BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFF038I16

Length=428
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

emb|CDP06299.1|  unnamed protein product                                235   7e-76   Coffea canephora [robusta coffee]
gb|ADE42972.1|  putative 60S ribosomal protein L18a                     235   7e-76   Gardenia jasminoides
ref|XP_010655647.1|  PREDICTED: 60S ribosomal protein L18a isofor...    234   1e-75   Vitis vinifera
ref|XP_004147412.1|  PREDICTED: 60S ribosomal protein L18a-like         234   2e-75   
ref|XP_008444078.1|  PREDICTED: 60S ribosomal protein L18a              234   2e-75   Cucumis melo [Oriental melon]
ref|XP_006387417.1|  60S ribosomal protein L18a-1                       233   3e-75   
gb|KHG29727.1|  60S ribosomal L18a                                      233   3e-75   Gossypium arboreum [tree cotton]
ref|XP_006477944.1|  PREDICTED: 60S ribosomal protein L18a-like i...    234   3e-75   Citrus sinensis [apfelsine]
ref|XP_002276260.1|  PREDICTED: 60S ribosomal protein L18a              233   3e-75   Vitis vinifera
ref|XP_004241806.1|  PREDICTED: 60S ribosomal protein L18a              233   4e-75   Solanum lycopersicum
ref|NP_001275107.1|  60S ribosomal protein L18a-like                    233   5e-75   Solanum tuberosum [potatoes]
gb|KHG02356.1|  60S ribosomal L18a                                      233   5e-75   Gossypium arboreum [tree cotton]
ref|XP_011096544.1|  PREDICTED: 60S ribosomal protein L18a-like         233   6e-75   Sesamum indicum [beniseed]
ref|XP_007215058.1|  hypothetical protein PRUPE_ppa012231mg             233   6e-75   
gb|EYU36633.1|  hypothetical protein MIMGU_mgv1a014793mg                233   7e-75   Erythranthe guttata [common monkey flower]
gb|ABB29925.1|  unknown                                                 232   8e-75   Solanum tuberosum [potatoes]
ref|XP_006449674.1|  hypothetical protein CICLE_v10016900mg             232   8e-75   Citrus clementina [clementine]
ref|XP_002317384.1|  60S ribosomal protein L18a-1                       232   9e-75   Populus trichocarpa [western balsam poplar]
ref|XP_011002051.1|  PREDICTED: 60S ribosomal protein L18a-like         232   9e-75   Populus euphratica
gb|KJB57268.1|  hypothetical protein B456_009G155900                    232   1e-74   Gossypium raimondii
gb|KDO51884.1|  hypothetical protein CISIN_1g030276mg                   232   1e-74   Citrus sinensis [apfelsine]
ref|XP_008439644.1|  PREDICTED: 60S ribosomal protein L18a              232   1e-74   Cucumis melo [Oriental melon]
ref|XP_004134633.1|  PREDICTED: 60S ribosomal protein L18a-like         232   2e-74   Cucumis sativus [cucumbers]
ref|XP_010542333.1|  PREDICTED: 60S ribosomal protein L18a isofor...    231   2e-74   Tarenaya hassleriana [spider flower]
ref|NP_001275252.1|  uncharacterized protein LOC102577837               231   2e-74   Solanum tuberosum [potatoes]
ref|XP_011071121.1|  PREDICTED: 60S ribosomal protein L18a              231   2e-74   Sesamum indicum [beniseed]
gb|EYU43268.1|  hypothetical protein MIMGU_mgv1a013972mg                232   2e-74   Erythranthe guttata [common monkey flower]
ref|XP_002268750.1|  PREDICTED: 60S ribosomal protein L18a              231   3e-74   Vitis vinifera
ref|XP_006363066.1|  PREDICTED: 60S ribosomal protein L18a-like         231   3e-74   Solanum tuberosum [potatoes]
ref|XP_009598886.1|  PREDICTED: 60S ribosomal protein L18a-like         231   4e-74   Nicotiana tomentosiformis
sp|Q9ATF5.1|RL18A_CASSA  RecName: Full=60S ribosomal protein L18a       231   4e-74   Castanea sativa
gb|KHG16522.1|  60S ribosomal L18a                                      231   4e-74   Gossypium arboreum [tree cotton]
ref|XP_009799848.1|  PREDICTED: 60S ribosomal protein L18a              231   4e-74   Nicotiana sylvestris
gb|KHG16962.1|  60S ribosomal L18a                                      231   4e-74   Gossypium arboreum [tree cotton]
ref|XP_002528496.1|  60S ribosomal protein L18a, putative               231   4e-74   Ricinus communis
gb|ACS96446.1|  60S ribosomal protein L18a                              230   5e-74   Jatropha curcas
gb|ABK92715.1|  unknown                                                 230   5e-74   Populus trichocarpa [western balsam poplar]
ref|XP_010538246.1|  PREDICTED: 60S ribosomal protein L18a-like         230   5e-74   Tarenaya hassleriana [spider flower]
ref|XP_011009655.1|  PREDICTED: 60S ribosomal protein L18a-2            230   5e-74   Populus euphratica
ref|XP_010324737.1|  PREDICTED: 60S ribosomal protein L18a-like         230   5e-74   Solanum lycopersicum
ref|NP_001275234.1|  60S ribosomal protein L18a-like                    230   5e-74   Solanum tuberosum [potatoes]
ref|XP_008811096.1|  PREDICTED: 60S ribosomal protein L18a              230   6e-74   Phoenix dactylifera
ref|XP_006437137.1|  hypothetical protein CICLE_v10032878mg             230   6e-74   
gb|KJB10614.1|  hypothetical protein B456_001G211400                    230   7e-74   Gossypium raimondii
gb|KCW89757.1|  hypothetical protein EUGRSUZ_A02018                     230   7e-74   Eucalyptus grandis [rose gum]
ref|XP_009609142.1|  PREDICTED: 60S ribosomal protein L18a              229   9e-74   Nicotiana tomentosiformis
ref|XP_006442292.1|  hypothetical protein CICLE_v10022114mg             231   1e-73   Citrus clementina [clementine]
gb|EYU33348.1|  hypothetical protein MIMGU_mgv1a014797mg                229   1e-73   Erythranthe guttata [common monkey flower]
ref|XP_010552158.1|  PREDICTED: 60S ribosomal protein L18a              229   1e-73   Tarenaya hassleriana [spider flower]
ref|XP_002300869.1|  60S ribosomal protein L18a-1                       229   2e-73   Populus trichocarpa [western balsam poplar]
ref|XP_006410594.1|  hypothetical protein EUTSA_v10017304mg             229   2e-73   Eutrema salsugineum [saltwater cress]
ref|XP_007025105.1|  Ribosomal protein L18ae/LX family protein          229   2e-73   
ref|XP_009394206.1|  PREDICTED: 60S ribosomal protein L18a-like         229   2e-73   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009406265.1|  PREDICTED: 60S ribosomal protein L18a              229   2e-73   Musa acuminata subsp. malaccensis [pisang utan]
gb|ABK94361.1|  unknown                                                 229   2e-73   Populus trichocarpa [western balsam poplar]
ref|XP_008798296.1|  PREDICTED: 60S ribosomal protein L18a              229   3e-73   Phoenix dactylifera
ref|XP_010053843.1|  PREDICTED: 60S ribosomal protein L18a              228   3e-73   
gb|KCW89756.1|  hypothetical protein EUGRSUZ_A02018                     229   3e-73   Eucalyptus grandis [rose gum]
gb|KHG27228.1|  60S ribosomal L18a                                      228   3e-73   Gossypium arboreum [tree cotton]
ref|XP_010924380.1|  PREDICTED: 60S ribosomal protein L18a              228   4e-73   Elaeis guineensis
ref|XP_010540563.1|  PREDICTED: 60S ribosomal protein L18a              228   4e-73   Tarenaya hassleriana [spider flower]
gb|KCW75929.1|  hypothetical protein EUGRSUZ_D00304                     231   5e-73   Eucalyptus grandis [rose gum]
gb|KJB42782.1|  hypothetical protein B456_007G174800                    228   5e-73   Gossypium raimondii
ref|XP_010052071.1|  PREDICTED: 60S ribosomal protein L18a-like i...    228   5e-73   Eucalyptus grandis [rose gum]
ref|XP_009782492.1|  PREDICTED: 60S ribosomal protein L18a-like         228   6e-73   Nicotiana sylvestris
ref|NP_001238728.1|  uncharacterized protein LOC100306174               228   7e-73   Glycine max [soybeans]
gb|KHN38335.1|  60S ribosomal protein L18a                              227   9e-73   Glycine soja [wild soybean]
gb|KJB69800.1|  hypothetical protein B456_011G042900                    227   1e-72   Gossypium raimondii
ref|NP_001237679.1|  uncharacterized protein LOC100306365               227   1e-72   Glycine max [soybeans]
gb|AFK44558.1|  unknown                                                 227   1e-72   Lotus japonicus
ref|XP_007159262.1|  hypothetical protein PHAVU_002G223200g             227   1e-72   Phaseolus vulgaris [French bean]
ref|XP_011074018.1|  PREDICTED: 60S ribosomal protein L18a-2-like       226   2e-72   Sesamum indicum [beniseed]
ref|NP_001236918.1|  uncharacterized protein LOC100500108               226   2e-72   Glycine max [soybeans]
ref|XP_007147889.1|  hypothetical protein PHAVU_006G163400g             226   2e-72   Phaseolus vulgaris [French bean]
ref|NP_001056335.1|  Os05g0565000                                       226   2e-72   
gb|KHG26670.1|  60S ribosomal L18a                                      226   2e-72   Gossypium arboreum [tree cotton]
ref|XP_007048983.1|  Ribosomal protein L18ae/LX family protein          226   2e-72   Theobroma cacao [chocolate]
ref|XP_006654794.1|  PREDICTED: 60S ribosomal protein L18a-like         226   3e-72   Oryza brachyantha
ref|XP_002440257.1|  hypothetical protein SORBIDRAFT_09g028590          226   3e-72   Sorghum bicolor [broomcorn]
gb|ACN28455.1|  unknown                                                 226   4e-72   Zea mays [maize]
ref|NP_001148024.1|  60S ribosomal protein L18a                         226   4e-72   Zea mays [maize]
ref|XP_009389413.1|  PREDICTED: 60S ribosomal protein L18a-like         226   4e-72   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_007136179.1|  hypothetical protein PHAVU_009G024800g             225   4e-72   Phaseolus vulgaris [French bean]
gb|ACG30921.1|  60S ribosomal protein L18a                              225   5e-72   Zea mays [maize]
emb|CDX97587.1|  BnaA05g24920D                                          225   5e-72   
gb|AFK33651.1|  unknown                                                 225   5e-72   Lotus japonicus
ref|XP_006841639.1|  hypothetical protein AMTR_s00003p00234980          225   6e-72   Amborella trichopoda
ref|XP_004486036.1|  PREDICTED: 60S ribosomal protein L18a-like         225   6e-72   Cicer arietinum [garbanzo]
ref|XP_004969468.1|  PREDICTED: 60S ribosomal protein L18a-like         225   6e-72   Setaria italica
ref|XP_006644488.1|  PREDICTED: 60S ribosomal protein L18a-like         225   6e-72   Oryza brachyantha
gb|AFK46978.1|  unknown                                                 225   7e-72   Lotus japonicus
ref|NP_001043805.2|  Os01g0666900                                       225   7e-72   
pdb|3IZS|S  Chain S, Localization Of The Large Subunit Ribosomal ...    224   8e-72   Saccharomyces cerevisiae [brewer's yeast]
ref|XP_010263115.1|  PREDICTED: 60S ribosomal protein L18a-2            225   8e-72   Nelumbo nucifera [Indian lotus]
ref|NP_001044264.1|  Os01g0752300                                       225   8e-72   
ref|NP_001149475.1|  LOC100283101                                       224   9e-72   Zea mays [maize]
ref|XP_004979031.1|  PREDICTED: 60S ribosomal protein L18a-like         224   9e-72   Setaria italica
ref|NP_001152227.1|  60S ribosomal protein L18a                         224   9e-72   Zea mays [maize]
ref|XP_009399317.1|  PREDICTED: 60S ribosomal protein L18a-like         224   1e-71   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_002449311.1|  hypothetical protein SORBIDRAFT_05g007540          224   2e-71   Sorghum bicolor [broomcorn]
emb|CDX75778.1|  BnaC03g38610D                                          227   2e-71   
ref|NP_001237207.1|  uncharacterized protein LOC100527007               224   2e-71   
ref|XP_008380196.1|  PREDICTED: 60S ribosomal protein L18a-2-like       224   2e-71   Malus domestica [apple tree]
ref|XP_010918885.1|  PREDICTED: 60S ribosomal protein L18a-like         224   2e-71   
ref|XP_004488610.1|  PREDICTED: 60S ribosomal protein L18a-like i...    224   2e-71   Cicer arietinum [garbanzo]
gb|EMS54441.1|  60S ribosomal protein L18a                              223   3e-71   Triticum urartu
gb|EMT07340.1|  60S ribosomal protein L18a                              223   3e-71   
gb|ABK26330.1|  unknown                                                 223   3e-71   Picea sitchensis
ref|XP_003597433.1|  60S ribosomal protein L18a                         223   4e-71   
ref|XP_008796386.1|  PREDICTED: 60S ribosomal protein L18a-like         223   4e-71   Phoenix dactylifera
ref|XP_006407062.1|  hypothetical protein EUTSA_v10021546mg             223   4e-71   Eutrema salsugineum [saltwater cress]
ref|XP_009407842.1|  PREDICTED: 60S ribosomal protein L18a-like         223   4e-71   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_003567891.1|  PREDICTED: 60S ribosomal protein L18a-like         223   4e-71   Brachypodium distachyon [annual false brome]
ref|XP_008789456.1|  PREDICTED: 60S ribosomal protein L18a-2            223   5e-71   Phoenix dactylifera
gb|AFK40398.1|  unknown                                                 223   5e-71   Medicago truncatula
gb|ACF78859.1|  unknown                                                 223   5e-71   Zea mays [maize]
ref|XP_007212144.1|  hypothetical protein PRUPE_ppa012251mg             223   5e-71   Prunus persica
ref|XP_003569521.1|  PREDICTED: 60S ribosomal protein L18a-like         222   7e-71   Brachypodium distachyon [annual false brome]
emb|CDX79564.1|  BnaC03g19000D                                          222   8e-71   
ref|XP_008465452.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    237   1e-70   Cucumis melo [Oriental melon]
ref|XP_009135390.1|  PREDICTED: 60S ribosomal protein L18a-2-like       222   1e-70   Brassica rapa
ref|XP_004166596.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    237   1e-70   
ref|XP_008371596.1|  PREDICTED: 60S ribosomal protein L18a-2 isof...    221   2e-70   Malus domestica [apple tree]
ref|XP_010679799.1|  PREDICTED: 60S ribosomal protein L18a-2            221   2e-70   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_009132991.1|  PREDICTED: 60S ribosomal protein L18a-2-like       221   2e-70   Brassica rapa
ref|XP_002276545.1|  PREDICTED: 60S ribosomal protein L18a isofor...    225   3e-70   Vitis vinifera
ref|XP_009146339.1|  PREDICTED: 60S ribosomal protein L18a-2            221   3e-70   Brassica rapa
ref|XP_008229704.1|  PREDICTED: uncharacterized protein LOC103329046    236   3e-70   Prunus mume [ume]
ref|XP_004488609.1|  PREDICTED: 60S ribosomal protein L18a-like i...    220   5e-70   
ref|XP_006298665.1|  hypothetical protein CARUB_v10014756mg             220   5e-70   Capsella rubella
ref|XP_003569823.1|  PREDICTED: 60S ribosomal protein L18a              220   6e-70   Brachypodium distachyon [annual false brome]
gb|EMT24993.1|  60S ribosomal protein L18a                              220   7e-70   
dbj|BAJ85943.1|  predicted protein                                      220   7e-70   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|KFK36339.1|  hypothetical protein AALP_AA4G109800                    219   9e-70   Arabis alpina [alpine rockcress]
ref|XP_006295085.1|  hypothetical protein CARUB_v10024156mg             219   1e-69   Capsella rubella
ref|XP_009141387.1|  PREDICTED: 60S ribosomal protein L18a-2            219   1e-69   Brassica rapa
gb|ACG47612.1|  60S ribosomal protein L18a                              219   1e-69   Zea mays [maize]
ref|XP_010542335.1|  PREDICTED: 60S ribosomal protein L18a-2 isof...    223   2e-69   Tarenaya hassleriana [spider flower]
ref|XP_010465351.1|  PREDICTED: 60S ribosomal protein L18a-3            218   4e-69   Camelina sativa [gold-of-pleasure]
ref|XP_003617399.1|  60S ribosomal protein L18a                         233   4e-69   
ref|XP_006601742.1|  PREDICTED: uncharacterized protein LOC100306...    218   4e-69   
ref|NP_180995.1|  60S ribosomal protein L18a-2                          218   5e-69   Arabidopsis thaliana [mouse-ear cress]
ref|XP_011085620.1|  PREDICTED: 60S ribosomal protein L18a-like         217   6e-69   
ref|XP_004303886.1|  PREDICTED: 60S ribosomal protein L18a-2 isof...    217   6e-69   Fragaria vesca subsp. vesca
gb|KEH33554.1|  60S ribosomal protein L18a-3                            217   6e-69   Medicago truncatula
ref|XP_006484924.1|  PREDICTED: uncharacterized protein LOC102625748    233   7e-69   
ref|XP_010504908.1|  PREDICTED: 60S ribosomal protein L18a-2            217   8e-69   Camelina sativa [gold-of-pleasure]
ref|XP_006595492.1|  PREDICTED: uncharacterized protein LOC100305...    232   8e-69   
emb|CBI30857.3|  unnamed protein product                                215   1e-68   Vitis vinifera
ref|XP_010666370.1|  PREDICTED: 60S ribosomal protein L18a-like         217   1e-68   Beta vulgaris subsp. vulgaris [field beet]
gb|KFK44821.1|  hypothetical protein AALP_AA1G307200                    217   1e-68   Arabis alpina [alpine rockcress]
ref|XP_006467486.1|  PREDICTED: 60S ribosomal protein L18a-2-like...    221   2e-68   Citrus sinensis [apfelsine]
ref|NP_001152434.1|  LOC100286074                                       216   2e-68   
ref|XP_009419339.1|  PREDICTED: 60S ribosomal protein L18a-like         216   3e-68   
ref|XP_006407063.1|  hypothetical protein EUTSA_v10021546mg             217   3e-68   
ref|XP_002882886.1|  60S ribosomal protein L18A                         216   3e-68   
ref|XP_010501986.1|  PREDICTED: 60S ribosomal protein L18a-3-like       215   4e-68   Camelina sativa [gold-of-pleasure]
ref|NP_188078.1|  60S ribosomal protein L18a-3                          215   4e-68   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010460775.1|  PREDICTED: 60S ribosomal protein L18a-1-like       215   5e-68   Camelina sativa [gold-of-pleasure]
ref|XP_010499515.1|  PREDICTED: 60S ribosomal protein L18a-1            215   6e-68   Camelina sativa [gold-of-pleasure]
ref|XP_006574359.1|  PREDICTED: uncharacterized protein LOC100527...    230   7e-68   
ref|XP_004491319.1|  PREDICTED: LOW QUALITY PROTEIN: probable asp...    229   8e-68   
gb|AAM65890.1|  putative 60S ribosomal protein L18A                     214   2e-67   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008371597.1|  PREDICTED: 60S ribosomal protein L18a-2 isof...    218   2e-67   Malus domestica [apple tree]
ref|XP_002519698.1|  60S ribosomal protein L18a, putative               218   2e-67   Ricinus communis
ref|XP_009360876.1|  PREDICTED: 60S ribosomal protein L18a-2 isof...    218   4e-67   Pyrus x bretschneideri [bai li]
ref|XP_008225468.1|  PREDICTED: 60S ribosomal protein L18a isofor...    217   5e-67   
ref|XP_010052072.1|  PREDICTED: 60S ribosomal protein L18a-2-like...    217   5e-67   Eucalyptus grandis [rose gum]
ref|XP_004303885.2|  PREDICTED: 60S ribosomal protein L18a-2 isof...    212   9e-67   Fragaria vesca subsp. vesca
ref|XP_009109630.1|  PREDICTED: 60S ribosomal protein L18a-2            212   1e-66   Brassica rapa
ref|XP_004961208.1|  PREDICTED: 60S ribosomal protein L18a-like         217   1e-66   
ref|XP_006415527.1|  hypothetical protein EUTSA_v10009933mg             216   2e-66   
ref|NP_849729.1|  ribosomal protein L18ae/LX family protein             211   2e-66   Arabidopsis thaliana [mouse-ear cress]
emb|CDY35269.1|  BnaC03g59540D                                          211   2e-66   Brassica napus [oilseed rape]
ref|XP_006306031.1|  hypothetical protein CARUB_v10011327mg             214   6e-66   
gb|EEE55145.1|  hypothetical protein OsJ_02939                          210   9e-66   Oryza sativa Japonica Group [Japonica rice]
dbj|BAB90499.1|  ribosomal protein L18a-like                            210   1e-65   Oryza sativa Japonica Group [Japonica rice]
ref|XP_001762693.1|  predicted protein                                  208   3e-65   
ref|XP_001765218.1|  predicted protein                                  208   3e-65   
ref|XP_001752605.1|  predicted protein                                  208   3e-65   
ref|XP_002961150.1|  hypothetical protein SELMODRAFT_227198             207   9e-65   Selaginella moellendorffii
ref|XP_001760636.1|  predicted protein                                  203   2e-63   
ref|XP_002893593.1|  60S ribosomal protein L18A-1                       207   6e-63   
ref|NP_001077626.1|  60S ribosomal protein L18a-1                       206   9e-63   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010940708.1|  PREDICTED: 60S ribosomal protein L18a-2-like       202   9e-63   Elaeis guineensis
ref|XP_010936051.1|  PREDICTED: 60S ribosomal protein L18a-2            200   4e-62   Elaeis guineensis
ref|XP_005652280.1|  60S ribosomal protein L18a-2                       199   1e-61   Coccomyxa subellipsoidea C-169
ref|XP_010549484.1|  PREDICTED: 60S ribosomal protein L18a-2 isof...    203   1e-61   Tarenaya hassleriana [spider flower]
ref|XP_005848088.1|  hypothetical protein CHLNCDRAFT_30965              196   1e-60   Chlorella variabilis
gb|AAG52055.1|AC022455_9  60S ribosomal protein L18A, putative; 2...    197   3e-59   Arabidopsis thaliana [mouse-ear cress]
gb|ABQ42114.1|  60S ribosomal protein L18a                              189   7e-59   Sonneratia caseolaris
gb|ABQ42113.1|  60S ribosomal protein L18a                              189   7e-59   Sonneratia alba
ref|XP_011460183.1|  PREDICTED: 60S ribosomal protein L18a              190   3e-58   Fragaria vesca subsp. vesca
ref|XP_011401286.1|  60S ribosomal protein L18a-2                       186   1e-56   Auxenochlorella protothecoides
ref|XP_001689743.1|  ribosomal protein L18a, component of cytosol...    186   2e-56   Chlamydomonas reinhardtii
gb|KDD75676.1|  ribosomal protein L18ae/LX                              186   2e-56   Helicosporidium sp. ATCC 50920
gb|ADU56180.1|  hypothetical protein                                    184   6e-56   Jatropha curcas
gb|ACS68696.1|  60S RPL18aB                                             181   7e-56   Sonneratia alba
ref|XP_002948508.1|  ribosomal protein L18A component of cytosoli...    183   1e-55   Volvox carteri f. nagariensis
ref|XP_007146225.1|  hypothetical protein PHAVU_006G022700g             181   5e-55   Phaseolus vulgaris [French bean]
gb|AAT08714.1|  ribosomal protein L18A                                  180   3e-54   Hyacinthus orientalis [common hyacinth]
gb|KIZ01204.1|  60S ribosomal protein L18a-2                            179   6e-54   Monoraphidium neglectum
gb|KJB10615.1|  hypothetical protein B456_001G211400                    177   2e-53   Gossypium raimondii
emb|CDX98480.1|  BnaC05g38950D                                          177   3e-53   
emb|CDX82474.1|  BnaA03g33470D                                          176   3e-53   
ref|XP_006387416.1|  hypothetical protein POPTR_1064s00200g             176   3e-53   
gb|KJB34967.1|  hypothetical protein B456_006G092900                    176   3e-53   Gossypium raimondii
emb|CDX84313.1|  BnaC04g10750D                                          176   6e-53   
ref|XP_004144680.1|  PREDICTED: LOW QUALITY PROTEIN: protein ASPA...    188   9e-53   
ref|NP_001237792.1|  uncharacterized protein LOC100305604               174   2e-52   
gb|EYU33347.1|  hypothetical protein MIMGU_mgv1a014797mg                174   2e-52   Erythranthe guttata [common monkey flower]
emb|CDY43672.1|  BnaA04g20190D                                          174   3e-52   Brassica napus [oilseed rape]
emb|CDX84643.1|  BnaA03g15870D                                          174   3e-52   
ref|XP_001418811.1|  Ribosomal protein L18a, component of cytosol...    171   6e-51   Ostreococcus lucimarinus CCE9901
emb|CEF98555.1|  Ribosomal protein L18ae                                171   1e-50   Ostreococcus tauri
ref|XP_007508296.1|  unknown                                            172   1e-50   Bathycoccus prasinos
gb|ADV03035.1|  ribosomal protein L18A                                  168   1e-49   Karlodinium veneficum
ref|XP_003062312.1|  predicted protein                                  168   2e-49   Micromonas pusilla CCMP1545
dbj|BAH20340.1|  AT3G14600                                              165   1e-48   Arabidopsis thaliana [mouse-ear cress]
gb|KFH68950.1|  60S ribosomal protein L20                               162   3e-47   Mortierella verticillata NRRL 6337
ref|XP_002501229.1|  predicted protein                                  160   2e-46   Micromonas commoda
ref|XP_008880083.1|  hypothetical protein H310_14105                    159   6e-46   Aphanomyces invadans
gb|KFH68928.1|  large subunit ribosomal protein L18Ae                   160   1e-45   Mortierella verticillata NRRL 6337
ref|XP_008604133.1|  50S ribosomal protein L18Ae                        157   4e-45   Saprolegnia diclina VS20
ref|XP_009831602.1|  hypothetical protein H257_07690                    155   8e-45   Aphanomyces astaci
dbj|BAK07344.1|  predicted protein                                      156   1e-44   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|KDR72699.1|  hypothetical protein GALMADRAFT_142989                  155   1e-44   Galerina marginata CBS 339.88
ref|XP_001614192.1|  60S ribosomal protein L18a                         155   2e-44   Plasmodium vivax
gb|KJA26912.1|  hypothetical protein HYPSUDRAFT_132230                  155   2e-44   Hypholoma sublateritium FD-334 SS-4
emb|CDS03349.1|  Putative 60S ribosomal protein L20                     155   2e-44   Lichtheimia ramosa
emb|CDH57447.1|  60s ribosomal protein l20                              155   2e-44   Lichtheimia corymbifera JMRC:FSU:9682
gb|EFA83144.1|  S60 ribosomal protein L18a                              154   2e-44   Heterostelium album PN500
emb|CDS14547.1|  Putative 60S ribosomal protein L20                     154   2e-44   Lichtheimia ramosa
ref|XP_007791911.1|  putative 60s ribosomal protein l20 protein         154   2e-44   
ref|XP_005702735.1|  60S ribosomal protein L18Ae                        154   2e-44   Galdieria sulphuraria
ref|XP_007394375.1|  hypothetical protein PHACADRAFT_253712             154   3e-44   Phanerochaete carnosa HHB-10118-sp
ref|XP_008815720.1|  50S ribosomal protein L18Ae                        155   3e-44   Plasmodium inui San Antonio 1
gb|KIL64760.1|  hypothetical protein M378DRAFT_77817                    154   3e-44   Amanita muscaria Koide BX008
gb|ERS97659.1|  60S ribosomal protein L20                               155   3e-44   Sporothrix schenckii ATCC 58251
ref|XP_003656447.1|  60S ribosomal protein L20                          154   3e-44   Thielavia terrestris NRRL 8126
gb|KIK70034.1|  hypothetical protein GYMLUDRAFT_34471                   154   3e-44   Gymnopus luxurians FD-317 M1
ref|XP_003029116.1|  60S ribosomal protein L20                          154   3e-44   Schizophyllum commune H4-8
gb|KIO01130.1|  hypothetical protein M404DRAFT_1003406                  154   3e-44   Pisolithus tinctorius Marx 270
ref|XP_007313367.1|  hypothetical protein SERLADRAFT_456475             154   3e-44   Serpula lacrymans var. lacrymans S7.9
ref|XP_002783609.1|  60S ribosomal protein L18A-2, putative             154   4e-44   Perkinsus marinus ATCC 50983
gb|KIK92807.1|  hypothetical protein PAXRUDRAFT_13013                   154   5e-44   Paxillus rubicundulus Ve08.2h10
gb|EPZ32213.1|  60S ribosomal protein L20-B                             154   5e-44   Rozella allomycis CSF55
ref|XP_002259942.1|  60S ribosomal subunit protein L18                  154   7e-44   Plasmodium knowlesi strain H
gb|KDQ32854.1|  hypothetical protein PLEOSDRAFT_1051744                 153   7e-44   Pleurotus ostreatus PC15
gb|KIM56681.1|  hypothetical protein SCLCIDRAFT_1220115                 153   8e-44   Scleroderma citrinum Foug A
ref|XP_004223603.1|  60S ribosomal protein L18a                         153   1e-43   Plasmodium cynomolgi strain B
ref|XP_003841410.1|  similar to 60S ribosomal protein L18a              153   1e-43   Leptosphaeria maculans JN3
emb|CDO75758.1|  hypothetical protein BN946_scf184921.g34               152   1e-43   Trametes cinnabarina
emb|CDO66197.1|  60S ribosomal protein L18, putative                    153   1e-43   Plasmodium reichenowi
gb|KDQ60389.1|  hypothetical protein JAAARDRAFT_126134                  152   1e-43   Jaapia argillacea MUCL 33604
gb|EGU11460.1|  60S ribosomal protein L20A                              152   1e-43   Rhodotorula toruloides ATCC 204091
ref|XP_002469001.1|  60S ribosomal protein L18A                         152   2e-43   
ref|XP_505817.1|  60S ribosomal protein L20                             152   2e-43   Yarrowia lipolytica CLIB122
gb|KIK23334.1|  hypothetical protein PISMIDRAFT_679451                  152   2e-43   Pisolithus microcarpus 441
ref|XP_007867854.1|  60S ribosomal protein L18A                         152   2e-43   Gloeophyllum trabeum ATCC 11539
gb|KIH90052.1|  60S ribosomal protein l20                               155   2e-43   Sporothrix brasiliensis 5110
dbj|GAM38126.1|  ribosomal L18ae protein family protein                 152   2e-43   Talaromyces cellulolyticus
ref|XP_002484037.1|  60S ribosomal protein L20                          152   2e-43   Talaromyces stipitatus ATCC 10500
ref|XP_011274808.1|  60S ribosomal protein L18a                         152   2e-43   Wickerhamomyces ciferrii
ref|XP_007717889.1|  hypothetical protein COCCADRAFT_9694               152   2e-43   Bipolaris zeicola 26-R-13
ref|XP_001350134.1|  60S ribosomal protein L18, putative                152   3e-43   Plasmodium falciparum 3D7
gb|KIJ91891.1|  hypothetical protein K443DRAFT_114419                   152   3e-43   Laccaria amethystina LaAM-08-1
gb|EUT80094.1|  hypothetical protein PFAG_04738                         152   3e-43   Plasmodium falciparum Santa Lucia
ref|XP_006696013.1|  60S ribosomal protein l20-like protein             152   3e-43   Chaetomium thermophilum var. thermophilum DSM 1495
gb|EUC60950.1|  60S ribosomal protein L20                               151   3e-43   Rhizoctonia solani AG-3 Rhs1AP
ref|XP_007848531.1|  60s ribosomal protein l20                          151   3e-43   
emb|CCX05992.1|  Similar to 60S ribosomal protein L20-A; acc. no....    151   3e-43   Pyronema omphalodes CBS 100304
ref|XP_007415007.1|  hypothetical protein MELLADRAFT_72927              151   3e-43   Melampsora larici-populina 98AG31
gb|ETW59457.1|  hypothetical protein PFMC_04646                         152   3e-43   Plasmodium falciparum CAMP/Malaysia
ref|XP_001882521.1|  60S ribosomal protein L20                          151   4e-43   Laccaria bicolor S238N-H82
ref|XP_004200777.1|  Piso0_003381                                       151   4e-43   
ref|XP_007303851.1|  60S ribosomal protein L20                          151   4e-43   Stereum hirsutum FP-91666 SS1
gb|ADV03042.1|  ribosomal protein L18A                                  151   5e-43   Amphidinium carterae
gb|EMD87012.1|  hypothetical protein COCHEDRAFT_1227999                 152   6e-43   Bipolaris maydis C5
ref|XP_002150233.1|  60S ribosomal protein L20                          151   6e-43   
ref|XP_006464014.1|  hypothetical protein AGABI2DRAFT_194625            150   6e-43   
ref|XP_009552266.1|  hypothetical protein HETIRDRAFT_442343             150   7e-43   
ref|XP_007352772.1|  ribosomal protein L18ae                            150   7e-43   
gb|KIJ63802.1|  hypothetical protein HYDPIDRAFT_91738                   150   7e-43   
ref|XP_002394051.1|  hypothetical protein MPER_06120                    149   8e-43   
gb|EIF45355.1|  60s ribosomal protein l20                               151   8e-43   
ref|XP_007772738.1|  60S ribosomal protein L18A                         150   8e-43   
gb|ESZ99063.1|  60S ribosomal protein L20                               151   8e-43   
emb|CCG80842.1|  Ribosomal L18ae protein family                         150   9e-43   
gb|KIJ04866.1|  hypothetical protein PAXINDRAFT_159230                  150   9e-43   
ref|XP_001839657.1|  60S ribosomal protein L20                          150   9e-43   
gb|ETW40546.1|  hypothetical protein PFNF135_04852                      150   9e-43   
gb|EPS96483.1|  hypothetical protein FOMPIDRAFT_1025390                 150   9e-43   
gb|KIM74091.1|  hypothetical protein PILCRDRAFT_99202                   150   1e-42   
gb|AFK46142.1|  unknown                                                 150   1e-42   
ref|XP_001935145.1|  60S ribosomal protein L20                          150   1e-42   
gb|KIP09725.1|  hypothetical protein PHLGIDRAFT_28839                   150   1e-42   
ref|XP_001549060.1|  60S ribosomal protein L20                          150   1e-42   
emb|CEG71682.1|  Putative 60S ribosomal protein L20                     150   1e-42   
ref|XP_003297118.1|  60S ribosomal protein L20                          150   1e-42   
ref|XP_001592983.1|  60S ribosomal protein L20                          150   1e-42   
gb|KDE03132.1|  60S ribosomal protein L20                               150   1e-42   
emb|CDP22704.1|  Putative cytosolic 60S ribosomal protein Rpl18a        150   1e-42   
gb|KIM42469.1|  hypothetical protein M413DRAFT_444884                   150   1e-42   
gb|KDN45848.1|  hypothetical protein RSAG8_04681                        151   1e-42   
dbj|GAM28311.1|  hypothetical protein SAMD00019534_114870               150   1e-42   
ref|XP_011127067.1|  hypothetical protein AOL_s00193g154                152   1e-42   
ref|XP_637982.2|  S60 ribosomal protein L18a                            150   1e-42   
gb|KIJ28628.1|  hypothetical protein M422DRAFT_37236                    150   1e-42   
gb|KFX43566.1|  60S ribosomal protein L20-B                             150   2e-42   
gb|KIV96880.1|  60S ribosomal protein L20-A                             150   2e-42   
emb|CCM00446.1|  predicted protein                                      150   2e-42   
gb|ADG23110.1|  60S ribosomal protein L20                               150   2e-42   
gb|KIY70561.1|  60S ribosomal protein L18A                              149   2e-42   
gb|KGK37450.1|  hypothetical protein JL09_g3403                         150   2e-42   
dbj|GAA88696.1|  60S ribosomal protein L20                              149   2e-42   
emb|CAK36896.1|  unnamed protein product                                150   2e-42   
ref|XP_003716235.1|  60S ribosomal protein L20                          149   2e-42   
ref|XP_009159133.1|  60S ribosomal protein L20                          149   2e-42   
ref|XP_001388788.2|  60S ribosomal protein L20                          149   3e-42   
ref|XP_007580415.1|  putative 60s ribosomal protein l20 protein         149   3e-42   
gb|KII84587.1|  hypothetical protein PLICRDRAFT_146717                  149   3e-42   
gb|EHA26343.1|  hypothetical protein ASPNIDRAFT_137752                  149   3e-42   
emb|CBK25105.2|  unnamed protein product                                149   3e-42   
gb|EYE94501.1|  ribosomal protein L18ae                                 149   3e-42   
ref|XP_001221038.1|  60S ribosomal protein L20                          149   4e-42   
gb|EMR86198.1|  putative 60s ribosomal protein l20 protein              150   4e-42   
gb|KFM72761.1|  60S ribosomal protein L18a                              148   4e-42   
gb|EWM27710.1|  60s ribosomal protein l18a                              152   4e-42   
ref|XP_007719951.1|  60S ribosomal protein L20                          149   5e-42   
gb|EJT99201.1|  ribosomal protein L18ae                                 148   5e-42   
dbj|GAM87453.1|  hypothetical protein ANO11243_054780                   148   5e-42   
emb|CDR97128.1|  60S ribosomal protein L18ae, putative                  149   5e-42   
ref|XP_003658479.1|  hypothetical protein MYCTH_2122073                 149   5e-42   
gb|ESW95865.1|  60S ribosomal protein L20-A                             148   6e-42   
gb|KEQ75912.1|  60S ribosomal protein L18ae                             148   7e-42   
ref|XP_002779521.1|  60S ribosomal protein L18A-2, putative             148   7e-42   
ref|XP_007803531.1|  60S ribosomal protein L20-B                        149   7e-42   
emb|CCD33810.1|  hypothetical protein BofuT4_P064120.1                  150   7e-42   
ref|XP_001245490.1|  60S ribosomal protein L20                          148   7e-42   
gb|KDO27995.1|  hypothetical protein SPRG_22195                         158   8e-42   
ref|NP_985877.3|  60S ribosomal protein L20                             148   8e-42   
dbj|GAD92811.1|  60S ribosomal protein L20                              150   1e-41   
gb|KHJ31045.1|  putative 60s ribosomal protein l20                      147   1e-41   
emb|CEL63282.1|  60S ribosomal protein L20-A OS=Saccharomyces cer...    147   1e-41   
ref|XP_003856132.1|  60S ribosomal protein L20                          147   1e-41   
gb|KIK40382.1|  hypothetical protein CY34DRAFT_87440                    147   1e-41   
ref|XP_003292885.1|  ribosomal protein L18a                             147   1e-41   
ref|XP_008020166.1|  hypothetical protein SETTUDRAFT_29919              147   1e-41   
ref|XP_007874905.1|  hypothetical protein PNEG_02868                    147   1e-41   
ref|XP_003672513.1|  ribosomal protein L20                              147   1e-41   
gb|EPQ64215.1|  Protein component of the large (60S) ribosomal su...    147   1e-41   
gb|KIY48970.1|  60S ribosomal protein L18A                              147   1e-41   
gb|ABL89190.1|  RPL20Bp                                                 145   2e-41   
ref|XP_003644532.1|  hypothetical protein Ecym_1491                     147   2e-41   
gb|EFX00968.1|  60S ribosomal protein l20                               147   2e-41   
emb|CCU81505.1|  60S ribosomal protein L20                              147   2e-41   
emb|CDR47151.1|  CYFA0S29e00936g1_1                                     147   2e-41   
ref|XP_007687479.1|  hypothetical protein COCMIDRAFT_94025              147   2e-41   
gb|EMS66554.1|  60S ribosomal protein L18a                              146   2e-41   
gb|EIE86590.1|  60S ribosomal protein L18ae                             147   2e-41   
gb|EIE90718.1|  60S ribosomal protein L18ae                             147   3e-41   
ref|XP_007704720.1|  hypothetical protein COCSADRAFT_203472             147   3e-41   
gb|KIY02830.1|  hypothetical protein Z520_01295                         147   3e-41   
ref|XP_005715079.1|  unnamed protein product                            147   3e-41   
ref|XP_007925856.1|  hypothetical protein MYCFIDRAFT_51495              147   3e-41   
gb|KIW37335.1|  hypothetical protein PV06_10383                         146   3e-41   
ref|XP_001652207.1|  AAEL006785-PB                                      147   3e-41   
ref|XP_001212923.1|  60S ribosomal protein L20                          146   3e-41   
gb|AAV90708.1|  60S ribosomal protein L18a                              146   3e-41   
ref|XP_002108947.1|  expressed hypothetical protein                     146   4e-41   
gb|EHN05474.1|  Rpl20bp                                                 146   4e-41   
ref|XP_658037.1|  hypothetical protein AN0433.2                         146   4e-41   
gb|KIW61227.1|  hypothetical protein PV05_01378                         146   4e-41   
gb|EHN00058.1|  Rpl20bp                                                 146   4e-41   
gb|KIM98051.1|  hypothetical protein OIDMADRAFT_147541                  146   4e-41   
dbj|BAN65814.1|  60S ribosomal protein L18ae, putative                  146   4e-41   
emb|CAA88652.1|  unknown                                                146   4e-41   
gb|EEQ45313.1|  60S ribosomal protein L20                               146   4e-41   
ref|XP_007263568.1|  ribosomal protein L18ae                            146   4e-41   
ref|NP_013969.3|  ribosomal 60S subunit protein L20A                    146   4e-41   
ref|XP_001611594.1|  60S ribosomal  protein L18ae                       146   5e-41   
emb|CDO95724.1|  unnamed protein product                                146   5e-41   
gb|AJS98744.1|  Rpl20ap                                                 146   5e-41   
ref|XP_722704.1|  likely cytosolic ribosomal protein L20 (L18)          146   5e-41   
ref|XP_007297620.1|  60S ribosomal protein L20                          148   6e-41   
emb|CCJ29034.1|  unnamed protein product                                146   6e-41   
emb|CAA62167.1|  orf 06116                                              145   6e-41   
gb|ELR06554.1|  60S ribosomal protein L20                               145   6e-41   
gb|EJT44404.1|  RPL20A-like protein                                     147   6e-41   
gb|KFY52161.1|  hypothetical protein V496_08621                         145   7e-41   
ref|XP_005830017.1|  large subunit ribosomal protein L18Ae, cytop...    146   7e-41   
gb|KFY29381.1|  hypothetical protein V491_00056                         145   7e-41   
ref|XP_002545416.1|  60S ribosomal protein L20                          145   7e-41   
gb|EHN00736.1|  Rpl20bp                                                 147   7e-41   
gb|KIW75002.1|  60S ribosomal protein L20-B                             145   7e-41   
gb|KFY17461.1|  hypothetical protein V492_00655                         145   7e-41   
ref|XP_007784343.1|  60S ribosomal protein L20                          145   8e-41   
ref|XP_745012.1|  60S ribosomal subunit protein L18                     145   8e-41   
emb|CDM26451.1|  60S ribosomal protein L20                              147   8e-41   
gb|EGA73566.1|  Rpl20ap                                                 146   8e-41   
emb|CEG68118.1|  Putative 60S ribosomal protein L20                     145   8e-41   
ref|XP_002419817.1|  60S ribosomal protein L20                          145   9e-41   
emb|CDR16003.1|  60S ribosomal protein L18, putative                    145   9e-41   
gb|EMG48306.1|  Ribosomal protein, large subunit, putative              145   9e-41   
gb|EDN64179.1|  ribosomal protein L20A                                  145   9e-41   
ref|XP_008622468.1|  50S ribosomal protein L18Ae                        145   9e-41   
gb|EUD71724.1|  50S ribosomal protein L18Ae                             145   1e-40   
ref|XP_001524279.1|  60S ribosomal protein L20                          145   1e-40   
ref|XP_729143.1|  ribosomal L18ae protein                               145   1e-40   
ref|XP_009224397.1|  60S ribosomal protein L20                          145   1e-40   
ref|XP_003170190.1|  60S ribosomal protein L20                          145   1e-40   
ref|XP_001265211.1|  60S ribosomal protein L20                          146   1e-40   
ref|XP_448543.1|  60S ribosomal protein L20                             145   1e-40   
ref|XP_002849494.1|  60S ribosomal protein L20                          146   1e-40   
gb|EEH38031.2|  60S ribosomal protein L20                               145   1e-40   
emb|CDI83837.1|  60S ribosomal protein L18a, putative                   145   1e-40   
gb|KEZ42433.1|  hypothetical protein SAPIO_CDS5629                      145   1e-40   
ref|XP_001387514.1|  60S ribosomal protein L20                          145   1e-40   
ref|XP_007914565.1|  putative 60s ribosomal protein l20 protein         145   1e-40   
ref|XP_002797093.1|  60S ribosomal protein L20                          145   1e-40   
gb|EKV11298.1|  Ribosomal L18ae protein family                          146   1e-40   
gb|KFX98087.1|  hypothetical protein O988_04540                         145   1e-40   
gb|KIW11360.1|  hypothetical protein PV08_10660                         147   1e-40   
gb|AGE89254.1|  60S ribosomal protein L18a                              145   1e-40   
gb|KEQ93295.1|  hypothetical protein AUEXF2481DRAFT_81514               145   1e-40   
ref|XP_001541495.1|  60S ribosomal protein L20                          145   1e-40   
gb|EMF14474.1|  60S ribosomal protein L20                               145   1e-40   
ref|XP_010759221.1|  60S ribosomal protein L20                          145   2e-40   
gb|EEQ86274.1|  60S ribosomal protein L18A                              145   2e-40   
gb|KEQ58402.1|  ribosomal L18ae protein family                          145   2e-40   
gb|AGH70166.1|  60S ribosomal protein L18a                              145   2e-40   
ref|XP_003233919.1|  60S ribosomal protein L20                          144   2e-40   
ref|XP_003670112.1|  ribosomal protein L20                              144   2e-40   
emb|CEP13249.1|  hypothetical protein                                   145   2e-40   
gb|KIW87333.1|  60S ribosomal protein L20-B                             144   2e-40   
gb|EZF34867.1|  60S ribosomal protein L20                               144   2e-40   
ref|XP_004354799.1|  hypothetical protein DFA_09450                     156   2e-40   
ref|XP_007741872.1|  60S ribosomal protein L20                          144   2e-40   
gb|KJB69797.1|  hypothetical protein B456_011G042800                    144   2e-40   
gb|EGE06819.1|  Ribosomal L18ae family protein                          145   2e-40   
ref|XP_008082174.1|  60S ribosomal protein L20                          145   2e-40   
ref|XP_001269707.1|  60S ribosomal protein L20                          145   2e-40   
gb|EPS27971.1|  hypothetical protein PDE_02916                          145   2e-40   
gb|KEQ84974.1|  ribosomal protein L18ae                                 145   2e-40   
ref|XP_773195.1|  60S ribosomal protein L20                             144   2e-40   
gb|EGD98622.1|  60S ribosomal protein L18A                              145   2e-40   
ref|XP_002618653.1|  hypothetical protein CLUG_02112                    144   2e-40   
ref|XP_461659.1|  60S ribosomal protein L20                             144   2e-40   
ref|XP_320252.4|  AGAP012284-PA                                         144   2e-40   
gb|KIW08808.1|  60S ribosomal protein L20-B                             145   2e-40   
ref|XP_004178642.1|  hypothetical protein TBLA_0B02810                  144   2e-40   
gb|KIR47203.1|  50S small subunit ribosomal protein L18Ae               144   2e-40   
gb|KIW69117.1|  hypothetical protein PV04_05012                         144   2e-40   
ref|XP_003196123.1|  60s ribosomal protein l20 (yl17)                   144   2e-40   
gb|KEF62256.1|  large subunit ribosomal protein L18Ae                   146   3e-40   
ref|XP_006689073.1|  60S ribosomal protein L18A                         144   3e-40   
gb|KIW08809.1|  60S ribosomal protein L20-B, variant                    144   3e-40   
gb|KGB80154.1|  60S ribosomal protein L20                               145   3e-40   
ref|XP_003955787.1|  hypothetical protein KAFR_0B03550                  144   3e-40   
ref|XP_003022051.1|  hypothetical protein TRV_03792                     144   3e-40   
dbj|BAO38776.2|  60S ribosomal protein L20                              144   4e-40   
ref|XP_009521845.1|  hypothetical protein PHYSODRAFT_354168             144   4e-40   
ref|XP_678651.1|  60S ribosomal subunit protein L18                     144   4e-40   
gb|EJT45352.1|  60s ribosomal protein l20 (yl17)                        144   4e-40   
ref|NP_593336.1|  60S ribosomal protein L20                             144   4e-40   
emb|CDS50953.1|  60S ribosomal protein L18, putative                    144   4e-40   
ref|XP_008727176.1|  60S ribosomal protein L20                          144   4e-40   
gb|KGG51320.1|  60S ribosomal protein L20                               143   4e-40   
gb|KIV82076.1|  60S ribosomal protein L20-B                             144   5e-40   
ref|XP_003869824.1|  Rpl20b predicted ribosomal protein L20             143   5e-40   
emb|CCO32560.1|  60S ribosomal protein L20-A AltName: Full=L18a         143   5e-40   
ref|XP_002897608.1|  60S ribosomal protein L18a                         143   5e-40   
ref|XP_007376811.1|  60S ribosomal protein L20                          143   5e-40   
ref|XP_008041267.1|  hypothetical protein TRAVEDRAFT_73375              153   5e-40   
gb|KFB49813.1|  AGAP012284-PA-like protein                              143   5e-40   
dbj|GAA95901.1|  hypothetical protein E5Q_02559                         143   5e-40   
emb|CCE44296.1|  hypothetical protein CPAR2_400980                      143   5e-40   
emb|CEG80127.1|  Putative 60S ribosomal protein L20                     143   5e-40   
gb|KDQ08157.1|  hypothetical protein BOTBODRAFT_38144                   143   5e-40   
emb|CEG74192.1|  Putative 60S ribosomal protein L20                     143   5e-40   
emb|CCK72147.1|  hypothetical protein KNAG_0J00640                      143   5e-40   
emb|CCE34709.1|  probable 60S large subunit ribosomal protein           143   5e-40   
gb|EPE02198.1|  60s ribosomal protein l20                               147   6e-40   
gb|KIV82077.1|  60S ribosomal protein L20-B, variant                    143   6e-40   
gb|EHK19200.1|  hypothetical protein TRIVIDRAFT_92973                   143   6e-40   
ref|XP_008897642.1|  hypothetical protein PPTG_05682                    143   7e-40   
emb|CDF88589.1|  BN860_13806g1_1                                        143   7e-40   
ref|XP_007383455.1|  60S ribosomal protein L18A                         143   7e-40   
gb|ELK19170.1|  60S ribosomal protein L18a                              144   7e-40   
ref|XP_002492262.1|  60S ribosomal protein L20                          143   8e-40   
gb|EEH11334.1|  60S ribosomal protein L20                               144   8e-40   
sp|Q8WQI7.1|RL18A_SPOFR  RecName: Full=60S ribosomal protein L18a       143   8e-40   
ref|XP_003345411.1|  60S ribosomal protein L20                          143   8e-40   
ref|XP_006965654.1|  hypothetical protein TRIREDRAFT_107784             143   9e-40   
ref|XP_007813976.1|  60S ribosomal protein L20                          142   1e-39   
ref|NP_001037219.1|  ribosomal protein L18A                             142   1e-39   
ref|XP_006828776.1|  hypothetical protein AMTR_s00001p00102800          141   1e-39   
gb|KIW28290.1|  hypothetical protein PV07_07966                         144   1e-39   
ref|XP_011393206.1|  60S ribosomal protein L20                          142   1e-39   



>emb|CDP06299.1| unnamed protein product [Coffea canephora]
Length=178

 Score =   235 bits (599),  Expect = 7e-76, Method: Compositional matrix adjust.
 Identities = 110/115 (96%), Positives = 112/115 (97%), Gaps = 0/115 (0%)
 Frame = +1

Query  82   MVTYRFHQYQVVGRALPSETDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQV  261
            MV YRFHQYQVVGRALPSETDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQV
Sbjct  1    MVNYRFHQYQVVGRALPSETDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQV  60

Query  262  LAINEIFEKCPTXVKNYGIWLRYQSRTGYHNMYKEFRDTTLNGAVEQMYTEMASR  426
            LAINEIFEK PT +KNYGIWLRYQSRTGYHNMYKE+RDTTLNGAVEQMYTEMASR
Sbjct  61   LAINEIFEKNPTTIKNYGIWLRYQSRTGYHNMYKEYRDTTLNGAVEQMYTEMASR  115



>gb|ADE42972.1| putative 60S ribosomal protein L18a [Gardenia jasminoides]
Length=178

 Score =   235 bits (599),  Expect = 7e-76, Method: Compositional matrix adjust.
 Identities = 110/115 (96%), Positives = 112/115 (97%), Gaps = 0/115 (0%)
 Frame = +1

Query  82   MVTYRFHQYQVVGRALPSETDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQV  261
            MV YRFHQYQVVGRALPSETDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQV
Sbjct  1    MVNYRFHQYQVVGRALPSETDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQV  60

Query  262  LAINEIFEKCPTXVKNYGIWLRYQSRTGYHNMYKEFRDTTLNGAVEQMYTEMASR  426
            LAINEIFEK PT +KNYGIWLRYQSRTGYHNMYKE+RDTTLNGAVEQMYTEMASR
Sbjct  61   LAINEIFEKNPTTIKNYGIWLRYQSRTGYHNMYKEYRDTTLNGAVEQMYTEMASR  115



>ref|XP_010655647.1| PREDICTED: 60S ribosomal protein L18a isoform X1 [Vitis vinifera]
 emb|CAN82658.1| hypothetical protein VITISV_011977 [Vitis vinifera]
Length=178

 Score =   234 bits (598),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 109/115 (95%), Positives = 112/115 (97%), Gaps = 0/115 (0%)
 Frame = +1

Query  82   MVTYRFHQYQVVGRALPSETDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQV  261
            MVT+RFHQYQVVGRALPSETDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQV
Sbjct  1    MVTFRFHQYQVVGRALPSETDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQV  60

Query  262  LAINEIFEKCPTXVKNYGIWLRYQSRTGYHNMYKEFRDTTLNGAVEQMYTEMASR  426
            LAINEIFEK PT +KNYGIWLRYQSRTGYHNMYKE+RDTTLNGAVEQMY EMASR
Sbjct  61   LAINEIFEKNPTTIKNYGIWLRYQSRTGYHNMYKEYRDTTLNGAVEQMYAEMASR  115



>ref|XP_004147412.1| PREDICTED: 60S ribosomal protein L18a-like [Cucumis sativus]
 ref|XP_004164939.1| PREDICTED: 60S ribosomal protein L18a-like [Cucumis sativus]
Length=178

 Score =   234 bits (597),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 109/115 (95%), Positives = 113/115 (98%), Gaps = 0/115 (0%)
 Frame = +1

Query  82   MVTYRFHQYQVVGRALPSETDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQV  261
            MV++RFHQYQVVGRALPSE+DEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQV
Sbjct  1    MVSFRFHQYQVVGRALPSESDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQV  60

Query  262  LAINEIFEKCPTXVKNYGIWLRYQSRTGYHNMYKEFRDTTLNGAVEQMYTEMASR  426
            LAINEIFEK PT VKNYGIWLRYQSRTGYHNMYKE+RDTTLNGAVEQMYTEMASR
Sbjct  61   LAINEIFEKNPTKVKNYGIWLRYQSRTGYHNMYKEYRDTTLNGAVEQMYTEMASR  115



>ref|XP_008444078.1| PREDICTED: 60S ribosomal protein L18a [Cucumis melo]
Length=178

 Score =   234 bits (597),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 109/115 (95%), Positives = 113/115 (98%), Gaps = 0/115 (0%)
 Frame = +1

Query  82   MVTYRFHQYQVVGRALPSETDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQV  261
            MV++RFHQYQVVGRALPSE+DEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQV
Sbjct  1    MVSFRFHQYQVVGRALPSESDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQV  60

Query  262  LAINEIFEKCPTXVKNYGIWLRYQSRTGYHNMYKEFRDTTLNGAVEQMYTEMASR  426
            LAINEIFEK PT VKNYGIWLRYQSRTGYHNMYKE+RDTTLNGAVEQMYTEMASR
Sbjct  61   LAINEIFEKNPTKVKNYGIWLRYQSRTGYHNMYKEYRDTTLNGAVEQMYTEMASR  115



>ref|XP_006387417.1| 60S ribosomal protein L18a-1 [Populus trichocarpa]
 ref|XP_011009656.1| PREDICTED: 60S ribosomal protein L18a [Populus euphratica]
 gb|ABK93213.1| unknown [Populus trichocarpa]
 gb|ABK94632.1| unknown [Populus trichocarpa]
 gb|ERP46331.1| 60S ribosomal protein L18a-1 [Populus trichocarpa]
Length=178

 Score =   233 bits (595),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 108/115 (94%), Positives = 113/115 (98%), Gaps = 0/115 (0%)
 Frame = +1

Query  82   MVTYRFHQYQVVGRALPSETDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQV  261
            MVT+RFHQYQVVGRALP+E+DEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQV
Sbjct  1    MVTFRFHQYQVVGRALPTESDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQV  60

Query  262  LAINEIFEKCPTXVKNYGIWLRYQSRTGYHNMYKEFRDTTLNGAVEQMYTEMASR  426
            LAINEIFEK PT +KNYGIWLRYQSRTGYHNMYKE+RDTTLNGAVEQMYTEMASR
Sbjct  61   LAINEIFEKNPTKIKNYGIWLRYQSRTGYHNMYKEYRDTTLNGAVEQMYTEMASR  115



>gb|KHG29727.1| 60S ribosomal L18a [Gossypium arboreum]
Length=178

 Score =   233 bits (595),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 108/115 (94%), Positives = 113/115 (98%), Gaps = 0/115 (0%)
 Frame = +1

Query  82   MVTYRFHQYQVVGRALPSETDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQV  261
            MVT+RFHQYQVVGRALP+E+DEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQV
Sbjct  1    MVTFRFHQYQVVGRALPTESDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQV  60

Query  262  LAINEIFEKCPTXVKNYGIWLRYQSRTGYHNMYKEFRDTTLNGAVEQMYTEMASR  426
            LAINEIFEK PT +KNYGIWLRYQSRTGYHNMYKE+RDTTLNGAVEQMYTEMASR
Sbjct  61   LAINEIFEKNPTKIKNYGIWLRYQSRTGYHNMYKEYRDTTLNGAVEQMYTEMASR  115



>ref|XP_006477944.1| PREDICTED: 60S ribosomal protein L18a-like isoform X1 [Citrus 
sinensis]
 gb|KDO49363.1| hypothetical protein CISIN_1g028910mg [Citrus sinensis]
Length=202

 Score =   234 bits (597),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 109/123 (89%), Positives = 115/123 (93%), Gaps = 0/123 (0%)
 Frame = +1

Query  58   EDGSVVAKMVTYRFHQYQVVGRALPSETDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKK  237
            E   +  KMVT+RFHQYQVVGRALP+E DEHPKIYRMKLWATNEVRAKSKFWYFLRKLKK
Sbjct  17   EPALLGGKMVTFRFHQYQVVGRALPTEKDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKK  76

Query  238  VKKSNGQVLAINEIFEKCPTXVKNYGIWLRYQSRTGYHNMYKEFRDTTLNGAVEQMYTEM  417
            VKKSNGQ+LAINEIFEK PT +KNYGIWLRYQSRTGYHNMYKE+RDTTLNGAVEQMYTEM
Sbjct  77   VKKSNGQMLAINEIFEKNPTKIKNYGIWLRYQSRTGYHNMYKEYRDTTLNGAVEQMYTEM  136

Query  418  ASR  426
            ASR
Sbjct  137  ASR  139



>ref|XP_002276260.1| PREDICTED: 60S ribosomal protein L18a [Vitis vinifera]
 emb|CAN71860.1| hypothetical protein VITISV_019859 [Vitis vinifera]
 emb|CBI30856.3| unnamed protein product [Vitis vinifera]
Length=178

 Score =   233 bits (595),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 108/115 (94%), Positives = 112/115 (97%), Gaps = 0/115 (0%)
 Frame = +1

Query  82   MVTYRFHQYQVVGRALPSETDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQV  261
            MVT+RFHQYQVVGRALPSE+DEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQV
Sbjct  1    MVTFRFHQYQVVGRALPSESDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQV  60

Query  262  LAINEIFEKCPTXVKNYGIWLRYQSRTGYHNMYKEFRDTTLNGAVEQMYTEMASR  426
            LAINEIFEK PT +KNYGIWLRYQSRTGYHNMYKE+RDTTLNGAVEQMY EMASR
Sbjct  61   LAINEIFEKNPTTIKNYGIWLRYQSRTGYHNMYKEYRDTTLNGAVEQMYAEMASR  115



>ref|XP_004241806.1| PREDICTED: 60S ribosomal protein L18a [Solanum lycopersicum]
Length=178

 Score =   233 bits (594),  Expect = 4e-75, Method: Compositional matrix adjust.
 Identities = 108/115 (94%), Positives = 113/115 (98%), Gaps = 0/115 (0%)
 Frame = +1

Query  82   MVTYRFHQYQVVGRALPSETDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQV  261
            MVT++FHQYQVVGRALPSETDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQ+
Sbjct  1    MVTFKFHQYQVVGRALPSETDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQM  60

Query  262  LAINEIFEKCPTXVKNYGIWLRYQSRTGYHNMYKEFRDTTLNGAVEQMYTEMASR  426
            LAINEIFEK PT +KNYGIWLRYQSRTGYHNMYKE+RDTTLNGAVEQMYTEMASR
Sbjct  61   LAINEIFEKYPTKIKNYGIWLRYQSRTGYHNMYKEYRDTTLNGAVEQMYTEMASR  115



>ref|NP_001275107.1| 60S ribosomal protein L18a-like [Solanum tuberosum]
 gb|AFX66998.1| 60S ribosomal protein L18a [Solanum tuberosum]
Length=178

 Score =   233 bits (594),  Expect = 5e-75, Method: Compositional matrix adjust.
 Identities = 108/115 (94%), Positives = 113/115 (98%), Gaps = 0/115 (0%)
 Frame = +1

Query  82   MVTYRFHQYQVVGRALPSETDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQV  261
            MVT++FHQYQVVGRALPSETDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQ+
Sbjct  1    MVTFKFHQYQVVGRALPSETDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQM  60

Query  262  LAINEIFEKCPTXVKNYGIWLRYQSRTGYHNMYKEFRDTTLNGAVEQMYTEMASR  426
            LAINEIFEK PT +KNYGIWLRYQSRTGYHNMYKE+RDTTLNGAVEQMYTEMASR
Sbjct  61   LAINEIFEKYPTKIKNYGIWLRYQSRTGYHNMYKEYRDTTLNGAVEQMYTEMASR  115



>gb|KHG02356.1| 60S ribosomal L18a [Gossypium arboreum]
 gb|KJB34966.1| hypothetical protein B456_006G092900 [Gossypium raimondii]
Length=178

 Score =   233 bits (594),  Expect = 5e-75, Method: Compositional matrix adjust.
 Identities = 108/115 (94%), Positives = 112/115 (97%), Gaps = 0/115 (0%)
 Frame = +1

Query  82   MVTYRFHQYQVVGRALPSETDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQV  261
            MVT+RFHQYQVVGRALP+E DEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQV
Sbjct  1    MVTFRFHQYQVVGRALPTENDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQV  60

Query  262  LAINEIFEKCPTXVKNYGIWLRYQSRTGYHNMYKEFRDTTLNGAVEQMYTEMASR  426
            LAINEIFEK PT +KNYGIWLRYQSRTGYHNMYKE+RDTTLNGAVEQMYTEMASR
Sbjct  61   LAINEIFEKNPTKIKNYGIWLRYQSRTGYHNMYKEYRDTTLNGAVEQMYTEMASR  115



>ref|XP_011096544.1| PREDICTED: 60S ribosomal protein L18a-like [Sesamum indicum]
Length=178

 Score =   233 bits (593),  Expect = 6e-75, Method: Compositional matrix adjust.
 Identities = 107/115 (93%), Positives = 113/115 (98%), Gaps = 0/115 (0%)
 Frame = +1

Query  82   MVTYRFHQYQVVGRALPSETDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQV  261
            MVTY+FHQYQVVGRALP+ETDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQ+
Sbjct  1    MVTYKFHQYQVVGRALPTETDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQI  60

Query  262  LAINEIFEKCPTXVKNYGIWLRYQSRTGYHNMYKEFRDTTLNGAVEQMYTEMASR  426
            LAINEIFEK PT +KNYGIWLRYQSRTGYHNMYKE+RDTTLNG+VEQMYTEMASR
Sbjct  61   LAINEIFEKNPTTIKNYGIWLRYQSRTGYHNMYKEYRDTTLNGSVEQMYTEMASR  115



>ref|XP_007215058.1| hypothetical protein PRUPE_ppa012231mg [Prunus persica]
 gb|EMJ16257.1| hypothetical protein PRUPE_ppa012231mg [Prunus persica]
Length=178

 Score =   233 bits (593),  Expect = 6e-75, Method: Compositional matrix adjust.
 Identities = 108/115 (94%), Positives = 111/115 (97%), Gaps = 0/115 (0%)
 Frame = +1

Query  82   MVTYRFHQYQVVGRALPSETDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQV  261
            MVT+RFHQYQVVGRALPSE DEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQV
Sbjct  1    MVTFRFHQYQVVGRALPSEKDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQV  60

Query  262  LAINEIFEKCPTXVKNYGIWLRYQSRTGYHNMYKEFRDTTLNGAVEQMYTEMASR  426
            LAINEIFEK PT +KNYGIWLRYQSRTGYHNMYKE+RDTTLNGAVE MYTEMASR
Sbjct  61   LAINEIFEKSPTTIKNYGIWLRYQSRTGYHNMYKEYRDTTLNGAVEDMYTEMASR  115



>gb|EYU36633.1| hypothetical protein MIMGU_mgv1a014793mg [Erythranthe guttata]
Length=178

 Score =   233 bits (593),  Expect = 7e-75, Method: Compositional matrix adjust.
 Identities = 108/115 (94%), Positives = 112/115 (97%), Gaps = 0/115 (0%)
 Frame = +1

Query  82   MVTYRFHQYQVVGRALPSETDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQV  261
            MVTYRFHQYQVVGRALP+ET+EHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQV
Sbjct  1    MVTYRFHQYQVVGRALPTETEEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQV  60

Query  262  LAINEIFEKCPTXVKNYGIWLRYQSRTGYHNMYKEFRDTTLNGAVEQMYTEMASR  426
            LAINEIFEK PT +KNYGIWLRYQSRTGYHNMYKE+RDTTLNGAVE MYTEMASR
Sbjct  61   LAINEIFEKNPTTIKNYGIWLRYQSRTGYHNMYKEYRDTTLNGAVEHMYTEMASR  115



>gb|ABB29925.1| unknown [Solanum tuberosum]
Length=178

 Score =   232 bits (592),  Expect = 8e-75, Method: Compositional matrix adjust.
 Identities = 108/115 (94%), Positives = 113/115 (98%), Gaps = 0/115 (0%)
 Frame = +1

Query  82   MVTYRFHQYQVVGRALPSETDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQV  261
            MVT++FHQYQVVGRALPSETDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQ+
Sbjct  1    MVTFKFHQYQVVGRALPSETDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQM  60

Query  262  LAINEIFEKCPTXVKNYGIWLRYQSRTGYHNMYKEFRDTTLNGAVEQMYTEMASR  426
            LAINEIFEK PT +KNYGIWLRYQSRTGYHNMYKE+RDTTLNGAVEQMYTEMASR
Sbjct  61   LAINEIFEKYPTKIKNYGIWLRYQSRTGYHNMYKEYRDTTLNGAVEQMYTEMASR  115



>ref|XP_006449674.1| hypothetical protein CICLE_v10016900mg [Citrus clementina]
 ref|XP_006467485.1| PREDICTED: 60S ribosomal protein L18a-2-like isoform X1 [Citrus 
sinensis]
 gb|ESR62914.1| hypothetical protein CICLE_v10016900mg [Citrus clementina]
 gb|KDO78150.1| hypothetical protein CISIN_1g035537mg [Citrus sinensis]
Length=178

 Score =   232 bits (592),  Expect = 8e-75, Method: Compositional matrix adjust.
 Identities = 107/115 (93%), Positives = 113/115 (98%), Gaps = 0/115 (0%)
 Frame = +1

Query  82   MVTYRFHQYQVVGRALPSETDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQV  261
            MVT+RFHQYQVVGRALP+E+DEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQ+
Sbjct  1    MVTFRFHQYQVVGRALPTESDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQM  60

Query  262  LAINEIFEKCPTXVKNYGIWLRYQSRTGYHNMYKEFRDTTLNGAVEQMYTEMASR  426
            LAINEIFEK PT +KNYGIWLRYQSRTGYHNMYKE+RDTTLNGAVEQMYTEMASR
Sbjct  61   LAINEIFEKNPTKIKNYGIWLRYQSRTGYHNMYKEYRDTTLNGAVEQMYTEMASR  115



>ref|XP_002317384.1| 60S ribosomal protein L18a-1 [Populus trichocarpa]
 gb|ABK93710.1| unknown [Populus trichocarpa]
 gb|EEE97996.1| 60S ribosomal protein L18a-1 [Populus trichocarpa]
Length=178

 Score =   232 bits (592),  Expect = 9e-75, Method: Compositional matrix adjust.
 Identities = 107/115 (93%), Positives = 113/115 (98%), Gaps = 0/115 (0%)
 Frame = +1

Query  82   MVTYRFHQYQVVGRALPSETDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQV  261
            MVT+RFHQYQVVGRALP+++DEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQV
Sbjct  1    MVTFRFHQYQVVGRALPTQSDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQV  60

Query  262  LAINEIFEKCPTXVKNYGIWLRYQSRTGYHNMYKEFRDTTLNGAVEQMYTEMASR  426
            LAINEIFEK PT +KNYGIWLRYQSRTGYHNMYKE+RDTTLNGAVEQMYTEMASR
Sbjct  61   LAINEIFEKNPTTIKNYGIWLRYQSRTGYHNMYKEYRDTTLNGAVEQMYTEMASR  115



>ref|XP_011002051.1| PREDICTED: 60S ribosomal protein L18a-like [Populus euphratica]
Length=178

 Score =   232 bits (592),  Expect = 9e-75, Method: Compositional matrix adjust.
 Identities = 107/115 (93%), Positives = 113/115 (98%), Gaps = 0/115 (0%)
 Frame = +1

Query  82   MVTYRFHQYQVVGRALPSETDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQV  261
            MVT+RFHQYQVVGRALP+++DEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQV
Sbjct  1    MVTFRFHQYQVVGRALPTQSDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQV  60

Query  262  LAINEIFEKCPTXVKNYGIWLRYQSRTGYHNMYKEFRDTTLNGAVEQMYTEMASR  426
            LAINEIFEK PT +KNYGIWLRYQSRTGYHNMYKE+RDTTLNGAVEQMYTEMASR
Sbjct  61   LAINEIFEKNPTTIKNYGIWLRYQSRTGYHNMYKEYRDTTLNGAVEQMYTEMASR  115



>gb|KJB57268.1| hypothetical protein B456_009G155900 [Gossypium raimondii]
Length=178

 Score =   232 bits (592),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 107/115 (93%), Positives = 113/115 (98%), Gaps = 0/115 (0%)
 Frame = +1

Query  82   MVTYRFHQYQVVGRALPSETDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQV  261
            MVT+RFHQYQVVGRALP+++DEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQV
Sbjct  1    MVTFRFHQYQVVGRALPTDSDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQV  60

Query  262  LAINEIFEKCPTXVKNYGIWLRYQSRTGYHNMYKEFRDTTLNGAVEQMYTEMASR  426
            LAINEIFEK PT +KNYGIWLRYQSRTGYHNMYKE+RDTTLNGAVEQMYTEMASR
Sbjct  61   LAINEIFEKNPTKIKNYGIWLRYQSRTGYHNMYKEYRDTTLNGAVEQMYTEMASR  115



>gb|KDO51884.1| hypothetical protein CISIN_1g030276mg [Citrus sinensis]
Length=180

 Score =   232 bits (592),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 107/116 (92%), Positives = 113/116 (97%), Gaps = 0/116 (0%)
 Frame = +1

Query  79   KMVTYRFHQYQVVGRALPSETDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQ  258
            +MVT+RFHQYQVVGRALP+ETDEHPKIYRMKLWATNEVRAKSKFWY+LRKLKKVKKSNGQ
Sbjct  2    RMVTFRFHQYQVVGRALPTETDEHPKIYRMKLWATNEVRAKSKFWYYLRKLKKVKKSNGQ  61

Query  259  VLAINEIFEKCPTXVKNYGIWLRYQSRTGYHNMYKEFRDTTLNGAVEQMYTEMASR  426
            VLAINEIFEK PT +KNYGIWLRYQSRTGYHNMYKE+RDTTLNGAVEQMY EMASR
Sbjct  62   VLAINEIFEKNPTKIKNYGIWLRYQSRTGYHNMYKEYRDTTLNGAVEQMYNEMASR  117



>ref|XP_008439644.1| PREDICTED: 60S ribosomal protein L18a [Cucumis melo]
Length=178

 Score =   232 bits (591),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 108/115 (94%), Positives = 111/115 (97%), Gaps = 0/115 (0%)
 Frame = +1

Query  82   MVTYRFHQYQVVGRALPSETDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQV  261
            MVT+RFHQYQVVGRALPSE DEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQV
Sbjct  1    MVTFRFHQYQVVGRALPSEADEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQV  60

Query  262  LAINEIFEKCPTXVKNYGIWLRYQSRTGYHNMYKEFRDTTLNGAVEQMYTEMASR  426
            LAINEIFEK PT +KNYGIWLRYQSRTGYHNMYKE+RDTTLNGAVE MYTEMASR
Sbjct  61   LAINEIFEKNPTKIKNYGIWLRYQSRTGYHNMYKEYRDTTLNGAVEAMYTEMASR  115



>ref|XP_004134633.1| PREDICTED: 60S ribosomal protein L18a-like [Cucumis sativus]
 ref|XP_004162601.1| PREDICTED: 60S ribosomal protein L18a-like [Cucumis sativus]
 gb|KGN49388.1| hypothetical protein Csa_6G522810 [Cucumis sativus]
Length=178

 Score =   232 bits (591),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 108/115 (94%), Positives = 111/115 (97%), Gaps = 0/115 (0%)
 Frame = +1

Query  82   MVTYRFHQYQVVGRALPSETDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQV  261
            MVT+RFHQYQVVGRALPSE DEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQV
Sbjct  1    MVTFRFHQYQVVGRALPSEADEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQV  60

Query  262  LAINEIFEKCPTXVKNYGIWLRYQSRTGYHNMYKEFRDTTLNGAVEQMYTEMASR  426
            LAINEIFEK PT +KNYGIWLRYQSRTGYHNMYKE+RDTTLNGAVE MYTEMASR
Sbjct  61   LAINEIFEKNPTKIKNYGIWLRYQSRTGYHNMYKEYRDTTLNGAVEAMYTEMASR  115



>ref|XP_010542333.1| PREDICTED: 60S ribosomal protein L18a isoform X1 [Tarenaya hassleriana]
Length=178

 Score =   231 bits (590),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 107/115 (93%), Positives = 112/115 (97%), Gaps = 0/115 (0%)
 Frame = +1

Query  82   MVTYRFHQYQVVGRALPSETDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQV  261
            MV +RFHQYQVVGRALP+ETDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQ+
Sbjct  1    MVAFRFHQYQVVGRALPTETDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQM  60

Query  262  LAINEIFEKCPTXVKNYGIWLRYQSRTGYHNMYKEFRDTTLNGAVEQMYTEMASR  426
            LAINEIFEK PT +KNYGIWLRYQSRTGYHNMYKE+RDTTLNGAVEQMYTEMASR
Sbjct  61   LAINEIFEKNPTKIKNYGIWLRYQSRTGYHNMYKEYRDTTLNGAVEQMYTEMASR  115



>ref|NP_001275252.1| uncharacterized protein LOC102577837 [Solanum tuberosum]
 ref|XP_004233112.1| PREDICTED: 60S ribosomal protein L18a-2 [Solanum lycopersicum]
 ref|XP_010316931.1| PREDICTED: 60S ribosomal protein L18a-2 [Solanum lycopersicum]
 gb|ABA46783.1| unknown [Solanum tuberosum]
Length=178

 Score =   231 bits (590),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 107/115 (93%), Positives = 112/115 (97%), Gaps = 0/115 (0%)
 Frame = +1

Query  82   MVTYRFHQYQVVGRALPSETDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQV  261
            MVTY+FHQYQVVGRALP+ETDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQ+
Sbjct  1    MVTYKFHQYQVVGRALPTETDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQM  60

Query  262  LAINEIFEKCPTXVKNYGIWLRYQSRTGYHNMYKEFRDTTLNGAVEQMYTEMASR  426
            LAINEIFEK PT +KNYGIWLRYQSRTGYHNMYKE+RDTTLNG VEQMYTEMASR
Sbjct  61   LAINEIFEKNPTTIKNYGIWLRYQSRTGYHNMYKEYRDTTLNGGVEQMYTEMASR  115



>ref|XP_011071121.1| PREDICTED: 60S ribosomal protein L18a [Sesamum indicum]
Length=178

 Score =   231 bits (589),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 106/115 (92%), Positives = 112/115 (97%), Gaps = 0/115 (0%)
 Frame = +1

Query  82   MVTYRFHQYQVVGRALPSETDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQV  261
            MVTY+FHQYQVVGR LP+ETDEHP+IYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQ+
Sbjct  1    MVTYKFHQYQVVGRGLPTETDEHPRIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQI  60

Query  262  LAINEIFEKCPTXVKNYGIWLRYQSRTGYHNMYKEFRDTTLNGAVEQMYTEMASR  426
            LAINEIFEK PT +KNYGIWLRYQSRTGYHNMYKE+RDTTLNGAVEQMYTEMASR
Sbjct  61   LAINEIFEKNPTTIKNYGIWLRYQSRTGYHNMYKEYRDTTLNGAVEQMYTEMASR  115



>gb|EYU43268.1| hypothetical protein MIMGU_mgv1a013972mg [Erythranthe guttata]
Length=204

 Score =   232 bits (592),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 107/125 (86%), Positives = 117/125 (94%), Gaps = 0/125 (0%)
 Frame = +1

Query  52   SQEDGSVVAKMVTYRFHQYQVVGRALPSETDEHPKIYRMKLWATNEVRAKSKFWYFLRKL  231
            ++E  S  +KMVTY+FHQYQVVGRALP+E DEHPKIYRMKLWATNEVRAKSKFWYFLRKL
Sbjct  17   TEERESEQSKMVTYKFHQYQVVGRALPTEKDEHPKIYRMKLWATNEVRAKSKFWYFLRKL  76

Query  232  KKVKKSNGQVLAINEIFEKCPTXVKNYGIWLRYQSRTGYHNMYKEFRDTTLNGAVEQMYT  411
            KKVKKSNGQ+LAINEIFEK PT +KN+G+WLRYQSRTGYHNMYKE+RDTTLNG VEQMYT
Sbjct  77   KKVKKSNGQMLAINEIFEKNPTTIKNFGVWLRYQSRTGYHNMYKEYRDTTLNGGVEQMYT  136

Query  412  EMASR  426
            EMASR
Sbjct  137  EMASR  141



>ref|XP_002268750.1| PREDICTED: 60S ribosomal protein L18a [Vitis vinifera]
 emb|CBI22128.3| unnamed protein product [Vitis vinifera]
Length=178

 Score =   231 bits (589),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 106/115 (92%), Positives = 113/115 (98%), Gaps = 0/115 (0%)
 Frame = +1

Query  82   MVTYRFHQYQVVGRALPSETDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQV  261
            MVT++FHQYQVVGRALPSE+DEHP+IYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQV
Sbjct  1    MVTFKFHQYQVVGRALPSESDEHPRIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQV  60

Query  262  LAINEIFEKCPTXVKNYGIWLRYQSRTGYHNMYKEFRDTTLNGAVEQMYTEMASR  426
            LAINEIFEK PT +KNYGIWLRYQSRTGYHNMYKE+RDTTLNG+VEQMYTEMASR
Sbjct  61   LAINEIFEKNPTKIKNYGIWLRYQSRTGYHNMYKEYRDTTLNGSVEQMYTEMASR  115



>ref|XP_006363066.1| PREDICTED: 60S ribosomal protein L18a-like [Solanum tuberosum]
Length=178

 Score =   231 bits (589),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 107/115 (93%), Positives = 112/115 (97%), Gaps = 0/115 (0%)
 Frame = +1

Query  82   MVTYRFHQYQVVGRALPSETDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQV  261
            MV Y+FHQYQVVGRALPSE+DEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQ+
Sbjct  1    MVNYKFHQYQVVGRALPSESDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQM  60

Query  262  LAINEIFEKCPTXVKNYGIWLRYQSRTGYHNMYKEFRDTTLNGAVEQMYTEMASR  426
            LAINEIFEK PT +KNYGIWLRYQSRTGYHNMYKE+RDTTLNGAVEQMYTEMASR
Sbjct  61   LAINEIFEKYPTKIKNYGIWLRYQSRTGYHNMYKEYRDTTLNGAVEQMYTEMASR  115



>ref|XP_009598886.1| PREDICTED: 60S ribosomal protein L18a-like [Nicotiana tomentosiformis]
Length=178

 Score =   231 bits (588),  Expect = 4e-74, Method: Compositional matrix adjust.
 Identities = 107/115 (93%), Positives = 112/115 (97%), Gaps = 0/115 (0%)
 Frame = +1

Query  82   MVTYRFHQYQVVGRALPSETDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQV  261
            MV Y+FHQYQVVGRALPSETDEHPKIYRMKLWATNEVRAKSKFWY+LRKLKKVKKSNGQ+
Sbjct  1    MVNYKFHQYQVVGRALPSETDEHPKIYRMKLWATNEVRAKSKFWYYLRKLKKVKKSNGQM  60

Query  262  LAINEIFEKCPTXVKNYGIWLRYQSRTGYHNMYKEFRDTTLNGAVEQMYTEMASR  426
            LAINEIFEK PT +KNYGIWLRYQSRTGYHNMYKE+RDTTLNGAVEQMYTEMASR
Sbjct  61   LAINEIFEKNPTKIKNYGIWLRYQSRTGYHNMYKEYRDTTLNGAVEQMYTEMASR  115



>sp|Q9ATF5.1|RL18A_CASSA RecName: Full=60S ribosomal protein L18a [Castanea sativa]
 gb|AAK25759.1|AF334839_1 ribosomal protein L18a [Castanea sativa]
Length=178

 Score =   231 bits (588),  Expect = 4e-74, Method: Compositional matrix adjust.
 Identities = 107/115 (93%), Positives = 111/115 (97%), Gaps = 0/115 (0%)
 Frame = +1

Query  82   MVTYRFHQYQVVGRALPSETDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQV  261
            MVT+RFHQYQVVGR LPSETDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQ+
Sbjct  1    MVTFRFHQYQVVGRGLPSETDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQM  60

Query  262  LAINEIFEKCPTXVKNYGIWLRYQSRTGYHNMYKEFRDTTLNGAVEQMYTEMASR  426
            LAINEIFEK PT +KNYGIWLRYQSRTGYHNMYKE+RDTTLNGAVEQMY EMASR
Sbjct  61   LAINEIFEKNPTKIKNYGIWLRYQSRTGYHNMYKEYRDTTLNGAVEQMYIEMASR  115



>gb|KHG16522.1| 60S ribosomal L18a [Gossypium arboreum]
Length=178

 Score =   231 bits (588),  Expect = 4e-74, Method: Compositional matrix adjust.
 Identities = 107/115 (93%), Positives = 112/115 (97%), Gaps = 0/115 (0%)
 Frame = +1

Query  82   MVTYRFHQYQVVGRALPSETDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQV  261
            MVT+RFHQYQVVGRA P+E+DEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQV
Sbjct  1    MVTFRFHQYQVVGRAHPTESDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQV  60

Query  262  LAINEIFEKCPTXVKNYGIWLRYQSRTGYHNMYKEFRDTTLNGAVEQMYTEMASR  426
            LAINEIFEK PT +KNYGIWLRYQSRTGYHNMYKE+RDTTLNGAVEQMYTEMASR
Sbjct  61   LAINEIFEKNPTKIKNYGIWLRYQSRTGYHNMYKEYRDTTLNGAVEQMYTEMASR  115



>ref|XP_009799848.1| PREDICTED: 60S ribosomal protein L18a [Nicotiana sylvestris]
Length=178

 Score =   231 bits (588),  Expect = 4e-74, Method: Compositional matrix adjust.
 Identities = 107/115 (93%), Positives = 112/115 (97%), Gaps = 0/115 (0%)
 Frame = +1

Query  82   MVTYRFHQYQVVGRALPSETDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQV  261
            MV Y+FHQYQVVGRALPSETDEHPKIYRMKLWATNEVRAKSKFWY+LRKLKKVKKSNGQ+
Sbjct  1    MVNYKFHQYQVVGRALPSETDEHPKIYRMKLWATNEVRAKSKFWYYLRKLKKVKKSNGQM  60

Query  262  LAINEIFEKCPTXVKNYGIWLRYQSRTGYHNMYKEFRDTTLNGAVEQMYTEMASR  426
            LAINEIFEK PT +KNYGIWLRYQSRTGYHNMYKE+RDTTLNGAVEQMYTEMASR
Sbjct  61   LAINEIFEKNPTKIKNYGIWLRYQSRTGYHNMYKEYRDTTLNGAVEQMYTEMASR  115



>gb|KHG16962.1| 60S ribosomal L18a [Gossypium arboreum]
 gb|KJB69799.1| hypothetical protein B456_011G042800 [Gossypium raimondii]
Length=178

 Score =   231 bits (588),  Expect = 4e-74, Method: Compositional matrix adjust.
 Identities = 107/115 (93%), Positives = 112/115 (97%), Gaps = 0/115 (0%)
 Frame = +1

Query  82   MVTYRFHQYQVVGRALPSETDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQV  261
            MVT+RFHQYQVVGRA P+E+DEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQV
Sbjct  1    MVTFRFHQYQVVGRAHPTESDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQV  60

Query  262  LAINEIFEKCPTXVKNYGIWLRYQSRTGYHNMYKEFRDTTLNGAVEQMYTEMASR  426
            LAINEIFEK PT +KNYGIWLRYQSRTGYHNMYKE+RDTTLNGAVEQMYTEMASR
Sbjct  61   LAINEIFEKNPTKIKNYGIWLRYQSRTGYHNMYKEYRDTTLNGAVEQMYTEMASR  115



>ref|XP_002528496.1| 60S ribosomal protein L18a, putative [Ricinus communis]
 gb|EEF33913.1| 60S ribosomal protein L18a, putative [Ricinus communis]
Length=178

 Score =   231 bits (588),  Expect = 4e-74, Method: Compositional matrix adjust.
 Identities = 105/115 (91%), Positives = 112/115 (97%), Gaps = 0/115 (0%)
 Frame = +1

Query  82   MVTYRFHQYQVVGRALPSETDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQV  261
            MVT+RFHQYQVVGRALP+E D+HPKIYRMKLW+TNEVRAKSKFWYFLRKLKKVK+SNGQV
Sbjct  1    MVTFRFHQYQVVGRALPTENDDHPKIYRMKLWSTNEVRAKSKFWYFLRKLKKVKRSNGQV  60

Query  262  LAINEIFEKCPTXVKNYGIWLRYQSRTGYHNMYKEFRDTTLNGAVEQMYTEMASR  426
            LAINEIFEK PT +KNYGIWLRYQSRTGYHNMYKE+RDTTLNGAVEQMYTEMASR
Sbjct  61   LAINEIFEKSPTKIKNYGIWLRYQSRTGYHNMYKEYRDTTLNGAVEQMYTEMASR  115



>gb|ACS96446.1| 60S ribosomal protein L18a [Jatropha curcas]
 gb|KDP37961.1| hypothetical protein JCGZ_04604 [Jatropha curcas]
Length=178

 Score =   230 bits (587),  Expect = 5e-74, Method: Compositional matrix adjust.
 Identities = 107/115 (93%), Positives = 111/115 (97%), Gaps = 0/115 (0%)
 Frame = +1

Query  82   MVTYRFHQYQVVGRALPSETDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQV  261
            MVTY+FHQYQVVGR LP+E DEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQV
Sbjct  1    MVTYKFHQYQVVGRGLPTENDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQV  60

Query  262  LAINEIFEKCPTXVKNYGIWLRYQSRTGYHNMYKEFRDTTLNGAVEQMYTEMASR  426
            LAINEIFEK PT +KNYGIWLRYQSRTGYHNMYKE+RDTTLNGAVEQMYTEMASR
Sbjct  61   LAINEIFEKNPTKIKNYGIWLRYQSRTGYHNMYKEYRDTTLNGAVEQMYTEMASR  115



>gb|ABK92715.1| unknown [Populus trichocarpa]
Length=178

 Score =   230 bits (587),  Expect = 5e-74, Method: Compositional matrix adjust.
 Identities = 107/115 (93%), Positives = 112/115 (97%), Gaps = 0/115 (0%)
 Frame = +1

Query  82   MVTYRFHQYQVVGRALPSETDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQV  261
            MVT+RFHQYQVVGRALP+ +DEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQV
Sbjct  1    MVTFRFHQYQVVGRALPTGSDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQV  60

Query  262  LAINEIFEKCPTXVKNYGIWLRYQSRTGYHNMYKEFRDTTLNGAVEQMYTEMASR  426
            LAINEIFEK PT +KNYGIWLRYQSRTGYHNMYKE+RDTTLNGAVEQMYTEMASR
Sbjct  61   LAINEIFEKNPTKIKNYGIWLRYQSRTGYHNMYKEYRDTTLNGAVEQMYTEMASR  115



>ref|XP_010538246.1| PREDICTED: 60S ribosomal protein L18a-like [Tarenaya hassleriana]
Length=178

 Score =   230 bits (587),  Expect = 5e-74, Method: Compositional matrix adjust.
 Identities = 106/115 (92%), Positives = 111/115 (97%), Gaps = 0/115 (0%)
 Frame = +1

Query  82   MVTYRFHQYQVVGRALPSETDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQV  261
            MVT+RFHQYQVVGRALP+E DEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQ+
Sbjct  1    MVTFRFHQYQVVGRALPTEADEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQI  60

Query  262  LAINEIFEKCPTXVKNYGIWLRYQSRTGYHNMYKEFRDTTLNGAVEQMYTEMASR  426
            LAINEIFEK PT +KNYGIWLRYQSRTGYHNMYKE+RD TLNGAVEQMYTEMASR
Sbjct  61   LAINEIFEKNPTKIKNYGIWLRYQSRTGYHNMYKEYRDITLNGAVEQMYTEMASR  115



>ref|XP_011009655.1| PREDICTED: 60S ribosomal protein L18a-2 [Populus euphratica]
 ref|XP_011009657.1| PREDICTED: 60S ribosomal protein L18a-2 [Populus euphratica]
Length=178

 Score =   230 bits (587),  Expect = 5e-74, Method: Compositional matrix adjust.
 Identities = 107/115 (93%), Positives = 112/115 (97%), Gaps = 0/115 (0%)
 Frame = +1

Query  82   MVTYRFHQYQVVGRALPSETDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQV  261
            M T+RFHQYQVVGRALP+E+DEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQV
Sbjct  1    MGTFRFHQYQVVGRALPTESDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQV  60

Query  262  LAINEIFEKCPTXVKNYGIWLRYQSRTGYHNMYKEFRDTTLNGAVEQMYTEMASR  426
            LAINEIFEK PT +KNYGIWLRYQSRTGYHNMYKE+RDTTLNGAVEQMYTEMASR
Sbjct  61   LAINEIFEKNPTKIKNYGIWLRYQSRTGYHNMYKEYRDTTLNGAVEQMYTEMASR  115



>ref|XP_010324737.1| PREDICTED: 60S ribosomal protein L18a-like [Solanum lycopersicum]
Length=178

 Score =   230 bits (587),  Expect = 5e-74, Method: Compositional matrix adjust.
 Identities = 107/115 (93%), Positives = 111/115 (97%), Gaps = 0/115 (0%)
 Frame = +1

Query  82   MVTYRFHQYQVVGRALPSETDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQV  261
            MVTY+FHQYQVVGRALPSE DEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQ+
Sbjct  1    MVTYKFHQYQVVGRALPSENDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQM  60

Query  262  LAINEIFEKCPTXVKNYGIWLRYQSRTGYHNMYKEFRDTTLNGAVEQMYTEMASR  426
            LAINEIFEK PT +KNYGIWLRYQSRTGYHNMYKE+RDTTLNG VEQMYTEMASR
Sbjct  61   LAINEIFEKYPTKIKNYGIWLRYQSRTGYHNMYKEYRDTTLNGGVEQMYTEMASR  115



>ref|NP_001275234.1| 60S ribosomal protein L18a-like [Solanum tuberosum]
 gb|ABB29928.1| unknown [Solanum tuberosum]
Length=178

 Score =   230 bits (587),  Expect = 5e-74, Method: Compositional matrix adjust.
 Identities = 107/115 (93%), Positives = 111/115 (97%), Gaps = 0/115 (0%)
 Frame = +1

Query  82   MVTYRFHQYQVVGRALPSETDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQV  261
            MVTY+FHQYQVVGRALPSE DEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQ+
Sbjct  1    MVTYKFHQYQVVGRALPSENDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQM  60

Query  262  LAINEIFEKCPTXVKNYGIWLRYQSRTGYHNMYKEFRDTTLNGAVEQMYTEMASR  426
            LAINEIFEK PT +KNYGIWLRYQSRTGYHNMYKE+RDTTLNG VEQMYTEMASR
Sbjct  61   LAINEIFEKYPTKIKNYGIWLRYQSRTGYHNMYKEYRDTTLNGGVEQMYTEMASR  115



>ref|XP_008811096.1| PREDICTED: 60S ribosomal protein L18a [Phoenix dactylifera]
Length=178

 Score =   230 bits (587),  Expect = 6e-74, Method: Compositional matrix adjust.
 Identities = 107/115 (93%), Positives = 110/115 (96%), Gaps = 0/115 (0%)
 Frame = +1

Query  82   MVTYRFHQYQVVGRALPSETDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQV  261
            MV +RFHQYQVVGRALPS TDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQV
Sbjct  1    MVVFRFHQYQVVGRALPSPTDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQV  60

Query  262  LAINEIFEKCPTXVKNYGIWLRYQSRTGYHNMYKEFRDTTLNGAVEQMYTEMASR  426
            LAINEIFE+ PT +KNYGIWLRYQSRTGYHNMYKEFRDTTLNGAVEQMY EMASR
Sbjct  61   LAINEIFERKPTKIKNYGIWLRYQSRTGYHNMYKEFRDTTLNGAVEQMYNEMASR  115



>ref|XP_006437137.1| hypothetical protein CICLE_v10032878mg [Citrus clementina]
 gb|ESR50377.1| hypothetical protein CICLE_v10032878mg [Citrus clementina]
Length=180

 Score =   230 bits (587),  Expect = 6e-74, Method: Compositional matrix adjust.
 Identities = 106/116 (91%), Positives = 112/116 (97%), Gaps = 0/116 (0%)
 Frame = +1

Query  79   KMVTYRFHQYQVVGRALPSETDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQ  258
            +MVT+RFHQYQVVGRALP+ETDEHPKIYRMKLWATNEVRAKSKFWY+LRKLKKVKKSNGQ
Sbjct  2    RMVTFRFHQYQVVGRALPTETDEHPKIYRMKLWATNEVRAKSKFWYYLRKLKKVKKSNGQ  61

Query  259  VLAINEIFEKCPTXVKNYGIWLRYQSRTGYHNMYKEFRDTTLNGAVEQMYTEMASR  426
            VLAINEIFEK P  +KNYGIWLRYQSRTGYHNMYKE+RDTTLNGAVEQMY EMASR
Sbjct  62   VLAINEIFEKNPAKIKNYGIWLRYQSRTGYHNMYKEYRDTTLNGAVEQMYNEMASR  117



>gb|KJB10614.1| hypothetical protein B456_001G211400 [Gossypium raimondii]
Length=178

 Score =   230 bits (586),  Expect = 7e-74, Method: Compositional matrix adjust.
 Identities = 106/115 (92%), Positives = 110/115 (96%), Gaps = 0/115 (0%)
 Frame = +1

Query  82   MVTYRFHQYQVVGRALPSETDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQV  261
            MV +RFHQYQVVGR LP+E DEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQV
Sbjct  1    MVAFRFHQYQVVGRGLPTEADEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQV  60

Query  262  LAINEIFEKCPTXVKNYGIWLRYQSRTGYHNMYKEFRDTTLNGAVEQMYTEMASR  426
            LAINEIFEK PT +KNYGIWLRYQSRTGYHNMYKE+RDTTLNGAVEQMYTEMASR
Sbjct  61   LAINEIFEKSPTKIKNYGIWLRYQSRTGYHNMYKEYRDTTLNGAVEQMYTEMASR  115



>gb|KCW89757.1| hypothetical protein EUGRSUZ_A02018 [Eucalyptus grandis]
Length=178

 Score =   230 bits (586),  Expect = 7e-74, Method: Compositional matrix adjust.
 Identities = 106/119 (89%), Positives = 112/119 (94%), Gaps = 0/119 (0%)
 Frame = +1

Query  70   VVAKMVTYRFHQYQVVGRALPSETDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKS  249
              + MVT+RFHQYQVVGRALP+ +DEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKS
Sbjct  32   ATSTMVTFRFHQYQVVGRALPTGSDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKS  91

Query  250  NGQVLAINEIFEKCPTXVKNYGIWLRYQSRTGYHNMYKEFRDTTLNGAVEQMYTEMASR  426
            NGQVLAINEIFEK PT + NYGIWLRYQSRTGYHNMYKE+RDTTLNGAVEQMYTEMASR
Sbjct  92   NGQVLAINEIFEKNPTKINNYGIWLRYQSRTGYHNMYKEYRDTTLNGAVEQMYTEMASR  150



>ref|XP_009609142.1| PREDICTED: 60S ribosomal protein L18a [Nicotiana tomentosiformis]
 ref|XP_009627827.1| PREDICTED: 60S ribosomal protein L18a [Nicotiana tomentosiformis]
 ref|XP_009592293.1| PREDICTED: 60S ribosomal protein L18a [Nicotiana tomentosiformis]
 ref|XP_009757479.1| PREDICTED: 60S ribosomal protein L18a-like [Nicotiana sylvestris]
 ref|XP_009757480.1| PREDICTED: 60S ribosomal protein L18a-like [Nicotiana sylvestris]
Length=178

 Score =   229 bits (585),  Expect = 9e-74, Method: Compositional matrix adjust.
 Identities = 106/115 (92%), Positives = 112/115 (97%), Gaps = 0/115 (0%)
 Frame = +1

Query  82   MVTYRFHQYQVVGRALPSETDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQV  261
            MVTY+FHQYQVVGRALP+E DEHPKIYRMKLWATNEVRAKSKFWY+LRKLKKVKKSNGQ+
Sbjct  1    MVTYKFHQYQVVGRALPTENDEHPKIYRMKLWATNEVRAKSKFWYYLRKLKKVKKSNGQM  60

Query  262  LAINEIFEKCPTXVKNYGIWLRYQSRTGYHNMYKEFRDTTLNGAVEQMYTEMASR  426
            LAINEIFEK PT +KNYGIWLRYQSRTGYHNMYKE+RDTTLNGAVEQMYTEMASR
Sbjct  61   LAINEIFEKNPTKIKNYGIWLRYQSRTGYHNMYKEYRDTTLNGAVEQMYTEMASR  115



>ref|XP_006442292.1| hypothetical protein CICLE_v10022114mg [Citrus clementina]
 gb|ESR55532.1| hypothetical protein CICLE_v10022114mg [Citrus clementina]
Length=224

 Score =   231 bits (589),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 110/141 (78%), Positives = 120/141 (85%), Gaps = 0/141 (0%)
 Frame = +1

Query  4    PSLAAQrerergrergSQEDGSVVAKMVTYRFHQYQVVGRALPSETDEHPKIYRMKLWAT  183
            PS+ +   + R       E   +  KMVT+RFHQYQVVGRALP+E DEHPKIYRMKLWAT
Sbjct  21   PSMQSAAYKPRFPSFTCSEPALLGGKMVTFRFHQYQVVGRALPTEKDEHPKIYRMKLWAT  80

Query  184  NEVRAKSKFWYFLRKLKKVKKSNGQVLAINEIFEKCPTXVKNYGIWLRYQSRTGYHNMYK  363
            NEVRAKSKFWYFLRKLKKVKKSNGQ+LAI+EIFEK PT +KNYGIWLRYQSRTGYHNMYK
Sbjct  81   NEVRAKSKFWYFLRKLKKVKKSNGQMLAIDEIFEKNPTKIKNYGIWLRYQSRTGYHNMYK  140

Query  364  EFRDTTLNGAVEQMYTEMASR  426
            E+RD TLNGAVEQMYTEMASR
Sbjct  141  EYRDITLNGAVEQMYTEMASR  161



>gb|EYU33348.1| hypothetical protein MIMGU_mgv1a014797mg [Erythranthe guttata]
Length=178

 Score =   229 bits (585),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 106/115 (92%), Positives = 111/115 (97%), Gaps = 0/115 (0%)
 Frame = +1

Query  82   MVTYRFHQYQVVGRALPSETDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQV  261
            MVTYR HQYQVVGRALP+ET+EHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQ+
Sbjct  1    MVTYRIHQYQVVGRALPTETEEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQI  60

Query  262  LAINEIFEKCPTXVKNYGIWLRYQSRTGYHNMYKEFRDTTLNGAVEQMYTEMASR  426
            LAINEIFEK PT +KNYGIWLRYQSRTGYHNMYKE+RDTTLNGAVE MYTEMASR
Sbjct  61   LAINEIFEKNPTTIKNYGIWLRYQSRTGYHNMYKEYRDTTLNGAVEHMYTEMASR  115



>ref|XP_010552158.1| PREDICTED: 60S ribosomal protein L18a [Tarenaya hassleriana]
Length=178

 Score =   229 bits (585),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 105/115 (91%), Positives = 112/115 (97%), Gaps = 0/115 (0%)
 Frame = +1

Query  82   MVTYRFHQYQVVGRALPSETDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQV  261
            MV +RFHQYQVVGRALP+ETDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQ+
Sbjct  1    MVAFRFHQYQVVGRALPTETDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQM  60

Query  262  LAINEIFEKCPTXVKNYGIWLRYQSRTGYHNMYKEFRDTTLNGAVEQMYTEMASR  426
            LAINEIFEK PT ++NYGIWLRYQSRTGYHNMYKE+RDTTLNG+VEQMYTEMASR
Sbjct  61   LAINEIFEKNPTKIRNYGIWLRYQSRTGYHNMYKEYRDTTLNGSVEQMYTEMASR  115



>ref|XP_002300869.1| 60S ribosomal protein L18a-1 [Populus trichocarpa]
 ref|XP_011026230.1| PREDICTED: 60S ribosomal protein L18a-like [Populus euphratica]
 gb|ABK92614.1| unknown [Populus trichocarpa]
 gb|EEE80142.1| 60S ribosomal protein L18a-1 [Populus trichocarpa]
Length=178

 Score =   229 bits (584),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 104/115 (90%), Positives = 112/115 (97%), Gaps = 0/115 (0%)
 Frame = +1

Query  82   MVTYRFHQYQVVGRALPSETDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQV  261
            MV++RFHQYQVVGRALP+E+DEHPKIYRMKLWATNEVR+KSKFWYFLRKLKKVKKSNGQ+
Sbjct  1    MVSFRFHQYQVVGRALPTESDEHPKIYRMKLWATNEVRSKSKFWYFLRKLKKVKKSNGQI  60

Query  262  LAINEIFEKCPTXVKNYGIWLRYQSRTGYHNMYKEFRDTTLNGAVEQMYTEMASR  426
            LAINEIFEK PT +KNYGIWLRYQSRTGYHNMYKE+RDTTLNGAVEQMY EMASR
Sbjct  61   LAINEIFEKNPTKIKNYGIWLRYQSRTGYHNMYKEYRDTTLNGAVEQMYNEMASR  115



>ref|XP_006410594.1| hypothetical protein EUTSA_v10017304mg [Eutrema salsugineum]
 gb|ESQ52047.1| hypothetical protein EUTSA_v10017304mg [Eutrema salsugineum]
Length=178

 Score =   229 bits (584),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 105/115 (91%), Positives = 112/115 (97%), Gaps = 0/115 (0%)
 Frame = +1

Query  82   MVTYRFHQYQVVGRALPSETDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQV  261
            MVT++FHQYQVVGRALP+E DEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQ+
Sbjct  1    MVTFKFHQYQVVGRALPTEKDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQM  60

Query  262  LAINEIFEKCPTXVKNYGIWLRYQSRTGYHNMYKEFRDTTLNGAVEQMYTEMASR  426
            LAINEIFEK PT +KN+GIWLRYQSRTGYHNMYKE+RDTTLNGAVEQMYTEMASR
Sbjct  61   LAINEIFEKNPTTIKNFGIWLRYQSRTGYHNMYKEYRDTTLNGAVEQMYTEMASR  115



>ref|XP_007025105.1| Ribosomal protein L18ae/LX family protein [Theobroma cacao]
 gb|EOY27727.1| Ribosomal protein L18ae/LX family protein [Theobroma cacao]
Length=178

 Score =   229 bits (583),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 105/115 (91%), Positives = 112/115 (97%), Gaps = 0/115 (0%)
 Frame = +1

Query  82   MVTYRFHQYQVVGRALPSETDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQV  261
            MVT+R+HQYQVVGRALP+E+DEHPKIYRM+LWATNEVRAKSKFWYFLRKLKKVKKSNGQV
Sbjct  1    MVTFRYHQYQVVGRALPTESDEHPKIYRMRLWATNEVRAKSKFWYFLRKLKKVKKSNGQV  60

Query  262  LAINEIFEKCPTXVKNYGIWLRYQSRTGYHNMYKEFRDTTLNGAVEQMYTEMASR  426
            LAINEIFEK PT +KNYGIWLRYQSRTGYHNMYKE+RDTTLNGAVEQMY EMASR
Sbjct  61   LAINEIFEKNPTKIKNYGIWLRYQSRTGYHNMYKEYRDTTLNGAVEQMYNEMASR  115



>ref|XP_009394206.1| PREDICTED: 60S ribosomal protein L18a-like [Musa acuminata subsp. 
malaccensis]
Length=178

 Score =   229 bits (583),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 106/115 (92%), Positives = 110/115 (96%), Gaps = 0/115 (0%)
 Frame = +1

Query  82   MVTYRFHQYQVVGRALPSETDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQV  261
            MV +RFHQYQVVGRALPS TDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQV
Sbjct  1    MVAFRFHQYQVVGRALPSSTDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQV  60

Query  262  LAINEIFEKCPTXVKNYGIWLRYQSRTGYHNMYKEFRDTTLNGAVEQMYTEMASR  426
            LAINEIFE+ PT +KNYGIWLRYQSRTGYHNMYKE+RDTTLNGAVEQMY EMASR
Sbjct  61   LAINEIFERKPTKIKNYGIWLRYQSRTGYHNMYKEYRDTTLNGAVEQMYNEMASR  115



>ref|XP_009406265.1| PREDICTED: 60S ribosomal protein L18a [Musa acuminata subsp. 
malaccensis]
Length=178

 Score =   229 bits (583),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 106/115 (92%), Positives = 110/115 (96%), Gaps = 0/115 (0%)
 Frame = +1

Query  82   MVTYRFHQYQVVGRALPSETDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQV  261
            MV +RFHQYQVVGRALPS TDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQV
Sbjct  1    MVVFRFHQYQVVGRALPSATDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQV  60

Query  262  LAINEIFEKCPTXVKNYGIWLRYQSRTGYHNMYKEFRDTTLNGAVEQMYTEMASR  426
            LAINEIFE+ PT +KNYGIWLRYQSRTGYHNMYKE+RDTTLNGAVEQMY EMASR
Sbjct  61   LAINEIFERKPTKIKNYGIWLRYQSRTGYHNMYKEYRDTTLNGAVEQMYNEMASR  115



>gb|ABK94361.1| unknown [Populus trichocarpa]
Length=178

 Score =   229 bits (583),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 104/115 (90%), Positives = 112/115 (97%), Gaps = 0/115 (0%)
 Frame = +1

Query  82   MVTYRFHQYQVVGRALPSETDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQV  261
            MV++RFHQYQVVGRALP+E+DEHPKIYRMKLWATNEVR+KSKFWYFLRKLKKVKKSNGQ+
Sbjct  1    MVSFRFHQYQVVGRALPTESDEHPKIYRMKLWATNEVRSKSKFWYFLRKLKKVKKSNGQI  60

Query  262  LAINEIFEKCPTXVKNYGIWLRYQSRTGYHNMYKEFRDTTLNGAVEQMYTEMASR  426
            LAINEIFEK PT +KNYGIWLRYQSRTGYHNMYKE+RDTTLNGAVEQMY EMASR
Sbjct  61   LAINEIFEKNPTKIKNYGIWLRYQSRTGYHNMYKEYRDTTLNGAVEQMYNEMASR  115



>ref|XP_008798296.1| PREDICTED: 60S ribosomal protein L18a [Phoenix dactylifera]
Length=178

 Score =   229 bits (583),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 106/115 (92%), Positives = 110/115 (96%), Gaps = 0/115 (0%)
 Frame = +1

Query  82   MVTYRFHQYQVVGRALPSETDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQV  261
            MV +RFHQYQVVGRALPS T+EHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQV
Sbjct  1    MVAFRFHQYQVVGRALPSPTNEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQV  60

Query  262  LAINEIFEKCPTXVKNYGIWLRYQSRTGYHNMYKEFRDTTLNGAVEQMYTEMASR  426
            LAINEIFE+ PT +KNYGIWLRYQSRTGYHNMYKEFRDTTLNGAVEQMY EMASR
Sbjct  61   LAINEIFERKPTKIKNYGIWLRYQSRTGYHNMYKEFRDTTLNGAVEQMYNEMASR  115



>ref|XP_010053843.1| PREDICTED: 60S ribosomal protein L18a [Eucalyptus grandis]
Length=178

 Score =   228 bits (582),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 106/115 (92%), Positives = 111/115 (97%), Gaps = 0/115 (0%)
 Frame = +1

Query  82   MVTYRFHQYQVVGRALPSETDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQV  261
            MVT+RFHQYQVVGRALP+ +DEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQV
Sbjct  1    MVTFRFHQYQVVGRALPTGSDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQV  60

Query  262  LAINEIFEKCPTXVKNYGIWLRYQSRTGYHNMYKEFRDTTLNGAVEQMYTEMASR  426
            LAINEIFEK PT + NYGIWLRYQSRTGYHNMYKE+RDTTLNGAVEQMYTEMASR
Sbjct  61   LAINEIFEKNPTKINNYGIWLRYQSRTGYHNMYKEYRDTTLNGAVEQMYTEMASR  115



>gb|KCW89756.1| hypothetical protein EUGRSUZ_A02018 [Eucalyptus grandis]
Length=213

 Score =   229 bits (585),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 106/119 (89%), Positives = 112/119 (94%), Gaps = 0/119 (0%)
 Frame = +1

Query  70   VVAKMVTYRFHQYQVVGRALPSETDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKS  249
              + MVT+RFHQYQVVGRALP+ +DEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKS
Sbjct  32   ATSTMVTFRFHQYQVVGRALPTGSDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKS  91

Query  250  NGQVLAINEIFEKCPTXVKNYGIWLRYQSRTGYHNMYKEFRDTTLNGAVEQMYTEMASR  426
            NGQVLAINEIFEK PT + NYGIWLRYQSRTGYHNMYKE+RDTTLNGAVEQMYTEMASR
Sbjct  92   NGQVLAINEIFEKNPTKINNYGIWLRYQSRTGYHNMYKEYRDTTLNGAVEQMYTEMASR  150



>gb|KHG27228.1| 60S ribosomal L18a [Gossypium arboreum]
Length=178

 Score =   228 bits (582),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 105/115 (91%), Positives = 110/115 (96%), Gaps = 0/115 (0%)
 Frame = +1

Query  82   MVTYRFHQYQVVGRALPSETDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQV  261
            MV +RFHQYQVVGR LP++ DEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQV
Sbjct  1    MVAFRFHQYQVVGRGLPTDADEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQV  60

Query  262  LAINEIFEKCPTXVKNYGIWLRYQSRTGYHNMYKEFRDTTLNGAVEQMYTEMASR  426
            LAINEIFEK PT +KNYGIWLRYQSRTGYHNMYKE+RDTTLNGAVEQMYTEMASR
Sbjct  61   LAINEIFEKNPTKIKNYGIWLRYQSRTGYHNMYKEYRDTTLNGAVEQMYTEMASR  115



>ref|XP_010924380.1| PREDICTED: 60S ribosomal protein L18a [Elaeis guineensis]
Length=178

 Score =   228 bits (581),  Expect = 4e-73, Method: Compositional matrix adjust.
 Identities = 106/115 (92%), Positives = 109/115 (95%), Gaps = 0/115 (0%)
 Frame = +1

Query  82   MVTYRFHQYQVVGRALPSETDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQV  261
            MV +RFHQYQVVGRALPS TDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQV
Sbjct  1    MVAFRFHQYQVVGRALPSPTDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQV  60

Query  262  LAINEIFEKCPTXVKNYGIWLRYQSRTGYHNMYKEFRDTTLNGAVEQMYTEMASR  426
            LAINEIFE+ PT +KNYGIWLRYQSRTGYHNMYKEFRDTTLNGAVE MY EMASR
Sbjct  61   LAINEIFERKPTKIKNYGIWLRYQSRTGYHNMYKEFRDTTLNGAVEHMYNEMASR  115



>ref|XP_010540563.1| PREDICTED: 60S ribosomal protein L18a [Tarenaya hassleriana]
Length=178

 Score =   228 bits (581),  Expect = 4e-73, Method: Compositional matrix adjust.
 Identities = 106/115 (92%), Positives = 110/115 (96%), Gaps = 0/115 (0%)
 Frame = +1

Query  82   MVTYRFHQYQVVGRALPSETDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQV  261
            MVT+RFHQYQVV RALP+ETDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQ+
Sbjct  1    MVTFRFHQYQVVERALPTETDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQM  60

Query  262  LAINEIFEKCPTXVKNYGIWLRYQSRTGYHNMYKEFRDTTLNGAVEQMYTEMASR  426
            LAINEIFEK PT +KNYGIWLRYQSRTGYHNMYKEFRD TLNGAVEQMY EMASR
Sbjct  61   LAINEIFEKNPTKIKNYGIWLRYQSRTGYHNMYKEFRDITLNGAVEQMYNEMASR  115



>gb|KCW75929.1| hypothetical protein EUGRSUZ_D00304 [Eucalyptus grandis]
Length=255

 Score =   231 bits (588),  Expect = 5e-73, Method: Compositional matrix adjust.
 Identities = 106/119 (89%), Positives = 113/119 (95%), Gaps = 0/119 (0%)
 Frame = +1

Query  70   VVAKMVTYRFHQYQVVGRALPSETDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKS  249
            + ++MVT+RFHQYQVVGRALP+  DEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKS
Sbjct  74   LASEMVTFRFHQYQVVGRALPTGADEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKS  133

Query  250  NGQVLAINEIFEKCPTXVKNYGIWLRYQSRTGYHNMYKEFRDTTLNGAVEQMYTEMASR  426
            NGQVLAINEIFEK PT + NYGIWLRYQSRTGYHNMYKE+RDTTLNGAVEQMYTEMASR
Sbjct  134  NGQVLAINEIFEKNPTKINNYGIWLRYQSRTGYHNMYKEYRDTTLNGAVEQMYTEMASR  192



>gb|KJB42782.1| hypothetical protein B456_007G174800 [Gossypium raimondii]
Length=178

 Score =   228 bits (581),  Expect = 5e-73, Method: Compositional matrix adjust.
 Identities = 105/115 (91%), Positives = 110/115 (96%), Gaps = 0/115 (0%)
 Frame = +1

Query  82   MVTYRFHQYQVVGRALPSETDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQV  261
            MV +RFHQYQVVGR LP+E D+HPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQV
Sbjct  1    MVAFRFHQYQVVGRGLPTEADQHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQV  60

Query  262  LAINEIFEKCPTXVKNYGIWLRYQSRTGYHNMYKEFRDTTLNGAVEQMYTEMASR  426
            LAINEIFEK PT +KNYGIWLRYQSRTGYHNMYKE+RDTTLNGAVEQMYTEMASR
Sbjct  61   LAINEIFEKNPTKIKNYGIWLRYQSRTGYHNMYKEYRDTTLNGAVEQMYTEMASR  115



>ref|XP_010052071.1| PREDICTED: 60S ribosomal protein L18a-like isoform X1 [Eucalyptus 
grandis]
Length=178

 Score =   228 bits (581),  Expect = 5e-73, Method: Compositional matrix adjust.
 Identities = 106/115 (92%), Positives = 110/115 (96%), Gaps = 0/115 (0%)
 Frame = +1

Query  82   MVTYRFHQYQVVGRALPSETDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQV  261
            MVT+RFHQYQVVGRALP+  DEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQV
Sbjct  1    MVTFRFHQYQVVGRALPTGADEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQV  60

Query  262  LAINEIFEKCPTXVKNYGIWLRYQSRTGYHNMYKEFRDTTLNGAVEQMYTEMASR  426
            LAINEIFEK PT + NYGIWLRYQSRTGYHNMYKE+RDTTLNGAVEQMYTEMASR
Sbjct  61   LAINEIFEKNPTKINNYGIWLRYQSRTGYHNMYKEYRDTTLNGAVEQMYTEMASR  115



>ref|XP_009782492.1| PREDICTED: 60S ribosomal protein L18a-like [Nicotiana sylvestris]
Length=178

 Score =   228 bits (580),  Expect = 6e-73, Method: Compositional matrix adjust.
 Identities = 105/115 (91%), Positives = 111/115 (97%), Gaps = 0/115 (0%)
 Frame = +1

Query  82   MVTYRFHQYQVVGRALPSETDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQV  261
            MVTY+FHQYQVVGRALP+E DEHPKIYRMKLWATNEVRAKSKFWY+LRKLKKVKKSNGQ+
Sbjct  1    MVTYKFHQYQVVGRALPTENDEHPKIYRMKLWATNEVRAKSKFWYYLRKLKKVKKSNGQM  60

Query  262  LAINEIFEKCPTXVKNYGIWLRYQSRTGYHNMYKEFRDTTLNGAVEQMYTEMASR  426
            LAINEIFEK PT +KNYGIWLRYQSRTGYHNMYKE+RDTTLNG VEQMYTEMASR
Sbjct  61   LAINEIFEKNPTKIKNYGIWLRYQSRTGYHNMYKEYRDTTLNGGVEQMYTEMASR  115



>ref|NP_001238728.1| uncharacterized protein LOC100306174 [Glycine max]
 gb|ACU14228.1| unknown [Glycine max]
 gb|KHN33136.1| 60S ribosomal protein L18a [Glycine soja]
Length=178

 Score =   228 bits (580),  Expect = 7e-73, Method: Compositional matrix adjust.
 Identities = 105/115 (91%), Positives = 110/115 (96%), Gaps = 0/115 (0%)
 Frame = +1

Query  82   MVTYRFHQYQVVGRALPSETDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQV  261
            MVT+RFHQYQVVGRALP+E D+HPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQV
Sbjct  1    MVTFRFHQYQVVGRALPTEADQHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQV  60

Query  262  LAINEIFEKCPTXVKNYGIWLRYQSRTGYHNMYKEFRDTTLNGAVEQMYTEMASR  426
            LAINEIFEK PT +KNYGIWLRYQSRTGYHNMYKE+RDTTLNGAVE MY EMASR
Sbjct  61   LAINEIFEKNPTKIKNYGIWLRYQSRTGYHNMYKEYRDTTLNGAVEAMYNEMASR  115



>gb|KHN38335.1| 60S ribosomal protein L18a [Glycine soja]
Length=178

 Score =   227 bits (579),  Expect = 9e-73, Method: Compositional matrix adjust.
 Identities = 105/115 (91%), Positives = 110/115 (96%), Gaps = 0/115 (0%)
 Frame = +1

Query  82   MVTYRFHQYQVVGRALPSETDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQV  261
            MV  RFHQYQVVGRALP+E+DEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQV
Sbjct  1    MVAMRFHQYQVVGRALPTESDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQV  60

Query  262  LAINEIFEKCPTXVKNYGIWLRYQSRTGYHNMYKEFRDTTLNGAVEQMYTEMASR  426
            LAINEIFE+ PT +KNYGIWLRYQSRTGYHNMYKE+RDTTLNGAVE MYTEMASR
Sbjct  61   LAINEIFERNPTKIKNYGIWLRYQSRTGYHNMYKEYRDTTLNGAVEHMYTEMASR  115



>gb|KJB69800.1| hypothetical protein B456_011G042900 [Gossypium raimondii]
Length=178

 Score =   227 bits (579),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 106/115 (92%), Positives = 111/115 (97%), Gaps = 0/115 (0%)
 Frame = +1

Query  82   MVTYRFHQYQVVGRALPSETDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQV  261
            MVT+RFHQYQVVGRA P+E+DEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKS GQV
Sbjct  1    MVTFRFHQYQVVGRAHPAESDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSIGQV  60

Query  262  LAINEIFEKCPTXVKNYGIWLRYQSRTGYHNMYKEFRDTTLNGAVEQMYTEMASR  426
            LAINEIFEK PT +KNYGIWLRYQSRTGYHNMYKE+RDTTLNGAVEQMYTEMASR
Sbjct  61   LAINEIFEKNPTKIKNYGIWLRYQSRTGYHNMYKEYRDTTLNGAVEQMYTEMASR  115



>ref|NP_001237679.1| uncharacterized protein LOC100306365 [Glycine max]
 gb|ACU14501.1| unknown [Glycine max]
 gb|KHN35898.1| 60S ribosomal protein L18a-2 [Glycine soja]
Length=178

 Score =   227 bits (578),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 105/115 (91%), Positives = 110/115 (96%), Gaps = 0/115 (0%)
 Frame = +1

Query  82   MVTYRFHQYQVVGRALPSETDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQV  261
            MVT+RFHQYQVVGRALP+ETD HPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQ+
Sbjct  1    MVTFRFHQYQVVGRALPTETDVHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQM  60

Query  262  LAINEIFEKCPTXVKNYGIWLRYQSRTGYHNMYKEFRDTTLNGAVEQMYTEMASR  426
            LAINEIFEK PT +KNYGIWLRYQSRTGYHNMYKE+RDTTLNGAVE MY EMASR
Sbjct  61   LAINEIFEKNPTKIKNYGIWLRYQSRTGYHNMYKEYRDTTLNGAVEHMYNEMASR  115



>gb|AFK44558.1| unknown [Lotus japonicus]
Length=178

 Score =   227 bits (578),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 103/115 (90%), Positives = 112/115 (97%), Gaps = 0/115 (0%)
 Frame = +1

Query  82   MVTYRFHQYQVVGRALPSETDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQV  261
            MVT+RFHQYQVVGRALP+++D+HPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQV
Sbjct  1    MVTFRFHQYQVVGRALPTDSDQHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQV  60

Query  262  LAINEIFEKCPTXVKNYGIWLRYQSRTGYHNMYKEFRDTTLNGAVEQMYTEMASR  426
            LAINEIFEK PT +KN+GIWLRYQSRTGYHNMYKE+RDTTLNGAV+ MYTEMASR
Sbjct  61   LAINEIFEKNPTKIKNFGIWLRYQSRTGYHNMYKEYRDTTLNGAVDAMYTEMASR  115



>ref|XP_007159262.1| hypothetical protein PHAVU_002G223200g [Phaseolus vulgaris]
 gb|ESW31256.1| hypothetical protein PHAVU_002G223200g [Phaseolus vulgaris]
Length=178

 Score =   227 bits (578),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 104/115 (90%), Positives = 109/115 (95%), Gaps = 0/115 (0%)
 Frame = +1

Query  82   MVTYRFHQYQVVGRALPSETDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQV  261
            MVT+RFHQYQVVGRALP+E D+HPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQ+
Sbjct  1    MVTFRFHQYQVVGRALPTEADQHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQM  60

Query  262  LAINEIFEKCPTXVKNYGIWLRYQSRTGYHNMYKEFRDTTLNGAVEQMYTEMASR  426
            LAINEIFEK PT + NYGIWLRYQSRTGYHNMYKEFRDTTLNGAVE MY EMASR
Sbjct  61   LAINEIFEKNPTKINNYGIWLRYQSRTGYHNMYKEFRDTTLNGAVEHMYNEMASR  115



>ref|XP_011074018.1| PREDICTED: 60S ribosomal protein L18a-2-like [Sesamum indicum]
Length=178

 Score =   226 bits (577),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 105/115 (91%), Positives = 110/115 (96%), Gaps = 0/115 (0%)
 Frame = +1

Query  82   MVTYRFHQYQVVGRALPSETDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQV  261
            M  YRF QYQVVGRALP+ET+EHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQ+
Sbjct  1    MAIYRFRQYQVVGRALPTETEEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQI  60

Query  262  LAINEIFEKCPTXVKNYGIWLRYQSRTGYHNMYKEFRDTTLNGAVEQMYTEMASR  426
            LAINEIFEK PT +KNYGIWLRYQSRTGYHNMYKE+RDTTLNGAVEQMYTEMASR
Sbjct  61   LAINEIFEKNPTTIKNYGIWLRYQSRTGYHNMYKEYRDTTLNGAVEQMYTEMASR  115



>ref|NP_001236918.1| uncharacterized protein LOC100500108 [Glycine max]
 gb|ACU14971.1| unknown [Glycine max]
 gb|KHN47310.1| 60S ribosomal protein L18a [Glycine soja]
Length=178

 Score =   226 bits (577),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 104/115 (90%), Positives = 110/115 (96%), Gaps = 0/115 (0%)
 Frame = +1

Query  82   MVTYRFHQYQVVGRALPSETDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQV  261
            MVT+RFHQYQVVGRALP+E D+HPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQV
Sbjct  1    MVTFRFHQYQVVGRALPTEADQHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQV  60

Query  262  LAINEIFEKCPTXVKNYGIWLRYQSRTGYHNMYKEFRDTTLNGAVEQMYTEMASR  426
            LAINEIFEK PT +KNYGIWLRYQSRTGYHNMYKE+RDTTLNG+VE MY EMASR
Sbjct  61   LAINEIFEKNPTKIKNYGIWLRYQSRTGYHNMYKEYRDTTLNGSVEAMYNEMASR  115



>ref|XP_007147889.1| hypothetical protein PHAVU_006G163400g [Phaseolus vulgaris]
 gb|ESW19883.1| hypothetical protein PHAVU_006G163400g [Phaseolus vulgaris]
Length=178

 Score =   226 bits (577),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 104/115 (90%), Positives = 109/115 (95%), Gaps = 0/115 (0%)
 Frame = +1

Query  82   MVTYRFHQYQVVGRALPSETDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQV  261
            MVT+RFHQYQVVGRALP+E D+HPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQ+
Sbjct  1    MVTFRFHQYQVVGRALPTEADQHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQM  60

Query  262  LAINEIFEKCPTXVKNYGIWLRYQSRTGYHNMYKEFRDTTLNGAVEQMYTEMASR  426
            LAINEIFEK PT + NYGIWLRYQSRTGYHNMYKEFRDTTLNGAVE MY EMASR
Sbjct  61   LAINEIFEKNPTKINNYGIWLRYQSRTGYHNMYKEFRDTTLNGAVEHMYNEMASR  115



>ref|NP_001056335.1| Os05g0565000 [Oryza sativa Japonica Group]
 gb|AAT77404.1| putative 60S ribosomal protein L18a [Oryza sativa Japonica Group]
 dbj|BAF18249.1| Os05g0565000 [Oryza sativa Japonica Group]
 gb|EAY99039.1| hypothetical protein OsI_20997 [Oryza sativa Indica Group]
 dbj|BAG95664.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEE64706.1| hypothetical protein OsJ_19561 [Oryza sativa Japonica Group]
Length=178

 Score =   226 bits (576),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 105/115 (91%), Positives = 110/115 (96%), Gaps = 0/115 (0%)
 Frame = +1

Query  82   MVTYRFHQYQVVGRALPSETDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQV  261
            MV YRFHQYQVVGRALP+  DEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQ+
Sbjct  1    MVAYRFHQYQVVGRALPTPGDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQM  60

Query  262  LAINEIFEKCPTXVKNYGIWLRYQSRTGYHNMYKEFRDTTLNGAVEQMYTEMASR  426
            LAINEIFE+ PT +KNYGIWLRYQSRTGYHNMYKE+RDTTLNGAVEQMYTEMASR
Sbjct  61   LAINEIFERNPTTIKNYGIWLRYQSRTGYHNMYKEYRDTTLNGAVEQMYTEMASR  115



>gb|KHG26670.1| 60S ribosomal L18a [Gossypium arboreum]
Length=178

 Score =   226 bits (576),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 104/115 (90%), Positives = 109/115 (95%), Gaps = 0/115 (0%)
 Frame = +1

Query  82   MVTYRFHQYQVVGRALPSETDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQV  261
            MV +RFHQYQVVGR LP+E D+HPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQV
Sbjct  1    MVAFRFHQYQVVGRGLPTEADQHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQV  60

Query  262  LAINEIFEKCPTXVKNYGIWLRYQSRTGYHNMYKEFRDTTLNGAVEQMYTEMASR  426
            LAINEIFEK PT +KNYGIWLRYQSRTGYHNMYKE+RDTTLNGAVEQMY EMASR
Sbjct  61   LAINEIFEKNPTKIKNYGIWLRYQSRTGYHNMYKEYRDTTLNGAVEQMYAEMASR  115



>ref|XP_007048983.1| Ribosomal protein L18ae/LX family protein [Theobroma cacao]
 gb|EOX93140.1| Ribosomal protein L18ae/LX family protein [Theobroma cacao]
Length=178

 Score =   226 bits (576),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 104/115 (90%), Positives = 110/115 (96%), Gaps = 0/115 (0%)
 Frame = +1

Query  82   MVTYRFHQYQVVGRALPSETDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQV  261
            MV++R+HQYQVVGR LP+E DEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQV
Sbjct  1    MVSFRYHQYQVVGRGLPTEADEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQV  60

Query  262  LAINEIFEKCPTXVKNYGIWLRYQSRTGYHNMYKEFRDTTLNGAVEQMYTEMASR  426
            LAINEIFEK PT +KNYGIWLRYQSRTGYHNMYKE+RDTTLNGAVEQMY EMASR
Sbjct  61   LAINEIFEKNPTKIKNYGIWLRYQSRTGYHNMYKEYRDTTLNGAVEQMYNEMASR  115



>ref|XP_006654794.1| PREDICTED: 60S ribosomal protein L18a-like [Oryza brachyantha]
Length=178

 Score =   226 bits (576),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 105/115 (91%), Positives = 110/115 (96%), Gaps = 0/115 (0%)
 Frame = +1

Query  82   MVTYRFHQYQVVGRALPSETDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQV  261
            MV YRFHQYQVVGRALP+  DEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQ+
Sbjct  1    MVAYRFHQYQVVGRALPTPGDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQM  60

Query  262  LAINEIFEKCPTXVKNYGIWLRYQSRTGYHNMYKEFRDTTLNGAVEQMYTEMASR  426
            LAINEIFE+ PT +KNYGIWLRYQSRTGYHNMYKE+RDTTLNGAVEQMYTEMASR
Sbjct  61   LAINEIFERNPTTIKNYGIWLRYQSRTGYHNMYKEYRDTTLNGAVEQMYTEMASR  115



>ref|XP_002440257.1| hypothetical protein SORBIDRAFT_09g028590 [Sorghum bicolor]
 gb|EES18687.1| hypothetical protein SORBIDRAFT_09g028590 [Sorghum bicolor]
Length=178

 Score =   226 bits (575),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 104/115 (90%), Positives = 110/115 (96%), Gaps = 0/115 (0%)
 Frame = +1

Query  82   MVTYRFHQYQVVGRALPSETDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQV  261
            MV +RFHQYQVVGRALP+ TDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQ+
Sbjct  1    MVAHRFHQYQVVGRALPTPTDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQM  60

Query  262  LAINEIFEKCPTXVKNYGIWLRYQSRTGYHNMYKEFRDTTLNGAVEQMYTEMASR  426
            LAINEIFE+ PT +KNYGIWLRYQSRTGYHNMYKE+RDTTLNGAVEQMY EMASR
Sbjct  61   LAINEIFERNPTTIKNYGIWLRYQSRTGYHNMYKEYRDTTLNGAVEQMYNEMASR  115



>gb|ACN28455.1| unknown [Zea mays]
 gb|AFW79177.1| 60S ribosomal protein L18a [Zea mays]
Length=178

 Score =   226 bits (575),  Expect = 4e-72, Method: Compositional matrix adjust.
 Identities = 104/115 (90%), Positives = 110/115 (96%), Gaps = 0/115 (0%)
 Frame = +1

Query  82   MVTYRFHQYQVVGRALPSETDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQV  261
            MV +RFHQYQVVGRALP+ TDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQ+
Sbjct  1    MVAHRFHQYQVVGRALPTPTDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQM  60

Query  262  LAINEIFEKCPTXVKNYGIWLRYQSRTGYHNMYKEFRDTTLNGAVEQMYTEMASR  426
            LAINEIFE+ PT +KNYGIWLRYQSRTGYHNMYKE+RDTTLNGAVEQMY EMASR
Sbjct  61   LAINEIFERNPTTIKNYGIWLRYQSRTGYHNMYKEYRDTTLNGAVEQMYNEMASR  115



>ref|NP_001148024.1| 60S ribosomal protein L18a [Zea mays]
 gb|ACG29459.1| 60S ribosomal protein L18a [Zea mays]
Length=178

 Score =   226 bits (575),  Expect = 4e-72, Method: Compositional matrix adjust.
 Identities = 104/115 (90%), Positives = 110/115 (96%), Gaps = 0/115 (0%)
 Frame = +1

Query  82   MVTYRFHQYQVVGRALPSETDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQV  261
            MV +RFHQYQVVGRALP+ TDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQ+
Sbjct  1    MVAHRFHQYQVVGRALPTPTDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQM  60

Query  262  LAINEIFEKCPTXVKNYGIWLRYQSRTGYHNMYKEFRDTTLNGAVEQMYTEMASR  426
            LAINEIFE+ PT +KNYGIWLRYQSRTGYHNMYKE+RDTTLNGAVEQMY EMASR
Sbjct  61   LAINEIFERNPTTIKNYGIWLRYQSRTGYHNMYKEYRDTTLNGAVEQMYNEMASR  115



>ref|XP_009389413.1| PREDICTED: 60S ribosomal protein L18a-like [Musa acuminata subsp. 
malaccensis]
Length=188

 Score =   226 bits (576),  Expect = 4e-72, Method: Compositional matrix adjust.
 Identities = 104/115 (90%), Positives = 109/115 (95%), Gaps = 0/115 (0%)
 Frame = +1

Query  82   MVTYRFHQYQVVGRALPSETDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQV  261
            MV +RFHQYQVVGRALP+  DEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQV
Sbjct  11   MVAFRFHQYQVVGRALPTAADEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQV  70

Query  262  LAINEIFEKCPTXVKNYGIWLRYQSRTGYHNMYKEFRDTTLNGAVEQMYTEMASR  426
            LAINEIFE+ PT +KNYGIWLRYQSRTGYHNMYKE+RDTTLNGAVEQMY EMASR
Sbjct  71   LAINEIFERKPTKIKNYGIWLRYQSRTGYHNMYKEYRDTTLNGAVEQMYNEMASR  125



>ref|XP_007136179.1| hypothetical protein PHAVU_009G024800g [Phaseolus vulgaris]
 gb|ESW08173.1| hypothetical protein PHAVU_009G024800g [Phaseolus vulgaris]
Length=178

 Score =   225 bits (574),  Expect = 4e-72, Method: Compositional matrix adjust.
 Identities = 103/115 (90%), Positives = 110/115 (96%), Gaps = 0/115 (0%)
 Frame = +1

Query  82   MVTYRFHQYQVVGRALPSETDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQV  261
            MV++RFHQYQVVGRALP+E D+HPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQ+
Sbjct  1    MVSFRFHQYQVVGRALPTEADQHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQM  60

Query  262  LAINEIFEKCPTXVKNYGIWLRYQSRTGYHNMYKEFRDTTLNGAVEQMYTEMASR  426
            LAINEIFEK PT ++NYGIWLRYQSRTGYHNMYKEFRDTTLNGAVE MY EMASR
Sbjct  61   LAINEIFEKNPTKIQNYGIWLRYQSRTGYHNMYKEFRDTTLNGAVEHMYNEMASR  115



>gb|ACG30921.1| 60S ribosomal protein L18a [Zea mays]
 gb|AFW81142.1| 60S ribosomal protein L18a [Zea mays]
Length=178

 Score =   225 bits (574),  Expect = 5e-72, Method: Compositional matrix adjust.
 Identities = 104/115 (90%), Positives = 110/115 (96%), Gaps = 0/115 (0%)
 Frame = +1

Query  82   MVTYRFHQYQVVGRALPSETDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQV  261
            MV +RFHQYQVVGRALP+ TDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQ+
Sbjct  1    MVAHRFHQYQVVGRALPTPTDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQM  60

Query  262  LAINEIFEKCPTXVKNYGIWLRYQSRTGYHNMYKEFRDTTLNGAVEQMYTEMASR  426
            LAINEIFE+ PT +KNYGIWLRYQSRTGYHNMYKE+RDTTLNGAVEQMY EMASR
Sbjct  61   LAINEIFERNPTTIKNYGIWLRYQSRTGYHNMYKEYRDTTLNGAVEQMYNEMASR  115



>emb|CDX97587.1| BnaA05g24920D [Brassica napus]
Length=178

 Score =   225 bits (574),  Expect = 5e-72, Method: Compositional matrix adjust.
 Identities = 105/115 (91%), Positives = 109/115 (95%), Gaps = 0/115 (0%)
 Frame = +1

Query  82   MVTYRFHQYQVVGRALPSETDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQV  261
            MV +RFHQYQVVGRALP+E D  PKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQ+
Sbjct  1    MVAFRFHQYQVVGRALPTEKDVQPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQM  60

Query  262  LAINEIFEKCPTXVKNYGIWLRYQSRTGYHNMYKEFRDTTLNGAVEQMYTEMASR  426
            LAINEIFEK PT +KNYGIWLRYQSRTGYHNMYKEFRDTTLNGAVEQMYTEMASR
Sbjct  61   LAINEIFEKNPTKIKNYGIWLRYQSRTGYHNMYKEFRDTTLNGAVEQMYTEMASR  115



>gb|AFK33651.1| unknown [Lotus japonicus]
Length=178

 Score =   225 bits (574),  Expect = 5e-72, Method: Compositional matrix adjust.
 Identities = 103/115 (90%), Positives = 110/115 (96%), Gaps = 0/115 (0%)
 Frame = +1

Query  82   MVTYRFHQYQVVGRALPSETDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQV  261
            MV ++FHQYQVVGRALP+E+D+HPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQV
Sbjct  1    MVAFKFHQYQVVGRALPTESDDHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQV  60

Query  262  LAINEIFEKCPTXVKNYGIWLRYQSRTGYHNMYKEFRDTTLNGAVEQMYTEMASR  426
            LAINEIFEK PT +KNYGIWLRYQSRTGYHNMYKE+RDTTLNGAVE MY EMASR
Sbjct  61   LAINEIFEKNPTTIKNYGIWLRYQSRTGYHNMYKEYRDTTLNGAVEHMYNEMASR  115



>ref|XP_006841639.1| hypothetical protein AMTR_s00003p00234980 [Amborella trichopoda]
 gb|ERN03314.1| hypothetical protein AMTR_s00003p00234980 [Amborella trichopoda]
Length=178

 Score =   225 bits (574),  Expect = 6e-72, Method: Compositional matrix adjust.
 Identities = 104/115 (90%), Positives = 110/115 (96%), Gaps = 0/115 (0%)
 Frame = +1

Query  82   MVTYRFHQYQVVGRALPSETDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQV  261
            MV +RFHQYQVVGRALP+ T+EHPK+YRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQV
Sbjct  1    MVAFRFHQYQVVGRALPTPTEEHPKLYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQV  60

Query  262  LAINEIFEKCPTXVKNYGIWLRYQSRTGYHNMYKEFRDTTLNGAVEQMYTEMASR  426
            LAINEIFEK PT +KNYGIWLRYQSRTGYHNMYKE+RDTTLNGAVEQMY EMASR
Sbjct  61   LAINEIFEKKPTKIKNYGIWLRYQSRTGYHNMYKEYRDTTLNGAVEQMYNEMASR  115



>ref|XP_004486036.1| PREDICTED: 60S ribosomal protein L18a-like [Cicer arietinum]
Length=178

 Score =   225 bits (574),  Expect = 6e-72, Method: Compositional matrix adjust.
 Identities = 103/115 (90%), Positives = 111/115 (97%), Gaps = 0/115 (0%)
 Frame = +1

Query  82   MVTYRFHQYQVVGRALPSETDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQV  261
            MV++++HQYQVVGRALP+E+DEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQV
Sbjct  1    MVSFKYHQYQVVGRALPTESDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQV  60

Query  262  LAINEIFEKCPTXVKNYGIWLRYQSRTGYHNMYKEFRDTTLNGAVEQMYTEMASR  426
            LAINEIFEK PT +KNYGIWLRYQSRTGYHNMYKEFRDTTLNGAV+ MY EMASR
Sbjct  61   LAINEIFEKNPTKIKNYGIWLRYQSRTGYHNMYKEFRDTTLNGAVDLMYNEMASR  115



>ref|XP_004969468.1| PREDICTED: 60S ribosomal protein L18a-like [Setaria italica]
Length=178

 Score =   225 bits (574),  Expect = 6e-72, Method: Compositional matrix adjust.
 Identities = 104/115 (90%), Positives = 109/115 (95%), Gaps = 0/115 (0%)
 Frame = +1

Query  82   MVTYRFHQYQVVGRALPSETDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQV  261
            MV +RFHQYQVVGRALP+  DEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQV
Sbjct  1    MVAFRFHQYQVVGRALPTPGDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQV  60

Query  262  LAINEIFEKCPTXVKNYGIWLRYQSRTGYHNMYKEFRDTTLNGAVEQMYTEMASR  426
            LAINEIFE+ PT +KNYGIWLRYQSRTGYHNMYKE+RDTTLNGAVEQMY EMASR
Sbjct  61   LAINEIFERNPTTIKNYGIWLRYQSRTGYHNMYKEYRDTTLNGAVEQMYNEMASR  115



>ref|XP_006644488.1| PREDICTED: 60S ribosomal protein L18a-like [Oryza brachyantha]
Length=178

 Score =   225 bits (574),  Expect = 6e-72, Method: Compositional matrix adjust.
 Identities = 104/115 (90%), Positives = 110/115 (96%), Gaps = 0/115 (0%)
 Frame = +1

Query  82   MVTYRFHQYQVVGRALPSETDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQV  261
            MV +RFHQYQVVGRALP+  DEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQ+
Sbjct  1    MVAFRFHQYQVVGRALPTPGDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQM  60

Query  262  LAINEIFEKCPTXVKNYGIWLRYQSRTGYHNMYKEFRDTTLNGAVEQMYTEMASR  426
            LAINEIFE+ PT +KNYGIWLRYQSRTGYHNMYKE+RDTTLNGAVEQMYTEMASR
Sbjct  61   LAINEIFERNPTTIKNYGIWLRYQSRTGYHNMYKEYRDTTLNGAVEQMYTEMASR  115



>gb|AFK46978.1| unknown [Lotus japonicus]
Length=178

 Score =   225 bits (573),  Expect = 7e-72, Method: Compositional matrix adjust.
 Identities = 104/115 (90%), Positives = 109/115 (95%), Gaps = 0/115 (0%)
 Frame = +1

Query  82   MVTYRFHQYQVVGRALPSETDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQV  261
            MV ++FHQYQVVGRALP+ETD HPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQV
Sbjct  1    MVAFKFHQYQVVGRALPTETDVHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQV  60

Query  262  LAINEIFEKCPTXVKNYGIWLRYQSRTGYHNMYKEFRDTTLNGAVEQMYTEMASR  426
            LAINEIFEK PT +KNYGIWLRYQSRTGYHNMYKE+RDTTLNGAVE MY EMASR
Sbjct  61   LAINEIFEKNPTKIKNYGIWLRYQSRTGYHNMYKEYRDTTLNGAVEHMYNEMASR  115



>ref|NP_001043805.2| Os01g0666900 [Oryza sativa Japonica Group]
 gb|EEC71234.1| hypothetical protein OsI_03189 [Oryza sativa Indica Group]
 dbj|BAF05719.2| Os01g0666900 [Oryza sativa Japonica Group]
Length=178

 Score =   225 bits (573),  Expect = 7e-72, Method: Compositional matrix adjust.
 Identities = 104/115 (90%), Positives = 110/115 (96%), Gaps = 0/115 (0%)
 Frame = +1

Query  82   MVTYRFHQYQVVGRALPSETDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQV  261
            MV +RFHQYQVVGRALP+  DEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQ+
Sbjct  1    MVAFRFHQYQVVGRALPTPGDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQM  60

Query  262  LAINEIFEKCPTXVKNYGIWLRYQSRTGYHNMYKEFRDTTLNGAVEQMYTEMASR  426
            LAINEIFE+ PT +KNYGIWLRYQSRTGYHNMYKE+RDTTLNGAVEQMYTEMASR
Sbjct  61   LAINEIFERNPTTIKNYGIWLRYQSRTGYHNMYKEYRDTTLNGAVEQMYTEMASR  115



>pdb|3IZS|S Chain S, Localization Of The Large Subunit Ribosomal Proteins 
Into A 6.1 A Cryo-Em Map Of Saccharomyces Cerevisiae Translating 
80s Ribosome
Length=167

 Score =   224 bits (572),  Expect = 8e-72, Method: Compositional matrix adjust.
 Identities = 104/115 (90%), Positives = 109/115 (95%), Gaps = 0/115 (0%)
 Frame = +1

Query  82   MVTYRFHQYQVVGRALPSETDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQV  261
            M  +RFHQYQVVGR LP+ TDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQ+
Sbjct  1    MGAFRFHQYQVVGRGLPTPTDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQI  60

Query  262  LAINEIFEKCPTXVKNYGIWLRYQSRTGYHNMYKEFRDTTLNGAVEQMYTEMASR  426
            LAINEIFEK PT +KNYGIWLRYQSRTGYHNMYKE+RDTTLNGAVEQMYTEMASR
Sbjct  61   LAINEIFEKNPTTIKNYGIWLRYQSRTGYHNMYKEYRDTTLNGAVEQMYTEMASR  115



>ref|XP_010263115.1| PREDICTED: 60S ribosomal protein L18a-2 [Nelumbo nucifera]
Length=178

 Score =   225 bits (573),  Expect = 8e-72, Method: Compositional matrix adjust.
 Identities = 105/115 (91%), Positives = 108/115 (94%), Gaps = 0/115 (0%)
 Frame = +1

Query  82   MVTYRFHQYQVVGRALPSETDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQV  261
            M  +RFHQYQVVGRALPSE D HPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQV
Sbjct  1    MGIFRFHQYQVVGRALPSEADPHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQV  60

Query  262  LAINEIFEKCPTXVKNYGIWLRYQSRTGYHNMYKEFRDTTLNGAVEQMYTEMASR  426
            LAINEIFEK PT +KNYGIWLRYQSRTGYHNMYKE+RDTTLNGAVEQMY EMASR
Sbjct  61   LAINEIFEKNPTKIKNYGIWLRYQSRTGYHNMYKEYRDTTLNGAVEQMYNEMASR  115



>ref|NP_001044264.1| Os01g0752300 [Oryza sativa Japonica Group]
 ref|XP_006644713.1| PREDICTED: 60S ribosomal protein L18a-like [Oryza brachyantha]
 sp|Q943F3.1|RL18A_ORYSJ RecName: Full=60S ribosomal protein L18a [Oryza sativa Japonica 
Group]
 pdb|3J61|S Chain S, Localization Of The Large Subunit Ribosomal Proteins 
Into A 5.5 A Cryo-em Map Of Triticum Aestivum Translating 80s 
Ribosome
 dbj|BAB67920.1| putative ribosomal protein L18a [Oryza sativa Japonica Group]
 dbj|BAB89536.1| putative ribosomal protein L18a [Oryza sativa Japonica Group]
 dbj|BAF06178.1| Os01g0752300 [Oryza sativa Japonica Group]
 gb|EAY75840.1| hypothetical protein OsI_03756 [Oryza sativa Indica Group]
 gb|EAZ13560.1| hypothetical protein OsJ_03475 [Oryza sativa Japonica Group]
Length=178

 Score =   225 bits (573),  Expect = 8e-72, Method: Compositional matrix adjust.
 Identities = 104/115 (90%), Positives = 109/115 (95%), Gaps = 0/115 (0%)
 Frame = +1

Query  82   MVTYRFHQYQVVGRALPSETDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQV  261
            M  +RFHQYQVVGR LP+ TDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQ+
Sbjct  1    MGAFRFHQYQVVGRGLPTPTDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQI  60

Query  262  LAINEIFEKCPTXVKNYGIWLRYQSRTGYHNMYKEFRDTTLNGAVEQMYTEMASR  426
            LAINEIFEK PT +KNYGIWLRYQSRTGYHNMYKE+RDTTLNGAVEQMYTEMASR
Sbjct  61   LAINEIFEKNPTTIKNYGIWLRYQSRTGYHNMYKEYRDTTLNGAVEQMYTEMASR  115



>ref|NP_001149475.1| LOC100283101 [Zea mays]
 ref|XP_002458279.1| hypothetical protein SORBIDRAFT_03g030600 [Sorghum bicolor]
 gb|ACF85683.1| unknown [Zea mays]
 gb|ACF85980.1| unknown [Zea mays]
 gb|ACG29474.1| 60S ribosomal protein L18a [Zea mays]
 gb|ACG35503.1| 60S ribosomal protein L18a [Zea mays]
 gb|ACG35547.1| 60S ribosomal protein L18a [Zea mays]
 gb|EES03399.1| hypothetical protein SORBIDRAFT_03g030600 [Sorghum bicolor]
 tpg|DAA58211.1| TPA: hypothetical protein ZEAMMB73_000159 [Zea mays]
Length=178

 Score =   224 bits (572),  Expect = 9e-72, Method: Compositional matrix adjust.
 Identities = 104/115 (90%), Positives = 109/115 (95%), Gaps = 0/115 (0%)
 Frame = +1

Query  82   MVTYRFHQYQVVGRALPSETDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQV  261
            MV +RFHQYQVVGRALP+  DEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQV
Sbjct  1    MVAFRFHQYQVVGRALPTPGDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQV  60

Query  262  LAINEIFEKCPTXVKNYGIWLRYQSRTGYHNMYKEFRDTTLNGAVEQMYTEMASR  426
            LAINEIFE+ PT +KNYGIWLRYQSRTGYHNMYKE+RDTTLNGAVEQMY EMASR
Sbjct  61   LAINEIFERNPTTIKNYGIWLRYQSRTGYHNMYKEYRDTTLNGAVEQMYNEMASR  115



>ref|XP_004979031.1| PREDICTED: 60S ribosomal protein L18a-like [Setaria italica]
Length=178

 Score =   224 bits (572),  Expect = 9e-72, Method: Compositional matrix adjust.
 Identities = 104/115 (90%), Positives = 109/115 (95%), Gaps = 0/115 (0%)
 Frame = +1

Query  82   MVTYRFHQYQVVGRALPSETDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQV  261
            MV +RFHQYQVVGRALP+  DEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQV
Sbjct  1    MVAHRFHQYQVVGRALPTPGDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQV  60

Query  262  LAINEIFEKCPTXVKNYGIWLRYQSRTGYHNMYKEFRDTTLNGAVEQMYTEMASR  426
            LAINEIFE+ PT +KNYGIWLRYQSRTGYHNMYKE+RDTTLNGAVEQMY EMASR
Sbjct  61   LAINEIFERNPTTIKNYGIWLRYQSRTGYHNMYKEYRDTTLNGAVEQMYNEMASR  115



>ref|NP_001152227.1| 60S ribosomal protein L18a [Zea mays]
 gb|ACG46491.1| 60S ribosomal protein L18a [Zea mays]
 gb|AFW83498.1| 60S ribosomal protein L18a [Zea mays]
Length=178

 Score =   224 bits (572),  Expect = 9e-72, Method: Compositional matrix adjust.
 Identities = 104/115 (90%), Positives = 109/115 (95%), Gaps = 0/115 (0%)
 Frame = +1

Query  82   MVTYRFHQYQVVGRALPSETDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQV  261
            MV +RFHQYQVVGRALP+  DEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQV
Sbjct  1    MVAFRFHQYQVVGRALPTPGDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQV  60

Query  262  LAINEIFEKCPTXVKNYGIWLRYQSRTGYHNMYKEFRDTTLNGAVEQMYTEMASR  426
            LAINEIFE+ PT +KNYGIWLRYQSRTGYHNMYKE+RDTTLNGAVEQMY EMASR
Sbjct  61   LAINEIFERNPTTIKNYGIWLRYQSRTGYHNMYKEYRDTTLNGAVEQMYNEMASR  115



>ref|XP_009399317.1| PREDICTED: 60S ribosomal protein L18a-like [Musa acuminata subsp. 
malaccensis]
Length=178

 Score =   224 bits (571),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 103/115 (90%), Positives = 110/115 (96%), Gaps = 0/115 (0%)
 Frame = +1

Query  82   MVTYRFHQYQVVGRALPSETDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQV  261
            M  +RFHQYQVVGRALP+ET+EHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQV
Sbjct  1    MGNFRFHQYQVVGRALPTETEEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQV  60

Query  262  LAINEIFEKCPTXVKNYGIWLRYQSRTGYHNMYKEFRDTTLNGAVEQMYTEMASR  426
            LAINEIFE+ PT +KNYG+WLRYQSRTGYHNMYKE+RDTTLNGAVEQMY EMASR
Sbjct  61   LAINEIFERKPTKIKNYGVWLRYQSRTGYHNMYKEYRDTTLNGAVEQMYNEMASR  115



>ref|XP_002449311.1| hypothetical protein SORBIDRAFT_05g007540 [Sorghum bicolor]
 gb|EES08299.1| hypothetical protein SORBIDRAFT_05g007540 [Sorghum bicolor]
Length=178

 Score =   224 bits (571),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 103/115 (90%), Positives = 109/115 (95%), Gaps = 0/115 (0%)
 Frame = +1

Query  82   MVTYRFHQYQVVGRALPSETDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQV  261
            MV +RFHQYQVVGRALP+  DEHPKIYRMKLWATNEVR+KSKFWYFLRKLKKVKKSNGQV
Sbjct  1    MVAHRFHQYQVVGRALPTPADEHPKIYRMKLWATNEVRSKSKFWYFLRKLKKVKKSNGQV  60

Query  262  LAINEIFEKCPTXVKNYGIWLRYQSRTGYHNMYKEFRDTTLNGAVEQMYTEMASR  426
            LAINEIFE+ PT +KNYGIWLRYQSRTGYHNMYKE+RDTTLNGAVEQMY EMASR
Sbjct  61   LAINEIFERNPTTIKNYGIWLRYQSRTGYHNMYKEYRDTTLNGAVEQMYNEMASR  115



>emb|CDX75778.1| BnaC03g38610D [Brassica napus]
Length=258

 Score =   227 bits (578),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 105/116 (91%), Positives = 110/116 (95%), Gaps = 0/116 (0%)
 Frame = +1

Query  79   KMVTYRFHQYQVVGRALPSETDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQ  258
            +MV +RFHQYQVVGRALP+E D  PKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQ
Sbjct  80   EMVAFRFHQYQVVGRALPTEKDVQPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQ  139

Query  259  VLAINEIFEKCPTXVKNYGIWLRYQSRTGYHNMYKEFRDTTLNGAVEQMYTEMASR  426
            +LAINEIFEK PT +KNYGIWLRYQSRTGYHNMYKEFRDTTLNGAVEQMYTEMASR
Sbjct  140  MLAINEIFEKSPTKIKNYGIWLRYQSRTGYHNMYKEFRDTTLNGAVEQMYTEMASR  195



>ref|NP_001237207.1| uncharacterized protein LOC100527007 [Glycine max]
 gb|ACU16044.1| unknown [Glycine max]
Length=178

 Score =   224 bits (571),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 104/115 (90%), Positives = 109/115 (95%), Gaps = 0/115 (0%)
 Frame = +1

Query  82   MVTYRFHQYQVVGRALPSETDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQV  261
            MV  RFHQYQVVGRALP+E+DEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQV
Sbjct  1    MVAMRFHQYQVVGRALPTESDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQV  60

Query  262  LAINEIFEKCPTXVKNYGIWLRYQSRTGYHNMYKEFRDTTLNGAVEQMYTEMASR  426
            LAINEIFE+ PT +KN GIWLRYQSRTGYHNMYKE+RDTTLNGAVE MYTEMASR
Sbjct  61   LAINEIFERNPTKIKNCGIWLRYQSRTGYHNMYKEYRDTTLNGAVEHMYTEMASR  115



>ref|XP_008380196.1| PREDICTED: 60S ribosomal protein L18a-2-like [Malus domestica]
 ref|XP_008342343.1| PREDICTED: 60S ribosomal protein L18a-2-like [Malus domestica]
 ref|XP_009377204.1| PREDICTED: 60S ribosomal protein L18a-2-like [Pyrus x bretschneideri]
 ref|XP_009356606.1| PREDICTED: 60S ribosomal protein L18a-2-like [Pyrus x bretschneideri]
Length=178

 Score =   224 bits (570),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 104/115 (90%), Positives = 109/115 (95%), Gaps = 0/115 (0%)
 Frame = +1

Query  82   MVTYRFHQYQVVGRALPSETDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQV  261
            M  +RFHQYQVVGRALP+E DEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQV
Sbjct  1    MGVFRFHQYQVVGRALPTEKDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQV  60

Query  262  LAINEIFEKCPTXVKNYGIWLRYQSRTGYHNMYKEFRDTTLNGAVEQMYTEMASR  426
            LAINEIFEK PT +KNYGIWLRYQSRTGYHNMYKE+RDTTLNGAVE MYTE+ASR
Sbjct  61   LAINEIFEKYPTTIKNYGIWLRYQSRTGYHNMYKEYRDTTLNGAVEAMYTELASR  115



>ref|XP_010918885.1| PREDICTED: 60S ribosomal protein L18a-like [Elaeis guineensis]
Length=178

 Score =   224 bits (570),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 103/115 (90%), Positives = 107/115 (93%), Gaps = 0/115 (0%)
 Frame = +1

Query  82   MVTYRFHQYQVVGRALPSETDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQV  261
            MV +RFHQYQVVGRALPS TDEHP+IYRMKLW TNEVRAKSKFWYFLRKLKKVKKSNGQV
Sbjct  1    MVAFRFHQYQVVGRALPSPTDEHPRIYRMKLWTTNEVRAKSKFWYFLRKLKKVKKSNGQV  60

Query  262  LAINEIFEKCPTXVKNYGIWLRYQSRTGYHNMYKEFRDTTLNGAVEQMYTEMASR  426
            LAINEIFE+ PT +KNYGIWLRYQSRTGYHNMYKEFRDT LNGAVE MY EMASR
Sbjct  61   LAINEIFERKPTKIKNYGIWLRYQSRTGYHNMYKEFRDTALNGAVEHMYNEMASR  115



>ref|XP_004488610.1| PREDICTED: 60S ribosomal protein L18a-like isoform X2 [Cicer 
arietinum]
Length=178

 Score =   224 bits (570),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 104/115 (90%), Positives = 109/115 (95%), Gaps = 0/115 (0%)
 Frame = +1

Query  82   MVTYRFHQYQVVGRALPSETDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQV  261
            MV  +FHQYQVVGRALP+ET+EHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQV
Sbjct  1    MVNMKFHQYQVVGRALPTETEEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQV  60

Query  262  LAINEIFEKCPTXVKNYGIWLRYQSRTGYHNMYKEFRDTTLNGAVEQMYTEMASR  426
            LAINEIFEK PT +KNYGIWLRYQSRTGYHNMYKE+RDTTLNGAVE MY EMASR
Sbjct  61   LAINEIFEKNPTKIKNYGIWLRYQSRTGYHNMYKEYRDTTLNGAVETMYNEMASR  115



>gb|EMS54441.1| 60S ribosomal protein L18a [Triticum urartu]
Length=178

 Score =   223 bits (569),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 104/115 (90%), Positives = 109/115 (95%), Gaps = 0/115 (0%)
 Frame = +1

Query  82   MVTYRFHQYQVVGRALPSETDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQV  261
            MV +RFHQYQVVGRALP+  DE PKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQ+
Sbjct  1    MVAFRFHQYQVVGRALPTPGDEQPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQM  60

Query  262  LAINEIFEKCPTXVKNYGIWLRYQSRTGYHNMYKEFRDTTLNGAVEQMYTEMASR  426
            LAINEIFEK PT +KNYGIWLRYQSRTGYHNMYKE+RDTTLNGAVEQMYTEMASR
Sbjct  61   LAINEIFEKNPTTIKNYGIWLRYQSRTGYHNMYKEYRDTTLNGAVEQMYTEMASR  115



>gb|EMT07340.1| 60S ribosomal protein L18a [Aegilops tauschii]
Length=178

 Score =   223 bits (569),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 104/115 (90%), Positives = 109/115 (95%), Gaps = 0/115 (0%)
 Frame = +1

Query  82   MVTYRFHQYQVVGRALPSETDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQV  261
            MV +RFHQYQVVGRALP+  DE PKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQ+
Sbjct  1    MVAFRFHQYQVVGRALPTPGDEQPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQM  60

Query  262  LAINEIFEKCPTXVKNYGIWLRYQSRTGYHNMYKEFRDTTLNGAVEQMYTEMASR  426
            LAINEIFEK PT +KNYGIWLRYQSRTGYHNMYKE+RDTTLNGAVEQMYTEMASR
Sbjct  61   LAINEIFEKNPTTIKNYGIWLRYQSRTGYHNMYKEYRDTTLNGAVEQMYTEMASR  115



>gb|ABK26330.1| unknown [Picea sitchensis]
 gb|ABR16921.1| unknown [Picea sitchensis]
 gb|ABR17139.1| unknown [Picea sitchensis]
Length=178

 Score =   223 bits (569),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 101/115 (88%), Positives = 110/115 (96%), Gaps = 0/115 (0%)
 Frame = +1

Query  82   MVTYRFHQYQVVGRALPSETDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQV  261
            MV +RFHQYQVVGR+LP+ TDEHPKI+RMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQ+
Sbjct  1    MVNFRFHQYQVVGRSLPTPTDEHPKIFRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQI  60

Query  262  LAINEIFEKCPTXVKNYGIWLRYQSRTGYHNMYKEFRDTTLNGAVEQMYTEMASR  426
            LAINEIFEK PT +KN+GIWLRYQSRTGYHNMYKE+RDTTLNGAV+QMY EMASR
Sbjct  61   LAINEIFEKNPTTIKNFGIWLRYQSRTGYHNMYKEYRDTTLNGAVQQMYDEMASR  115



>ref|XP_003597433.1| 60S ribosomal protein L18a [Medicago truncatula]
 ref|XP_003617397.1| 60S ribosomal protein L18a [Medicago truncatula]
 gb|ACJ84852.1| unknown [Medicago truncatula]
 gb|AES67684.1| 60S ribosomal protein L18a-3 [Medicago truncatula]
 gb|AET00356.1| 60S ribosomal protein L18a-3 [Medicago truncatula]
 gb|AFK39885.1| unknown [Medicago truncatula]
 gb|AFK41441.1| unknown [Medicago truncatula]
 gb|AFK43765.1| unknown [Medicago truncatula]
 gb|AFK46613.1| unknown [Medicago truncatula]
 gb|KEH28400.1| 60S ribosomal protein L18a-3 [Medicago truncatula]
Length=178

 Score =   223 bits (568),  Expect = 4e-71, Method: Compositional matrix adjust.
 Identities = 104/115 (90%), Positives = 108/115 (94%), Gaps = 0/115 (0%)
 Frame = +1

Query  82   MVTYRFHQYQVVGRALPSETDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQV  261
            MV  +FHQYQVVGRALP+E DEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQV
Sbjct  1    MVNAKFHQYQVVGRALPTEKDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQV  60

Query  262  LAINEIFEKCPTXVKNYGIWLRYQSRTGYHNMYKEFRDTTLNGAVEQMYTEMASR  426
            LAINEIFEK PT +KNYGIWLRYQSRTGYHNMYKE+RDTTLNGAVE MY EMASR
Sbjct  61   LAINEIFEKNPTKIKNYGIWLRYQSRTGYHNMYKEYRDTTLNGAVETMYNEMASR  115



>ref|XP_008796386.1| PREDICTED: 60S ribosomal protein L18a-like [Phoenix dactylifera]
Length=178

 Score =   223 bits (568),  Expect = 4e-71, Method: Compositional matrix adjust.
 Identities = 103/115 (90%), Positives = 109/115 (95%), Gaps = 0/115 (0%)
 Frame = +1

Query  82   MVTYRFHQYQVVGRALPSETDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQV  261
            M  +RFHQYQVVGRALP+ +DEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQV
Sbjct  1    MGNFRFHQYQVVGRALPTPSDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQV  60

Query  262  LAINEIFEKCPTXVKNYGIWLRYQSRTGYHNMYKEFRDTTLNGAVEQMYTEMASR  426
            LAINEIFE+ PT +KNYGIWLRYQSRTGYHNMYKE+RDTTLNGAVEQMY EMASR
Sbjct  61   LAINEIFERKPTKIKNYGIWLRYQSRTGYHNMYKEYRDTTLNGAVEQMYNEMASR  115



>ref|XP_006407062.1| hypothetical protein EUTSA_v10021546mg [Eutrema salsugineum]
 gb|ESQ48515.1| hypothetical protein EUTSA_v10021546mg [Eutrema salsugineum]
Length=178

 Score =   223 bits (568),  Expect = 4e-71, Method: Compositional matrix adjust.
 Identities = 104/115 (90%), Positives = 108/115 (94%), Gaps = 0/115 (0%)
 Frame = +1

Query  82   MVTYRFHQYQVVGRALPSETDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQV  261
            MV +RFHQYQVVGRALP+E D  PKIYRMKLWATNEVRA SKFWYFLRKLKKVKKSNGQ+
Sbjct  1    MVAFRFHQYQVVGRALPTEKDVQPKIYRMKLWATNEVRAMSKFWYFLRKLKKVKKSNGQM  60

Query  262  LAINEIFEKCPTXVKNYGIWLRYQSRTGYHNMYKEFRDTTLNGAVEQMYTEMASR  426
            LAINEIFEK PT +KNYGIWLRYQSRTGYHNMYKEFRDTTLNGAVEQMYTEMASR
Sbjct  61   LAINEIFEKNPTTIKNYGIWLRYQSRTGYHNMYKEFRDTTLNGAVEQMYTEMASR  115



>ref|XP_009407842.1| PREDICTED: 60S ribosomal protein L18a-like [Musa acuminata subsp. 
malaccensis]
Length=178

 Score =   223 bits (568),  Expect = 4e-71, Method: Compositional matrix adjust.
 Identities = 103/115 (90%), Positives = 109/115 (95%), Gaps = 0/115 (0%)
 Frame = +1

Query  82   MVTYRFHQYQVVGRALPSETDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQV  261
            M  +RFHQYQVVGRALP+ TDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQV
Sbjct  1    MGNFRFHQYQVVGRALPTATDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQV  60

Query  262  LAINEIFEKCPTXVKNYGIWLRYQSRTGYHNMYKEFRDTTLNGAVEQMYTEMASR  426
            LAINEIFE+ PT +KNYGIWLRYQSRTGYHNMYKE+RDTTLNG+VEQMY EMASR
Sbjct  61   LAINEIFERKPTKIKNYGIWLRYQSRTGYHNMYKEYRDTTLNGSVEQMYNEMASR  115



>ref|XP_003567891.1| PREDICTED: 60S ribosomal protein L18a-like [Brachypodium distachyon]
Length=178

 Score =   223 bits (568),  Expect = 4e-71, Method: Compositional matrix adjust.
 Identities = 104/115 (90%), Positives = 109/115 (95%), Gaps = 0/115 (0%)
 Frame = +1

Query  82   MVTYRFHQYQVVGRALPSETDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQV  261
            MV +RFHQYQVVGRALP+  DE PKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQ+
Sbjct  1    MVAHRFHQYQVVGRALPTPGDEQPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQM  60

Query  262  LAINEIFEKCPTXVKNYGIWLRYQSRTGYHNMYKEFRDTTLNGAVEQMYTEMASR  426
            LAINEIFEK PT +KNYGIWLRYQSRTGYHNMYKE+RDTTLNGAVEQMYTEMASR
Sbjct  61   LAINEIFEKNPTTIKNYGIWLRYQSRTGYHNMYKEYRDTTLNGAVEQMYTEMASR  115



>ref|XP_008789456.1| PREDICTED: 60S ribosomal protein L18a-2 [Phoenix dactylifera]
Length=178

 Score =   223 bits (568),  Expect = 5e-71, Method: Compositional matrix adjust.
 Identities = 103/115 (90%), Positives = 109/115 (95%), Gaps = 0/115 (0%)
 Frame = +1

Query  82   MVTYRFHQYQVVGRALPSETDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQV  261
            M  +RFHQYQVVGRALP+ +DEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQV
Sbjct  1    MGNFRFHQYQVVGRALPTPSDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQV  60

Query  262  LAINEIFEKCPTXVKNYGIWLRYQSRTGYHNMYKEFRDTTLNGAVEQMYTEMASR  426
            LAINEIFE+ PT +KNYGIWLRYQSRTGYHNMYKE+RDTTLNGAVEQMY EMASR
Sbjct  61   LAINEIFERKPTKIKNYGIWLRYQSRTGYHNMYKEYRDTTLNGAVEQMYNEMASR  115



>gb|AFK40398.1| unknown [Medicago truncatula]
 gb|KEH33553.1| 60S ribosomal protein L18a-3 [Medicago truncatula]
Length=178

 Score =   223 bits (567),  Expect = 5e-71, Method: Compositional matrix adjust.
 Identities = 103/115 (90%), Positives = 109/115 (95%), Gaps = 0/115 (0%)
 Frame = +1

Query  82   MVTYRFHQYQVVGRALPSETDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQV  261
            M T+++HQYQVVGRALP+E DEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQV
Sbjct  1    MATFKYHQYQVVGRALPTEKDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQV  60

Query  262  LAINEIFEKCPTXVKNYGIWLRYQSRTGYHNMYKEFRDTTLNGAVEQMYTEMASR  426
            LAINEIFEK PT +KNYGIWLRYQSRTGYHNMYKE+RDTTLNGAVE MY EMASR
Sbjct  61   LAINEIFEKNPTKIKNYGIWLRYQSRTGYHNMYKEYRDTTLNGAVEYMYNEMASR  115



>gb|ACF78859.1| unknown [Zea mays]
Length=178

 Score =   223 bits (567),  Expect = 5e-71, Method: Compositional matrix adjust.
 Identities = 103/115 (90%), Positives = 108/115 (94%), Gaps = 0/115 (0%)
 Frame = +1

Query  82   MVTYRFHQYQVVGRALPSETDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQV  261
            MV +RFHQYQVVGRALP+  DEHPKIYRMKLWATNEVRAKSKFWYFLR LKKVKKSNGQV
Sbjct  1    MVAFRFHQYQVVGRALPTPGDEHPKIYRMKLWATNEVRAKSKFWYFLRNLKKVKKSNGQV  60

Query  262  LAINEIFEKCPTXVKNYGIWLRYQSRTGYHNMYKEFRDTTLNGAVEQMYTEMASR  426
            LAINEIFE+ PT +KNYGIWLRYQSRTGYHNMYKE+RDTTLNGAVEQMY EMASR
Sbjct  61   LAINEIFERNPTTIKNYGIWLRYQSRTGYHNMYKEYRDTTLNGAVEQMYNEMASR  115



>ref|XP_007212144.1| hypothetical protein PRUPE_ppa012251mg [Prunus persica]
 ref|XP_008225467.1| PREDICTED: 60S ribosomal protein L18a-2 isoform X1 [Prunus mume]
 gb|EMJ13343.1| hypothetical protein PRUPE_ppa012251mg [Prunus persica]
Length=178

 Score =   223 bits (567),  Expect = 5e-71, Method: Compositional matrix adjust.
 Identities = 103/115 (90%), Positives = 109/115 (95%), Gaps = 0/115 (0%)
 Frame = +1

Query  82   MVTYRFHQYQVVGRALPSETDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQV  261
            M T++FHQYQVVGR LP+ +DEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQV
Sbjct  1    MGTFKFHQYQVVGRKLPTASDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQV  60

Query  262  LAINEIFEKCPTXVKNYGIWLRYQSRTGYHNMYKEFRDTTLNGAVEQMYTEMASR  426
            LAINEIFEK PT +KNYGIWLRYQSRTGYHNMYKE+RDTTLNGAVEQMY EMASR
Sbjct  61   LAINEIFEKNPTTIKNYGIWLRYQSRTGYHNMYKEYRDTTLNGAVEQMYIEMASR  115



>ref|XP_003569521.1| PREDICTED: 60S ribosomal protein L18a-like [Brachypodium distachyon]
Length=178

 Score =   222 bits (566),  Expect = 7e-71, Method: Compositional matrix adjust.
 Identities = 103/115 (90%), Positives = 109/115 (95%), Gaps = 0/115 (0%)
 Frame = +1

Query  82   MVTYRFHQYQVVGRALPSETDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQV  261
            MV +RFHQYQVVGRALP+  DE PKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQ+
Sbjct  1    MVAFRFHQYQVVGRALPTPGDEQPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQM  60

Query  262  LAINEIFEKCPTXVKNYGIWLRYQSRTGYHNMYKEFRDTTLNGAVEQMYTEMASR  426
            LAINEIFEK PT +KN+GIWLRYQSRTGYHNMYKE+RDTTLNGAVEQMYTEMASR
Sbjct  61   LAINEIFEKNPTTIKNFGIWLRYQSRTGYHNMYKEYRDTTLNGAVEQMYTEMASR  115



>emb|CDX79564.1| BnaC03g19000D [Brassica napus]
Length=178

 Score =   222 bits (566),  Expect = 8e-71, Method: Compositional matrix adjust.
 Identities = 103/115 (90%), Positives = 109/115 (95%), Gaps = 0/115 (0%)
 Frame = +1

Query  82   MVTYRFHQYQVVGRALPSETDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQV  261
            MV +RFHQYQVVGRALP+E D  PKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQ+
Sbjct  1    MVAFRFHQYQVVGRALPTEKDVQPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQM  60

Query  262  LAINEIFEKCPTXVKNYGIWLRYQSRTGYHNMYKEFRDTTLNGAVEQMYTEMASR  426
            LAINEIFEK PT +KN+GIWLRYQSRTGYHNMYKE+RDTTLNGAVEQMYTEMASR
Sbjct  61   LAINEIFEKNPTNIKNFGIWLRYQSRTGYHNMYKEYRDTTLNGAVEQMYTEMASR  115



>ref|XP_008465452.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 2 [Cucumis 
melo]
Length=751

 Score =   237 bits (605),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 109/116 (94%), Positives = 114/116 (98%), Gaps = 0/116 (0%)
 Frame = +1

Query  79   KMVTYRFHQYQVVGRALPSETDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQ  258
            KMVT+RFHQYQVVGRALPSE+DEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQ
Sbjct  573  KMVTFRFHQYQVVGRALPSESDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQ  632

Query  259  VLAINEIFEKCPTXVKNYGIWLRYQSRTGYHNMYKEFRDTTLNGAVEQMYTEMASR  426
            +LAINEIFEK PT +KNYGIWLRYQSRTGYHNMYKE+RDTTLNGAVEQMYTEMASR
Sbjct  633  ILAINEIFEKNPTKIKNYGIWLRYQSRTGYHNMYKEYRDTTLNGAVEQMYTEMASR  688



>ref|XP_009135390.1| PREDICTED: 60S ribosomal protein L18a-2-like [Brassica rapa]
Length=178

 Score =   222 bits (565),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 103/115 (90%), Positives = 108/115 (94%), Gaps = 0/115 (0%)
 Frame = +1

Query  82   MVTYRFHQYQVVGRALPSETDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQV  261
            M  +RFHQYQVVGRALP+E D  PKIYRMKLWA+NEVRAKSKFWYFLRKLKKVKKSNGQ+
Sbjct  1    MGAFRFHQYQVVGRALPTEKDVQPKIYRMKLWASNEVRAKSKFWYFLRKLKKVKKSNGQM  60

Query  262  LAINEIFEKCPTXVKNYGIWLRYQSRTGYHNMYKEFRDTTLNGAVEQMYTEMASR  426
            LAINEIFEK PT +KNYGIWLRYQSRTGYHNMYKEFRDTTLNGAVEQMYTEMASR
Sbjct  61   LAINEIFEKSPTKIKNYGIWLRYQSRTGYHNMYKEFRDTTLNGAVEQMYTEMASR  115



>ref|XP_004166596.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 1-like [Cucumis 
sativus]
Length=752

 Score =   237 bits (604),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 109/116 (94%), Positives = 114/116 (98%), Gaps = 0/116 (0%)
 Frame = +1

Query  79   KMVTYRFHQYQVVGRALPSETDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQ  258
            KMVT+RFHQYQVVGRALPSE+DEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQ
Sbjct  574  KMVTFRFHQYQVVGRALPSESDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQ  633

Query  259  VLAINEIFEKCPTXVKNYGIWLRYQSRTGYHNMYKEFRDTTLNGAVEQMYTEMASR  426
            +LAINEIFEK PT +KNYGIWLRYQSRTGYHNMYKE+RDTTLNGAVEQMYTEMASR
Sbjct  634  ILAINEIFEKNPTKIKNYGIWLRYQSRTGYHNMYKEYRDTTLNGAVEQMYTEMASR  689



>ref|XP_008371596.1| PREDICTED: 60S ribosomal protein L18a-2 isoform X1 [Malus domestica]
 ref|XP_008383489.1| PREDICTED: 60S ribosomal protein L18a-2 [Malus domestica]
 ref|XP_009360875.1| PREDICTED: 60S ribosomal protein L18a-2 isoform X1 [Pyrus x bretschneideri]
Length=178

 Score =   221 bits (564),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 103/115 (90%), Positives = 108/115 (94%), Gaps = 0/115 (0%)
 Frame = +1

Query  82   MVTYRFHQYQVVGRALPSETDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQV  261
            M  ++FHQYQVVGR LP+ETDE PKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQV
Sbjct  1    MGVFKFHQYQVVGRKLPTETDEQPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQV  60

Query  262  LAINEIFEKCPTXVKNYGIWLRYQSRTGYHNMYKEFRDTTLNGAVEQMYTEMASR  426
            LAINEIFEK PT +KNYGIWLRYQSRTGYHNMYKE+RDTTLNGAVEQMY EMASR
Sbjct  61   LAINEIFEKNPTTIKNYGIWLRYQSRTGYHNMYKEYRDTTLNGAVEQMYIEMASR  115



>ref|XP_010679799.1| PREDICTED: 60S ribosomal protein L18a-2 [Beta vulgaris subsp. 
vulgaris]
Length=178

 Score =   221 bits (563),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 103/115 (90%), Positives = 109/115 (95%), Gaps = 0/115 (0%)
 Frame = +1

Query  82   MVTYRFHQYQVVGRALPSETDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQV  261
            M  +RFHQYQVVGRALP+E+D HPKIYRMKLWATN+VRAKSKFWYFLRKLKKVKKS GQV
Sbjct  1    MGQFRFHQYQVVGRALPTESDAHPKIYRMKLWATNDVRAKSKFWYFLRKLKKVKKSVGQV  60

Query  262  LAINEIFEKCPTXVKNYGIWLRYQSRTGYHNMYKEFRDTTLNGAVEQMYTEMASR  426
            LAINEI+EK PT +KNYGIWLRYQSRTGYHNMYKEFRDTTLNGAVEQMYTEMASR
Sbjct  61   LAINEIYEKNPTLIKNYGIWLRYQSRTGYHNMYKEFRDTTLNGAVEQMYTEMASR  115



>ref|XP_009132991.1| PREDICTED: 60S ribosomal protein L18a-2-like [Brassica rapa]
Length=178

 Score =   221 bits (563),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 103/115 (90%), Positives = 108/115 (94%), Gaps = 0/115 (0%)
 Frame = +1

Query  82   MVTYRFHQYQVVGRALPSETDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQV  261
            MV +RFHQYQVVGRALP+E D  PKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQ+
Sbjct  1    MVAFRFHQYQVVGRALPTEKDVQPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQM  60

Query  262  LAINEIFEKCPTXVKNYGIWLRYQSRTGYHNMYKEFRDTTLNGAVEQMYTEMASR  426
            LAINEIFEK PT +KN+GIWLRYQSRTGYHNMYKE RDTTLNGAVEQMYTEMASR
Sbjct  61   LAINEIFEKNPTTIKNFGIWLRYQSRTGYHNMYKESRDTTLNGAVEQMYTEMASR  115



>ref|XP_002276545.1| PREDICTED: 60S ribosomal protein L18a isoform X2 [Vitis vinifera]
Length=299

 Score =   225 bits (573),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 108/124 (87%), Positives = 113/124 (91%), Gaps = 2/124 (2%)
 Frame = +1

Query  55   QEDGSVVAKMVTYRFHQYQVVGRALPSETDEHPKIYRMKLWATNEVRAKSKFWYFLRKLK  234
            +E   ++A   T  FHQYQVVGRALPSETDEHPKIYRMKLWATNEVRAKSKFWYFLRKLK
Sbjct  115  REKPGLIA--CTIAFHQYQVVGRALPSETDEHPKIYRMKLWATNEVRAKSKFWYFLRKLK  172

Query  235  KVKKSNGQVLAINEIFEKCPTXVKNYGIWLRYQSRTGYHNMYKEFRDTTLNGAVEQMYTE  414
            KVKKSNGQVLAINEIFEK PT +KNYGIWLRYQSRTGYHNMYKE+RDTTLNGAVEQMY E
Sbjct  173  KVKKSNGQVLAINEIFEKNPTTIKNYGIWLRYQSRTGYHNMYKEYRDTTLNGAVEQMYAE  232

Query  415  MASR  426
            MASR
Sbjct  233  MASR  236



>ref|XP_009146339.1| PREDICTED: 60S ribosomal protein L18a-2 [Brassica rapa]
Length=178

 Score =   221 bits (562),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 103/115 (90%), Positives = 108/115 (94%), Gaps = 0/115 (0%)
 Frame = +1

Query  82   MVTYRFHQYQVVGRALPSETDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQV  261
            MV + FHQYQVVGRALP+E D  PKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQ+
Sbjct  1    MVAFGFHQYQVVGRALPTEKDVQPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQM  60

Query  262  LAINEIFEKCPTXVKNYGIWLRYQSRTGYHNMYKEFRDTTLNGAVEQMYTEMASR  426
            LAINEIFEK PT +KNYGIWLRYQSRTGYHNMYKEFRDTTLNG+VEQMYTEMASR
Sbjct  61   LAINEIFEKNPTKIKNYGIWLRYQSRTGYHNMYKEFRDTTLNGSVEQMYTEMASR  115



>ref|XP_008229704.1| PREDICTED: uncharacterized protein LOC103329046 [Prunus mume]
Length=776

 Score =   236 bits (602),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 109/120 (91%), Positives = 114/120 (95%), Gaps = 0/120 (0%)
 Frame = +1

Query  67   SVVAKMVTYRFHQYQVVGRALPSETDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKK  246
            S  ++MVT+RFHQYQVVGRALPSE DEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKK
Sbjct  594  SPTSQMVTFRFHQYQVVGRALPSEKDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKK  653

Query  247  SNGQVLAINEIFEKCPTXVKNYGIWLRYQSRTGYHNMYKEFRDTTLNGAVEQMYTEMASR  426
            SNGQVLAINEIFEK PT +KNYGIWLRYQSRTGYHNMYKE+RDTTLNGAVE MYTEMASR
Sbjct  654  SNGQVLAINEIFEKSPTTIKNYGIWLRYQSRTGYHNMYKEYRDTTLNGAVEDMYTEMASR  713



>ref|XP_004488609.1| PREDICTED: 60S ribosomal protein L18a-like isoform X1 [Cicer 
arietinum]
Length=182

 Score =   220 bits (561),  Expect = 5e-70, Method: Compositional matrix adjust.
 Identities = 102/116 (88%), Positives = 110/116 (95%), Gaps = 0/116 (0%)
 Frame = +1

Query  79   KMVTYRFHQYQVVGRALPSETDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQ  258
            +++  +FHQYQVVGRALP+ET+EHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQ
Sbjct  4    RLLLKQFHQYQVVGRALPTETEEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQ  63

Query  259  VLAINEIFEKCPTXVKNYGIWLRYQSRTGYHNMYKEFRDTTLNGAVEQMYTEMASR  426
            VLAINEIFEK PT +KNYGIWLRYQSRTGYHNMYKE+RDTTLNGAVE MY EMASR
Sbjct  64   VLAINEIFEKNPTKIKNYGIWLRYQSRTGYHNMYKEYRDTTLNGAVETMYNEMASR  119



>ref|XP_006298665.1| hypothetical protein CARUB_v10014756mg [Capsella rubella]
 gb|EOA31563.1| hypothetical protein CARUB_v10014756mg [Capsella rubella]
Length=178

 Score =   220 bits (561),  Expect = 5e-70, Method: Compositional matrix adjust.
 Identities = 102/115 (89%), Positives = 108/115 (94%), Gaps = 0/115 (0%)
 Frame = +1

Query  82   MVTYRFHQYQVVGRALPSETDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQV  261
            M  +RFHQYQVVGRALP+E DEHPKIYRMKLW TNEV AKSKFWYF+RKLKKVKKSNGQ+
Sbjct  1    MGAFRFHQYQVVGRALPTEKDEHPKIYRMKLWGTNEVCAKSKFWYFMRKLKKVKKSNGQM  60

Query  262  LAINEIFEKCPTXVKNYGIWLRYQSRTGYHNMYKEFRDTTLNGAVEQMYTEMASR  426
            LAINEIFEK PT +KNYGIWLRYQSRTGYHNMYKE+RDTTLNGAVEQMYTEMASR
Sbjct  61   LAINEIFEKNPTTIKNYGIWLRYQSRTGYHNMYKEYRDTTLNGAVEQMYTEMASR  115



>ref|XP_003569823.1| PREDICTED: 60S ribosomal protein L18a [Brachypodium distachyon]
Length=178

 Score =   220 bits (560),  Expect = 6e-70, Method: Compositional matrix adjust.
 Identities = 101/115 (88%), Positives = 108/115 (94%), Gaps = 0/115 (0%)
 Frame = +1

Query  82   MVTYRFHQYQVVGRALPSETDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQV  261
            MV +RFHQYQVVGR LP+ T+E PKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQ+
Sbjct  1    MVAFRFHQYQVVGRGLPTPTEEKPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQI  60

Query  262  LAINEIFEKCPTXVKNYGIWLRYQSRTGYHNMYKEFRDTTLNGAVEQMYTEMASR  426
            LA NEIFEK PT +KN+GIWLRYQSRTGYHNMYKE+RDTTLNGAVEQMYTEMASR
Sbjct  61   LAFNEIFEKNPTTIKNFGIWLRYQSRTGYHNMYKEYRDTTLNGAVEQMYTEMASR  115



>gb|EMT24993.1| 60S ribosomal protein L18a [Aegilops tauschii]
Length=178

 Score =   220 bits (560),  Expect = 7e-70, Method: Compositional matrix adjust.
 Identities = 102/115 (89%), Positives = 108/115 (94%), Gaps = 0/115 (0%)
 Frame = +1

Query  82   MVTYRFHQYQVVGRALPSETDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQV  261
            MV +RFHQYQVVGRALP+  DE PKIYRMKLWATNEVRAKSKFWYFLRKLKKVKK+NGQ+
Sbjct  1    MVAHRFHQYQVVGRALPTPGDEQPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKANGQM  60

Query  262  LAINEIFEKCPTXVKNYGIWLRYQSRTGYHNMYKEFRDTTLNGAVEQMYTEMASR  426
            LAINEIFEK PT +KNYGIWLRYQSRTGYHNMYKE+RDTTLNG VEQMYTEMASR
Sbjct  61   LAINEIFEKNPTTIKNYGIWLRYQSRTGYHNMYKEYRDTTLNGGVEQMYTEMASR  115



>dbj|BAJ85943.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=178

 Score =   220 bits (560),  Expect = 7e-70, Method: Compositional matrix adjust.
 Identities = 102/115 (89%), Positives = 108/115 (94%), Gaps = 0/115 (0%)
 Frame = +1

Query  82   MVTYRFHQYQVVGRALPSETDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQV  261
            MV +RFHQYQVVGRALP+  DE PKIYRMKLWATNEVRAKSKFWYFLRKLKKVKK+NGQ+
Sbjct  1    MVAHRFHQYQVVGRALPTPGDEQPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKANGQM  60

Query  262  LAINEIFEKCPTXVKNYGIWLRYQSRTGYHNMYKEFRDTTLNGAVEQMYTEMASR  426
            LAINEIFEK PT +KNYGIWLRYQSRTGYHNMYKE+RDTTLNG VEQMYTEMASR
Sbjct  61   LAINEIFEKNPTTIKNYGIWLRYQSRTGYHNMYKEYRDTTLNGGVEQMYTEMASR  115



>gb|KFK36339.1| hypothetical protein AALP_AA4G109800 [Arabis alpina]
Length=178

 Score =   219 bits (559),  Expect = 9e-70, Method: Compositional matrix adjust.
 Identities = 102/115 (89%), Positives = 108/115 (94%), Gaps = 0/115 (0%)
 Frame = +1

Query  82   MVTYRFHQYQVVGRALPSETDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQV  261
            M T+RFHQYQVVGRALP+E D  PKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQ+
Sbjct  1    MGTFRFHQYQVVGRALPTEKDVQPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQM  60

Query  262  LAINEIFEKCPTXVKNYGIWLRYQSRTGYHNMYKEFRDTTLNGAVEQMYTEMASR  426
            LAINEIFEK PT +KN+GIWLRYQSRTGYHNMYKE+RDTTLNG VEQMYTEMASR
Sbjct  61   LAINEIFEKNPTTIKNFGIWLRYQSRTGYHNMYKEYRDTTLNGGVEQMYTEMASR  115



>ref|XP_006295085.1| hypothetical protein CARUB_v10024156mg [Capsella rubella]
 gb|EOA27983.1| hypothetical protein CARUB_v10024156mg [Capsella rubella]
Length=178

 Score =   219 bits (559),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 102/115 (89%), Positives = 109/115 (95%), Gaps = 0/115 (0%)
 Frame = +1

Query  82   MVTYRFHQYQVVGRALPSETDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQV  261
            M T+RFHQYQVVGRALP+E D  PKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQ+
Sbjct  1    MGTFRFHQYQVVGRALPTEKDVQPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQM  60

Query  262  LAINEIFEKCPTXVKNYGIWLRYQSRTGYHNMYKEFRDTTLNGAVEQMYTEMASR  426
            LAINEI+EK PT +KN+GIWLRYQSRTGYHNMYKE+RDTTLNGAVEQMYTEMASR
Sbjct  61   LAINEIYEKNPTTIKNFGIWLRYQSRTGYHNMYKEYRDTTLNGAVEQMYTEMASR  115



>ref|XP_009141387.1| PREDICTED: 60S ribosomal protein L18a-2 [Brassica rapa]
 ref|XP_009143771.1| PREDICTED: 60S ribosomal protein L18a-2 [Brassica rapa]
Length=178

 Score =   219 bits (559),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 102/115 (89%), Positives = 108/115 (94%), Gaps = 0/115 (0%)
 Frame = +1

Query  82   MVTYRFHQYQVVGRALPSETDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQV  261
            M  +RFHQYQVVGRALP+E D  PKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQ+
Sbjct  1    MGAFRFHQYQVVGRALPTEKDVQPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQM  60

Query  262  LAINEIFEKCPTXVKNYGIWLRYQSRTGYHNMYKEFRDTTLNGAVEQMYTEMASR  426
            LAINEIFEK PT +KN+GIWLRYQSRTGYHNMYKE+RDTTLNGAVEQMYTEMASR
Sbjct  61   LAINEIFEKNPTTIKNFGIWLRYQSRTGYHNMYKEYRDTTLNGAVEQMYTEMASR  115



>gb|ACG47612.1| 60S ribosomal protein L18a [Zea mays]
Length=178

 Score =   219 bits (558),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 101/115 (88%), Positives = 107/115 (93%), Gaps = 0/115 (0%)
 Frame = +1

Query  82   MVTYRFHQYQVVGRALPSETDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQV  261
            MV +RFHQYQVVGRALP+ TDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQ+
Sbjct  1    MVAHRFHQYQVVGRALPTPTDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQM  60

Query  262  LAINEIFEKCPTXVKNYGIWLRYQSRTGYHNMYKEFRDTTLNGAVEQMYTEMASR  426
            LAINEIFE+ PT +KNYGIWLRYQSRTGYHNMYKE+RDTTLNG V QMY EM SR
Sbjct  61   LAINEIFERNPTTIKNYGIWLRYQSRTGYHNMYKEYRDTTLNGXVXQMYNEMXSR  115



>ref|XP_010542335.1| PREDICTED: 60S ribosomal protein L18a-2 isoform X3 [Tarenaya 
hassleriana]
Length=316

 Score =   223 bits (569),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 104/110 (95%), Positives = 108/110 (98%), Gaps = 0/110 (0%)
 Frame = +1

Query  97   FHQYQVVGRALPSETDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQVLAINE  276
            FHQYQVVGRALP+ETDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQ+LAINE
Sbjct  144  FHQYQVVGRALPTETDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQMLAINE  203

Query  277  IFEKCPTXVKNYGIWLRYQSRTGYHNMYKEFRDTTLNGAVEQMYTEMASR  426
            IFEK PT +KNYGIWLRYQSRTGYHNMYKE+RDTTLNGAVEQMYTEMASR
Sbjct  204  IFEKNPTKIKNYGIWLRYQSRTGYHNMYKEYRDTTLNGAVEQMYTEMASR  253



>ref|XP_010465351.1| PREDICTED: 60S ribosomal protein L18a-3 [Camelina sativa]
Length=178

 Score =   218 bits (555),  Expect = 4e-69, Method: Compositional matrix adjust.
 Identities = 101/115 (88%), Positives = 107/115 (93%), Gaps = 0/115 (0%)
 Frame = +1

Query  82   MVTYRFHQYQVVGRALPSETDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQV  261
            M  +RFHQYQVVGRALP+E DEHPKIYRMKLW  NEV AKSKFWYF+RKLKKVKKSNGQ+
Sbjct  1    MGVFRFHQYQVVGRALPTEKDEHPKIYRMKLWGKNEVCAKSKFWYFMRKLKKVKKSNGQM  60

Query  262  LAINEIFEKCPTXVKNYGIWLRYQSRTGYHNMYKEFRDTTLNGAVEQMYTEMASR  426
            LAINEIFEK PT +KNYGIWLRYQSRTGYHNMYKE+RDTTLNGAVEQMYTEMASR
Sbjct  61   LAINEIFEKNPTTIKNYGIWLRYQSRTGYHNMYKEYRDTTLNGAVEQMYTEMASR  115



>ref|XP_003617399.1| 60S ribosomal protein L18a [Medicago truncatula]
Length=749

 Score =   233 bits (593),  Expect = 4e-69, Method: Compositional matrix adjust.
 Identities = 109/125 (87%), Positives = 114/125 (91%), Gaps = 0/125 (0%)
 Frame = +1

Query  52   SQEDGSVVAKMVTYRFHQYQVVGRALPSETDEHPKIYRMKLWATNEVRAKSKFWYFLRKL  231
            SQ +   VAKMV  +FHQYQVVGRALP+E DEHPKIYRMKLWATNEVRAKSKFWYFLRKL
Sbjct  562  SQSESVFVAKMVNAKFHQYQVVGRALPTEKDEHPKIYRMKLWATNEVRAKSKFWYFLRKL  621

Query  232  KKVKKSNGQVLAINEIFEKCPTXVKNYGIWLRYQSRTGYHNMYKEFRDTTLNGAVEQMYT  411
            KKVKKSNGQVLAINEIFEK PT +KNYGIWLRYQSRTGYHNMYKE+RDTTLNGAVE MY 
Sbjct  622  KKVKKSNGQVLAINEIFEKNPTKIKNYGIWLRYQSRTGYHNMYKEYRDTTLNGAVETMYN  681

Query  412  EMASR  426
            EMASR
Sbjct  682  EMASR  686



>ref|XP_006601742.1| PREDICTED: uncharacterized protein LOC100306365 isoform X1 [Glycine 
max]
Length=184

 Score =   218 bits (555),  Expect = 4e-69, Method: Compositional matrix adjust.
 Identities = 101/111 (91%), Positives = 106/111 (95%), Gaps = 0/111 (0%)
 Frame = +1

Query  94   RFHQYQVVGRALPSETDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQVLAIN  273
            +FHQYQVVGRALP+ETD HPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQ+LAIN
Sbjct  11   QFHQYQVVGRALPTETDVHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQMLAIN  70

Query  274  EIFEKCPTXVKNYGIWLRYQSRTGYHNMYKEFRDTTLNGAVEQMYTEMASR  426
            EIFEK PT +KNYGIWLRYQSRTGYHNMYKE+RDTTLNGAVE MY EMASR
Sbjct  71   EIFEKNPTKIKNYGIWLRYQSRTGYHNMYKEYRDTTLNGAVEHMYNEMASR  121



>ref|NP_180995.1| 60S ribosomal protein L18a-2 [Arabidopsis thaliana]
 ref|XP_002881337.1| 60S ribosomal protein L18A [Arabidopsis lyrata subsp. lyrata]
 sp|P51418.2|R18A2_ARATH RecName: Full=60S ribosomal protein L18a-2 [Arabidopsis thaliana]
 gb|AAC26708.1| 60S ribosomal protein L18A [Arabidopsis thaliana]
 gb|AAK68743.1| Unknown protein [Arabidopsis thaliana]
 gb|AAM14956.1| 60S ribosomal protein L18A [Arabidopsis thaliana]
 gb|AAM53336.1| 60S ribosomal protein L18A [Arabidopsis thaliana]
 gb|AAN15395.1| 60S ribosomal protein L18A [Arabidopsis thaliana]
 gb|AAP21367.1| At2g34480 [Arabidopsis thaliana]
 gb|EFH57596.1| 60S ribosomal protein L18A [Arabidopsis lyrata subsp. lyrata]
 gb|AEC08980.1| 60S ribosomal protein L18a-2 [Arabidopsis thaliana]
Length=178

 Score =   218 bits (554),  Expect = 5e-69, Method: Compositional matrix adjust.
 Identities = 101/115 (88%), Positives = 108/115 (94%), Gaps = 0/115 (0%)
 Frame = +1

Query  82   MVTYRFHQYQVVGRALPSETDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQV  261
            M  +RFHQYQVVGRALP+E D  PKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQ+
Sbjct  1    MGAFRFHQYQVVGRALPTEKDVQPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQM  60

Query  262  LAINEIFEKCPTXVKNYGIWLRYQSRTGYHNMYKEFRDTTLNGAVEQMYTEMASR  426
            LAINEI+EK PT +KN+GIWLRYQSRTGYHNMYKE+RDTTLNGAVEQMYTEMASR
Sbjct  61   LAINEIYEKNPTTIKNFGIWLRYQSRTGYHNMYKEYRDTTLNGAVEQMYTEMASR  115



>ref|XP_011085620.1| PREDICTED: 60S ribosomal protein L18a-like [Sesamum indicum]
Length=175

 Score =   217 bits (553),  Expect = 6e-69, Method: Compositional matrix adjust.
 Identities = 103/115 (90%), Positives = 109/115 (95%), Gaps = 3/115 (3%)
 Frame = +1

Query  82   MVTYRFHQYQVVGRALPSETDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQV  261
            MVTYR   YQVVGR+LP+ET+EHPKIYRMKLWA NEVRAKSKFWYFLRKLKKVKKSNGQ+
Sbjct  1    MVTYR---YQVVGRSLPTETEEHPKIYRMKLWAPNEVRAKSKFWYFLRKLKKVKKSNGQI  57

Query  262  LAINEIFEKCPTXVKNYGIWLRYQSRTGYHNMYKEFRDTTLNGAVEQMYTEMASR  426
            LAINEIFEK PT +KNYGIWLRYQSRTGYHNMYKE+RDTTLNGAVEQMYTEMASR
Sbjct  58   LAINEIFEKNPTTIKNYGIWLRYQSRTGYHNMYKEYRDTTLNGAVEQMYTEMASR  112



>ref|XP_004303886.1| PREDICTED: 60S ribosomal protein L18a-2 isoform X2 [Fragaria 
vesca subsp. vesca]
Length=178

 Score =   217 bits (553),  Expect = 6e-69, Method: Compositional matrix adjust.
 Identities = 99/115 (86%), Positives = 107/115 (93%), Gaps = 0/115 (0%)
 Frame = +1

Query  82   MVTYRFHQYQVVGRALPSETDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQV  261
            M  +R+HQYQVVGRALP+E DEHPKI+RMKLW TNEVRAKSKFWYFLRKLKKVKKSNGQ+
Sbjct  1    MAPFRYHQYQVVGRALPTEKDEHPKIFRMKLWHTNEVRAKSKFWYFLRKLKKVKKSNGQI  60

Query  262  LAINEIFEKCPTXVKNYGIWLRYQSRTGYHNMYKEFRDTTLNGAVEQMYTEMASR  426
            LAINEIFEK PT + NYGIWLRYQSRTGYHNMYKE+R+TTLNGAVE MYTEMASR
Sbjct  61   LAINEIFEKNPTTINNYGIWLRYQSRTGYHNMYKEYRNTTLNGAVEDMYTEMASR  115



>gb|KEH33554.1| 60S ribosomal protein L18a-3 [Medicago truncatula]
Length=176

 Score =   217 bits (553),  Expect = 6e-69, Method: Compositional matrix adjust.
 Identities = 101/111 (91%), Positives = 106/111 (95%), Gaps = 0/111 (0%)
 Frame = +1

Query  94   RFHQYQVVGRALPSETDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQVLAIN  273
            ++HQYQVVGRALP+E DEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQVLAIN
Sbjct  3    QYHQYQVVGRALPTEKDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQVLAIN  62

Query  274  EIFEKCPTXVKNYGIWLRYQSRTGYHNMYKEFRDTTLNGAVEQMYTEMASR  426
            EIFEK PT +KNYGIWLRYQSRTGYHNMYKE+RDTTLNGAVE MY EMASR
Sbjct  63   EIFEKNPTKIKNYGIWLRYQSRTGYHNMYKEYRDTTLNGAVEYMYNEMASR  113



>ref|XP_006484924.1| PREDICTED: uncharacterized protein LOC102625748 [Citrus sinensis]
Length=820

 Score =   233 bits (594),  Expect = 7e-69, Method: Compositional matrix adjust.
 Identities = 107/118 (91%), Positives = 114/118 (97%), Gaps = 0/118 (0%)
 Frame = +1

Query  73   VAKMVTYRFHQYQVVGRALPSETDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSN  252
            ++ MVT+RFHQYQVVGRALP+ETDEHPKIYRMKLWATNEVRAKSKFWY+LRKLKKVKKSN
Sbjct  640  LSLMVTFRFHQYQVVGRALPTETDEHPKIYRMKLWATNEVRAKSKFWYYLRKLKKVKKSN  699

Query  253  GQVLAINEIFEKCPTXVKNYGIWLRYQSRTGYHNMYKEFRDTTLNGAVEQMYTEMASR  426
            GQVLAINEIFEK PT +KNYGIWLRYQSRTGYHNMYKE+RDTTLNGAVEQMY EMASR
Sbjct  700  GQVLAINEIFEKNPTKIKNYGIWLRYQSRTGYHNMYKEYRDTTLNGAVEQMYNEMASR  757



>ref|XP_010504908.1| PREDICTED: 60S ribosomal protein L18a-2 [Camelina sativa]
 ref|XP_010509745.1| PREDICTED: 60S ribosomal protein L18a-2 [Camelina sativa]
 ref|XP_010516589.1| PREDICTED: 60S ribosomal protein L18a-2 isoform X1 [Camelina 
sativa]
 ref|XP_010516590.1| PREDICTED: 60S ribosomal protein L18a-2 isoform X2 [Camelina 
sativa]
Length=178

 Score =   217 bits (553),  Expect = 8e-69, Method: Compositional matrix adjust.
 Identities = 101/115 (88%), Positives = 108/115 (94%), Gaps = 0/115 (0%)
 Frame = +1

Query  82   MVTYRFHQYQVVGRALPSETDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQV  261
            M  +RFHQYQVVGRALP+E D  PKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQ+
Sbjct  1    MGLFRFHQYQVVGRALPTEKDVQPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQM  60

Query  262  LAINEIFEKCPTXVKNYGIWLRYQSRTGYHNMYKEFRDTTLNGAVEQMYTEMASR  426
            LAINEI+EK PT +KN+GIWLRYQSRTGYHNMYKE+RDTTLNGAVEQMYTEMASR
Sbjct  61   LAINEIYEKNPTTIKNFGIWLRYQSRTGYHNMYKEYRDTTLNGAVEQMYTEMASR  115



>ref|XP_006595492.1| PREDICTED: uncharacterized protein LOC100305604 isoform X1 [Glycine 
max]
Length=753

 Score =   232 bits (591),  Expect = 8e-69, Method: Compositional matrix adjust.
 Identities = 107/117 (91%), Positives = 112/117 (96%), Gaps = 0/117 (0%)
 Frame = +1

Query  76   AKMVTYRFHQYQVVGRALPSETDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNG  255
            A+MV  RFHQYQVVGRALP+E+DEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNG
Sbjct  574  AEMVAMRFHQYQVVGRALPTESDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNG  633

Query  256  QVLAINEIFEKCPTXVKNYGIWLRYQSRTGYHNMYKEFRDTTLNGAVEQMYTEMASR  426
            QVLAINEIFEK PT +KNYGIWLRYQSRTGYHNMYKE+RDTTLNGAVE MYTEMASR
Sbjct  634  QVLAINEIFEKNPTKIKNYGIWLRYQSRTGYHNMYKEYRDTTLNGAVEHMYTEMASR  690



>emb|CBI30857.3| unnamed protein product [Vitis vinifera]
Length=124

 Score =   215 bits (547),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 99/105 (94%), Positives = 103/105 (98%), Gaps = 0/105 (0%)
 Frame = +1

Query  82   MVTYRFHQYQVVGRALPSETDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQV  261
            MVT+RFHQYQVVGRALPSETDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQV
Sbjct  1    MVTFRFHQYQVVGRALPSETDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQV  60

Query  262  LAINEIFEKCPTXVKNYGIWLRYQSRTGYHNMYKEFRDTTLNGAV  396
            LAINEIFEK PT +KNYGIWLRYQSRTGYHNMYKE+RDTTLNGA+
Sbjct  61   LAINEIFEKNPTTIKNYGIWLRYQSRTGYHNMYKEYRDTTLNGAL  105



>ref|XP_010666370.1| PREDICTED: 60S ribosomal protein L18a-like [Beta vulgaris subsp. 
vulgaris]
Length=177

 Score =   217 bits (552),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 101/112 (90%), Positives = 107/112 (96%), Gaps = 0/112 (0%)
 Frame = +1

Query  91   YRFHQYQVVGRALPSETDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQVLAI  270
            +RFHQYQVVGRALP+E+ EHPKIYRMKLWATN+VRAKSKFWYFLRKLKKVKKS GQVLAI
Sbjct  3    FRFHQYQVVGRALPTESVEHPKIYRMKLWATNDVRAKSKFWYFLRKLKKVKKSVGQVLAI  62

Query  271  NEIFEKCPTXVKNYGIWLRYQSRTGYHNMYKEFRDTTLNGAVEQMYTEMASR  426
            NEI+EK PT +KNYGIWLRYQSRTGYHNMYKEFRDTTLNGAVEQMY EMASR
Sbjct  63   NEIYEKNPTIIKNYGIWLRYQSRTGYHNMYKEFRDTTLNGAVEQMYCEMASR  114



>gb|KFK44821.1| hypothetical protein AALP_AA1G307200 [Arabis alpina]
Length=178

 Score =   217 bits (552),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 101/115 (88%), Positives = 107/115 (93%), Gaps = 0/115 (0%)
 Frame = +1

Query  82   MVTYRFHQYQVVGRALPSETDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQV  261
            M  +RFHQYQVVGRALPSE +  PKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQ+
Sbjct  1    MGAFRFHQYQVVGRALPSEKELQPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQM  60

Query  262  LAINEIFEKCPTXVKNYGIWLRYQSRTGYHNMYKEFRDTTLNGAVEQMYTEMASR  426
            LAINEIFEK PT +KN+GIWLRYQSRTGYHNMYKE+RDTTLNG VEQMYTEMASR
Sbjct  61   LAINEIFEKNPTTIKNFGIWLRYQSRTGYHNMYKEYRDTTLNGGVEQMYTEMASR  115



>ref|XP_006467486.1| PREDICTED: 60S ribosomal protein L18a-2-like isoform X2 [Citrus 
sinensis]
Length=307

 Score =   221 bits (562),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 103/110 (94%), Positives = 108/110 (98%), Gaps = 0/110 (0%)
 Frame = +1

Query  97   FHQYQVVGRALPSETDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQVLAINE  276
            FHQYQVVGRALP+E+DEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQ+LAINE
Sbjct  135  FHQYQVVGRALPTESDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQMLAINE  194

Query  277  IFEKCPTXVKNYGIWLRYQSRTGYHNMYKEFRDTTLNGAVEQMYTEMASR  426
            IFEK PT +KNYGIWLRYQSRTGYHNMYKE+RDTTLNGAVEQMYTEMASR
Sbjct  195  IFEKNPTKIKNYGIWLRYQSRTGYHNMYKEYRDTTLNGAVEQMYTEMASR  244



>ref|NP_001152434.1| LOC100286074 [Zea mays]
 gb|ACG47606.1| 60S ribosomal protein L18a [Zea mays]
Length=178

 Score =   216 bits (550),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 101/115 (88%), Positives = 107/115 (93%), Gaps = 0/115 (0%)
 Frame = +1

Query  82   MVTYRFHQYQVVGRALPSETDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQV  261
            MV +RFHQYQVVGRAL + TDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKS GQ+
Sbjct  1    MVAHRFHQYQVVGRALXTPTDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSXGQM  60

Query  262  LAINEIFEKCPTXVKNYGIWLRYQSRTGYHNMYKEFRDTTLNGAVEQMYTEMASR  426
            LAINEIFE+ PT +KNYGIWLRYQSRTGYHNMYKE+R TTLNGAVEQMY EMASR
Sbjct  61   LAINEIFERXPTTIKNYGIWLRYQSRTGYHNMYKEYRXTTLNGAVEQMYNEMASR  115



>ref|XP_009419339.1| PREDICTED: 60S ribosomal protein L18a-like [Musa acuminata subsp. 
malaccensis]
Length=173

 Score =   216 bits (549),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 100/115 (87%), Positives = 105/115 (91%), Gaps = 0/115 (0%)
 Frame = +1

Query  82   MVTYRFHQYQVVGRALPSETDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQV  261
            M  +RFHQYQVVGRALP+   EHPKIYRMKLWATNE RAKSKFWYFLRKLKKVKKSNGQV
Sbjct  1    MTIFRFHQYQVVGRALPTAAVEHPKIYRMKLWATNEARAKSKFWYFLRKLKKVKKSNGQV  60

Query  262  LAINEIFEKCPTXVKNYGIWLRYQSRTGYHNMYKEFRDTTLNGAVEQMYTEMASR  426
            LAIN IFE+ PT +KNYGIWLRYQSRTGYHNMYKE+RDTTLNGAVEQMY EMASR
Sbjct  61   LAINVIFERKPTKIKNYGIWLRYQSRTGYHNMYKEYRDTTLNGAVEQMYNEMASR  115



>ref|XP_006407063.1| hypothetical protein EUTSA_v10021546mg [Eutrema salsugineum]
 gb|ESQ48516.1| hypothetical protein EUTSA_v10021546mg [Eutrema salsugineum]
Length=203

 Score =   217 bits (552),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 101/110 (92%), Positives = 104/110 (95%), Gaps = 0/110 (0%)
 Frame = +1

Query  97   FHQYQVVGRALPSETDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQVLAINE  276
            FHQYQVVGRALP+E D  PKIYRMKLWATNEVRA SKFWYFLRKLKKVKKSNGQ+LAINE
Sbjct  31   FHQYQVVGRALPTEKDVQPKIYRMKLWATNEVRAMSKFWYFLRKLKKVKKSNGQMLAINE  90

Query  277  IFEKCPTXVKNYGIWLRYQSRTGYHNMYKEFRDTTLNGAVEQMYTEMASR  426
            IFEK PT +KNYGIWLRYQSRTGYHNMYKEFRDTTLNGAVEQMYTEMASR
Sbjct  91   IFEKNPTTIKNYGIWLRYQSRTGYHNMYKEFRDTTLNGAVEQMYTEMASR  140



>ref|XP_002882886.1| 60S ribosomal protein L18A [Arabidopsis lyrata subsp. lyrata]
 gb|EFH59145.1| 60S ribosomal protein L18A [Arabidopsis lyrata subsp. lyrata]
Length=178

 Score =   216 bits (549),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 100/115 (87%), Positives = 106/115 (92%), Gaps = 0/115 (0%)
 Frame = +1

Query  82   MVTYRFHQYQVVGRALPSETDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQV  261
            M  +RFHQYQVVGRALP+E DEHPKIYRMKLW  NEV AKSKFWYF+RKLKKVKKSNGQ+
Sbjct  1    MGAFRFHQYQVVGRALPTEKDEHPKIYRMKLWGRNEVCAKSKFWYFMRKLKKVKKSNGQM  60

Query  262  LAINEIFEKCPTXVKNYGIWLRYQSRTGYHNMYKEFRDTTLNGAVEQMYTEMASR  426
            LAINEIFEK PT +KNYGIWLRYQSRTGYHNMYKE+RDTTLNG VEQMYTEMASR
Sbjct  61   LAINEIFEKNPTTIKNYGIWLRYQSRTGYHNMYKEYRDTTLNGGVEQMYTEMASR  115



>ref|XP_010501986.1| PREDICTED: 60S ribosomal protein L18a-3-like [Camelina sativa]
Length=178

 Score =   215 bits (548),  Expect = 4e-68, Method: Compositional matrix adjust.
 Identities = 100/115 (87%), Positives = 106/115 (92%), Gaps = 0/115 (0%)
 Frame = +1

Query  82   MVTYRFHQYQVVGRALPSETDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQV  261
            M  +RFHQYQVVGRALP+E DEHPKIYRMKLW  NEV A SKFWYF+RKLKKVKKSNGQ+
Sbjct  1    MGAFRFHQYQVVGRALPTEKDEHPKIYRMKLWGKNEVCAMSKFWYFMRKLKKVKKSNGQM  60

Query  262  LAINEIFEKCPTXVKNYGIWLRYQSRTGYHNMYKEFRDTTLNGAVEQMYTEMASR  426
            LAINEIFEK PT +KNYGIWLRYQSRTGYHNMYKE+RDTTLNGAVEQMYTEMASR
Sbjct  61   LAINEIFEKNPTTIKNYGIWLRYQSRTGYHNMYKEYRDTTLNGAVEQMYTEMASR  115



>ref|NP_188078.1| 60S ribosomal protein L18a-3 [Arabidopsis thaliana]
 sp|Q9LUD4.1|R18A3_ARATH RecName: Full=60S ribosomal protein L18a-3 [Arabidopsis thaliana]
 dbj|BAB02392.1| 60S ribosomal protein L18A-like [Arabidopsis thaliana]
 gb|AAL60048.1| AT3g14600/MIE1_10 [Arabidopsis thaliana]
 gb|AAM19893.1| AT3g14600/MIE1_10 [Arabidopsis thaliana]
 gb|AEE75546.1| 60S ribosomal protein L18a-3 [Arabidopsis thaliana]
Length=178

 Score =   215 bits (548),  Expect = 4e-68, Method: Compositional matrix adjust.
 Identities = 100/115 (87%), Positives = 106/115 (92%), Gaps = 0/115 (0%)
 Frame = +1

Query  82   MVTYRFHQYQVVGRALPSETDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQV  261
            M  +RFHQYQVVGRALP+E DEHPKIYRMKLW  NEV AKSKFWYF+RKLKKVKKSNGQ+
Sbjct  1    MGGFRFHQYQVVGRALPTENDEHPKIYRMKLWGRNEVCAKSKFWYFMRKLKKVKKSNGQM  60

Query  262  LAINEIFEKCPTXVKNYGIWLRYQSRTGYHNMYKEFRDTTLNGAVEQMYTEMASR  426
            LAINEIFEK PT +KNYGIWLRYQSRTGYHNMYKE+RDTTLNG VEQMYTEMASR
Sbjct  61   LAINEIFEKNPTTIKNYGIWLRYQSRTGYHNMYKEYRDTTLNGGVEQMYTEMASR  115



>ref|XP_010460775.1| PREDICTED: 60S ribosomal protein L18a-1-like [Camelina sativa]
Length=178

 Score =   215 bits (548),  Expect = 5e-68, Method: Compositional matrix adjust.
 Identities = 100/115 (87%), Positives = 106/115 (92%), Gaps = 0/115 (0%)
 Frame = +1

Query  82   MVTYRFHQYQVVGRALPSETDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQV  261
            M  +R HQYQVVGRALP+E DE PKIYRMKLWATNEV AKSKFWYFLR+ KKVKKSNGQ+
Sbjct  1    MGVFRLHQYQVVGRALPTEKDEQPKIYRMKLWATNEVLAKSKFWYFLRRQKKVKKSNGQM  60

Query  262  LAINEIFEKCPTXVKNYGIWLRYQSRTGYHNMYKEFRDTTLNGAVEQMYTEMASR  426
            LAINEIFEK PT +KN+GIWLRYQSRTGYHNMYKEFRDTTLNGAVEQMYTEMASR
Sbjct  61   LAINEIFEKNPTTIKNFGIWLRYQSRTGYHNMYKEFRDTTLNGAVEQMYTEMASR  115



>ref|XP_010499515.1| PREDICTED: 60S ribosomal protein L18a-1 [Camelina sativa]
 ref|XP_010478371.1| PREDICTED: 60S ribosomal protein L18a-1 [Camelina sativa]
Length=178

 Score =   215 bits (547),  Expect = 6e-68, Method: Compositional matrix adjust.
 Identities = 100/115 (87%), Positives = 106/115 (92%), Gaps = 0/115 (0%)
 Frame = +1

Query  82   MVTYRFHQYQVVGRALPSETDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQV  261
            M  +R HQYQVVGRALP+E DE PKIYRMKLWATNEV AKSKFWYFLR+ KKVKKSNGQ+
Sbjct  1    MGVFRLHQYQVVGRALPTEKDEQPKIYRMKLWATNEVLAKSKFWYFLRRQKKVKKSNGQM  60

Query  262  LAINEIFEKCPTXVKNYGIWLRYQSRTGYHNMYKEFRDTTLNGAVEQMYTEMASR  426
            LAINEIFEK PT +KN+GIWLRYQSRTGYHNMYKEFRDTTLNGAVEQMYTEMASR
Sbjct  61   LAINEIFEKNPTTIKNFGIWLRYQSRTGYHNMYKEFRDTTLNGAVEQMYTEMASR  115



>ref|XP_006574359.1| PREDICTED: uncharacterized protein LOC100527007 isoform X1 [Glycine 
max]
Length=784

 Score =   230 bits (586),  Expect = 7e-68, Method: Compositional matrix adjust.
 Identities = 106/117 (91%), Positives = 111/117 (95%), Gaps = 0/117 (0%)
 Frame = +1

Query  76   AKMVTYRFHQYQVVGRALPSETDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNG  255
             KMV  RFHQYQVVGRALP+E+DEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNG
Sbjct  605  VKMVAMRFHQYQVVGRALPTESDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNG  664

Query  256  QVLAINEIFEKCPTXVKNYGIWLRYQSRTGYHNMYKEFRDTTLNGAVEQMYTEMASR  426
            QVLAINEIFE+ PT +KNYGIWLRYQSRTGYHNMYKE+RDTTLNGAVE MYTEMASR
Sbjct  665  QVLAINEIFERNPTKIKNYGIWLRYQSRTGYHNMYKEYRDTTLNGAVEHMYTEMASR  721



>ref|XP_004491319.1| PREDICTED: LOW QUALITY PROTEIN: probable aspartic protease At2g35615-like 
[Cicer arietinum]
Length=748

 Score =   229 bits (584),  Expect = 8e-68, Method: Compositional matrix adjust.
 Identities = 107/125 (86%), Positives = 113/125 (90%), Gaps = 0/125 (0%)
 Frame = +1

Query  52   SQEDGSVVAKMVTYRFHQYQVVGRALPSETDEHPKIYRMKLWATNEVRAKSKFWYFLRKL  231
            SQ +     KMV  +FHQYQVVGRALP+ET+EHPKIYRMKLWATNEVRAKSKFWYFLRKL
Sbjct  561  SQSESVFFVKMVNMKFHQYQVVGRALPTETEEHPKIYRMKLWATNEVRAKSKFWYFLRKL  620

Query  232  KKVKKSNGQVLAINEIFEKCPTXVKNYGIWLRYQSRTGYHNMYKEFRDTTLNGAVEQMYT  411
            KKVKKSNGQVLAINEIFEK PT +KNYGIWLRYQSRTGYHNMYKE+RDTTLNGAVE MY 
Sbjct  621  KKVKKSNGQVLAINEIFEKNPTKIKNYGIWLRYQSRTGYHNMYKEYRDTTLNGAVETMYN  680

Query  412  EMASR  426
            EMASR
Sbjct  681  EMASR  685



>gb|AAM65890.1| putative 60S ribosomal protein L18A [Arabidopsis thaliana]
Length=178

 Score =   214 bits (544),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 99/115 (86%), Positives = 106/115 (92%), Gaps = 0/115 (0%)
 Frame = +1

Query  82   MVTYRFHQYQVVGRALPSETDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQV  261
            M  +RFHQYQVVGRALP+E DEHPKIYRMKLW  NEV AKSKFWYF+RKLKKVKKSNGQ+
Sbjct  1    MGGFRFHQYQVVGRALPTENDEHPKIYRMKLWGRNEVCAKSKFWYFMRKLKKVKKSNGQM  60

Query  262  LAINEIFEKCPTXVKNYGIWLRYQSRTGYHNMYKEFRDTTLNGAVEQMYTEMASR  426
            LAINEIFEK PT +KNYGIWLRYQSRTGYHNMYKE+RDTTLNG VEQMYTE+ASR
Sbjct  61   LAINEIFEKNPTTIKNYGIWLRYQSRTGYHNMYKEYRDTTLNGGVEQMYTEIASR  115



>ref|XP_008371597.1| PREDICTED: 60S ribosomal protein L18a-2 isoform X2 [Malus domestica]
Length=315

 Score =   218 bits (555),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 103/114 (90%), Positives = 106/114 (93%), Gaps = 0/114 (0%)
 Frame = +1

Query  85   VTYRFHQYQVVGRALPSETDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQVL  264
             T  FHQYQVVGR LP+ETDE PKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQVL
Sbjct  139  CTIAFHQYQVVGRKLPTETDEQPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQVL  198

Query  265  AINEIFEKCPTXVKNYGIWLRYQSRTGYHNMYKEFRDTTLNGAVEQMYTEMASR  426
            AINEIFEK PT +KNYGIWLRYQSRTGYHNMYKE+RDTTLNGAVEQMY EMASR
Sbjct  199  AINEIFEKNPTTIKNYGIWLRYQSRTGYHNMYKEYRDTTLNGAVEQMYIEMASR  252



>ref|XP_002519698.1| 60S ribosomal protein L18a, putative [Ricinus communis]
 gb|EEF42671.1| 60S ribosomal protein L18a, putative [Ricinus communis]
Length=303

 Score =   218 bits (554),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 101/110 (92%), Positives = 105/110 (95%), Gaps = 0/110 (0%)
 Frame = +1

Query  97   FHQYQVVGRALPSETDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQVLAINE  276
            FHQYQVVGR LP+E D+HPKIYRMKLWATNE RAKSKFWYFLRKLKKVKKSNGQVLAINE
Sbjct  131  FHQYQVVGRGLPTEADDHPKIYRMKLWATNEFRAKSKFWYFLRKLKKVKKSNGQVLAINE  190

Query  277  IFEKCPTXVKNYGIWLRYQSRTGYHNMYKEFRDTTLNGAVEQMYTEMASR  426
            IFEK PT +KNYGIWLRYQSRTGYHNMYKE+RDTTLNGAVEQMYTEMASR
Sbjct  191  IFEKNPTKIKNYGIWLRYQSRTGYHNMYKEYRDTTLNGAVEQMYTEMASR  240



>ref|XP_009360876.1| PREDICTED: 60S ribosomal protein L18a-2 isoform X2 [Pyrus x bretschneideri]
Length=321

 Score =   218 bits (554),  Expect = 4e-67, Method: Compositional matrix adjust.
 Identities = 103/114 (90%), Positives = 106/114 (93%), Gaps = 0/114 (0%)
 Frame = +1

Query  85   VTYRFHQYQVVGRALPSETDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQVL  264
             T  FHQYQVVGR LP+ETDE PKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQVL
Sbjct  145  CTIAFHQYQVVGRKLPTETDEQPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQVL  204

Query  265  AINEIFEKCPTXVKNYGIWLRYQSRTGYHNMYKEFRDTTLNGAVEQMYTEMASR  426
            AINEIFEK PT +KNYGIWLRYQSRTGYHNMYKE+RDTTLNGAVEQMY EMASR
Sbjct  205  AINEIFEKNPTTIKNYGIWLRYQSRTGYHNMYKEYRDTTLNGAVEQMYIEMASR  258



>ref|XP_008225468.1| PREDICTED: 60S ribosomal protein L18a isoform X2 [Prunus mume]
Length=320

 Score =   217 bits (553),  Expect = 5e-67, Method: Compositional matrix adjust.
 Identities = 102/114 (89%), Positives = 106/114 (93%), Gaps = 0/114 (0%)
 Frame = +1

Query  85   VTYRFHQYQVVGRALPSETDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQVL  264
             T  FHQYQVVGR LP+ +DEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQVL
Sbjct  144  CTIAFHQYQVVGRKLPTASDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQVL  203

Query  265  AINEIFEKCPTXVKNYGIWLRYQSRTGYHNMYKEFRDTTLNGAVEQMYTEMASR  426
            AINEIFEK PT +KNYGIWLRYQSRTGYHNMYKE+RDTTLNGAVEQMY EMASR
Sbjct  204  AINEIFEKNPTTIKNYGIWLRYQSRTGYHNMYKEYRDTTLNGAVEQMYIEMASR  257



>ref|XP_010052072.1| PREDICTED: 60S ribosomal protein L18a-2-like isoform X2 [Eucalyptus 
grandis]
Length=317

 Score =   217 bits (553),  Expect = 5e-67, Method: Compositional matrix adjust.
 Identities = 102/110 (93%), Positives = 105/110 (95%), Gaps = 0/110 (0%)
 Frame = +1

Query  97   FHQYQVVGRALPSETDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQVLAINE  276
            FHQYQVVGRALP+  DEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQVLAINE
Sbjct  145  FHQYQVVGRALPTGADEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQVLAINE  204

Query  277  IFEKCPTXVKNYGIWLRYQSRTGYHNMYKEFRDTTLNGAVEQMYTEMASR  426
            IFEK PT + NYGIWLRYQSRTGYHNMYKE+RDTTLNGAVEQMYTEMASR
Sbjct  205  IFEKNPTKINNYGIWLRYQSRTGYHNMYKEYRDTTLNGAVEQMYTEMASR  254



>ref|XP_004303885.2| PREDICTED: 60S ribosomal protein L18a-2 isoform X1 [Fragaria 
vesca subsp. vesca]
Length=181

 Score =   212 bits (540),  Expect = 9e-67, Method: Compositional matrix adjust.
 Identities = 97/111 (87%), Positives = 105/111 (95%), Gaps = 0/111 (0%)
 Frame = +1

Query  94   RFHQYQVVGRALPSETDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQVLAIN  273
            ++HQYQVVGRALP+E DEHPKI+RMKLW TNEVRAKSKFWYFLRKLKKVKKSNGQ+LAIN
Sbjct  8    QYHQYQVVGRALPTEKDEHPKIFRMKLWHTNEVRAKSKFWYFLRKLKKVKKSNGQILAIN  67

Query  274  EIFEKCPTXVKNYGIWLRYQSRTGYHNMYKEFRDTTLNGAVEQMYTEMASR  426
            EIFEK PT + NYGIWLRYQSRTGYHNMYKE+R+TTLNGAVE MYTEMASR
Sbjct  68   EIFEKNPTTINNYGIWLRYQSRTGYHNMYKEYRNTTLNGAVEDMYTEMASR  118



>ref|XP_009109630.1| PREDICTED: 60S ribosomal protein L18a-2 [Brassica rapa]
Length=194

 Score =   212 bits (540),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 98/119 (82%), Positives = 106/119 (89%), Gaps = 0/119 (0%)
 Frame = +1

Query  70   VVAKMVTYRFHQYQVVGRALPSETDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKS  249
            +  KM  +RFHQYQVVGRALP+E +  PKIYRMKLWATNEVRA SKFWYFLRK  K+KKS
Sbjct  13   LTTKMGVFRFHQYQVVGRALPTENEVQPKIYRMKLWATNEVRAMSKFWYFLRKQVKIKKS  72

Query  250  NGQVLAINEIFEKCPTXVKNYGIWLRYQSRTGYHNMYKEFRDTTLNGAVEQMYTEMASR  426
            NGQ+LAINEIFEK PT + N+GIWLRYQSRTGYHNMYKEFRDTTLNGAVEQMYTEMASR
Sbjct  73   NGQMLAINEIFEKNPTTINNFGIWLRYQSRTGYHNMYKEFRDTTLNGAVEQMYTEMASR  131



>ref|XP_004961208.1| PREDICTED: 60S ribosomal protein L18a-like [Setaria italica]
Length=339

 Score =   217 bits (552),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 101/114 (89%), Positives = 106/114 (93%), Gaps = 0/114 (0%)
 Frame = +1

Query  85   VTYRFHQYQVVGRALPSETDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQVL  264
             T  FHQYQVVGRALP+  DEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQ+L
Sbjct  163  CTIAFHQYQVVGRALPTPGDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQML  222

Query  265  AINEIFEKCPTXVKNYGIWLRYQSRTGYHNMYKEFRDTTLNGAVEQMYTEMASR  426
            AINEIFE+ PT +KNYGIWLRYQSRTGYHNMYKE+RDTTLNGAVEQMY EMASR
Sbjct  223  AINEIFERNPTTIKNYGIWLRYQSRTGYHNMYKEYRDTTLNGAVEQMYNEMASR  276



>ref|XP_006415527.1| hypothetical protein EUTSA_v10009933mg [Eutrema salsugineum]
 gb|ESQ33880.1| hypothetical protein EUTSA_v10009933mg [Eutrema salsugineum]
Length=317

 Score =   216 bits (549),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 101/110 (92%), Positives = 106/110 (96%), Gaps = 0/110 (0%)
 Frame = +1

Query  97   FHQYQVVGRALPSETDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQVLAINE  276
            FHQYQVVGRALP+E + HPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQ+LAINE
Sbjct  145  FHQYQVVGRALPTEKELHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQMLAINE  204

Query  277  IFEKCPTXVKNYGIWLRYQSRTGYHNMYKEFRDTTLNGAVEQMYTEMASR  426
            IFEK PT +KN+GIWLRYQSRTGYHNMYKEFRDTTLNGAVEQMYTEMASR
Sbjct  205  IFEKNPTKIKNFGIWLRYQSRTGYHNMYKEFRDTTLNGAVEQMYTEMASR  254



>ref|NP_849729.1| ribosomal protein L18ae/LX family protein [Arabidopsis thaliana]
 sp|Q8L7K0.1|R18A1_ARATH RecName: Full=60S ribosomal protein L18a-1 [Arabidopsis thaliana]
 gb|AAM91614.1| 60S ribosomal protein L18A, putative [Arabidopsis thaliana]
 gb|AAN15378.1| 60S ribosomal protein L18A, putative [Arabidopsis thaliana]
 gb|AEE31159.1| ribosomal protein L18ae/LX family protein [Arabidopsis thaliana]
Length=178

 Score =   211 bits (537),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 98/115 (85%), Positives = 105/115 (91%), Gaps = 0/115 (0%)
 Frame = +1

Query  82   MVTYRFHQYQVVGRALPSETDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQV  261
            M   R HQYQVVGRALP+E DE PKIYRMKLWATNEV AKSKFWY+LR+ KKVKKSNGQ+
Sbjct  1    MSVIRLHQYQVVGRALPTEKDEQPKIYRMKLWATNEVLAKSKFWYYLRRQKKVKKSNGQM  60

Query  262  LAINEIFEKCPTXVKNYGIWLRYQSRTGYHNMYKEFRDTTLNGAVEQMYTEMASR  426
            LAINEIFEK PT +KN+GIWLRYQSRTGYHNMYKE+RDTTLNGAVEQMYTEMASR
Sbjct  61   LAINEIFEKNPTTIKNFGIWLRYQSRTGYHNMYKEYRDTTLNGAVEQMYTEMASR  115



>emb|CDY35269.1| BnaC03g59540D [Brassica napus]
Length=178

 Score =   211 bits (537),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 98/115 (85%), Positives = 105/115 (91%), Gaps = 0/115 (0%)
 Frame = +1

Query  82   MVTYRFHQYQVVGRALPSETDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQV  261
            M  +RFHQYQVVGRALP+E +  PKIYRMKLWATNEVRA SKFWYFLRK  K+KKSNGQ+
Sbjct  1    MGVFRFHQYQVVGRALPTEKEVQPKIYRMKLWATNEVRAMSKFWYFLRKQVKIKKSNGQM  60

Query  262  LAINEIFEKCPTXVKNYGIWLRYQSRTGYHNMYKEFRDTTLNGAVEQMYTEMASR  426
            LAINEIFEK PT +KN+GIWLRYQSRTGYHNMYKEFRDTTLNGAVEQMYTEMASR
Sbjct  61   LAINEIFEKNPTTIKNFGIWLRYQSRTGYHNMYKEFRDTTLNGAVEQMYTEMASR  115



>ref|XP_006306031.1| hypothetical protein CARUB_v10011327mg [Capsella rubella]
 gb|EOA38929.1| hypothetical protein CARUB_v10011327mg [Capsella rubella]
Length=319

 Score =   214 bits (546),  Expect = 6e-66, Method: Compositional matrix adjust.
 Identities = 100/110 (91%), Positives = 104/110 (95%), Gaps = 0/110 (0%)
 Frame = +1

Query  97   FHQYQVVGRALPSETDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQVLAINE  276
             HQYQVVGRALP+E DEHPKIYRMKLWATNEV AKSKFWYFLR+ KKVKKSNGQ+LAINE
Sbjct  147  LHQYQVVGRALPTEKDEHPKIYRMKLWATNEVLAKSKFWYFLRRQKKVKKSNGQMLAINE  206

Query  277  IFEKCPTXVKNYGIWLRYQSRTGYHNMYKEFRDTTLNGAVEQMYTEMASR  426
            IFEK PT +KNYGIWLRYQSRTGYHNMYKEFRDTTLNGAVEQMYTEMASR
Sbjct  207  IFEKSPTKIKNYGIWLRYQSRTGYHNMYKEFRDTTLNGAVEQMYTEMASR  256



>gb|EEE55145.1| hypothetical protein OsJ_02939 [Oryza sativa Japonica Group]
Length=198

 Score =   210 bits (535),  Expect = 9e-66, Method: Compositional matrix adjust.
 Identities = 103/135 (76%), Positives = 109/135 (81%), Gaps = 20/135 (15%)
 Frame = +1

Query  82   MVTYRFHQYQVVGRALPSETDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQV  261
            MV +RFHQYQVVGRALP+  DEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQ+
Sbjct  1    MVAFRFHQYQVVGRALPTPGDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQM  60

Query  262  LAIN--------------------EIFEKCPTXVKNYGIWLRYQSRTGYHNMYKEFRDTT  381
            LAIN                     IFE+ PT +KNYGIWLRYQSRTGYHNMYKE+RDTT
Sbjct  61   LAINGGGPSAFANEFFIFLHHGFVGIFERNPTTIKNYGIWLRYQSRTGYHNMYKEYRDTT  120

Query  382  LNGAVEQMYTEMASR  426
            LNGAVEQMYTEMASR
Sbjct  121  LNGAVEQMYTEMASR  135



>dbj|BAB90499.1| ribosomal protein L18a-like [Oryza sativa Japonica Group]
Length=195

 Score =   210 bits (534),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 104/132 (79%), Positives = 110/132 (83%), Gaps = 17/132 (13%)
 Frame = +1

Query  82   MVTYRFHQYQVVGRALPSETDEHPKIYRMKLWATNEVRAKSKF----------W------  213
            MV +RFHQYQVVGRALP+  DEHPKIYRMKLWATNEVRAKSKF          W      
Sbjct  1    MVAFRFHQYQVVGRALPTPGDEHPKIYRMKLWATNEVRAKSKFCSSYLVRFADWGACPVC  60

Query  214  -YFLRKLKKVKKSNGQVLAINEIFEKCPTXVKNYGIWLRYQSRTGYHNMYKEFRDTTLNG  390
             YFLRKLKKVKKSNGQ+LAINEIFE+ PT +KNYGIWLRYQSRTGYHNMYKE+RDTTLNG
Sbjct  61   RYFLRKLKKVKKSNGQMLAINEIFERNPTTIKNYGIWLRYQSRTGYHNMYKEYRDTTLNG  120

Query  391  AVEQMYTEMASR  426
            AVEQMYTEMASR
Sbjct  121  AVEQMYTEMASR  132



>ref|XP_001762693.1| predicted protein [Physcomitrella patens]
 ref|XP_001768277.1| predicted protein [Physcomitrella patens]
 gb|EDQ66891.1| predicted protein [Physcomitrella patens]
 gb|EDQ72492.1| predicted protein [Physcomitrella patens]
Length=177

 Score =   208 bits (529),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 95/114 (83%), Positives = 107/114 (94%), Gaps = 0/114 (0%)
 Frame = +1

Query  85   VTYRFHQYQVVGRALPSETDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQVL  264
            +++RFHQYQVVGRALP+ T+E PK YRMKLWATNEVRAKSKFWYFLRKL+KVKK++GQ+L
Sbjct  1    MSFRFHQYQVVGRALPTATNETPKAYRMKLWATNEVRAKSKFWYFLRKLQKVKKAHGQLL  60

Query  265  AINEIFEKCPTXVKNYGIWLRYQSRTGYHNMYKEFRDTTLNGAVEQMYTEMASR  426
            AINEIFEK PT +KNYGIW+RYQSRTGYHNMYKE+RD TLNGAVEQMY EMASR
Sbjct  61   AINEIFEKYPTTIKNYGIWVRYQSRTGYHNMYKEYRDLTLNGAVEQMYDEMASR  114



>ref|XP_001765218.1| predicted protein [Physcomitrella patens]
 ref|XP_001774990.1| predicted protein [Physcomitrella patens]
 gb|EDQ60256.1| predicted protein [Physcomitrella patens]
 gb|EDQ69946.1| predicted protein [Physcomitrella patens]
Length=177

 Score =   208 bits (529),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 95/114 (83%), Positives = 107/114 (94%), Gaps = 0/114 (0%)
 Frame = +1

Query  85   VTYRFHQYQVVGRALPSETDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQVL  264
            +++RFHQYQVVGRALP+ T+E PK YRMKLWATNEVRAKSKFWYFLRKL+KVKK++GQ+L
Sbjct  1    MSFRFHQYQVVGRALPTATNETPKAYRMKLWATNEVRAKSKFWYFLRKLQKVKKAHGQLL  60

Query  265  AINEIFEKCPTXVKNYGIWLRYQSRTGYHNMYKEFRDTTLNGAVEQMYTEMASR  426
            AINEIFEK PT +KNYGIW+RYQSRTGYHNMYKE+RD TLNGAVEQMY EMASR
Sbjct  61   AINEIFEKYPTTIKNYGIWVRYQSRTGYHNMYKEYRDLTLNGAVEQMYDEMASR  114



>ref|XP_001752605.1| predicted protein [Physcomitrella patens]
 gb|EDQ82476.1| predicted protein [Physcomitrella patens]
Length=177

 Score =   208 bits (529),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 95/114 (83%), Positives = 107/114 (94%), Gaps = 0/114 (0%)
 Frame = +1

Query  85   VTYRFHQYQVVGRALPSETDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQVL  264
            +++RFHQYQVVGRALP+ T+E PK YRMKLWATNEVRAKSKFWYFLRKL+KVKK++GQ+L
Sbjct  1    MSFRFHQYQVVGRALPTATNEAPKAYRMKLWATNEVRAKSKFWYFLRKLQKVKKAHGQLL  60

Query  265  AINEIFEKCPTXVKNYGIWLRYQSRTGYHNMYKEFRDTTLNGAVEQMYTEMASR  426
            AINEIFEK PT +KNYGIW+RYQSRTGYHNMYKE+RD TLNGAVEQMY EMASR
Sbjct  61   AINEIFEKYPTTIKNYGIWVRYQSRTGYHNMYKEYRDLTLNGAVEQMYDEMASR  114



>ref|XP_002961150.1| hypothetical protein SELMODRAFT_227198 [Selaginella moellendorffii]
 ref|XP_002966859.1| hypothetical protein SELMODRAFT_270606 [Selaginella moellendorffii]
 gb|EFJ31458.1| hypothetical protein SELMODRAFT_270606 [Selaginella moellendorffii]
 gb|EFJ38689.1| hypothetical protein SELMODRAFT_227198 [Selaginella moellendorffii]
Length=177

 Score =   207 bits (526),  Expect = 9e-65, Method: Compositional matrix adjust.
 Identities = 94/112 (84%), Positives = 104/112 (93%), Gaps = 0/112 (0%)
 Frame = +1

Query  91   YRFHQYQVVGRALPSETDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQVLAI  270
            +RFHQYQVVGRA P+  +EHPK+YRMKLWA +EVRAKSKFWYFLRKLKKVKKS+GQ+LAI
Sbjct  3    FRFHQYQVVGRATPTPDNEHPKMYRMKLWAGDEVRAKSKFWYFLRKLKKVKKSHGQILAI  62

Query  271  NEIFEKCPTXVKNYGIWLRYQSRTGYHNMYKEFRDTTLNGAVEQMYTEMASR  426
            NEIFEK PT +KNYGIW+RYQSRTGYHNMYKE+RD TLNGAVEQMY EMASR
Sbjct  63   NEIFEKNPTTIKNYGIWVRYQSRTGYHNMYKEYRDITLNGAVEQMYDEMASR  114



>ref|XP_001760636.1| predicted protein [Physcomitrella patens]
 gb|EDQ74375.1| predicted protein [Physcomitrella patens]
Length=177

 Score =   203 bits (517),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 93/114 (82%), Positives = 105/114 (92%), Gaps = 0/114 (0%)
 Frame = +1

Query  85   VTYRFHQYQVVGRALPSETDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQVL  264
            + +RFHQYQVVGRALP+  +E PK YRMKLWAT+EVRAKSKFWYFLRKL+KVKK++GQ+L
Sbjct  1    MIFRFHQYQVVGRALPTPGNETPKAYRMKLWATDEVRAKSKFWYFLRKLQKVKKAHGQLL  60

Query  265  AINEIFEKCPTXVKNYGIWLRYQSRTGYHNMYKEFRDTTLNGAVEQMYTEMASR  426
            AINEIFEK PT +KNYGIW+RYQSRTGYHNMYKE+RD TLNGAVEQMY EMASR
Sbjct  61   AINEIFEKYPTTIKNYGIWVRYQSRTGYHNMYKEYRDLTLNGAVEQMYDEMASR  114



>ref|XP_002893593.1| 60S ribosomal protein L18A-1 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH69852.1| 60S ribosomal protein L18A-1 [Arabidopsis lyrata subsp. lyrata]
Length=314

 Score =   207 bits (526),  Expect = 6e-63, Method: Compositional matrix adjust.
 Identities = 97/110 (88%), Positives = 102/110 (93%), Gaps = 0/110 (0%)
 Frame = +1

Query  97   FHQYQVVGRALPSETDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQVLAINE  276
             HQYQVVGRALP E DE PKIYRMKLWATNEV AKSKFWYFLR+ KKVKKSNGQ+LAINE
Sbjct  142  LHQYQVVGRALPMEKDEQPKIYRMKLWATNEVLAKSKFWYFLRRQKKVKKSNGQMLAINE  201

Query  277  IFEKCPTXVKNYGIWLRYQSRTGYHNMYKEFRDTTLNGAVEQMYTEMASR  426
            IFEK PT +KN+GIWLRYQSRTGYHNMYKE+RDTTLNGAVEQMYTEMASR
Sbjct  202  IFEKNPTTIKNFGIWLRYQSRTGYHNMYKEYRDTTLNGAVEQMYTEMASR  251



>ref|NP_001077626.1| 60S ribosomal protein L18a-1 [Arabidopsis thaliana]
 gb|AEE31161.1| 60S ribosomal protein L18a-1 [Arabidopsis thaliana]
Length=312

 Score =   206 bits (524),  Expect = 9e-63, Method: Compositional matrix adjust.
 Identities = 96/110 (87%), Positives = 103/110 (94%), Gaps = 0/110 (0%)
 Frame = +1

Query  97   FHQYQVVGRALPSETDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQVLAINE  276
             HQYQVVGRALP+E DE PKIYRMKLWATNEV AKSKFWY+LR+ KKVKKSNGQ+LAINE
Sbjct  140  LHQYQVVGRALPTEKDEQPKIYRMKLWATNEVLAKSKFWYYLRRQKKVKKSNGQMLAINE  199

Query  277  IFEKCPTXVKNYGIWLRYQSRTGYHNMYKEFRDTTLNGAVEQMYTEMASR  426
            IFEK PT +KN+GIWLRYQSRTGYHNMYKE+RDTTLNGAVEQMYTEMASR
Sbjct  200  IFEKNPTTIKNFGIWLRYQSRTGYHNMYKEYRDTTLNGAVEQMYTEMASR  249



>ref|XP_010940708.1| PREDICTED: 60S ribosomal protein L18a-2-like [Elaeis guineensis]
Length=178

 Score =   202 bits (513),  Expect = 9e-63, Method: Compositional matrix adjust.
 Identities = 102/115 (89%), Positives = 107/115 (93%), Gaps = 0/115 (0%)
 Frame = +1

Query  82   MVTYRFHQYQVVGRALPSETDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQV  261
            M  +RFHQYQVVGRALP+ +DEHPKIYRMKLWATNEVRAKSKFWYFL KLKKVKKSNGQV
Sbjct  1    MGNFRFHQYQVVGRALPTPSDEHPKIYRMKLWATNEVRAKSKFWYFLSKLKKVKKSNGQV  60

Query  262  LAINEIFEKCPTXVKNYGIWLRYQSRTGYHNMYKEFRDTTLNGAVEQMYTEMASR  426
            LAINEIFE+ PT +KNYGIWLRYQSRTGYHNMYKEFRDTTLNGAVE MY EMASR
Sbjct  61   LAINEIFERKPTKIKNYGIWLRYQSRTGYHNMYKEFRDTTLNGAVEHMYNEMASR  115



>ref|XP_010936051.1| PREDICTED: 60S ribosomal protein L18a-2 [Elaeis guineensis]
Length=178

 Score =   200 bits (509),  Expect = 4e-62, Method: Compositional matrix adjust.
 Identities = 101/115 (88%), Positives = 107/115 (93%), Gaps = 0/115 (0%)
 Frame = +1

Query  82   MVTYRFHQYQVVGRALPSETDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQV  261
            M  +RFHQYQVVGRALP+ +DEHPKIYRMKLWATNEVRAKSKFWYFL KLKKVKKSNGQV
Sbjct  1    MGNFRFHQYQVVGRALPTPSDEHPKIYRMKLWATNEVRAKSKFWYFLSKLKKVKKSNGQV  60

Query  262  LAINEIFEKCPTXVKNYGIWLRYQSRTGYHNMYKEFRDTTLNGAVEQMYTEMASR  426
            LAINEIFE+ PT +KNYGIWLRYQSRTGYHNMYKE+RDTTLNGAVE MY EMASR
Sbjct  61   LAINEIFERKPTKIKNYGIWLRYQSRTGYHNMYKEYRDTTLNGAVEHMYNEMASR  115



>ref|XP_005652280.1| 60S ribosomal protein L18a-2 [Coccomyxa subellipsoidea C-169]
 gb|EIE27736.1| 60S ribosomal protein L18a-2 [Coccomyxa subellipsoidea C-169]
Length=179

 Score =   199 bits (505),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 90/115 (78%), Positives = 103/115 (90%), Gaps = 0/115 (0%)
 Frame = +1

Query  82   MVTYRFHQYQVVGRALPSETDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQV  261
            M  Y++HQYQVVGR LP+E +  P IYRMKLWAT+ VRAKSKFWYFLRKL+KVKK+NGQ+
Sbjct  1    MGGYKYHQYQVVGRHLPTEKEPEPTIYRMKLWATDPVRAKSKFWYFLRKLRKVKKANGQI  60

Query  262  LAINEIFEKCPTXVKNYGIWLRYQSRTGYHNMYKEFRDTTLNGAVEQMYTEMASR  426
            LA NEIFEK PT VKN+G+W+RYQSRTGYHNMYKE+RDTTLNGAVEQ+Y EMASR
Sbjct  61   LAANEIFEKKPTTVKNFGVWVRYQSRTGYHNMYKEYRDTTLNGAVEQLYQEMASR  115



>ref|XP_010549484.1| PREDICTED: 60S ribosomal protein L18a-2 isoform X2 [Tarenaya 
hassleriana]
Length=312

 Score =   203 bits (516),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 95/107 (89%), Positives = 99/107 (93%), Gaps = 0/107 (0%)
 Frame = +1

Query  106  YQVVGRALPSETDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQVLAINEIFE  285
            Y     ALP+ETDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQ+LAINEIFE
Sbjct  143  YHCFVPALPTETDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQILAINEIFE  202

Query  286  KCPTXVKNYGIWLRYQSRTGYHNMYKEFRDTTLNGAVEQMYTEMASR  426
            K PT +KNYGIWLRYQSRTGYHNMYKE+RD TLNGAVEQMYTEMASR
Sbjct  203  KNPTKIKNYGIWLRYQSRTGYHNMYKEYRDITLNGAVEQMYTEMASR  249



>ref|XP_005848088.1| hypothetical protein CHLNCDRAFT_30965 [Chlorella variabilis]
 gb|EFN55986.1| hypothetical protein CHLNCDRAFT_30965 [Chlorella variabilis]
Length=181

 Score =   196 bits (499),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 89/112 (79%), Positives = 99/112 (88%), Gaps = 0/112 (0%)
 Frame = +1

Query  91   YRFHQYQVVGRALPSETDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQVLAI  270
            Y++HQYQVVGR LPSE D  P IYRMKLWA + VRAKSKFWYFLRKL+KVKK+NGQ+LA 
Sbjct  6    YKYHQYQVVGRHLPSEKDAEPTIYRMKLWAQDPVRAKSKFWYFLRKLRKVKKANGQILAC  65

Query  271  NEIFEKCPTXVKNYGIWLRYQSRTGYHNMYKEFRDTTLNGAVEQMYTEMASR  426
            NEIFE+ PT VKNYGIW+RYQSRTG+HN YKE+RDTTLNGAVEQMY EM SR
Sbjct  66   NEIFERNPTTVKNYGIWVRYQSRTGFHNAYKEYRDTTLNGAVEQMYQEMGSR  117



>gb|AAG52055.1|AC022455_9 60S ribosomal protein L18A, putative; 23187-20334 [Arabidopsis 
thaliana]
Length=321

 Score =   197 bits (501),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 96/122 (79%), Positives = 103/122 (84%), Gaps = 12/122 (10%)
 Frame = +1

Query  97   FHQYQVVGRALPSETDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQVLAINE  276
             HQYQVVGRALP+E DE PKIYRMKLWATNEV AKSKFWY+LR+ KKVKKSNGQ+LAINE
Sbjct  137  LHQYQVVGRALPTEKDEQPKIYRMKLWATNEVLAKSKFWYYLRRQKKVKKSNGQMLAINE  196

Query  277  ------------IFEKCPTXVKNYGIWLRYQSRTGYHNMYKEFRDTTLNGAVEQMYTEMA  420
                        IFEK PT +KN+GIWLRYQSRTGYHNMYKE+RDTTLNGAVEQMYTEMA
Sbjct  197  VLAVGSEFDLFSIFEKNPTTIKNFGIWLRYQSRTGYHNMYKEYRDTTLNGAVEQMYTEMA  256

Query  421  SR  426
            SR
Sbjct  257  SR  258



>gb|ABQ42114.1| 60S ribosomal protein L18a [Sonneratia caseolaris]
Length=107

 Score =   189 bits (481),  Expect = 7e-59, Method: Compositional matrix adjust.
 Identities = 89/95 (94%), Positives = 91/95 (96%), Gaps = 0/95 (0%)
 Frame = +1

Query  142  DEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQVLAINEIFEKCPTXVKNYGIW  321
            DEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQVLAINEIFEK PT + NYGIW
Sbjct  1    DEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQVLAINEIFEKNPTKIDNYGIW  60

Query  322  LRYQSRTGYHNMYKEFRDTTLNGAVEQMYTEMASR  426
            LRYQSRTGYHNMYKE+RDTTLNGAVEQMY EMASR
Sbjct  61   LRYQSRTGYHNMYKEYRDTTLNGAVEQMYNEMASR  95



>gb|ABQ42113.1| 60S ribosomal protein L18a [Sonneratia alba]
 gb|ABQ42115.1| 60S ribosomal protein L18a [Sonneratia ovata]
 gb|ABQ42116.1| 60S ribosomal protein L18a [Sonneratia apetala]
Length=107

 Score =   189 bits (481),  Expect = 7e-59, Method: Compositional matrix adjust.
 Identities = 89/95 (94%), Positives = 91/95 (96%), Gaps = 0/95 (0%)
 Frame = +1

Query  142  DEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQVLAINEIFEKCPTXVKNYGIW  321
            DEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQVLAINEIFEK PT + NYGIW
Sbjct  1    DEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQVLAINEIFEKNPTRIDNYGIW  60

Query  322  LRYQSRTGYHNMYKEFRDTTLNGAVEQMYTEMASR  426
            LRYQSRTGYHNMYKE+RDTTLNGAVEQMY EMASR
Sbjct  61   LRYQSRTGYHNMYKEYRDTTLNGAVEQMYNEMASR  95



>ref|XP_011460183.1| PREDICTED: 60S ribosomal protein L18a [Fragaria vesca subsp. 
vesca]
Length=178

 Score =   190 bits (483),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 96/115 (83%), Positives = 106/115 (92%), Gaps = 0/115 (0%)
 Frame = +1

Query  82   MVTYRFHQYQVVGRALPSETDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQV  261
            MV  ++HQYQVVGRALP + ++ PKIYRMKLW TNEVRAKSKFWYFL+KLKKVKKSNGQ+
Sbjct  1    MVALKYHQYQVVGRALPKDAEDTPKIYRMKLWHTNEVRAKSKFWYFLKKLKKVKKSNGQM  60

Query  262  LAINEIFEKCPTXVKNYGIWLRYQSRTGYHNMYKEFRDTTLNGAVEQMYTEMASR  426
            LAINEIFEK PT V+NYGIWLRYQSRTGYHNMYKE+RDTTLNGAV+QMY EMASR
Sbjct  61   LAINEIFEKKPTVVENYGIWLRYQSRTGYHNMYKEYRDTTLNGAVDQMYNEMASR  115



>ref|XP_011401286.1| 60S ribosomal protein L18a-2 [Auxenochlorella protothecoides]
 gb|KFM28272.1| 60S ribosomal protein L18a-2 [Auxenochlorella protothecoides]
Length=182

 Score =   186 bits (472),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 81/112 (72%), Positives = 97/112 (87%), Gaps = 0/112 (0%)
 Frame = +1

Query  91   YRFHQYQVVGRALPSETDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQVLAI  270
            Y++HQYQVVGR LP+E D  P I+RMKLWA + VRAKSKFWYFL KL+KVKK+NGQ++A+
Sbjct  7    YKYHQYQVVGRHLPTEKDAEPPIFRMKLWAQDTVRAKSKFWYFLAKLRKVKKANGQIVAV  66

Query  271  NEIFEKCPTXVKNYGIWLRYQSRTGYHNMYKEFRDTTLNGAVEQMYTEMASR  426
            NEIFE+ PT +KN+GIW+RY SRTG HNM+KE+RD TLNGAVEQMY EM SR
Sbjct  67   NEIFERRPTTIKNFGIWVRYTSRTGVHNMFKEYRDVTLNGAVEQMYQEMGSR  118



>ref|XP_001689743.1| ribosomal protein L18a, component of cytosolic 80S ribosome and 
60S large subunit [Chlamydomonas reinhardtii]
 gb|EDP09481.1| ribosomal protein L18a [Chlamydomonas reinhardtii]
Length=182

 Score =   186 bits (471),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 80/112 (71%), Positives = 98/112 (88%), Gaps = 0/112 (0%)
 Frame = +1

Query  91   YRFHQYQVVGRALPSETDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQVLAI  270
            ++FHQYQVVGR LP+  D +P +YRMK+WA ++V+AKSKFWYFLRKL++VKK+NGQ++A 
Sbjct  7    FKFHQYQVVGRHLPTAADANPTVYRMKVWAEDDVKAKSKFWYFLRKLRRVKKANGQIIAC  66

Query  271  NEIFEKCPTXVKNYGIWLRYQSRTGYHNMYKEFRDTTLNGAVEQMYTEMASR  426
            NEIFE+ PT  KNYGIW+RYQSRTG HNMYKE+RD TLNG+V QMY EMASR
Sbjct  67   NEIFERKPTLAKNYGIWVRYQSRTGVHNMYKEYRDVTLNGSVSQMYQEMASR  118



>gb|KDD75676.1| ribosomal protein L18ae/LX [Helicosporidium sp. ATCC 50920]
Length=182

 Score =   186 bits (471),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 83/112 (74%), Positives = 97/112 (87%), Gaps = 0/112 (0%)
 Frame = +1

Query  91   YRFHQYQVVGRALPSETDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQVLAI  270
            +++ QYQVVGR LP+E D  P ++RMKLWA + VRAKSKFWYF+RKL+KVKK+NGQV+A+
Sbjct  7    FKYKQYQVVGRHLPTEKDAEPALFRMKLWAEDSVRAKSKFWYFMRKLRKVKKANGQVVAV  66

Query  271  NEIFEKCPTXVKNYGIWLRYQSRTGYHNMYKEFRDTTLNGAVEQMYTEMASR  426
            NEI EK PT VKNYGIW+RY SRTG HNMYKEFRDTTLNGAV QMY+EMA R
Sbjct  67   NEIVEKRPTVVKNYGIWVRYTSRTGVHNMYKEFRDTTLNGAVSQMYSEMAGR  118



>gb|ADU56180.1| hypothetical protein [Jatropha curcas]
Length=154

 Score =   184 bits (466),  Expect = 6e-56, Method: Compositional matrix adjust.
 Identities = 87/91 (96%), Positives = 89/91 (98%), Gaps = 0/91 (0%)
 Frame = +1

Query  154  KIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQVLAINEIFEKCPTXVKNYGIWLRYQ  333
            KIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQVLAINEIFEK PT +KNYGIWLRYQ
Sbjct  1    KIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQVLAINEIFEKNPTKIKNYGIWLRYQ  60

Query  334  SRTGYHNMYKEFRDTTLNGAVEQMYTEMASR  426
            SRTGYHNMYKE+RDTTLNGAVEQMYTEMASR
Sbjct  61   SRTGYHNMYKEYRDTTLNGAVEQMYTEMASR  91



>gb|ACS68696.1| 60S RPL18aB [Sonneratia alba]
 gb|ACS68767.1| 60S RPL18aB, partial [Sonneratia alba]
Length=101

 Score =   181 bits (460),  Expect = 7e-56, Method: Compositional matrix adjust.
 Identities = 86/92 (93%), Positives = 88/92 (96%), Gaps = 0/92 (0%)
 Frame = +1

Query  151  PKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQVLAINEIFEKCPTXVKNYGIWLRY  330
            PKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQVLAINEIFEK PT + NYGIWLRY
Sbjct  1    PKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQVLAINEIFEKNPTRIDNYGIWLRY  60

Query  331  QSRTGYHNMYKEFRDTTLNGAVEQMYTEMASR  426
            QSRTGYHNMYKE+RDTTLNGAVEQMY EMASR
Sbjct  61   QSRTGYHNMYKEYRDTTLNGAVEQMYNEMASR  92



>ref|XP_002948508.1| ribosomal protein L18A component of cytosolic 80S ribosome and 
60S large subunit [Volvox carteri f. nagariensis]
 gb|EFJ50383.1| ribosomal protein L18A component of cytosolic 80S ribosome and 
60S large subunit [Volvox carteri f. nagariensis]
Length=182

 Score =   183 bits (465),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 79/112 (71%), Positives = 97/112 (87%), Gaps = 0/112 (0%)
 Frame = +1

Query  91   YRFHQYQVVGRALPSETDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQVLAI  270
            ++FHQYQVVGR LP+  D  P +YRMK+WA ++V+AKSKFWYFLRKL++VKK+NGQ++A 
Sbjct  7    FKFHQYQVVGRHLPTAADATPTVYRMKVWAEDDVKAKSKFWYFLRKLRRVKKANGQIIAC  66

Query  271  NEIFEKCPTXVKNYGIWLRYQSRTGYHNMYKEFRDTTLNGAVEQMYTEMASR  426
            NEIFE+ PT  KNYG+W+RYQSRTG HNMYKE+RD TLNG+V QMY EMASR
Sbjct  67   NEIFERKPTLAKNYGVWVRYQSRTGVHNMYKEYRDVTLNGSVAQMYQEMASR  118



>ref|XP_007146225.1| hypothetical protein PHAVU_006G022700g [Phaseolus vulgaris]
 gb|ESW18219.1| hypothetical protein PHAVU_006G022700g [Phaseolus vulgaris]
Length=159

 Score =   181 bits (460),  Expect = 5e-55, Method: Compositional matrix adjust.
 Identities = 89/115 (77%), Positives = 94/115 (82%), Gaps = 19/115 (17%)
 Frame = +1

Query  82   MVTYRFHQYQVVGRALPSETDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQV  261
            MVT+RFHQYQVVGRALP+ETD HPKIYRMKLWATNEVRAKSKFWYFLRK+KKVKKSNGQ+
Sbjct  1    MVTFRFHQYQVVGRALPTETDVHPKIYRMKLWATNEVRAKSKFWYFLRKVKKVKKSNGQM  60

Query  262  LAINEIFEKCPTXVKNYGIWLRYQSRTGYHNMYKEFRDTTLNGAVEQMYTEMASR  426
            LAINE                   SRTGYHNMYKE+RDTTLNGAVEQMY EMASR
Sbjct  61   LAINE-------------------SRTGYHNMYKEYRDTTLNGAVEQMYNEMASR  96



>gb|AAT08714.1| ribosomal protein L18A [Hyacinthus orientalis]
Length=178

 Score =   180 bits (456),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 90/119 (76%), Positives = 98/119 (82%), Gaps = 8/119 (7%)
 Frame = +1

Query  82   MVTYRFHQYQVVGRALPSETDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQV  261
            M  +RFHQYQVVGRALP+ +DEHPKI+RMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQV
Sbjct  1    MGGFRFHQYQVVGRALPTPSDEHPKIFRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQV  60

Query  262  LAINEIFEKCPTXVKNYGIWLRYQSRTGYHN----MYKEFRDTTLNGAVEQMYTEMASR  426
            LAINEIFEK PT +    I LR+ +     N    MYKE+RDTTLNG VEQMYTEMASR
Sbjct  61   LAINEIFEKNPTKI----IELRHMAEVPEQNRLSYMYKEYRDTTLNGGVEQMYTEMASR  115



>gb|KIZ01204.1| 60S ribosomal protein L18a-2 [Monoraphidium neglectum]
Length=182

 Score =   179 bits (454),  Expect = 6e-54, Method: Compositional matrix adjust.
 Identities = 79/112 (71%), Positives = 98/112 (88%), Gaps = 0/112 (0%)
 Frame = +1

Query  91   YRFHQYQVVGRALPSETDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQVLAI  270
            +++HQYQVVGR  P+  + +P +YRMK+WA + V AKSKFWYFLRKL++VKK+NGQVLA+
Sbjct  7    FKYHQYQVVGRHNPTTAEPNPTVYRMKVWAPDAVCAKSKFWYFLRKLRRVKKANGQVLAV  66

Query  271  NEIFEKCPTXVKNYGIWLRYQSRTGYHNMYKEFRDTTLNGAVEQMYTEMASR  426
            NEIFE+  T VKN+G+W+RYQSRTGYHNMYKE+RDTTLNGA+ QMY EMASR
Sbjct  67   NEIFERKTTTVKNFGVWVRYQSRTGYHNMYKEYRDTTLNGAIGQMYGEMASR  118



>gb|KJB10615.1| hypothetical protein B456_001G211400 [Gossypium raimondii]
Length=150

 Score =   177 bits (449),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 83/87 (95%), Positives = 85/87 (98%), Gaps = 0/87 (0%)
 Frame = +1

Query  166  MKLWATNEVRAKSKFWYFLRKLKKVKKSNGQVLAINEIFEKCPTXVKNYGIWLRYQSRTG  345
            MKLWATNEVRAKSKFWYFLRKLKKVKKSNGQVLAINEIFEK PT +KNYGIWLRYQSRTG
Sbjct  1    MKLWATNEVRAKSKFWYFLRKLKKVKKSNGQVLAINEIFEKSPTKIKNYGIWLRYQSRTG  60

Query  346  YHNMYKEFRDTTLNGAVEQMYTEMASR  426
            YHNMYKE+RDTTLNGAVEQMYTEMASR
Sbjct  61   YHNMYKEYRDTTLNGAVEQMYTEMASR  87



>emb|CDX98480.1| BnaC05g38950D [Brassica napus]
Length=150

 Score =   177 bits (448),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 83/87 (95%), Positives = 85/87 (98%), Gaps = 0/87 (0%)
 Frame = +1

Query  166  MKLWATNEVRAKSKFWYFLRKLKKVKKSNGQVLAINEIFEKCPTXVKNYGIWLRYQSRTG  345
            MKLWATNEVRAKSKFWYFLRKLKKVKKSNGQ+LAINEIFEK PT +KNYGIWLRYQSRTG
Sbjct  1    MKLWATNEVRAKSKFWYFLRKLKKVKKSNGQMLAINEIFEKNPTKIKNYGIWLRYQSRTG  60

Query  346  YHNMYKEFRDTTLNGAVEQMYTEMASR  426
            YHNMYKEFRDTTLNGAVEQMYTEMASR
Sbjct  61   YHNMYKEFRDTTLNGAVEQMYTEMASR  87



>emb|CDX82474.1| BnaA03g33470D [Brassica napus]
Length=150

 Score =   176 bits (447),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 82/87 (94%), Positives = 85/87 (98%), Gaps = 0/87 (0%)
 Frame = +1

Query  166  MKLWATNEVRAKSKFWYFLRKLKKVKKSNGQVLAINEIFEKCPTXVKNYGIWLRYQSRTG  345
            MKLWA+NEVRAKSKFWYFLRKLKKVKKSNGQ+LAINEIFEK PT +KNYGIWLRYQSRTG
Sbjct  1    MKLWASNEVRAKSKFWYFLRKLKKVKKSNGQMLAINEIFEKSPTKIKNYGIWLRYQSRTG  60

Query  346  YHNMYKEFRDTTLNGAVEQMYTEMASR  426
            YHNMYKEFRDTTLNGAVEQMYTEMASR
Sbjct  61   YHNMYKEFRDTTLNGAVEQMYTEMASR  87



>ref|XP_006387416.1| hypothetical protein POPTR_1064s00200g [Populus trichocarpa]
 gb|ERP46330.1| hypothetical protein POPTR_1064s00200g [Populus trichocarpa]
Length=150

 Score =   176 bits (447),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 83/87 (95%), Positives = 85/87 (98%), Gaps = 0/87 (0%)
 Frame = +1

Query  166  MKLWATNEVRAKSKFWYFLRKLKKVKKSNGQVLAINEIFEKCPTXVKNYGIWLRYQSRTG  345
            MKLWATNEVRAKSKFWYFLRKLKKVKKSNGQVLAINEIFEK PT +KNYGIWLRYQSRTG
Sbjct  1    MKLWATNEVRAKSKFWYFLRKLKKVKKSNGQVLAINEIFEKNPTKIKNYGIWLRYQSRTG  60

Query  346  YHNMYKEFRDTTLNGAVEQMYTEMASR  426
            YHNMYKE+RDTTLNGAVEQMYTEMASR
Sbjct  61   YHNMYKEYRDTTLNGAVEQMYTEMASR  87



>gb|KJB34967.1| hypothetical protein B456_006G092900 [Gossypium raimondii]
 gb|KJB42783.1| hypothetical protein B456_007G174800 [Gossypium raimondii]
 gb|KJB69798.1| hypothetical protein B456_011G042800 [Gossypium raimondii]
Length=150

 Score =   176 bits (447),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 83/87 (95%), Positives = 85/87 (98%), Gaps = 0/87 (0%)
 Frame = +1

Query  166  MKLWATNEVRAKSKFWYFLRKLKKVKKSNGQVLAINEIFEKCPTXVKNYGIWLRYQSRTG  345
            MKLWATNEVRAKSKFWYFLRKLKKVKKSNGQVLAINEIFEK PT +KNYGIWLRYQSRTG
Sbjct  1    MKLWATNEVRAKSKFWYFLRKLKKVKKSNGQVLAINEIFEKNPTKIKNYGIWLRYQSRTG  60

Query  346  YHNMYKEFRDTTLNGAVEQMYTEMASR  426
            YHNMYKE+RDTTLNGAVEQMYTEMASR
Sbjct  61   YHNMYKEYRDTTLNGAVEQMYTEMASR  87



>emb|CDX84313.1| BnaC04g10750D [Brassica napus]
Length=150

 Score =   176 bits (445),  Expect = 6e-53, Method: Compositional matrix adjust.
 Identities = 82/87 (94%), Positives = 85/87 (98%), Gaps = 0/87 (0%)
 Frame = +1

Query  166  MKLWATNEVRAKSKFWYFLRKLKKVKKSNGQVLAINEIFEKCPTXVKNYGIWLRYQSRTG  345
            MKLWATNEVRAKSKFWYFLRKLKKVKKSNGQ+LAINEIFEK PT +KN+GIWLRYQSRTG
Sbjct  1    MKLWATNEVRAKSKFWYFLRKLKKVKKSNGQMLAINEIFEKNPTTIKNFGIWLRYQSRTG  60

Query  346  YHNMYKEFRDTTLNGAVEQMYTEMASR  426
            YHNMYKEFRDTTLNGAVEQMYTEMASR
Sbjct  61   YHNMYKEFRDTTLNGAVEQMYTEMASR  87



>ref|XP_004144680.1| PREDICTED: LOW QUALITY PROTEIN: protein ASPARTIC PROTEASE IN 
GUARD CELL 1-like [Cucumis sativus]
Length=757

 Score =   188 bits (477),  Expect = 9e-53, Method: Compositional matrix adjust.
 Identities = 93/128 (73%), Positives = 100/128 (78%), Gaps = 19/128 (15%)
 Frame = +1

Query  79   KMVTYRFHQYQVVGRALPSETDEHPKIYRMKLWATNEVRAKSKFW------------YFL  222
            KMVT+RFHQYQVVGRALPSE+DEHPKIYRMKLWATNEVRAKSKFW            + L
Sbjct  574  KMVTFRFHQYQVVGRALPSESDEHPKIYRMKLWATNEVRAKSKFWCVVILSVDVSLSFXL  633

Query  223  RKLKKVKKSNGQVLAINEIFEKCPTXVKNYGIWLRYQSRTGYHNMYKEFRDTTLNGAVEQ  402
                K+K + G       IFEK PT +KNYGIWLRYQSRTGYHNMYKE+RDTTLNGAVEQ
Sbjct  634  VTCXKMKANKG-------IFEKNPTKIKNYGIWLRYQSRTGYHNMYKEYRDTTLNGAVEQ  686

Query  403  MYTEMASR  426
            MYTEMASR
Sbjct  687  MYTEMASR  694



>ref|NP_001237792.1| uncharacterized protein LOC100305604 [Glycine max]
 gb|ACU13370.1| unknown [Glycine max]
Length=150

 Score =   174 bits (442),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 82/87 (94%), Positives = 84/87 (97%), Gaps = 0/87 (0%)
 Frame = +1

Query  166  MKLWATNEVRAKSKFWYFLRKLKKVKKSNGQVLAINEIFEKCPTXVKNYGIWLRYQSRTG  345
            MKLWATNEVRAKSKFWYFLRKLKKVKKSNGQVLAINEIFEK PT +KNYGIWLRYQSRTG
Sbjct  1    MKLWATNEVRAKSKFWYFLRKLKKVKKSNGQVLAINEIFEKNPTKIKNYGIWLRYQSRTG  60

Query  346  YHNMYKEFRDTTLNGAVEQMYTEMASR  426
            YHNMYKE+RDTTLNGAVE MYTEMASR
Sbjct  61   YHNMYKEYRDTTLNGAVEHMYTEMASR  87



>gb|EYU33347.1| hypothetical protein MIMGU_mgv1a014797mg [Erythranthe guttata]
Length=150

 Score =   174 bits (441),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 81/87 (93%), Positives = 84/87 (97%), Gaps = 0/87 (0%)
 Frame = +1

Query  166  MKLWATNEVRAKSKFWYFLRKLKKVKKSNGQVLAINEIFEKCPTXVKNYGIWLRYQSRTG  345
            MKLWATNEVRAKSKFWYFLRKLKKVKKSNGQ+LAINEIFEK PT +KNYGIWLRYQSRTG
Sbjct  1    MKLWATNEVRAKSKFWYFLRKLKKVKKSNGQILAINEIFEKNPTTIKNYGIWLRYQSRTG  60

Query  346  YHNMYKEFRDTTLNGAVEQMYTEMASR  426
            YHNMYKE+RDTTLNGAVE MYTEMASR
Sbjct  61   YHNMYKEYRDTTLNGAVEHMYTEMASR  87



>emb|CDY43672.1| BnaA04g20190D [Brassica napus]
 emb|CDY17253.1| BnaA05g09350D [Brassica napus]
Length=150

 Score =   174 bits (441),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 81/87 (93%), Positives = 85/87 (98%), Gaps = 0/87 (0%)
 Frame = +1

Query  166  MKLWATNEVRAKSKFWYFLRKLKKVKKSNGQVLAINEIFEKCPTXVKNYGIWLRYQSRTG  345
            MKLWATNEVRAKSKFWYFLRKLKKVKKSNGQ+LAINEIFEK PT +KN+GIWLRYQSRTG
Sbjct  1    MKLWATNEVRAKSKFWYFLRKLKKVKKSNGQMLAINEIFEKNPTTIKNFGIWLRYQSRTG  60

Query  346  YHNMYKEFRDTTLNGAVEQMYTEMASR  426
            YHNMYKE+RDTTLNGAVEQMYTEMASR
Sbjct  61   YHNMYKEYRDTTLNGAVEQMYTEMASR  87



>emb|CDX84643.1| BnaA03g15870D [Brassica napus]
Length=150

 Score =   174 bits (441),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 81/87 (93%), Positives = 85/87 (98%), Gaps = 0/87 (0%)
 Frame = +1

Query  166  MKLWATNEVRAKSKFWYFLRKLKKVKKSNGQVLAINEIFEKCPTXVKNYGIWLRYQSRTG  345
            MKLWATNEVRAKSKFWYFLRKLKKVKKSNGQ+LAINEIFEK PT +KN+GIWLRYQSRTG
Sbjct  1    MKLWATNEVRAKSKFWYFLRKLKKVKKSNGQMLAINEIFEKNPTTIKNFGIWLRYQSRTG  60

Query  346  YHNMYKEFRDTTLNGAVEQMYTEMASR  426
            YHNMYKE+RDTTLNGAVEQMYTEMASR
Sbjct  61   YHNMYKEYRDTTLNGAVEQMYTEMASR  87



>ref|XP_001418811.1| Ribosomal protein L18a, component of cytosolic 80S ribosome and 
60S large subunit [Ostreococcus lucimarinus CCE9901]
 gb|ABO97104.1| Ribosomal protein L18a, component of cytosolic 80S ribosome and 
60S large subunit [Ostreococcus lucimarinus CCE9901]
Length=179

 Score =   171 bits (434),  Expect = 6e-51, Method: Compositional matrix adjust.
 Identities = 73/115 (63%), Positives = 96/115 (83%), Gaps = 0/115 (0%)
 Frame = +1

Query  82   MVTYRFHQYQVVGRALPSETDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQV  261
            M   R+HQYQVVGR +P++    P+++RMKLWA ++V+A+SKFWYF+ +LKKVKK+NGQ+
Sbjct  1    MAKIRYHQYQVVGRHVPTDAHPEPEVFRMKLWALDDVKARSKFWYFMSRLKKVKKANGQI  60

Query  262  LAINEIFEKCPTXVKNYGIWLRYQSRTGYHNMYKEFRDTTLNGAVEQMYTEMASR  426
            +A NEIFE   T VKN+GIW+RYQSRTGYHN YKE+R+TT+N AV+ +Y EMASR
Sbjct  61   IACNEIFEADTTTVKNFGIWIRYQSRTGYHNSYKEYRETTMNAAVDALYEEMASR  115



>emb|CEF98555.1| Ribosomal protein L18ae [Ostreococcus tauri]
Length=179

 Score =   171 bits (432),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 73/115 (63%), Positives = 97/115 (84%), Gaps = 0/115 (0%)
 Frame = +1

Query  82   MVTYRFHQYQVVGRALPSETDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQV  261
            M  YR+ Q+QVVGR LP+E    P+++RMKLWA ++V+A+SKFWYF+ +LKKVKK+NGQ+
Sbjct  1    MAPYRYRQFQVVGRHLPTEATPEPEVFRMKLWALDDVKARSKFWYFMSRLKKVKKANGQI  60

Query  262  LAINEIFEKCPTXVKNYGIWLRYQSRTGYHNMYKEFRDTTLNGAVEQMYTEMASR  426
            +A NEIFE+  T VKN+GIW+RYQSRTG+HN YKE+R+TT+N AV+ +Y EMASR
Sbjct  61   IACNEIFEEDTTTVKNFGIWIRYQSRTGFHNSYKEYRETTMNKAVDALYEEMASR  115



>ref|XP_007508296.1| unknown [Bathycoccus prasinos]
 emb|CCO20400.1| unknown [Bathycoccus prasinos]
Length=211

 Score =   172 bits (435),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 72/110 (65%), Positives = 94/110 (85%), Gaps = 0/110 (0%)
 Frame = +1

Query  97   FHQYQVVGRALPSETDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQVLAINE  276
            +HQYQ+VGR +P+E +  P++YRMKLWA +  RA+SKFWYFL +L+KVKK+NGQ++A NE
Sbjct  38   YHQYQIVGRRVPTEQEPTPQVYRMKLWALDATRARSKFWYFLSRLRKVKKANGQIIACNE  97

Query  277  IFEKCPTXVKNYGIWLRYQSRTGYHNMYKEFRDTTLNGAVEQMYTEMASR  426
            IFEK  T VKNYG+W+RYQSR G+HN YKE+R+TT+N AV+ +YTEMASR
Sbjct  98   IFEKDDTTVKNYGVWIRYQSRVGFHNAYKEYRETTMNAAVDALYTEMASR  147



>gb|ADV03035.1| ribosomal protein L18A [Karlodinium veneficum]
Length=187

 Score =   168 bits (426),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 74/124 (60%), Positives = 97/124 (78%), Gaps = 5/124 (4%)
 Frame = +1

Query  55   QEDGSVVAKMVTYRFHQYQVVGRALPSETDEHPKIYRMKLWATNEVRAKSKFWYFLRKLK  234
            + D S+ A+M     HQYQ+VGRA P+  +  PKIYRM+L+A N V AKS+FWYF++K+ 
Sbjct  6    KADASLQARM-----HQYQIVGRAAPTPKNPTPKIYRMRLFAKNAVLAKSRFWYFMKKIN  60

Query  235  KVKKSNGQVLAINEIFEKCPTXVKNYGIWLRYQSRTGYHNMYKEFRDTTLNGAVEQMYTE  414
            K K+S G++L +NE+F++ PT VKNYGIWLRY+SRT  HNMYKEFRD T+NGAV Q+Y+E
Sbjct  61   KAKRSGGELLGVNELFDRAPTKVKNYGIWLRYESRTNTHNMYKEFRDVTINGAVSQLYSE  120

Query  415  MASR  426
            MA R
Sbjct  121  MAGR  124



>ref|XP_003062312.1| predicted protein [Micromonas pusilla CCMP1545]
 gb|EEH53131.1| predicted protein [Micromonas pusilla CCMP1545]
Length=185

 Score =   168 bits (425),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 70/119 (59%), Positives = 99/119 (83%), Gaps = 0/119 (0%)
 Frame = +1

Query  70   VVAKMVTYRFHQYQVVGRALPSETDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKS  249
            +V  +  +R+HQY +VGR +P++ D +P++YRMKLW+ ++ RAKSKFWYFL +LKKVKK+
Sbjct  1    MVKGLKPHRYHQYHIVGRHVPTDADPNPQVYRMKLWSLDDTRAKSKFWYFLSRLKKVKKA  60

Query  250  NGQVLAINEIFEKCPTXVKNYGIWLRYQSRTGYHNMYKEFRDTTLNGAVEQMYTEMASR  426
            NGQ++A NEIFE+  T +KN+GIW+RYQSRTG+HN YKE+R+ ++N AV+ +Y EMASR
Sbjct  61   NGQIIACNEIFEEDVTTIKNFGIWIRYQSRTGFHNAYKEYREISMNKAVDALYEEMASR  119



>dbj|BAH20340.1| AT3G14600 [Arabidopsis thaliana]
Length=150

 Score =   165 bits (417),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 77/87 (89%), Positives = 81/87 (93%), Gaps = 0/87 (0%)
 Frame = +1

Query  166  MKLWATNEVRAKSKFWYFLRKLKKVKKSNGQVLAINEIFEKCPTXVKNYGIWLRYQSRTG  345
            MKLW  NEV AKSKFWYF+RKLKKVKKSNGQ+LAINEIFEK PT +KNYGIWLRYQSRTG
Sbjct  1    MKLWGRNEVCAKSKFWYFMRKLKKVKKSNGQMLAINEIFEKNPTTIKNYGIWLRYQSRTG  60

Query  346  YHNMYKEFRDTTLNGAVEQMYTEMASR  426
            YHNMYKE+RDTTLNG VEQMYTEMASR
Sbjct  61   YHNMYKEYRDTTLNGGVEQMYTEMASR  87



>gb|KFH68950.1| 60S ribosomal protein L20 [Mortierella verticillata NRRL 6337]
Length=176

 Score =   162 bits (410),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 71/111 (64%), Positives = 91/111 (82%), Gaps = 0/111 (0%)
 Frame = +1

Query  94   RFHQYQVVGRALPSETDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQVLAIN  273
            R H+YQ+VGR LP+E D  PK++RM+L+A NEV AKS+FWYF+RKLKKVKK NG+++ IN
Sbjct  3    RLHEYQLVGRHLPTEKDATPKLFRMRLFAPNEVIAKSRFWYFMRKLKKVKKVNGEIVGIN  62

Query  274  EIFEKCPTXVKNYGIWLRYQSRTGYHNMYKEFRDTTLNGAVEQMYTEMASR  426
            EI EK P  +KN+GIW+RY SR+G HNMYKE+R+ T N AVE  Y++MASR
Sbjct  63   EIHEKKPLQIKNFGIWIRYDSRSGTHNMYKEYRELTRNAAVEACYSDMASR  113



>ref|XP_002501229.1| predicted protein [Micromonas sp. RCC299]
 gb|ACO62487.1| predicted protein [Micromonas sp. RCC299]
Length=188

 Score =   160 bits (405),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 67/110 (61%), Positives = 92/110 (84%), Gaps = 0/110 (0%)
 Frame = +1

Query  97   FHQYQVVGRALPSETDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQVLAINE  276
            + Q+ +VGR +P++    P++YRMKLW+T++ RAKSKFWYFL +LKKVKK+NGQ+LA NE
Sbjct  13   YRQFHIVGRHVPTDAMPDPQVYRMKLWSTDDTRAKSKFWYFLSRLKKVKKANGQILACNE  72

Query  277  IFEKCPTXVKNYGIWLRYQSRTGYHNMYKEFRDTTLNGAVEQMYTEMASR  426
            IFE+  T +KN+GIW+RYQSRTG+HN YKE+R+ ++N AV+ +Y EMASR
Sbjct  73   IFEEDVTTIKNFGIWIRYQSRTGFHNAYKEYREVSMNKAVDALYEEMASR  122



>ref|XP_008880083.1| hypothetical protein H310_14105 [Aphanomyces invadans]
 gb|ETV91246.1| hypothetical protein H310_14105 [Aphanomyces invadans]
Length=177

 Score =   159 bits (401),  Expect = 6e-46, Method: Compositional matrix adjust.
 Identities = 69/110 (63%), Positives = 89/110 (81%), Gaps = 0/110 (0%)
 Frame = +1

Query  97   FHQYQVVGRALPSETDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQVLAINE  276
             H YQVVGR  P+ETD +P  +RMKL+A NEV AKS+FWYFL ++KK+KK+ G++L+INE
Sbjct  4    IHHYQVVGRKAPTETDPNPPAFRMKLFAPNEVLAKSRFWYFLHQMKKMKKTTGEILSINE  63

Query  277  IFEKCPTXVKNYGIWLRYQSRTGYHNMYKEFRDTTLNGAVEQMYTEMASR  426
            + EK    VKNYG+W+RY SR+G HNMYKE+RD TLNGA+EQ+Y E+A R
Sbjct  64   LREKNKRIVKNYGVWIRYNSRSGTHNMYKEYRDVTLNGAIEQLYAELAGR  113



>gb|KFH68928.1| large subunit ribosomal protein L18Ae [Mortierella verticillata 
NRRL 6337]
Length=244

 Score =   160 bits (404),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 70/110 (64%), Positives = 90/110 (82%), Gaps = 0/110 (0%)
 Frame = +1

Query  97   FHQYQVVGRALPSETDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQVLAINE  276
             H+YQ+VGR LP+E D  PK++RM+L+A NEV AKS+FWYF+RKLKKVKK NG+++ INE
Sbjct  72   LHEYQLVGRHLPTEKDATPKLFRMRLFAPNEVIAKSRFWYFMRKLKKVKKVNGEIVGINE  131

Query  277  IFEKCPTXVKNYGIWLRYQSRTGYHNMYKEFRDTTLNGAVEQMYTEMASR  426
            I EK P  +KN+GIW+RY SR+G HNMYKE+R+ T N AVE  Y++MASR
Sbjct  132  IHEKKPLQIKNFGIWIRYDSRSGTHNMYKEYRELTRNAAVEACYSDMASR  181



>ref|XP_008604133.1| 50S ribosomal protein L18Ae [Saprolegnia diclina VS20]
 gb|EQC42710.1| 50S ribosomal protein L18Ae [Saprolegnia diclina VS20]
Length=177

 Score =   157 bits (396),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 69/110 (63%), Positives = 88/110 (80%), Gaps = 0/110 (0%)
 Frame = +1

Query  97   FHQYQVVGRALPSETDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQVLAINE  276
             HQYQVVGR  P+E+D +P  +RMKL+A NEV AKS+FWYFL ++KK+KK+ G++L +NE
Sbjct  4    IHQYQVVGRKAPTESDPNPPAFRMKLFAPNEVLAKSRFWYFLHQMKKMKKTTGEILCLNE  63

Query  277  IFEKCPTXVKNYGIWLRYQSRTGYHNMYKEFRDTTLNGAVEQMYTEMASR  426
            + EK    VKNYG+W+RY SR+G HNMYKE+RD TL GAVEQMY E+A R
Sbjct  64   LREKNKRIVKNYGVWIRYNSRSGTHNMYKEYRDVTLCGAVEQMYAELAGR  113



>ref|XP_009831602.1| hypothetical protein H257_07690 [Aphanomyces astaci]
 gb|ETV78883.1| hypothetical protein H257_07690 [Aphanomyces astaci]
Length=177

 Score =   155 bits (393),  Expect = 8e-45, Method: Compositional matrix adjust.
 Identities = 67/110 (61%), Positives = 88/110 (80%), Gaps = 0/110 (0%)
 Frame = +1

Query  97   FHQYQVVGRALPSETDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQVLAINE  276
             H YQVVGR  P+ETD +P  +RMKL+A NEV AKS+FWYFL ++KK+KK+ G++L++NE
Sbjct  4    IHHYQVVGRKAPTETDPNPPAFRMKLFAPNEVLAKSRFWYFLHQMKKMKKTTGEILSVNE  63

Query  277  IFEKCPTXVKNYGIWLRYQSRTGYHNMYKEFRDTTLNGAVEQMYTEMASR  426
            + EK    VKNYG+W+RY SR+G HNMYKE+RD TLN A+EQ+Y E+A R
Sbjct  64   LREKNKRIVKNYGVWIRYNSRSGTHNMYKEYRDVTLNSAIEQLYAELAGR  113



>dbj|BAK07344.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=192

 Score =   156 bits (394),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 71/125 (57%), Positives = 99/125 (79%), Gaps = 2/125 (2%)
 Frame = +1

Query  52   SQEDGSVVAKMVTYRFHQYQVVGRALPSETDEHPKIYRMKLWATNEVRAKSKFWYFLRKL  231
            S +   VVAKM   RF +Y ++GR+LP+E++  PK+YRM+++A N+V AKS+FWYFLR+L
Sbjct  11   SSKKECVVAKMA--RFTEYSILGRSLPTESEPTPKLYRMRIFAPNQVVAKSRFWYFLRQL  68

Query  232  KKVKKSNGQVLAINEIFEKCPTXVKNYGIWLRYQSRTGYHNMYKEFRDTTLNGAVEQMYT  411
            KKVKK+NG+++ +N I EK P  VKN+GIWLRY SR+G HNMYKEFR+ +  GAVE +Y 
Sbjct  69   KKVKKANGEIVGVNVIHEKRPLKVKNFGIWLRYDSRSGTHNMYKEFRELSRVGAVEALYQ  128

Query  412  EMASR  426
            ++A+R
Sbjct  129  DLAAR  133



>gb|KDR72699.1| hypothetical protein GALMADRAFT_142989 [Galerina marginata CBS 
339.88]
Length=170

 Score =   155 bits (392),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 68/110 (62%), Positives = 89/110 (81%), Gaps = 0/110 (0%)
 Frame = +1

Query  97   FHQYQVVGRALPSETDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQVLAINE  276
              ++QVVGR LP+E+D  PKIYRM+++A NEV AKS+FWYFLR+LKKVKK+NG+++ +N 
Sbjct  3    LQEFQVVGRHLPTESDPTPKIYRMRIFAPNEVVAKSRFWYFLRQLKKVKKANGEIIGVNV  62

Query  277  IFEKCPTXVKNYGIWLRYQSRTGYHNMYKEFRDTTLNGAVEQMYTEMASR  426
            I EK P  VKN+GIWLRY SR+G HNMYKEFRD +   AV+ +Y +MA+R
Sbjct  63   IHEKKPLKVKNFGIWLRYDSRSGTHNMYKEFRDLSRADAVKSLYQDMAAR  112



>ref|XP_001614192.1| 60S ribosomal protein L18a [Plasmodium vivax Sal-1]
 gb|EDL44465.1| 60S ribosomal protein L18a, putative [Plasmodium vivax]
Length=184

 Score =   155 bits (392),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 66/110 (60%), Positives = 88/110 (80%), Gaps = 0/110 (0%)
 Frame = +1

Query  97   FHQYQVVGRALPSETDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQVLAINE  276
             HQY +VGRA+P+E D++P +YRM ++A N+  AKS+FWYF++K+ K+KKSNG++LA  +
Sbjct  13   IHQYHIVGRAIPTEKDKNPNVYRMCIFAKNDTNAKSRFWYFMKKINKLKKSNGELLACEQ  72

Query  277  IFEKCPTXVKNYGIWLRYQSRTGYHNMYKEFRDTTLNGAVEQMYTEMASR  426
            I E+ P  VKNYG+ LRY SRTG HNMYKEFRDTT  GA+ Q+Y+EMA R
Sbjct  73   IRERFPLRVKNYGVLLRYDSRTGTHNMYKEFRDTTKEGAIAQLYSEMAGR  122



>gb|KJA26912.1| hypothetical protein HYPSUDRAFT_132230 [Hypholoma sublateritium 
FD-334 SS-4]
Length=170

 Score =   155 bits (391),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 69/110 (63%), Positives = 89/110 (81%), Gaps = 0/110 (0%)
 Frame = +1

Query  97   FHQYQVVGRALPSETDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQVLAINE  276
            F +YQVVGR LP+E +  PKIYRM+++A NEV AKS+FWYFLR+LKKVKK+NG+++ +N 
Sbjct  3    FTEYQVVGRHLPTEAEPTPKIYRMRIFAPNEVVAKSRFWYFLRQLKKVKKANGEIIGVNV  62

Query  277  IFEKCPTXVKNYGIWLRYQSRTGYHNMYKEFRDTTLNGAVEQMYTEMASR  426
            I EK P  VKN+GIWLRY SR+G HNMYKEFRD +   AV+ +Y +MA+R
Sbjct  63   IHEKKPLKVKNFGIWLRYDSRSGTHNMYKEFRDLSRADAVKSLYQDMAAR  112



>emb|CDS03349.1| Putative 60S ribosomal protein L20 [Absidia idahoensis var. thermophila]
Length=175

 Score =   155 bits (391),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 66/111 (59%), Positives = 91/111 (82%), Gaps = 0/111 (0%)
 Frame = +1

Query  94   RFHQYQVVGRALPSETDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQVLAIN  273
            +FH+YQVVGR LPSE + HPK+YRM+++A N V AKS+FWY+L+KL+KVKK+ G+++++N
Sbjct  3    KFHEYQVVGRKLPSEKEPHPKLYRMRVFAPNTVVAKSRFWYYLKKLRKVKKAAGEIVSVN  62

Query  274  EIFEKCPTXVKNYGIWLRYQSRTGYHNMYKEFRDTTLNGAVEQMYTEMASR  426
            EIFEK P  +KN+GIW+RY SR+G HNMYKE+R  +   AVE  Y +MA+R
Sbjct  63   EIFEKRPEQIKNFGIWIRYDSRSGTHNMYKEYRSMSRVEAVENCYQDMAAR  113



>emb|CDH57447.1| 60s ribosomal protein l20 [Lichtheimia corymbifera JMRC:FSU:9682]
Length=175

 Score =   155 bits (391),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 66/111 (59%), Positives = 91/111 (82%), Gaps = 0/111 (0%)
 Frame = +1

Query  94   RFHQYQVVGRALPSETDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQVLAIN  273
            +FH+YQVVGR LPSE + HPK+YRM+++A N V AKS+FWY+L+KL+KVKK+ G+++++N
Sbjct  3    KFHEYQVVGRKLPSEKEPHPKLYRMRVFAPNTVVAKSRFWYYLKKLRKVKKAAGEIVSVN  62

Query  274  EIFEKCPTXVKNYGIWLRYQSRTGYHNMYKEFRDTTLNGAVEQMYTEMASR  426
            EIFEK P  +KN+GIW+RY SR+G HNMYKE+R  +   AVE  Y +MA+R
Sbjct  63   EIFEKHPEQIKNFGIWIRYDSRSGTHNMYKEYRSMSRVEAVENCYQDMAAR  113



>gb|EFA83144.1| S60 ribosomal protein L18a [Polysphondylium pallidum PN500]
Length=173

 Score =   154 bits (390),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 66/110 (60%), Positives = 90/110 (82%), Gaps = 0/110 (0%)
 Frame = +1

Query  97   FHQYQVVGRALPSETDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQVLAINE  276
            FH++QVVGR +P+E + HPK++RM+L+A   V AKS+FWYFL K++K+KK+ G++L + E
Sbjct  3    FHEFQVVGRHVPTEREAHPKLFRMRLFAKTSVHAKSRFWYFLSKIQKMKKATGEILNVTE  62

Query  277  IFEKCPTXVKNYGIWLRYQSRTGYHNMYKEFRDTTLNGAVEQMYTEMASR  426
            IFE+ P  VKN+GI++RY SR+G HN+YKE+RDTT  GAV QMY EMASR
Sbjct  63   IFEEKPLQVKNFGIFIRYNSRSGTHNIYKEYRDTTRVGAVAQMYDEMASR  112



>emb|CDS14547.1| Putative 60S ribosomal protein L20 [Absidia idahoensis var. thermophila]
 emb|CDS04618.1| Putative 60S ribosomal protein L20 [Absidia idahoensis var. thermophila]
Length=175

 Score =   154 bits (390),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 66/111 (59%), Positives = 91/111 (82%), Gaps = 0/111 (0%)
 Frame = +1

Query  94   RFHQYQVVGRALPSETDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQVLAIN  273
            +FH+YQVVGR LPSE + HPK+YRM+++A N V AKS+FWY+L+KL+KVKK+ G+++++N
Sbjct  3    KFHEYQVVGRKLPSEKEPHPKLYRMRVFAPNTVVAKSRFWYYLKKLRKVKKAAGEIVSVN  62

Query  274  EIFEKCPTXVKNYGIWLRYQSRTGYHNMYKEFRDTTLNGAVEQMYTEMASR  426
            EIFEK P  +KN+GIW+RY SR+G HNMYKE+R  +   AVE  Y +MA+R
Sbjct  63   EIFEKRPEQIKNFGIWIRYDSRSGTHNMYKEYRSMSRVEAVENCYQDMAAR  113



>ref|XP_007791911.1| putative 60s ribosomal protein l20 protein [Eutypa lata UCREL1]
 gb|EMR68991.1| putative 60s ribosomal protein l20 protein [Eutypa lata UCREL1]
Length=174

 Score =   154 bits (390),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 66/111 (59%), Positives = 92/111 (83%), Gaps = 0/111 (0%)
 Frame = +1

Query  94   RFHQYQVVGRALPSETDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQVLAIN  273
            R  +YQV+GR LP+E++  PK+YRM+++A NEV AKS+FWYFL KL+KVKKSNG+++++N
Sbjct  3    RLQEYQVIGRHLPTESNPTPKLYRMRIFAPNEVVAKSRFWYFLMKLRKVKKSNGEIVSLN  62

Query  274  EIFEKCPTXVKNYGIWLRYQSRTGYHNMYKEFRDTTLNGAVEQMYTEMASR  426
             I EK P  VKN+GIW+RY SR+G HNMYKE+R+T+   AVE +Y++MA+R
Sbjct  63   TIHEKRPLKVKNFGIWIRYDSRSGTHNMYKEYRETSRTDAVEALYSDMAAR  113



>ref|XP_005702735.1| 60S ribosomal protein L18Ae [Galdieria sulphuraria]
 gb|EME26215.1| 60S ribosomal protein L18Ae [Galdieria sulphuraria]
Length=178

 Score =   154 bits (390),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 69/110 (63%), Positives = 90/110 (82%), Gaps = 0/110 (0%)
 Frame = +1

Query  97   FHQYQVVGRALPSETDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQVLAINE  276
             HQY VVGR +P++ +  P IYR+K++A N V AKS+FWYFLRKLK+VKKS+G++L I+E
Sbjct  5    LHQYSVVGRKIPTQEEPEPPIYRLKIFAPNVVNAKSRFWYFLRKLKRVKKSSGEILNISE  64

Query  277  IFEKCPTXVKNYGIWLRYQSRTGYHNMYKEFRDTTLNGAVEQMYTEMASR  426
            IFEK  T VKNYGIW+RY+SR+   NMY+E+RD T+NGAVEQMY +M+ R
Sbjct  65   IFEKKSTQVKNYGIWIRYKSRSDTINMYREYRDVTVNGAVEQMYKDMSGR  114



>ref|XP_007394375.1| hypothetical protein PHACADRAFT_253712 [Phanerochaete carnosa 
HHB-10118-sp]
 gb|EKM56529.1| hypothetical protein PHACADRAFT_253712 [Phanerochaete carnosa 
HHB-10118-sp]
Length=170

 Score =   154 bits (390),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 68/110 (62%), Positives = 90/110 (82%), Gaps = 0/110 (0%)
 Frame = +1

Query  97   FHQYQVVGRALPSETDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQVLAINE  276
              +YQVVGR LP+ETD +PKIYRM+++A NEV AKS+FWYFLR+LKKVKK++G+++ +N 
Sbjct  3    LQEYQVVGRHLPTETDPNPKIYRMRIFAPNEVVAKSRFWYFLRQLKKVKKASGEIIGVNV  62

Query  277  IFEKCPTXVKNYGIWLRYQSRTGYHNMYKEFRDTTLNGAVEQMYTEMASR  426
            I EK P  VKN+GIWLRY SR+G HNMYKEFR+ +   AV+ +Y +MA+R
Sbjct  63   IHEKKPLKVKNFGIWLRYDSRSGTHNMYKEFRELSRADAVKALYQDMAAR  112



>ref|XP_008815720.1| 50S ribosomal protein L18Ae [Plasmodium inui San Antonio 1]
 gb|EUD67710.1| 50S ribosomal protein L18Ae [Plasmodium inui San Antonio 1]
Length=184

 Score =   155 bits (391),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 67/110 (61%), Positives = 87/110 (79%), Gaps = 0/110 (0%)
 Frame = +1

Query  97   FHQYQVVGRALPSETDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQVLAINE  276
             HQY +VGRA+PSE D++P +YRM ++A N+  AKS+FWYF++K+ K+KKSNG++LA   
Sbjct  13   IHQYHIVGRAIPSEKDKNPNVYRMCIFAKNDTNAKSRFWYFMKKINKLKKSNGELLACEL  72

Query  277  IFEKCPTXVKNYGIWLRYQSRTGYHNMYKEFRDTTLNGAVEQMYTEMASR  426
            I E+ P  VKNYG+ LRY SRTG HNMYKEFRDTT  GA+ Q+Y+EMA R
Sbjct  73   IRERFPLRVKNYGVLLRYDSRTGTHNMYKEFRDTTKEGAIAQLYSEMAGR  122



>gb|KIL64760.1| hypothetical protein M378DRAFT_77817 [Amanita muscaria Koide 
BX008]
Length=170

 Score =   154 bits (389),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 69/110 (63%), Positives = 89/110 (81%), Gaps = 0/110 (0%)
 Frame = +1

Query  97   FHQYQVVGRALPSETDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQVLAINE  276
              +YQVVGR LP+E+D  PKIYRM+++A NEV AKS+FWYFLR+LKKVKK+NG+V+A+N 
Sbjct  3    LQEYQVVGRHLPTESDPTPKIYRMRIFAPNEVVAKSRFWYFLRQLKKVKKANGEVIAVNT  62

Query  277  IFEKCPTXVKNYGIWLRYQSRTGYHNMYKEFRDTTLNGAVEQMYTEMASR  426
            I EK P  +K +GIWLRY SR+G HNMYKEFRD +   AV+ +Y +MA+R
Sbjct  63   IQEKRPLKIKIFGIWLRYDSRSGTHNMYKEFRDLSRADAVKSLYQDMAAR  112



>gb|ERS97659.1| 60S ribosomal protein L20 [Sporothrix schenckii ATCC 58251]
Length=185

 Score =   155 bits (391),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 66/111 (59%), Positives = 89/111 (80%), Gaps = 0/111 (0%)
 Frame = +1

Query  94   RFHQYQVVGRALPSETDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQVLAIN  273
            R H+YQV+GR LP+ET+  P +YRM+++A N V AKS+FWYFLR LKKVKK+ G+++A+N
Sbjct  14   RLHEYQVIGRHLPTETNPSPALYRMRIFAPNTVVAKSRFWYFLRGLKKVKKATGEIVAVN  73

Query  274  EIFEKCPTXVKNYGIWLRYQSRTGYHNMYKEFRDTTLNGAVEQMYTEMASR  426
            EI EK P  VKN+GIWLRY SR+G HNMYKE+R+ +   A E +Y++MA+R
Sbjct  74   EISEKHPLKVKNFGIWLRYDSRSGTHNMYKEYRELSRTAAAESLYSDMAAR  124



>ref|XP_003656447.1| 60S ribosomal protein L20 [Thielavia terrestris NRRL 8126]
 gb|AEO70111.1| hypothetical protein THITE_2121081 [Thielavia terrestris NRRL 
8126]
Length=174

 Score =   154 bits (389),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 65/111 (59%), Positives = 90/111 (81%), Gaps = 0/111 (0%)
 Frame = +1

Query  94   RFHQYQVVGRALPSETDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQVLAIN  273
            R H+YQV+GR LP+E +  P +YRM+++A NEV AKS+FWYFLR L+KVKK+ G+++++N
Sbjct  3    RLHEYQVIGRHLPTEANPTPNLYRMRIFAPNEVVAKSRFWYFLRGLRKVKKATGEIVSVN  62

Query  274  EIFEKCPTXVKNYGIWLRYQSRTGYHNMYKEFRDTTLNGAVEQMYTEMASR  426
            EI EK P  VKN+GIW+RY SR+G HNMYKE+R+T+   AVE +Y +MA+R
Sbjct  63   EISEKHPLKVKNFGIWIRYDSRSGTHNMYKEYRETSRTAAVEALYADMAAR  113



>gb|KIK70034.1| hypothetical protein GYMLUDRAFT_34471 [Gymnopus luxurians FD-317 
M1]
Length=170

 Score =   154 bits (389),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 68/110 (62%), Positives = 89/110 (81%), Gaps = 0/110 (0%)
 Frame = +1

Query  97   FHQYQVVGRALPSETDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQVLAINE  276
              +YQVVGR LP+E+D  PKIYRM+++A NEV AKS+FWYFLR+LKKVKK+NG+++ +N 
Sbjct  3    LQEYQVVGRHLPTESDPTPKIYRMRIFAPNEVVAKSRFWYFLRQLKKVKKANGEIIGVNV  62

Query  277  IFEKCPTXVKNYGIWLRYQSRTGYHNMYKEFRDTTLNGAVEQMYTEMASR  426
            I EK P  VKN+GIWLRY SR+G HNMYKE+R+ +   AV+ MY +MA+R
Sbjct  63   IHEKKPLKVKNFGIWLRYDSRSGTHNMYKEYRELSRADAVKSMYQDMAAR  112



>ref|XP_003029116.1| 60S ribosomal protein L20 [Schizophyllum commune H4-8]
 gb|EFI94213.1| hypothetical protein SCHCODRAFT_83207 [Schizophyllum commune 
H4-8]
Length=171

 Score =   154 bits (389),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 68/110 (62%), Positives = 90/110 (82%), Gaps = 0/110 (0%)
 Frame = +1

Query  97   FHQYQVVGRALPSETDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQVLAINE  276
            F +YQVVGR LP+E D +PKIYRM+++A NEV AKS+FWYFLR+LKKVKK++G+++ +N 
Sbjct  3    FVEYQVVGRHLPTEQDPNPKIYRMRIFAPNEVVAKSRFWYFLRQLKKVKKASGEIIGVNV  62

Query  277  IFEKCPTXVKNYGIWLRYQSRTGYHNMYKEFRDTTLNGAVEQMYTEMASR  426
            I EK P  VKN+GIWLRY SR+G HNMYKEFR+ +   AV+ +Y +MA+R
Sbjct  63   IHEKKPLKVKNFGIWLRYDSRSGTHNMYKEFRELSRTAAVKSLYQDMAAR  112



>gb|KIO01130.1| hypothetical protein M404DRAFT_1003406 [Pisolithus tinctorius 
Marx 270]
Length=170

 Score =   154 bits (389),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 67/110 (61%), Positives = 90/110 (82%), Gaps = 0/110 (0%)
 Frame = +1

Query  97   FHQYQVVGRALPSETDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQVLAINE  276
              +YQVVGR LP+E+D  PKIYRM+++A NEV AKS+FWYFLR+LKKVKK++G+++ +N 
Sbjct  3    LQEYQVVGRHLPTESDPTPKIYRMRIFAPNEVVAKSRFWYFLRQLKKVKKASGEIIGVNV  62

Query  277  IFEKCPTXVKNYGIWLRYQSRTGYHNMYKEFRDTTLNGAVEQMYTEMASR  426
            I+EK P  VKN+GIWLRY SR+G HNMYKEFR+ +   AV+ +Y +MA+R
Sbjct  63   IYEKKPLKVKNFGIWLRYDSRSGTHNMYKEFRELSRADAVKSLYQDMAAR  112



>ref|XP_007313367.1| hypothetical protein SERLADRAFT_456475 [Serpula lacrymans var. 
lacrymans S7.9]
 gb|EGO03354.1| hypothetical protein SERLA73DRAFT_174811 [Serpula lacrymans var. 
lacrymans S7.3]
 gb|EGO29125.1| hypothetical protein SERLADRAFT_456475 [Serpula lacrymans var. 
lacrymans S7.9]
Length=170

 Score =   154 bits (389),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 67/110 (61%), Positives = 89/110 (81%), Gaps = 0/110 (0%)
 Frame = +1

Query  97   FHQYQVVGRALPSETDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQVLAINE  276
              +YQVVGR LP+E+D  PKIYRM+++A NEV AKS+FWYFLR+LKKVKK+NG+++ +N 
Sbjct  3    LQEYQVVGRHLPTESDPTPKIYRMRIFAPNEVVAKSRFWYFLRQLKKVKKANGEIIGVNV  62

Query  277  IFEKCPTXVKNYGIWLRYQSRTGYHNMYKEFRDTTLNGAVEQMYTEMASR  426
            I EK P  +KN+GIWLRY SR+G HNMYKEFR+ +   AV+ +Y +MA+R
Sbjct  63   IHEKKPLKIKNFGIWLRYDSRSGTHNMYKEFRELSRADAVKSLYQDMAAR  112



>ref|XP_002783609.1| 60S ribosomal protein L18A-2, putative [Perkinsus marinus ATCC 
50983]
 gb|EER15405.1| 60S ribosomal protein L18A-2, putative [Perkinsus marinus ATCC 
50983]
Length=184

 Score =   154 bits (389),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 69/114 (61%), Positives = 87/114 (76%), Gaps = 0/114 (0%)
 Frame = +1

Query  85   VTYRFHQYQVVGRALPSETDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQVL  264
            ++ + H YQ+VGRA PS  +  PKI+RMK++A N V AKSKFWY+++++ K K + G++L
Sbjct  8    ISMKMHLYQLVGRAAPSVKNPKPKIFRMKMFARNSVVAKSKFWYYMKRITKAKLTGGEML  67

Query  265  AINEIFEKCPTXVKNYGIWLRYQSRTGYHNMYKEFRDTTLNGAVEQMYTEMASR  426
             I E FEK PT V NYGIWLRY SR+G HNMYKE+RDTTL GAV QMY EMA R
Sbjct  68   GITECFEKHPTTVNNYGIWLRYDSRSGTHNMYKEYRDTTLTGAVGQMYQEMAGR  121



>gb|KIK92807.1| hypothetical protein PAXRUDRAFT_13013 [Paxillus rubicundulus 
Ve08.2h10]
Length=170

 Score =   154 bits (388),  Expect = 5e-44, Method: Compositional matrix adjust.
 Identities = 68/110 (62%), Positives = 88/110 (80%), Gaps = 0/110 (0%)
 Frame = +1

Query  97   FHQYQVVGRALPSETDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQVLAINE  276
              +YQVVGR LP+E D  PKIYRM+++A NEV AKS+FWYFLR+LKKVKK++G+++ +N 
Sbjct  3    LQEYQVVGRHLPTELDPTPKIYRMRIFAPNEVVAKSRFWYFLRQLKKVKKASGEIIGVNV  62

Query  277  IFEKCPTXVKNYGIWLRYQSRTGYHNMYKEFRDTTLNGAVEQMYTEMASR  426
            I EK P  VKN+GIWLRY SR+G HNMYKEFRD +   AV+ +Y +MA+R
Sbjct  63   IHEKKPLKVKNFGIWLRYDSRSGTHNMYKEFRDLSRADAVKSLYQDMAAR  112



>gb|EPZ32213.1| 60S ribosomal protein L20-B [Rozella allomycis CSF55]
Length=178

 Score =   154 bits (388),  Expect = 5e-44, Method: Compositional matrix adjust.
 Identities = 67/115 (58%), Positives = 91/115 (79%), Gaps = 0/115 (0%)
 Frame = +1

Query  82   MVTYRFHQYQVVGRALPSETDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQV  261
            M   ++H+YQ++GR LP+  +  P++Y+M+++A NEV  KS+FWYFL+KLKKVKK+NG++
Sbjct  1    MTESKYHEYQIIGRKLPTAAEPVPRLYKMRVFAKNEVVGKSRFWYFLQKLKKVKKANGEI  60

Query  262  LAINEIFEKCPTXVKNYGIWLRYQSRTGYHNMYKEFRDTTLNGAVEQMYTEMASR  426
            +A+NEIFEK P  VKNYGIWLRY SRTG HNMYKE+R+ +   AV   Y +MASR
Sbjct  61   VAVNEIFEKRPNQVKNYGIWLRYDSRTGTHNMYKEYREMSRVDAVHSCYQDMASR  115



>ref|XP_002259942.1| 60S ribosomal subunit protein L18 [Plasmodium knowlesi strain 
H]
 emb|CAQ41209.1| 60S ribosomal subunit protein L18, putative [Plasmodium knowlesi 
strain H]
Length=184

 Score =   154 bits (388),  Expect = 7e-44, Method: Compositional matrix adjust.
 Identities = 68/120 (57%), Positives = 90/120 (75%), Gaps = 0/120 (0%)
 Frame = +1

Query  67   SVVAKMVTYRFHQYQVVGRALPSETDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKK  246
            SV    +    HQY +VGRA+P+E D++P +YRM ++A N+  AKS+FWYF++K+ K+KK
Sbjct  3    SVADNSLKTNIHQYHIVGRAIPTEKDKNPNVYRMCIFAKNDTNAKSRFWYFMKKINKLKK  62

Query  247  SNGQVLAINEIFEKCPTXVKNYGIWLRYQSRTGYHNMYKEFRDTTLNGAVEQMYTEMASR  426
            SNG++LA   I E+ P  VKNYG+ LRY SRTG HNMYKEFRDTT  GA+ Q+Y+EMA R
Sbjct  63   SNGELLACELIRERFPLRVKNYGVLLRYDSRTGTHNMYKEFRDTTKEGAISQLYSEMAGR  122



>gb|KDQ32854.1| hypothetical protein PLEOSDRAFT_1051744 [Pleurotus ostreatus 
PC15]
Length=170

 Score =   153 bits (387),  Expect = 7e-44, Method: Compositional matrix adjust.
 Identities = 67/110 (61%), Positives = 89/110 (81%), Gaps = 0/110 (0%)
 Frame = +1

Query  97   FHQYQVVGRALPSETDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQVLAINE  276
              ++QVVGR LP+E+D  PKIYRM+++A NEV AKS+FWYFLR+LKKVKK++G+++ +N 
Sbjct  3    LQEFQVVGRHLPTESDPTPKIYRMRIFAPNEVVAKSRFWYFLRQLKKVKKASGEIIGVNV  62

Query  277  IFEKCPTXVKNYGIWLRYQSRTGYHNMYKEFRDTTLNGAVEQMYTEMASR  426
            I EK P  VKN+GIWLRY SR+G HNMYKEFRD +   AV+ +Y +MA+R
Sbjct  63   IHEKKPLKVKNFGIWLRYDSRSGTHNMYKEFRDLSRADAVKSLYQDMAAR  112



>gb|KIM56681.1| hypothetical protein SCLCIDRAFT_1220115 [Scleroderma citrinum 
Foug A]
Length=170

 Score =   153 bits (386),  Expect = 8e-44, Method: Compositional matrix adjust.
 Identities = 67/110 (61%), Positives = 89/110 (81%), Gaps = 0/110 (0%)
 Frame = +1

Query  97   FHQYQVVGRALPSETDEHPKIYRMKLWATNEVRAKSKFWYFLRKLKKVKKSNGQVLAINE  276
              +YQVVGR LP+E+D +PKIYRM+++A NEV AKS+FWYFLR+LKKVKK++G+++ +N 
Sbjct  3    LQEYQVVGRHLPTESDPNPKIYRMRIFAPNEVVAKSRFWYFLRQLKKVKKASGEIIGVNV  62

Query  277  IFEKCPTXVKNYGIWLRYQSRTGYHNMYKEFRDTTLNGAVEQMYTEMASR  426
            I EK P  VKN+GIWLRY SR+G HNMYKEFR+ +   AV  +Y +MA+R
Sbjct  63   IHEKKPLKVKNFGIWLRYDSRSGTHNMYKEFRELSRADAVRSLYQDMAAR  112



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 553413336175