicago truncatula
ref|NP_187235.1|  Shaggy-related protein kinase gamma                   177   6e-50   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009410923.1|  PREDICTED: shaggy-related protein kinase eta...    176   6e-50   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_006394905.1|  hypothetical protein EUTSA_v10004319mg             177   6e-50   Eutrema salsugineum [saltwater cress]
ref|XP_010421531.1|  PREDICTED: shaggy-related protein kinase alp...    177   7e-50   Camelina sativa [gold-of-pleasure]
ref|XP_006408022.1|  hypothetical protein EUTSA_v10020835mg             176   7e-50   Eutrema salsugineum [saltwater cress]
ref|XP_006408021.1|  hypothetical protein EUTSA_v10020835mg             176   7e-50   Eutrema salsugineum [saltwater cress]
ref|XP_010251218.1|  PREDICTED: shaggy-related protein kinase eps...    176   8e-50   Nelumbo nucifera [Indian lotus]
ref|XP_002882438.1|  hypothetical protein ARALYDRAFT_477878             176   8e-50   
ref|XP_010270906.1|  PREDICTED: shaggy-related protein kinase alp...    176   8e-50   Nelumbo nucifera [Indian lotus]
emb|CDY49981.1|  BnaC03g34380D                                          176   8e-50   Brassica napus [oilseed rape]
ref|XP_009147201.1|  PREDICTED: shaggy-related protein kinase gamma     176   8e-50   Brassica rapa
gb|AFW76550.1|  putative glycogen synthase kinase family protein        171   8e-50   
gb|KDO86865.1|  hypothetical protein CISIN_1g015632mg                   173   9e-50   Citrus sinensis [apfelsine]
emb|CDY05202.1|  BnaC05g46010D                                          176   9e-50   
gb|KDO45355.1|  hypothetical protein CISIN_1g015298mg                   175   9e-50   Citrus sinensis [apfelsine]
gb|ABG74911.1|  AtSK12-like protein                                     176   9e-50   Brassica napus [oilseed rape]
ref|XP_004965568.1|  PREDICTED: shaggy-related protein kinase zet...    176   9e-50   Setaria italica
ref|XP_009134851.1|  PREDICTED: shaggy-related protein kinase gamma     176   1e-49   Brassica rapa
ref|XP_011040636.1|  PREDICTED: shaggy-related protein kinase alp...    176   1e-49   Populus euphratica
ref|XP_009410924.1|  PREDICTED: shaggy-related protein kinase iot...    175   1e-49   Musa acuminata subsp. malaccensis [pisang utan]
gb|KJB45480.1|  hypothetical protein B456_007G308500                    174   1e-49   Gossypium raimondii
ref|XP_010251217.1|  PREDICTED: shaggy-related protein kinase eps...    176   1e-49   Nelumbo nucifera [Indian lotus]
ref|XP_002987888.1|  GSK3/shaggy-like protein kinase                    176   1e-49   Selaginella moellendorffii
ref|XP_010524830.1|  PREDICTED: shaggy-related protein kinase alp...    176   1e-49   Tarenaya hassleriana [spider flower]
emb|CDP02094.1|  unnamed protein product                                176   1e-49   Coffea canephora [robusta coffee]
ref|XP_010270905.1|  PREDICTED: shaggy-related protein kinase alp...    176   1e-49   Nelumbo nucifera [Indian lotus]
emb|CBI39647.3|  unnamed protein product                                175   1e-49   Vitis vinifera
gb|ABY60447.1|  serine/threonine protein kinase                         176   1e-49   Adonis aestivalis var. palaestina
ref|XP_002512564.1|  Glycogen synthase kinase-3 beta, putative          175   2e-49   
ref|XP_006594816.1|  PREDICTED: shaggy-related protein kinase zet...    175   2e-49   Glycine max [soybeans]
ref|XP_010486058.1|  PREDICTED: shaggy-related protein kinase gam...    175   2e-49   Camelina sativa [gold-of-pleasure]
gb|KDO45353.1|  hypothetical protein CISIN_1g015298mg                   175   2e-49   Citrus sinensis [apfelsine]
emb|CDY19757.1|  BnaA09g04100D                                          175   2e-49   Brassica napus [oilseed rape]
ref|XP_010432712.1|  PREDICTED: shaggy-related protein kinase gam...    175   2e-49   Camelina sativa [gold-of-pleasure]
ref|XP_011039006.1|  PREDICTED: shaggy-related protein kinase alpha     175   2e-49   Populus euphratica
ref|XP_010464137.1|  PREDICTED: shaggy-related protein kinase gamma     175   2e-49   Camelina sativa [gold-of-pleasure]
ref|XP_010231609.1|  PREDICTED: shaggy-related protein kinase eta       175   2e-49   Brachypodium distachyon [annual false brome]
gb|KDP23349.1|  hypothetical protein JCGZ_23182                         175   2e-49   Jatropha curcas
ref|XP_006382290.1|  hypothetical protein POPTR_0005s00710g             175   2e-49   Populus trichocarpa [western balsam poplar]
ref|XP_006480288.1|  PREDICTED: shaggy-related protein kinase alp...    175   2e-49   
ref|XP_011092192.1|  PREDICTED: shaggy-related protein kinase alpha     175   2e-49   
ref|XP_002280673.1|  PREDICTED: shaggy-related protein kinase alpha     175   2e-49   
ref|XP_007205270.1|  hypothetical protein PRUPE_ppa006473mg             175   2e-49   
emb|CAN64359.1|  hypothetical protein VITISV_041427                     176   2e-49   
ref|XP_008246288.1|  PREDICTED: shaggy-related protein kinase alpha     175   2e-49   
ref|XP_009111716.1|  PREDICTED: shaggy-related protein kinase alp...    175   3e-49   
ref|NP_001274855.1|  Shaggy-like protein kinase NtK-1                   175   3e-49   
emb|CDX87033.1|  BnaC09g03480D                                          175   3e-49   
gb|AFN42826.1|  GSK3-like protein                                       174   3e-49   
gb|AAQ23107.1|  shaggy-related protein kinase 2                         175   3e-49   
ref|XP_001781586.1|  predicted protein                                  175   3e-49   
ref|XP_001763265.1|  predicted protein                                  175   3e-49   
ref|XP_009334099.1|  PREDICTED: shaggy-related protein kinase eps...    175   3e-49   
ref|NP_001130511.1|  uncharacterized protein LOC100191610               175   4e-49   
gb|KDO86864.1|  hypothetical protein CISIN_1g015632mg                   173   4e-49   
gb|EYU34725.1|  hypothetical protein MIMGU_mgv1a007335mg                174   4e-49   
ref|XP_006444574.1|  hypothetical protein CICLE_v10020852mg             173   4e-49   
gb|ACG33869.1|  shaggy-related protein kinase eta                       174   4e-49   
ref|XP_010941497.1|  PREDICTED: shaggy-related protein kinase alpha     174   4e-49   
emb|CDY27737.1|  BnaA05g31460D                                          176   4e-49   
ref|XP_009131508.1|  PREDICTED: shaggy-related protein kinase eps...    172   4e-49   
ref|XP_002453590.1|  hypothetical protein SORBIDRAFT_04g008580          174   5e-49   
gb|AES82237.2|  glycogen synthase kinase                                173   5e-49   
ref|XP_006647108.1|  PREDICTED: shaggy-related protein kinase zet...    174   5e-49   
gb|KHG02936.1|  Shaggy-related protein kinase alpha                     174   5e-49   
gb|EEE54080.1|  hypothetical protein OsJ_00810                          174   5e-49   
emb|CBI37005.3|  unnamed protein product                                174   5e-49   
ref|XP_008357735.1|  PREDICTED: shaggy-related protein kinase eps...    174   5e-49   
ref|XP_008812956.1|  PREDICTED: shaggy-related protein kinase alp...    174   5e-49   
ref|XP_006428242.1|  hypothetical protein CICLE_v10013624mg             175   5e-49   
gb|KJB45479.1|  hypothetical protein B456_007G308500                    174   5e-49   
ref|XP_002515218.1|  Glycogen synthase kinase-3 beta, putative          174   5e-49   
ref|XP_007031506.1|  Shaggy-like kinase 13 isoform 3                    174   5e-49   
ref|XP_007031504.1|  Shaggy-like kinase 13 isoform 1                    174   5e-49   
ref|XP_007031229.1|  Shaggy-related kinase 11, 11 isoform 1             174   6e-49   
ref|XP_010660897.1|  PREDICTED: shaggy-related protein kinase eps...    174   6e-49   
ref|XP_011097427.1|  PREDICTED: shaggy-related protein kinase eps...    174   6e-49   
ref|XP_004252662.1|  PREDICTED: shaggy-related protein kinase eps...    174   6e-49   
ref|NP_001149135.1|  shaggy-related protein kinase eta                  174   6e-49   
gb|AFW80358.1|  putative glycogen synthase kinase family protein        172   6e-49   
ref|XP_010317426.1|  PREDICTED: shaggy-related protein kinase eta...    173   6e-49   
ref|XP_004494455.1|  PREDICTED: glycogen synthase kinase-3 homolo...    173   7e-49   
gb|KCW84977.1|  hypothetical protein EUGRSUZ_B01797                     171   7e-49   
ref|XP_007145031.1|  hypothetical protein PHAVU_007G204000g             174   7e-49   
ref|XP_004232308.1|  PREDICTED: shaggy-related protein kinase eps...    174   7e-49   
ref|XP_006470301.1|  PREDICTED: shaggy-related protein kinase eps...    174   7e-49   
ref|XP_006446534.1|  hypothetical protein CICLE_v10015323mg             174   7e-49   
dbj|BAA92966.1|  putative shaggy-like kinase dzeta                      174   7e-49   
ref|XP_007215466.1|  hypothetical protein PRUPE_ppa006497mg             174   7e-49   
ref|XP_008343189.1|  PREDICTED: glycogen synthase kinase-3 homolo...    173   7e-49   
ref|XP_010660896.1|  PREDICTED: shaggy-related protein kinase eps...    174   7e-49   
ref|XP_003591238.1|  Glycogen synthase kinase                           174   7e-49   
ref|XP_011079505.1|  PREDICTED: shaggy-related protein kinase alp...    174   7e-49   
sp|P51137.1|MSK1_MEDSA  RecName: Full=Glycogen synthase kinase-3 ...    174   8e-49   
ref|XP_008230580.1|  PREDICTED: shaggy-related protein kinase eps...    174   8e-49   
gb|ACJ85178.1|  unknown                                                 173   8e-49   
ref|XP_009759533.1|  PREDICTED: shaggy-related protein kinase eps...    174   8e-49   
ref|XP_002454973.1|  hypothetical protein SORBIDRAFT_03g002380          174   8e-49   
gb|KJB49765.1|  hypothetical protein B456_008G136600                    174   8e-49   
gb|KHG00969.1|  Glycogen synthase kinase-3 MsK-3                        174   8e-49   
ref|NP_001046390.1|  Os02g0236200                                       174   8e-49   
ref|XP_004252661.1|  PREDICTED: shaggy-related protein kinase eps...    174   8e-49   
ref|XP_002279596.1|  PREDICTED: shaggy-related protein kinase alp...    174   8e-49   
ref|XP_006364003.1|  PREDICTED: shaggy-related protein kinase eps...    174   8e-49   
gb|ABR16348.1|  unknown                                                 174   9e-49   
ref|XP_009598967.1|  PREDICTED: shaggy-related protein kinase eps...    174   9e-49   
gb|EEC70138.1|  hypothetical protein OsI_00828                          173   9e-49   
ref|XP_008672878.1|  PREDICTED: shaggy-related protein kinase eta...    174   9e-49   
ref|XP_009775930.1|  PREDICTED: shaggy-related protein kinase NtK...    174   9e-49   
ref|XP_008793304.1|  PREDICTED: shaggy-related protein kinase alp...    174   1e-48   
ref|XP_010278583.1|  PREDICTED: shaggy-related protein kinase eps...    175   1e-48   
ref|XP_001781582.1|  predicted protein                                  174   1e-48   
gb|AAQ23108.1|  shaggy-related protein kinase 3                         174   1e-48   
ref|XP_008781189.1|  PREDICTED: shaggy-related protein kinase alp...    173   1e-48   
dbj|BAJ34573.1|  unnamed protein product                                173   1e-48   
ref|XP_002991115.1|  hypothetical protein SELMODRAFT_451471             174   1e-48   
gb|AFK38277.1|  unknown                                                 173   1e-48   
gb|EYU38392.1|  hypothetical protein MIMGU_mgv1a007572mg                173   1e-48   
ref|XP_003626019.1|  Protein kinase, putative                           173   1e-48   
ref|XP_010276519.1|  PREDICTED: shaggy-related protein kinase alpha     173   1e-48   
ref|XP_003591341.1|  Glycogen synthase kinase-3-like protein            172   1e-48   
gb|EAZ22360.1|  hypothetical protein OsJ_06019                          173   1e-48   
ref|XP_006588497.1|  PREDICTED: uncharacterized protein LOC100817...    173   1e-48   
gb|AFH00876.1|  glycogen synthase kinase-3                              173   1e-48   
ref|XP_006588432.1|  PREDICTED: glycogen synthase kinase-3 isofor...    173   1e-48   
emb|CAA48472.1|  protein kinase                                         173   1e-48   
sp|P51139.2|MSK3_MEDSA  RecName: Full=Glycogen synthase kinase-3 ...    173   2e-48   
ref|XP_006444573.1|  hypothetical protein CICLE_v10020852mg             173   2e-48   
emb|CDP15204.1|  unnamed protein product                                173   2e-48   
ref|XP_010248490.1|  PREDICTED: shaggy-related protein kinase eps...    173   2e-48   
ref|XP_003518657.1|  PREDICTED: glycogen synthase kinase-3 homolo...    173   2e-48   
gb|KHN16033.1|  Glycogen synthase kinase-3 like MsK-1                   173   2e-48   
ref|XP_003591340.1|  Glycogen synthase kinase-3-like protein            173   2e-48   
ref|XP_004495628.1|  PREDICTED: glycogen synthase kinase-3 homolo...    173   2e-48   
ref|XP_010910596.1|  PREDICTED: shaggy-related protein kinase alp...    173   2e-48   
ref|XP_004148581.1|  PREDICTED: glycogen synthase kinase-3 homolo...    173   2e-48   
emb|CAA58594.1|  Petunia Shaggy kinase 4                                173   2e-48   
gb|AGJ93556.1|  SHAGGY-like kinase                                      172   2e-48   
gb|AES61591.2|  glycogen synthase kinase                                173   2e-48   
ref|XP_010921357.1|  PREDICTED: shaggy-related protein kinase alpha     173   2e-48   
ref|XP_003555781.1|  PREDICTED: glycogen synthase kinase-3 homolo...    173   2e-48   
ref|XP_008353866.1|  PREDICTED: glycogen synthase kinase-3 homolo...    173   2e-48   
ref|XP_010097328.1|  Shaggy-related protein kinase alpha                175   2e-48   
sp|P51138.1|MSK2_MEDSA  RecName: Full=Glycogen synthase kinase-3 ...    173   2e-48   
ref|XP_006841582.1|  hypothetical protein AMTR_s00003p00196730          172   2e-48   
gb|AGK41246.1|  SHAGGY-like kinase                                      172   2e-48   
gb|EMS65432.1|  Shaggy-related protein kinase iota                      172   2e-48   
ref|NP_001242406.1|  uncharacterized protein LOC100788612               172   2e-48   
ref|XP_003554602.1|  PREDICTED: shaggy-related protein kinase alp...    172   2e-48   
ref|XP_006576226.1|  PREDICTED: uncharacterized protein LOC100788...    172   2e-48   
ref|XP_008778092.1|  PREDICTED: shaggy-related protein kinase alp...    172   2e-48   
gb|KHN00323.1|  Glycogen synthase kinase-3 like MsK-2                   172   2e-48   
gb|AFM94293.1|  glycogen synthase kinase                                171   3e-48   
ref|XP_003626020.1|  Protein kinase, putative                           173   3e-48   
ref|XP_006338577.1|  PREDICTED: shaggy-related protein kinase eps...    172   3e-48   
gb|EYU46859.1|  hypothetical protein MIMGU_mgv1a007395mg                172   3e-48   
ref|XP_004304635.1|  PREDICTED: shaggy-related protein kinase eps...    172   3e-48   
gb|ACQ91102.1|  glycogen synthase kinase                                172   3e-48   
ref|XP_004495625.1|  PREDICTED: glycogen synthase kinase-3 homolo...    173   3e-48   
ref|XP_008381452.1|  PREDICTED: glycogen synthase kinase-3 homolo...    172   3e-48   
gb|ACG33866.1|  shaggy-related protein kinase eta                       172   3e-48   
ref|XP_001762052.1|  predicted protein                                  172   3e-48   
ref|XP_006338576.1|  PREDICTED: shaggy-related protein kinase eps...    172   3e-48   
ref|NP_001131812.1|  putative glycogen synthase kinase family pro...    172   3e-48   
gb|AAQ23109.1|  shaggy-related protein kinase 4                         172   3e-48   
ref|XP_009363099.1|  PREDICTED: glycogen synthase kinase-3 homolo...    172   4e-48   
ref|XP_004951349.1|  PREDICTED: shaggy-related protein kinase eta...    172   4e-48   
ref|XP_010091400.1|  Glycogen synthase kinase-3-MsK-3-like protein      172   4e-48   
ref|XP_006840718.1|  hypothetical protein AMTR_s00096p00102520          171   4e-48   
ref|XP_007051226.1|  Shaggy-related kinase 11, 11 isoform 1             172   4e-48   
gb|AFW71144.1|  putative glycogen synthase kinase family protein        172   4e-48   
gb|ACG34459.1|  shaggy-related protein kinase eta                       172   4e-48   
ref|XP_010038314.1|  PREDICTED: shaggy-related protein kinase alp...    172   4e-48   
gb|KHG08917.1|  Shaggy-related protein kinase eta                       171   5e-48   
ref|XP_006588498.1|  PREDICTED: uncharacterized protein LOC100817...    171   5e-48   
ref|XP_010251219.1|  PREDICTED: shaggy-related protein kinase eps...    171   5e-48   
emb|CDP17018.1|  unnamed protein product                                171   5e-48   
ref|XP_009392422.1|  PREDICTED: shaggy-related protein kinase eta...    171   6e-48   
ref|XP_008227813.1|  PREDICTED: glycogen synthase kinase-3 homolo...    171   6e-48   
ref|XP_007221484.1|  hypothetical protein PRUPE_ppa006462mg             171   7e-48   
gb|KHN00229.1|  Glycogen synthase kinase-3 like MsK-3                   174   7e-48   
gb|EEC72801.1|  hypothetical protein OsI_06492                          170   7e-48   
gb|ABB55385.1|  Ser/Thr protein kinase-like                             171   7e-48   
ref|XP_010674528.1|  PREDICTED: shaggy-related protein kinase alpha     171   7e-48   
gb|EPS63877.1|  hypothetical protein M569_10905                         171   9e-48   
ref|XP_010679446.1|  PREDICTED: shaggy-related protein kinase NtK-1     171   9e-48   
sp|Q40518.1|MSK1_TOBAC  RecName: Full=Shaggy-related protein kina...    171   1e-47   
ref|XP_006382289.1|  hypothetical protein POPTR_0005s00710g             171   1e-47   
ref|XP_010493929.1|  PREDICTED: shaggy-related protein kinase alp...    170   1e-47   
ref|XP_008363964.1|  PREDICTED: shaggy-related protein kinase alpha     171   1e-47   
ref|XP_009366055.1|  PREDICTED: shaggy-related protein kinase alp...    171   1e-47   
ref|XP_009335521.1|  PREDICTED: shaggy-related protein kinase alpha     171   1e-47   
ref|NP_001167685.1|  shaggy-related protein kinase eta                  171   1e-47   
ref|XP_011023844.1|  PREDICTED: shaggy-related protein kinase alpha     171   1e-47   
ref|XP_010652295.1|  PREDICTED: shaggy-related protein kinase alp...    170   1e-47   
ref|NP_001131188.1|  putative glycogen synthase kinase family pro...    171   1e-47   
gb|AGJ93558.1|  SHAGGY-like kinase                                      171   1e-47   
dbj|BAD95892.1|  Ser/Thr protein kinase                                 171   1e-47   
ref|XP_004495878.1|  PREDICTED: glycogen synthase kinase-3 homolo...    171   1e-47   
gb|ABK93098.1|  unknown                                                 171   1e-47   
gb|KDO86034.1|  hypothetical protein CISIN_1g011138mg                   167   1e-47   
gb|ABK24355.1|  unknown                                                 169   1e-47   
ref|NP_001057824.1|  Os06g0547900                                       170   1e-47   
ref|XP_010042192.1|  PREDICTED: shaggy-related protein kinase alpha     171   1e-47   
ref|XP_002319468.1|  Glycogen synthase kinase-3 MsK-1 family protein    170   2e-47   
gb|EEC80781.1|  hypothetical protein OsI_23306                          170   2e-47   
emb|CAA73848.1|  shaggy-like kinase etha (OSKetha)                      170   2e-47   
ref|NP_001242661.1|  glycogen synthase kinase-3                         170   2e-47   
gb|AAQ23111.1|  shaggy-related protein kinase 1                         170   2e-47   
ref|XP_009383704.1|  PREDICTED: shaggy-related protein kinase alpha     170   2e-47   
ref|XP_001763270.1|  predicted protein                                  171   2e-47   
ref|XP_010938176.1|  PREDICTED: shaggy-related protein kinase alp...    170   2e-47   
ref|NP_001269276.1|  glycogen synthase kinase-3 homolog MsK-1-like      170   2e-47   
gb|EMT26120.1|  Shaggy-related protein kinase iota                      170   2e-47   
ref|NP_001149983.1|  shaggy-related protein kinase eta                  170   3e-47   
gb|EPS73818.1|  hypothetical protein M569_00937                         169   3e-47   
ref|XP_001765207.1|  predicted protein                                  170   3e-47   
ref|XP_007031230.1|  Shaggy-related kinase 11, 11 isoform 2             169   3e-47   
emb|CDX78658.1|  BnaA03g05700D                                          172   3e-47   
ref|XP_009403747.1|  PREDICTED: shaggy-related protein kinase alp...    169   3e-47   
ref|XP_008344049.1|  PREDICTED: shaggy-related protein kinase eps...    171   4e-47   
tpg|DAA53953.1|  TPA: putative glycogen synthase kinase family pr...    167   4e-47   
gb|KDO86866.1|  hypothetical protein CISIN_1g015632mg                   168   4e-47   
ref|XP_008383272.1|  PREDICTED: shaggy-related protein kinase theta     171   5e-47   
gb|EPS68698.1|  hypothetical protein M569_06069                         167   5e-47   
ref|XP_008443540.1|  PREDICTED: shaggy-related protein kinase eps...    169   5e-47   
ref|XP_009384996.1|  PREDICTED: shaggy-related protein kinase alp...    169   5e-47   
ref|XP_009617298.1|  PREDICTED: shaggy-related protein kinase NtK-1     169   6e-47   
ref|XP_008388444.1|  PREDICTED: shaggy-related protein kinase alpha     169   6e-47   
ref|NP_001242506.1|  uncharacterized protein LOC100817819               168   6e-47   
ref|XP_009416503.1|  PREDICTED: shaggy-related protein kinase eta...    169   6e-47   
ref|XP_009340624.1|  PREDICTED: shaggy-related protein kinase the...    170   6e-47   
ref|XP_010108792.1|  Shaggy-related protein kinase epsilon              176   7e-47   
ref|XP_003591339.1|  Glycogen synthase kinase-3-like protein            168   7e-47   
ref|XP_010070089.1|  PREDICTED: shaggy-related protein kinase alp...    169   8e-47   
ref|XP_009386339.1|  PREDICTED: shaggy-related protein kinase alp...    168   8e-47   
ref|XP_010070081.1|  PREDICTED: shaggy-related protein kinase alp...    168   9e-47   
gb|KHN26183.1|  Glycogen synthase kinase-3 like MsK-1                   167   1e-46   
tpg|DAA53950.1|  TPA: putative glycogen synthase kinase family pr...    167   1e-46   
ref|XP_004968576.1|  PREDICTED: shaggy-related protein kinase iot...    168   1e-46   
ref|XP_006375323.1|  hypothetical protein POPTR_0014s07120g             167   2e-46   
gb|KDO86033.1|  hypothetical protein CISIN_1g011138mg                   166   2e-46   
ref|XP_004164819.1|  PREDICTED: shaggy-related protein kinase eps...    167   2e-46   
gb|KDP28311.1|  hypothetical protein JCGZ_14082                         167   2e-46   
ref|XP_004141099.1|  PREDICTED: shaggy-related protein kinase eps...    167   2e-46   
gb|KGN59685.1|  hypothetical protein Csa_3G838640                       167   2e-46   
gb|AFW79696.1|  putative glycogen synthase kinase family protein        167   2e-46   
emb|CDM82575.1|  unnamed protein product                                167   2e-46   
gb|ADE76936.1|  unknown                                                 167   2e-46   
dbj|BAF36565.1|  Shaggy-like kinase                                     167   2e-46   
ref|XP_002455378.1|  hypothetical protein SORBIDRAFT_03g009580          167   3e-46   
ref|NP_001150105.1|  LOC100283734                                       167   3e-46   
ref|NP_001148880.1|  glycogen synthase kinase-3 MsK-3                   167   3e-46   
tpg|DAA53951.1|  TPA: putative glycogen synthase kinase family pr...    167   3e-46   
ref|XP_004967857.1|  PREDICTED: shaggy-related protein kinase alp...    167   3e-46   
gb|KCW78018.1|  hypothetical protein EUGRSUZ_D02249                     167   3e-46   
ref|XP_008385705.1|  PREDICTED: shaggy-related protein kinase the...    168   3e-46   
ref|XP_007140965.1|  hypothetical protein PHAVU_008G156000g             166   4e-46   
gb|EPS68300.1|  hypothetical protein M569_06467                         167   4e-46   
ref|XP_009415683.1|  PREDICTED: uncharacterized protein LOC103996486    172   4e-46   



>gb|KDO63405.1| hypothetical protein CISIN_1g014750mg [Citrus sinensis]
Length=340

 Score =   206 bits (523),  Expect = 8e-62, Method: Compositional matrix adjust.
 Identities = 95/105 (90%), Positives = 104/105 (99%), Gaps = 0/105 (0%)
 Frame = +1

Query  199  PEMETDKEMSAAVVEGNEAVTGHIISTTIGGKNGEPKRTITYMAERVVGTGSFGIVFQAK  378
            P+M++DKEMSAAV++GN+AVTGHIISTTIGGKNGEPK+TI+YMAERVVGTGSFGIVFQAK
Sbjct  38   PDMDSDKEMSAAVIQGNDAVTGHIISTTIGGKNGEPKQTISYMAERVVGTGSFGIVFQAK  97

Query  379  CLKTGETVAIKKVLQDRRYKNRELXLMRLMDHPNVISLKHCFFST  513
            CL+TGETVAIKKVLQDRRYKNREL LMRLMDHPNVISLKHCFFST
Sbjct  98   CLETGETVAIKKVLQDRRYKNRELQLMRLMDHPNVISLKHCFFST  142



>gb|AGJ98225.1| BIN2-like protein PSK8 [Petunia x hybrida]
Length=420

 Score =   208 bits (529),  Expect = 9e-62, Method: Compositional matrix adjust.
 Identities = 98/105 (93%), Positives = 103/105 (98%), Gaps = 0/105 (0%)
 Frame = +1

Query  199  PEMETDKEMSAAVVEGNEAVTGHIISTTIGGKNGEPKRTITYMAERVVGTGSFGIVFQAK  378
            PEME+DKEMSAAVVEGN+AVTGHIISTTIGGKNGEPKRTI+YMAERVVGTGSFGIVFQAK
Sbjct  39   PEMESDKEMSAAVVEGNDAVTGHIISTTIGGKNGEPKRTISYMAERVVGTGSFGIVFQAK  98

Query  379  CLKTGETVAIKKVLQDRRYKNRELXLMRLMDHPNVISLKHCFFST  513
            CL+TGETVAIKKVLQD+RYKNREL LMRLMDHPNVI LKHCFFST
Sbjct  99   CLETGETVAIKKVLQDKRYKNRELQLMRLMDHPNVICLKHCFFST  143



>dbj|BAJ33892.1| unnamed protein product [Thellungiella halophila]
Length=322

 Score =   204 bits (519),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 95/105 (90%), Positives = 103/105 (98%), Gaps = 0/105 (0%)
 Frame = +1

Query  199  PEMETDKEMSAAVVEGNEAVTGHIISTTIGGKNGEPKRTITYMAERVVGTGSFGIVFQAK  378
            PE+++DKEMSAAV EGN+AVTGHIISTTIGGKNGEPK+TI+YMAERVVGTGSFGIVFQAK
Sbjct  32   PELDSDKEMSAAVTEGNDAVTGHIISTTIGGKNGEPKQTISYMAERVVGTGSFGIVFQAK  91

Query  379  CLKTGETVAIKKVLQDRRYKNRELXLMRLMDHPNVISLKHCFFST  513
            CL+TGE+VAIKKVLQDRRYKNREL LMRLMDHPNVISLKHCFFST
Sbjct  92   CLETGESVAIKKVLQDRRYKNRELQLMRLMDHPNVISLKHCFFST  136



>gb|KDO63403.1| hypothetical protein CISIN_1g014750mg [Citrus sinensis]
Length=375

 Score =   205 bits (522),  Expect = 4e-61, Method: Compositional matrix adjust.
 Identities = 95/105 (90%), Positives = 104/105 (99%), Gaps = 0/105 (0%)
 Frame = +1

Query  199  PEMETDKEMSAAVVEGNEAVTGHIISTTIGGKNGEPKRTITYMAERVVGTGSFGIVFQAK  378
            P+M++DKEMSAAV++GN+AVTGHIISTTIGGKNGEPK+TI+YMAERVVGTGSFGIVFQAK
Sbjct  38   PDMDSDKEMSAAVIQGNDAVTGHIISTTIGGKNGEPKQTISYMAERVVGTGSFGIVFQAK  97

Query  379  CLKTGETVAIKKVLQDRRYKNRELXLMRLMDHPNVISLKHCFFST  513
            CL+TGETVAIKKVLQDRRYKNREL LMRLMDHPNVISLKHCFFST
Sbjct  98   CLETGETVAIKKVLQDRRYKNRELQLMRLMDHPNVISLKHCFFST  142



>ref|XP_002881146.1| hypothetical protein ARALYDRAFT_902112 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH57405.1| hypothetical protein ARALYDRAFT_902112 [Arabidopsis lyrata subsp. 
lyrata]
Length=412

 Score =   205 bits (522),  Expect = 7e-61, Method: Compositional matrix adjust.
 Identities = 95/105 (90%), Positives = 104/105 (99%), Gaps = 0/105 (0%)
 Frame = +1

Query  199  PEMETDKEMSAAVVEGNEAVTGHIISTTIGGKNGEPKRTITYMAERVVGTGSFGIVFQAK  378
            P+M+TDKEMSAAV+EGN+AVTGHIISTTIGGKNGEPK+TI+YMAERVVGTGSFGIVFQAK
Sbjct  31   PDMDTDKEMSAAVIEGNDAVTGHIISTTIGGKNGEPKQTISYMAERVVGTGSFGIVFQAK  90

Query  379  CLKTGETVAIKKVLQDRRYKNRELXLMRLMDHPNVISLKHCFFST  513
            CL+TGE+VAIKKVLQDRRYKNREL LMRLMDHPNV+SLKHCFFST
Sbjct  91   CLETGESVAIKKVLQDRRYKNRELQLMRLMDHPNVVSLKHCFFST  135



>gb|KDO63404.1| hypothetical protein CISIN_1g014750mg [Citrus sinensis]
Length=395

 Score =   204 bits (520),  Expect = 8e-61, Method: Compositional matrix adjust.
 Identities = 95/105 (90%), Positives = 104/105 (99%), Gaps = 0/105 (0%)
 Frame = +1

Query  199  PEMETDKEMSAAVVEGNEAVTGHIISTTIGGKNGEPKRTITYMAERVVGTGSFGIVFQAK  378
            P+M++DKEMSAAV++GN+AVTGHIISTTIGGKNGEPK+TI+YMAERVVGTGSFGIVFQAK
Sbjct  38   PDMDSDKEMSAAVIQGNDAVTGHIISTTIGGKNGEPKQTISYMAERVVGTGSFGIVFQAK  97

Query  379  CLKTGETVAIKKVLQDRRYKNRELXLMRLMDHPNVISLKHCFFST  513
            CL+TGETVAIKKVLQDRRYKNREL LMRLMDHPNVISLKHCFFST
Sbjct  98   CLETGETVAIKKVLQDRRYKNRELQLMRLMDHPNVISLKHCFFST  142



>ref|XP_008365741.1| PREDICTED: shaggy-related protein kinase eta isoform X2 [Malus 
domestica]
Length=416

 Score =   205 bits (521),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 95/105 (90%), Positives = 103/105 (98%), Gaps = 0/105 (0%)
 Frame = +1

Query  199  PEMETDKEMSAAVVEGNEAVTGHIISTTIGGKNGEPKRTITYMAERVVGTGSFGIVFQAK  378
            P+M++DKEMSA VVEGN+AVTGHIISTTIGGKNGEPKRTI+YMAERVVGTGSFGIVFQAK
Sbjct  35   PQMDSDKEMSAPVVEGNDAVTGHIISTTIGGKNGEPKRTISYMAERVVGTGSFGIVFQAK  94

Query  379  CLKTGETVAIKKVLQDRRYKNRELXLMRLMDHPNVISLKHCFFST  513
            C++TGETVAIKKVLQDRRYKNREL LMRLMDHPNV+SLKHCFFST
Sbjct  95   CIETGETVAIKKVLQDRRYKNRELQLMRLMDHPNVVSLKHCFFST  139



>ref|XP_006468992.1| PREDICTED: shaggy-related protein kinase zeta-like [Citrus sinensis]
Length=419

 Score =   205 bits (521),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 95/105 (90%), Positives = 104/105 (99%), Gaps = 0/105 (0%)
 Frame = +1

Query  199  PEMETDKEMSAAVVEGNEAVTGHIISTTIGGKNGEPKRTITYMAERVVGTGSFGIVFQAK  378
            P+M++DKEMSAAV++GN+AVTGHIISTTIGGKNGEPK+TI+YMAERVVGTGSFGIVFQAK
Sbjct  38   PDMDSDKEMSAAVIQGNDAVTGHIISTTIGGKNGEPKQTISYMAERVVGTGSFGIVFQAK  97

Query  379  CLKTGETVAIKKVLQDRRYKNRELXLMRLMDHPNVISLKHCFFST  513
            CL+TGETVAIKKVLQDRRYKNREL LMRLMDHPNVISLKHCFFST
Sbjct  98   CLETGETVAIKKVLQDRRYKNRELQLMRLMDHPNVISLKHCFFST  142



>ref|XP_006446814.1| hypothetical protein CICLE_v10015375mg [Citrus clementina]
 gb|ESR60054.1| hypothetical protein CICLE_v10015375mg [Citrus clementina]
Length=419

 Score =   205 bits (521),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 95/105 (90%), Positives = 104/105 (99%), Gaps = 0/105 (0%)
 Frame = +1

Query  199  PEMETDKEMSAAVVEGNEAVTGHIISTTIGGKNGEPKRTITYMAERVVGTGSFGIVFQAK  378
            P+M++DKEMSAAV++GN+AVTGHIISTTIGGKNGEPK+TI+YMAERVVGTGSFGIVFQAK
Sbjct  38   PDMDSDKEMSAAVIQGNDAVTGHIISTTIGGKNGEPKQTISYMAERVVGTGSFGIVFQAK  97

Query  379  CLKTGETVAIKKVLQDRRYKNRELXLMRLMDHPNVISLKHCFFST  513
            CL+TGETVAIKKVLQDRRYKNREL LMRLMDHPNVISLKHCFFST
Sbjct  98   CLETGETVAIKKVLQDRRYKNRELQLMRLMDHPNVISLKHCFFST  142



>gb|KDO63402.1| hypothetical protein CISIN_1g014750mg [Citrus sinensis]
Length=419

 Score =   205 bits (521),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 95/105 (90%), Positives = 104/105 (99%), Gaps = 0/105 (0%)
 Frame = +1

Query  199  PEMETDKEMSAAVVEGNEAVTGHIISTTIGGKNGEPKRTITYMAERVVGTGSFGIVFQAK  378
            P+M++DKEMSAAV++GN+AVTGHIISTTIGGKNGEPK+TI+YMAERVVGTGSFGIVFQAK
Sbjct  38   PDMDSDKEMSAAVIQGNDAVTGHIISTTIGGKNGEPKQTISYMAERVVGTGSFGIVFQAK  97

Query  379  CLKTGETVAIKKVLQDRRYKNRELXLMRLMDHPNVISLKHCFFST  513
            CL+TGETVAIKKVLQDRRYKNREL LMRLMDHPNVISLKHCFFST
Sbjct  98   CLETGETVAIKKVLQDRRYKNRELQLMRLMDHPNVISLKHCFFST  142



>ref|XP_007215447.1| hypothetical protein PRUPE_ppa006349mg [Prunus persica]
 gb|EMJ16646.1| hypothetical protein PRUPE_ppa006349mg [Prunus persica]
Length=416

 Score =   204 bits (520),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 94/105 (90%), Positives = 103/105 (98%), Gaps = 0/105 (0%)
 Frame = +1

Query  199  PEMETDKEMSAAVVEGNEAVTGHIISTTIGGKNGEPKRTITYMAERVVGTGSFGIVFQAK  378
            P+M++DKEMSA V+EGN+AVTGHIISTTIGGKNGEPKRTI+YMAERVVGTGSFGIVFQAK
Sbjct  35   PDMDSDKEMSAPVIEGNDAVTGHIISTTIGGKNGEPKRTISYMAERVVGTGSFGIVFQAK  94

Query  379  CLKTGETVAIKKVLQDRRYKNRELXLMRLMDHPNVISLKHCFFST  513
            C++TGETVAIKKVLQDRRYKNREL LMRLMDHPNV+SLKHCFFST
Sbjct  95   CIETGETVAIKKVLQDRRYKNRELQLMRLMDHPNVVSLKHCFFST  139



>ref|XP_008228934.1| PREDICTED: shaggy-related protein kinase eta isoform X1 [Prunus 
mume]
Length=416

 Score =   204 bits (520),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 94/105 (90%), Positives = 103/105 (98%), Gaps = 0/105 (0%)
 Frame = +1

Query  199  PEMETDKEMSAAVVEGNEAVTGHIISTTIGGKNGEPKRTITYMAERVVGTGSFGIVFQAK  378
            P+M++DKEMSA V+EGN+AVTGHIISTTIGGKNGEPKRTI+YMAERVVGTGSFGIVFQAK
Sbjct  35   PDMDSDKEMSAPVIEGNDAVTGHIISTTIGGKNGEPKRTISYMAERVVGTGSFGIVFQAK  94

Query  379  CLKTGETVAIKKVLQDRRYKNRELXLMRLMDHPNVISLKHCFFST  513
            C++TGETVAIKKVLQDRRYKNREL LMRLMDHPNV+SLKHCFFST
Sbjct  95   CIETGETVAIKKVLQDRRYKNRELQLMRLMDHPNVVSLKHCFFST  139



>gb|KFK42959.1| hypothetical protein AALP_AA1G061200 [Arabis alpina]
Length=409

 Score =   204 bits (518),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 95/104 (91%), Positives = 103/104 (99%), Gaps = 0/104 (0%)
 Frame = +1

Query  202  EMETDKEMSAAVVEGNEAVTGHIISTTIGGKNGEPKRTITYMAERVVGTGSFGIVFQAKC  381
            EM++DKEMSAAV+EGN+AVTGHIISTTIGGKNGEPK+TI+YMAERVVGTGSFGIVFQAKC
Sbjct  32   EMDSDKEMSAAVIEGNDAVTGHIISTTIGGKNGEPKQTISYMAERVVGTGSFGIVFQAKC  91

Query  382  LKTGETVAIKKVLQDRRYKNRELXLMRLMDHPNVISLKHCFFST  513
            L+TGE+VAIKKVLQDRRYKNREL LMRLMDHPNVISLKHCFFST
Sbjct  92   LETGESVAIKKVLQDRRYKNRELQLMRLMDHPNVISLKHCFFST  135



>ref|XP_006294432.1| hypothetical protein CARUB_v10023447mg [Capsella rubella]
 gb|EOA27330.1| hypothetical protein CARUB_v10023447mg [Capsella rubella]
Length=376

 Score =   203 bits (516),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 93/105 (89%), Positives = 104/105 (99%), Gaps = 0/105 (0%)
 Frame = +1

Query  199  PEMETDKEMSAAVVEGNEAVTGHIISTTIGGKNGEPKRTITYMAERVVGTGSFGIVFQAK  378
            P+++TDK+MSAAV+EGN+AVTGHIISTTIGGKNGEPK+TI+YMAERVVGTGSFGIVFQAK
Sbjct  31   PDIDTDKDMSAAVIEGNDAVTGHIISTTIGGKNGEPKQTISYMAERVVGTGSFGIVFQAK  90

Query  379  CLKTGETVAIKKVLQDRRYKNRELXLMRLMDHPNVISLKHCFFST  513
            CL+TGE+VAIKKVLQDRRYKNREL LMRLMDHPNV+SLKHCFFST
Sbjct  91   CLETGESVAIKKVLQDRRYKNRELQLMRLMDHPNVVSLKHCFFST  135



>ref|XP_006417928.1| hypothetical protein EUTSA_v10007772mg [Eutrema salsugineum]
 gb|ESQ36281.1| hypothetical protein EUTSA_v10007772mg [Eutrema salsugineum]
Length=410

 Score =   204 bits (518),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 95/105 (90%), Positives = 103/105 (98%), Gaps = 0/105 (0%)
 Frame = +1

Query  199  PEMETDKEMSAAVVEGNEAVTGHIISTTIGGKNGEPKRTITYMAERVVGTGSFGIVFQAK  378
            PE+++DKEMSAAV EGN+AVTGHIISTTIGGKNGEPK+TI+YMAERVVGTGSFGIVFQAK
Sbjct  32   PELDSDKEMSAAVTEGNDAVTGHIISTTIGGKNGEPKQTISYMAERVVGTGSFGIVFQAK  91

Query  379  CLKTGETVAIKKVLQDRRYKNRELXLMRLMDHPNVISLKHCFFST  513
            CL+TGE+VAIKKVLQDRRYKNREL LMRLMDHPNVISLKHCFFST
Sbjct  92   CLETGESVAIKKVLQDRRYKNRELQLMRLMDHPNVISLKHCFFST  136



>ref|XP_009365288.1| PREDICTED: shaggy-related protein kinase eta-like isoform X1 
[Pyrus x bretschneideri]
Length=416

 Score =   204 bits (518),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 95/105 (90%), Positives = 102/105 (97%), Gaps = 0/105 (0%)
 Frame = +1

Query  199  PEMETDKEMSAAVVEGNEAVTGHIISTTIGGKNGEPKRTITYMAERVVGTGSFGIVFQAK  378
            P+M++DKEMSA VVEGN AVTGHIISTTIGGKNGEPKRTI+YMAERVVGTGSFGIVFQAK
Sbjct  35   PQMDSDKEMSAPVVEGNAAVTGHIISTTIGGKNGEPKRTISYMAERVVGTGSFGIVFQAK  94

Query  379  CLKTGETVAIKKVLQDRRYKNRELXLMRLMDHPNVISLKHCFFST  513
            C++TGETVAIKKVLQDRRYKNREL LMRLMDHPNV+SLKHCFFST
Sbjct  95   CIETGETVAIKKVLQDRRYKNRELQLMRLMDHPNVVSLKHCFFST  139



>ref|XP_004243275.1| PREDICTED: shaggy-related protein kinase eta-like [Solanum lycopersicum]
Length=437

 Score =   204 bits (519),  Expect = 4e-60, Method: Compositional matrix adjust.
 Identities = 97/105 (92%), Positives = 103/105 (98%), Gaps = 0/105 (0%)
 Frame = +1

Query  199  PEMETDKEMSAAVVEGNEAVTGHIISTTIGGKNGEPKRTITYMAERVVGTGSFGIVFQAK  378
            PEME++KEMSAAVVEGN AVTGHIISTTIGGKNGEPKRTI+YMAERVVGTGSFGIVFQAK
Sbjct  56   PEMESEKEMSAAVVEGNGAVTGHIISTTIGGKNGEPKRTISYMAERVVGTGSFGIVFQAK  115

Query  379  CLKTGETVAIKKVLQDRRYKNRELXLMRLMDHPNVISLKHCFFST  513
            CL+TGETVAIKKVLQD+RYKNREL LMRLMDHPNVI+LKHCFFST
Sbjct  116  CLETGETVAIKKVLQDKRYKNRELQLMRLMDHPNVITLKHCFFST  160



>ref|XP_006348884.1| PREDICTED: shaggy-related protein kinase zeta-like [Solanum tuberosum]
Length=434

 Score =   204 bits (519),  Expect = 4e-60, Method: Compositional matrix adjust.
 Identities = 97/105 (92%), Positives = 103/105 (98%), Gaps = 0/105 (0%)
 Frame = +1

Query  199  PEMETDKEMSAAVVEGNEAVTGHIISTTIGGKNGEPKRTITYMAERVVGTGSFGIVFQAK  378
            PEME++KEMSAAVVEGN AVTGHIISTTIGGKNGEPKRTI+YMAERVVGTGSFGIVFQAK
Sbjct  53   PEMESEKEMSAAVVEGNGAVTGHIISTTIGGKNGEPKRTISYMAERVVGTGSFGIVFQAK  112

Query  379  CLKTGETVAIKKVLQDRRYKNRELXLMRLMDHPNVISLKHCFFST  513
            CL+TGETVAIKKVLQD+RYKNREL LMRLMDHPNVI+LKHCFFST
Sbjct  113  CLETGETVAIKKVLQDKRYKNRELQLMRLMDHPNVITLKHCFFST  157



>ref|XP_008343093.1| PREDICTED: shaggy-related protein kinase eta isoform X1 [Malus 
domestica]
Length=416

 Score =   203 bits (517),  Expect = 4e-60, Method: Compositional matrix adjust.
 Identities = 94/105 (90%), Positives = 103/105 (98%), Gaps = 0/105 (0%)
 Frame = +1

Query  199  PEMETDKEMSAAVVEGNEAVTGHIISTTIGGKNGEPKRTITYMAERVVGTGSFGIVFQAK  378
            P+M++DKEMSA V+EGN+AVTGHIISTTIGGKNGEPKRTI+YMAERVVGTGSFGIVFQAK
Sbjct  35   PQMDSDKEMSAPVMEGNDAVTGHIISTTIGGKNGEPKRTISYMAERVVGTGSFGIVFQAK  94

Query  379  CLKTGETVAIKKVLQDRRYKNRELXLMRLMDHPNVISLKHCFFST  513
            C++TGETVAIKKVLQDRRYKNREL LMRLMDHPNV+SLKHCFFST
Sbjct  95   CIETGETVAIKKVLQDRRYKNRELQLMRLMDHPNVVSLKHCFFST  139



>ref|XP_002889601.1| hypothetical protein ARALYDRAFT_470656 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH65860.1| hypothetical protein ARALYDRAFT_470656 [Arabidopsis lyrata subsp. 
lyrata]
Length=410

 Score =   203 bits (516),  Expect = 5e-60, Method: Compositional matrix adjust.
 Identities = 95/105 (90%), Positives = 103/105 (98%), Gaps = 0/105 (0%)
 Frame = +1

Query  199  PEMETDKEMSAAVVEGNEAVTGHIISTTIGGKNGEPKRTITYMAERVVGTGSFGIVFQAK  378
            PEM++DKEMSAAV+EGN+AVTGHIISTTIGGKNGEPK+TI+YMAERVVGTGSFGIVFQAK
Sbjct  32   PEMDSDKEMSAAVIEGNDAVTGHIISTTIGGKNGEPKQTISYMAERVVGTGSFGIVFQAK  91

Query  379  CLKTGETVAIKKVLQDRRYKNRELXLMRLMDHPNVISLKHCFFST  513
            CL+TGE+VAIKKVLQDRRYKNREL LMR MDHPNVISLKHCFFST
Sbjct  92   CLETGESVAIKKVLQDRRYKNRELQLMRPMDHPNVISLKHCFFST  136



>gb|EYU30769.1| hypothetical protein MIMGU_mgv1a006689mg [Erythranthe guttata]
Length=349

 Score =   201 bits (512),  Expect = 5e-60, Method: Compositional matrix adjust.
 Identities = 94/104 (90%), Positives = 101/104 (97%), Gaps = 0/104 (0%)
 Frame = +1

Query  202  EMETDKEMSAAVVEGNEAVTGHIISTTIGGKNGEPKRTITYMAERVVGTGSFGIVFQAKC  381
             M+TDKEM+A+VVEGN+ +TGHIISTTIGGKNGEPKRTI+YMAERVVGTGSFGIVFQAKC
Sbjct  52   SMDTDKEMAASVVEGNDPLTGHIISTTIGGKNGEPKRTISYMAERVVGTGSFGIVFQAKC  111

Query  382  LKTGETVAIKKVLQDRRYKNRELXLMRLMDHPNVISLKHCFFST  513
            L+TGETVAIKKVLQDRRYKNREL LMRLMDHPNVISLKHCFFST
Sbjct  112  LETGETVAIKKVLQDRRYKNRELQLMRLMDHPNVISLKHCFFST  155



>dbj|BAH19519.1| AT1G06390 [Arabidopsis thaliana]
Length=407

 Score =   202 bits (515),  Expect = 8e-60, Method: Compositional matrix adjust.
 Identities = 94/105 (90%), Positives = 103/105 (98%), Gaps = 0/105 (0%)
 Frame = +1

Query  199  PEMETDKEMSAAVVEGNEAVTGHIISTTIGGKNGEPKRTITYMAERVVGTGSFGIVFQAK  378
            PE+++DKEMSAAV+EGN+AVTGHIISTTIGGKNGEPK+TI+YMAERVVGTGSFGIVFQAK
Sbjct  29   PELDSDKEMSAAVIEGNDAVTGHIISTTIGGKNGEPKQTISYMAERVVGTGSFGIVFQAK  88

Query  379  CLKTGETVAIKKVLQDRRYKNRELXLMRLMDHPNVISLKHCFFST  513
            CL+TGE+VAIKKVLQDRRYKNREL LMR MDHPNVISLKHCFFST
Sbjct  89   CLETGESVAIKKVLQDRRYKNRELQLMRPMDHPNVISLKHCFFST  133



>ref|NP_172127.1| shaggy-related protein kinase iota [Arabidopsis thaliana]
 ref|NP_973771.1| shaggy-related protein kinase iota [Arabidopsis thaliana]
 sp|Q39012.1|KSG9_ARATH RecName: Full=Shaggy-related protein kinase iota; AltName: Full=ASK-iota 
[Arabidopsis thaliana]
 gb|AAF82167.1|AC068143_9 Contains a very strong similarity to a shaggy-like kinase iota 
from Arabidopsis thaliana gb|X99696 and contains an eukaryotic 
protein kinase PF|00069 domain. EST gb|N37432 comes from 
this gene [Arabidopsis thaliana]
 emb|CAA68027.1| shaggy-like protein kinase iota [Arabidopsis thaliana]
 gb|AAB71545.1| GSK3/shaggy-like protein kinase [Arabidopsis thaliana]
 gb|AAK59553.1| putative shaggy kinase [Arabidopsis thaliana]
 gb|AAK93730.1| putative shaggy kinase [Arabidopsis thaliana]
 gb|AEE27980.1| shaggy-related protein kinase iota [Arabidopsis thaliana]
 gb|AEE27981.1| shaggy-related protein kinase iota [Arabidopsis thaliana]
Length=407

 Score =   202 bits (514),  Expect = 9e-60, Method: Compositional matrix adjust.
 Identities = 94/105 (90%), Positives = 103/105 (98%), Gaps = 0/105 (0%)
 Frame = +1

Query  199  PEMETDKEMSAAVVEGNEAVTGHIISTTIGGKNGEPKRTITYMAERVVGTGSFGIVFQAK  378
            PE+++DKEMSAAV+EGN+AVTGHIISTTIGGKNGEPK+TI+YMAERVVGTGSFGIVFQAK
Sbjct  29   PELDSDKEMSAAVIEGNDAVTGHIISTTIGGKNGEPKQTISYMAERVVGTGSFGIVFQAK  88

Query  379  CLKTGETVAIKKVLQDRRYKNRELXLMRLMDHPNVISLKHCFFST  513
            CL+TGE+VAIKKVLQDRRYKNREL LMR MDHPNVISLKHCFFST
Sbjct  89   CLETGESVAIKKVLQDRRYKNRELQLMRPMDHPNVISLKHCFFST  133



>ref|XP_010522087.1| PREDICTED: shaggy-related protein kinase iota [Tarenaya hassleriana]
Length=411

 Score =   202 bits (513),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 93/104 (89%), Positives = 103/104 (99%), Gaps = 0/104 (0%)
 Frame = +1

Query  202  EMETDKEMSAAVVEGNEAVTGHIISTTIGGKNGEPKRTITYMAERVVGTGSFGIVFQAKC  381
            +M++DKEMS+AV+EGN+AVTGHIISTTIGGKNGEPKRTI+YMAERVVGTGSFGIVFQAKC
Sbjct  30   DMDSDKEMSSAVIEGNDAVTGHIISTTIGGKNGEPKRTISYMAERVVGTGSFGIVFQAKC  89

Query  382  LKTGETVAIKKVLQDRRYKNRELXLMRLMDHPNVISLKHCFFST  513
            L+TGE+VAIKKVLQDRRYKNREL LMRLMDHPNV+SLKHCFFST
Sbjct  90   LETGESVAIKKVLQDRRYKNRELQLMRLMDHPNVVSLKHCFFST  133



>ref|XP_006307671.1| hypothetical protein CARUB_v10009298mg [Capsella rubella]
 gb|EOA40569.1| hypothetical protein CARUB_v10009298mg [Capsella rubella]
Length=412

 Score =   202 bits (513),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 94/105 (90%), Positives = 103/105 (98%), Gaps = 0/105 (0%)
 Frame = +1

Query  199  PEMETDKEMSAAVVEGNEAVTGHIISTTIGGKNGEPKRTITYMAERVVGTGSFGIVFQAK  378
            P+M++DKEM+ AVVEGN+AVTGHIISTTIGGKNGEPK+TI+YMAERVVGTGSFGIVFQAK
Sbjct  31   PDMDSDKEMTPAVVEGNDAVTGHIISTTIGGKNGEPKQTISYMAERVVGTGSFGIVFQAK  90

Query  379  CLKTGETVAIKKVLQDRRYKNRELXLMRLMDHPNVISLKHCFFST  513
            CL+TGE+VAIKKVLQDRRYKNREL LMRLMDHPNVISLKHCFFST
Sbjct  91   CLETGESVAIKKVLQDRRYKNRELQLMRLMDHPNVISLKHCFFST  135



>emb|CAA64408.1| shaggy-like kinase dzeta [Arabidopsis thaliana]
 emb|CAA70483.1| serine/threonine kinase [Arabidopsis thaliana]
Length=412

 Score =   202 bits (513),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 93/105 (89%), Positives = 103/105 (98%), Gaps = 0/105 (0%)
 Frame = +1

Query  199  PEMETDKEMSAAVVEGNEAVTGHIISTTIGGKNGEPKRTITYMAERVVGTGSFGIVFQAK  378
            P+++ DKEMSAAV+EGN+AVTGHIISTTIGGKNGEPK+TI+YMAERVVGTGSFGIVFQAK
Sbjct  31   PDIDNDKEMSAAVIEGNDAVTGHIISTTIGGKNGEPKQTISYMAERVVGTGSFGIVFQAK  90

Query  379  CLKTGETVAIKKVLQDRRYKNRELXLMRLMDHPNVISLKHCFFST  513
            CL+TGE+VAIKKVLQDRRYKNREL LMRLMDHPNV+SLKHCFFST
Sbjct  91   CLETGESVAIKKVLQDRRYKNRELQLMRLMDHPNVVSLKHCFFST  135



>ref|XP_009593779.1| PREDICTED: shaggy-related protein kinase eta isoform X1 [Nicotiana 
tomentosiformis]
Length=430

 Score =   202 bits (514),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 96/105 (91%), Positives = 101/105 (96%), Gaps = 0/105 (0%)
 Frame = +1

Query  199  PEMETDKEMSAAVVEGNEAVTGHIISTTIGGKNGEPKRTITYMAERVVGTGSFGIVFQAK  378
            PE ++DKEMSAA VEGN AVTGHIISTTIGGKNGEPKRTI+YMAERVVGTGSFGIVFQAK
Sbjct  49   PETDSDKEMSAAAVEGNGAVTGHIISTTIGGKNGEPKRTISYMAERVVGTGSFGIVFQAK  108

Query  379  CLKTGETVAIKKVLQDRRYKNRELXLMRLMDHPNVISLKHCFFST  513
            CL+TGETVAIKKVLQD+RYKNREL LMRLMDHPNVISLKHCFFST
Sbjct  109  CLETGETVAIKKVLQDKRYKNRELQLMRLMDHPNVISLKHCFFST  153



>ref|XP_010104417.1| Shaggy-related protein kinase zeta [Morus notabilis]
 gb|EXC00262.1| Shaggy-related protein kinase zeta [Morus notabilis]
Length=436

 Score =   202 bits (515),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 94/104 (90%), Positives = 101/104 (97%), Gaps = 0/104 (0%)
 Frame = +1

Query  202  EMETDKEMSAAVVEGNEAVTGHIISTTIGGKNGEPKRTITYMAERVVGTGSFGIVFQAKC  381
            +METDK+MSA V+EGN+ VTGHIISTTIGGKNGEPKRTI+YMAERVVGTGSFGIVFQAKC
Sbjct  35   DMETDKDMSATVIEGNDQVTGHIISTTIGGKNGEPKRTISYMAERVVGTGSFGIVFQAKC  94

Query  382  LKTGETVAIKKVLQDRRYKNRELXLMRLMDHPNVISLKHCFFST  513
            L+TGETVAIKKVLQDRRYKNREL LMRLMDHPNV+SLKHCFFST
Sbjct  95   LETGETVAIKKVLQDRRYKNRELQLMRLMDHPNVVSLKHCFFST  138



>ref|NP_180655.1| Shaggy-related protein kinase zeta [Arabidopsis thaliana]
 sp|Q39010.2|KSG6_ARATH RecName: Full=Shaggy-related protein kinase zeta; AltName: Full=ASK-zeta 
[Arabidopsis thaliana]
 gb|AAC20732.1| putative shaggy-like protein kinase dzeta [Arabidopsis thaliana]
 gb|AAL36376.1| putative shaggy protein kinase dzeta [Arabidopsis thaliana]
 gb|AAM19796.1| At2g30980/F7F1.19 [Arabidopsis thaliana]
 gb|AAM20332.1| putative shaggy protein kinase dzeta [Arabidopsis thaliana]
 gb|AEC08470.1| Shaggy-related protein kinase zeta [Arabidopsis thaliana]
Length=412

 Score =   202 bits (513),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 93/105 (89%), Positives = 103/105 (98%), Gaps = 0/105 (0%)
 Frame = +1

Query  199  PEMETDKEMSAAVVEGNEAVTGHIISTTIGGKNGEPKRTITYMAERVVGTGSFGIVFQAK  378
            P+++ DKEMSAAV+EGN+AVTGHIISTTIGGKNGEPK+TI+YMAERVVGTGSFGIVFQAK
Sbjct  31   PDIDNDKEMSAAVIEGNDAVTGHIISTTIGGKNGEPKQTISYMAERVVGTGSFGIVFQAK  90

Query  379  CLKTGETVAIKKVLQDRRYKNRELXLMRLMDHPNVISLKHCFFST  513
            CL+TGE+VAIKKVLQDRRYKNREL LMRLMDHPNV+SLKHCFFST
Sbjct  91   CLETGESVAIKKVLQDRRYKNRELQLMRLMDHPNVVSLKHCFFST  135



>gb|AAM65084.1| putative shaggy-like protein kinase dzeta [Arabidopsis thaliana]
Length=412

 Score =   202 bits (513),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 93/105 (89%), Positives = 103/105 (98%), Gaps = 0/105 (0%)
 Frame = +1

Query  199  PEMETDKEMSAAVVEGNEAVTGHIISTTIGGKNGEPKRTITYMAERVVGTGSFGIVFQAK  378
            P+++ DKEMSAAV+EGN+AVTGHIISTTIGGKNGEPK+TI+YMAERVVGTGSFGIVFQAK
Sbjct  31   PDIDNDKEMSAAVIEGNDAVTGHIISTTIGGKNGEPKQTISYMAERVVGTGSFGIVFQAK  90

Query  379  CLKTGETVAIKKVLQDRRYKNRELXLMRLMDHPNVISLKHCFFST  513
            CL+TGE+VAIKKVLQDRRYKNREL LMRLMDHPNV+SLKHCFFST
Sbjct  91   CLETGESVAIKKVLQDRRYKNRELQLMRLMDHPNVVSLKHCFFST  135



>ref|XP_009801781.1| PREDICTED: shaggy-related protein kinase eta-like [Nicotiana 
sylvestris]
Length=424

 Score =   202 bits (513),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 96/105 (91%), Positives = 101/105 (96%), Gaps = 0/105 (0%)
 Frame = +1

Query  199  PEMETDKEMSAAVVEGNEAVTGHIISTTIGGKNGEPKRTITYMAERVVGTGSFGIVFQAK  378
            PE ++DKEMSAAVVEGN AVTGHIISTTIGGKNGEPKRTI+YMAERVVGTGSFGIVFQAK
Sbjct  43   PETDSDKEMSAAVVEGNGAVTGHIISTTIGGKNGEPKRTISYMAERVVGTGSFGIVFQAK  102

Query  379  CLKTGETVAIKKVLQDRRYKNRELXLMRLMDHPNVISLKHCFFST  513
            CL+TGETVAIKKVLQD+RYKNREL LMRLMDHPNVI LKHCFFST
Sbjct  103  CLETGETVAIKKVLQDKRYKNRELQLMRLMDHPNVICLKHCFFST  147



>ref|XP_004149276.1| PREDICTED: shaggy-related protein kinase zeta-like [Cucumis sativus]
 ref|XP_004162470.1| PREDICTED: shaggy-related protein kinase zeta-like [Cucumis sativus]
Length=425

 Score =   201 bits (512),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 93/103 (90%), Positives = 102/103 (99%), Gaps = 0/103 (0%)
 Frame = +1

Query  205  METDKEMSAAVVEGNEAVTGHIISTTIGGKNGEPKRTITYMAERVVGTGSFGIVFQAKCL  384
            M+TDKEMSAAV+EGN+AVTGHIISTTIGGKNGEPK+TI+YMAERVVG+GSFGIVFQAKCL
Sbjct  45   MDTDKEMSAAVIEGNDAVTGHIISTTIGGKNGEPKQTISYMAERVVGSGSFGIVFQAKCL  104

Query  385  KTGETVAIKKVLQDRRYKNRELXLMRLMDHPNVISLKHCFFST  513
            +TGETVAIKKVLQD+RYKNREL LMRLMDHPNV+SLKHCFFST
Sbjct  105  ETGETVAIKKVLQDKRYKNRELQLMRLMDHPNVVSLKHCFFST  147



>emb|CDP15948.1| unnamed protein product [Coffea canephora]
Length=434

 Score =   201 bits (512),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 96/104 (92%), Positives = 102/104 (98%), Gaps = 0/104 (0%)
 Frame = +1

Query  202  EMETDKEMSAAVVEGNEAVTGHIISTTIGGKNGEPKRTITYMAERVVGTGSFGIVFQAKC  381
            +M++DKEMSAAVVEGN AVTGHIISTTIGGKNGEPKRTI+YMAERVVGTGSFGIVFQAKC
Sbjct  53   DMDSDKEMSAAVVEGNGAVTGHIISTTIGGKNGEPKRTISYMAERVVGTGSFGIVFQAKC  112

Query  382  LKTGETVAIKKVLQDRRYKNRELXLMRLMDHPNVISLKHCFFST  513
            L+TGETVAIKKVLQDRRYKNREL LMRLM+HPNVISLKHCFFST
Sbjct  113  LETGETVAIKKVLQDRRYKNRELQLMRLMNHPNVISLKHCFFST  156



>ref|XP_008448253.1| PREDICTED: shaggy-related protein kinase eta isoform X1 [Cucumis 
melo]
Length=425

 Score =   201 bits (512),  Expect = 4e-59, Method: Compositional matrix adjust.
 Identities = 93/103 (90%), Positives = 102/103 (99%), Gaps = 0/103 (0%)
 Frame = +1

Query  205  METDKEMSAAVVEGNEAVTGHIISTTIGGKNGEPKRTITYMAERVVGTGSFGIVFQAKCL  384
            M+TDKEMSAAV+EGN+AVTGHIISTTIGGKNGEPK+TI+YMAERVVG+GSFGIVFQAKCL
Sbjct  45   MDTDKEMSAAVIEGNDAVTGHIISTTIGGKNGEPKQTISYMAERVVGSGSFGIVFQAKCL  104

Query  385  KTGETVAIKKVLQDRRYKNRELXLMRLMDHPNVISLKHCFFST  513
            +TGETVAIKKVLQD+RYKNREL LMRLMDHPNV+SLKHCFFST
Sbjct  105  ETGETVAIKKVLQDKRYKNRELQLMRLMDHPNVVSLKHCFFST  147



>ref|XP_009378929.1| PREDICTED: shaggy-related protein kinase eta isoform X1 [Pyrus 
x bretschneideri]
Length=416

 Score =   201 bits (511),  Expect = 4e-59, Method: Compositional matrix adjust.
 Identities = 93/105 (89%), Positives = 102/105 (97%), Gaps = 0/105 (0%)
 Frame = +1

Query  199  PEMETDKEMSAAVVEGNEAVTGHIISTTIGGKNGEPKRTITYMAERVVGTGSFGIVFQAK  378
            P+M++DKEMSA V+EGN+AVTGHIISTTIGGKNGEPKRTI+YMAERVVGTGSFGIVFQAK
Sbjct  35   PQMDSDKEMSAPVMEGNDAVTGHIISTTIGGKNGEPKRTISYMAERVVGTGSFGIVFQAK  94

Query  379  CLKTGETVAIKKVLQDRRYKNRELXLMRLMDHPNVISLKHCFFST  513
            C++TGETVAIKKVLQDRRYKNREL LMRLMDHPNV+ LKHCFFST
Sbjct  95   CIETGETVAIKKVLQDRRYKNRELQLMRLMDHPNVVLLKHCFFST  139



>ref|XP_003527338.1| PREDICTED: shaggy-related protein kinase zeta-like [Glycine max]
Length=419

 Score =   201 bits (510),  Expect = 5e-59, Method: Compositional matrix adjust.
 Identities = 93/104 (89%), Positives = 101/104 (97%), Gaps = 0/104 (0%)
 Frame = +1

Query  202  EMETDKEMSAAVVEGNEAVTGHIISTTIGGKNGEPKRTITYMAERVVGTGSFGIVFQAKC  381
            +METDK+MSA V+EGN+AVTGHIISTTIGGKNGEPK+TI+YMAERVVGTGSFG+VFQAKC
Sbjct  39   DMETDKDMSATVIEGNDAVTGHIISTTIGGKNGEPKQTISYMAERVVGTGSFGVVFQAKC  98

Query  382  LKTGETVAIKKVLQDRRYKNRELXLMRLMDHPNVISLKHCFFST  513
            L+TGE VAIKKVLQDRRYKNREL LMRLMDHPNVISLKHCFFST
Sbjct  99   LETGEAVAIKKVLQDRRYKNRELQLMRLMDHPNVISLKHCFFST  142



>gb|EYU30768.1| hypothetical protein MIMGU_mgv1a006689mg [Erythranthe guttata]
Length=435

 Score =   201 bits (511),  Expect = 5e-59, Method: Compositional matrix adjust.
 Identities = 94/103 (91%), Positives = 101/103 (98%), Gaps = 0/103 (0%)
 Frame = +1

Query  205  METDKEMSAAVVEGNEAVTGHIISTTIGGKNGEPKRTITYMAERVVGTGSFGIVFQAKCL  384
            M+TDKEM+A+VVEGN+ +TGHIISTTIGGKNGEPKRTI+YMAERVVGTGSFGIVFQAKCL
Sbjct  53   MDTDKEMAASVVEGNDPLTGHIISTTIGGKNGEPKRTISYMAERVVGTGSFGIVFQAKCL  112

Query  385  KTGETVAIKKVLQDRRYKNRELXLMRLMDHPNVISLKHCFFST  513
            +TGETVAIKKVLQDRRYKNREL LMRLMDHPNVISLKHCFFST
Sbjct  113  ETGETVAIKKVLQDRRYKNRELQLMRLMDHPNVISLKHCFFST  155



>gb|KHN33940.1| Shaggy-related protein kinase zeta [Glycine soja]
Length=415

 Score =   200 bits (509),  Expect = 6e-59, Method: Compositional matrix adjust.
 Identities = 93/104 (89%), Positives = 101/104 (97%), Gaps = 0/104 (0%)
 Frame = +1

Query  202  EMETDKEMSAAVVEGNEAVTGHIISTTIGGKNGEPKRTITYMAERVVGTGSFGIVFQAKC  381
            +METDK+MSA V+EGN+AVTGHIISTTIGGKNGEPK+TI+YMAERVVGTGSFG+VFQAKC
Sbjct  35   DMETDKDMSATVIEGNDAVTGHIISTTIGGKNGEPKQTISYMAERVVGTGSFGVVFQAKC  94

Query  382  LKTGETVAIKKVLQDRRYKNRELXLMRLMDHPNVISLKHCFFST  513
            L+TGE VAIKKVLQDRRYKNREL LMRLMDHPNVISLKHCFFST
Sbjct  95   LETGEAVAIKKVLQDRRYKNRELQLMRLMDHPNVISLKHCFFST  138



>gb|KFK31745.1| hypothetical protein AALP_AA6G153600 [Arabis alpina]
Length=405

 Score =   199 bits (507),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 92/103 (89%), Positives = 102/103 (99%), Gaps = 0/103 (0%)
 Frame = +1

Query  205  METDKEMSAAVVEGNEAVTGHIISTTIGGKNGEPKRTITYMAERVVGTGSFGIVFQAKCL  384
            M++DKEMSAAV++GN+AVTGHIISTTIGGKNGEPK+TI+YMAERVVGTGSFGIVFQAKCL
Sbjct  24   MDSDKEMSAAVIDGNDAVTGHIISTTIGGKNGEPKQTISYMAERVVGTGSFGIVFQAKCL  83

Query  385  KTGETVAIKKVLQDRRYKNRELXLMRLMDHPNVISLKHCFFST  513
            +TGE+VAIKKVLQDRRYKNREL LMRLMDHPNV+SLKHCFFST
Sbjct  84   ETGESVAIKKVLQDRRYKNRELQLMRLMDHPNVVSLKHCFFST  126



>ref|XP_010414192.1| PREDICTED: shaggy-related protein kinase zeta-like [Camelina 
sativa]
Length=411

 Score =   199 bits (507),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 91/105 (87%), Positives = 103/105 (98%), Gaps = 0/105 (0%)
 Frame = +1

Query  199  PEMETDKEMSAAVVEGNEAVTGHIISTTIGGKNGEPKRTITYMAERVVGTGSFGIVFQAK  378
            P+M++DK+MSAAV+EGN+AVTGHIISTTIGGKNGEPK+ I+YMAERVVGTGSFGIVFQAK
Sbjct  30   PDMDSDKDMSAAVIEGNDAVTGHIISTTIGGKNGEPKQVISYMAERVVGTGSFGIVFQAK  89

Query  379  CLKTGETVAIKKVLQDRRYKNRELXLMRLMDHPNVISLKHCFFST  513
            CL+TGE+VAIKKVLQDRRYKNREL LMRL+DHPNV+SLKHCFFST
Sbjct  90   CLETGESVAIKKVLQDRRYKNRELQLMRLIDHPNVVSLKHCFFST  134



>ref|XP_009141120.1| PREDICTED: shaggy-related protein kinase zeta [Brassica rapa]
 emb|CDX97773.1| BnaC04g41660D [Brassica napus]
Length=410

 Score =   199 bits (507),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 92/104 (88%), Positives = 102/104 (98%), Gaps = 0/104 (0%)
 Frame = +1

Query  202  EMETDKEMSAAVVEGNEAVTGHIISTTIGGKNGEPKRTITYMAERVVGTGSFGIVFQAKC  381
            +M+TDK+MSAAV+EGN+AVTGHIISTTIGGKNGEPK+TI+YMAERVVG GSFGIVFQAKC
Sbjct  30   DMDTDKDMSAAVIEGNDAVTGHIISTTIGGKNGEPKQTISYMAERVVGQGSFGIVFQAKC  89

Query  382  LKTGETVAIKKVLQDRRYKNRELXLMRLMDHPNVISLKHCFFST  513
            L+TGE+VAIKKVLQDRRYKNREL LMRLMDHPNV+SLKHCFFST
Sbjct  90   LETGESVAIKKVLQDRRYKNRELQLMRLMDHPNVVSLKHCFFST  133



>ref|XP_010475366.1| PREDICTED: shaggy-related protein kinase iota-like [Camelina 
sativa]
Length=417

 Score =   199 bits (507),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 93/104 (89%), Positives = 102/104 (98%), Gaps = 0/104 (0%)
 Frame = +1

Query  202  EMETDKEMSAAVVEGNEAVTGHIISTTIGGKNGEPKRTITYMAERVVGTGSFGIVFQAKC  381
            E ++DKEM+AAV+EGN+AVTGHIISTTIGGKNGEPK+TI+YMAERVVGTGSFGIVFQAKC
Sbjct  37   ETDSDKEMTAAVIEGNDAVTGHIISTTIGGKNGEPKQTISYMAERVVGTGSFGIVFQAKC  96

Query  382  LKTGETVAIKKVLQDRRYKNRELXLMRLMDHPNVISLKHCFFST  513
            L+TGE+VAIKKVLQDRRYKNREL LMRLMDHPNVISLKHCFFST
Sbjct  97   LETGESVAIKKVLQDRRYKNRELQLMRLMDHPNVISLKHCFFST  140



>ref|XP_003540001.1| PREDICTED: shaggy-related protein kinase zeta-like [Glycine max]
Length=420

 Score =   200 bits (508),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 93/104 (89%), Positives = 100/104 (96%), Gaps = 0/104 (0%)
 Frame = +1

Query  202  EMETDKEMSAAVVEGNEAVTGHIISTTIGGKNGEPKRTITYMAERVVGTGSFGIVFQAKC  381
            +METDK+MSA V+EGN+AVTGHIISTTIGGKNGEPK TI+YMAERVVGTGSFG+VFQAKC
Sbjct  40   DMETDKDMSATVIEGNDAVTGHIISTTIGGKNGEPKETISYMAERVVGTGSFGVVFQAKC  99

Query  382  LKTGETVAIKKVLQDRRYKNRELXLMRLMDHPNVISLKHCFFST  513
            L+TGE VAIKKVLQDRRYKNREL LMRLMDHPNVISLKHCFFST
Sbjct  100  LETGEAVAIKKVLQDRRYKNRELQLMRLMDHPNVISLKHCFFST  143



>ref|XP_010486052.1| PREDICTED: shaggy-related protein kinase iota-like [Camelina 
sativa]
Length=413

 Score =   199 bits (507),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 93/104 (89%), Positives = 102/104 (98%), Gaps = 0/104 (0%)
 Frame = +1

Query  202  EMETDKEMSAAVVEGNEAVTGHIISTTIGGKNGEPKRTITYMAERVVGTGSFGIVFQAKC  381
            E ++DKEM+AAV+EGN+AVTGHIISTTIGGKNGEPK+TI+YMAERVVGTGSFGIVFQAKC
Sbjct  33   ETDSDKEMTAAVIEGNDAVTGHIISTTIGGKNGEPKQTISYMAERVVGTGSFGIVFQAKC  92

Query  382  LKTGETVAIKKVLQDRRYKNRELXLMRLMDHPNVISLKHCFFST  513
            L+TGE+VAIKKVLQDRRYKNREL LMRLMDHPNVISLKHCFFST
Sbjct  93   LETGESVAIKKVLQDRRYKNRELQLMRLMDHPNVISLKHCFFST  136



>ref|XP_010457765.1| PREDICTED: shaggy-related protein kinase iota [Camelina sativa]
Length=413

 Score =   199 bits (507),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 93/104 (89%), Positives = 102/104 (98%), Gaps = 0/104 (0%)
 Frame = +1

Query  202  EMETDKEMSAAVVEGNEAVTGHIISTTIGGKNGEPKRTITYMAERVVGTGSFGIVFQAKC  381
            E ++DKEM+AAV+EGN+AVTGHIISTTIGGKNGEPK+TI+YMAERVVGTGSFGIVFQAKC
Sbjct  33   ETDSDKEMTAAVIEGNDAVTGHIISTTIGGKNGEPKQTISYMAERVVGTGSFGIVFQAKC  92

Query  382  LKTGETVAIKKVLQDRRYKNRELXLMRLMDHPNVISLKHCFFST  513
            L+TGE+VAIKKVLQDRRYKNREL LMRLMDHPNVISLKHCFFST
Sbjct  93   LETGESVAIKKVLQDRRYKNRELQLMRLMDHPNVISLKHCFFST  136



>ref|XP_010510261.1| PREDICTED: shaggy-related protein kinase zeta [Camelina sativa]
Length=411

 Score =   199 bits (505),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 91/105 (87%), Positives = 103/105 (98%), Gaps = 0/105 (0%)
 Frame = +1

Query  199  PEMETDKEMSAAVVEGNEAVTGHIISTTIGGKNGEPKRTITYMAERVVGTGSFGIVFQAK  378
            P+++TDK+MSAAV+EGN+AVTGHIISTTIGGKNGEPK+ I+YMAERVVGTGSFGIVFQAK
Sbjct  30   PDVDTDKDMSAAVIEGNDAVTGHIISTTIGGKNGEPKQVISYMAERVVGTGSFGIVFQAK  89

Query  379  CLKTGETVAIKKVLQDRRYKNRELXLMRLMDHPNVISLKHCFFST  513
            CL+TGE+VAIKKVLQDRRYKNREL LMRL+DHPNV+SLKHCFFST
Sbjct  90   CLETGESVAIKKVLQDRRYKNRELQLMRLIDHPNVVSLKHCFFST  134



>ref|XP_010469777.1| PREDICTED: shaggy-related protein kinase zeta-like [Camelina 
sativa]
Length=411

 Score =   198 bits (504),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 91/105 (87%), Positives = 102/105 (97%), Gaps = 0/105 (0%)
 Frame = +1

Query  199  PEMETDKEMSAAVVEGNEAVTGHIISTTIGGKNGEPKRTITYMAERVVGTGSFGIVFQAK  378
            P+M++DK+MSAAV+EGN AVTGHIISTTIGGKNGEPK+ I+YMAERVVGTGSFGIVFQAK
Sbjct  30   PDMDSDKDMSAAVIEGNYAVTGHIISTTIGGKNGEPKQVISYMAERVVGTGSFGIVFQAK  89

Query  379  CLKTGETVAIKKVLQDRRYKNRELXLMRLMDHPNVISLKHCFFST  513
            CL+TGE+VAIKKVLQDRRYKNREL LMRL+DHPNV+SLKHCFFST
Sbjct  90   CLETGESVAIKKVLQDRRYKNRELQLMRLIDHPNVVSLKHCFFST  134



>ref|XP_007132829.1| hypothetical protein PHAVU_011G128000g [Phaseolus vulgaris]
 gb|ESW04823.1| hypothetical protein PHAVU_011G128000g [Phaseolus vulgaris]
Length=419

 Score =   198 bits (504),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 92/104 (88%), Positives = 101/104 (97%), Gaps = 0/104 (0%)
 Frame = +1

Query  202  EMETDKEMSAAVVEGNEAVTGHIISTTIGGKNGEPKRTITYMAERVVGTGSFGIVFQAKC  381
            +METDK+MSA V+EGN+AVTGHIISTTIGGKNGEPK+TI+YMAERVVGTGSFG+VFQAKC
Sbjct  39   DMETDKDMSATVIEGNDAVTGHIISTTIGGKNGEPKQTISYMAERVVGTGSFGVVFQAKC  98

Query  382  LKTGETVAIKKVLQDRRYKNRELXLMRLMDHPNVISLKHCFFST  513
            L+TGE VAIKKVLQDR+YKNREL LMRLMDHPNVISLKHCFFST
Sbjct  99   LETGEPVAIKKVLQDRQYKNRELQLMRLMDHPNVISLKHCFFST  142



>emb|CBI22011.3| unnamed protein product [Vitis vinifera]
Length=354

 Score =   196 bits (499),  Expect = 4e-58, Method: Compositional matrix adjust.
 Identities = 89/103 (86%), Positives = 101/103 (98%), Gaps = 0/103 (0%)
 Frame = +1

Query  205  METDKEMSAAVVEGNEAVTGHIISTTIGGKNGEPKRTITYMAERVVGTGSFGIVFQAKCL  384
            +++DKEMSAAV+EGN+ VTGHIISTTIGGKNGEPK+TI+YMAER+VGTGSFGIVFQAKCL
Sbjct  34   LDSDKEMSAAVIEGNDPVTGHIISTTIGGKNGEPKQTISYMAERIVGTGSFGIVFQAKCL  93

Query  385  KTGETVAIKKVLQDRRYKNRELXLMRLMDHPNVISLKHCFFST  513
            +TGETVAIKKVLQDRRYKNREL L+RLMDHPNV++LKHCFFST
Sbjct  94   ETGETVAIKKVLQDRRYKNRELQLLRLMDHPNVVTLKHCFFST  136



>gb|KHN34245.1| Shaggy-related protein kinase zeta [Glycine soja]
Length=502

 Score =   200 bits (509),  Expect = 4e-58, Method: Compositional matrix adjust.
 Identities = 93/104 (89%), Positives = 100/104 (96%), Gaps = 0/104 (0%)
 Frame = +1

Query  202  EMETDKEMSAAVVEGNEAVTGHIISTTIGGKNGEPKRTITYMAERVVGTGSFGIVFQAKC  381
            +METDK+MSA V+EGN+AVTGHIISTTIGGKNGEPK TI+YMAERVVGTGSFG+VFQAKC
Sbjct  122  DMETDKDMSATVIEGNDAVTGHIISTTIGGKNGEPKETISYMAERVVGTGSFGVVFQAKC  181

Query  382  LKTGETVAIKKVLQDRRYKNRELXLMRLMDHPNVISLKHCFFST  513
            L+TGE VAIKKVLQDRRYKNREL LMRLMDHPNVISLKHCFFST
Sbjct  182  LETGEAVAIKKVLQDRRYKNRELQLMRLMDHPNVISLKHCFFST  225



>ref|XP_010557131.1| PREDICTED: shaggy-related protein kinase zeta-like isoform X1 
[Tarenaya hassleriana]
Length=411

 Score =   198 bits (503),  Expect = 5e-58, Method: Compositional matrix adjust.
 Identities = 91/104 (88%), Positives = 102/104 (98%), Gaps = 0/104 (0%)
 Frame = +1

Query  202  EMETDKEMSAAVVEGNEAVTGHIISTTIGGKNGEPKRTITYMAERVVGTGSFGIVFQAKC  381
            +M++DKEMSAAV++GN+AVTGHIISTTIGGKNGEPK TI+YMAERVVGTGSFGIVFQAKC
Sbjct  30   DMDSDKEMSAAVIDGNDAVTGHIISTTIGGKNGEPKGTISYMAERVVGTGSFGIVFQAKC  89

Query  382  LKTGETVAIKKVLQDRRYKNRELXLMRLMDHPNVISLKHCFFST  513
            L+TGE+VAIKKVLQDRRYKNREL LMRLMDHPNV+SL+HCFFST
Sbjct  90   LETGESVAIKKVLQDRRYKNRELQLMRLMDHPNVVSLRHCFFST  133



>ref|XP_010557132.1| PREDICTED: shaggy-related protein kinase zeta-like isoform X2 
[Tarenaya hassleriana]
Length=410

 Score =   198 bits (503),  Expect = 5e-58, Method: Compositional matrix adjust.
 Identities = 91/104 (88%), Positives = 102/104 (98%), Gaps = 0/104 (0%)
 Frame = +1

Query  202  EMETDKEMSAAVVEGNEAVTGHIISTTIGGKNGEPKRTITYMAERVVGTGSFGIVFQAKC  381
            +M++DKEMSAAV++GN+AVTGHIISTTIGGKNGEPK TI+YMAERVVGTGSFGIVFQAKC
Sbjct  30   DMDSDKEMSAAVIDGNDAVTGHIISTTIGGKNGEPKGTISYMAERVVGTGSFGIVFQAKC  89

Query  382  LKTGETVAIKKVLQDRRYKNRELXLMRLMDHPNVISLKHCFFST  513
            L+TGE+VAIKKVLQDRRYKNREL LMRLMDHPNV+SL+HCFFST
Sbjct  90   LETGESVAIKKVLQDRRYKNRELQLMRLMDHPNVVSLRHCFFST  133



>ref|XP_004303195.1| PREDICTED: shaggy-related protein kinase eta isoform X1 [Fragaria 
vesca subsp. vesca]
Length=417

 Score =   198 bits (503),  Expect = 6e-58, Method: Compositional matrix adjust.
 Identities = 92/104 (88%), Positives = 100/104 (96%), Gaps = 0/104 (0%)
 Frame = +1

Query  202  EMETDKEMSAAVVEGNEAVTGHIISTTIGGKNGEPKRTITYMAERVVGTGSFGIVFQAKC  381
            +M++ KEMSA V+EGN+AVTGHIISTTIGGKNGEPKRTI+YMAER VGTGSFGIVFQAKC
Sbjct  37   DMDSHKEMSAPVIEGNDAVTGHIISTTIGGKNGEPKRTISYMAERAVGTGSFGIVFQAKC  96

Query  382  LKTGETVAIKKVLQDRRYKNRELXLMRLMDHPNVISLKHCFFST  513
            L+TGETVAIKKVLQDRRYKNREL LMRLMDHPNV+SLKHCFFST
Sbjct  97   LETGETVAIKKVLQDRRYKNRELQLMRLMDHPNVVSLKHCFFST  140



>ref|XP_007048726.1| GSK3/SHAGGY-like protein kinase 1 isoform 2 [Theobroma cacao]
 gb|EOX92883.1| GSK3/SHAGGY-like protein kinase 1 isoform 2 [Theobroma cacao]
Length=384

 Score =   197 bits (500),  Expect = 7e-58, Method: Compositional matrix adjust.
 Identities = 92/104 (88%), Positives = 99/104 (95%), Gaps = 0/104 (0%)
 Frame = +1

Query  202  EMETDKEMSAAVVEGNEAVTGHIISTTIGGKNGEPKRTITYMAERVVGTGSFGIVFQAKC  381
            +M++DKEMSA VVEGN  VTGHIISTTIGGKNGEPK+TI+YMAERVVGTGSFGIVFQAKC
Sbjct  29   DMDSDKEMSAPVVEGNNQVTGHIISTTIGGKNGEPKQTISYMAERVVGTGSFGIVFQAKC  88

Query  382  LKTGETVAIKKVLQDRRYKNRELXLMRLMDHPNVISLKHCFFST  513
            L+T ETVAIKKVLQDRRYKNREL LMRLMDHPNV+SLKHCFFST
Sbjct  89   LETSETVAIKKVLQDRRYKNRELQLMRLMDHPNVVSLKHCFFST  132



>ref|XP_010100748.1| Shaggy-related protein kinase eta [Morus notabilis]
 gb|EXB84051.1| Shaggy-related protein kinase eta [Morus notabilis]
Length=323

 Score =   195 bits (495),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 90/103 (87%), Positives = 100/103 (97%), Gaps = 0/103 (0%)
 Frame = +1

Query  205  METDKEMSAAVVEGNEAVTGHIISTTIGGKNGEPKRTITYMAERVVGTGSFGIVFQAKCL  384
            M  DKE+SA++V+GN++VTGHIISTTIGGKNGEPK+TI+YMAERVVGTGSFGIVFQAKCL
Sbjct  1    MADDKEISASIVDGNDSVTGHIISTTIGGKNGEPKQTISYMAERVVGTGSFGIVFQAKCL  60

Query  385  KTGETVAIKKVLQDRRYKNRELXLMRLMDHPNVISLKHCFFST  513
            +TGETVAIKKVLQDRRYKNREL LMR+MDHPNVISLKHCFFST
Sbjct  61   ETGETVAIKKVLQDRRYKNRELQLMRVMDHPNVISLKHCFFST  103



>ref|XP_007048725.1| SHAGGY-related protein kinase dZeta isoform 1 [Theobroma cacao]
 gb|EOX92882.1| SHAGGY-related protein kinase dZeta isoform 1 [Theobroma cacao]
Length=409

 Score =   196 bits (499),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 92/104 (88%), Positives = 99/104 (95%), Gaps = 0/104 (0%)
 Frame = +1

Query  202  EMETDKEMSAAVVEGNEAVTGHIISTTIGGKNGEPKRTITYMAERVVGTGSFGIVFQAKC  381
            +M++DKEMSA VVEGN  VTGHIISTTIGGKNGEPK+TI+YMAERVVGTGSFGIVFQAKC
Sbjct  29   DMDSDKEMSAPVVEGNNQVTGHIISTTIGGKNGEPKQTISYMAERVVGTGSFGIVFQAKC  88

Query  382  LKTGETVAIKKVLQDRRYKNRELXLMRLMDHPNVISLKHCFFST  513
            L+T ETVAIKKVLQDRRYKNREL LMRLMDHPNV+SLKHCFFST
Sbjct  89   LETSETVAIKKVLQDRRYKNRELQLMRLMDHPNVVSLKHCFFST  132



>ref|XP_007025343.1| Kinase superfamily protein isoform 2, partial [Theobroma cacao]
 gb|EOY27965.1| Kinase superfamily protein isoform 2, partial [Theobroma cacao]
Length=376

 Score =   196 bits (497),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 92/103 (89%), Positives = 99/103 (96%), Gaps = 0/103 (0%)
 Frame = +1

Query  205  METDKEMSAAVVEGNEAVTGHIISTTIGGKNGEPKRTITYMAERVVGTGSFGIVFQAKCL  384
            M  DKEMSAAVV+GN+ VTGHIISTTIGGKNGEPK+TI+YMAERVVGTGSFGIVFQAKCL
Sbjct  53   MADDKEMSAAVVDGNDPVTGHIISTTIGGKNGEPKQTISYMAERVVGTGSFGIVFQAKCL  112

Query  385  KTGETVAIKKVLQDRRYKNRELXLMRLMDHPNVISLKHCFFST  513
            +TGETVAIKKVLQDRRYKNREL LMR++DHPNVISLKHCFFST
Sbjct  113  ETGETVAIKKVLQDRRYKNRELQLMRVLDHPNVISLKHCFFST  155



>ref|XP_010657061.1| PREDICTED: shaggy-related protein kinase eta-like [Vitis vinifera]
Length=413

 Score =   196 bits (499),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 89/103 (86%), Positives = 101/103 (98%), Gaps = 0/103 (0%)
 Frame = +1

Query  205  METDKEMSAAVVEGNEAVTGHIISTTIGGKNGEPKRTITYMAERVVGTGSFGIVFQAKCL  384
            +++DKEMSAAV+EGN+ VTGHIISTTIGGKNGEPK+TI+YMAER+VGTGSFGIVFQAKCL
Sbjct  34   LDSDKEMSAAVIEGNDPVTGHIISTTIGGKNGEPKQTISYMAERIVGTGSFGIVFQAKCL  93

Query  385  KTGETVAIKKVLQDRRYKNRELXLMRLMDHPNVISLKHCFFST  513
            +TGETVAIKKVLQDRRYKNREL L+RLMDHPNV++LKHCFFST
Sbjct  94   ETGETVAIKKVLQDRRYKNRELQLLRLMDHPNVVTLKHCFFST  136



>gb|AES66963.2| shaggy-like kinase dzeta [Medicago truncatula]
Length=426

 Score =   197 bits (500),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 92/103 (89%), Positives = 100/103 (97%), Gaps = 0/103 (0%)
 Frame = +1

Query  205  METDKEMSAAVVEGNEAVTGHIISTTIGGKNGEPKRTITYMAERVVGTGSFGIVFQAKCL  384
            M+TDKEMSA+VV+ N+AVTGHIISTTIGGKNGEPKRTI+YMAERVVGTGSFGIVFQAKCL
Sbjct  49   MDTDKEMSASVVDSNDAVTGHIISTTIGGKNGEPKRTISYMAERVVGTGSFGIVFQAKCL  108

Query  385  KTGETVAIKKVLQDRRYKNRELXLMRLMDHPNVISLKHCFFST  513
            +TGE VAIKKVLQD+RYKNREL LMR+MDHPNVISLKHCFFST
Sbjct  109  ETGEAVAIKKVLQDKRYKNRELQLMRVMDHPNVISLKHCFFST  151



>gb|KDO77888.1| hypothetical protein CISIN_1g016950mg [Citrus sinensis]
Length=314

 Score =   194 bits (492),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 92/103 (89%), Positives = 99/103 (96%), Gaps = 0/103 (0%)
 Frame = +1

Query  205  METDKEMSAAVVEGNEAVTGHIISTTIGGKNGEPKRTITYMAERVVGTGSFGIVFQAKCL  384
            M  DKEMSAAVV+G++ VTGHIISTTIGGKNGEPK+TI+YMAERVVGTGSFGIVFQAKCL
Sbjct  1    MADDKEMSAAVVDGSDHVTGHIISTTIGGKNGEPKQTISYMAERVVGTGSFGIVFQAKCL  60

Query  385  KTGETVAIKKVLQDRRYKNRELXLMRLMDHPNVISLKHCFFST  513
            +TGETVAIKKVLQDRRYKNREL LMR+MDHPNVISLKHCFFST
Sbjct  61   ETGETVAIKKVLQDRRYKNRELQLMRVMDHPNVISLKHCFFST  103



>ref|XP_003596712.1| Shaggy-related protein kinase [Medicago truncatula]
Length=423

 Score =   196 bits (499),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 92/103 (89%), Positives = 100/103 (97%), Gaps = 0/103 (0%)
 Frame = +1

Query  205  METDKEMSAAVVEGNEAVTGHIISTTIGGKNGEPKRTITYMAERVVGTGSFGIVFQAKCL  384
            M+TDKEMSA+VV+ N+AVTGHIISTTIGGKNGEPKRTI+YMAERVVGTGSFGIVFQAKCL
Sbjct  46   MDTDKEMSASVVDSNDAVTGHIISTTIGGKNGEPKRTISYMAERVVGTGSFGIVFQAKCL  105

Query  385  KTGETVAIKKVLQDRRYKNRELXLMRLMDHPNVISLKHCFFST  513
            +TGE VAIKKVLQD+RYKNREL LMR+MDHPNVISLKHCFFST
Sbjct  106  ETGEAVAIKKVLQDKRYKNRELQLMRVMDHPNVISLKHCFFST  148



>gb|ACJ85155.1| unknown [Medicago truncatula]
Length=172

 Score =   189 bits (479),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 86/103 (83%), Positives = 96/103 (93%), Gaps = 0/103 (0%)
 Frame = +1

Query  205  METDKEMSAAVVEGNEAVTGHIISTTIGGKNGEPKRTITYMAERVVGTGSFGIVFQAKCL  384
            M  DKEMS +V+ GN+++TGHIISTTIGGKNGEPK+TI+YMAERVVGTGSFGIVFQAKCL
Sbjct  1    MSEDKEMSTSVINGNDSLTGHIISTTIGGKNGEPKQTISYMAERVVGTGSFGIVFQAKCL  60

Query  385  KTGETVAIKKVLQDRRYKNRELXLMRLMDHPNVISLKHCFFST  513
            +TGE VAIKKVLQDRRYKNREL LMR+MDHPNV +LKHCFFST
Sbjct  61   ETGEAVAIKKVLQDRRYKNRELQLMRVMDHPNVATLKHCFFST  103



>ref|XP_006449527.1| hypothetical protein CICLE_v10015608mg [Citrus clementina]
 gb|ESR62767.1| hypothetical protein CICLE_v10015608mg [Citrus clementina]
Length=380

 Score =   194 bits (493),  Expect = 7e-57, Method: Compositional matrix adjust.
 Identities = 92/103 (89%), Positives = 99/103 (96%), Gaps = 0/103 (0%)
 Frame = +1

Query  205  METDKEMSAAVVEGNEAVTGHIISTTIGGKNGEPKRTITYMAERVVGTGSFGIVFQAKCL  384
            M  DKEMSAAVV+G++ VTGHIISTTIGGKNGEPK+TI+YMAERVVGTGSFGIVFQAKCL
Sbjct  1    MADDKEMSAAVVDGSDHVTGHIISTTIGGKNGEPKQTISYMAERVVGTGSFGIVFQAKCL  60

Query  385  KTGETVAIKKVLQDRRYKNRELXLMRLMDHPNVISLKHCFFST  513
            +TGETVAIKKVLQDRRYKNREL LMR+MDHPNVISLKHCFFST
Sbjct  61   ETGETVAIKKVLQDRRYKNRELQLMRVMDHPNVISLKHCFFST  103



>ref|XP_006467630.1| PREDICTED: shaggy-related protein kinase eta-like [Citrus sinensis]
 gb|KDO77887.1| hypothetical protein CISIN_1g016950mg [Citrus sinensis]
Length=380

 Score =   194 bits (493),  Expect = 8e-57, Method: Compositional matrix adjust.
 Identities = 92/103 (89%), Positives = 99/103 (96%), Gaps = 0/103 (0%)
 Frame = +1

Query  205  METDKEMSAAVVEGNEAVTGHIISTTIGGKNGEPKRTITYMAERVVGTGSFGIVFQAKCL  384
            M  DKEMSAAVV+G++ VTGHIISTTIGGKNGEPK+TI+YMAERVVGTGSFGIVFQAKCL
Sbjct  1    MADDKEMSAAVVDGSDHVTGHIISTTIGGKNGEPKQTISYMAERVVGTGSFGIVFQAKCL  60

Query  385  KTGETVAIKKVLQDRRYKNRELXLMRLMDHPNVISLKHCFFST  513
            +TGETVAIKKVLQDRRYKNREL LMR+MDHPNVISLKHCFFST
Sbjct  61   ETGETVAIKKVLQDRRYKNRELQLMRVMDHPNVISLKHCFFST  103



>gb|KDO63406.1| hypothetical protein CISIN_1g014750mg [Citrus sinensis]
Length=376

 Score =   193 bits (491),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 91/98 (93%), Positives = 97/98 (99%), Gaps = 0/98 (0%)
 Frame = +1

Query  220  EMSAAVVEGNEAVTGHIISTTIGGKNGEPKRTITYMAERVVGTGSFGIVFQAKCLKTGET  399
            EMSAAV++GN+AVTGHIISTTIGGKNGEPK+TI+YMAERVVGTGSFGIVFQAKCL+TGET
Sbjct  2    EMSAAVIQGNDAVTGHIISTTIGGKNGEPKQTISYMAERVVGTGSFGIVFQAKCLETGET  61

Query  400  VAIKKVLQDRRYKNRELXLMRLMDHPNVISLKHCFFST  513
            VAIKKVLQDRRYKNREL LMRLMDHPNVISLKHCFFST
Sbjct  62   VAIKKVLQDRRYKNRELQLMRLMDHPNVISLKHCFFST  99



>gb|KDP21116.1| hypothetical protein JCGZ_21587 [Jatropha curcas]
Length=379

 Score =   193 bits (490),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 91/103 (88%), Positives = 98/103 (95%), Gaps = 0/103 (0%)
 Frame = +1

Query  205  METDKEMSAAVVEGNEAVTGHIISTTIGGKNGEPKRTITYMAERVVGTGSFGIVFQAKCL  384
            M  DKEMSA VV+GN+ VTGHIISTTIGGKNGEPK+TI+YMAERVVGTGSFGIVFQAKCL
Sbjct  1    MADDKEMSARVVDGNDPVTGHIISTTIGGKNGEPKQTISYMAERVVGTGSFGIVFQAKCL  60

Query  385  KTGETVAIKKVLQDRRYKNRELXLMRLMDHPNVISLKHCFFST  513
            +TGETVAIKKVLQD+RYKNREL LMR+MDHPNVISLKHCFFST
Sbjct  61   ETGETVAIKKVLQDKRYKNRELQLMRVMDHPNVISLKHCFFST  103



>ref|XP_004487575.1| PREDICTED: shaggy-related protein kinase zeta-like [Cicer arietinum]
Length=420

 Score =   194 bits (492),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 90/104 (87%), Positives = 99/104 (95%), Gaps = 0/104 (0%)
 Frame = +1

Query  202  EMETDKEMSAAVVEGNEAVTGHIISTTIGGKNGEPKRTITYMAERVVGTGSFGIVFQAKC  381
            +M+TDKEMS+ VV+ N+AVTGHIISTTIGGKNGEPKRTI+YMAERVVGTGSFGIVFQAKC
Sbjct  42   DMDTDKEMSSTVVDSNDAVTGHIISTTIGGKNGEPKRTISYMAERVVGTGSFGIVFQAKC  101

Query  382  LKTGETVAIKKVLQDRRYKNRELXLMRLMDHPNVISLKHCFFST  513
            L+T E VAIKKVLQD+RYKNREL LMR+MDHPNVISLKHCFFST
Sbjct  102  LETSEAVAIKKVLQDKRYKNRELQLMRVMDHPNVISLKHCFFST  145



>ref|XP_011082988.1| PREDICTED: shaggy-related protein kinase eta [Sesamum indicum]
Length=430

 Score =   194 bits (492),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 91/103 (88%), Positives = 98/103 (95%), Gaps = 0/103 (0%)
 Frame = +1

Query  205  METDKEMSAAVVEGNEAVTGHIISTTIGGKNGEPKRTITYMAERVVGTGSFGIVFQAKCL  384
            ME DKEM +++VEGN+ VTGHIISTTIGGKNGEPKRTI+YMAERVVGTGSFGIVFQAKCL
Sbjct  49   MEADKEMPSSMVEGNDPVTGHIISTTIGGKNGEPKRTISYMAERVVGTGSFGIVFQAKCL  108

Query  385  KTGETVAIKKVLQDRRYKNRELXLMRLMDHPNVISLKHCFFST  513
            +TGE+VAIKKVLQDRRYKNREL LMRLMDH NVISLKHCFFST
Sbjct  109  ETGESVAIKKVLQDRRYKNRELQLMRLMDHSNVISLKHCFFST  151



>ref|XP_010689734.1| PREDICTED: shaggy-related protein kinase eta [Beta vulgaris subsp. 
vulgaris]
Length=407

 Score =   193 bits (491),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 91/103 (88%), Positives = 97/103 (94%), Gaps = 0/103 (0%)
 Frame = +1

Query  205  METDKEMSAAVVEGNEAVTGHIISTTIGGKNGEPKRTITYMAERVVGTGSFGIVFQAKCL  384
            M  DKEMS AV++GN+ VTGHIISTTIGGKNGEPKRTI+YMAERVVGTGSFGIVFQAKCL
Sbjct  32   MSDDKEMSPAVIQGNDQVTGHIISTTIGGKNGEPKRTISYMAERVVGTGSFGIVFQAKCL  91

Query  385  KTGETVAIKKVLQDRRYKNRELXLMRLMDHPNVISLKHCFFST  513
            +TGETVAIKKVLQDRRYKNREL LMRL+DH NVISLKHCFFST
Sbjct  92   ETGETVAIKKVLQDRRYKNRELQLMRLLDHANVISLKHCFFST  134



>ref|NP_001190762.1| Shaggy-related protein kinase eta [Arabidopsis thaliana]
 gb|AEE84080.1| Shaggy-related protein kinase eta [Arabidopsis thaliana]
Length=280

 Score =   190 bits (482),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 89/103 (86%), Positives = 97/103 (94%), Gaps = 0/103 (0%)
 Frame = +1

Query  205  METDKEMSAAVVEGNEAVTGHIISTTIGGKNGEPKRTITYMAERVVGTGSFGIVFQAKCL  384
            M  DKEM AAVV+G++ VTGHIISTTIGGKNGEPK+TI+YMAERVVGTGSFGIVFQAKCL
Sbjct  1    MADDKEMPAAVVDGHDQVTGHIISTTIGGKNGEPKQTISYMAERVVGTGSFGIVFQAKCL  60

Query  385  KTGETVAIKKVLQDRRYKNRELXLMRLMDHPNVISLKHCFFST  513
            +TGETVAIKKVLQDRRYKNREL LMR+MDHPNV+ LKHCFFST
Sbjct  61   ETGETVAIKKVLQDRRYKNRELQLMRVMDHPNVVCLKHCFFST  103



>ref|XP_011466966.1| PREDICTED: shaggy-related protein kinase zeta isoform X2 [Fragaria 
vesca subsp. vesca]
Length=386

 Score =   192 bits (489),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 90/99 (91%), Positives = 96/99 (97%), Gaps = 0/99 (0%)
 Frame = +1

Query  217  KEMSAAVVEGNEAVTGHIISTTIGGKNGEPKRTITYMAERVVGTGSFGIVFQAKCLKTGE  396
            +EMSA V+EGN+AVTGHIISTTIGGKNGEPKRTI+YMAER VGTGSFGIVFQAKCL+TGE
Sbjct  11   EEMSAPVIEGNDAVTGHIISTTIGGKNGEPKRTISYMAERAVGTGSFGIVFQAKCLETGE  70

Query  397  TVAIKKVLQDRRYKNRELXLMRLMDHPNVISLKHCFFST  513
            TVAIKKVLQDRRYKNREL LMRLMDHPNV+SLKHCFFST
Sbjct  71   TVAIKKVLQDRRYKNRELQLMRLMDHPNVVSLKHCFFST  109



>ref|XP_003633016.1| PREDICTED: shaggy-related protein kinase eta isoform X1 [Vitis 
vinifera]
 emb|CBI30705.3| unnamed protein product [Vitis vinifera]
Length=380

 Score =   192 bits (489),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 91/103 (88%), Positives = 97/103 (94%), Gaps = 0/103 (0%)
 Frame = +1

Query  205  METDKEMSAAVVEGNEAVTGHIISTTIGGKNGEPKRTITYMAERVVGTGSFGIVFQAKCL  384
            M  DKE+SA VV+GN+ VTGHIISTTIGGKNGEPK+TI+YMAERVVGTGSFGIVFQAKCL
Sbjct  1    MSDDKEISAPVVDGNDPVTGHIISTTIGGKNGEPKQTISYMAERVVGTGSFGIVFQAKCL  60

Query  385  KTGETVAIKKVLQDRRYKNRELXLMRLMDHPNVISLKHCFFST  513
            +TGETVAIKKVLQDRRYKNREL LMR MDHPNVISLKHCFFST
Sbjct  61   ETGETVAIKKVLQDRRYKNRELQLMRTMDHPNVISLKHCFFST  103



>ref|XP_008365740.1| PREDICTED: shaggy-related protein kinase zeta isoform X1 [Malus 
domestica]
Length=356

 Score =   191 bits (486),  Expect = 4e-56, Method: Compositional matrix adjust.
 Identities = 90/97 (93%), Positives = 95/97 (98%), Gaps = 0/97 (0%)
 Frame = +1

Query  223  MSAAVVEGNEAVTGHIISTTIGGKNGEPKRTITYMAERVVGTGSFGIVFQAKCLKTGETV  402
            MSA VVEGN+AVTGHIISTTIGGKNGEPKRTI+YMAERVVGTGSFGIVFQAKC++TGETV
Sbjct  1    MSAPVVEGNDAVTGHIISTTIGGKNGEPKRTISYMAERVVGTGSFGIVFQAKCIETGETV  60

Query  403  AIKKVLQDRRYKNRELXLMRLMDHPNVISLKHCFFST  513
            AIKKVLQDRRYKNREL LMRLMDHPNV+SLKHCFFST
Sbjct  61   AIKKVLQDRRYKNRELQLMRLMDHPNVVSLKHCFFST  97



>ref|XP_009593781.1| PREDICTED: shaggy-related protein kinase zeta isoform X2 [Nicotiana 
tomentosiformis]
Length=376

 Score =   192 bits (488),  Expect = 4e-56, Method: Compositional matrix adjust.
 Identities = 92/98 (94%), Positives = 95/98 (97%), Gaps = 0/98 (0%)
 Frame = +1

Query  220  EMSAAVVEGNEAVTGHIISTTIGGKNGEPKRTITYMAERVVGTGSFGIVFQAKCLKTGET  399
            EMSAA VEGN AVTGHIISTTIGGKNGEPKRTI+YMAERVVGTGSFGIVFQAKCL+TGET
Sbjct  2    EMSAAAVEGNGAVTGHIISTTIGGKNGEPKRTISYMAERVVGTGSFGIVFQAKCLETGET  61

Query  400  VAIKKVLQDRRYKNRELXLMRLMDHPNVISLKHCFFST  513
            VAIKKVLQD+RYKNREL LMRLMDHPNVISLKHCFFST
Sbjct  62   VAIKKVLQDKRYKNRELQLMRLMDHPNVISLKHCFFST  99



>gb|KJB34904.1| hypothetical protein B456_006G089400 [Gossypium raimondii]
Length=317

 Score =   190 bits (483),  Expect = 5e-56, Method: Compositional matrix adjust.
 Identities = 90/103 (87%), Positives = 97/103 (94%), Gaps = 0/103 (0%)
 Frame = +1

Query  205  METDKEMSAAVVEGNEAVTGHIISTTIGGKNGEPKRTITYMAERVVGTGSFGIVFQAKCL  384
            M  DKEMSA VV+ N+ VTGHIISTTIGGKNGEPK+TI+YMAERVVGTGSFGIVFQAKCL
Sbjct  1    MADDKEMSALVVDVNDPVTGHIISTTIGGKNGEPKQTISYMAERVVGTGSFGIVFQAKCL  60

Query  385  KTGETVAIKKVLQDRRYKNRELXLMRLMDHPNVISLKHCFFST  513
            +TGETVAIKKVLQDRRYKNREL LMR++DHPNVISLKHCFFST
Sbjct  61   ETGETVAIKKVLQDRRYKNRELQLMRVLDHPNVISLKHCFFST  103



>ref|XP_007148030.1| hypothetical protein PHAVU_006G1745000g, partial [Phaseolus vulgaris]
 gb|ESW20024.1| hypothetical protein PHAVU_006G1745000g, partial [Phaseolus vulgaris]
Length=238

 Score =   187 bits (476),  Expect = 6e-56, Method: Compositional matrix adjust.
 Identities = 86/103 (83%), Positives = 97/103 (94%), Gaps = 0/103 (0%)
 Frame = +1

Query  205  METDKEMSAAVVEGNEAVTGHIISTTIGGKNGEPKRTITYMAERVVGTGSFGIVFQAKCL  384
            M  DKEMS++V+ GN+++TGHIISTTIGGKNGEPK+TI+Y AERVVGTGSFGIVFQAKCL
Sbjct  1    MAEDKEMSSSVINGNDSLTGHIISTTIGGKNGEPKQTISYKAERVVGTGSFGIVFQAKCL  60

Query  385  KTGETVAIKKVLQDRRYKNRELXLMRLMDHPNVISLKHCFFST  513
            +TGE VAIKKVLQDRRYKNREL LMR++DHPNVISLKHCFFST
Sbjct  61   ETGEAVAIKKVLQDRRYKNRELQLMRVLDHPNVISLKHCFFST  103



>gb|KJB34903.1| hypothetical protein B456_006G089400 [Gossypium raimondii]
Length=319

 Score =   190 bits (482),  Expect = 7e-56, Method: Compositional matrix adjust.
 Identities = 90/103 (87%), Positives = 97/103 (94%), Gaps = 0/103 (0%)
 Frame = +1

Query  205  METDKEMSAAVVEGNEAVTGHIISTTIGGKNGEPKRTITYMAERVVGTGSFGIVFQAKCL  384
            M  DKEMSA VV+ N+ VTGHIISTTIGGKNGEPK+TI+YMAERVVGTGSFGIVFQAKCL
Sbjct  1    MADDKEMSALVVDVNDPVTGHIISTTIGGKNGEPKQTISYMAERVVGTGSFGIVFQAKCL  60

Query  385  KTGETVAIKKVLQDRRYKNRELXLMRLMDHPNVISLKHCFFST  513
            +TGETVAIKKVLQDRRYKNREL LMR++DHPNVISLKHCFFST
Sbjct  61   ETGETVAIKKVLQDRRYKNRELQLMRVLDHPNVISLKHCFFST  103



>ref|XP_002317404.1| GSK3/SHAGGY-LIKE protein KINASE 1 [Populus trichocarpa]
 gb|EEE98016.1| GSK3/SHAGGY-LIKE protein KINASE 1 [Populus trichocarpa]
Length=380

 Score =   191 bits (486),  Expect = 7e-56, Method: Compositional matrix adjust.
 Identities = 90/103 (87%), Positives = 97/103 (94%), Gaps = 0/103 (0%)
 Frame = +1

Query  205  METDKEMSAAVVEGNEAVTGHIISTTIGGKNGEPKRTITYMAERVVGTGSFGIVFQAKCL  384
            M  DKEM+A V +GN+ VTGHIISTTIGGKNGEPK+TI+YMAERVVGTGSFGIVFQAKCL
Sbjct  1    MAEDKEMNARVADGNDPVTGHIISTTIGGKNGEPKQTISYMAERVVGTGSFGIVFQAKCL  60

Query  385  KTGETVAIKKVLQDRRYKNRELXLMRLMDHPNVISLKHCFFST  513
            +TGETVAIKKVLQDRRYKNREL LMR+MDHPNVISLKHCFFST
Sbjct  61   ETGETVAIKKVLQDRRYKNRELQLMRVMDHPNVISLKHCFFST  103



>ref|XP_011039408.1| PREDICTED: shaggy-related protein kinase eta-like [Populus euphratica]
 ref|XP_011039409.1| PREDICTED: shaggy-related protein kinase eta-like [Populus euphratica]
Length=380

 Score =   191 bits (486),  Expect = 8e-56, Method: Compositional matrix adjust.
 Identities = 90/103 (87%), Positives = 97/103 (94%), Gaps = 0/103 (0%)
 Frame = +1

Query  205  METDKEMSAAVVEGNEAVTGHIISTTIGGKNGEPKRTITYMAERVVGTGSFGIVFQAKCL  384
            M  DKEM+A V +GN+ VTGHIISTTIGGKNGEPK+TI+YMAERVVGTGSFGIVFQAKCL
Sbjct  1    MAEDKEMNARVADGNDPVTGHIISTTIGGKNGEPKQTISYMAERVVGTGSFGIVFQAKCL  60

Query  385  KTGETVAIKKVLQDRRYKNRELXLMRLMDHPNVISLKHCFFST  513
            +TGETVAIKKVLQDRRYKNREL LMR+MDHPNVISLKHCFFST
Sbjct  61   ETGETVAIKKVLQDRRYKNRELQLMRVMDHPNVISLKHCFFST  103



>ref|XP_010529205.1| PREDICTED: shaggy-related protein kinase eta-like isoform X1 
[Tarenaya hassleriana]
Length=380

 Score =   191 bits (485),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 90/103 (87%), Positives = 99/103 (96%), Gaps = 0/103 (0%)
 Frame = +1

Query  205  METDKEMSAAVVEGNEAVTGHIISTTIGGKNGEPKRTITYMAERVVGTGSFGIVFQAKCL  384
            M  +KEMSAAVV+G++ VTGHIISTTIGGKNGEPK+TI+YMAERVVGTGSFGIVFQAKCL
Sbjct  1    MADEKEMSAAVVDGHDQVTGHIISTTIGGKNGEPKQTISYMAERVVGTGSFGIVFQAKCL  60

Query  385  KTGETVAIKKVLQDRRYKNRELXLMRLMDHPNVISLKHCFFST  513
            +TGETVAIKKVLQDRRYKNREL LMR+MDHPNV+SLKHCFFST
Sbjct  61   ETGETVAIKKVLQDRRYKNRELQLMRVMDHPNVVSLKHCFFST  103



>ref|XP_010274430.1| PREDICTED: shaggy-related protein kinase eta-like [Nelumbo nucifera]
Length=412

 Score =   192 bits (487),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 92/104 (88%), Positives = 96/104 (92%), Gaps = 0/104 (0%)
 Frame = +1

Query  202  EMETDKEMSAAVVEGNEAVTGHIISTTIGGKNGEPKRTITYMAERVVGTGSFGIVFQAKC  381
            EM  DKEMS  V+EGN+ VTGHIISTTIGGKNGE KRTI+YMAERVVGTGSFGIVFQAKC
Sbjct  32   EMGDDKEMSTPVIEGNDPVTGHIISTTIGGKNGEAKRTISYMAERVVGTGSFGIVFQAKC  91

Query  382  LKTGETVAIKKVLQDRRYKNRELXLMRLMDHPNVISLKHCFFST  513
            L+TGETVAIKKVLQDRRYKNREL LMR MDHPNVISLKHCFFST
Sbjct  92   LETGETVAIKKVLQDRRYKNRELQLMRSMDHPNVISLKHCFFST  135



>ref|XP_008228935.1| PREDICTED: shaggy-related protein kinase zeta isoform X2 [Prunus 
mume]
Length=374

 Score =   191 bits (485),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 89/97 (92%), Positives = 95/97 (98%), Gaps = 0/97 (0%)
 Frame = +1

Query  223  MSAAVVEGNEAVTGHIISTTIGGKNGEPKRTITYMAERVVGTGSFGIVFQAKCLKTGETV  402
            MSA V+EGN+AVTGHIISTTIGGKNGEPKRTI+YMAERVVGTGSFGIVFQAKC++TGETV
Sbjct  1    MSAPVIEGNDAVTGHIISTTIGGKNGEPKRTISYMAERVVGTGSFGIVFQAKCIETGETV  60

Query  403  AIKKVLQDRRYKNRELXLMRLMDHPNVISLKHCFFST  513
            AIKKVLQDRRYKNREL LMRLMDHPNV+SLKHCFFST
Sbjct  61   AIKKVLQDRRYKNRELQLMRLMDHPNVVSLKHCFFST  97



>gb|KJB34905.1| hypothetical protein B456_006G089400 [Gossypium raimondii]
Length=357

 Score =   190 bits (483),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 90/103 (87%), Positives = 97/103 (94%), Gaps = 0/103 (0%)
 Frame = +1

Query  205  METDKEMSAAVVEGNEAVTGHIISTTIGGKNGEPKRTITYMAERVVGTGSFGIVFQAKCL  384
            M  DKEMSA VV+ N+ VTGHIISTTIGGKNGEPK+TI+YMAERVVGTGSFGIVFQAKCL
Sbjct  1    MADDKEMSALVVDVNDPVTGHIISTTIGGKNGEPKQTISYMAERVVGTGSFGIVFQAKCL  60

Query  385  KTGETVAIKKVLQDRRYKNRELXLMRLMDHPNVISLKHCFFST  513
            +TGETVAIKKVLQDRRYKNREL LMR++DHPNVISLKHCFFST
Sbjct  61   ETGETVAIKKVLQDRRYKNRELQLMRVLDHPNVISLKHCFFST  103



>ref|XP_009365289.1| PREDICTED: shaggy-related protein kinase zeta-like isoform X2 
[Pyrus x bretschneideri]
Length=374

 Score =   190 bits (483),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 90/97 (93%), Positives = 94/97 (97%), Gaps = 0/97 (0%)
 Frame = +1

Query  223  MSAAVVEGNEAVTGHIISTTIGGKNGEPKRTITYMAERVVGTGSFGIVFQAKCLKTGETV  402
            MSA VVEGN AVTGHIISTTIGGKNGEPKRTI+YMAERVVGTGSFGIVFQAKC++TGETV
Sbjct  1    MSAPVVEGNAAVTGHIISTTIGGKNGEPKRTISYMAERVVGTGSFGIVFQAKCIETGETV  60

Query  403  AIKKVLQDRRYKNRELXLMRLMDHPNVISLKHCFFST  513
            AIKKVLQDRRYKNREL LMRLMDHPNV+SLKHCFFST
Sbjct  61   AIKKVLQDRRYKNRELQLMRLMDHPNVVSLKHCFFST  97



>ref|XP_011466967.1| PREDICTED: shaggy-related protein kinase zeta isoform X3 [Fragaria 
vesca subsp. vesca]
Length=374

 Score =   190 bits (483),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 89/97 (92%), Positives = 94/97 (97%), Gaps = 0/97 (0%)
 Frame = +1

Query  223  MSAAVVEGNEAVTGHIISTTIGGKNGEPKRTITYMAERVVGTGSFGIVFQAKCLKTGETV  402
            MSA V+EGN+AVTGHIISTTIGGKNGEPKRTI+YMAER VGTGSFGIVFQAKCL+TGETV
Sbjct  1    MSAPVIEGNDAVTGHIISTTIGGKNGEPKRTISYMAERAVGTGSFGIVFQAKCLETGETV  60

Query  403  AIKKVLQDRRYKNRELXLMRLMDHPNVISLKHCFFST  513
            AIKKVLQDRRYKNREL LMRLMDHPNV+SLKHCFFST
Sbjct  61   AIKKVLQDRRYKNRELQLMRLMDHPNVVSLKHCFFST  97



>emb|CAA64409.1| shaggy-like kinase etha [Arabidopsis thaliana]
 emb|CAA70144.1| shaggy-like kinase etha [Arabidopsis thaliana]
Length=380

 Score =   190 bits (483),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 89/103 (86%), Positives = 97/103 (94%), Gaps = 0/103 (0%)
 Frame = +1

Query  205  METDKEMSAAVVEGNEAVTGHIISTTIGGKNGEPKRTITYMAERVVGTGSFGIVFQAKCL  384
            M  DKEM AAVV+G++ VTGHIISTTIGGKNGEPK+TI+YMAERVVGTGSFGIVFQAKCL
Sbjct  1    MADDKEMPAAVVDGHDQVTGHIISTTIGGKNGEPKQTISYMAERVVGTGSFGIVFQAKCL  60

Query  385  KTGETVAIKKVLQDRRYKNRELXLMRLMDHPNVISLKHCFFST  513
            +TGETVAIKKVLQDRRYKNREL LMR+MDHPNV+ LKHCFFST
Sbjct  61   ETGETVAIKKVLQDRRYKNRELQLMRVMDHPNVVCLKHCFFST  103



>dbj|BAJ33611.1| unnamed protein product [Thellungiella halophila]
Length=380

 Score =   190 bits (483),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 89/103 (86%), Positives = 97/103 (94%), Gaps = 0/103 (0%)
 Frame = +1

Query  205  METDKEMSAAVVEGNEAVTGHIISTTIGGKNGEPKRTITYMAERVVGTGSFGIVFQAKCL  384
            M  DKEM AAVV+G++ VTGHIISTTIGGKNGEPK+TI+YMAERVVGTGSFGIVFQAKCL
Sbjct  1    MADDKEMPAAVVDGHDQVTGHIISTTIGGKNGEPKQTISYMAERVVGTGSFGIVFQAKCL  60

Query  385  KTGETVAIKKVLQDRRYKNRELXLMRLMDHPNVISLKHCFFST  513
            +TGETVAIKKVLQDRRYKNREL LMR+MDHPNV+ LKHCFFST
Sbjct  61   ETGETVAIKKVLQDRRYKNRELQLMRVMDHPNVVCLKHCFFST  103



>gb|KHG20434.1| Shaggy-related protein kinase eta [Gossypium arboreum]
Length=381

 Score =   190 bits (483),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 90/103 (87%), Positives = 97/103 (94%), Gaps = 0/103 (0%)
 Frame = +1

Query  205  METDKEMSAAVVEGNEAVTGHIISTTIGGKNGEPKRTITYMAERVVGTGSFGIVFQAKCL  384
            M  DKEMSA VV+ N+ VTGHIISTTIGGKNGEPK+TI+YMAERVVGTGSFGIVFQAKCL
Sbjct  1    MADDKEMSAPVVDVNDPVTGHIISTTIGGKNGEPKQTISYMAERVVGTGSFGIVFQAKCL  60

Query  385  KTGETVAIKKVLQDRRYKNRELXLMRLMDHPNVISLKHCFFST  513
            +TGETVAIKKVLQDRRYKNREL LMR++DHPNVISLKHCFFST
Sbjct  61   ETGETVAIKKVLQDRRYKNRELQLMRVLDHPNVISLKHCFFST  103



>ref|XP_002870026.1| hypothetical protein ARALYDRAFT_914806 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH46285.1| hypothetical protein ARALYDRAFT_914806 [Arabidopsis lyrata subsp. 
lyrata]
Length=380

 Score =   190 bits (483),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 89/103 (86%), Positives = 97/103 (94%), Gaps = 0/103 (0%)
 Frame = +1

Query  205  METDKEMSAAVVEGNEAVTGHIISTTIGGKNGEPKRTITYMAERVVGTGSFGIVFQAKCL  384
            M  DKEM AAVV+G++ VTGHIISTTIGGKNGEPK+TI+YMAERVVGTGSFGIVFQAKCL
Sbjct  1    MADDKEMPAAVVDGHDQVTGHIISTTIGGKNGEPKQTISYMAERVVGTGSFGIVFQAKCL  60

Query  385  KTGETVAIKKVLQDRRYKNRELXLMRLMDHPNVISLKHCFFST  513
            +TGETVAIKKVLQDRRYKNREL LMR+MDHPNV+ LKHCFFST
Sbjct  61   ETGETVAIKKVLQDRRYKNRELQLMRVMDHPNVVCLKHCFFST  103



>ref|XP_008789340.1| PREDICTED: shaggy-related protein kinase eta [Phoenix dactylifera]
Length=406

 Score =   191 bits (484),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 92/105 (88%), Positives = 98/105 (93%), Gaps = 2/105 (2%)
 Frame = +1

Query  199  PEMETDKEMSAAVVEGNEAVTGHIISTTIGGKNGEPKRTITYMAERVVGTGSFGIVFQAK  378
            PEM  DK+  A+VVEGN+ VTGHIISTTIGGKNGEPK+TI+YMAERVVGTGSFGIVFQAK
Sbjct  27   PEMAEDKQ--ASVVEGNDQVTGHIISTTIGGKNGEPKQTISYMAERVVGTGSFGIVFQAK  84

Query  379  CLKTGETVAIKKVLQDRRYKNRELXLMRLMDHPNVISLKHCFFST  513
            CL+TGETVAIKKVLQDRRYKNREL LMR MDHPNVISLKHCFFST
Sbjct  85   CLETGETVAIKKVLQDRRYKNRELQLMRAMDHPNVISLKHCFFST  129



>ref|NP_193606.1| Shaggy-related protein kinase eta [Arabidopsis thaliana]
 sp|Q39011.2|KSG7_ARATH RecName: Full=Shaggy-related protein kinase eta; AltName: Full=ASK-eta; 
AltName: Full=Protein BRASSINOSTEROID INSENSITIVE 
2; AltName: Full=Protein ULTRACURVATA 1 [Arabidopsis thaliana]
 emb|CAB37456.1| shaggy-like protein kinase etha (EC 2.7.1.-) [Arabidopsis thaliana]
 emb|CAB78873.1| shaggy-like protein kinase etha (EC 2.7.1.-) [Arabidopsis thaliana]
 gb|AAM63594.1| shaggy-like protein kinase etha (EC 2.7.1.-) [Arabidopsis thaliana]
 gb|AAN71719.1| glycogen synthase kinase 3 beta protein kinase DWARF12 [Arabidopsis 
thaliana]
 gb|ABG48387.1| At4g18710 [Arabidopsis thaliana]
 gb|AEE84079.1| Shaggy-related protein kinase eta [Arabidopsis thaliana]
 gb|KFK28543.1| hypothetical protein AALP_AA7G010300 [Arabis alpina]
Length=380

 Score =   190 bits (482),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 89/103 (86%), Positives = 97/103 (94%), Gaps = 0/103 (0%)
 Frame = +1

Query  205  METDKEMSAAVVEGNEAVTGHIISTTIGGKNGEPKRTITYMAERVVGTGSFGIVFQAKCL  384
            M  DKEM AAVV+G++ VTGHIISTTIGGKNGEPK+TI+YMAERVVGTGSFGIVFQAKCL
Sbjct  1    MADDKEMPAAVVDGHDQVTGHIISTTIGGKNGEPKQTISYMAERVVGTGSFGIVFQAKCL  60

Query  385  KTGETVAIKKVLQDRRYKNRELXLMRLMDHPNVISLKHCFFST  513
            +TGETVAIKKVLQDRRYKNREL LMR+MDHPNV+ LKHCFFST
Sbjct  61   ETGETVAIKKVLQDRRYKNRELQLMRVMDHPNVVCLKHCFFST  103



>gb|EAY96932.1| hypothetical protein OsI_18850 [Oryza sativa Indica Group]
Length=220

 Score =   185 bits (470),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 88/99 (89%), Positives = 92/99 (93%), Gaps = 0/99 (0%)
 Frame = +1

Query  217  KEMSAAVVEGNEAVTGHIISTTIGGKNGEPKRTITYMAERVVGTGSFGIVFQAKCLKTGE  396
            +E  A   EGN+AVTGHIISTTIGGKNGEPKRTI+YMAERVVGTGSFGIVFQAKCL+TGE
Sbjct  28   QEGEAPYAEGNDAVTGHIISTTIGGKNGEPKRTISYMAERVVGTGSFGIVFQAKCLETGE  87

Query  397  TVAIKKVLQDRRYKNRELXLMRLMDHPNVISLKHCFFST  513
            TVAIKKVLQDRRYKNREL LMR MDHPNVISLKHCFFST
Sbjct  88   TVAIKKVLQDRRYKNRELQLMRAMDHPNVISLKHCFFST  126



>gb|KJB34902.1| hypothetical protein B456_006G089400 [Gossypium raimondii]
Length=381

 Score =   190 bits (482),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 90/103 (87%), Positives = 97/103 (94%), Gaps = 0/103 (0%)
 Frame = +1

Query  205  METDKEMSAAVVEGNEAVTGHIISTTIGGKNGEPKRTITYMAERVVGTGSFGIVFQAKCL  384
            M  DKEMSA VV+ N+ VTGHIISTTIGGKNGEPK+TI+YMAERVVGTGSFGIVFQAKCL
Sbjct  1    MADDKEMSALVVDVNDPVTGHIISTTIGGKNGEPKQTISYMAERVVGTGSFGIVFQAKCL  60

Query  385  KTGETVAIKKVLQDRRYKNRELXLMRLMDHPNVISLKHCFFST  513
            +TGETVAIKKVLQDRRYKNREL LMR++DHPNVISLKHCFFST
Sbjct  61   ETGETVAIKKVLQDRRYKNRELQLMRVLDHPNVISLKHCFFST  103



>ref|XP_008448254.1| PREDICTED: shaggy-related protein kinase zeta isoform X2 [Cucumis 
melo]
Length=375

 Score =   190 bits (482),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 88/97 (91%), Positives = 96/97 (99%), Gaps = 0/97 (0%)
 Frame = +1

Query  223  MSAAVVEGNEAVTGHIISTTIGGKNGEPKRTITYMAERVVGTGSFGIVFQAKCLKTGETV  402
            MSAAV+EGN+AVTGHIISTTIGGKNGEPK+TI+YMAERVVG+GSFGIVFQAKCL+TGETV
Sbjct  1    MSAAVIEGNDAVTGHIISTTIGGKNGEPKQTISYMAERVVGSGSFGIVFQAKCLETGETV  60

Query  403  AIKKVLQDRRYKNRELXLMRLMDHPNVISLKHCFFST  513
            AIKKVLQD+RYKNREL LMRLMDHPNV+SLKHCFFST
Sbjct  61   AIKKVLQDKRYKNRELQLMRLMDHPNVVSLKHCFFST  97



>ref|XP_008343095.1| PREDICTED: shaggy-related protein kinase zeta isoform X2 [Malus 
domestica]
Length=374

 Score =   190 bits (482),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 89/97 (92%), Positives = 95/97 (98%), Gaps = 0/97 (0%)
 Frame = +1

Query  223  MSAAVVEGNEAVTGHIISTTIGGKNGEPKRTITYMAERVVGTGSFGIVFQAKCLKTGETV  402
            MSA V+EGN+AVTGHIISTTIGGKNGEPKRTI+YMAERVVGTGSFGIVFQAKC++TGETV
Sbjct  1    MSAPVMEGNDAVTGHIISTTIGGKNGEPKRTISYMAERVVGTGSFGIVFQAKCIETGETV  60

Query  403  AIKKVLQDRRYKNRELXLMRLMDHPNVISLKHCFFST  513
            AIKKVLQDRRYKNREL LMRLMDHPNV+SLKHCFFST
Sbjct  61   AIKKVLQDRRYKNRELQLMRLMDHPNVVSLKHCFFST  97



>ref|XP_003526266.1| PREDICTED: shaggy-related protein kinase eta-like [Glycine max]
Length=380

 Score =   190 bits (482),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 88/103 (85%), Positives = 97/103 (94%), Gaps = 0/103 (0%)
 Frame = +1

Query  205  METDKEMSAAVVEGNEAVTGHIISTTIGGKNGEPKRTITYMAERVVGTGSFGIVFQAKCL  384
            M  DKEMS +V+ GN+++TGHIISTTIGGKNGEPK+TI+YMAERVVGTGSFGIVFQAKCL
Sbjct  1    MAEDKEMSTSVINGNDSLTGHIISTTIGGKNGEPKQTISYMAERVVGTGSFGIVFQAKCL  60

Query  385  KTGETVAIKKVLQDRRYKNRELXLMRLMDHPNVISLKHCFFST  513
            +TGE VAIKKVLQDRRYKNREL LMR+MDHPNVISLKHCFFST
Sbjct  61   ETGEAVAIKKVLQDRRYKNRELQLMRVMDHPNVISLKHCFFST  103



>ref|XP_003522493.1| PREDICTED: shaggy-related protein kinase eta-like [Glycine max]
Length=380

 Score =   190 bits (482),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 88/103 (85%), Positives = 97/103 (94%), Gaps = 0/103 (0%)
 Frame = +1

Query  205  METDKEMSAAVVEGNEAVTGHIISTTIGGKNGEPKRTITYMAERVVGTGSFGIVFQAKCL  384
            M  DKEMS +V+ GN+++TGHIISTTIGGKNGEPK+TI+YMAERVVGTGSFGIVFQAKCL
Sbjct  1    MAEDKEMSTSVINGNDSLTGHIISTTIGGKNGEPKQTISYMAERVVGTGSFGIVFQAKCL  60

Query  385  KTGETVAIKKVLQDRRYKNRELXLMRLMDHPNVISLKHCFFST  513
            +TGE VAIKKVLQDRRYKNREL LMR+MDHPNVISLKHCFFST
Sbjct  61   ETGEAVAIKKVLQDRRYKNRELQLMRVMDHPNVISLKHCFFST  103



>emb|CAN73053.1| hypothetical protein VITISV_015513 [Vitis vinifera]
Length=435

 Score =   191 bits (486),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 87/99 (88%), Positives = 97/99 (98%), Gaps = 0/99 (0%)
 Frame = +1

Query  217  KEMSAAVVEGNEAVTGHIISTTIGGKNGEPKRTITYMAERVVGTGSFGIVFQAKCLKTGE  396
            +EMSAAV+EGN+ VTGHIISTTIGGKNGEPK+TI+YMAER+VGTGSFGIVFQAKCL+TGE
Sbjct  52   REMSAAVIEGNDPVTGHIISTTIGGKNGEPKQTISYMAERIVGTGSFGIVFQAKCLETGE  111

Query  397  TVAIKKVLQDRRYKNRELXLMRLMDHPNVISLKHCFFST  513
            TVAIKKVLQDRRYKNREL L+RLMDHPNV++LKHCFFST
Sbjct  112  TVAIKKVLQDRRYKNRELQLLRLMDHPNVVTLKHCFFST  150



>gb|AAL77705.1| AT4g18710/F28A21_120 [Arabidopsis thaliana]
Length=380

 Score =   190 bits (482),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 89/103 (86%), Positives = 97/103 (94%), Gaps = 0/103 (0%)
 Frame = +1

Query  205  METDKEMSAAVVEGNEAVTGHIISTTIGGKNGEPKRTITYMAERVVGTGSFGIVFQAKCL  384
            M  DKEM AAVV+G++ VTGHIISTTIGGKNGEPK+TI+YMAERVVGTGSFGIVFQAKCL
Sbjct  1    MADDKEMPAAVVDGHDQVTGHIISTTIGGKNGEPKQTISYMAERVVGTGSFGIVFQAKCL  60

Query  385  KTGETVAIKKVLQDRRYKNRELXLMRLMDHPNVISLKHCFFST  513
            +TGETVAIKKVLQDRRYKNREL LMR+MDHPNV+ LKHCFFST
Sbjct  61   ETGETVAIKKVLQDRRYKNRELQLMRVMDHPNVVCLKHCFFST  103



>ref|XP_002522231.1| Glycogen synthase kinase-3 beta, putative [Ricinus communis]
 gb|EEF40089.1| Glycogen synthase kinase-3 beta, putative [Ricinus communis]
Length=380

 Score =   189 bits (481),  Expect = 4e-55, Method: Compositional matrix adjust.
 Identities = 89/103 (86%), Positives = 97/103 (94%), Gaps = 0/103 (0%)
 Frame = +1

Query  205  METDKEMSAAVVEGNEAVTGHIISTTIGGKNGEPKRTITYMAERVVGTGSFGIVFQAKCL  384
            M  DKEM+A VV+ N+ VTGHIISTTIGGKNGEPK+TI+YMAERVVGTGSFGIVFQAKCL
Sbjct  1    MADDKEMAARVVDSNDPVTGHIISTTIGGKNGEPKQTISYMAERVVGTGSFGIVFQAKCL  60

Query  385  KTGETVAIKKVLQDRRYKNRELXLMRLMDHPNVISLKHCFFST  513
            +TGETVAIKKVLQD+RYKNREL LMR+MDHPNVISLKHCFFST
Sbjct  61   ETGETVAIKKVLQDKRYKNRELQLMRVMDHPNVISLKHCFFST  103



>ref|XP_007136978.1| hypothetical protein PHAVU_009G089900g [Phaseolus vulgaris]
 gb|ESW08972.1| hypothetical protein PHAVU_009G089900g [Phaseolus vulgaris]
Length=380

 Score =   189 bits (481),  Expect = 4e-55, Method: Compositional matrix adjust.
 Identities = 88/103 (85%), Positives = 97/103 (94%), Gaps = 0/103 (0%)
 Frame = +1

Query  205  METDKEMSAAVVEGNEAVTGHIISTTIGGKNGEPKRTITYMAERVVGTGSFGIVFQAKCL  384
            M  DKEMS AV+ GN+++TGHIISTTIGGKNGEPK+TI+YMAERVVGTGSFGIVFQAKCL
Sbjct  1    MAEDKEMSNAVINGNDSLTGHIISTTIGGKNGEPKQTISYMAERVVGTGSFGIVFQAKCL  60

Query  385  KTGETVAIKKVLQDRRYKNRELXLMRLMDHPNVISLKHCFFST  513
            +TGE VAIKKVLQDRRYKNREL LMR+MDHPNVI+LKHCFFST
Sbjct  61   ETGEAVAIKKVLQDRRYKNRELQLMRVMDHPNVITLKHCFFST  103



>gb|KGN46984.1| hypothetical protein Csa_6G157100 [Cucumis sativus]
Length=441

 Score =   191 bits (485),  Expect = 4e-55, Method: Compositional matrix adjust.
 Identities = 93/119 (78%), Positives = 102/119 (86%), Gaps = 16/119 (13%)
 Frame = +1

Query  205  METDKEMSAAVVEGNEAVTGHIISTTIGGKNGEPKRTITYMAERVVGTGSFGIV------  366
            M+TDKEMSAAV+EGN+AVTGHIISTTIGGKNGEPK+TI+YMAERVVG+GSFGIV      
Sbjct  45   MDTDKEMSAAVIEGNDAVTGHIISTTIGGKNGEPKQTISYMAERVVGSGSFGIVFQFVLS  104

Query  367  ----------FQAKCLKTGETVAIKKVLQDRRYKNRELXLMRLMDHPNVISLKHCFFST  513
                      FQAKCL+TGETVAIKKVLQD+RYKNREL LMRLMDHPNV+SLKHCFFST
Sbjct  105  VQFLKSKCPSFQAKCLETGETVAIKKVLQDKRYKNRELQLMRLMDHPNVVSLKHCFFST  163



>ref|XP_010246462.1| PREDICTED: shaggy-related protein kinase eta [Nelumbo nucifera]
Length=405

 Score =   190 bits (482),  Expect = 5e-55, Method: Compositional matrix adjust.
 Identities = 92/104 (88%), Positives = 96/104 (92%), Gaps = 0/104 (0%)
 Frame = +1

Query  202  EMETDKEMSAAVVEGNEAVTGHIISTTIGGKNGEPKRTITYMAERVVGTGSFGIVFQAKC  381
            EM  DKEMSA VVEGN+ VTGHIISTTIGGKNGE KRTI+YMAERVVGTGSFGIVFQAKC
Sbjct  25   EMGDDKEMSAPVVEGNDPVTGHIISTTIGGKNGEAKRTISYMAERVVGTGSFGIVFQAKC  84

Query  382  LKTGETVAIKKVLQDRRYKNRELXLMRLMDHPNVISLKHCFFST  513
            L+TGETVAIKKVLQDRRYKNREL LMR M+HPNVI LKHCFFST
Sbjct  85   LETGETVAIKKVLQDRRYKNRELQLMRSMEHPNVICLKHCFFST  128



>ref|XP_010538570.1| PREDICTED: shaggy-related protein kinase eta-like isoform X1 
[Tarenaya hassleriana]
Length=380

 Score =   189 bits (480),  Expect = 5e-55, Method: Compositional matrix adjust.
 Identities = 89/103 (86%), Positives = 98/103 (95%), Gaps = 0/103 (0%)
 Frame = +1

Query  205  METDKEMSAAVVEGNEAVTGHIISTTIGGKNGEPKRTITYMAERVVGTGSFGIVFQAKCL  384
            M  DKEMSAAVV+G++ VTGHIISTTIGGKNGEPK+TI+YMAERVVGTGSFG+VFQAKCL
Sbjct  1    MAEDKEMSAAVVDGHDQVTGHIISTTIGGKNGEPKQTISYMAERVVGTGSFGVVFQAKCL  60

Query  385  KTGETVAIKKVLQDRRYKNRELXLMRLMDHPNVISLKHCFFST  513
            +T ETVAIKKVLQDRRYKNREL +MR+MDHPNVISLKHCFFST
Sbjct  61   ETRETVAIKKVLQDRRYKNRELQIMRVMDHPNVISLKHCFFST  103



>emb|CDY66894.1| BnaCnng52760D [Brassica napus]
Length=374

 Score =   189 bits (480),  Expect = 6e-55, Method: Compositional matrix adjust.
 Identities = 88/97 (91%), Positives = 95/97 (98%), Gaps = 0/97 (0%)
 Frame = +1

Query  223  MSAAVVEGNEAVTGHIISTTIGGKNGEPKRTITYMAERVVGTGSFGIVFQAKCLKTGETV  402
            MSAAV+EGN+AVTGHIISTTIGGKNGEPK+TI+YMAERVVG GSFGIVFQAKCL+TGE+V
Sbjct  1    MSAAVIEGNDAVTGHIISTTIGGKNGEPKQTISYMAERVVGQGSFGIVFQAKCLETGESV  60

Query  403  AIKKVLQDRRYKNRELXLMRLMDHPNVISLKHCFFST  513
            AIKKVLQDRRYKNREL LMRLMDHPNV+SLKHCFFST
Sbjct  61   AIKKVLQDRRYKNRELQLMRLMDHPNVVSLKHCFFST  97



>ref|XP_008439730.1| PREDICTED: shaggy-related protein kinase eta [Cucumis melo]
Length=379

 Score =   189 bits (480),  Expect = 6e-55, Method: Compositional matrix adjust.
 Identities = 88/103 (85%), Positives = 96/103 (93%), Gaps = 0/103 (0%)
 Frame = +1

Query  205  METDKEMSAAVVEGNEAVTGHIISTTIGGKNGEPKRTITYMAERVVGTGSFGIVFQAKCL  384
            M  DKEMS  V++GN+ VTGHIISTTIGGKNGEPK+TI+YMAERVVGTGSFGIVF+AKCL
Sbjct  1    MADDKEMSGPVIDGNDPVTGHIISTTIGGKNGEPKQTISYMAERVVGTGSFGIVFKAKCL  60

Query  385  KTGETVAIKKVLQDRRYKNRELXLMRLMDHPNVISLKHCFFST  513
            +TGE VAIKKVLQDRRYKNREL LMR+MDHPNVISLKHCFFST
Sbjct  61   ETGENVAIKKVLQDRRYKNRELQLMRVMDHPNVISLKHCFFST  103



>ref|XP_010999759.1| PREDICTED: shaggy-related protein kinase eta [Populus euphratica]
 ref|XP_010999761.1| PREDICTED: shaggy-related protein kinase eta [Populus euphratica]
 ref|XP_010999762.1| PREDICTED: shaggy-related protein kinase eta [Populus euphratica]
Length=380

 Score =   189 bits (480),  Expect = 6e-55, Method: Compositional matrix adjust.
 Identities = 88/103 (85%), Positives = 96/103 (93%), Gaps = 0/103 (0%)
 Frame = +1

Query  205  METDKEMSAAVVEGNEAVTGHIISTTIGGKNGEPKRTITYMAERVVGTGSFGIVFQAKCL  384
            M  DKEM+  V +GN+ VTGHIISTTIGGKNGEPK+TI+YMAERVVGTGSFG+VFQAKCL
Sbjct  1    MAEDKEMTTRVADGNDPVTGHIISTTIGGKNGEPKQTISYMAERVVGTGSFGVVFQAKCL  60

Query  385  KTGETVAIKKVLQDRRYKNRELXLMRLMDHPNVISLKHCFFST  513
            +TGETVAIKKVLQDRRYKNREL LMR+MDHPNVISLKHCFFST
Sbjct  61   ETGETVAIKKVLQDRRYKNRELQLMRVMDHPNVISLKHCFFST  103



>ref|XP_009132133.1| PREDICTED: shaggy-related protein kinase eta [Brassica rapa]
Length=380

 Score =   189 bits (480),  Expect = 6e-55, Method: Compositional matrix adjust.
 Identities = 88/103 (85%), Positives = 97/103 (94%), Gaps = 0/103 (0%)
 Frame = +1

Query  205  METDKEMSAAVVEGNEAVTGHIISTTIGGKNGEPKRTITYMAERVVGTGSFGIVFQAKCL  384
            M  D+EM AAVV+G++ VTGHIISTTIGGKNGEPK+TI+YMAERVVGTGSFGIVFQAKCL
Sbjct  1    MADDREMPAAVVDGHDQVTGHIISTTIGGKNGEPKQTISYMAERVVGTGSFGIVFQAKCL  60

Query  385  KTGETVAIKKVLQDRRYKNRELXLMRLMDHPNVISLKHCFFST  513
            +TGETVAIKKVLQDRRYKNREL LMR+MDHPNV+ LKHCFFST
Sbjct  61   ETGETVAIKKVLQDRRYKNRELQLMRVMDHPNVVCLKHCFFST  103



>ref|XP_002305736.1| hypothetical protein POPTR_0004s05770g [Populus trichocarpa]
 ref|XP_006384065.1| GSK3/SHAGGY-LIKE protein KINASE 1 [Populus trichocarpa]
 ref|XP_006384066.1| hypothetical protein POPTR_0004s05770g [Populus trichocarpa]
 gb|EEE86247.1| hypothetical protein POPTR_0004s05770g [Populus trichocarpa]
 gb|ERP61862.1| GSK3/SHAGGY-LIKE protein KINASE 1 [Populus trichocarpa]
 gb|ERP61863.1| hypothetical protein POPTR_0004s05770g [Populus trichocarpa]
Length=380

 Score =   189 bits (480),  Expect = 6e-55, Method: Compositional matrix adjust.
 Identities = 88/103 (85%), Positives = 96/103 (93%), Gaps = 0/103 (0%)
 Frame = +1

Query  205  METDKEMSAAVVEGNEAVTGHIISTTIGGKNGEPKRTITYMAERVVGTGSFGIVFQAKCL  384
            M  DKEM+  V +GN+ VTGHIISTTIGGKNGEPK+TI+YMAERVVGTGSFG+VFQAKCL
Sbjct  1    MAEDKEMTTRVADGNDPVTGHIISTTIGGKNGEPKQTISYMAERVVGTGSFGVVFQAKCL  60

Query  385  KTGETVAIKKVLQDRRYKNRELXLMRLMDHPNVISLKHCFFST  513
            +TGETVAIKKVLQDRRYKNREL LMR+MDHPNVISLKHCFFST
Sbjct  61   ETGETVAIKKVLQDRRYKNRELQLMRVMDHPNVISLKHCFFST  103



>ref|XP_010686226.1| PREDICTED: shaggy-related protein kinase eta [Beta vulgaris subsp. 
vulgaris]
Length=380

 Score =   189 bits (480),  Expect = 7e-55, Method: Compositional matrix adjust.
 Identities = 89/103 (86%), Positives = 97/103 (94%), Gaps = 0/103 (0%)
 Frame = +1

Query  205  METDKEMSAAVVEGNEAVTGHIISTTIGGKNGEPKRTITYMAERVVGTGSFGIVFQAKCL  384
            M  DKE+S+ VV+ N AVTGHIISTTIGGKNGEPK+TI+YMAERVVGTGSFGIVFQAKCL
Sbjct  1    MADDKELSSTVVDSNGAVTGHIISTTIGGKNGEPKQTISYMAERVVGTGSFGIVFQAKCL  60

Query  385  KTGETVAIKKVLQDRRYKNRELXLMRLMDHPNVISLKHCFFST  513
            +TGETVAIKKVLQDRRYKNREL LMR++DHPNVISLKHCFFST
Sbjct  61   ETGETVAIKKVLQDRRYKNRELQLMRVLDHPNVISLKHCFFST  103



>gb|ABK95578.1| unknown [Populus trichocarpa]
Length=380

 Score =   189 bits (480),  Expect = 7e-55, Method: Compositional matrix adjust.
 Identities = 88/103 (85%), Positives = 96/103 (93%), Gaps = 0/103 (0%)
 Frame = +1

Query  205  METDKEMSAAVVEGNEAVTGHIISTTIGGKNGEPKRTITYMAERVVGTGSFGIVFQAKCL  384
            M  DKEM+  V +GN+ VTGHIISTTIGGKNGEPK+TI+YMAERVVGTGSFG+VFQAKCL
Sbjct  1    MAEDKEMTTRVADGNDPVTGHIISTTIGGKNGEPKQTISYMAERVVGTGSFGVVFQAKCL  60

Query  385  KTGETVAIKKVLQDRRYKNRELXLMRLMDHPNVISLKHCFFST  513
            +TGETVAIKKVLQDRRYKNREL LMR+MDHPNVISLKHCFFST
Sbjct  61   ETGETVAIKKVLQDRRYKNRELQLMRVMDHPNVISLKHCFFST  103



>gb|ABG74917.1| BIN2-like protein [Brassica napus]
Length=387

 Score =   189 bits (480),  Expect = 7e-55, Method: Compositional matrix adjust.
 Identities = 88/103 (85%), Positives = 97/103 (94%), Gaps = 0/103 (0%)
 Frame = +1

Query  205  METDKEMSAAVVEGNEAVTGHIISTTIGGKNGEPKRTITYMAERVVGTGSFGIVFQAKCL  384
            M  D+EM AAVV+G++ VTGHIISTTIGGKNGEPK+TI+YMAERVVGTGSFGIVFQAKCL
Sbjct  1    MADDREMPAAVVDGHDQVTGHIISTTIGGKNGEPKQTISYMAERVVGTGSFGIVFQAKCL  60

Query  385  KTGETVAIKKVLQDRRYKNRELXLMRLMDHPNVISLKHCFFST  513
            +TGETVAIKKVLQDRRYKNREL LMR+MDHPNV+ LKHCFFST
Sbjct  61   ETGETVAIKKVLQDRRYKNRELQLMRVMDHPNVVCLKHCFFST  103



>gb|KJB68374.1| hypothetical protein B456_010G241600 [Gossypium raimondii]
Length=381

 Score =   189 bits (479),  Expect = 8e-55, Method: Compositional matrix adjust.
 Identities = 89/103 (86%), Positives = 96/103 (93%), Gaps = 0/103 (0%)
 Frame = +1

Query  205  METDKEMSAAVVEGNEAVTGHIISTTIGGKNGEPKRTITYMAERVVGTGSFGIVFQAKCL  384
            M  DKEMS  VV+ N+ VTGHIISTTIGGKNGEPK+TI+YMAERVVGTGSFGIVFQAKCL
Sbjct  1    MADDKEMSTPVVDRNDPVTGHIISTTIGGKNGEPKQTISYMAERVVGTGSFGIVFQAKCL  60

Query  385  KTGETVAIKKVLQDRRYKNRELXLMRLMDHPNVISLKHCFFST  513
            +TGETVAIKKVLQDRRYKNREL LMR++DHPNVISLKHCFFST
Sbjct  61   ETGETVAIKKVLQDRRYKNRELQLMRVLDHPNVISLKHCFFST  103



>emb|CDO96835.1| unnamed protein product [Coffea canephora]
Length=380

 Score =   189 bits (479),  Expect = 8e-55, Method: Compositional matrix adjust.
 Identities = 87/103 (84%), Positives = 97/103 (94%), Gaps = 0/103 (0%)
 Frame = +1

Query  205  METDKEMSAAVVEGNEAVTGHIISTTIGGKNGEPKRTITYMAERVVGTGSFGIVFQAKCL  384
            M  DKEMSA +++G++ VTGHIISTTIGGKNGEPK+T++YMAERVVGTGSFGIVFQAKCL
Sbjct  1    MANDKEMSAPIMDGHDTVTGHIISTTIGGKNGEPKQTVSYMAERVVGTGSFGIVFQAKCL  60

Query  385  KTGETVAIKKVLQDRRYKNRELXLMRLMDHPNVISLKHCFFST  513
            +TGETVAIKKVLQDRRYKNREL LMR MDHPNV+SLKHCFFST
Sbjct  61   ETGETVAIKKVLQDRRYKNRELQLMRTMDHPNVVSLKHCFFST  103



>gb|KJB68373.1| hypothetical protein B456_010G241600 [Gossypium raimondii]
Length=385

 Score =   189 bits (479),  Expect = 9e-55, Method: Compositional matrix adjust.
 Identities = 89/103 (86%), Positives = 96/103 (93%), Gaps = 0/103 (0%)
 Frame = +1

Query  205  METDKEMSAAVVEGNEAVTGHIISTTIGGKNGEPKRTITYMAERVVGTGSFGIVFQAKCL  384
            M  DKEMS  VV+ N+ VTGHIISTTIGGKNGEPK+TI+YMAERVVGTGSFGIVFQAKCL
Sbjct  1    MADDKEMSTPVVDRNDPVTGHIISTTIGGKNGEPKQTISYMAERVVGTGSFGIVFQAKCL  60

Query  385  KTGETVAIKKVLQDRRYKNRELXLMRLMDHPNVISLKHCFFST  513
            +TGETVAIKKVLQDRRYKNREL LMR++DHPNVISLKHCFFST
Sbjct  61   ETGETVAIKKVLQDRRYKNRELQLMRVLDHPNVISLKHCFFST  103



>ref|XP_009136953.1| PREDICTED: shaggy-related protein kinase eta-like [Brassica rapa]
Length=380

 Score =   189 bits (479),  Expect = 9e-55, Method: Compositional matrix adjust.
 Identities = 88/103 (85%), Positives = 96/103 (93%), Gaps = 0/103 (0%)
 Frame = +1

Query  205  METDKEMSAAVVEGNEAVTGHIISTTIGGKNGEPKRTITYMAERVVGTGSFGIVFQAKCL  384
            M  DKEM AAVV+G++ VTGHIISTTIGGKNGEPK+TI+YMAERVVGTGSFGIVFQAKCL
Sbjct  1    MADDKEMPAAVVDGHDQVTGHIISTTIGGKNGEPKQTISYMAERVVGTGSFGIVFQAKCL  60

Query  385  KTGETVAIKKVLQDRRYKNRELXLMRLMDHPNVISLKHCFFST  513
            +TGETVAIKKV QDRRYKNREL LMR+MDHPNV+ LKHCFFST
Sbjct  61   ETGETVAIKKVFQDRRYKNRELQLMRVMDHPNVVRLKHCFFST  103



>gb|ACJ84750.1| unknown [Medicago truncatula]
Length=380

 Score =   188 bits (478),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 86/103 (83%), Positives = 97/103 (94%), Gaps = 0/103 (0%)
 Frame = +1

Query  205  METDKEMSAAVVEGNEAVTGHIISTTIGGKNGEPKRTITYMAERVVGTGSFGIVFQAKCL  384
            M  DKEMS +V+ GN+++TGHIISTTIGGKNGEPK+TI+YMAERVVGTGSFGIVFQAKCL
Sbjct  1    MSEDKEMSTSVINGNDSLTGHIISTTIGGKNGEPKQTISYMAERVVGTGSFGIVFQAKCL  60

Query  385  KTGETVAIKKVLQDRRYKNRELXLMRLMDHPNVISLKHCFFST  513
            +TGE VAIKKVLQDRRYKNREL LMR+MDHPNV++LKHCFFST
Sbjct  61   ETGEAVAIKKVLQDRRYKNRELQLMRVMDHPNVVTLKHCFFST  103



>gb|AFK40474.1| unknown [Medicago truncatula]
 gb|KEH36622.1| shaggy-like kinase dzeta [Medicago truncatula]
Length=380

 Score =   188 bits (478),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 86/103 (83%), Positives = 97/103 (94%), Gaps = 0/103 (0%)
 Frame = +1

Query  205  METDKEMSAAVVEGNEAVTGHIISTTIGGKNGEPKRTITYMAERVVGTGSFGIVFQAKCL  384
            M  DKEMS +V+ GN+++TGHIISTTIGGKNGEPK+TI+YMAERVVGTGSFGIVFQAKCL
Sbjct  1    MSEDKEMSTSVINGNDSLTGHIISTTIGGKNGEPKQTISYMAERVVGTGSFGIVFQAKCL  60

Query  385  KTGETVAIKKVLQDRRYKNRELXLMRLMDHPNVISLKHCFFST  513
            +TGE VAIKKVLQDRRYKNREL LMR+MDHPNV++LKHCFFST
Sbjct  61   ETGEAVAIKKVLQDRRYKNRELQLMRVMDHPNVVTLKHCFFST  103



>gb|AGV54503.1| shaggy-related protein kinase eta-like protein [Phaseolus vulgaris]
Length=380

 Score =   188 bits (478),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 87/103 (84%), Positives = 97/103 (94%), Gaps = 0/103 (0%)
 Frame = +1

Query  205  METDKEMSAAVVEGNEAVTGHIISTTIGGKNGEPKRTITYMAERVVGTGSFGIVFQAKCL  384
            M  DKEMS +V+ GN+++TGHIISTTIGGKNGEPK+TI+YMAERVVGTGSFGIVFQAKCL
Sbjct  1    MAEDKEMSNSVINGNDSLTGHIISTTIGGKNGEPKQTISYMAERVVGTGSFGIVFQAKCL  60

Query  385  KTGETVAIKKVLQDRRYKNRELXLMRLMDHPNVISLKHCFFST  513
            +TGE VAIKKVLQDRRYKNREL LMR+MDHPNVI+LKHCFFST
Sbjct  61   ETGEAVAIKKVLQDRRYKNRELQLMRVMDHPNVITLKHCFFST  103



>gb|AFK46922.1| unknown [Lotus japonicus]
Length=380

 Score =   188 bits (478),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 86/103 (83%), Positives = 97/103 (94%), Gaps = 0/103 (0%)
 Frame = +1

Query  205  METDKEMSAAVVEGNEAVTGHIISTTIGGKNGEPKRTITYMAERVVGTGSFGIVFQAKCL  384
            M  DKEMS +V+ GN+++TGHIISTTIGGKNGEPK+TI+YMAERVVGTGSFGIVFQAKCL
Sbjct  1    MAEDKEMSTSVINGNDSLTGHIISTTIGGKNGEPKQTISYMAERVVGTGSFGIVFQAKCL  60

Query  385  KTGETVAIKKVLQDRRYKNRELXLMRLMDHPNVISLKHCFFST  513
            ++GE VAIKKVLQDRRYKNREL LMR+MDHPNV+SLKHCFFST
Sbjct  61   ESGEAVAIKKVLQDRRYKNRELQLMRVMDHPNVVSLKHCFFST  103



>gb|KDO77889.1| hypothetical protein CISIN_1g016950mg [Citrus sinensis]
Length=376

 Score =   188 bits (478),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 89/98 (91%), Positives = 96/98 (98%), Gaps = 0/98 (0%)
 Frame = +1

Query  220  EMSAAVVEGNEAVTGHIISTTIGGKNGEPKRTITYMAERVVGTGSFGIVFQAKCLKTGET  399
            EMSAAVV+G++ VTGHIISTTIGGKNGEPK+TI+YMAERVVGTGSFGIVFQAKCL+TGET
Sbjct  2    EMSAAVVDGSDHVTGHIISTTIGGKNGEPKQTISYMAERVVGTGSFGIVFQAKCLETGET  61

Query  400  VAIKKVLQDRRYKNRELXLMRLMDHPNVISLKHCFFST  513
            VAIKKVLQDRRYKNREL LMR+MDHPNVISLKHCFFST
Sbjct  62   VAIKKVLQDRRYKNRELQLMRVMDHPNVISLKHCFFST  99



>ref|XP_004485912.1| PREDICTED: shaggy-related protein kinase eta-like [Cicer arietinum]
Length=379

 Score =   188 bits (477),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 86/103 (83%), Positives = 97/103 (94%), Gaps = 0/103 (0%)
 Frame = +1

Query  205  METDKEMSAAVVEGNEAVTGHIISTTIGGKNGEPKRTITYMAERVVGTGSFGIVFQAKCL  384
            M  DKEMS +V+ GN+++TGHIISTTIGGKNGEPK+TI+YMAERVVGTGSFGIVFQAKCL
Sbjct  1    MAEDKEMSTSVINGNDSLTGHIISTTIGGKNGEPKQTISYMAERVVGTGSFGIVFQAKCL  60

Query  385  KTGETVAIKKVLQDRRYKNRELXLMRLMDHPNVISLKHCFFST  513
            +TGE VAIKKVLQDRRYKNREL LMR+MDHPNV++LKHCFFST
Sbjct  61   ETGEAVAIKKVLQDRRYKNRELQLMRVMDHPNVVTLKHCFFST  103



>gb|KJB34899.1| hypothetical protein B456_006G089300 [Gossypium raimondii]
Length=381

 Score =   188 bits (477),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 88/103 (85%), Positives = 97/103 (94%), Gaps = 0/103 (0%)
 Frame = +1

Query  205  METDKEMSAAVVEGNEAVTGHIISTTIGGKNGEPKRTITYMAERVVGTGSFGIVFQAKCL  384
            M  DKE+SA VV+ N+ VTGH+ISTTIGGKNGEPK+TI+YMAERVVGTGSFGIVFQAKCL
Sbjct  1    MADDKEISAPVVDVNDPVTGHVISTTIGGKNGEPKQTISYMAERVVGTGSFGIVFQAKCL  60

Query  385  KTGETVAIKKVLQDRRYKNRELXLMRLMDHPNVISLKHCFFST  513
            +TGETVAIKKVLQDRRYKNREL LMR++DHPNVISLKHCFFST
Sbjct  61   ETGETVAIKKVLQDRRYKNRELQLMRVLDHPNVISLKHCFFST  103



>ref|XP_009144602.1| PREDICTED: shaggy-related protein kinase zeta-like [Brassica 
rapa]
Length=358

 Score =   187 bits (475),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 87/97 (90%), Positives = 95/97 (98%), Gaps = 0/97 (0%)
 Frame = +1

Query  223  MSAAVVEGNEAVTGHIISTTIGGKNGEPKRTITYMAERVVGTGSFGIVFQAKCLKTGETV  402
            M AAV+EGN+AVTGHIISTTIGGKNGEPK+TI+YMAERVVGTGSFGIVF+AKCL+TGE+V
Sbjct  1    MFAAVIEGNDAVTGHIISTTIGGKNGEPKQTISYMAERVVGTGSFGIVFEAKCLETGESV  60

Query  403  AIKKVLQDRRYKNRELXLMRLMDHPNVISLKHCFFST  513
            AIKKVLQDRRYKNREL LMRLMDHPNV+SLKHCFFST
Sbjct  61   AIKKVLQDRRYKNRELQLMRLMDHPNVVSLKHCFFST  97



>ref|XP_007025342.1| Kinase superfamily protein isoform 1 [Theobroma cacao]
 gb|EOY27964.1| Kinase superfamily protein isoform 1 [Theobroma cacao]
Length=362

 Score =   187 bits (475),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 88/97 (91%), Positives = 95/97 (98%), Gaps = 0/97 (0%)
 Frame = +1

Query  223  MSAAVVEGNEAVTGHIISTTIGGKNGEPKRTITYMAERVVGTGSFGIVFQAKCLKTGETV  402
            MSAAVV+GN+ VTGHIISTTIGGKNGEPK+TI+YMAERVVGTGSFGIVFQAKCL+TGETV
Sbjct  1    MSAAVVDGNDPVTGHIISTTIGGKNGEPKQTISYMAERVVGTGSFGIVFQAKCLETGETV  60

Query  403  AIKKVLQDRRYKNRELXLMRLMDHPNVISLKHCFFST  513
            AIKKVLQDRRYKNREL LMR++DHPNVISLKHCFFST
Sbjct  61   AIKKVLQDRRYKNRELQLMRVLDHPNVISLKHCFFST  97



>ref|XP_006285118.1| hypothetical protein CARUB_v10006451mg [Capsella rubella]
 gb|EOA18016.1| hypothetical protein CARUB_v10006451mg [Capsella rubella]
Length=380

 Score =   187 bits (476),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 88/103 (85%), Positives = 96/103 (93%), Gaps = 0/103 (0%)
 Frame = +1

Query  205  METDKEMSAAVVEGNEAVTGHIISTTIGGKNGEPKRTITYMAERVVGTGSFGIVFQAKCL  384
            M  DKEM  AVV+G++ VTGHIISTTIGGKNGEPK+TI+YMAERVVGTGSFGIVFQAKCL
Sbjct  1    MADDKEMPDAVVDGHDQVTGHIISTTIGGKNGEPKQTISYMAERVVGTGSFGIVFQAKCL  60

Query  385  KTGETVAIKKVLQDRRYKNRELXLMRLMDHPNVISLKHCFFST  513
            +TGETVAIKKVLQDRRYKNREL LMR+MDHPNV+ LKHCFFST
Sbjct  61   ETGETVAIKKVLQDRRYKNRELQLMRVMDHPNVVCLKHCFFST  103



>ref|XP_007149727.1| hypothetical protein PHAVU_005G094100g [Phaseolus vulgaris]
 gb|ESW21721.1| hypothetical protein PHAVU_005G094100g [Phaseolus vulgaris]
Length=425

 Score =   189 bits (479),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 90/103 (87%), Positives = 97/103 (94%), Gaps = 2/103 (2%)
 Frame = +1

Query  211  TDKEMSAAVVEGNEA--VTGHIISTTIGGKNGEPKRTITYMAERVVGTGSFGIVFQAKCL  384
            ++KEMSA V EGNEA  +TGHIISTTIGGKNGEPKRTI+YMAERVVGTGSFGIVFQAKCL
Sbjct  44   SNKEMSAPVAEGNEAHALTGHIISTTIGGKNGEPKRTISYMAERVVGTGSFGIVFQAKCL  103

Query  385  KTGETVAIKKVLQDRRYKNRELXLMRLMDHPNVISLKHCFFST  513
            +TGE VAIKKVLQDRRYKNREL LMR+MDHPNVISL+HCFFST
Sbjct  104  ETGEAVAIKKVLQDRRYKNRELQLMRMMDHPNVISLRHCFFST  146



>ref|XP_010052816.1| PREDICTED: shaggy-related protein kinase eta [Eucalyptus grandis]
 gb|KCW89654.1| hypothetical protein EUGRSUZ_A01926 [Eucalyptus grandis]
Length=419

 Score =   188 bits (478),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 87/103 (84%), Positives = 96/103 (93%), Gaps = 0/103 (0%)
 Frame = +1

Query  205  METDKEMSAAVVEGNEAVTGHIISTTIGGKNGEPKRTITYMAERVVGTGSFGIVFQAKCL  384
            M+TDKE S +++E NEAVTG IISTTIGGKNGEPK+TI+Y AERVVGTGSFG+VFQAKCL
Sbjct  40   MDTDKEASPSIIENNEAVTGQIISTTIGGKNGEPKQTISYKAERVVGTGSFGVVFQAKCL  99

Query  385  KTGETVAIKKVLQDRRYKNRELXLMRLMDHPNVISLKHCFFST  513
            +TGE VAIKKVLQDRRYKNREL LMRLMDHPNV+SLKHCFFST
Sbjct  100  ETGEMVAIKKVLQDRRYKNRELQLMRLMDHPNVVSLKHCFFST  142



>ref|XP_009378930.1| PREDICTED: shaggy-related protein kinase zeta isoform X2 [Pyrus 
x bretschneideri]
Length=374

 Score =   187 bits (475),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 88/97 (91%), Positives = 94/97 (97%), Gaps = 0/97 (0%)
 Frame = +1

Query  223  MSAAVVEGNEAVTGHIISTTIGGKNGEPKRTITYMAERVVGTGSFGIVFQAKCLKTGETV  402
            MSA V+EGN+AVTGHIISTTIGGKNGEPKRTI+YMAERVVGTGSFGIVFQAKC++TGETV
Sbjct  1    MSAPVMEGNDAVTGHIISTTIGGKNGEPKRTISYMAERVVGTGSFGIVFQAKCIETGETV  60

Query  403  AIKKVLQDRRYKNRELXLMRLMDHPNVISLKHCFFST  513
            AIKKVLQDRRYKNREL LMRLMDHPNV+ LKHCFFST
Sbjct  61   AIKKVLQDRRYKNRELQLMRLMDHPNVVLLKHCFFST  97



>emb|CDY34051.1| BnaC03g62810D [Brassica napus]
Length=380

 Score =   187 bits (475),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 88/103 (85%), Positives = 96/103 (93%), Gaps = 0/103 (0%)
 Frame = +1

Query  205  METDKEMSAAVVEGNEAVTGHIISTTIGGKNGEPKRTITYMAERVVGTGSFGIVFQAKCL  384
            M  DKE+ AAVV G++ VTGHIISTTIGGKNGEPK+TI+YMAERVVGTGSFGIVFQAKCL
Sbjct  1    MADDKEVPAAVVNGHDQVTGHIISTTIGGKNGEPKQTISYMAERVVGTGSFGIVFQAKCL  60

Query  385  KTGETVAIKKVLQDRRYKNRELXLMRLMDHPNVISLKHCFFST  513
            +TGETVAIKKVLQDRRYKNREL LMR+MDHPNV+ LKHCFFST
Sbjct  61   ETGETVAIKKVLQDRRYKNRELQLMRVMDHPNVVCLKHCFFST  103



>ref|XP_009394828.1| PREDICTED: shaggy-related protein kinase eta [Musa acuminata 
subsp. malaccensis]
Length=406

 Score =   188 bits (477),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 91/105 (87%), Positives = 97/105 (92%), Gaps = 3/105 (3%)
 Frame = +1

Query  199  PEMETDKEMSAAVVEGNEAVTGHIISTTIGGKNGEPKRTITYMAERVVGTGSFGIVFQAK  378
            PEM  DK   A+VVEGN+AVTGHIISTTIGGKNGEPK+TI+YMAERVVG GSFGIVFQAK
Sbjct  28   PEMAQDK---ASVVEGNDAVTGHIISTTIGGKNGEPKQTISYMAERVVGNGSFGIVFQAK  84

Query  379  CLKTGETVAIKKVLQDRRYKNRELXLMRLMDHPNVISLKHCFFST  513
            CL+TGETVAIKKVLQDRRYKNREL LMR +DHPNVISLKHCFFST
Sbjct  85   CLETGETVAIKKVLQDRRYKNRELQLMRSIDHPNVISLKHCFFST  129



>ref|XP_010924595.1| PREDICTED: shaggy-related protein kinase eta-like [Elaeis guineensis]
Length=406

 Score =   188 bits (477),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 89/105 (85%), Positives = 98/105 (93%), Gaps = 2/105 (2%)
 Frame = +1

Query  199  PEMETDKEMSAAVVEGNEAVTGHIISTTIGGKNGEPKRTITYMAERVVGTGSFGIVFQAK  378
            PEM  DK+  A+++EGN+ VTGHIISTTIGGKNGEPK+TI+YMAERVVGTGSFGIVFQAK
Sbjct  27   PEMAEDKQ--ASIIEGNDPVTGHIISTTIGGKNGEPKQTISYMAERVVGTGSFGIVFQAK  84

Query  379  CLKTGETVAIKKVLQDRRYKNRELXLMRLMDHPNVISLKHCFFST  513
            CL+TGETVAIKKVLQDRRYKNREL LMR MDHPNVI+LKHCFFST
Sbjct  85   CLETGETVAIKKVLQDRRYKNRELQLMRSMDHPNVITLKHCFFST  129



>ref|XP_009619543.1| PREDICTED: shaggy-related protein kinase eta [Nicotiana tomentosiformis]
Length=382

 Score =   187 bits (474),  Expect = 4e-54, Method: Compositional matrix adjust.
 Identities = 86/103 (83%), Positives = 96/103 (93%), Gaps = 0/103 (0%)
 Frame = +1

Query  205  METDKEMSAAVVEGNEAVTGHIISTTIGGKNGEPKRTITYMAERVVGTGSFGIVFQAKCL  384
            M  DKEMSA V++GN+AVTGHIISTTIGGKNGEPK+T++YMAERVVGTGSFGIVFQAKCL
Sbjct  1    MADDKEMSAPVMDGNDAVTGHIISTTIGGKNGEPKQTVSYMAERVVGTGSFGIVFQAKCL  60

Query  385  KTGETVAIKKVLQDRRYKNRELXLMRLMDHPNVISLKHCFFST  513
            + GETVAIKKVLQDRRYKNREL LMR +DHPNV+ LKHCF+ST
Sbjct  61   ENGETVAIKKVLQDRRYKNRELQLMRTLDHPNVVCLKHCFYST  103



>ref|XP_009781118.1| PREDICTED: shaggy-related protein kinase eta [Nicotiana sylvestris]
Length=382

 Score =   187 bits (474),  Expect = 4e-54, Method: Compositional matrix adjust.
 Identities = 86/103 (83%), Positives = 96/103 (93%), Gaps = 0/103 (0%)
 Frame = +1

Query  205  METDKEMSAAVVEGNEAVTGHIISTTIGGKNGEPKRTITYMAERVVGTGSFGIVFQAKCL  384
            M  DKEMSA V++GN+AVTGHIISTTIGGKNGEPK+T++YMAERVVGTGSFGIVFQAKCL
Sbjct  1    MADDKEMSAPVMDGNDAVTGHIISTTIGGKNGEPKQTVSYMAERVVGTGSFGIVFQAKCL  60

Query  385  KTGETVAIKKVLQDRRYKNRELXLMRLMDHPNVISLKHCFFST  513
            + GETVAIKKVLQDRRYKNREL LMR +DHPNV+ LKHCF+ST
Sbjct  61   ENGETVAIKKVLQDRRYKNRELQLMRTLDHPNVVCLKHCFYST  103



>ref|XP_010920339.1| PREDICTED: shaggy-related protein kinase eta [Elaeis guineensis]
Length=406

 Score =   187 bits (476),  Expect = 4e-54, Method: Compositional matrix adjust.
 Identities = 90/105 (86%), Positives = 97/105 (92%), Gaps = 2/105 (2%)
 Frame = +1

Query  199  PEMETDKEMSAAVVEGNEAVTGHIISTTIGGKNGEPKRTITYMAERVVGTGSFGIVFQAK  378
            PEM  DK+  A+V+EGN+ VTGHIISTTIGGKNGEPK+TI+YMAERVVGTGSFGIVFQAK
Sbjct  27   PEMAEDKQ--ASVIEGNDQVTGHIISTTIGGKNGEPKQTISYMAERVVGTGSFGIVFQAK  84

Query  379  CLKTGETVAIKKVLQDRRYKNRELXLMRLMDHPNVISLKHCFFST  513
            CL+T ETVAIKKVLQDRRYKNREL LMR MDHPNVISLKHCFFST
Sbjct  85   CLETQETVAIKKVLQDRRYKNRELQLMRTMDHPNVISLKHCFFST  129



>ref|XP_008790026.1| PREDICTED: shaggy-related protein kinase eta-like [Phoenix dactylifera]
Length=403

 Score =   187 bits (475),  Expect = 5e-54, Method: Compositional matrix adjust.
 Identities = 93/105 (89%), Positives = 96/105 (91%), Gaps = 2/105 (2%)
 Frame = +1

Query  199  PEMETDKEMSAAVVEGNEAVTGHIISTTIGGKNGEPKRTITYMAERVVGTGSFGIVFQAK  378
            PEM  DKE  A+VVEGN  VTGHIISTTIGGKNGE KRTI+YMAERVVGTGSFGIVFQAK
Sbjct  24   PEMAEDKE--ASVVEGNGPVTGHIISTTIGGKNGEAKRTISYMAERVVGTGSFGIVFQAK  81

Query  379  CLKTGETVAIKKVLQDRRYKNRELXLMRLMDHPNVISLKHCFFST  513
            CL+TGETVAIKKVLQDRRYKNREL LMR MDHPNVISLKHCFFST
Sbjct  82   CLETGETVAIKKVLQDRRYKNRELQLMRSMDHPNVISLKHCFFST  126



>ref|XP_003542973.1| PREDICTED: shaggy-related protein kinase eta-like isoform X1 
[Glycine max]
 gb|KHN08421.1| Shaggy-related protein kinase eta [Glycine soja]
Length=380

 Score =   186 bits (473),  Expect = 5e-54, Method: Compositional matrix adjust.
 Identities = 86/103 (83%), Positives = 97/103 (94%), Gaps = 0/103 (0%)
 Frame = +1

Query  205  METDKEMSAAVVEGNEAVTGHIISTTIGGKNGEPKRTITYMAERVVGTGSFGIVFQAKCL  384
            M  DKEMS++V  G++++TGHIISTTIGGKNGEPK+TI+YMAERVVGTGSFGIVFQAKCL
Sbjct  1    MAEDKEMSSSVTNGDDSLTGHIISTTIGGKNGEPKQTISYMAERVVGTGSFGIVFQAKCL  60

Query  385  KTGETVAIKKVLQDRRYKNRELXLMRLMDHPNVISLKHCFFST  513
            +TGE VAIKKVLQDRRYKNREL LMR++DHPNVISLKHCFFST
Sbjct  61   ETGEAVAIKKVLQDRRYKNRELQLMRVLDHPNVISLKHCFFST  103



>gb|KDO77890.1| hypothetical protein CISIN_1g016950mg [Citrus sinensis]
Length=374

 Score =   186 bits (473),  Expect = 6e-54, Method: Compositional matrix adjust.
 Identities = 88/97 (91%), Positives = 95/97 (98%), Gaps = 0/97 (0%)
 Frame = +1

Query  223  MSAAVVEGNEAVTGHIISTTIGGKNGEPKRTITYMAERVVGTGSFGIVFQAKCLKTGETV  402
            MSAAVV+G++ VTGHIISTTIGGKNGEPK+TI+YMAERVVGTGSFGIVFQAKCL+TGETV
Sbjct  1    MSAAVVDGSDHVTGHIISTTIGGKNGEPKQTISYMAERVVGTGSFGIVFQAKCLETGETV  60

Query  403  AIKKVLQDRRYKNRELXLMRLMDHPNVISLKHCFFST  513
            AIKKVLQDRRYKNREL LMR+MDHPNVISLKHCFFST
Sbjct  61   AIKKVLQDRRYKNRELQLMRVMDHPNVISLKHCFFST  97



>ref|XP_010655538.1| PREDICTED: shaggy-related protein kinase eta isoform X2 [Vitis 
vinifera]
Length=376

 Score =   186 bits (472),  Expect = 7e-54, Method: Compositional matrix adjust.
 Identities = 88/98 (90%), Positives = 94/98 (96%), Gaps = 0/98 (0%)
 Frame = +1

Query  220  EMSAAVVEGNEAVTGHIISTTIGGKNGEPKRTITYMAERVVGTGSFGIVFQAKCLKTGET  399
            E+SA VV+GN+ VTGHIISTTIGGKNGEPK+TI+YMAERVVGTGSFGIVFQAKCL+TGET
Sbjct  2    EISAPVVDGNDPVTGHIISTTIGGKNGEPKQTISYMAERVVGTGSFGIVFQAKCLETGET  61

Query  400  VAIKKVLQDRRYKNRELXLMRLMDHPNVISLKHCFFST  513
            VAIKKVLQDRRYKNREL LMR MDHPNVISLKHCFFST
Sbjct  62   VAIKKVLQDRRYKNRELQLMRTMDHPNVISLKHCFFST  99



>ref|XP_003546036.1| PREDICTED: shaggy-related protein kinase eta-like [Glycine max]
Length=380

 Score =   186 bits (473),  Expect = 7e-54, Method: Compositional matrix adjust.
 Identities = 86/103 (83%), Positives = 97/103 (94%), Gaps = 0/103 (0%)
 Frame = +1

Query  205  METDKEMSAAVVEGNEAVTGHIISTTIGGKNGEPKRTITYMAERVVGTGSFGIVFQAKCL  384
            M  DKEMS++V  G++++TGHIISTTIGGKNGEPK+TI+YMAERVVGTGSFGIVFQAKCL
Sbjct  1    MTEDKEMSSSVTNGDDSLTGHIISTTIGGKNGEPKQTISYMAERVVGTGSFGIVFQAKCL  60

Query  385  KTGETVAIKKVLQDRRYKNRELXLMRLMDHPNVISLKHCFFST  513
            +TGE VAIKKVLQDRRYKNREL LMR++DHPNVISLKHCFFST
Sbjct  61   ETGEAVAIKKVLQDRRYKNRELQLMRVLDHPNVISLKHCFFST  103



>ref|XP_006449528.1| hypothetical protein CICLE_v10015608mg [Citrus clementina]
 gb|ESR62768.1| hypothetical protein CICLE_v10015608mg [Citrus clementina]
Length=374

 Score =   186 bits (472),  Expect = 7e-54, Method: Compositional matrix adjust.
 Identities = 88/97 (91%), Positives = 95/97 (98%), Gaps = 0/97 (0%)
 Frame = +1

Query  223  MSAAVVEGNEAVTGHIISTTIGGKNGEPKRTITYMAERVVGTGSFGIVFQAKCLKTGETV  402
            MSAAVV+G++ VTGHIISTTIGGKNGEPK+TI+YMAERVVGTGSFGIVFQAKCL+TGETV
Sbjct  1    MSAAVVDGSDHVTGHIISTTIGGKNGEPKQTISYMAERVVGTGSFGIVFQAKCLETGETV  60

Query  403  AIKKVLQDRRYKNRELXLMRLMDHPNVISLKHCFFST  513
            AIKKVLQDRRYKNREL LMR+MDHPNVISLKHCFFST
Sbjct  61   AIKKVLQDRRYKNRELQLMRVMDHPNVISLKHCFFST  97



>gb|AES66964.2| shaggy-like kinase dzeta [Medicago truncatula]
Length=372

 Score =   186 bits (471),  Expect = 9e-54, Method: Compositional matrix adjust.
 Identities = 87/97 (90%), Positives = 94/97 (97%), Gaps = 0/97 (0%)
 Frame = +1

Query  223  MSAAVVEGNEAVTGHIISTTIGGKNGEPKRTITYMAERVVGTGSFGIVFQAKCLKTGETV  402
            MSA+VV+ N+AVTGHIISTTIGGKNGEPKRTI+YMAERVVGTGSFGIVFQAKCL+TGE V
Sbjct  1    MSASVVDSNDAVTGHIISTTIGGKNGEPKRTISYMAERVVGTGSFGIVFQAKCLETGEAV  60

Query  403  AIKKVLQDRRYKNRELXLMRLMDHPNVISLKHCFFST  513
            AIKKVLQD+RYKNREL LMR+MDHPNVISLKHCFFST
Sbjct  61   AIKKVLQDKRYKNRELQLMRVMDHPNVISLKHCFFST  97



>ref|XP_010518815.1| PREDICTED: shaggy-related protein kinase eta isoform X1 [Tarenaya 
hassleriana]
Length=380

 Score =   186 bits (472),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 87/103 (84%), Positives = 97/103 (94%), Gaps = 0/103 (0%)
 Frame = +1

Query  205  METDKEMSAAVVEGNEAVTGHIISTTIGGKNGEPKRTITYMAERVVGTGSFGIVFQAKCL  384
            M  DKEMS AVV+G++ VTGHIISTTIGGKNGEPK+T++YMAE VVGTGSFGIVF+AKCL
Sbjct  1    MADDKEMSDAVVDGHDQVTGHIISTTIGGKNGEPKQTMSYMAESVVGTGSFGIVFRAKCL  60

Query  385  KTGETVAIKKVLQDRRYKNRELXLMRLMDHPNVISLKHCFFST  513
            +TGETVAIKKVLQDRRYKNREL LMR+MDHPNV+SLKHCFFST
Sbjct  61   ETGETVAIKKVLQDRRYKNRELQLMRVMDHPNVVSLKHCFFST  103



>ref|XP_010529206.1| PREDICTED: shaggy-related protein kinase eta-like isoform X2 
[Tarenaya hassleriana]
Length=374

 Score =   185 bits (470),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 87/97 (90%), Positives = 95/97 (98%), Gaps = 0/97 (0%)
 Frame = +1

Query  223  MSAAVVEGNEAVTGHIISTTIGGKNGEPKRTITYMAERVVGTGSFGIVFQAKCLKTGETV  402
            MSAAVV+G++ VTGHIISTTIGGKNGEPK+TI+YMAERVVGTGSFGIVFQAKCL+TGETV
Sbjct  1    MSAAVVDGHDQVTGHIISTTIGGKNGEPKQTISYMAERVVGTGSFGIVFQAKCLETGETV  60

Query  403  AIKKVLQDRRYKNRELXLMRLMDHPNVISLKHCFFST  513
            AIKKVLQDRRYKNREL LMR+MDHPNV+SLKHCFFST
Sbjct  61   AIKKVLQDRRYKNRELQLMRVMDHPNVVSLKHCFFST  97



>ref|XP_009108386.1| PREDICTED: shaggy-related protein kinase eta-like [Brassica rapa]
Length=380

 Score =   185 bits (470),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 87/103 (84%), Positives = 95/103 (92%), Gaps = 0/103 (0%)
 Frame = +1

Query  205  METDKEMSAAVVEGNEAVTGHIISTTIGGKNGEPKRTITYMAERVVGTGSFGIVFQAKCL  384
            M  DKE+  AVV G++ VTGHIISTTIGGKNGEPK+TI+YMAERVVGTGSFGIVFQAKCL
Sbjct  1    MADDKEVPGAVVNGHDQVTGHIISTTIGGKNGEPKQTISYMAERVVGTGSFGIVFQAKCL  60

Query  385  KTGETVAIKKVLQDRRYKNRELXLMRLMDHPNVISLKHCFFST  513
            +TGETVAIKKVLQDRRYKNREL LMR+MDHPNV+ LKHCFFST
Sbjct  61   ETGETVAIKKVLQDRRYKNRELQLMRVMDHPNVVCLKHCFFST  103



>ref|XP_011085977.1| PREDICTED: shaggy-related protein kinase eta isoform X1 [Sesamum 
indicum]
Length=382

 Score =   185 bits (469),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 86/103 (83%), Positives = 95/103 (92%), Gaps = 0/103 (0%)
 Frame = +1

Query  205  METDKEMSAAVVEGNEAVTGHIISTTIGGKNGEPKRTITYMAERVVGTGSFGIVFQAKCL  384
            M  DKEM A V++ N+ VTGHIISTTIGGKNGEPK+T++YMAERVVGTGSFGIVFQAKC+
Sbjct  1    MADDKEMHAPVMDRNDTVTGHIISTTIGGKNGEPKQTVSYMAERVVGTGSFGIVFQAKCI  60

Query  385  KTGETVAIKKVLQDRRYKNRELXLMRLMDHPNVISLKHCFFST  513
            +TGETVAIKKVLQDRRYKNREL LMR MDHPNV+SLKHCFFST
Sbjct  61   ETGETVAIKKVLQDRRYKNRELQLMRTMDHPNVVSLKHCFFST  103



>ref|NP_001054901.1| Os05g0207500 [Oryza sativa Japonica Group]
 gb|AAU90187.1| putative shaggy-related protein kinase [Oryza sativa Japonica 
Group]
 dbj|BAF16815.1| Os05g0207500 [Oryza sativa Japonica Group]
Length=402

 Score =   185 bits (470),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 88/99 (89%), Positives = 92/99 (93%), Gaps = 0/99 (0%)
 Frame = +1

Query  217  KEMSAAVVEGNEAVTGHIISTTIGGKNGEPKRTITYMAERVVGTGSFGIVFQAKCLKTGE  396
            +E  A   EGN+AVTGHIISTTIGGKNGEPKRTI+YMAERVVGTGSFGIVFQAKCL+TGE
Sbjct  28   QEGEAPYAEGNDAVTGHIISTTIGGKNGEPKRTISYMAERVVGTGSFGIVFQAKCLETGE  87

Query  397  TVAIKKVLQDRRYKNRELXLMRLMDHPNVISLKHCFFST  513
            TVAIKKVLQDRRYKNREL LMR MDHPNVISLKHCFFST
Sbjct  88   TVAIKKVLQDRRYKNRELQLMRAMDHPNVISLKHCFFST  126



>emb|CDY62551.1| BnaA03g58360D, partial [Brassica napus]
Length=264

 Score =   181 bits (460),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 85/99 (86%), Positives = 94/99 (95%), Gaps = 0/99 (0%)
 Frame = +1

Query  217  KEMSAAVVEGNEAVTGHIISTTIGGKNGEPKRTITYMAERVVGTGSFGIVFQAKCLKTGE  396
            +EM AAVV+G++ VTGHIISTTIGGKNGEPK+TI+YMAERVVGTGSFGIVFQAKCL+TGE
Sbjct  4    QEMPAAVVDGHDQVTGHIISTTIGGKNGEPKQTISYMAERVVGTGSFGIVFQAKCLETGE  63

Query  397  TVAIKKVLQDRRYKNRELXLMRLMDHPNVISLKHCFFST  513
            TVAIKK LQDRRYKNREL LMR+MDHPNV+ LKHCFFST
Sbjct  64   TVAIKKGLQDRRYKNRELQLMRVMDHPNVVCLKHCFFST  102



>ref|XP_010925615.1| PREDICTED: shaggy-related protein kinase eta-like [Elaeis guineensis]
Length=403

 Score =   185 bits (469),  Expect = 4e-53, Method: Compositional matrix adjust.
 Identities = 91/105 (87%), Positives = 95/105 (90%), Gaps = 2/105 (2%)
 Frame = +1

Query  199  PEMETDKEMSAAVVEGNEAVTGHIISTTIGGKNGEPKRTITYMAERVVGTGSFGIVFQAK  378
            PEM  DKE  A+VVEGN   TGHIISTTIGGKNGE KRTI+YMAERVVGTGSFG+VFQAK
Sbjct  24   PEMAEDKE--ASVVEGNGPATGHIISTTIGGKNGESKRTISYMAERVVGTGSFGVVFQAK  81

Query  379  CLKTGETVAIKKVLQDRRYKNRELXLMRLMDHPNVISLKHCFFST  513
            CL+TGETVAIKKVLQDRRYKNREL LMR MDHPNVISLKHCFFST
Sbjct  82   CLETGETVAIKKVLQDRRYKNRELQLMRSMDHPNVISLKHCFFST  126



>ref|XP_004293965.1| PREDICTED: shaggy-related protein kinase eta [Fragaria vesca 
subsp. vesca]
Length=379

 Score =   184 bits (468),  Expect = 4e-53, Method: Compositional matrix adjust.
 Identities = 88/103 (85%), Positives = 97/103 (94%), Gaps = 1/103 (1%)
 Frame = +1

Query  205  METDKEMSAAVVEGNEAVTGHIISTTIGGKNGEPKRTITYMAERVVGTGSFGIVFQAKCL  384
            M  DKEM+A+VV+G++  TGHIISTTIGGKNGEPK+TI+YMAERVVGTGSFGIVFQAKCL
Sbjct  1    MADDKEMAASVVDGSDP-TGHIISTTIGGKNGEPKQTISYMAERVVGTGSFGIVFQAKCL  59

Query  385  KTGETVAIKKVLQDRRYKNRELXLMRLMDHPNVISLKHCFFST  513
            +TGETVAIKKVLQDRRYKNREL LMR+MDHPNVI LKHCFFST
Sbjct  60   ETGETVAIKKVLQDRRYKNRELQLMRVMDHPNVICLKHCFFST  102



>ref|XP_004233047.1| PREDICTED: shaggy-related protein kinase eta [Solanum lycopersicum]
 ref|XP_006358115.1| PREDICTED: shaggy-related protein kinase eta-like [Solanum tuberosum]
Length=382

 Score =   184 bits (468),  Expect = 4e-53, Method: Compositional matrix adjust.
 Identities = 86/103 (83%), Positives = 95/103 (92%), Gaps = 0/103 (0%)
 Frame = +1

Query  205  METDKEMSAAVVEGNEAVTGHIISTTIGGKNGEPKRTITYMAERVVGTGSFGIVFQAKCL  384
            M  DKEMSA V++GN+AVTGHIISTTIGGKNGEPK+T++YMAERVVGTGSFGIVFQAKCL
Sbjct  1    MADDKEMSAPVMDGNDAVTGHIISTTIGGKNGEPKQTVSYMAERVVGTGSFGIVFQAKCL  60

Query  385  KTGETVAIKKVLQDRRYKNRELXLMRLMDHPNVISLKHCFFST  513
            + GETVAIKKVLQDRRYKNREL LMR MDH NV+ LKHCF+ST
Sbjct  61   ENGETVAIKKVLQDRRYKNRELQLMRTMDHTNVVCLKHCFYST  103



>emb|CDX99437.1| BnaC01g11150D [Brassica napus]
Length=381

 Score =   184 bits (468),  Expect = 4e-53, Method: Compositional matrix adjust.
 Identities = 88/104 (85%), Positives = 97/104 (93%), Gaps = 1/104 (1%)
 Frame = +1

Query  205  METDKEMS-AAVVEGNEAVTGHIISTTIGGKNGEPKRTITYMAERVVGTGSFGIVFQAKC  381
            M  D+EM  AAVV+G++ VTGHIISTTIGGKNGEPK+TI+YMAERVVGTGSFGIVFQAKC
Sbjct  1    MADDREMPPAAVVDGHDQVTGHIISTTIGGKNGEPKQTISYMAERVVGTGSFGIVFQAKC  60

Query  382  LKTGETVAIKKVLQDRRYKNRELXLMRLMDHPNVISLKHCFFST  513
            L+TGETVAIKKVLQDRRYKNREL LMR+MDHPNV+ LKHCFFST
Sbjct  61   LETGETVAIKKVLQDRRYKNRELQLMRVMDHPNVVCLKHCFFST  104



>ref|XP_010915474.1| PREDICTED: shaggy-related protein kinase eta-like [Elaeis guineensis]
Length=403

 Score =   185 bits (469),  Expect = 4e-53, Method: Compositional matrix adjust.
 Identities = 91/105 (87%), Positives = 95/105 (90%), Gaps = 2/105 (2%)
 Frame = +1

Query  199  PEMETDKEMSAAVVEGNEAVTGHIISTTIGGKNGEPKRTITYMAERVVGTGSFGIVFQAK  378
            PEM  DKE  A+V+EGN  VTGHIISTTIGGKNGE KRTI+YMAERVVGTGSFGIVFQAK
Sbjct  24   PEMAEDKE--ASVIEGNGPVTGHIISTTIGGKNGEAKRTISYMAERVVGTGSFGIVFQAK  81

Query  379  CLKTGETVAIKKVLQDRRYKNRELXLMRLMDHPNVISLKHCFFST  513
            CL+TGE VAIKKVLQDRRYKNREL LMR MDHPNVISLKHCFFST
Sbjct  82   CLETGEIVAIKKVLQDRRYKNRELQLMRSMDHPNVISLKHCFFST  126



>ref|XP_004134656.1| PREDICTED: shaggy-related protein kinase eta-like [Cucumis sativus]
 ref|XP_004163355.1| PREDICTED: shaggy-related protein kinase eta-like [Cucumis sativus]
 gb|KGN49313.1| hypothetical protein Csa_6G519650 [Cucumis sativus]
Length=379

 Score =   183 bits (465),  Expect = 9e-53, Method: Compositional matrix adjust.
 Identities = 86/103 (83%), Positives = 94/103 (91%), Gaps = 0/103 (0%)
 Frame = +1

Query  205  METDKEMSAAVVEGNEAVTGHIISTTIGGKNGEPKRTITYMAERVVGTGSFGIVFQAKCL  384
            M   KEM   V++GN+ VTGHIISTTIGGKNGEPK+TI+YMAERVVGTGSFGIVF+AKCL
Sbjct  1    MADVKEMPGPVIDGNDPVTGHIISTTIGGKNGEPKQTISYMAERVVGTGSFGIVFKAKCL  60

Query  385  KTGETVAIKKVLQDRRYKNRELXLMRLMDHPNVISLKHCFFST  513
            +TGE VAIKKVLQDRRYKNREL LMR+MDHPNVISLKHCFFST
Sbjct  61   ETGENVAIKKVLQDRRYKNRELQLMRVMDHPNVISLKHCFFST  103



>gb|KJB34900.1| hypothetical protein B456_006G089300 [Gossypium raimondii]
Length=382

 Score =   183 bits (465),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 88/104 (85%), Positives = 97/104 (93%), Gaps = 1/104 (1%)
 Frame = +1

Query  205  METDK-EMSAAVVEGNEAVTGHIISTTIGGKNGEPKRTITYMAERVVGTGSFGIVFQAKC  381
            M  DK E+SA VV+ N+ VTGH+ISTTIGGKNGEPK+TI+YMAERVVGTGSFGIVFQAKC
Sbjct  1    MADDKQEISAPVVDVNDPVTGHVISTTIGGKNGEPKQTISYMAERVVGTGSFGIVFQAKC  60

Query  382  LKTGETVAIKKVLQDRRYKNRELXLMRLMDHPNVISLKHCFFST  513
            L+TGETVAIKKVLQDRRYKNREL LMR++DHPNVISLKHCFFST
Sbjct  61   LETGETVAIKKVLQDRRYKNRELQLMRVLDHPNVISLKHCFFST  104



>ref|XP_009351457.1| PREDICTED: shaggy-related protein kinase eta [Pyrus x bretschneideri]
Length=378

 Score =   183 bits (465),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 87/103 (84%), Positives = 97/103 (94%), Gaps = 1/103 (1%)
 Frame = +1

Query  205  METDKEMSAAVVEGNEAVTGHIISTTIGGKNGEPKRTITYMAERVVGTGSFGIVFQAKCL  384
            M  DKE+SA VV+G++  TGHIISTTIGGKNGEPK+TI+YMAERVVGTGSFGIVFQAKCL
Sbjct  1    MADDKEISAPVVDGSDP-TGHIISTTIGGKNGEPKQTISYMAERVVGTGSFGIVFQAKCL  59

Query  385  KTGETVAIKKVLQDRRYKNRELXLMRLMDHPNVISLKHCFFST  513
            ++GETVAIKKVLQDRRYKNREL LMR+MDHPNV+SLKHCFFST
Sbjct  60   ESGETVAIKKVLQDRRYKNRELQLMRVMDHPNVVSLKHCFFST  102



>ref|XP_006833052.1| hypothetical protein AMTR_s00170p00028260 [Amborella trichopoda]
 gb|ERM98330.1| hypothetical protein AMTR_s00170p00028260 [Amborella trichopoda]
Length=355

 Score =   182 bits (463),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 85/103 (83%), Positives = 95/103 (92%), Gaps = 0/103 (0%)
 Frame = +1

Query  205  METDKEMSAAVVEGNEAVTGHIISTTIGGKNGEPKRTITYMAERVVGTGSFGIVFQAKCL  384
            M  +KE+SA+VVEG +  TGHIIS TIGGKNGEPK+TI+YMAERVVGTGSFG+VFQAKCL
Sbjct  1    MADEKEVSASVVEGTDTETGHIISITIGGKNGEPKQTISYMAERVVGTGSFGVVFQAKCL  60

Query  385  KTGETVAIKKVLQDRRYKNRELXLMRLMDHPNVISLKHCFFST  513
            +TGETVAIKKVLQDRRYKNREL LMR MDHPNV+SLKHCF+ST
Sbjct  61   ETGETVAIKKVLQDRRYKNRELQLMRCMDHPNVVSLKHCFYST  103



>ref|XP_008225315.1| PREDICTED: shaggy-related protein kinase eta [Prunus mume]
Length=379

 Score =   183 bits (465),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 87/103 (84%), Positives = 97/103 (94%), Gaps = 1/103 (1%)
 Frame = +1

Query  205  METDKEMSAAVVEGNEAVTGHIISTTIGGKNGEPKRTITYMAERVVGTGSFGIVFQAKCL  384
            M  DKE+SA VV+G++  TGHIISTTIGGKNGEPK+TI+YMAERVVGTGSFGIVFQAKCL
Sbjct  1    MADDKEISAPVVDGSDP-TGHIISTTIGGKNGEPKQTISYMAERVVGTGSFGIVFQAKCL  59

Query  385  KTGETVAIKKVLQDRRYKNRELXLMRLMDHPNVISLKHCFFST  513
            ++GETVAIKKVLQDRRYKNREL LMR+MDHPNV+SLKHCFFST
Sbjct  60   ESGETVAIKKVLQDRRYKNRELQLMRVMDHPNVVSLKHCFFST  102



>ref|XP_010439822.1| PREDICTED: shaggy-related protein kinase eta-like [Camelina sativa]
Length=381

 Score =   183 bits (465),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 88/104 (85%), Positives = 96/104 (92%), Gaps = 1/104 (1%)
 Frame = +1

Query  205  METDKEMSAAVVEG-NEAVTGHIISTTIGGKNGEPKRTITYMAERVVGTGSFGIVFQAKC  381
            M  DKEM  AVV+G ++ VTGHIISTTIGGKNGEPK+TI+YMAERVVGTGSFGIVFQAKC
Sbjct  1    MADDKEMPDAVVDGGHDQVTGHIISTTIGGKNGEPKQTISYMAERVVGTGSFGIVFQAKC  60

Query  382  LKTGETVAIKKVLQDRRYKNRELXLMRLMDHPNVISLKHCFFST  513
            L+TGETVAIKKVLQDRRYKNREL LMR+MDHPNV+ LKHCFFST
Sbjct  61   LETGETVAIKKVLQDRRYKNRELQLMRVMDHPNVVCLKHCFFST  104



>ref|XP_007211435.1| hypothetical protein PRUPE_ppa007161mg [Prunus persica]
 gb|EMJ12634.1| hypothetical protein PRUPE_ppa007161mg [Prunus persica]
Length=379

 Score =   183 bits (464),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 87/103 (84%), Positives = 97/103 (94%), Gaps = 1/103 (1%)
 Frame = +1

Query  205  METDKEMSAAVVEGNEAVTGHIISTTIGGKNGEPKRTITYMAERVVGTGSFGIVFQAKCL  384
            M  DKE+SA VV+G++  TGHIISTTIGGKNGEPK+TI+YMAERVVGTGSFGIVFQAKCL
Sbjct  1    MADDKEISAPVVDGSDP-TGHIISTTIGGKNGEPKQTISYMAERVVGTGSFGIVFQAKCL  59

Query  385  KTGETVAIKKVLQDRRYKNRELXLMRLMDHPNVISLKHCFFST  513
            ++GETVAIKKVLQDRRYKNREL LMR+MDHPNV+SLKHCFFST
Sbjct  60   ESGETVAIKKVLQDRRYKNRELQLMRVMDHPNVVSLKHCFFST  102



>ref|XP_010496879.1| PREDICTED: shaggy-related protein kinase eta-like [Camelina sativa]
Length=381

 Score =   183 bits (464),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 88/104 (85%), Positives = 96/104 (92%), Gaps = 1/104 (1%)
 Frame = +1

Query  205  METDKEMSAAVVEG-NEAVTGHIISTTIGGKNGEPKRTITYMAERVVGTGSFGIVFQAKC  381
            M  DKEM  AVV+G ++ VTGHIISTTIGGKNGEPK+TI+YMAERVVGTGSFGIVFQAKC
Sbjct  1    MADDKEMPDAVVDGGHDQVTGHIISTTIGGKNGEPKQTISYMAERVVGTGSFGIVFQAKC  60

Query  382  LKTGETVAIKKVLQDRRYKNRELXLMRLMDHPNVISLKHCFFST  513
            L+TGETVAIKKVLQDRRYKNREL LMR+MDHPNV+ LKHCFFST
Sbjct  61   LETGETVAIKKVLQDRRYKNRELQLMRVMDHPNVVCLKHCFFST  104



>ref|XP_008371494.1| PREDICTED: shaggy-related protein kinase eta-like [Malus domestica]
Length=378

 Score =   183 bits (464),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 87/103 (84%), Positives = 97/103 (94%), Gaps = 1/103 (1%)
 Frame = +1

Query  205  METDKEMSAAVVEGNEAVTGHIISTTIGGKNGEPKRTITYMAERVVGTGSFGIVFQAKCL  384
            M  DKE+SA VV+G++  TGHIISTTIGGKNGEPK+TI+YMAERVVGTGSFGIVFQAKCL
Sbjct  1    MADDKEISAPVVDGSDP-TGHIISTTIGGKNGEPKQTISYMAERVVGTGSFGIVFQAKCL  59

Query  385  KTGETVAIKKVLQDRRYKNRELXLMRLMDHPNVISLKHCFFST  513
            ++GETVAIKKVLQDRRYKNREL LMR+MDHPNV+SLKHCFFST
Sbjct  60   ESGETVAIKKVLQDRRYKNRELQLMRVMDHPNVVSLKHCFFST  102



>ref|XP_010449479.1| PREDICTED: shaggy-related protein kinase eta [Camelina sativa]
Length=381

 Score =   183 bits (464),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 88/104 (85%), Positives = 96/104 (92%), Gaps = 1/104 (1%)
 Frame = +1

Query  205  METDKEMSAAVVEG-NEAVTGHIISTTIGGKNGEPKRTITYMAERVVGTGSFGIVFQAKC  381
            M  DKEM  AVV+G ++ VTGHIISTTIGGKNGEPK+TI+YMAERVVGTGSFGIVFQAKC
Sbjct  1    MADDKEMPDAVVDGGHDQVTGHIISTTIGGKNGEPKQTISYMAERVVGTGSFGIVFQAKC  60

Query  382  LKTGETVAIKKVLQDRRYKNRELXLMRLMDHPNVISLKHCFFST  513
            L+TGETVAIKKVLQDRRYKNREL LMR+MDHPNV+ LKHCFFST
Sbjct  61   LETGETVAIKKVLQDRRYKNRELQLMRVMDHPNVVCLKHCFFST  104



>ref|XP_008383613.1| PREDICTED: shaggy-related protein kinase eta [Malus domestica]
 ref|XP_008366041.1| PREDICTED: shaggy-related protein kinase eta [Malus domestica]
Length=379

 Score =   183 bits (464),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 87/103 (84%), Positives = 97/103 (94%), Gaps = 1/103 (1%)
 Frame = +1

Query  205  METDKEMSAAVVEGNEAVTGHIISTTIGGKNGEPKRTITYMAERVVGTGSFGIVFQAKCL  384
            M  DKE+SA VV+G++  TGHIISTTIGGKNGEPK+TI+YMAERVVGTGSFGIVFQAKCL
Sbjct  1    MADDKEISAPVVDGSDP-TGHIISTTIGGKNGEPKQTISYMAERVVGTGSFGIVFQAKCL  59

Query  385  KTGETVAIKKVLQDRRYKNRELXLMRLMDHPNVISLKHCFFST  513
            ++GETVAIKKVLQDRRYKNREL LMR+MDHPNV+SLKHCFFST
Sbjct  60   ESGETVAIKKVLQDRRYKNRELQLMRVMDHPNVVSLKHCFFST  102



>gb|KCW47359.1| hypothetical protein EUGRSUZ_K01144 [Eucalyptus grandis]
Length=378

 Score =   182 bits (463),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 81/102 (79%), Positives = 95/102 (93%), Gaps = 0/102 (0%)
 Frame = +1

Query  208  ETDKEMSAAVVEGNEAVTGHIISTTIGGKNGEPKRTITYMAERVVGTGSFGIVFQAKCLK  387
            ++D+E+S AV E   AVTGHIISTTIGGKNGEPK+T++YMAER++G GSFG+VFQA+CL+
Sbjct  32   DSDREVSPAVYENKNAVTGHIISTTIGGKNGEPKQTLSYMAERIIGNGSFGVVFQARCLE  91

Query  388  TGETVAIKKVLQDRRYKNRELXLMRLMDHPNVISLKHCFFST  513
            TGETVAIKKVLQDRRYKNREL LMRLMDHPNV+SL+HCFFST
Sbjct  92   TGETVAIKKVLQDRRYKNRELQLMRLMDHPNVVSLRHCFFST  133



>ref|XP_009352741.1| PREDICTED: shaggy-related protein kinase eta-like [Pyrus x bretschneideri]
Length=379

 Score =   182 bits (463),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 87/103 (84%), Positives = 97/103 (94%), Gaps = 1/103 (1%)
 Frame = +1

Query  205  METDKEMSAAVVEGNEAVTGHIISTTIGGKNGEPKRTITYMAERVVGTGSFGIVFQAKCL  384
            M  DKE+SA VV+G++  TGHIISTTIGGKNGEPK+TI+YMAERVVGTGSFGIVFQAKCL
Sbjct  1    MAEDKEISAPVVDGSDP-TGHIISTTIGGKNGEPKQTISYMAERVVGTGSFGIVFQAKCL  59

Query  385  KTGETVAIKKVLQDRRYKNRELXLMRLMDHPNVISLKHCFFST  513
            ++GETVAIKKVLQDRRYKNREL LMR+MDHPNV+SLKHCFFST
Sbjct  60   ESGETVAIKKVLQDRRYKNRELQLMRVMDHPNVVSLKHCFFST  102



>ref|XP_009394192.1| PREDICTED: shaggy-related protein kinase eta-like [Musa acuminata 
subsp. malaccensis]
Length=410

 Score =   183 bits (465),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 89/104 (86%), Positives = 96/104 (92%), Gaps = 2/104 (2%)
 Frame = +1

Query  202  EMETDKEMSAAVVEGNEAVTGHIISTTIGGKNGEPKRTITYMAERVVGTGSFGIVFQAKC  381
            EM  DK+  A+V+EGN+AVTGHIISTTIGGKNGEPK+TI+YMAERVVG GSFGIVFQAKC
Sbjct  32   EMAEDKQ--ASVMEGNDAVTGHIISTTIGGKNGEPKQTISYMAERVVGNGSFGIVFQAKC  89

Query  382  LKTGETVAIKKVLQDRRYKNRELXLMRLMDHPNVISLKHCFFST  513
            L+T ETVAIKKVLQDRRYKNREL LMR MDHPNVISLKHCFFST
Sbjct  90   LETRETVAIKKVLQDRRYKNRELQLMRSMDHPNVISLKHCFFST  133



>gb|KHN29604.1| Shaggy-related protein kinase eta [Glycine soja]
Length=374

 Score =   182 bits (462),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 84/97 (87%), Positives = 93/97 (96%), Gaps = 0/97 (0%)
 Frame = +1

Query  223  MSAAVVEGNEAVTGHIISTTIGGKNGEPKRTITYMAERVVGTGSFGIVFQAKCLKTGETV  402
            MS +V+ GN+++TGHIISTTIGGKNGEPK+TI+YMAERVVGTGSFGIVFQAKCL+TGE V
Sbjct  1    MSTSVINGNDSLTGHIISTTIGGKNGEPKQTISYMAERVVGTGSFGIVFQAKCLETGEAV  60

Query  403  AIKKVLQDRRYKNRELXLMRLMDHPNVISLKHCFFST  513
            AIKKVLQDRRYKNREL LMR+MDHPNVISLKHCFFST
Sbjct  61   AIKKVLQDRRYKNRELQLMRVMDHPNVISLKHCFFST  97



>emb|CDX78886.1| BnaA01g09530D [Brassica napus]
Length=374

 Score =   182 bits (462),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 85/97 (88%), Positives = 93/97 (96%), Gaps = 0/97 (0%)
 Frame = +1

Query  223  MSAAVVEGNEAVTGHIISTTIGGKNGEPKRTITYMAERVVGTGSFGIVFQAKCLKTGETV  402
            M AAVV+G++ VTGHIISTTIGGKNGEPK+TI+YMAERVVGTGSFGIVFQAKCL+TGETV
Sbjct  1    MPAAVVDGHDQVTGHIISTTIGGKNGEPKQTISYMAERVVGTGSFGIVFQAKCLETGETV  60

Query  403  AIKKVLQDRRYKNRELXLMRLMDHPNVISLKHCFFST  513
            AIKKVLQDRRYKNREL LMR+MDHPNV+ LKHCFFST
Sbjct  61   AIKKVLQDRRYKNRELQLMRVMDHPNVVCLKHCFFST  97



>dbj|BAH57105.1| AT4G18710 [Arabidopsis thaliana]
Length=374

 Score =   182 bits (462),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 85/97 (88%), Positives = 93/97 (96%), Gaps = 0/97 (0%)
 Frame = +1

Query  223  MSAAVVEGNEAVTGHIISTTIGGKNGEPKRTITYMAERVVGTGSFGIVFQAKCLKTGETV  402
            M AAVV+G++ VTGHIISTTIGGKNGEPK+TI+YMAERVVGTGSFGIVFQAKCL+TGETV
Sbjct  1    MPAAVVDGHDQVTGHIISTTIGGKNGEPKQTISYMAERVVGTGSFGIVFQAKCLETGETV  60

Query  403  AIKKVLQDRRYKNRELXLMRLMDHPNVISLKHCFFST  513
            AIKKVLQDRRYKNREL LMR+MDHPNV+ LKHCFFST
Sbjct  61   AIKKVLQDRRYKNRELQLMRVMDHPNVVCLKHCFFST  97



>emb|CDY64921.1| BnaC07g50210D [Brassica napus]
Length=374

 Score =   182 bits (462),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 85/97 (88%), Positives = 93/97 (96%), Gaps = 0/97 (0%)
 Frame = +1

Query  223  MSAAVVEGNEAVTGHIISTTIGGKNGEPKRTITYMAERVVGTGSFGIVFQAKCLKTGETV  402
            M AAVV+G++ VTGHIISTTIGGKNGEPK+TI+YMAERVVGTGSFGIVFQAKCL+TGETV
Sbjct  1    MPAAVVDGHDQVTGHIISTTIGGKNGEPKQTISYMAERVVGTGSFGIVFQAKCLETGETV  60

Query  403  AIKKVLQDRRYKNRELXLMRLMDHPNVISLKHCFFST  513
            AIKKVLQDRRYKNREL LMR+MDHPNV+ LKHCFFST
Sbjct  61   AIKKVLQDRRYKNRELQLMRVMDHPNVVRLKHCFFST  97



>gb|KHN07046.1| Shaggy-related protein kinase eta [Glycine soja]
Length=374

 Score =   182 bits (462),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 84/97 (87%), Positives = 93/97 (96%), Gaps = 0/97 (0%)
 Frame = +1

Query  223  MSAAVVEGNEAVTGHIISTTIGGKNGEPKRTITYMAERVVGTGSFGIVFQAKCLKTGETV  402
            MS +V+ GN+++TGHIISTTIGGKNGEPK+TI+YMAERVVGTGSFGIVFQAKCL+TGE V
Sbjct  1    MSTSVINGNDSLTGHIISTTIGGKNGEPKQTISYMAERVVGTGSFGIVFQAKCLETGEAV  60

Query  403  AIKKVLQDRRYKNRELXLMRLMDHPNVISLKHCFFST  513
            AIKKVLQDRRYKNREL LMR+MDHPNVISLKHCFFST
Sbjct  61   AIKKVLQDRRYKNRELQLMRVMDHPNVISLKHCFFST  97



>emb|CDY70859.1| BnaAnng35300D [Brassica napus]
Length=374

 Score =   182 bits (462),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 85/97 (88%), Positives = 93/97 (96%), Gaps = 0/97 (0%)
 Frame = +1

Query  223  MSAAVVEGNEAVTGHIISTTIGGKNGEPKRTITYMAERVVGTGSFGIVFQAKCLKTGETV  402
            M AAVV+G++ VTGHIISTTIGGKNGEPK+TI+YMAERVVGTGSFGIVFQAKCL+TGETV
Sbjct  1    MPAAVVDGHDQVTGHIISTTIGGKNGEPKQTISYMAERVVGTGSFGIVFQAKCLETGETV  60

Query  403  AIKKVLQDRRYKNRELXLMRLMDHPNVISLKHCFFST  513
            AIKKVLQDRRYKNREL LMR+MDHPNV+ LKHCFFST
Sbjct  61   AIKKVLQDRRYKNRELQLMRVMDHPNVVRLKHCFFST  97



>ref|XP_010538571.1| PREDICTED: shaggy-related protein kinase eta-like isoform X2 
[Tarenaya hassleriana]
Length=374

 Score =   181 bits (460),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 85/97 (88%), Positives = 94/97 (97%), Gaps = 0/97 (0%)
 Frame = +1

Query  223  MSAAVVEGNEAVTGHIISTTIGGKNGEPKRTITYMAERVVGTGSFGIVFQAKCLKTGETV  402
            MSAAVV+G++ VTGHIISTTIGGKNGEPK+TI+YMAERVVGTGSFG+VFQAKCL+T ETV
Sbjct  1    MSAAVVDGHDQVTGHIISTTIGGKNGEPKQTISYMAERVVGTGSFGVVFQAKCLETRETV  60

Query  403  AIKKVLQDRRYKNRELXLMRLMDHPNVISLKHCFFST  513
            AIKKVLQDRRYKNREL +MR+MDHPNVISLKHCFFST
Sbjct  61   AIKKVLQDRRYKNRELQIMRVMDHPNVISLKHCFFST  97



>ref|XP_010035873.1| PREDICTED: shaggy-related protein kinase eta-like [Eucalyptus 
grandis]
 gb|KCW47357.1| hypothetical protein EUGRSUZ_K01144 [Eucalyptus grandis]
Length=410

 Score =   182 bits (462),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 81/102 (79%), Positives = 95/102 (93%), Gaps = 0/102 (0%)
 Frame = +1

Query  208  ETDKEMSAAVVEGNEAVTGHIISTTIGGKNGEPKRTITYMAERVVGTGSFGIVFQAKCLK  387
            ++D+E+S AV E   AVTGHIISTTIGGKNGEPK+T++YMAER++G GSFG+VFQA+CL+
Sbjct  32   DSDREVSPAVYENKNAVTGHIISTTIGGKNGEPKQTLSYMAERIIGNGSFGVVFQARCLE  91

Query  388  TGETVAIKKVLQDRRYKNRELXLMRLMDHPNVISLKHCFFST  513
            TGETVAIKKVLQDRRYKNREL LMRLMDHPNV+SL+HCFFST
Sbjct  92   TGETVAIKKVLQDRRYKNRELQLMRLMDHPNVVSLRHCFFST  133



>gb|EPS63039.1| hypothetical protein M569_11747, partial [Genlisea aurea]
Length=344

 Score =   180 bits (457),  Expect = 5e-52, Method: Compositional matrix adjust.
 Identities = 83/98 (85%), Positives = 91/98 (93%), Gaps = 0/98 (0%)
 Frame = +1

Query  220  EMSAAVVEGNEAVTGHIISTTIGGKNGEPKRTITYMAERVVGTGSFGIVFQAKCLKTGET  399
            EMS +  + N+ VTGHIISTTIGGKNGEPKRTI+YMAERVVGTGSFGIVFQA+CL++GE 
Sbjct  1    EMSVSTADANDPVTGHIISTTIGGKNGEPKRTISYMAERVVGTGSFGIVFQARCLESGEY  60

Query  400  VAIKKVLQDRRYKNRELXLMRLMDHPNVISLKHCFFST  513
            VAIKKVLQDRRYKNREL +MRLMDHPNVISLKHCFFST
Sbjct  61   VAIKKVLQDRRYKNRELQIMRLMDHPNVISLKHCFFST  98



>gb|EYU28104.1| hypothetical protein MIMGU_mgv1a008133mg [Erythranthe guttata]
Length=383

 Score =   181 bits (459),  Expect = 7e-52, Method: Compositional matrix adjust.
 Identities = 85/104 (82%), Positives = 96/104 (92%), Gaps = 1/104 (1%)
 Frame = +1

Query  205  METDKEMSAA-VVEGNEAVTGHIISTTIGGKNGEPKRTITYMAERVVGTGSFGIVFQAKC  381
            M  DKEMSAA +++GN A  GHIISTTIGGKNGEPK+T++YMAERVVGTGSFG+VFQAKC
Sbjct  1    MADDKEMSAAPIMDGNGASIGHIISTTIGGKNGEPKQTVSYMAERVVGTGSFGVVFQAKC  60

Query  382  LKTGETVAIKKVLQDRRYKNRELXLMRLMDHPNVISLKHCFFST  513
            ++TGE+VAIKKVLQDRRYKNREL LMR MDHPNV+SLKHCFFST
Sbjct  61   IETGESVAIKKVLQDRRYKNRELQLMRTMDHPNVVSLKHCFFST  104



>ref|XP_009380485.1| PREDICTED: shaggy-related protein kinase eta-like [Musa acuminata 
subsp. malaccensis]
Length=406

 Score =   182 bits (461),  Expect = 7e-52, Method: Compositional matrix adjust.
 Identities = 86/105 (82%), Positives = 95/105 (90%), Gaps = 0/105 (0%)
 Frame = +1

Query  199  PEMETDKEMSAAVVEGNEAVTGHIISTTIGGKNGEPKRTITYMAERVVGTGSFGIVFQAK  378
            PEM    +  A+V++GN+ +TGHIISTTIGGKNGEPK+TI+YMAERVVGTGSFGIVFQAK
Sbjct  24   PEMVDADKQEASVIQGNQPLTGHIISTTIGGKNGEPKQTISYMAERVVGTGSFGIVFQAK  83

Query  379  CLKTGETVAIKKVLQDRRYKNRELXLMRLMDHPNVISLKHCFFST  513
            CL+TGETVAIKKVLQD RYKNREL LMRLM HPNVISLKHCFFST
Sbjct  84   CLETGETVAIKKVLQDIRYKNRELQLMRLMGHPNVISLKHCFFST  128



>gb|KJB68372.1| hypothetical protein B456_010G241600 [Gossypium raimondii]
Length=375

 Score =   181 bits (459),  Expect = 7e-52, Method: Compositional matrix adjust.
 Identities = 85/97 (88%), Positives = 92/97 (95%), Gaps = 0/97 (0%)
 Frame = +1

Query  223  MSAAVVEGNEAVTGHIISTTIGGKNGEPKRTITYMAERVVGTGSFGIVFQAKCLKTGETV  402
            MS  VV+ N+ VTGHIISTTIGGKNGEPK+TI+YMAERVVGTGSFGIVFQAKCL+TGETV
Sbjct  1    MSTPVVDRNDPVTGHIISTTIGGKNGEPKQTISYMAERVVGTGSFGIVFQAKCLETGETV  60

Query  403  AIKKVLQDRRYKNRELXLMRLMDHPNVISLKHCFFST  513
            AIKKVLQDRRYKNREL LMR++DHPNVISLKHCFFST
Sbjct  61   AIKKVLQDRRYKNRELQLMRVLDHPNVISLKHCFFST  97



>gb|EYU43326.1| hypothetical protein MIMGU_mgv1a008172mg [Erythranthe guttata]
Length=382

 Score =   181 bits (459),  Expect = 7e-52, Method: Compositional matrix adjust.
 Identities = 85/103 (83%), Positives = 94/103 (91%), Gaps = 0/103 (0%)
 Frame = +1

Query  205  METDKEMSAAVVEGNEAVTGHIISTTIGGKNGEPKRTITYMAERVVGTGSFGIVFQAKCL  384
            M  DKEMS  V++  +AVTGHIISTTIGGKNGEPK+T+TYMAERVVGTGSFGIVFQAKC+
Sbjct  1    MADDKEMSVPVMDRKDAVTGHIISTTIGGKNGEPKQTVTYMAERVVGTGSFGIVFQAKCI  60

Query  385  KTGETVAIKKVLQDRRYKNRELXLMRLMDHPNVISLKHCFFST  513
            +TGETVAIKKVLQDRRYKNREL LMR MDH NV+SLKHCF+ST
Sbjct  61   ETGETVAIKKVLQDRRYKNRELELMRTMDHSNVVSLKHCFYST  103



>gb|ACJ83284.1| unknown [Medicago truncatula]
Length=172

 Score =   175 bits (443),  Expect = 7e-52, Method: Compositional matrix adjust.
 Identities = 80/104 (77%), Positives = 93/104 (89%), Gaps = 0/104 (0%)
 Frame = +1

Query  202  EMETDKEMSAAVVEGNEAVTGHIISTTIGGKNGEPKRTITYMAERVVGTGSFGIVFQAKC  381
            ++  D+EM A VV+GN   TGHII TTIGG+NG+PK+TI+YMAERVVG GSFG+VFQAKC
Sbjct  35   KIRDDREMEATVVDGNGTETGHIIVTTIGGRNGQPKQTISYMAERVVGHGSFGVVFQAKC  94

Query  382  LKTGETVAIKKVLQDRRYKNRELXLMRLMDHPNVISLKHCFFST  513
            L+TGETVAIKKVLQD+RYKNREL  MRL+DHPNV+SLKHCFFST
Sbjct  95   LETGETVAIKKVLQDKRYKNRELQTMRLLDHPNVVSLKHCFFST  138



>ref|XP_008794094.1| PREDICTED: shaggy-related protein kinase eta [Phoenix dactylifera]
Length=403

 Score =   181 bits (460),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 90/105 (86%), Positives = 94/105 (90%), Gaps = 2/105 (2%)
 Frame = +1

Query  199  PEMETDKEMSAAVVEGNEAVTGHIISTTIGGKNGEPKRTITYMAERVVGTGSFGIVFQAK  378
            PEM  DKE  A+VVEGN   TGHIISTTI GKNGE KRTI+YMAERVVGTGSFGIVFQAK
Sbjct  24   PEMAEDKE--ASVVEGNGPATGHIISTTIVGKNGESKRTISYMAERVVGTGSFGIVFQAK  81

Query  379  CLKTGETVAIKKVLQDRRYKNRELXLMRLMDHPNVISLKHCFFST  513
            CL+TGETVAIKKVLQDRRYKNREL LMR MDHPN+ISLKHCFFST
Sbjct  82   CLETGETVAIKKVLQDRRYKNRELQLMRSMDHPNLISLKHCFFST  126



>ref|XP_009396521.1| PREDICTED: shaggy-related protein kinase eta-like [Musa acuminata 
subsp. malaccensis]
Length=410

 Score =   181 bits (459),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 89/105 (85%), Positives = 96/105 (91%), Gaps = 2/105 (2%)
 Frame = +1

Query  199  PEMETDKEMSAAVVEGNEAVTGHIISTTIGGKNGEPKRTITYMAERVVGTGSFGIVFQAK  378
            P M+ DK+ S  V+EGN+AVTGHIISTTIGGKNGEPK+TI+YMAERVVGTGSFGIVFQAK
Sbjct  31   PGMDEDKKTS--VLEGNDAVTGHIISTTIGGKNGEPKQTISYMAERVVGTGSFGIVFQAK  88

Query  379  CLKTGETVAIKKVLQDRRYKNRELXLMRLMDHPNVISLKHCFFST  513
            CL+TGETVAIKKVLQD RYKNREL LMR MDH NVISLKHCFFST
Sbjct  89   CLETGETVAIKKVLQDPRYKNRELQLMRSMDHSNVISLKHCFFST  133



>gb|KHN28622.1| Shaggy-related protein kinase eta [Glycine soja]
Length=374

 Score =   179 bits (454),  Expect = 4e-51, Method: Compositional matrix adjust.
 Identities = 82/97 (85%), Positives = 93/97 (96%), Gaps = 0/97 (0%)
 Frame = +1

Query  223  MSAAVVEGNEAVTGHIISTTIGGKNGEPKRTITYMAERVVGTGSFGIVFQAKCLKTGETV  402
            MS++V  G++++TGHIISTTIGGKNGEPK+TI+YMAERVVGTGSFGIVFQAKCL+TGE V
Sbjct  1    MSSSVTNGDDSLTGHIISTTIGGKNGEPKQTISYMAERVVGTGSFGIVFQAKCLETGEAV  60

Query  403  AIKKVLQDRRYKNRELXLMRLMDHPNVISLKHCFFST  513
            AIKKVLQDRRYKNREL LMR++DHPNVISLKHCFFST
Sbjct  61   AIKKVLQDRRYKNRELQLMRVLDHPNVISLKHCFFST  97



>ref|XP_002873682.1| kinase family protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH49941.1| kinase family protein [Arabidopsis lyrata subsp. lyrata]
Length=410

 Score =   180 bits (456),  Expect = 4e-51, Method: Compositional matrix adjust.
 Identities = 83/104 (80%), Positives = 95/104 (91%), Gaps = 0/104 (0%)
 Frame = +1

Query  202  EMETDKEMSAAVVEGNEAVTGHIISTTIGGKNGEPKRTITYMAERVVGTGSFGIVFQAKC  381
            +++ DKEM AAVV+GN   TGHII TTIGGKNG+PK+TI+YMAER+VG GSFGIVFQAKC
Sbjct  34   KIKDDKEMEAAVVDGNGTETGHIIVTTIGGKNGQPKQTISYMAERIVGQGSFGIVFQAKC  93

Query  382  LKTGETVAIKKVLQDRRYKNRELXLMRLMDHPNVISLKHCFFST  513
            L+TGETVAIKKVLQD+RYKNREL  MRL+DHPNV+SLKHCFFST
Sbjct  94   LETGETVAIKKVLQDKRYKNRELQTMRLLDHPNVVSLKHCFFST  137



>emb|CAB87631.1| protein kinase MSK-3-like [Arabidopsis thaliana]
Length=408

 Score =   180 bits (456),  Expect = 4e-51, Method: Compositional matrix adjust.
 Identities = 83/104 (80%), Positives = 95/104 (91%), Gaps = 0/104 (0%)
 Frame = +1

Query  202  EMETDKEMSAAVVEGNEAVTGHIISTTIGGKNGEPKRTITYMAERVVGTGSFGIVFQAKC  381
            +++ DKEM AAVV+GN   TGHII TTIGGKNG+PK+TI+YMAER+VG GSFGIVFQAKC
Sbjct  34   KIKDDKEMEAAVVDGNGTETGHIIVTTIGGKNGQPKQTISYMAERIVGQGSFGIVFQAKC  93

Query  382  LKTGETVAIKKVLQDRRYKNRELXLMRLMDHPNVISLKHCFFST  513
            L+TGETVAIKKVLQD+RYKNREL  MRL+DHPNV+SLKHCFFST
Sbjct  94   LETGETVAIKKVLQDKRYKNRELQTMRLLDHPNVVSLKHCFFST  137



>ref|XP_010492276.1| PREDICTED: shaggy-related protein kinase epsilon [Camelina sativa]
 ref|XP_010492277.1| PREDICTED: shaggy-related protein kinase epsilon [Camelina sativa]
Length=411

 Score =   180 bits (456),  Expect = 4e-51, Method: Compositional matrix adjust.
 Identities = 83/104 (80%), Positives = 95/104 (91%), Gaps = 0/104 (0%)
 Frame = +1

Query  202  EMETDKEMSAAVVEGNEAVTGHIISTTIGGKNGEPKRTITYMAERVVGTGSFGIVFQAKC  381
            +++ DKEM AAVV+GN   TGHII TTIGGKNG+PK+TI+YMAER+VG GSFGIVFQAKC
Sbjct  35   KIKDDKEMEAAVVDGNGTETGHIIVTTIGGKNGQPKQTISYMAERIVGQGSFGIVFQAKC  94

Query  382  LKTGETVAIKKVLQDRRYKNRELXLMRLMDHPNVISLKHCFFST  513
            L+TGETVAIKKVLQD+RYKNREL  MRL+DHPNV+SLKHCFFST
Sbjct  95   LETGETVAIKKVLQDKRYKNRELQTMRLLDHPNVVSLKHCFFST  138



>ref|XP_004234083.1| PREDICTED: shaggy-related protein kinase eta isoform X1 [Solanum 
lycopersicum]
Length=382

 Score =   179 bits (454),  Expect = 4e-51, Method: Compositional matrix adjust.
 Identities = 83/103 (81%), Positives = 94/103 (91%), Gaps = 0/103 (0%)
 Frame = +1

Query  205  METDKEMSAAVVEGNEAVTGHIISTTIGGKNGEPKRTITYMAERVVGTGSFGIVFQAKCL  384
            M  DKEMSA V++ N  VTGHIISTTIGGKNGEPK+T++YMAER+VGTGSFG+VFQAKCL
Sbjct  1    MADDKEMSAPVMDVNGGVTGHIISTTIGGKNGEPKQTVSYMAERIVGTGSFGVVFQAKCL  60

Query  385  KTGETVAIKKVLQDRRYKNRELXLMRLMDHPNVISLKHCFFST  513
            + GETVAIKKVLQDRRYKNREL LMR MD+PNV+SLKHCF+ST
Sbjct  61   ENGETVAIKKVLQDRRYKNRELQLMRTMDNPNVVSLKHCFYST  103



>ref|XP_006594547.1| PREDICTED: shaggy-related protein kinase eta-like isoform X2 
[Glycine max]
 ref|XP_006594548.1| PREDICTED: shaggy-related protein kinase eta-like isoform X3 
[Glycine max]
Length=374

 Score =   179 bits (453),  Expect = 4e-51, Method: Compositional matrix adjust.
 Identities = 82/97 (85%), Positives = 93/97 (96%), Gaps = 0/97 (0%)
 Frame = +1

Query  223  MSAAVVEGNEAVTGHIISTTIGGKNGEPKRTITYMAERVVGTGSFGIVFQAKCLKTGETV  402
            MS++V  G++++TGHIISTTIGGKNGEPK+TI+YMAERVVGTGSFGIVFQAKCL+TGE V
Sbjct  1    MSSSVTNGDDSLTGHIISTTIGGKNGEPKQTISYMAERVVGTGSFGIVFQAKCLETGEAV  60

Query  403  AIKKVLQDRRYKNRELXLMRLMDHPNVISLKHCFFST  513
            AIKKVLQDRRYKNREL LMR++DHPNVISLKHCFFST
Sbjct  61   AIKKVLQDRRYKNRELQLMRVLDHPNVISLKHCFFST  97



>ref|XP_010420109.1| PREDICTED: shaggy-related protein kinase epsilon-like [Camelina 
sativa]
Length=411

 Score =   180 bits (456),  Expect = 4e-51, Method: Compositional matrix adjust.
 Identities = 83/104 (80%), Positives = 95/104 (91%), Gaps = 0/104 (0%)
 Frame = +1

Query  202  EMETDKEMSAAVVEGNEAVTGHIISTTIGGKNGEPKRTITYMAERVVGTGSFGIVFQAKC  381
            +++ DKEM AAVV+GN   TGHII TTIGGKNG+PK+TI+YMAER+VG GSFGIVFQAKC
Sbjct  35   KIKDDKEMEAAVVDGNGTETGHIIVTTIGGKNGQPKQTISYMAERIVGQGSFGIVFQAKC  94

Query  382  LKTGETVAIKKVLQDRRYKNRELXLMRLMDHPNVISLKHCFFST  513
            L+TGETVAIKKVLQD+RYKNREL  MRL+DHPNV+SLKHCFFST
Sbjct  95   LETGETVAIKKVLQDKRYKNRELQTMRLLDHPNVVSLKHCFFST  138



>ref|XP_010453592.1| PREDICTED: shaggy-related protein kinase epsilon-like [Camelina 
sativa]
Length=411

 Score =   180 bits (456),  Expect = 4e-51, Method: Compositional matrix adjust.
 Identities = 83/104 (80%), Positives = 95/104 (91%), Gaps = 0/104 (0%)
 Frame = +1

Query  202  EMETDKEMSAAVVEGNEAVTGHIISTTIGGKNGEPKRTITYMAERVVGTGSFGIVFQAKC  381
            +++ DKEM AAVV+GN   TGHII TTIGGKNG+PK+TI+YMAER+VG GSFGIVFQAKC
Sbjct  35   KIKDDKEMEAAVVDGNGTETGHIIVTTIGGKNGQPKQTISYMAERIVGQGSFGIVFQAKC  94

Query  382  LKTGETVAIKKVLQDRRYKNRELXLMRLMDHPNVISLKHCFFST  513
            L+TGETVAIKKVLQD+RYKNREL  MRL+DHPNV+SLKHCFFST
Sbjct  95   LETGETVAIKKVLQDKRYKNRELQTMRLLDHPNVVSLKHCFFST  138



>ref|XP_006367136.1| PREDICTED: shaggy-related protein kinase eta-like [Solanum tuberosum]
Length=382

 Score =   179 bits (454),  Expect = 5e-51, Method: Compositional matrix adjust.
 Identities = 83/103 (81%), Positives = 94/103 (91%), Gaps = 0/103 (0%)
 Frame = +1

Query  205  METDKEMSAAVVEGNEAVTGHIISTTIGGKNGEPKRTITYMAERVVGTGSFGIVFQAKCL  384
            M  DKEMSA V++ N  VTGHIISTTIGGKNGEPK+T++YMAER+VGTGSFG+VFQAKCL
Sbjct  1    MADDKEMSAPVMDVNGGVTGHIISTTIGGKNGEPKQTVSYMAERIVGTGSFGVVFQAKCL  60

Query  385  KTGETVAIKKVLQDRRYKNRELXLMRLMDHPNVISLKHCFFST  513
            + GETVAIKKVLQDRRYKNREL LMR MD+PNV+SLKHCF+ST
Sbjct  61   ENGETVAIKKVLQDRRYKNRELQLMRTMDNPNVVSLKHCFYST  103



>ref|NP_196968.2| Shaggy-related protein kinase 13 [Arabidopsis thaliana]
 sp|Q8VZD5.1|KSG5_ARATH RecName: Full=Shaggy-related protein kinase epsilon; AltName: 
Full=ASK-epsilon [Arabidopsis thaliana]
 gb|AAL57679.1| AT5g14640/T15N1_130 [Arabidopsis thaliana]
 gb|AAQ65089.1| At5g14640/T15N1_130 [Arabidopsis thaliana]
 gb|AED92057.1| Shaggy-related protein kinase 13 [Arabidopsis thaliana]
Length=410

 Score =   179 bits (455),  Expect = 5e-51, Method: Compositional matrix adjust.
 Identities = 83/104 (80%), Positives = 95/104 (91%), Gaps = 0/104 (0%)
 Frame = +1

Query  202  EMETDKEMSAAVVEGNEAVTGHIISTTIGGKNGEPKRTITYMAERVVGTGSFGIVFQAKC  381
            +++ DKEM AAVV+GN   TGHII TTIGGKNG+PK+TI+YMAER+VG GSFGIVFQAKC
Sbjct  34   KIKDDKEMEAAVVDGNGTETGHIIVTTIGGKNGQPKQTISYMAERIVGQGSFGIVFQAKC  93

Query  382  LKTGETVAIKKVLQDRRYKNRELXLMRLMDHPNVISLKHCFFST  513
            L+TGETVAIKKVLQD+RYKNREL  MRL+DHPNV+SLKHCFFST
Sbjct  94   LETGETVAIKKVLQDKRYKNRELQTMRLLDHPNVVSLKHCFFST  137



>ref|XP_009770234.1| PREDICTED: shaggy-related protein kinase eta-like [Nicotiana 
sylvestris]
Length=384

 Score =   179 bits (454),  Expect = 5e-51, Method: Compositional matrix adjust.
 Identities = 84/103 (82%), Positives = 93/103 (90%), Gaps = 0/103 (0%)
 Frame = +1

Query  205  METDKEMSAAVVEGNEAVTGHIISTTIGGKNGEPKRTITYMAERVVGTGSFGIVFQAKCL  384
            M  DKEMSA V++ N AVTGHIISTTIGGKNGEPK+T++YMAERVVGTGSFG+VFQAKCL
Sbjct  1    MADDKEMSAPVMDVNGAVTGHIISTTIGGKNGEPKQTVSYMAERVVGTGSFGVVFQAKCL  60

Query  385  KTGETVAIKKVLQDRRYKNRELXLMRLMDHPNVISLKHCFFST  513
            + GETVAIKKVLQDRRYKNREL LMR MDH NV+ LKHCF+ST
Sbjct  61   ENGETVAIKKVLQDRRYKNRELQLMRTMDHSNVVCLKHCFYST  103



>ref|XP_006287860.1| hypothetical protein CARUB_v10001087mg [Capsella rubella]
 ref|XP_006287861.1| hypothetical protein CARUB_v10001087mg [Capsella rubella]
 ref|XP_006287862.1| hypothetical protein CARUB_v10001087mg [Capsella rubella]
 gb|EOA20758.1| hypothetical protein CARUB_v10001087mg [Capsella rubella]
 gb|EOA20759.1| hypothetical protein CARUB_v10001087mg [Capsella rubella]
 gb|EOA20760.1| hypothetical protein CARUB_v10001087mg [Capsella rubella]
Length=410

 Score =   179 bits (455),  Expect = 5e-51, Method: Compositional matrix adjust.
 Identities = 83/104 (80%), Positives = 95/104 (91%), Gaps = 0/104 (0%)
 Frame = +1

Query  202  EMETDKEMSAAVVEGNEAVTGHIISTTIGGKNGEPKRTITYMAERVVGTGSFGIVFQAKC  381
            +++ DKEM AAVV+GN   TGHII TTIGGKNG+PK+TI+YMAER+VG GSFGIVFQAKC
Sbjct  34   KIKDDKEMEAAVVDGNGTETGHIIVTTIGGKNGQPKQTISYMAERIVGQGSFGIVFQAKC  93

Query  382  LKTGETVAIKKVLQDRRYKNRELXLMRLMDHPNVISLKHCFFST  513
            L+TGETVAIKKVLQD+RYKNREL  MRL+DHPNV+SLKHCFFST
Sbjct  94   LETGETVAIKKVLQDKRYKNRELQTMRLLDHPNVVSLKHCFFST  137



>ref|XP_003540409.1| PREDICTED: shaggy-related protein kinase zeta-like [Glycine max]
Length=409

 Score =   179 bits (455),  Expect = 5e-51, Method: Compositional matrix adjust.
 Identities = 84/101 (83%), Positives = 94/101 (93%), Gaps = 0/101 (0%)
 Frame = +1

Query  211  TDKEMSAAVVEGNEAVTGHIISTTIGGKNGEPKRTITYMAERVVGTGSFGIVFQAKCLKT  390
            T+KEMSA V +GN+A+TGHIISTTI GKNGEPK+TI+YMAERVVGTGSFGIVFQAKCL+T
Sbjct  40   TEKEMSAPVADGNDALTGHIISTTIAGKNGEPKQTISYMAERVVGTGSFGIVFQAKCLET  99

Query  391  GETVAIKKVLQDRRYKNRELXLMRLMDHPNVISLKHCFFST  513
            GE VAIKKVLQDRRYKNREL LMR+MDHPN+ISL + FFST
Sbjct  100  GEAVAIKKVLQDRRYKNRELQLMRVMDHPNIISLSNYFFST  140



>ref|XP_006399977.1| hypothetical protein EUTSA_v10013689mg [Eutrema salsugineum]
 gb|ESQ41430.1| hypothetical protein EUTSA_v10013689mg [Eutrema salsugineum]
Length=409

 Score =   179 bits (455),  Expect = 5e-51, Method: Compositional matrix adjust.
 Identities = 83/104 (80%), Positives = 95/104 (91%), Gaps = 0/104 (0%)
 Frame = +1

Query  202  EMETDKEMSAAVVEGNEAVTGHIISTTIGGKNGEPKRTITYMAERVVGTGSFGIVFQAKC  381
            +++ DKEM AAVV+GN   TGHII TTIGGKNG+PK+TI+YMAER+VG GSFGIVFQAKC
Sbjct  33   KIKDDKEMEAAVVDGNGTETGHIIVTTIGGKNGQPKQTISYMAERIVGQGSFGIVFQAKC  92

Query  382  LKTGETVAIKKVLQDRRYKNRELXLMRLMDHPNVISLKHCFFST  513
            L+TGETVAIKKVLQD+RYKNREL  MRL+DHPNV+SLKHCFFST
Sbjct  93   LETGETVAIKKVLQDKRYKNRELQTMRLLDHPNVVSLKHCFFST  136



>gb|KDO66115.1| hypothetical protein CISIN_1g0141741mg, partial [Citrus sinensis]
Length=243

 Score =   175 bits (443),  Expect = 6e-51, Method: Compositional matrix adjust.
 Identities = 81/100 (81%), Positives = 91/100 (91%), Gaps = 0/100 (0%)
 Frame = +1

Query  214  DKEMSAAVVEGNEAVTGHIISTTIGGKNGEPKRTITYMAERVVGTGSFGIVFQAKCLKTG  393
            +KEM A VV+GN   TGHII TTIGG+NG+PK+TI+YMAERVVG GSFGIVFQAKCL+TG
Sbjct  57   EKEMEATVVDGNGTETGHIIVTTIGGRNGQPKQTISYMAERVVGQGSFGIVFQAKCLETG  116

Query  394  ETVAIKKVLQDRRYKNRELXLMRLMDHPNVISLKHCFFST  513
            ETVAIKKVLQD+RYKNREL  MRL+DHPNV+SLKHCFFST
Sbjct  117  ETVAIKKVLQDKRYKNRELQTMRLLDHPNVVSLKHCFFST  156



>gb|KDO66112.1| hypothetical protein CISIN_1g0141741mg, partial [Citrus sinensis]
 gb|KDO66113.1| hypothetical protein CISIN_1g0141741mg, partial [Citrus sinensis]
 gb|KDO66114.1| hypothetical protein CISIN_1g0141741mg, partial [Citrus sinensis]
Length=244

 Score =   175 bits (443),  Expect = 6e-51, Method: Compositional matrix adjust.
 Identities = 81/100 (81%), Positives = 91/100 (91%), Gaps = 0/100 (0%)
 Frame = +1

Query  214  DKEMSAAVVEGNEAVTGHIISTTIGGKNGEPKRTITYMAERVVGTGSFGIVFQAKCLKTG  393
            +KEM A VV+GN   TGHII TTIGG+NG+PK+TI+YMAERVVG GSFGIVFQAKCL+TG
Sbjct  57   EKEMEATVVDGNGTETGHIIVTTIGGRNGQPKQTISYMAERVVGQGSFGIVFQAKCLETG  116

Query  394  ETVAIKKVLQDRRYKNRELXLMRLMDHPNVISLKHCFFST  513
            ETVAIKKVLQD+RYKNREL  MRL+DHPNV+SLKHCFFST
Sbjct  117  ETVAIKKVLQDKRYKNRELQTMRLLDHPNVVSLKHCFFST  156



>gb|ACR37222.1| unknown [Zea mays]
Length=136

 Score =   171 bits (433),  Expect = 7e-51, Method: Compositional matrix adjust.
 Identities = 79/93 (85%), Positives = 88/93 (95%), Gaps = 0/93 (0%)
 Frame = +1

Query  235  VVEGNEAVTGHIISTTIGGKNGEPKRTITYMAERVVGTGSFGIVFQAKCLKTGETVAIKK  414
            ++EGN+ VTGHIISTTIGGKNGEPK+TI+YMAERVVGTGSFGIVFQAKCL+TGETVAIKK
Sbjct  1    MIEGNDPVTGHIISTTIGGKNGEPKKTISYMAERVVGTGSFGIVFQAKCLETGETVAIKK  60

Query  415  VLQDRRYKNRELXLMRLMDHPNVISLKHCFFST  513
            VLQD+RYKNREL +MR MDH N +SLKHCFFST
Sbjct  61   VLQDKRYKNRELQIMRSMDHCNAVSLKHCFFST  93



>ref|XP_006594815.1| PREDICTED: shaggy-related protein kinase zeta-like isoform X1 
[Glycine max]
Length=417

 Score =   179 bits (454),  Expect = 8e-51, Method: Compositional matrix adjust.
 Identities = 83/104 (80%), Positives = 95/104 (91%), Gaps = 0/104 (0%)
 Frame = +1

Query  202  EMETDKEMSAAVVEGNEAVTGHIISTTIGGKNGEPKRTITYMAERVVGTGSFGIVFQAKC  381
            +   +KEMSA V +GN+A+TGHIISTTIGGKNGEPK+TI+YMAERVVGTGSFGIVFQAKC
Sbjct  33   DASAEKEMSAPVADGNDALTGHIISTTIGGKNGEPKQTISYMAERVVGTGSFGIVFQAKC  92

Query  382  LKTGETVAIKKVLQDRRYKNRELXLMRLMDHPNVISLKHCFFST  513
            L+TGE VAIKKVLQDRRYKNREL LMR+MDHPN+I+L + FFST
Sbjct  93   LETGEAVAIKKVLQDRRYKNRELQLMRMMDHPNIITLSNYFFST  136



>gb|AEQ94156.1| shaggy-related protein kinase [Elaeis guineensis]
Length=216

 Score =   174 bits (440),  Expect = 9e-51, Method: Compositional matrix adjust.
 Identities = 79/104 (76%), Positives = 93/104 (89%), Gaps = 0/104 (0%)
 Frame = +1

Query  202  EMETDKEMSAAVVEGNEAVTGHIISTTIGGKNGEPKRTITYMAERVVGTGSFGIVFQAKC  381
            ++  DKE+ A V++GN   TGHII TTIGG+NG+PK+TI+YMAERVVG GSFG+VFQAKC
Sbjct  33   KIRDDKEVEATVIDGNGTETGHIIVTTIGGRNGQPKQTISYMAERVVGHGSFGVVFQAKC  92

Query  382  LKTGETVAIKKVLQDRRYKNRELXLMRLMDHPNVISLKHCFFST  513
            L+TGETVAIKKVLQD+RYKNREL  MRL+DHPNV+SLKHCFFST
Sbjct  93   LETGETVAIKKVLQDKRYKNRELQTMRLLDHPNVVSLKHCFFST  136



>ref|XP_010518816.1| PREDICTED: shaggy-related protein kinase eta isoform X2 [Tarenaya 
hassleriana]
Length=374

 Score =   178 bits (451),  Expect = 9e-51, Method: Compositional matrix adjust.
 Identities = 83/97 (86%), Positives = 93/97 (96%), Gaps = 0/97 (0%)
 Frame = +1

Query  223  MSAAVVEGNEAVTGHIISTTIGGKNGEPKRTITYMAERVVGTGSFGIVFQAKCLKTGETV  402
            MS AVV+G++ VTGHIISTTIGGKNGEPK+T++YMAE VVGTGSFGIVF+AKCL+TGETV
Sbjct  1    MSDAVVDGHDQVTGHIISTTIGGKNGEPKQTMSYMAESVVGTGSFGIVFRAKCLETGETV  60

Query  403  AIKKVLQDRRYKNRELXLMRLMDHPNVISLKHCFFST  513
            AIKKVLQDRRYKNREL LMR+MDHPNV+SLKHCFFST
Sbjct  61   AIKKVLQDRRYKNRELQLMRVMDHPNVVSLKHCFFST  97



>ref|XP_009151155.1| PREDICTED: shaggy-related protein kinase alpha [Brassica rapa]
 emb|CDX88238.1| BnaA06g28290D [Brassica napus]
Length=403

 Score =   178 bits (452),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 82/104 (79%), Positives = 93/104 (89%), Gaps = 0/104 (0%)
 Frame = +1

Query  202  EMETDKEMSAAVVEGNEAVTGHIISTTIGGKNGEPKRTITYMAERVVGTGSFGIVFQAKC  381
            ++  DKEM A VV+GN   TGHII TTIGG+NG+PK+TI+YMAERVVG GSFG+VFQAKC
Sbjct  27   KIRDDKEMEATVVDGNSTETGHIIVTTIGGRNGQPKQTISYMAERVVGQGSFGVVFQAKC  86

Query  382  LKTGETVAIKKVLQDRRYKNRELXLMRLMDHPNVISLKHCFFST  513
            L+TGETVAIKKVLQDRRYKNREL  MRL+DHPNV+SLKHCFFST
Sbjct  87   LETGETVAIKKVLQDRRYKNRELQTMRLLDHPNVVSLKHCFFST  130



>emb|CDX78587.1| BnaA03g04990D [Brassica napus]
Length=410

 Score =   178 bits (452),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 83/104 (80%), Positives = 95/104 (91%), Gaps = 0/104 (0%)
 Frame = +1

Query  202  EMETDKEMSAAVVEGNEAVTGHIISTTIGGKNGEPKRTITYMAERVVGTGSFGIVFQAKC  381
            +++ DKEM AAVV+GN   TGHII TTIGGK+G+PK+TI+YMAERVVG GSFGIVFQAKC
Sbjct  34   KIKDDKEMEAAVVDGNGTETGHIIVTTIGGKDGQPKQTISYMAERVVGQGSFGIVFQAKC  93

Query  382  LKTGETVAIKKVLQDRRYKNRELXLMRLMDHPNVISLKHCFFST  513
            L+TGETVAIKKVLQD+RYKNREL  MRL+DHPNV+SLKHCFFST
Sbjct  94   LETGETVAIKKVLQDKRYKNRELQTMRLLDHPNVVSLKHCFFST  137



>emb|CDX70574.1| BnaC03g06580D [Brassica napus]
Length=409

 Score =   178 bits (452),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 83/104 (80%), Positives = 95/104 (91%), Gaps = 0/104 (0%)
 Frame = +1

Query  202  EMETDKEMSAAVVEGNEAVTGHIISTTIGGKNGEPKRTITYMAERVVGTGSFGIVFQAKC  381
            +++ DKEM AAVV+GN   TGHII TTIGGK+G+PK+TI+YMAERVVG GSFGIVFQAKC
Sbjct  33   KIKDDKEMEAAVVDGNGTETGHIIVTTIGGKDGQPKQTISYMAERVVGQGSFGIVFQAKC  92

Query  382  LKTGETVAIKKVLQDRRYKNRELXLMRLMDHPNVISLKHCFFST  513
            L+TGETVAIKKVLQD+RYKNREL  MRL+DHPNV+SLKHCFFST
Sbjct  93   LETGETVAIKKVLQDKRYKNRELQTMRLLDHPNVVSLKHCFFST  136



>ref|XP_009131419.1| PREDICTED: shaggy-related protein kinase epsilon [Brassica rapa]
Length=410

 Score =   178 bits (452),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 83/104 (80%), Positives = 95/104 (91%), Gaps = 0/104 (0%)
 Frame = +1

Query  202  EMETDKEMSAAVVEGNEAVTGHIISTTIGGKNGEPKRTITYMAERVVGTGSFGIVFQAKC  381
            +++ DKEM AAVV+GN   TGHII TTIGGK+G+PK+TI+YMAERVVG GSFGIVFQAKC
Sbjct  34   KIKDDKEMEAAVVDGNGTETGHIIVTTIGGKDGQPKQTISYMAERVVGQGSFGIVFQAKC  93

Query  382  LKTGETVAIKKVLQDRRYKNRELXLMRLMDHPNVISLKHCFFST  513
            L+TGETVAIKKVLQD+RYKNREL  MRL+DHPNV+SLKHCFFST
Sbjct  94   LETGETVAIKKVLQDKRYKNRELQTMRLLDHPNVVSLKHCFFST  137



>gb|AEQ94143.1| putative Glycogen synthase kinase 3 [Elaeis guineensis]
Length=231

 Score =   173 bits (439),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 79/104 (76%), Positives = 93/104 (89%), Gaps = 0/104 (0%)
 Frame = +1

Query  202  EMETDKEMSAAVVEGNEAVTGHIISTTIGGKNGEPKRTITYMAERVVGTGSFGIVFQAKC  381
            ++  DKE+ A V++GN   TGHII TTIGG+NG+PK+TI+YMAERVVG GSFG+VFQAKC
Sbjct  33   KIRDDKEVEATVIDGNGTETGHIIVTTIGGRNGQPKQTISYMAERVVGHGSFGVVFQAKC  92

Query  382  LKTGETVAIKKVLQDRRYKNRELXLMRLMDHPNVISLKHCFFST  513
            L+TGETVAIKKVLQD+RYKNREL  MRL+DHPNV+SLKHCFFST
Sbjct  93   LETGETVAIKKVLQDKRYKNRELQTMRLLDHPNVVSLKHCFFST  136



>gb|KJB45482.1| hypothetical protein B456_007G308500 [Gossypium raimondii]
Length=275

 Score =   174 bits (442),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 80/104 (77%), Positives = 93/104 (89%), Gaps = 0/104 (0%)
 Frame = +1

Query  202  EMETDKEMSAAVVEGNEAVTGHIISTTIGGKNGEPKRTITYMAERVVGTGSFGIVFQAKC  381
            ++  DKEM A VV+GN   TGHII TTIGG+NG+PK+TI+YMAERVVG GSFG+VFQAKC
Sbjct  31   KIRDDKEMEATVVDGNGTETGHIIVTTIGGRNGQPKQTISYMAERVVGHGSFGVVFQAKC  90

Query  382  LKTGETVAIKKVLQDRRYKNRELXLMRLMDHPNVISLKHCFFST  513
            L+TGETVAIKKVLQD+RYKNREL  MRL+DHPNV++LKHCFFST
Sbjct  91   LETGETVAIKKVLQDKRYKNRELQTMRLLDHPNVVALKHCFFST  134



>gb|AGJ98224.1| BIN2-like protein PSK9 [Petunia x hybrida]
Length=376

 Score =   177 bits (449),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 81/97 (84%), Positives = 92/97 (95%), Gaps = 0/97 (0%)
 Frame = +1

Query  223  MSAAVVEGNEAVTGHIISTTIGGKNGEPKRTITYMAERVVGTGSFGIVFQAKCLKTGETV  402
            MSA V++ N+AVTGHIISTTIGGKNG+PK+T++YMAERVVGTGSFG+VFQAKCL+ GETV
Sbjct  1    MSAPVMDVNDAVTGHIISTTIGGKNGQPKQTVSYMAERVVGTGSFGVVFQAKCLENGETV  60

Query  403  AIKKVLQDRRYKNRELXLMRLMDHPNVISLKHCFFST  513
            AIKKVLQDRRYKNREL LMR MDHPNV+SLKHCF+ST
Sbjct  61   AIKKVLQDRRYKNRELQLMRTMDHPNVVSLKHCFYST  97



>emb|CDX80585.1| BnaC07g28590D [Brassica napus]
Length=402

 Score =   178 bits (451),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 82/104 (79%), Positives = 93/104 (89%), Gaps = 0/104 (0%)
 Frame = +1

Query  202  EMETDKEMSAAVVEGNEAVTGHIISTTIGGKNGEPKRTITYMAERVVGTGSFGIVFQAKC  381
            ++  DKEM A VV+GN   TGHII TTIGG+NG+PK+TI+YMAERVVG GSFG+VFQAKC
Sbjct  26   KIRDDKEMEATVVDGNSTETGHIIVTTIGGRNGQPKQTISYMAERVVGHGSFGVVFQAKC  85

Query  382  LKTGETVAIKKVLQDRRYKNRELXLMRLMDHPNVISLKHCFFST  513
            L+TGETVAIKKVLQDRRYKNREL  MRL+DHPNV+SLKHCFFST
Sbjct  86   LETGETVAIKKVLQDRRYKNRELQTMRLLDHPNVVSLKHCFFST  129



>ref|XP_010546768.1| PREDICTED: shaggy-related protein kinase alpha [Tarenaya hassleriana]
Length=399

 Score =   178 bits (451),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 83/104 (80%), Positives = 93/104 (89%), Gaps = 0/104 (0%)
 Frame = +1

Query  202  EMETDKEMSAAVVEGNEAVTGHIISTTIGGKNGEPKRTITYMAERVVGTGSFGIVFQAKC  381
            ++  DKEM A VV+GN   TGHII TTIGGKNG+PK+TI+YMAERVVG GSFG+VFQAKC
Sbjct  23   KIRDDKEMEATVVDGNGTETGHIIVTTIGGKNGQPKQTISYMAERVVGHGSFGVVFQAKC  82

Query  382  LKTGETVAIKKVLQDRRYKNRELXLMRLMDHPNVISLKHCFFST  513
            L+TGETVAIKKVLQDRRYKNREL  MRL+DHPNV+SLKHCFFST
Sbjct  83   LETGETVAIKKVLQDRRYKNRELQTMRLLDHPNVVSLKHCFFST  126



>ref|XP_002302794.1| Glycogen synthase kinase-3 MsK-3 family protein [Populus trichocarpa]
 gb|EEE82067.1| Glycogen synthase kinase-3 MsK-3 family protein [Populus trichocarpa]
Length=409

 Score =   178 bits (451),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 83/104 (80%), Positives = 94/104 (90%), Gaps = 0/104 (0%)
 Frame = +1

Query  202  EMETDKEMSAAVVEGNEAVTGHIISTTIGGKNGEPKRTITYMAERVVGTGSFGIVFQAKC  381
            ++  DKEM AAVV+GN   TGHII TTIGGKNG+PK+TI+YMAERVVG GSFG+VFQAKC
Sbjct  33   KISDDKEMEAAVVDGNGTETGHIIVTTIGGKNGQPKQTISYMAERVVGHGSFGLVFQAKC  92

Query  382  LKTGETVAIKKVLQDRRYKNRELXLMRLMDHPNVISLKHCFFST  513
            L+TGETVAIKKVLQD+RYKNREL  MRL+DHPNV+SLKHCFFST
Sbjct  93   LETGETVAIKKVLQDKRYKNRELQTMRLLDHPNVVSLKHCFFST  136



>ref|XP_011085978.1| PREDICTED: shaggy-related protein kinase eta isoform X2 [Sesamum 
indicum]
Length=376

 Score =   177 bits (448),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 82/97 (85%), Positives = 91/97 (94%), Gaps = 0/97 (0%)
 Frame = +1

Query  223  MSAAVVEGNEAVTGHIISTTIGGKNGEPKRTITYMAERVVGTGSFGIVFQAKCLKTGETV  402
            M A V++ N+ VTGHIISTTIGGKNGEPK+T++YMAERVVGTGSFGIVFQAKC++TGETV
Sbjct  1    MHAPVMDRNDTVTGHIISTTIGGKNGEPKQTVSYMAERVVGTGSFGIVFQAKCIETGETV  60

Query  403  AIKKVLQDRRYKNRELXLMRLMDHPNVISLKHCFFST  513
            AIKKVLQDRRYKNREL LMR MDHPNV+SLKHCFFST
Sbjct  61   AIKKVLQDRRYKNRELQLMRTMDHPNVVSLKHCFFST  97



>ref|XP_010550142.1| PREDICTED: shaggy-related protein kinase epsilon [Tarenaya hassleriana]
Length=409

 Score =   177 bits (450),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 82/104 (79%), Positives = 94/104 (90%), Gaps = 0/104 (0%)
 Frame = +1

Query  202  EMETDKEMSAAVVEGNEAVTGHIISTTIGGKNGEPKRTITYMAERVVGTGSFGIVFQAKC  381
            +++ DKEM AAVV+GN   TGHII TTIGGKNG+PK+TI+YMAER+VG GSFGIVFQAKC
Sbjct  33   KIKDDKEMEAAVVDGNGTETGHIIVTTIGGKNGQPKQTISYMAERIVGQGSFGIVFQAKC  92

Query  382  LKTGETVAIKKVLQDRRYKNRELXLMRLMDHPNVISLKHCFFST  513
            L+TGE VAIKKVLQD+RYKNREL  MRL+DHPNV+SLKHCFFST
Sbjct  93   LETGEAVAIKKVLQDKRYKNRELQTMRLLDHPNVVSLKHCFFST  136



>ref|XP_011003165.1| PREDICTED: shaggy-related protein kinase alpha-like [Populus 
euphratica]
 ref|XP_011003166.1| PREDICTED: shaggy-related protein kinase alpha-like [Populus 
euphratica]
Length=409

 Score =   177 bits (450),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 83/104 (80%), Positives = 94/104 (90%), Gaps = 0/104 (0%)
 Frame = +1

Query  202  EMETDKEMSAAVVEGNEAVTGHIISTTIGGKNGEPKRTITYMAERVVGTGSFGIVFQAKC  381
            ++  DKEM AAVV+GN   TGHII TTIGGKNG+PK+TI+YMAERVVG GSFG+VFQAKC
Sbjct  33   KISDDKEMEAAVVDGNGTETGHIIVTTIGGKNGQPKQTISYMAERVVGHGSFGLVFQAKC  92

Query  382  LKTGETVAIKKVLQDRRYKNRELXLMRLMDHPNVISLKHCFFST  513
            L+TGETVAIKKVLQD+RYKNREL  MRL+DHPNV+SLKHCFFST
Sbjct  93   LETGETVAIKKVLQDKRYKNRELQTMRLLDHPNVVSLKHCFFST  136



>gb|AGK41245.1| SHAGGY-like kinase [Triticum aestivum]
 gb|AGK41247.1| SHAGGY-like kinase [Triticum aestivum]
Length=400

 Score =   177 bits (449),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 84/94 (89%), Positives = 88/94 (94%), Gaps = 0/94 (0%)
 Frame = +1

Query  232  AVVEGNEAVTGHIISTTIGGKNGEPKRTITYMAERVVGTGSFGIVFQAKCLKTGETVAIK  411
            A  EG + VTGHIISTTIGGKNGEPKRTI+YMAERVVGTGSFGIVFQAKCL+TGETVAIK
Sbjct  31   ARTEGGDPVTGHIISTTIGGKNGEPKRTISYMAERVVGTGSFGIVFQAKCLETGETVAIK  90

Query  412  KVLQDRRYKNRELXLMRLMDHPNVISLKHCFFST  513
            KVLQDRRYKNREL LMR MDHPNV+SLKHCFFST
Sbjct  91   KVLQDRRYKNRELQLMRSMDHPNVVSLKHCFFST  124



>dbj|BAJ91341.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ96026.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=400

 Score =   177 bits (449),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 84/94 (89%), Positives = 88/94 (94%), Gaps = 0/94 (0%)
 Frame = +1

Query  232  AVVEGNEAVTGHIISTTIGGKNGEPKRTITYMAERVVGTGSFGIVFQAKCLKTGETVAIK  411
            A  EG + VTGHIISTTIGGKNGEPKRTI+YMAERVVGTGSFGIVFQAKCL+TGETVAIK
Sbjct  31   ARTEGGDPVTGHIISTTIGGKNGEPKRTISYMAERVVGTGSFGIVFQAKCLETGETVAIK  90

Query  412  KVLQDRRYKNRELXLMRLMDHPNVISLKHCFFST  513
            KVLQDRRYKNREL LMR MDHPNV+SLKHCFFST
Sbjct  91   KVLQDRRYKNRELQLMRSMDHPNVVSLKHCFFST  124



>ref|XP_010251221.1| PREDICTED: shaggy-related protein kinase epsilon-like isoform 
X4 [Nelumbo nucifera]
Length=350

 Score =   176 bits (446),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 82/104 (79%), Positives = 93/104 (89%), Gaps = 0/104 (0%)
 Frame = +1

Query  202  EMETDKEMSAAVVEGNEAVTGHIISTTIGGKNGEPKRTITYMAERVVGTGSFGIVFQAKC  381
            ++  DKEM A VV+GN   TGHII TTIGG+NG+PK+TI+YMAERVVG GSFGIVFQAKC
Sbjct  33   KIRDDKEMEATVVDGNGTETGHIIVTTIGGRNGQPKQTISYMAERVVGHGSFGIVFQAKC  92

Query  382  LKTGETVAIKKVLQDRRYKNRELXLMRLMDHPNVISLKHCFFST  513
            L+TGETVAIKKVLQD+RYKNREL  MRL+DHPNV+SLKHCFFST
Sbjct  93   LETGETVAIKKVLQDKRYKNRELQTMRLLDHPNVVSLKHCFFST  136



>ref|XP_003565257.1| PREDICTED: shaggy-related protein kinase eta-like [Brachypodium 
distachyon]
Length=399

 Score =   177 bits (449),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 83/91 (91%), Positives = 87/91 (96%), Gaps = 0/91 (0%)
 Frame = +1

Query  241  EGNEAVTGHIISTTIGGKNGEPKRTITYMAERVVGTGSFGIVFQAKCLKTGETVAIKKVL  420
            EG + VTGHIISTTIGGKNGEPKRTI+YMAERVVGTGSFGIVFQAKCL+TGETVAIKKVL
Sbjct  33   EGGDPVTGHIISTTIGGKNGEPKRTISYMAERVVGTGSFGIVFQAKCLETGETVAIKKVL  92

Query  421  QDRRYKNRELXLMRLMDHPNVISLKHCFFST  513
            QDRRYKNREL LMR MDHPNV+SLKHCFFST
Sbjct  93   QDRRYKNRELQLMRSMDHPNVVSLKHCFFST  123



>gb|AGJ93555.1| SHAGGY-like kinase [Triticum aestivum]
 gb|AGK41244.1| SHAGGY-like kinase [Triticum aestivum]
Length=401

 Score =   177 bits (449),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 83/91 (91%), Positives = 87/91 (96%), Gaps = 0/91 (0%)
 Frame = +1

Query  241  EGNEAVTGHIISTTIGGKNGEPKRTITYMAERVVGTGSFGIVFQAKCLKTGETVAIKKVL  420
            EG + VTGHIISTTIGGKNGEPKRTI+YMAERVVGTGSFGIVFQAKCL+TGETVAIKKVL
Sbjct  35   EGGDPVTGHIISTTIGGKNGEPKRTISYMAERVVGTGSFGIVFQAKCLETGETVAIKKVL  94

Query  421  QDRRYKNRELXLMRLMDHPNVISLKHCFFST  513
            QDRRYKNREL LMR MDHPNV+SLKHCFFST
Sbjct  95   QDRRYKNRELQLMRSMDHPNVVSLKHCFFST  125



>gb|EMT19129.1| Shaggy-related protein kinase iota [Aegilops tauschii]
Length=378

 Score =   176 bits (447),  Expect = 4e-50, Method: Compositional matrix adjust.
 Identities = 83/91 (91%), Positives = 87/91 (96%), Gaps = 0/91 (0%)
 Frame = +1

Query  241  EGNEAVTGHIISTTIGGKNGEPKRTITYMAERVVGTGSFGIVFQAKCLKTGETVAIKKVL  420
            EG + VTGHIISTTIGGKNGEPKRTI+YMAERVVGTGSFGIVFQAKCL+TGETVAIKKVL
Sbjct  12   EGGDPVTGHIISTTIGGKNGEPKRTISYMAERVVGTGSFGIVFQAKCLETGETVAIKKVL  71

Query  421  QDRRYKNRELXLMRLMDHPNVISLKHCFFST  513
            QDRRYKNREL LMR MDHPNV+SLKHCFFST
Sbjct  72   QDRRYKNRELQLMRSMDHPNVVSLKHCFFST  102



>ref|XP_004230343.1| PREDICTED: shaggy-related protein kinase NtK-1 [Solanum lycopersicum]
Length=409

 Score =   177 bits (449),  Expect = 4e-50, Method: Compositional matrix adjust.
 Identities = 81/103 (79%), Positives = 93/103 (90%), Gaps = 0/103 (0%)
 Frame = +1

Query  205  METDKEMSAAVVEGNEAVTGHIISTTIGGKNGEPKRTITYMAERVVGTGSFGIVFQAKCL  384
            +  DKEM AA+V+GN   TGHII TTIGG+NG+PK+TI+YMAERVVG GSFG+VFQAKCL
Sbjct  34   IRDDKEMEAAIVDGNGTETGHIIVTTIGGRNGQPKQTISYMAERVVGQGSFGVVFQAKCL  93

Query  385  KTGETVAIKKVLQDRRYKNRELXLMRLMDHPNVISLKHCFFST  513
            +TGETVAIKKVLQD+RYKNREL  MRL+DHPNV+SLKHCFFST
Sbjct  94   ETGETVAIKKVLQDKRYKNRELQTMRLLDHPNVVSLKHCFFST  136



>ref|XP_006299606.1| hypothetical protein CARUB_v10015785mg [Capsella rubella]
 gb|EOA32504.1| hypothetical protein CARUB_v10015785mg [Capsella rubella]
Length=409

 Score =   177 bits (449),  Expect = 4e-50, Method: Compositional matrix adjust.
 Identities = 82/104 (79%), Positives = 93/104 (89%), Gaps = 0/104 (0%)
 Frame = +1

Query  202  EMETDKEMSAAVVEGNEAVTGHIISTTIGGKNGEPKRTITYMAERVVGTGSFGIVFQAKC  381
            +++ DKEM A +V GN   TGHII TTIGG+NG+PK+TI+YMAERVVG GSFGIVFQAKC
Sbjct  33   KIQDDKEMEATIVNGNVTETGHIIVTTIGGRNGQPKQTISYMAERVVGHGSFGIVFQAKC  92

Query  382  LKTGETVAIKKVLQDRRYKNRELXLMRLMDHPNVISLKHCFFST  513
            L+TGETVAIKKVLQDRRYKNREL  MRL+DHPNV+SLKHCFFST
Sbjct  93   LETGETVAIKKVLQDRRYKNRELQTMRLLDHPNVVSLKHCFFST  136



>gb|EYU34726.1| hypothetical protein MIMGU_mgv1a007335mg [Erythranthe guttata]
Length=407

 Score =   177 bits (449),  Expect = 4e-50, Method: Compositional matrix adjust.
 Identities = 82/102 (80%), Positives = 93/102 (91%), Gaps = 0/102 (0%)
 Frame = +1

Query  208  ETDKEMSAAVVEGNEAVTGHIISTTIGGKNGEPKRTITYMAERVVGTGSFGIVFQAKCLK  387
            + +KEM AAVV+GN   TGHII TTIGGKNG+PK+TI+YMAER+VG GSFGIVFQAKCL+
Sbjct  34   KVEKEMEAAVVDGNGTETGHIIVTTIGGKNGQPKQTISYMAERIVGQGSFGIVFQAKCLE  93

Query  388  TGETVAIKKVLQDRRYKNRELXLMRLMDHPNVISLKHCFFST  513
            TGETVAIKKVLQD+RYKNREL  MRL+DHPNV+SLKHCFFST
Sbjct  94   TGETVAIKKVLQDKRYKNRELQTMRLLDHPNVVSLKHCFFST  135



>ref|XP_008345980.1| PREDICTED: shaggy-related protein kinase eta [Malus domestica]
Length=379

 Score =   176 bits (447),  Expect = 4e-50, Method: Compositional matrix adjust.
 Identities = 84/98 (86%), Positives = 93/98 (95%), Gaps = 1/98 (1%)
 Frame = +1

Query  220  EMSAAVVEGNEAVTGHIISTTIGGKNGEPKRTITYMAERVVGTGSFGIVFQAKCLKTGET  399
            E SA VV+G++  TGHIISTTIGGKNGEPK+TI+YMAERVVGTGSFGIVFQAKCL++GET
Sbjct  7    EXSAPVVDGSDP-TGHIISTTIGGKNGEPKQTISYMAERVVGTGSFGIVFQAKCLESGET  65

Query  400  VAIKKVLQDRRYKNRELXLMRLMDHPNVISLKHCFFST  513
            VAIKKVLQDRRYKNREL LMR+MDHPNV+SLKHCFFST
Sbjct  66   VAIKKVLQDRRYKNRELQLMRVMDHPNVVSLKHCFFST  103



>emb|CDM82043.1| unnamed protein product [Triticum aestivum]
Length=391

 Score =   177 bits (448),  Expect = 4e-50, Method: Compositional matrix adjust.
 Identities = 83/91 (91%), Positives = 87/91 (96%), Gaps = 0/91 (0%)
 Frame = +1

Query  241  EGNEAVTGHIISTTIGGKNGEPKRTITYMAERVVGTGSFGIVFQAKCLKTGETVAIKKVL  420
            EG + VTGHIISTTIGGKNGEPKRTI+YMAERVVGTGSFGIVFQAKCL+TGETVAIKKVL
Sbjct  25   EGGDPVTGHIISTTIGGKNGEPKRTISYMAERVVGTGSFGIVFQAKCLETGETVAIKKVL  84

Query  421  QDRRYKNRELXLMRLMDHPNVISLKHCFFST  513
            QDRRYKNREL LMR MDHPNV+SLKHCFFST
Sbjct  85   QDRRYKNRELQLMRSMDHPNVVSLKHCFFST  115



>ref|XP_009629200.1| PREDICTED: shaggy-related protein kinase NtK-1-like [Nicotiana 
tomentosiformis]
 ref|XP_009629201.1| PREDICTED: shaggy-related protein kinase NtK-1-like [Nicotiana 
tomentosiformis]
Length=409

 Score =   177 bits (449),  Expect = 5e-50, Method: Compositional matrix adjust.
 Identities = 81/103 (79%), Positives = 93/103 (90%), Gaps = 0/103 (0%)
 Frame = +1

Query  205  METDKEMSAAVVEGNEAVTGHIISTTIGGKNGEPKRTITYMAERVVGTGSFGIVFQAKCL  384
            +  DKEM AA+V+GN   TGHII TTIGG+NG+PK+TI+YMAERVVG GSFG+VFQAKCL
Sbjct  34   IRDDKEMEAAIVDGNGTETGHIIVTTIGGRNGQPKQTISYMAERVVGQGSFGVVFQAKCL  93

Query  385  KTGETVAIKKVLQDRRYKNRELXLMRLMDHPNVISLKHCFFST  513
            +TGETVAIKKVLQD+RYKNREL  MRL+DHPNV+SLKHCFFST
Sbjct  94   ETGETVAIKKVLQDKRYKNRELQTMRLLDHPNVVSLKHCFFST  136



>ref|XP_009588662.1| PREDICTED: shaggy-related protein kinase eta-like [Nicotiana 
tomentosiformis]
Length=384

 Score =   176 bits (447),  Expect = 5e-50, Method: Compositional matrix adjust.
 Identities = 83/103 (81%), Positives = 93/103 (90%), Gaps = 0/103 (0%)
 Frame = +1

Query  205  METDKEMSAAVVEGNEAVTGHIISTTIGGKNGEPKRTITYMAERVVGTGSFGIVFQAKCL  384
            M  DKEMSA V++ N AVTGHIISTTIGGKNGEPK+T++YMAERVVGTGSFG+VFQAKCL
Sbjct  1    MADDKEMSAPVMDVNGAVTGHIISTTIGGKNGEPKQTVSYMAERVVGTGSFGVVFQAKCL  60

Query  385  KTGETVAIKKVLQDRRYKNRELXLMRLMDHPNVISLKHCFFST  513
            + GETVAIKKVLQDRRYKNREL LMR M+H NV+ LKHCF+ST
Sbjct  61   ENGETVAIKKVLQDRRYKNRELQLMRTMEHLNVVCLKHCFYST  103



>gb|AAM62970.1| shaggy related protein kinase ASK-GAMMA [Arabidopsis thaliana]
Length=409

 Score =   177 bits (448),  Expect = 5e-50, Method: Compositional matrix adjust.
 Identities = 82/104 (79%), Positives = 93/104 (89%), Gaps = 0/104 (0%)
 Frame = +1

Query  202  EMETDKEMSAAVVEGNEAVTGHIISTTIGGKNGEPKRTITYMAERVVGTGSFGIVFQAKC  381
            +++ DKEM A VV GN   TGHII TTIGG+NG+PK+TI+YMAERVVG GSFG+VFQAKC
Sbjct  33   KIQDDKEMEATVVNGNVTETGHIIVTTIGGRNGQPKQTISYMAERVVGHGSFGVVFQAKC  92

Query  382  LKTGETVAIKKVLQDRRYKNRELXLMRLMDHPNVISLKHCFFST  513
            L+TGETVAIKKVLQDRRYKNREL  MRL+DHPNV+SLKHCFFST
Sbjct  93   LETGETVAIKKVLQDRRYKNRELQTMRLLDHPNVVSLKHCFFST  136



>gb|AGJ93554.1| SHAGGY-like kinase [Triticum aestivum]
 gb|AGK41243.1| SHAGGY-like kinase [Triticum aestivum]
Length=400

 Score =   177 bits (448),  Expect = 5e-50, Method: Compositional matrix adjust.
 Identities = 83/91 (91%), Positives = 87/91 (96%), Gaps = 0/91 (0%)
 Frame = +1

Query  241  EGNEAVTGHIISTTIGGKNGEPKRTITYMAERVVGTGSFGIVFQAKCLKTGETVAIKKVL  420
            EG + VTGHIISTTIGGKNGEPKRTI+YMAERVVGTGSFGIVFQAKCL+TGETVAIKKVL
Sbjct  34   EGGDPVTGHIISTTIGGKNGEPKRTISYMAERVVGTGSFGIVFQAKCLETGETVAIKKVL  93

Query  421  QDRRYKNRELXLMRLMDHPNVISLKHCFFST  513
            QDRRYKNREL LMR MDHPNV+SLKHCFFST
Sbjct  94   QDRRYKNRELQLMRSMDHPNVVSLKHCFFST  124



>emb|CAA53181.1| shaggy related kinase [Arabidopsis thaliana]
 emb|CAA48538.1| serine /threonine protein kinase [Arabidopsis thaliana]
Length=405

 Score =   177 bits (448),  Expect = 5e-50, Method: Compositional matrix adjust.
 Identities = 82/104 (79%), Positives = 93/104 (89%), Gaps = 0/104 (0%)
 Frame = +1

Query  202  EMETDKEMSAAVVEGNEAVTGHIISTTIGGKNGEPKRTITYMAERVVGTGSFGIVFQAKC  381
            ++  DKEM A VV+GN   TGHII TTIGG+NG+PK+TI+YMAERVVG GSFG+VFQAKC
Sbjct  29   KIRDDKEMEATVVDGNGTETGHIIVTTIGGRNGQPKQTISYMAERVVGHGSFGVVFQAKC  88

Query  382  LKTGETVAIKKVLQDRRYKNRELXLMRLMDHPNVISLKHCFFST  513
            L+TGETVAIKKVLQDRRYKNREL  MRL+DHPNV+SLKHCFFST
Sbjct  89   LETGETVAIKKVLQDRRYKNRELQTMRLLDHPNVVSLKHCFFST  132



>ref|NP_568486.1| Shaggy-related protein kinase alpha [Arabidopsis thaliana]
 sp|P43288.3|KSG1_ARATH RecName: Full=Shaggy-related protein kinase alpha; AltName: Full=ASK-alpha 
[Arabidopsis thaliana]
 gb|AAL16257.1|AF428327_1 AT5g26750/F2P16_10 [Arabidopsis thaliana]
 gb|AAK76698.1| putative shaggy kinase alpha [Arabidopsis thaliana]
 gb|AAN13164.1| putative shaggy kinase alpha [Arabidopsis thaliana]
 gb|AED93596.1| Shaggy-related protein kinase alpha [Arabidopsis thaliana]
Length=405

 Score =   177 bits (448),  Expect = 5e-50, Method: Compositional matrix adjust.
 Identities = 82/104 (79%), Positives = 93/104 (89%), Gaps = 0/104 (0%)
 Frame = +1

Query  202  EMETDKEMSAAVVEGNEAVTGHIISTTIGGKNGEPKRTITYMAERVVGTGSFGIVFQAKC  381
            ++  DKEM A VV+GN   TGHII TTIGG+NG+PK+TI+YMAERVVG GSFG+VFQAKC
Sbjct  29   KIRDDKEMEATVVDGNGTETGHIIVTTIGGRNGQPKQTISYMAERVVGHGSFGVVFQAKC  88

Query  382  LKTGETVAIKKVLQDRRYKNRELXLMRLMDHPNVISLKHCFFST  513
            L+TGETVAIKKVLQDRRYKNREL  MRL+DHPNV+SLKHCFFST
Sbjct  89   LETGETVAIKKVLQDRRYKNRELQTMRLLDHPNVVSLKHCFFST  132



>ref|XP_006289925.1| hypothetical protein CARUB_v10003541mg [Capsella rubella]
 gb|EOA22823.1| hypothetical protein CARUB_v10003541mg [Capsella rubella]
Length=409

 Score =   177 bits (448),  Expect = 5e-50, Method: Compositional matrix adjust.
 Identities = 82/104 (79%), Positives = 93/104 (89%), Gaps = 0/104 (0%)
 Frame = +1

Query  202  EMETDKEMSAAVVEGNEAVTGHIISTTIGGKNGEPKRTITYMAERVVGTGSFGIVFQAKC  381
            ++  DKEM A VV+GN   TGHII TTIGG+NG+PK+TI+YMAERVVG GSFG+VFQAKC
Sbjct  33   KIRDDKEMEATVVDGNGTETGHIIVTTIGGRNGQPKQTISYMAERVVGHGSFGVVFQAKC  92

Query  382  LKTGETVAIKKVLQDRRYKNRELXLMRLMDHPNVISLKHCFFST  513
            L+TGETVAIKKVLQDRRYKNREL  MRL+DHPNV+SLKHCFFST
Sbjct  93   LETGETVAIKKVLQDRRYKNRELQTMRLLDHPNVVSLKHCFFST  136



>emb|CAA04265.1| shaggy-like kinase alpha [Arabidopsis thaliana]
Length=405

 Score =   177 bits (448),  Expect = 5e-50, Method: Compositional matrix adjust.
 Identities = 82/104 (79%), Positives = 93/104 (89%), Gaps = 0/104 (0%)
 Frame = +1

Query  202  EMETDKEMSAAVVEGNEAVTGHIISTTIGGKNGEPKRTITYMAERVVGTGSFGIVFQAKC  381
            ++  DKEM A VV+GN   TGHII TTIGG+NG+PK+TI+YMAERVVG GSFG+VFQAKC
Sbjct  29   KIRDDKEMEATVVDGNGTETGHIIVTTIGGRNGQPKQTISYMAERVVGHGSFGVVFQAKC  88

Query  382  LKTGETVAIKKVLQDRRYKNRELXLMRLMDHPNVISLKHCFFST  513
            L+TGETVAIKKVLQDRRYKNREL  MRL+DHPNV+SLKHCFFST
Sbjct  89   LETGETVAIKKVLQDRRYKNRELQTMRLLDHPNVVSLKHCFFST  132



>ref|XP_002874323.1| hypothetical protein ARALYDRAFT_489503 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH50582.1| hypothetical protein ARALYDRAFT_489503 [Arabidopsis lyrata subsp. 
lyrata]
Length=409

 Score =   177 bits (448),  Expect = 6e-50, Method: Compositional matrix adjust.
 Identities = 82/104 (79%), Positives = 93/104 (89%), Gaps = 0/104 (0%)
 Frame = +1

Query  202  EMETDKEMSAAVVEGNEAVTGHIISTTIGGKNGEPKRTITYMAERVVGTGSFGIVFQAKC  381
            ++  DKEM A VV+GN   TGHII TTIGG+NG+PK+TI+YMAERVVG GSFG+VFQAKC
Sbjct  33   KIRDDKEMEATVVDGNGTETGHIIVTTIGGRNGQPKQTISYMAERVVGHGSFGVVFQAKC  92

Query  382  LKTGETVAIKKVLQDRRYKNRELXLMRLMDHPNVISLKHCFFST  513
            L+TGETVAIKKVLQDRRYKNREL  MRL+DHPNV+SLKHCFFST
Sbjct  93   LETGETVAIKKVLQDRRYKNRELQTMRLLDHPNVVSLKHCFFST  136



>ref|XP_010455024.1| PREDICTED: shaggy-related protein kinase alpha-like [Camelina 
sativa]
 ref|XP_010455025.1| PREDICTED: shaggy-related protein kinase alpha-like [Camelina 
sativa]
Length=412

 Score =   177 bits (448),  Expect = 6e-50, Method: Compositional matrix adjust.
 Identities = 82/104 (79%), Positives = 93/104 (89%), Gaps = 0/104 (0%)
 Frame = +1

Query  202  EMETDKEMSAAVVEGNEAVTGHIISTTIGGKNGEPKRTITYMAERVVGTGSFGIVFQAKC  381
            ++  DKEM A VV+GN   TGHII TTIGG+NG+PK+TI+YMAERVVG GSFG+VFQAKC
Sbjct  36   KIRDDKEMEATVVDGNGTETGHIIVTTIGGRNGQPKQTISYMAERVVGHGSFGVVFQAKC  95

Query  382  LKTGETVAIKKVLQDRRYKNRELXLMRLMDHPNVISLKHCFFST  513
            L+TGETVAIKKVLQDRRYKNREL  MRL+DHPNV+SLKHCFFST
Sbjct  96   LETGETVAIKKVLQDRRYKNRELQTMRLLDHPNVVSLKHCFFST  139



>ref|XP_010493927.1| PREDICTED: shaggy-related protein kinase alpha isoform X1 [Camelina 
sativa]
 ref|XP_010493928.1| PREDICTED: shaggy-related protein kinase alpha isoform X1 [Camelina 
sativa]
Length=412

 Score =   177 bits (448),  Expect = 6e-50, Method: Compositional matrix adjust.
 Identities = 82/104 (79%), Positives = 93/104 (89%), Gaps = 0/104 (0%)
 Frame = +1

Query  202  EMETDKEMSAAVVEGNEAVTGHIISTTIGGKNGEPKRTITYMAERVVGTGSFGIVFQAKC  381
            ++  DKEM A VV+GN   TGHII TTIGG+NG+PK+TI+YMAERVVG GSFG+VFQAKC
Sbjct  36   KIRDDKEMEATVVDGNGTETGHIIVTTIGGRNGQPKQTISYMAERVVGHGSFGVVFQAKC  95

Query  382  LKTGETVAIKKVLQDRRYKNRELXLMRLMDHPNVISLKHCFFST  513
            L+TGETVAIKKVLQDRRYKNREL  MRL+DHPNV+SLKHCFFST
Sbjct  96   LETGETVAIKKVLQDRRYKNRELQTMRLLDHPNVVSLKHCFFST  139



>gb|KDO45354.1| hypothetical protein CISIN_1g015298mg [Citrus sinensis]
Length=353

 Score =   175 bits (444),  Expect = 6e-50, Method: Compositional matrix adjust.
 Identities = 80/104 (77%), Positives = 93/104 (89%), Gaps = 0/104 (0%)
 Frame = +1

Query  202  EMETDKEMSAAVVEGNEAVTGHIISTTIGGKNGEPKRTITYMAERVVGTGSFGIVFQAKC  381
            ++  DKEM A VV+GN   TGHII TTIGG+NG+PK+TI+YMAER+VG GSFG+VFQAKC
Sbjct  33   KIRDDKEMEATVVDGNGTETGHIIVTTIGGRNGQPKQTISYMAERIVGQGSFGVVFQAKC  92

Query  382  LKTGETVAIKKVLQDRRYKNRELXLMRLMDHPNVISLKHCFFST  513
            L+TGETVAIKKVLQD+RYKNREL  MRL+DHPNV+SLKHCFFST
Sbjct  93   LETGETVAIKKVLQDKRYKNRELQTMRLLDHPNVVSLKHCFFST  136



>gb|ACJ85100.1| unknown [Medicago truncatula]
Length=250

 Score =   172 bits (437),  Expect = 6e-50, Method: Compositional matrix adjust.
 Identities = 78/103 (76%), Positives = 91/103 (88%), Gaps = 0/103 (0%)
 Frame = +1

Query  205  METDKEMSAAVVEGNEAVTGHIISTTIGGKNGEPKRTITYMAERVVGTGSFGIVFQAKCL  384
            ++ DKEM A VV+GN    GH+I TTIGGKNG+PK+TI+YMAER VG GSFG+VFQAKCL
Sbjct  3    IKDDKEMEAHVVDGNSTEAGHVIVTTIGGKNGQPKQTISYMAERAVGQGSFGVVFQAKCL  62

Query  385  KTGETVAIKKVLQDRRYKNRELXLMRLMDHPNVISLKHCFFST  513
            +TGETVAIKKVLQD+RYKNREL  MRL+DHPNV++LKHCFFST
Sbjct  63   ETGETVAIKKVLQDKRYKNRELQTMRLLDHPNVVTLKHCFFST  105



>ref|NP_187235.1| Shaggy-related protein kinase gamma [Arabidopsis thaliana]
 ref|NP_850520.1| Shaggy-related protein kinase gamma [Arabidopsis thaliana]
 sp|P43289.1|KSG3_ARATH RecName: Full=Shaggy-related protein kinase gamma; AltName: Full=ASK-gamma 
[Arabidopsis thaliana]
 gb|AAF26086.1|AC012393_12 shaggy related protein kinase, ASK-GAMMA [Arabidopsis thaliana]
 emb|CAA53180.1| ASK-gamma (Arabidopsis shaggy-related kinase) [Arabidopsis thaliana]
 emb|CAA73247.1| shaggy-like kinase gamma [Arabidopsis thaliana]
 gb|AAL32791.1| shaggy related protein kinase, ASK-GAMMA [Arabidopsis thaliana]
 gb|AAM13346.1| shaggy related protein kinase, ASK-GAMMA [Arabidopsis thaliana]
 dbj|BAE99095.1| shaggy related protein kinase [Arabidopsis thaliana]
 dbj|BAH19402.1| AT3G05840 [Arabidopsis thaliana]
 gb|AEE74303.1| Shaggy-related protein kinase gamma [Arabidopsis thaliana]
 gb|AEE74304.1| Shaggy-related protein kinase gamma [Arabidopsis thaliana]
Length=409

 Score =   177 bits (448),  Expect = 6e-50, Method: Compositional matrix adjust.
 Identities = 81/104 (78%), Positives = 93/104 (89%), Gaps = 0/104 (0%)
 Frame = +1

Query  202  EMETDKEMSAAVVEGNEAVTGHIISTTIGGKNGEPKRTITYMAERVVGTGSFGIVFQAKC  381
            +++ DKEM A +V GN   TGHII TTIGG+NG+PK+TI+YMAERVVG GSFG+VFQAKC
Sbjct  33   KIQDDKEMEATIVNGNVTETGHIIVTTIGGRNGQPKQTISYMAERVVGHGSFGVVFQAKC  92

Query  382  LKTGETVAIKKVLQDRRYKNRELXLMRLMDHPNVISLKHCFFST  513
            L+TGETVAIKKVLQDRRYKNREL  MRL+DHPNV+SLKHCFFST
Sbjct  93   LETGETVAIKKVLQDRRYKNRELQTMRLLDHPNVVSLKHCFFST  136



>ref|XP_009410923.1| PREDICTED: shaggy-related protein kinase eta isoform X1 [Musa 
acuminata subsp. malaccensis]
Length=390

 Score =   176 bits (446),  Expect = 6e-50, Method: Compositional matrix adjust.
 Identities = 82/97 (85%), Positives = 92/97 (95%), Gaps = 0/97 (0%)
 Frame = +1

Query  223  MSAAVVEGNEAVTGHIISTTIGGKNGEPKRTITYMAERVVGTGSFGIVFQAKCLKTGETV  402
            + A+V+EG++ VTGHIISTTIGGKNGEPK+TI+YMAERVVG GSFGIVFQAKCL+TGETV
Sbjct  18   LQASVMEGSDGVTGHIISTTIGGKNGEPKQTISYMAERVVGAGSFGIVFQAKCLETGETV  77

Query  403  AIKKVLQDRRYKNRELXLMRLMDHPNVISLKHCFFST  513
            AIKKVLQD+RYKNREL LMR MDHPNVISLKHCFF+T
Sbjct  78   AIKKVLQDQRYKNRELQLMRSMDHPNVISLKHCFFTT  114



>ref|XP_006394905.1| hypothetical protein EUTSA_v10004319mg [Eutrema salsugineum]
 gb|ESQ32191.1| hypothetical protein EUTSA_v10004319mg [Eutrema salsugineum]
Length=409

 Score =   177 bits (448),  Expect = 6e-50, Method: Compositional matrix adjust.
 Identities = 82/104 (79%), Positives = 93/104 (89%), Gaps = 0/104 (0%)
 Frame = +1

Query  202  EMETDKEMSAAVVEGNEAVTGHIISTTIGGKNGEPKRTITYMAERVVGTGSFGIVFQAKC  381
            ++  DKEM A VV+GN   TGHII TTIGG+NG+PK+TI+YMAERVVG GSFG+VFQAKC
Sbjct  33   KIRDDKEMEATVVDGNGTETGHIIVTTIGGRNGQPKQTISYMAERVVGHGSFGVVFQAKC  92

Query  382  LKTGETVAIKKVLQDRRYKNRELXLMRLMDHPNVISLKHCFFST  513
            L+TGETVAIKKVLQDRRYKNREL  MRL+DHPNV+SLKHCFFST
Sbjct  93   LETGETVAIKKVLQDRRYKNRELQTMRLLDHPNVVSLKHCFFST  136



>ref|XP_010421531.1| PREDICTED: shaggy-related protein kinase alpha-like [Camelina 
sativa]
 ref|XP_010421533.1| PREDICTED: shaggy-related protein kinase alpha-like [Camelina 
sativa]
Length=412

 Score =   177 bits (448),  Expect = 7e-50, Method: Compositional matrix adjust.
 Identities = 82/104 (79%), Positives = 93/104 (89%), Gaps = 0/104 (0%)
 Frame = +1

Query  202  EMETDKEMSAAVVEGNEAVTGHIISTTIGGKNGEPKRTITYMAERVVGTGSFGIVFQAKC  381
            ++  DKEM A VV+GN   TGHII TTIGG+NG+PK+TI+YMAERVVG GSFG+VFQAKC
Sbjct  36   KIRDDKEMEATVVDGNGTETGHIIVTTIGGRNGQPKQTISYMAERVVGHGSFGVVFQAKC  95

Query  382  LKTGETVAIKKVLQDRRYKNRELXLMRLMDHPNVISLKHCFFST  513
            L+TGETVAIKKVLQDRRYKNREL  MRL+DHPNV+SLKHCFFST
Sbjct  96   LETGETVAIKKVLQDRRYKNRELQTMRLLDHPNVVSLKHCFFST  139



>ref|XP_006408022.1| hypothetical protein EUTSA_v10020835mg [Eutrema salsugineum]
 gb|ESQ49475.1| hypothetical protein EUTSA_v10020835mg [Eutrema salsugineum]
Length=410

 Score =   176 bits (447),  Expect = 7e-50, Method: Compositional matrix adjust.
 Identities = 81/104 (78%), Positives = 93/104 (89%), Gaps = 0/104 (0%)
 Frame = +1

Query  202  EMETDKEMSAAVVEGNEAVTGHIISTTIGGKNGEPKRTITYMAERVVGTGSFGIVFQAKC  381
            +++ DKEM A +V GN   TGHII TTIGG+NG+PK+TI+YMAERVVG GSFG+VFQAKC
Sbjct  33   KIQDDKEMEATIVNGNVTETGHIIVTTIGGRNGQPKQTISYMAERVVGHGSFGVVFQAKC  92

Query  382  LKTGETVAIKKVLQDRRYKNRELXLMRLMDHPNVISLKHCFFST  513
            L+TGETVAIKKVLQDRRYKNREL  MRL+DHPNV+SLKHCFFST
Sbjct  93   LETGETVAIKKVLQDRRYKNRELQTMRLLDHPNVVSLKHCFFST  136



>ref|XP_006408021.1| hypothetical protein EUTSA_v10020835mg [Eutrema salsugineum]
 ref|XP_006408023.1| hypothetical protein EUTSA_v10020835mg [Eutrema salsugineum]
 gb|ESQ49474.1| hypothetical protein EUTSA_v10020835mg [Eutrema salsugineum]
 gb|ESQ49476.1| hypothetical protein EUTSA_v10020835mg [Eutrema salsugineum]
Length=409

 Score =   176 bits (447),  Expect = 7e-50, Method: Compositional matrix adjust.
 Identities = 81/104 (78%), Positives = 93/104 (89%), Gaps = 0/104 (0%)
 Frame = +1

Query  202  EMETDKEMSAAVVEGNEAVTGHIISTTIGGKNGEPKRTITYMAERVVGTGSFGIVFQAKC  381
            +++ DKEM A +V GN   TGHII TTIGG+NG+PK+TI+YMAERVVG GSFG+VFQAKC
Sbjct  33   KIQDDKEMEATIVNGNVTETGHIIVTTIGGRNGQPKQTISYMAERVVGHGSFGVVFQAKC  92

Query  382  LKTGETVAIKKVLQDRRYKNRELXLMRLMDHPNVISLKHCFFST  513
            L+TGETVAIKKVLQDRRYKNREL  MRL+DHPNV+SLKHCFFST
Sbjct  93   LETGETVAIKKVLQDRRYKNRELQTMRLLDHPNVVSLKHCFFST  136



>ref|XP_010251218.1| PREDICTED: shaggy-related protein kinase epsilon-like isoform 
X2 [Nelumbo nucifera]
Length=392

 Score =   176 bits (446),  Expect = 8e-50, Method: Compositional matrix adjust.
 Identities = 82/104 (79%), Positives = 93/104 (89%), Gaps = 0/104 (0%)
 Frame = +1

Query  202  EMETDKEMSAAVVEGNEAVTGHIISTTIGGKNGEPKRTITYMAERVVGTGSFGIVFQAKC  381
            ++  DKEM A VV+GN   TGHII TTIGG+NG+PK+TI+YMAERVVG GSFGIVFQAKC
Sbjct  33   KIRDDKEMEATVVDGNGTETGHIIVTTIGGRNGQPKQTISYMAERVVGHGSFGIVFQAKC  92

Query  382  LKTGETVAIKKVLQDRRYKNRELXLMRLMDHPNVISLKHCFFST  513
            L+TGETVAIKKVLQD+RYKNREL  MRL+DHPNV+SLKHCFFST
Sbjct  93   LETGETVAIKKVLQDKRYKNRELQTMRLLDHPNVVSLKHCFFST  136



>ref|XP_002882438.1| hypothetical protein ARALYDRAFT_477878 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH58697.1| hypothetical protein ARALYDRAFT_477878 [Arabidopsis lyrata subsp. 
lyrata]
Length=409

 Score =   176 bits (447),  Expect = 8e-50, Method: Compositional matrix adjust.
 Identities = 81/104 (78%), Positives = 93/104 (89%), Gaps = 0/104 (0%)
 Frame = +1

Query  202  EMETDKEMSAAVVEGNEAVTGHIISTTIGGKNGEPKRTITYMAERVVGTGSFGIVFQAKC  381
            +++ DKEM A +V GN   TGHII TTIGG+NG+PK+TI+YMAERVVG GSFG+VFQAKC
Sbjct  33   KIQDDKEMEATIVNGNVTETGHIIVTTIGGRNGQPKQTISYMAERVVGHGSFGVVFQAKC  92

Query  382  LKTGETVAIKKVLQDRRYKNRELXLMRLMDHPNVISLKHCFFST  513
            L+TGETVAIKKVLQDRRYKNREL  MRL+DHPNV+SLKHCFFST
Sbjct  93   LETGETVAIKKVLQDRRYKNRELQTMRLLDHPNVVSLKHCFFST  136



>ref|XP_010270906.1| PREDICTED: shaggy-related protein kinase alpha-like isoform X2 
[Nelumbo nucifera]
 ref|XP_010270907.1| PREDICTED: shaggy-related protein kinase alpha-like isoform X2 
[Nelumbo nucifera]
Length=409

 Score =   176 bits (447),  Expect = 8e-50, Method: Compositional matrix adjust.
 Identities = 82/104 (79%), Positives = 93/104 (89%), Gaps = 0/104 (0%)
 Frame = +1

Query  202  EMETDKEMSAAVVEGNEAVTGHIISTTIGGKNGEPKRTITYMAERVVGTGSFGIVFQAKC  381
            ++  DKEM A VV+GN   TGHII TTIGG+NG+PK+TI+YMAERVVG GSFGIVFQAKC
Sbjct  33   KIRDDKEMEATVVDGNGTETGHIIVTTIGGRNGQPKQTISYMAERVVGNGSFGIVFQAKC  92

Query  382  LKTGETVAIKKVLQDRRYKNRELXLMRLMDHPNVISLKHCFFST  513
            L+TGETVAIKKVLQD+RYKNREL  MRL+DHPNV+SLKHCFFST
Sbjct  93   LETGETVAIKKVLQDKRYKNRELQTMRLLDHPNVVSLKHCFFST  136



>emb|CDY49981.1| BnaC03g34380D [Brassica napus]
 emb|CDX74129.1| BnaA03g29180D [Brassica napus]
Length=411

 Score =   176 bits (447),  Expect = 8e-50, Method: Compositional matrix adjust.
 Identities = 81/104 (78%), Positives = 93/104 (89%), Gaps = 0/104 (0%)
 Frame = +1

Query  202  EMETDKEMSAAVVEGNEAVTGHIISTTIGGKNGEPKRTITYMAERVVGTGSFGIVFQAKC  381
            +++ DKEM A +V GN   TGHII TTIGG+NG+PK+TI+YMAERVVG GSFG+VFQAKC
Sbjct  34   KIQDDKEMEATIVNGNVTETGHIIVTTIGGRNGQPKQTISYMAERVVGHGSFGVVFQAKC  93

Query  382  LKTGETVAIKKVLQDRRYKNRELXLMRLMDHPNVISLKHCFFST  513
            L+TGETVAIKKVLQDRRYKNREL  MRL+DHPNV+SLKHCFFST
Sbjct  94   LETGETVAIKKVLQDRRYKNRELQTMRLLDHPNVVSLKHCFFST  137



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 554939364720