BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFF038H20

Length=510
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009789408.1|  PREDICTED: proliferation-associated protein ...    295   1e-95   Nicotiana sylvestris
ref|XP_009599246.1|  PREDICTED: proliferation-associated protein ...    291   2e-94   Nicotiana tomentosiformis
ref|XP_004137704.1|  PREDICTED: proliferation-associated protein ...    290   4e-94   Cucumis sativus [cucumbers]
ref|XP_006381246.1|  hypothetical protein POPTR_0006s10320g             286   5e-94   
ref|XP_009599304.1|  PREDICTED: proliferation-associated protein ...    288   2e-93   Nicotiana tomentosiformis
ref|XP_008442393.1|  PREDICTED: proliferation-associated protein ...    288   3e-93   Cucumis melo [Oriental melon]
ref|XP_009773246.1|  PREDICTED: proliferation-associated protein ...    288   3e-93   Nicotiana sylvestris
ref|XP_009599303.1|  PREDICTED: proliferation-associated protein ...    288   6e-93   Nicotiana tomentosiformis
ref|XP_010264591.1|  PREDICTED: proliferation-associated protein ...    286   1e-92   Nelumbo nucifera [Indian lotus]
gb|ABK95017.1|  unknown                                                 286   2e-92   Populus trichocarpa [western balsam poplar]
ref|XP_004242516.1|  PREDICTED: proliferation-associated protein ...    286   2e-92   Solanum lycopersicum
ref|XP_002308228.2|  hypothetical protein POPTR_0006s10320g             286   2e-92   
gb|EYU41925.1|  hypothetical protein MIMGU_mgv1a007938mg                286   2e-92   Erythranthe guttata [common monkey flower]
ref|NP_001275188.1|  EBP1                                               285   2e-92   Solanum tuberosum [potatoes]
ref|XP_002262986.2|  PREDICTED: proliferation-associated protein 2G4    285   6e-92   Vitis vinifera
ref|XP_011046861.1|  PREDICTED: proliferation-associated protein ...    285   7e-92   Populus euphratica
ref|XP_002530504.1|  proliferation-associated 2g4, putative             284   1e-91   Ricinus communis
ref|XP_006344058.1|  PREDICTED: proliferation-associated protein ...    284   1e-91   Solanum tuberosum [potatoes]
ref|XP_006344057.1|  PREDICTED: proliferation-associated protein ...    284   1e-91   Solanum tuberosum [potatoes]
gb|EYU26681.1|  hypothetical protein MIMGU_mgv1a007877mg                284   1e-91   Erythranthe guttata [common monkey flower]
ref|XP_011019082.1|  PREDICTED: proliferation-associated protein ...    283   2e-91   Populus euphratica
ref|XP_004156612.1|  PREDICTED: LOW QUALITY PROTEIN: proliferatio...    283   3e-91   
ref|XP_008464212.1|  PREDICTED: proliferation-associated protein ...    285   4e-91   Cucumis melo [Oriental melon]
ref|XP_010037691.1|  PREDICTED: proliferation-associated protein 2G4    282   4e-91   Eucalyptus grandis [rose gum]
ref|XP_004240407.1|  PREDICTED: proliferation-associated protein ...    282   7e-91   Solanum lycopersicum
ref|XP_010321752.1|  PREDICTED: proliferation-associated protein ...    282   7e-91   Solanum lycopersicum
ref|XP_006576221.1|  PREDICTED: uncharacterized protein LOC100784...    281   1e-90   
gb|AEY75257.1|  putative DNA binding protein                            281   1e-90   Atriplex canescens [shadscale]
ref|XP_009402229.1|  PREDICTED: proliferation-associated protein ...    281   1e-90   Musa acuminata subsp. malaccensis [pisang utan]
ref|NP_001242070.1|  uncharacterized protein LOC100784176               281   2e-90   
gb|KDP22867.1|  hypothetical protein JCGZ_00454                         281   2e-90   Jatropha curcas
ref|XP_009376423.1|  PREDICTED: proliferation-associated protein ...    280   2e-90   Pyrus x bretschneideri [bai li]
gb|KHN42848.1|  Proliferation-associated protein 2G4                    280   3e-90   Glycine soja [wild soybean]
ref|XP_003516956.1|  PREDICTED: proliferation-associated protein 2G4    280   3e-90   Glycine max [soybeans]
ref|XP_009376419.1|  PREDICTED: proliferation-associated protein ...    280   3e-90   Pyrus x bretschneideri [bai li]
ref|XP_007205303.1|  hypothetical protein PRUPE_ppa006778mg             280   4e-90   
ref|XP_008805004.1|  PREDICTED: proliferation-associated protein ...    280   4e-90   Phoenix dactylifera
ref|XP_007026647.1|  Metallopeptidase M24 family protein isoform 2      276   4e-90   
ref|XP_006843644.1|  hypothetical protein AMTR_s00007p00167240          277   4e-90   
gb|KDO56711.1|  hypothetical protein CISIN_1g016183mg                   280   5e-90   Citrus sinensis [apfelsine]
ref|XP_008388269.1|  PREDICTED: proliferation-associated protein ...    280   6e-90   Malus domestica [apple tree]
ref|XP_002322994.2|  hypothetical protein POPTR_0016s12720g             279   8e-90   
ref|XP_008388270.1|  PREDICTED: proliferation-associated protein ...    279   8e-90   
ref|XP_006429434.1|  hypothetical protein CICLE_v10011909mg             279   9e-90   
ref|XP_011095038.1|  PREDICTED: proliferation-associated protein ...    279   1e-89   Sesamum indicum [beniseed]
ref|XP_008362268.1|  PREDICTED: proliferation-associated protein ...    279   1e-89   Malus domestica [apple tree]
ref|XP_009384793.1|  PREDICTED: proliferation-associated protein ...    279   1e-89   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010503881.1|  PREDICTED: proliferation-associated protein ...    278   3e-89   Camelina sativa [gold-of-pleasure]
ref|XP_011077533.1|  PREDICTED: proliferation-associated protein ...    278   3e-89   Sesamum indicum [beniseed]
ref|XP_010529897.1|  PREDICTED: proliferation-associated protein ...    278   4e-89   Tarenaya hassleriana [spider flower]
ref|XP_010426749.1|  PREDICTED: proliferation-associated protein ...    278   4e-89   Camelina sativa [gold-of-pleasure]
ref|XP_004489059.1|  PREDICTED: proliferation-associated protein ...    277   4e-89   Cicer arietinum [garbanzo]
gb|ABF66654.1|  EBP1                                                    277   5e-89   Ammopiptanthus mongolicus
ref|XP_010515611.1|  PREDICTED: proliferation-associated protein ...    277   7e-89   Camelina sativa [gold-of-pleasure]
ref|XP_010650887.1|  PREDICTED: proliferation-associated protein ...    276   9e-89   
gb|AFG29445.1|  Erb3 binding protein                                    276   1e-88   Nervilia fordii
ref|XP_002877825.1|  hypothetical protein ARALYDRAFT_906530             276   1e-88   Arabidopsis lyrata subsp. lyrata
ref|NP_001190060.1|  putative nuclear DNA-binding protein G2p           276   1e-88   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002278744.2|  PREDICTED: proliferation-associated protein ...    276   1e-88   Vitis vinifera
dbj|BAH19507.1|  AT3G51800                                              275   1e-88   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010907411.1|  PREDICTED: proliferation-associated protein ...    276   1e-88   Elaeis guineensis
ref|XP_010253797.1|  PREDICTED: proliferation-associated protein ...    276   2e-88   Nelumbo nucifera [Indian lotus]
ref|XP_007026646.1|  Metallopeptidase M24 family protein isoform 1      276   2e-88   
ref|NP_190748.1|  putative nuclear DNA-binding protein G2p              276   2e-88   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010676777.1|  PREDICTED: proliferation-associated protein 2G4    275   4e-88   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_004489058.1|  PREDICTED: proliferation-associated protein ...    277   5e-88   
ref|XP_010553237.1|  PREDICTED: proliferation-associated protein ...    275   5e-88   Tarenaya hassleriana [spider flower]
ref|NP_850679.1|  putative nuclear DNA-binding protein G2p              275   6e-88   Arabidopsis thaliana [mouse-ear cress]
emb|CDP09213.1|  unnamed protein product                                274   7e-88   Coffea canephora [robusta coffee]
gb|ACU19222.1|  unknown                                                 268   7e-88   Glycine max [soybeans]
gb|AAK25936.1|AF360226_1  putative nuclear DNA-binding protein G2p      274   9e-88   Arabidopsis thaliana [mouse-ear cress]
ref|XP_003623305.1|  Proliferation-associated protein 2G4               274   1e-87   Medicago truncatula
gb|ACJ85304.1|  unknown                                                 273   1e-87   Medicago truncatula
ref|XP_004492468.1|  PREDICTED: proliferation-associated protein ...    273   2e-87   Cicer arietinum [garbanzo]
gb|KFK34423.1|  hypothetical protein AALP_AA5G142900                    273   2e-87   Arabis alpina [alpine rockcress]
gb|KJB17056.1|  hypothetical protein B456_002G262700                    270   2e-87   Gossypium raimondii
ref|XP_010920808.1|  PREDICTED: proliferation-associated protein ...    273   3e-87   Elaeis guineensis
gb|KEH38647.1|  proliferation-associated 2G4-like protein               272   3e-87   Medicago truncatula
gb|EPS71863.1|  hypothetical protein M569_02886                         271   5e-87   Genlisea aurea
ref|XP_009123761.1|  PREDICTED: proliferation-associated protein ...    271   8e-87   Brassica rapa
ref|XP_010920804.1|  PREDICTED: proliferation-associated protein ...    273   9e-87   
emb|CDX73690.1|  BnaC08g23130D                                          271   1e-86   
ref|XP_009115883.1|  PREDICTED: proliferation-associated protein ...    271   1e-86   Brassica rapa
ref|XP_009115882.1|  PREDICTED: proliferation-associated protein ...    271   1e-86   Brassica rapa
ref|XP_008792800.1|  PREDICTED: proliferation-associated protein ...    271   1e-86   Phoenix dactylifera
ref|XP_006403880.1|  hypothetical protein EUTSA_v10010435mg             271   2e-86   Eutrema salsugineum [saltwater cress]
gb|KHG25370.1|  Proliferation-associated 2G4                            271   2e-86   Gossypium arboreum [tree cotton]
gb|KHG01253.1|  Proliferation-associated 2G4                            271   2e-86   Gossypium arboreum [tree cotton]
emb|CDX90633.1|  BnaA03g41480D                                          270   2e-86   
ref|XP_009136636.1|  PREDICTED: proliferation-associated protein ...    270   3e-86   Brassica rapa
ref|XP_004302550.1|  PREDICTED: proliferation-associated protein 2G4    270   4e-86   Fragaria vesca subsp. vesca
ref|NP_001241588.1|  uncharacterized protein LOC100781302               270   4e-86   Glycine max [soybeans]
gb|KJB17053.1|  hypothetical protein B456_002G262700                    270   6e-86   Gossypium raimondii
emb|CDX78041.1|  BnaA09g32360D                                          270   7e-86   
emb|CDY33263.1|  BnaA01g19300D                                          269   8e-86   Brassica napus [oilseed rape]
gb|KJB36944.1|  hypothetical protein B456_006G183700                    269   9e-86   Gossypium raimondii
gb|KJB36946.1|  hypothetical protein B456_006G183700                    268   1e-85   Gossypium raimondii
ref|XP_003529167.1|  PREDICTED: proliferation-associated protein 2G4    268   1e-85   Glycine max [soybeans]
ref|XP_010937887.1|  PREDICTED: proliferation-associated protein ...    268   1e-85   Elaeis guineensis
emb|CDY16291.1|  BnaC01g23260D                                          268   1e-85   Brassica napus [oilseed rape]
gb|ADK78215.1|  methionine aminopeptiase                                268   1e-85   Hordeum vulgare [barley]
gb|KHN39558.1|  Proliferation-associated protein 2G4                    268   1e-85   Glycine soja [wild soybean]
ref|XP_002440927.1|  hypothetical protein SORBIDRAFT_09g016610          268   2e-85   Sorghum bicolor [broomcorn]
gb|ABR26103.1|  proliferation-associated protein 2g4                    263   2e-85   Oryza sativa Indica Group [Indian rice]
ref|XP_006291295.1|  hypothetical protein CARUB_v10017431mg             267   2e-85   
ref|XP_007140242.1|  hypothetical protein PHAVU_008G095800g             268   3e-85   Phaseolus vulgaris [French bean]
ref|XP_007140243.1|  hypothetical protein PHAVU_008G095900g             267   4e-85   Phaseolus vulgaris [French bean]
gb|AHA84129.1|  DNA-binding protein GBP16                               267   4e-85   Phaseolus vulgaris [French bean]
ref|XP_006654286.1|  PREDICTED: proliferation-associated protein ...    267   6e-85   Oryza brachyantha
ref|XP_008789134.1|  PREDICTED: proliferation-associated protein ...    267   7e-85   Phoenix dactylifera
ref|XP_004962368.1|  PREDICTED: proliferation-associated protein ...    267   8e-85   Setaria italica
ref|XP_003568643.1|  PREDICTED: proliferation-associated protein 2G4    266   1e-84   Brachypodium distachyon [annual false brome]
ref|NP_001149216.1|  proliferation-associated protein 2G4               265   3e-84   Zea mays [maize]
gb|EMT31637.1|  Proliferation-associated protein 2G4                    267   5e-84   
emb|CDY29047.1|  BnaC07g32530D                                          264   7e-84   Brassica napus [oilseed rape]
gb|AGV54689.1|  proliferation-associated protein 2G4-like protein       263   1e-83   Phaseolus vulgaris [French bean]
gb|EMS60472.1|  Proliferation-associated protein 2G4                    267   1e-83   Triticum urartu
gb|EAY97646.1|  hypothetical protein OsI_19569                          262   4e-83   Oryza sativa Indica Group [Indian rice]
ref|NP_001055274.1|  Os05g0350500                                       262   5e-83   
gb|ABK24337.1|  unknown                                                 259   6e-82   Picea sitchensis
gb|AAF91445.1|AF281652_1  putative DNA binding protein                  257   5e-81   Atriplex hortensis
gb|AAB80919.1|  DNA-binding protein GBP16                               256   1e-80   Oryza sativa Japonica Group [Japonica rice]
ref|XP_009338145.1|  PREDICTED: proliferation-associated protein ...    244   2e-79   
ref|XP_008350687.1|  PREDICTED: proliferation-associated protein ...    243   4e-78   
ref|XP_010092793.1|  Proliferation-associated protein 2G4               250   4e-78   
ref|XP_001779761.1|  predicted protein                                  247   3e-77   
gb|EEE63363.1|  hypothetical protein OsJ_18175                          242   9e-76   Oryza sativa Japonica Group [Japonica rice]
ref|XP_008656355.1|  PREDICTED: proliferation-associated protein ...    234   5e-75   
ref|XP_002963479.1|  hypothetical protein SELMODRAFT_79780              240   6e-75   
ref|XP_002988189.1|  hypothetical protein SELMODRAFT_127648             240   6e-75   
ref|XP_008792832.1|  PREDICTED: proliferation-associated protein ...    240   1e-74   
ref|XP_010920806.1|  PREDICTED: proliferation-associated protein ...    240   2e-74   
ref|XP_001769950.1|  predicted protein                                  240   2e-74   
ref|XP_009799003.1|  PREDICTED: LOW QUALITY PROTEIN: proliferatio...    234   1e-72   Nicotiana sylvestris
gb|KJB36945.1|  hypothetical protein B456_006G183700                    230   8e-71   Gossypium raimondii
ref|XP_004148633.1|  PREDICTED: LOW QUALITY PROTEIN: proliferatio...    202   8e-61   
ref|XP_001765994.1|  predicted protein                                  198   2e-58   
ref|XP_008366899.1|  PREDICTED: proliferation-associated protein ...    196   5e-58   
gb|KHN22549.1|  Proliferation-associated protein 2G4                    190   7e-56   Glycine soja [wild soybean]
ref|XP_002947167.1|  hypothetical protein VOLCADRAFT_79596              176   6e-50   Volvox carteri f. nagariensis
ref|XP_001699126.1|  hypothetical protein CHLREDRAFT_139416             166   4e-46   Chlamydomonas reinhardtii
ref|XP_007253393.1|  PREDICTED: proliferation-associated protein ...    166   5e-46   Astyanax mexicanus [blind cave fish]
ref|XP_002423336.1|  Proliferation-associated protein 2G4, putative     165   8e-46   Pediculus humanus corporis [human body lice]
ref|NP_001002070.1|  proliferation-associated 2G4, a                    164   2e-45   Danio rerio [leopard danio]
ref|XP_008294311.1|  PREDICTED: proliferation-associated protein 2G4    164   2e-45   Stegastes partitus
ref|XP_003441515.1|  PREDICTED: proliferation-associated protein ...    164   2e-45   Oreochromis niloticus
ref|XP_010747198.1|  PREDICTED: proliferation-associated protein 2G4    164   3e-45   Larimichthys crocea [croceine croaker]
gb|ADX97052.1|  proliferation-associated protein 2g4                    164   3e-45   Perca flavescens
ref|XP_003448224.1|  PREDICTED: proliferation-associated protein ...    164   3e-45   Oreochromis niloticus
ref|XP_006807648.1|  PREDICTED: proliferation-associated protein ...    164   3e-45   Neolamprologus brichardi [lyretail cichlid]
ref|XP_004558839.1|  PREDICTED: proliferation-associated protein ...    163   5e-45   Maylandia zebra
ref|XP_005741395.1|  PREDICTED: proliferation-associated protein ...    163   5e-45   Pundamilia nyererei
gb|KHN18040.1|  Proliferation-associated protein 2G4                    157   5e-45   Glycine soja [wild soybean]
ref|XP_004544946.1|  PREDICTED: proliferation-associated protein ...    164   7e-45   Maylandia zebra
emb|CAG06775.1|  unnamed protein product                                162   8e-45   Tetraodon nigroviridis
ref|XP_005311138.1|  PREDICTED: LOW QUALITY PROTEIN: proliferatio...    162   1e-44   Chrysemys picta bellii
ref|XP_003741970.1|  PREDICTED: proliferation-associated protein ...    162   1e-44   Galendromus occidentalis
ref|XP_005801435.1|  PREDICTED: proliferation-associated protein ...    162   1e-44   Xiphophorus maculatus
ref|XP_004085494.1|  PREDICTED: proliferation-associated protein ...    162   1e-44   Oryzias latipes [Japanese rice fish]
ref|XP_008411912.1|  PREDICTED: proliferation-associated protein ...    162   1e-44   Poecilia reticulata
ref|XP_004931156.1|  PREDICTED: proliferation-associated protein ...    162   1e-44   Bombyx mori [silk moth]
ref|XP_969584.1|  PREDICTED: proliferation-associated protein 2G4       162   1e-44   Tribolium castaneum [rust-red flour beetle]
ref|XP_008317097.1|  PREDICTED: proliferation-associated protein ...    162   2e-44   Cynoglossus semilaevis [half-smooth tongue sole]
ref|XP_006629280.1|  PREDICTED: proliferation-associated protein ...    162   2e-44   Lepisosteus oculatus
ref|XP_007556640.1|  PREDICTED: proliferation-associated protein ...    161   3e-44   Poecilia formosa
ref|XP_009011773.1|  hypothetical protein HELRODRAFT_156370             161   3e-44   Helobdella robusta
ref|XP_010764812.1|  PREDICTED: proliferation-associated protein 2G4    161   3e-44   Notothenia coriiceps [yellowbelly rockcod]
ref|XP_008279469.1|  PREDICTED: proliferation-associated protein ...    161   4e-44   Stegastes partitus
ref|XP_010782747.1|  PREDICTED: proliferation-associated protein ...    160   5e-44   Notothenia coriiceps [yellowbelly rockcod]
ref|XP_008318205.1|  PREDICTED: proliferation-associated protein ...    160   6e-44   Cynoglossus semilaevis [half-smooth tongue sole]
ref|XP_010907413.1|  PREDICTED: proliferation-associated protein ...    158   2e-43   
gb|ACI68772.1|  Proliferation-associated protein 2G4                    156   2e-43   Salmo salar
ref|XP_001984453.1|  GH15010                                            159   3e-43   Drosophila grimshawi
emb|CAJ82581.1|  proliferation-associated 2G4                           157   5e-43   Xenopus tropicalis [western clawed frog]
ref|XP_005650680.1|  proliferation-associated protein 1                 158   5e-43   Coccomyxa subellipsoidea C-169
ref|XP_003973252.1|  PREDICTED: proliferation-associated protein ...    157   7e-43   
ref|XP_002047403.1|  GJ11948                                            157   8e-43   Drosophila virilis
ref|NP_001008439.1|  ErbB3-binding protein 1                            157   8e-43   Xenopus tropicalis [western clawed frog]
ref|NP_001083993.1|  proliferation-associated 2G4, 38kD                 157   9e-43   Xenopus laevis [clawed frog]
gb|AAH44287.1|  Pa2g4 protein                                           157   9e-43   Xenopus laevis [clawed frog]
ref|XP_004070502.1|  PREDICTED: proliferation-associated protein ...    157   9e-43   Oryzias latipes [Japanese rice fish]
ref|XP_010745944.1|  PREDICTED: proliferation-associated protein ...    157   1e-42   Larimichthys crocea [croceine croaker]
emb|CDQ89185.1|  unnamed protein product                                157   2e-42   Oncorhynchus mykiss
ref|XP_005184671.1|  PREDICTED: proliferation-associated protein 2G4    157   2e-42   Musca domestica
ref|XP_010879916.1|  PREDICTED: proliferation-associated protein ...    156   2e-42   Esox lucius
gb|ACI33074.1|  Proliferation-associated protein 2G4                    156   2e-42   Salmo salar
gb|ACI33868.1|  Proliferation-associated protein 2G4                    156   2e-42   Salmo salar
gb|ENN76413.1|  hypothetical protein YQE_07074                          156   3e-42   Dendroctonus ponderosae
ref|XP_001363571.1|  PREDICTED: proliferation-associated protein 2G4    156   3e-42   Monodelphis domestica
gb|AEE62360.1|  unknown                                                 156   3e-42   Dendroctonus ponderosae
emb|CDQ74715.1|  unnamed protein product                                155   4e-42   Oncorhynchus mykiss
gb|AFM86347.1|  proliferation-associated 2G4                            155   5e-42   Callorhinchus milii [Australian ghost shark]
gb|ACO12262.1|  Proliferation-associated protein 2G4                    155   6e-42   Lepeophtheirus salmonis
ref|XP_002062021.1|  GK16873                                            155   6e-42   Drosophila willistoni
ref|XP_011209005.1|  PREDICTED: proliferation-associated protein 2G4    155   6e-42   Bactrocera dorsalis [papaya fruit fly]
ref|XP_011180648.1|  PREDICTED: proliferation-associated protein 2G4    155   6e-42   Zeugodacus cucurbitae [melon fruit fly]
emb|CDQ85755.1|  unnamed protein product                                155   7e-42   Oncorhynchus mykiss
ref|NP_001279838.1|  proliferation-associated 2G4, 38kDa                155   7e-42   Callorhinchus milii [Australian ghost shark]
gb|ACO10060.1|  Proliferation-associated protein 2G4                    154   1e-41   Osmerus mordax
ref|XP_002734317.1|  PREDICTED: proliferation-associated protein ...    154   1e-41   Saccoglossus kowalevskii
emb|CDQ78322.1|  unnamed protein product                                155   1e-41   Oncorhynchus mykiss
ref|XP_003223249.1|  PREDICTED: proliferation-associated protein 2G4    154   1e-41   Anolis carolinensis [Carolina anole]
ref|NP_001085830.1|  ErbB3-binding protein 1                            154   1e-41   Xenopus laevis [clawed frog]
ref|XP_003963121.1|  PREDICTED: proliferation-associated protein ...    154   2e-41   Takifugu rubripes [tiger puffer]
ref|XP_005371237.1|  PREDICTED: proliferation-associated protein 2G4    154   2e-41   Microtus ochrogaster [prairie voles]
ref|XP_002007862.1|  GI13173                                            153   3e-41   Drosophila mojavensis
ref|XP_001957516.1|  GF10449                                            153   3e-41   Drosophila ananassae
ref|XP_001647519.1|  predicted protein                                  153   3e-41   Nematostella vectensis
ref|XP_005335677.1|  PREDICTED: proliferation-associated protein 2G4    153   4e-41   Ictidomys tridecemlineatus
ref|XP_007533407.1|  PREDICTED: proliferation-associated protein 2G4    153   4e-41   Erinaceus europaeus [common hedgehog]
ref|XP_005680429.1|  PREDICTED: proliferation-associated protein ...    151   4e-41   Capra hircus [domestic goat]
gb|AAC34392.1|  PAS1                                                    153   4e-41   Takifugu rubripes [tiger puffer]
emb|CAG07405.1|  unnamed protein product                                153   4e-41   Tetraodon nigroviridis
gb|KIZ00762.1|  hypothetical protein MNEG_7198                          152   5e-41   Monoraphidium neglectum
gb|EFX72560.1|  hypothetical protein DAPPUDRAFT_308181                  152   6e-41   Daphnia pulex
ref|NP_997806.1|  proliferation-associated 2G4-like                     152   6e-41   Danio rerio [leopard danio]
ref|XP_007559711.1|  PREDICTED: proliferation-associated protein 2G4    152   6e-41   Poecilia formosa
ref|XP_003689614.1|  PREDICTED: proliferation-associated protein ...    152   7e-41   Apis florea [dwarf honeybee]
ref|XP_008408124.1|  PREDICTED: proliferation-associated protein 2G4    152   7e-41   Poecilia reticulata
gb|AFM85909.1|  proliferation-associated 2G4                            152   7e-41   Callorhinchus milii [Australian ghost shark]
ref|XP_005799891.1|  PREDICTED: proliferation-associated protein ...    152   8e-41   Xiphophorus maculatus
ref|WP_028832180.1|  hypothetical protein                               152   1e-40   
ref|XP_004525166.1|  PREDICTED: proliferation-associated protein ...    152   1e-40   Ceratitis capitata [medfly]
ref|XP_002508417.1|  predicted protein                                  151   1e-40   Micromonas commoda
ref|XP_011419861.1|  PREDICTED: proliferation-associated protein ...    151   1e-40   Crassostrea gigas
gb|ERL94099.1|  hypothetical protein D910_11381                         155   1e-40   Dendroctonus ponderosae
ref|XP_003703942.1|  PREDICTED: proliferation-associated protein ...    151   1e-40   Megachile rotundata
gb|ELT99251.1|  hypothetical protein CAPTEDRAFT_152656                  151   1e-40   Capitella teleta
gb|ELR50756.1|  Proliferation-associated protein 2G4                    151   2e-40   Bos mutus
ref|XP_010865536.1|  PREDICTED: proliferation-associated protein ...    151   2e-40   Esox lucius
gb|ACO15498.1|  Proliferation-associated protein 2G4                    150   2e-40   Caligus clemensi
ref|XP_005876787.1|  PREDICTED: proliferation-associated protein 2G4    151   2e-40   Myotis brandtii
ref|NP_001029871.1|  proliferation-associated protein 2G4               151   2e-40   Bos taurus [bovine]
ref|XP_001504854.1|  PREDICTED: proliferation-associated protein ...    151   2e-40   
ref|XP_011173347.1|  PREDICTED: proliferation-associated protein 2G4    151   2e-40   Solenopsis invicta [imported red fire ant]
ref|XP_006908945.1|  PREDICTED: proliferation-associated protein 2G4    151   2e-40   Pteropus alecto
ref|XP_004006644.1|  PREDICTED: proliferation-associated protein 2G4    151   2e-40   
ref|XP_006615964.1|  PREDICTED: proliferation-associated protein ...    151   2e-40   Apis dorsata [rock honeybee]
ref|XP_002093823.1|  GE20541                                            151   2e-40   Drosophila yakuba
ref|XP_006560659.1|  PREDICTED: proliferation-associated protein ...    150   2e-40   Apis mellifera [bee]
gb|EFZ09337.1|  hypothetical protein SINV_15911                         151   3e-40   
ref|XP_006859475.1|  PREDICTED: proliferation-associated protein 2G4    150   3e-40   Chrysochloris asiatica
ref|XP_010395474.1|  PREDICTED: proliferation-associated protein 2G4    145   4e-40   
ref|XP_004861453.1|  PREDICTED: proliferation-associated protein 2G4    148   4e-40   
ref|XP_003405168.1|  PREDICTED: proliferation-associated protein 2G4    150   4e-40   Loxodonta africana [African bush elephant]
ref|XP_007953297.1|  PREDICTED: proliferation-associated protein 2G4    150   4e-40   Orycteropus afer afer
ref|XP_008877833.1|  DNA-binding protein, 42 kDa                        150   4e-40   Aphanomyces invadans
gb|KDR23244.1|  Proliferation-associated protein 2G4                    150   6e-40   Zootermopsis nevadensis
gb|EDL84837.1|  proliferation-associated 2G4, isoform CRA_b             148   6e-40   Rattus norvegicus [brown rat]
ref|XP_011400941.1|  Proliferation-associated protein A                 149   6e-40   Auxenochlorella protothecoides
ref|XP_001353865.1|  GA10407                                            149   7e-40   Drosophila pseudoobscura pseudoobscura
ref|XP_004466155.1|  PREDICTED: LOW QUALITY PROTEIN: proliferatio...    150   7e-40   
ref|XP_004379999.1|  PREDICTED: proliferation-associated protein 2G4    149   8e-40   Trichechus manatus latirostris
emb|CDS15413.1|  Proliferation associated protein 2G4                   149   8e-40   Echinococcus granulosus
ref|XP_011306002.1|  PREDICTED: proliferation-associated protein 2G4    149   8e-40   Fopius arisanus
ref|XP_004274221.1|  PREDICTED: proliferation-associated protein 2G4    149   1e-39   
ref|XP_011263181.1|  PREDICTED: proliferation-associated protein 2G4    149   1e-39   Camponotus floridanus
gb|AAV36985.2|  LD30448p                                                149   1e-39   Drosophila melanogaster
ref|XP_006179892.1|  PREDICTED: proliferation-associated protein 2G4    149   1e-39   Camelus ferus
ref|XP_002035467.1|  GM13901                                            149   1e-39   Drosophila sechellia
ref|XP_002083760.1|  GD13178                                            149   1e-39   Drosophila simulans
ref|XP_001972015.1|  GG14116                                            149   1e-39   Drosophila erecta
ref|XP_009052849.1|  hypothetical protein LOTGIDRAFT_115903             148   1e-39   Lottia gigantea
ref|NP_647984.1|  CG10576, isoform A                                    149   1e-39   Drosophila melanogaster
gb|KDO19442.1|  DNA-binding protein                                     149   1e-39   Saprolegnia parasitica CBS 223.65
ref|XP_002116398.1|  hypothetical protein TRIADDRAFT_64279              149   1e-39   Trichoplax adhaerens
ref|XP_008619458.1|  hypothetical protein SDRG_15074                    149   1e-39   Saprolegnia diclina VS20
tpg|DAA34047.1|  TPA: metallopeptidase                                  148   1e-39   Amblyomma variegatum
ref|XP_003485618.1|  PREDICTED: proliferation-associated protein ...    149   1e-39   Bombus impatiens
gb|KFO54080.1|  Proliferation-associated protein 2G4                    147   2e-39   Corvus brachyrhynchos
gb|AAH03777.1|  Pa2g4 protein                                           148   2e-39   Mus musculus [mouse]
ref|XP_004700624.1|  PREDICTED: proliferation-associated protein 2G4    149   2e-39   Echinops telfairi [lesser hedgehog tenrec]
ref|XP_003394756.1|  PREDICTED: proliferation-associated protein ...    149   2e-39   Bombus terrestris [large earth bumblebee]
ref|XP_002163189.2|  PREDICTED: proliferation-associated protein ...    149   2e-39   Hydra vulgaris
dbj|BAM19228.1|  proliferation-associated 2g4                           148   2e-39   Papilio polytes
pdb|2V6C|A  Chain A, Crystal Structure Of Erbb3 Binding Protein 1...    148   2e-39   Mus musculus [mouse]
ref|XP_011340977.1|  PREDICTED: proliferation-associated protein 2G4    148   2e-39   Ooceraea biroi
ref|NP_001004206.1|  proliferation-associated protein 2G4               149   2e-39   Rattus norvegicus [brown rat]
ref|XP_009962860.1|  PREDICTED: LOW QUALITY PROTEIN: proliferatio...    142   2e-39   Tyto alba [Schleiereule]
ref|XP_003506238.1|  PREDICTED: proliferation-associated protein 2G4    149   2e-39   
gb|EHH20847.1|  Cell cycle protein p38-2G4-like protein                 148   2e-39   
ref|XP_005397344.1|  PREDICTED: proliferation-associated protein 2G4    148   2e-39   
dbj|BAF84485.1|  unnamed protein product                                148   2e-39   
ref|XP_003476243.1|  PREDICTED: proliferation-associated protein 2G4    148   2e-39   
gb|ADT71645.1|  proliferation associated 2G4                            148   2e-39   
ref|XP_008066667.1|  PREDICTED: proliferation-associated protein 2G4    148   2e-39   
gb|AAH32111.1|  PA2G4 protein                                           148   3e-39   
dbj|BAE25986.1|  unnamed protein product                                148   3e-39   
ref|NP_035249.1|  proliferation-associated protein 2G4                  148   3e-39   
ref|XP_008846918.1|  PREDICTED: proliferation-associated protein 2G4    148   3e-39   
emb|CDJ02959.1|  Proliferation associated protein 2G4                   148   3e-39   
ref|XP_313985.4|  AGAP005108-PA                                         148   3e-39   
ref|XP_002752647.1|  PREDICTED: proliferation-associated protein 2G4    148   3e-39   
gb|KFZ66630.1|  Proliferation-associated protein 2G4                    143   3e-39   
ref|XP_010348255.1|  PREDICTED: proliferation-associated protein 2G4    148   4e-39   
ref|XP_010643016.1|  PREDICTED: proliferation-associated protein 2G4    148   4e-39   
ref|XP_002711114.1|  PREDICTED: proliferation-associated protein 2G4    147   4e-39   
ref|NP_006182.2|  proliferation-associated protein 2G4                  147   4e-39   
ref|XP_004589712.1|  PREDICTED: proliferation-associated protein 2G4    147   4e-39   
ref|NP_001124717.1|  proliferation-associated protein 2G4               147   4e-39   
ref|NP_001271715.1|  uncharacterized protein LOC101867185               147   4e-39   
pdb|2Q8K|A  Chain A, The Crystal Structure Of Ebp1                      147   4e-39   
ref|XP_009179195.1|  PREDICTED: proliferation-associated protein 2G4    147   5e-39   
ref|XP_004601656.1|  PREDICTED: proliferation-associated protein 2G4    147   5e-39   
gb|AAB91536.1|  cell cycle protein p38-2G4 homolog                      147   5e-39   
ref|XP_011059200.1|  PREDICTED: proliferation-associated protein 2G4    147   6e-39   
ref|XP_003880798.1|  methionine aminopeptidase,related                  147   7e-39   
ref|XP_009041985.1|  hypothetical protein AURANDRAFT_55591              147   7e-39   
ref|XP_006897700.1|  PREDICTED: proliferation-associated protein 2G4    147   7e-39   
dbj|GAM23516.1|  hypothetical protein SAMD00019534_066910               147   8e-39   
ref|XP_780193.1|  PREDICTED: proliferation-associated protein 2G4...    147   9e-39   
ref|XP_001865752.1|  proliferation-associated 2g4                       147   9e-39   
ref|XP_004692692.1|  PREDICTED: proliferation-associated protein 2G4    146   1e-38   
ref|XP_004093117.1|  PREDICTED: LOW QUALITY PROTEIN: proliferatio...    146   1e-38   
ref|XP_006165654.1|  PREDICTED: proliferation-associated protein 2G4    146   2e-38   
ref|XP_006131250.1|  PREDICTED: proliferation-associated protein 2G4    145   2e-38   
ref|XP_004348044.1|  proliferation-associated 2G4,b                     146   2e-38   
ref|XP_011154366.1|  PREDICTED: proliferation-associated protein 2G4    146   2e-38   
gb|KFW82865.1|  Proliferation-associated protein 2G4                    145   2e-38   
gb|ELK15270.1|  Proliferation-associated protein 2G4                    150   2e-38   
ref|XP_009278316.1|  PREDICTED: proliferation-associated protein 2G4    145   2e-38   
gb|KIK41978.1|  hypothetical protein CY34DRAFT_805412                   145   2e-38   
gb|AAH19222.1|  PA2G4 protein                                           145   3e-38   
gb|EHJ70953.1|  hypothetical protein KGM_14785                          144   4e-38   
ref|XP_004649070.1|  PREDICTED: LOW QUALITY PROTEIN: proliferatio...    145   5e-38   
ref|XP_008549132.1|  PREDICTED: proliferation-associated protein 2G4    145   5e-38   
gb|KFP07640.1|  Proliferation-associated protein 2G4                    144   6e-38   
gb|KFB44440.1|  AGAP005108-PA-like protein                              145   6e-38   
gb|KFM08039.1|  Proliferation-associated protein 2G4                    143   9e-38   
gb|ETE68956.1|  Proliferation-associated protein 2G4                    143   1e-37   
gb|EQB77766.1|  hypothetical protein CB1_000449019                      148   1e-37   
emb|CCM00103.1|  predicted protein                                      144   1e-37   
ref|XP_006267753.1|  PREDICTED: proliferation-associated protein 2G4    144   1e-37   
ref|XP_009468808.1|  PREDICTED: LOW QUALITY PROTEIN: proliferatio...    143   1e-37   
ref|XP_009921703.1|  PREDICTED: LOW QUALITY PROTEIN: proliferatio...    143   1e-37   
ref|XP_009701955.1|  PREDICTED: LOW QUALITY PROTEIN: proliferatio...    143   1e-37   
ref|XP_009586223.1|  PREDICTED: LOW QUALITY PROTEIN: proliferatio...    143   1e-37   
ref|XP_003284133.1|  hypothetical protein DICPUDRAFT_52698              143   1e-37   
ref|XP_010282642.1|  PREDICTED: LOW QUALITY PROTEIN: proliferatio...    143   1e-37   
ref|XP_005095772.1|  PREDICTED: proliferation-associated protein ...    144   1e-37   
ref|XP_006035312.1|  PREDICTED: proliferation-associated protein 2G4    144   1e-37   
ref|XP_007318509.1|  hypothetical protein SERLADRAFT_467890             144   1e-37   
emb|CBK24689.2|  unnamed protein product                                143   2e-37   
ref|XP_009882846.1|  PREDICTED: LOW QUALITY PROTEIN: proliferatio...    143   2e-37   
gb|ETN66740.1|  proliferation-associated 2g4                            144   2e-37   
gb|KGL81710.1|  Proliferation-associated protein 2G4                    142   2e-37   
ref|XP_005705833.1|  DNA binding protein                                143   2e-37   
ref|XP_002141587.1|  proliferation-associated protein 2G4               143   2e-37   
gb|KFP66746.1|  Proliferation-associated protein 2G4                    142   2e-37   
gb|KFV87572.1|  Proliferation-associated protein 2G4                    142   2e-37   
gb|KFV16945.1|  Proliferation-associated protein 2G4                    142   2e-37   
gb|KFP09829.1|  Proliferation-associated protein 2G4                    142   2e-37   
gb|KFQ91587.1|  Proliferation-associated protein 2G4                    142   2e-37   
ref|XP_001662411.1|  AAEL012312-PA                                      144   2e-37   
gb|KFO08279.1|  Proliferation-associated protein 2G4                    142   2e-37   
ref|XP_007362719.1|  proliferation-associated protein 1                 143   2e-37   
gb|KFV99294.1|  Proliferation-associated protein 2G4                    142   3e-37   
gb|KFO24578.1|  Proliferation-associated protein 2G4                    147   3e-37   
ref|XP_423059.4|  PREDICTED: proliferation-associated protein 2G4       142   3e-37   
ref|XP_010020753.1|  PREDICTED: proliferation-associated protein 2G4    137   3e-37   
gb|KGL92866.1|  Proliferation-associated protein 2G4                    142   3e-37   
emb|CDO70649.1|  hypothetical protein BN946_scf184756.g16               142   3e-37   
ref|XP_002772853.1|  Curved DNA-binding protein, putative               138   4e-37   
gb|EPT01440.1|  hypothetical protein FOMPIDRAFT_1023315                 142   4e-37   
emb|CCO30365.1|  Curved DNA-binding protein AltName: Full=42 kDa ...    139   5e-37   
gb|AAB03665.1|  PrlA                                                    142   5e-37   
ref|XP_011502791.1|  PREDICTED: proliferation-associated protein 2G4    142   5e-37   
ref|XP_001134549.1|  proliferation associated protein                   142   6e-37   
ref|XP_008887722.1|  proliferation-associated protein 2G4, putative     143   6e-37   
gb|KFU89768.1|  Proliferation-associated protein 2G4                    141   6e-37   
ref|XP_002775231.1|  proliferation-associated protein 2G4 metallo...    141   7e-37   
gb|ELU40171.1|  metallopeptidase family m24 domain-containing pro...    137   8e-37   
gb|EOA93068.1|  Proliferation-associated protein 2G4                    140   9e-37   
ref|XP_004992055.1|  proliferation-associated protein 2G4               141   9e-37   
ref|XP_009641743.1|  PREDICTED: LOW QUALITY PROTEIN: proliferatio...    142   9e-37   
gb|KFR05935.1|  Proliferation-associated protein 2G4                    140   1e-36   
gb|KFQ63630.1|  Proliferation-associated protein 2G4                    140   1e-36   
gb|KFV11001.1|  Proliferation-associated protein 2G4                    140   1e-36   
gb|EPZ31276.1|  Peptidase M24, structural domain-containing protein     140   1e-36   
ref|XP_002675553.1|  methionyl aminopeptidase                           140   1e-36   
gb|EUB65031.1|  Proliferation-associated protein 2G4                    140   2e-36   
ref|XP_007238523.1|  PREDICTED: proliferation-associated protein ...    137   2e-36   
ref|XP_003084394.1|  putative DNA-binding protein GBP16 (ISS)           140   2e-36   
ref|XP_007869056.1|  proliferation-associated protein 1                 140   2e-36   
gb|KEP52663.1|  42 kDa curved DNA-binding protein                       140   2e-36   
gb|EUC64968.1|  42 kDa curved DNA-binding protein                       140   2e-36   
ref|XP_003772221.1|  PREDICTED: proliferation-associated protein 2G4    141   2e-36   
gb|EMD34055.1|  hypothetical protein CERSUDRAFT_117563                  140   2e-36   
ref|XP_002182273.1|  predicted protein                                  140   3e-36   
emb|CEG00817.1|  Peptidase M24, methionine aminopeptidase               140   3e-36   
gb|KIJ66985.1|  hypothetical protein HYDPIDRAFT_108958                  140   3e-36   
ref|XP_008472310.1|  PREDICTED: proliferation-associated protein 2G4    140   3e-36   
gb|EPR57248.1|  putative proliferation-associated protein 2G4           140   3e-36   
ref|XP_002371979.1|  proliferation-associated protein 2G4, putative     140   3e-36   
ref|XP_009039553.1|  hypothetical protein AURANDRAFT_54512              140   4e-36   
ref|XP_004029906.1|  hypothetical protein IMG5_170920                   139   5e-36   
ref|XP_001913309.1|  proliferation-associated protein 1                 139   6e-36   
ref|XP_001744838.1|  hypothetical protein                               139   6e-36   
emb|CEL55239.1|  Curved DNA-binding protein OS=Schizosaccharomyce...    139   8e-36   
emb|CEP13275.1|  hypothetical protein                                   139   9e-36   
ref|XP_002772849.1|  proliferation-associated protein 2G4 metallo...    139   9e-36   
ref|XP_003383390.1|  PREDICTED: proliferation-associated protein ...    139   9e-36   
gb|KIK19701.1|  hypothetical protein PISMIDRAFT_682876                  139   9e-36   
ref|XP_009839077.1|  DNA-binding protein, 42 kDa                        139   9e-36   
ref|XP_006011099.1|  PREDICTED: proliferation-associated protein ...    139   1e-35   
dbj|GAN04257.1|  proliferation-associated protein 1                     139   1e-35   
gb|KDO24965.1|  hypothetical protein SPRG_20806                         136   1e-35   
gb|EPY82331.1|  proliferation-associated protein 2G4                    135   1e-35   
gb|EFA84439.1|  proliferation associated protein                        138   1e-35   
gb|KIK63001.1|  hypothetical protein GYMLUDRAFT_41305                   138   1e-35   
emb|CAD58632.1|  proliferation-associated protein 2G4                   135   2e-35   
gb|KIM73267.1|  hypothetical protein PILCRDRAFT_829280                  138   2e-35   
gb|KHN20321.1|  Proliferation-associated protein 2G4                    132   2e-35   
gb|KIJ13451.1|  hypothetical protein PAXINDRAFT_170516                  138   2e-35   
emb|CDS30134.1|  Proliferation associated protein 2G4                   137   2e-35   
gb|EPB84759.1|  hypothetical protein HMPREF1544_08481                   137   2e-35   
ref|XP_009533169.1|  methionine aminopeptidase, merops subfamily M24    137   3e-35   
ref|XP_007383044.1|  proliferation-associated protein 1                 137   3e-35   
gb|ERZ97185.1|  hypothetical protein GLOINDRAFT_340272                  137   3e-35   
gb|EHB06549.1|  Proliferation-associated protein 2G4                    135   6e-35   
gb|KIO15241.1|  hypothetical protein M404DRAFT_120195                   136   6e-35   
ref|XP_007299448.1|  proliferation-associated protein 1                 136   6e-35   
emb|CCG84903.1|  unnamed protein product                                136   6e-35   
gb|KDQ57326.1|  hypothetical protein JAAARDRAFT_35952                   136   7e-35   
gb|KDQ14341.1|  hypothetical protein BOTBODRAFT_55496                   136   8e-35   
gb|KIK93612.1|  hypothetical protein PAXRUDRAFT_144694                  135   1e-34   
ref|XP_005655650.1|  PREDICTED: proliferation-associated protein 2G4    130   1e-34   
ref|XP_004890349.1|  PREDICTED: proliferation-associated protein 2G4    135   1e-34   
ref|XP_002171665.1|  curved DNA-binding protein Cdb4                    135   1e-34   
emb|CEG69752.1|  hypothetical protein RMATCC62417_05771                 135   2e-34   
gb|AAX27414.2|  SJCHGC05984 protein                                     134   3e-34   
emb|CAX74794.1|  Proliferation-associated protein 2G4                   134   4e-34   
gb|KFH72903.1|  hypothetical protein MVEG_00128                         134   4e-34   
emb|CEJ02679.1|  hypothetical protein RMCBS344292_16678                 134   4e-34   
emb|CAX83116.1|  Proliferation-associated protein 2G4                   134   4e-34   
ref|XP_005088325.1|  PREDICTED: proliferation-associated protein ...    129   4e-34   
ref|XP_007393682.1|  hypothetical protein PHACADRAFT_252626             134   5e-34   
gb|EGT51094.1|  hypothetical protein CAEBREN_32580                      129   6e-34   
ref|XP_007262711.1|  proliferation-associated protein 1                 134   6e-34   
gb|ETL29090.1|  DNA-binding protein, 42 kDa                             134   6e-34   
ref|XP_001010313.1|  metallopeptidase family M24 containing protein     133   7e-34   
gb|KIM67543.1|  hypothetical protein SCLCIDRAFT_21074                   133   8e-34   
ref|XP_002605416.1|  hypothetical protein BRAFLDRAFT_278505             133   9e-34   
ref|XP_008912890.1|  DNA-binding protein, 42 kDa                        133   9e-34   
gb|EIE89064.1|  hypothetical protein RO3G_13775                         133   9e-34   
ref|XP_008039729.1|  proliferation-associated protein 1                 133   9e-34   
ref|XP_626802.1|  proliferation-associated protein 2G4 metallopro...    133   1e-33   
gb|ELT89178.1|  hypothetical protein CAPTEDRAFT_136142                  127   1e-33   
ref|XP_666677.1|  nuclear DNA-binding protein G2p -related              133   1e-33   
ref|XP_007873749.1|  hypothetical protein PNEG_01781                    132   1e-33   
ref|XP_009098445.1|  PREDICTED: proliferation-associated protein 2G4    129   1e-33   
ref|XP_005826372.1|  hypothetical protein GUITHDRAFT_96731              132   2e-33   
emb|CDH53178.1|  proliferation-associated protein 1                     132   2e-33   
emb|CCI48095.1|  unnamed protein product                                132   2e-33   
emb|CDS14136.1|  hypothetical protein LRAMOSA06306                      132   2e-33   
ref|XP_008948368.1|  PREDICTED: proliferation-associated protein ...    126   3e-33   
ref|XP_005769829.1|  proliferation-associated protein 2G4               132   3e-33   
ref|XP_004355743.1|  proliferation associated protein                   132   3e-33   
gb|KDQ24453.1|  hypothetical protein PLEOSDRAFT_1067285                 132   3e-33   
dbj|GAN05953.1|  conserved hypothetical protein                         131   4e-33   
ref|XP_002900555.1|  proliferation-associated protein, metallopro...    132   4e-33   
gb|EFX62733.1|  hypothetical protein DAPPUDRAFT_67763                   131   4e-33   
gb|EFX83265.1|  hypothetical protein DAPPUDRAFT_315717                  131   4e-33   
emb|CDW84742.1|  proliferation-associated protein 2g4                   131   4e-33   
emb|CCA18784.1|  proliferationassociated protein putative               131   4e-33   
gb|EPB82512.1|  hypothetical protein HMPREF1544_10765                   131   5e-33   
ref|XP_005793747.1|  proliferation-associated protein 2G4               131   5e-33   
ref|XP_006459099.1|  hypothetical protein AGABI2DRAFT_191160            131   5e-33   
ref|XP_007331441.1|  hypothetical protein AGABI1DRAFT_114934            131   6e-33   
ref|XP_001880628.1|  predicted protein                                  131   6e-33   
ref|XP_005431428.1|  PREDICTED: proliferation-associated protein ...    130   9e-33   
ref|XP_007423593.1|  PREDICTED: proliferation-associated protein 2G4    129   1e-32   
ref|XP_007845989.1|  pa2g4 protein                                      130   1e-32   
gb|EFX84375.1|  hypothetical protein DAPPUDRAFT_46898                   130   1e-32   
ref|XP_010174818.1|  PREDICTED: proliferation-associated protein 2G4    125   1e-32   
gb|EIE80522.1|  DNA-binding protein                                     130   1e-32   
dbj|GAA35285.2|  metalloprotease ARX1                                   129   2e-32   
ref|XP_005533908.1|  PREDICTED: proliferation-associated protein 2G4    130   2e-32   
ref|XP_009545456.1|  Metallo peptidase M24                              129   2e-32   
emb|CEP17928.1|  hypothetical protein                                   129   2e-32   
gb|KJA26400.1|  hypothetical protein HYPSUDRAFT_36719                   129   2e-32   
gb|ETO03829.1|  aminopeptidase/ metalloexopeptidase                     125   2e-32   
ref|XP_006987432.1|  PREDICTED: proliferation-associated protein 2G4    129   2e-32   
ref|XP_006815930.1|  PREDICTED: proliferation-associated protein ...    128   3e-32   
gb|KIY67278.1|  proliferation-associated protein 1                      129   3e-32   
ref|XP_002634083.1|  Hypothetical protein CBG01629                      129   3e-32   
gb|KII85040.1|  hypothetical protein PLICRDRAFT_45151                   129   3e-32   
gb|KIK10054.1|  hypothetical protein K443DRAFT_81565                    129   4e-32   
gb|EJY79371.1|  Metallopeptidase family M24 containing protein          129   4e-32   
ref|XP_001113953.2|  PREDICTED: receptor tyrosine-protein kinase ...    133   4e-32   
ref|XP_008641741.1|  PREDICTED: proliferation-associated protein 2G4    127   5e-32   
gb|KIH60920.1|  putative DNA-binding protein                            127   5e-32   
ref|XP_003790559.1|  PREDICTED: receptor tyrosine-protein kinase ...    132   5e-32   
ref|XP_002290444.1|  DNA-binding protein                                127   6e-32   
ref|XP_003062941.1|  predicted protein                                  128   8e-32   
ref|XP_765891.1|  proliferation-associated protein 2g4                  128   8e-32   
emb|CDS14461.1|  hypothetical protein LRAMOSA06630                      128   8e-32   
gb|ETN87016.1|  DNA-binding protein                                     127   1e-31   
ref|NP_593397.1|  curved DNA-binding protein Cdb4, peptidase family     127   1e-31   
gb|KDD75813.1|  hypothetical protein H632_c489p2                        127   2e-31   



>ref|XP_009789408.1| PREDICTED: proliferation-associated protein 2G4-like [Nicotiana 
sylvestris]
Length=394

 Score =   295 bits (754),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 154/169 (91%), Positives = 167/169 (99%), Gaps = 0/169 (0%)
 Frame = +3

Query  3    ELDLTTPEVVTKYKSAAEILNKGLELVVSQCKPNAKIVDICEKGDAFIREQTGNMYKNVK  182
            ELDLT+PEVVTKYK+AAEI+NK L+LVVS+CKP AKIVD+CEKGDAFI+EQTGNMYKNVK
Sbjct  10   ELDLTSPEVVTKYKNAAEIVNKALQLVVSECKPKAKIVDLCEKGDAFIKEQTGNMYKNVK  69

Query  183  KKIERGVAFPTCISVNNTVCHFSPLSNDDTVLEDGDMVKIDMGCHIDGFIAVVGHTHLLQ  362
            KKIERGVAFPTCISVNNTVCHFSPLS+D+TVLE+GDMVKIDMGCHIDGFIAVVGHTH+LQ
Sbjct  70   KKIERGVAFPTCISVNNTVCHFSPLSSDETVLEEGDMVKIDMGCHIDGFIAVVGHTHVLQ  129

Query  363  EGPVTGRaadviaaantaaevaLRLVRPGKKNSDVTEAIQKVAAAYDCK  509
            EGPVTGRAADV+AAANTAAEVALRLVRPG+KNSDVTEAIQKVAAAYDCK
Sbjct  130  EGPVTGRAADVVAAANTAAEVALRLVRPGRKNSDVTEAIQKVAAAYDCK  178



>ref|XP_009599246.1| PREDICTED: proliferation-associated protein 2G4-like [Nicotiana 
tomentosiformis]
Length=394

 Score =   291 bits (744),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 152/169 (90%), Positives = 166/169 (98%), Gaps = 0/169 (0%)
 Frame = +3

Query  3    ELDLTTPEVVTKYKSAAEILNKGLELVVSQCKPNAKIVDICEKGDAFIREQTGNMYKNVK  182
            ELDLT+PEVVTKYK AAEI+NK L+LVVS+CKP +KIVD+CEKGDAFI+EQTGNMYKNVK
Sbjct  10   ELDLTSPEVVTKYKGAAEIVNKALQLVVSECKPKSKIVDLCEKGDAFIKEQTGNMYKNVK  69

Query  183  KKIERGVAFPTCISVNNTVCHFSPLSNDDTVLEDGDMVKIDMGCHIDGFIAVVGHTHLLQ  362
            KKIERGVAFPTCISVNNTVCHFSPLS+D+TVLE+GD+VKIDMGCHIDGFIAVVGHTH+LQ
Sbjct  70   KKIERGVAFPTCISVNNTVCHFSPLSSDETVLEEGDIVKIDMGCHIDGFIAVVGHTHVLQ  129

Query  363  EGPVTGRaadviaaantaaevaLRLVRPGKKNSDVTEAIQKVAAAYDCK  509
            EGPVTGRAADV+AAANTAAEVALRLVRPG+KNSDVTEAIQKVAAAYDCK
Sbjct  130  EGPVTGRAADVVAAANTAAEVALRLVRPGRKNSDVTEAIQKVAAAYDCK  178



>ref|XP_004137704.1| PREDICTED: proliferation-associated protein 2G4-like [Cucumis 
sativus]
 gb|KGN58739.1| EBP1 [Cucumis sativus]
Length=393

 Score =   290 bits (742),  Expect = 4e-94, Method: Compositional matrix adjust.
 Identities = 152/169 (90%), Positives = 164/169 (97%), Gaps = 0/169 (0%)
 Frame = +3

Query  3    ELDLTTPEVVTKYKSAAEILNKGLELVVSQCKPNAKIVDICEKGDAFIREQTGNMYKNVK  182
            ELDLT+PEVVTKYKSAAEI NK L+LV+S+CKP AKIVDICEKGD+FIREQTGNMYKNVK
Sbjct  11   ELDLTSPEVVTKYKSAAEIANKALQLVISECKPKAKIVDICEKGDSFIREQTGNMYKNVK  70

Query  183  KKIERGVAFPTCISVNNTVCHFSPLSNDDTVLEDGDMVKIDMGCHIDGFIAVVGHTHLLQ  362
            KKIERGVAFPTCISVNNT+CHFSPLS+D+TVLE+GDMVKID+GCHIDGFIAVV HTH+LQ
Sbjct  71   KKIERGVAFPTCISVNNTICHFSPLSSDETVLEEGDMVKIDLGCHIDGFIAVVAHTHVLQ  130

Query  363  EGPVTGRaadviaaantaaevaLRLVRPGKKNSDVTEAIQKVAAAYDCK  509
            EGPVTGRAADVIAAANTAAEVALRLVRPGKKN DVTEAIQKVAA+YDCK
Sbjct  131  EGPVTGRAADVIAAANTAAEVALRLVRPGKKNKDVTEAIQKVAASYDCK  179



>ref|XP_006381246.1| hypothetical protein POPTR_0006s10320g [Populus trichocarpa]
 gb|ERP59043.1| hypothetical protein POPTR_0006s10320g [Populus trichocarpa]
Length=284

 Score =   286 bits (732),  Expect = 5e-94, Method: Compositional matrix adjust.
 Identities = 148/169 (88%), Positives = 164/169 (97%), Gaps = 0/169 (0%)
 Frame = +3

Query  3    ELDLTTPEVVTKYKSAAEILNKGLELVVSQCKPNAKIVDICEKGDAFIREQTGNMYKNVK  182
            ELDLT+PEV+TKYKSAAEI+NK L+LV+S+CKP AKIVDICEKGD+FIREQTGNMYKNVK
Sbjct  11   ELDLTSPEVITKYKSAAEIVNKALQLVISECKPKAKIVDICEKGDSFIREQTGNMYKNVK  70

Query  183  KKIERGVAFPTCISVNNTVCHFSPLSNDDTVLEDGDMVKIDMGCHIDGFIAVVGHTHLLQ  362
            KKIERGVAFPTC+SVNNT+CHFSPL++D++VLE+GD+VKID+GCHIDGFIAVVGHTH LQ
Sbjct  71   KKIERGVAFPTCVSVNNTICHFSPLASDESVLEEGDIVKIDLGCHIDGFIAVVGHTHALQ  130

Query  363  EGPVTGRaadviaaantaaevaLRLVRPGKKNSDVTEAIQKVAAAYDCK  509
             GPVTGRAADVIAAANTAAEVALRLVRPGKKN DVTEAIQKVAAAYDCK
Sbjct  131  SGPVTGRAADVIAAANTAAEVALRLVRPGKKNKDVTEAIQKVAAAYDCK  179



>ref|XP_009599304.1| PREDICTED: proliferation-associated protein 2G4-like isoform 
X2 [Nicotiana tomentosiformis]
 ref|XP_009599305.1| PREDICTED: proliferation-associated protein 2G4-like isoform 
X2 [Nicotiana tomentosiformis]
Length=387

 Score =   288 bits (737),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 151/169 (89%), Positives = 164/169 (97%), Gaps = 0/169 (0%)
 Frame = +3

Query  3    ELDLTTPEVVTKYKSAAEILNKGLELVVSQCKPNAKIVDICEKGDAFIREQTGNMYKNVK  182
            ELDLT+PEVVTKYKSAAEI+NK L+LV+S+CKP AKIVD+CEKGDAFI+EQTGNMYKNVK
Sbjct  10   ELDLTSPEVVTKYKSAAEIVNKALQLVLSECKPKAKIVDLCEKGDAFIKEQTGNMYKNVK  69

Query  183  KKIERGVAFPTCISVNNTVCHFSPLSNDDTVLEDGDMVKIDMGCHIDGFIAVVGHTHLLQ  362
            KKIERGVAFPTCISVNNTVCHFSPLS+D+T LE+GD++KIDMGCHIDGFIAVVGHTH+L 
Sbjct  70   KKIERGVAFPTCISVNNTVCHFSPLSSDETSLEEGDILKIDMGCHIDGFIAVVGHTHVLH  129

Query  363  EGPVTGRaadviaaantaaevaLRLVRPGKKNSDVTEAIQKVAAAYDCK  509
            EGPVTGR ADVIAAANTAAEVALRLVRPGKKNSDVTEAIQKVAAAYDCK
Sbjct  130  EGPVTGRPADVIAAANTAAEVALRLVRPGKKNSDVTEAIQKVAAAYDCK  178



>ref|XP_008442393.1| PREDICTED: proliferation-associated protein 2G4-like [Cucumis 
melo]
Length=396

 Score =   288 bits (737),  Expect = 3e-93, Method: Compositional matrix adjust.
 Identities = 151/169 (89%), Positives = 163/169 (96%), Gaps = 0/169 (0%)
 Frame = +3

Query  3    ELDLTTPEVVTKYKSAAEILNKGLELVVSQCKPNAKIVDICEKGDAFIREQTGNMYKNVK  182
            ELDLT+PEVVTKYKSAAEI NK L+LV+S+CKP  KIVDICEKGD+FIREQTGNMYKNVK
Sbjct  11   ELDLTSPEVVTKYKSAAEIANKALQLVISECKPKTKIVDICEKGDSFIREQTGNMYKNVK  70

Query  183  KKIERGVAFPTCISVNNTVCHFSPLSNDDTVLEDGDMVKIDMGCHIDGFIAVVGHTHLLQ  362
            KKIERGVAFPTCISVNNT+CHFSPLS+D+TVLE+GDMVKID+GCHIDGFIAVV HTH+LQ
Sbjct  71   KKIERGVAFPTCISVNNTICHFSPLSSDETVLEEGDMVKIDLGCHIDGFIAVVAHTHVLQ  130

Query  363  EGPVTGRaadviaaantaaevaLRLVRPGKKNSDVTEAIQKVAAAYDCK  509
            EGPVTGRAADVIAAANTAAEVALRLVRPGKKN DVTEAIQKVAA+YDCK
Sbjct  131  EGPVTGRAADVIAAANTAAEVALRLVRPGKKNKDVTEAIQKVAASYDCK  179



>ref|XP_009773246.1| PREDICTED: proliferation-associated protein 2G4-like [Nicotiana 
sylvestris]
 ref|XP_009773247.1| PREDICTED: proliferation-associated protein 2G4-like [Nicotiana 
sylvestris]
 ref|XP_009773248.1| PREDICTED: proliferation-associated protein 2G4-like [Nicotiana 
sylvestris]
Length=387

 Score =   288 bits (736),  Expect = 3e-93, Method: Compositional matrix adjust.
 Identities = 151/168 (90%), Positives = 164/168 (98%), Gaps = 0/168 (0%)
 Frame = +3

Query  3    ELDLTTPEVVTKYKSAAEILNKGLELVVSQCKPNAKIVDICEKGDAFIREQTGNMYKNVK  182
            E DLT+PEVVTKYKSAAEI+NK L+LV+S+CKP AKIVD+CEKGDAFI+EQTGNMYKNVK
Sbjct  10   EFDLTSPEVVTKYKSAAEIVNKALQLVLSECKPKAKIVDLCEKGDAFIKEQTGNMYKNVK  69

Query  183  KKIERGVAFPTCISVNNTVCHFSPLSNDDTVLEDGDMVKIDMGCHIDGFIAVVGHTHLLQ  362
            KKIERGVAFPTCISVNNTVCHFSPLS+D+TVLE+GD++KIDMGCHIDGFIAVVGHTH+L 
Sbjct  70   KKIERGVAFPTCISVNNTVCHFSPLSSDETVLEEGDILKIDMGCHIDGFIAVVGHTHVLH  129

Query  363  EGPVTGRaadviaaantaaevaLRLVRPGKKNSDVTEAIQKVAAAYDC  506
            EGPVTGRAADVIAAANTAAEVALRLVRPGKKNSDVTEAIQKVAAAYDC
Sbjct  130  EGPVTGRAADVIAAANTAAEVALRLVRPGKKNSDVTEAIQKVAAAYDC  177



>ref|XP_009599303.1| PREDICTED: proliferation-associated protein 2G4-like isoform 
X1 [Nicotiana tomentosiformis]
Length=427

 Score =   288 bits (738),  Expect = 6e-93, Method: Compositional matrix adjust.
 Identities = 151/169 (89%), Positives = 164/169 (97%), Gaps = 0/169 (0%)
 Frame = +3

Query  3    ELDLTTPEVVTKYKSAAEILNKGLELVVSQCKPNAKIVDICEKGDAFIREQTGNMYKNVK  182
            ELDLT+PEVVTKYKSAAEI+NK L+LV+S+CKP AKIVD+CEKGDAFI+EQTGNMYKNVK
Sbjct  50   ELDLTSPEVVTKYKSAAEIVNKALQLVLSECKPKAKIVDLCEKGDAFIKEQTGNMYKNVK  109

Query  183  KKIERGVAFPTCISVNNTVCHFSPLSNDDTVLEDGDMVKIDMGCHIDGFIAVVGHTHLLQ  362
            KKIERGVAFPTCISVNNTVCHFSPLS+D+T LE+GD++KIDMGCHIDGFIAVVGHTH+L 
Sbjct  110  KKIERGVAFPTCISVNNTVCHFSPLSSDETSLEEGDILKIDMGCHIDGFIAVVGHTHVLH  169

Query  363  EGPVTGRaadviaaantaaevaLRLVRPGKKNSDVTEAIQKVAAAYDCK  509
            EGPVTGR ADVIAAANTAAEVALRLVRPGKKNSDVTEAIQKVAAAYDCK
Sbjct  170  EGPVTGRPADVIAAANTAAEVALRLVRPGKKNSDVTEAIQKVAAAYDCK  218



>ref|XP_010264591.1| PREDICTED: proliferation-associated protein 2G4-like [Nelumbo 
nucifera]
Length=397

 Score =   286 bits (733),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 149/169 (88%), Positives = 164/169 (97%), Gaps = 0/169 (0%)
 Frame = +3

Query  3    ELDLTTPEVVTKYKSAAEILNKGLELVVSQCKPNAKIVDICEKGDAFIREQTGNMYKNVK  182
            ELDLT+PEVVTKYKSAAEI+NK L+LV+S+CKP AKIVD+CEKGDAFIREQTGNMYKNVK
Sbjct  11   ELDLTSPEVVTKYKSAAEIVNKALQLVLSECKPKAKIVDLCEKGDAFIREQTGNMYKNVK  70

Query  183  KKIERGVAFPTCISVNNTVCHFSPLSNDDTVLEDGDMVKIDMGCHIDGFIAVVGHTHLLQ  362
            +KIERGVAFPTCISVNNTVCHFSPL++D+TVLE+GDM+KIDMGCHIDGFIAVV HT +LQ
Sbjct  71   RKIERGVAFPTCISVNNTVCHFSPLASDETVLEEGDMLKIDMGCHIDGFIAVVAHTRVLQ  130

Query  363  EGPVTGRaadviaaantaaevaLRLVRPGKKNSDVTEAIQKVAAAYDCK  509
            EGPVTGRAADVIAAANTAAEVALRLVRPG+KN DVTEA+QKVAAAYDCK
Sbjct  131  EGPVTGRAADVIAAANTAAEVALRLVRPGRKNKDVTEAVQKVAAAYDCK  179



>gb|ABK95017.1| unknown [Populus trichocarpa]
Length=396

 Score =   286 bits (732),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 148/169 (88%), Positives = 164/169 (97%), Gaps = 0/169 (0%)
 Frame = +3

Query  3    ELDLTTPEVVTKYKSAAEILNKGLELVVSQCKPNAKIVDICEKGDAFIREQTGNMYKNVK  182
            ELDLT+PEV+TKYKSAAEI+NK L+LV+S+CKP AKIVDICEKGD+FIREQTGNMYKNVK
Sbjct  11   ELDLTSPEVITKYKSAAEIVNKALQLVISECKPKAKIVDICEKGDSFIREQTGNMYKNVK  70

Query  183  KKIERGVAFPTCISVNNTVCHFSPLSNDDTVLEDGDMVKIDMGCHIDGFIAVVGHTHLLQ  362
            KKIERGVAFPTC+SVNNT+CHFSPL++D++VLE+GD+VKID+GCHIDGFIAVVGHTH LQ
Sbjct  71   KKIERGVAFPTCVSVNNTICHFSPLASDESVLEEGDIVKIDLGCHIDGFIAVVGHTHALQ  130

Query  363  EGPVTGRaadviaaantaaevaLRLVRPGKKNSDVTEAIQKVAAAYDCK  509
             GPVTGRAADVIAAANTAAEVALRLVRPGKKN DVTEAIQKVAAAYDCK
Sbjct  131  SGPVTGRAADVIAAANTAAEVALRLVRPGKKNKDVTEAIQKVAAAYDCK  179



>ref|XP_004242516.1| PREDICTED: proliferation-associated protein 2G4-like [Solanum 
lycopersicum]
Length=387

 Score =   286 bits (731),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 150/169 (89%), Positives = 165/169 (98%), Gaps = 0/169 (0%)
 Frame = +3

Query  3    ELDLTTPEVVTKYKSAAEILNKGLELVVSQCKPNAKIVDICEKGDAFIREQTGNMYKNVK  182
            ELDLT+PEVVTKYKSAAEI+NK L+LV+S+CKP AKIVD+CEKGDAFI+EQTGNMYKNVK
Sbjct  10   ELDLTSPEVVTKYKSAAEIVNKALQLVLSECKPKAKIVDLCEKGDAFIKEQTGNMYKNVK  69

Query  183  KKIERGVAFPTCISVNNTVCHFSPLSNDDTVLEDGDMVKIDMGCHIDGFIAVVGHTHLLQ  362
            KKIERGVAFPTCISVNNTVCHFSPL++D+TV+E+GD++KIDMGCHIDGFIAVVGHTH+L 
Sbjct  70   KKIERGVAFPTCISVNNTVCHFSPLASDETVVEEGDILKIDMGCHIDGFIAVVGHTHVLH  129

Query  363  EGPVTGRaadviaaantaaevaLRLVRPGKKNSDVTEAIQKVAAAYDCK  509
             GPVTGRAADVIAAANTAAEVALRLVRPGKKNSDVTEAIQKVAAAYDCK
Sbjct  130  NGPVTGRAADVIAAANTAAEVALRLVRPGKKNSDVTEAIQKVAAAYDCK  178



>ref|XP_002308228.2| hypothetical protein POPTR_0006s10320g [Populus trichocarpa]
 gb|EEE91751.2| hypothetical protein POPTR_0006s10320g [Populus trichocarpa]
Length=398

 Score =   286 bits (732),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 148/169 (88%), Positives = 164/169 (97%), Gaps = 0/169 (0%)
 Frame = +3

Query  3    ELDLTTPEVVTKYKSAAEILNKGLELVVSQCKPNAKIVDICEKGDAFIREQTGNMYKNVK  182
            ELDLT+PEV+TKYKSAAEI+NK L+LV+S+CKP AKIVDICEKGD+FIREQTGNMYKNVK
Sbjct  11   ELDLTSPEVITKYKSAAEIVNKALQLVISECKPKAKIVDICEKGDSFIREQTGNMYKNVK  70

Query  183  KKIERGVAFPTCISVNNTVCHFSPLSNDDTVLEDGDMVKIDMGCHIDGFIAVVGHTHLLQ  362
            KKIERGVAFPTC+SVNNT+CHFSPL++D++VLE+GD+VKID+GCHIDGFIAVVGHTH LQ
Sbjct  71   KKIERGVAFPTCVSVNNTICHFSPLASDESVLEEGDIVKIDLGCHIDGFIAVVGHTHALQ  130

Query  363  EGPVTGRaadviaaantaaevaLRLVRPGKKNSDVTEAIQKVAAAYDCK  509
             GPVTGRAADVIAAANTAAEVALRLVRPGKKN DVTEAIQKVAAAYDCK
Sbjct  131  SGPVTGRAADVIAAANTAAEVALRLVRPGKKNKDVTEAIQKVAAAYDCK  179



>gb|EYU41925.1| hypothetical protein MIMGU_mgv1a007938mg [Erythranthe guttata]
Length=390

 Score =   286 bits (731),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 149/169 (88%), Positives = 163/169 (96%), Gaps = 0/169 (0%)
 Frame = +3

Query  3    ELDLTTPEVVTKYKSAAEILNKGLELVVSQCKPNAKIVDICEKGDAFIREQTGNMYKNVK  182
            ELDL++PEVVTKYKSAAEI+NK L+LV+SQCKP  KIVD+CE GDAFIREQTGNMYKNVK
Sbjct  11   ELDLSSPEVVTKYKSAAEIVNKALQLVLSQCKPKVKIVDLCEAGDAFIREQTGNMYKNVK  70

Query  183  KKIERGVAFPTCISVNNTVCHFSPLSNDDTVLEDGDMVKIDMGCHIDGFIAVVGHTHLLQ  362
            KKIE+GVAFPTC+SVNNTVCHFSPL++D++VLEDGD+VKIDMGCHIDGFIAVV HTH+LQ
Sbjct  71   KKIEKGVAFPTCVSVNNTVCHFSPLASDESVLEDGDIVKIDMGCHIDGFIAVVAHTHVLQ  130

Query  363  EGPVTGRaadviaaantaaevaLRLVRPGKKNSDVTEAIQKVAAAYDCK  509
            EGPVTGRAADVIAAANTAAEVALRLVRPGKKN DVTEAIQKVAAAYDCK
Sbjct  131  EGPVTGRAADVIAAANTAAEVALRLVRPGKKNKDVTEAIQKVAAAYDCK  179



>ref|NP_001275188.1| EBP1 [Solanum tuberosum]
 gb|ABJ97690.1| EBP1 [Solanum tuberosum]
Length=387

 Score =   285 bits (730),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 149/169 (88%), Positives = 165/169 (98%), Gaps = 0/169 (0%)
 Frame = +3

Query  3    ELDLTTPEVVTKYKSAAEILNKGLELVVSQCKPNAKIVDICEKGDAFIREQTGNMYKNVK  182
            ELDLT+PEVVTKYKSAAEI+NK L+LV+S+CKP  KIVD+CEKGDAFI+EQTGNMYKNVK
Sbjct  10   ELDLTSPEVVTKYKSAAEIVNKALQLVLSECKPKVKIVDLCEKGDAFIKEQTGNMYKNVK  69

Query  183  KKIERGVAFPTCISVNNTVCHFSPLSNDDTVLEDGDMVKIDMGCHIDGFIAVVGHTHLLQ  362
            KKIERGVAFPTCISVNNTVCHFSPL++D+T++E+GD++KIDMGCHIDGFIAVVGHTH+L 
Sbjct  70   KKIERGVAFPTCISVNNTVCHFSPLASDETIVEEGDILKIDMGCHIDGFIAVVGHTHVLH  129

Query  363  EGPVTGRaadviaaantaaevaLRLVRPGKKNSDVTEAIQKVAAAYDCK  509
            EGPVTGRAADVIAAANTAAEVALRLVRPGKKNSDVTEAIQKVAAAYDCK
Sbjct  130  EGPVTGRAADVIAAANTAAEVALRLVRPGKKNSDVTEAIQKVAAAYDCK  178



>ref|XP_002262986.2| PREDICTED: proliferation-associated protein 2G4 [Vitis vinifera]
 ref|XP_010653323.1| PREDICTED: proliferation-associated protein 2G4 [Vitis vinifera]
 emb|CBI18248.3| unnamed protein product [Vitis vinifera]
Length=394

 Score =   285 bits (728),  Expect = 6e-92, Method: Compositional matrix adjust.
 Identities = 149/169 (88%), Positives = 162/169 (96%), Gaps = 0/169 (0%)
 Frame = +3

Query  3    ELDLTTPEVVTKYKSAAEILNKGLELVVSQCKPNAKIVDICEKGDAFIREQTGNMYKNVK  182
            ELDLT+PEVVTKYKSAAEI NK L+LV+S+CKP AKIVDICEKGD+FIREQTGNMYKNVK
Sbjct  10   ELDLTSPEVVTKYKSAAEIANKALQLVLSECKPKAKIVDICEKGDSFIREQTGNMYKNVK  69

Query  183  KKIERGVAFPTCISVNNTVCHFSPLSNDDTVLEDGDMVKIDMGCHIDGFIAVVGHTHLLQ  362
            KKIERGVAFPTCISVNNTVCHFSPL++D+TVLEDGDM+KID+GCHIDGFIAVV HTH+LQ
Sbjct  70   KKIERGVAFPTCISVNNTVCHFSPLASDETVLEDGDMLKIDLGCHIDGFIAVVAHTHVLQ  129

Query  363  EGPVTGRaadviaaantaaevaLRLVRPGKKNSDVTEAIQKVAAAYDCK  509
             GPV GRAADV+AAANTAAEVALRLVRPG+KN DVTEAIQKVAAAYDCK
Sbjct  130  GGPVMGRAADVLAAANTAAEVALRLVRPGRKNKDVTEAIQKVAAAYDCK  178



>ref|XP_011046861.1| PREDICTED: proliferation-associated protein 2G4-like [Populus 
euphratica]
Length=396

 Score =   285 bits (728),  Expect = 7e-92, Method: Compositional matrix adjust.
 Identities = 148/169 (88%), Positives = 164/169 (97%), Gaps = 0/169 (0%)
 Frame = +3

Query  3    ELDLTTPEVVTKYKSAAEILNKGLELVVSQCKPNAKIVDICEKGDAFIREQTGNMYKNVK  182
            ELDLT+PEVVTKYKSAAEI+NK L+L +S+CKP AKIVDICEKGD++IREQ+GNMYKNVK
Sbjct  11   ELDLTSPEVVTKYKSAAEIVNKALQLAISECKPKAKIVDICEKGDSYIREQSGNMYKNVK  70

Query  183  KKIERGVAFPTCISVNNTVCHFSPLSNDDTVLEDGDMVKIDMGCHIDGFIAVVGHTHLLQ  362
            KKIERGVAFPTC+SVNNTVCHFSPL++D++VLE+GD+VKIDMGCHIDGFIAVVGHTH+LQ
Sbjct  71   KKIERGVAFPTCVSVNNTVCHFSPLASDESVLEEGDIVKIDMGCHIDGFIAVVGHTHVLQ  130

Query  363  EGPVTGRaadviaaantaaevaLRLVRPGKKNSDVTEAIQKVAAAYDCK  509
             GPVTGRAADVIAAANTAAEVALRLVRPGKKN DVTEAIQKVAAAYDCK
Sbjct  131  SGPVTGRAADVIAAANTAAEVALRLVRPGKKNKDVTEAIQKVAAAYDCK  179



>ref|XP_002530504.1| proliferation-associated 2g4, putative [Ricinus communis]
 gb|EEF31888.1| proliferation-associated 2g4, putative [Ricinus communis]
Length=394

 Score =   284 bits (727),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 150/169 (89%), Positives = 164/169 (97%), Gaps = 0/169 (0%)
 Frame = +3

Query  3    ELDLTTPEVVTKYKSAAEILNKGLELVVSQCKPNAKIVDICEKGDAFIREQTGNMYKNVK  182
            ELDLT+PEVVTKYKSAAEI+NK L+LV+S+CKP AKIVD+CEKGDAFIREQTGNMYKNVK
Sbjct  10   ELDLTSPEVVTKYKSAAEIVNKALQLVISECKPKAKIVDLCEKGDAFIREQTGNMYKNVK  69

Query  183  KKIERGVAFPTCISVNNTVCHFSPLSNDDTVLEDGDMVKIDMGCHIDGFIAVVGHTHLLQ  362
            KKIERGVAFPTC+SVNNTVCH SPL++D+T+LE+GD+VKIDMGCHIDGFIAVVGHTH+LQ
Sbjct  70   KKIERGVAFPTCVSVNNTVCHCSPLASDETLLEEGDVVKIDMGCHIDGFIAVVGHTHVLQ  129

Query  363  EGPVTGRaadviaaantaaevaLRLVRPGKKNSDVTEAIQKVAAAYDCK  509
             GPVTGRAADVIAAANTAAEVALRLVRPGKKN DVTEAIQKVAAAYDCK
Sbjct  130  AGPVTGRAADVIAAANTAAEVALRLVRPGKKNKDVTEAIQKVAAAYDCK  178



>ref|XP_006344058.1| PREDICTED: proliferation-associated protein 2G4-like isoform 
X2 [Solanum tuberosum]
Length=390

 Score =   284 bits (726),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 149/169 (88%), Positives = 163/169 (96%), Gaps = 0/169 (0%)
 Frame = +3

Query  3    ELDLTTPEVVTKYKSAAEILNKGLELVVSQCKPNAKIVDICEKGDAFIREQTGNMYKNVK  182
            ELDLT+ EVVTKYK AAEI+NK L+LVVS+CKP AKIVD+CEKGDAFI+EQTGNMYKNVK
Sbjct  10   ELDLTSSEVVTKYKGAAEIVNKALQLVVSECKPKAKIVDLCEKGDAFIKEQTGNMYKNVK  69

Query  183  KKIERGVAFPTCISVNNTVCHFSPLSNDDTVLEDGDMVKIDMGCHIDGFIAVVGHTHLLQ  362
            KKIERGVAFPTCISVNNTVCHFSPLS+D+T+LE+GDMVKIDMGCHIDGFIAVV HTH++Q
Sbjct  70   KKIERGVAFPTCISVNNTVCHFSPLSSDETILEEGDMVKIDMGCHIDGFIAVVAHTHVVQ  129

Query  363  EGPVTGRaadviaaantaaevaLRLVRPGKKNSDVTEAIQKVAAAYDCK  509
             GPVTGRAADV+AAANTAAEVALRLVRPG+KNSDVTEAIQKVAAAYDCK
Sbjct  130  GGPVTGRAADVLAAANTAAEVALRLVRPGRKNSDVTEAIQKVAAAYDCK  178



>ref|XP_006344057.1| PREDICTED: proliferation-associated protein 2G4-like isoform 
X1 [Solanum tuberosum]
Length=391

 Score =   284 bits (726),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 149/169 (88%), Positives = 163/169 (96%), Gaps = 0/169 (0%)
 Frame = +3

Query  3    ELDLTTPEVVTKYKSAAEILNKGLELVVSQCKPNAKIVDICEKGDAFIREQTGNMYKNVK  182
            ELDLT+ EVVTKYK AAEI+NK L+LVVS+CKP AKIVD+CEKGDAFI+EQTGNMYKNVK
Sbjct  10   ELDLTSSEVVTKYKGAAEIVNKALQLVVSECKPKAKIVDLCEKGDAFIKEQTGNMYKNVK  69

Query  183  KKIERGVAFPTCISVNNTVCHFSPLSNDDTVLEDGDMVKIDMGCHIDGFIAVVGHTHLLQ  362
            KKIERGVAFPTCISVNNTVCHFSPLS+D+T+LE+GDMVKIDMGCHIDGFIAVV HTH++Q
Sbjct  70   KKIERGVAFPTCISVNNTVCHFSPLSSDETILEEGDMVKIDMGCHIDGFIAVVAHTHVVQ  129

Query  363  EGPVTGRaadviaaantaaevaLRLVRPGKKNSDVTEAIQKVAAAYDCK  509
             GPVTGRAADV+AAANTAAEVALRLVRPG+KNSDVTEAIQKVAAAYDCK
Sbjct  130  GGPVTGRAADVLAAANTAAEVALRLVRPGRKNSDVTEAIQKVAAAYDCK  178



>gb|EYU26681.1| hypothetical protein MIMGU_mgv1a007877mg [Erythranthe guttata]
Length=392

 Score =   284 bits (726),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 148/169 (88%), Positives = 163/169 (96%), Gaps = 0/169 (0%)
 Frame = +3

Query  3    ELDLTTPEVVTKYKSAAEILNKGLELVVSQCKPNAKIVDICEKGDAFIREQTGNMYKNVK  182
            ELDLT+PEVVTKYKSAAEI+NK L+LV+S+CKP AKIVD+CEKGD +IRE +GNMYKNVK
Sbjct  10   ELDLTSPEVVTKYKSAAEIVNKALQLVLSECKPKAKIVDLCEKGDVYIREHSGNMYKNVK  69

Query  183  KKIERGVAFPTCISVNNTVCHFSPLSNDDTVLEDGDMVKIDMGCHIDGFIAVVGHTHLLQ  362
            KKIERGVAFPTCISVNNTVCHFSPL++D+TVLEDGD++KIDMGCHIDGFIAVV HTH+LQ
Sbjct  70   KKIERGVAFPTCISVNNTVCHFSPLASDETVLEDGDILKIDMGCHIDGFIAVVAHTHVLQ  129

Query  363  EGPVTGRaadviaaantaaevaLRLVRPGKKNSDVTEAIQKVAAAYDCK  509
            +GPVTGRAADVIAAANTAAEVALRLVRPGKKN DVTEAIQKVAAAYDCK
Sbjct  130  QGPVTGRAADVIAAANTAAEVALRLVRPGKKNKDVTEAIQKVAAAYDCK  178



>ref|XP_011019082.1| PREDICTED: proliferation-associated protein 2G4-like [Populus 
euphratica]
Length=396

 Score =   283 bits (725),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 148/169 (88%), Positives = 163/169 (96%), Gaps = 0/169 (0%)
 Frame = +3

Query  3    ELDLTTPEVVTKYKSAAEILNKGLELVVSQCKPNAKIVDICEKGDAFIREQTGNMYKNVK  182
            ELDLT+ EVVTKYKSAAEI+NK L+LV+S+CKP AKIVDICEKGD+FIREQ+GNMYKNVK
Sbjct  11   ELDLTSSEVVTKYKSAAEIVNKALQLVISECKPKAKIVDICEKGDSFIREQSGNMYKNVK  70

Query  183  KKIERGVAFPTCISVNNTVCHFSPLSNDDTVLEDGDMVKIDMGCHIDGFIAVVGHTHLLQ  362
            KKIERGVAFPTC+SVNNT+CHFSPL++D+TVLE+GD+VKID+GCHIDGFIAVVGHTH LQ
Sbjct  71   KKIERGVAFPTCVSVNNTICHFSPLASDETVLEEGDIVKIDLGCHIDGFIAVVGHTHALQ  130

Query  363  EGPVTGRaadviaaantaaevaLRLVRPGKKNSDVTEAIQKVAAAYDCK  509
             GPVTGRAADVIAAANTAAEVALRLVRPGKKN DVTEAIQKVAAAYDCK
Sbjct  131  SGPVTGRAADVIAAANTAAEVALRLVRPGKKNKDVTEAIQKVAAAYDCK  179



>ref|XP_004156612.1| PREDICTED: LOW QUALITY PROTEIN: proliferation-associated protein 
2G4-like [Cucumis sativus]
Length=395

 Score =   283 bits (724),  Expect = 3e-91, Method: Compositional matrix adjust.
 Identities = 150/171 (88%), Positives = 164/171 (96%), Gaps = 2/171 (1%)
 Frame = +3

Query  3    ELDLTTPEVVTKYKSAAEILNKGLELVVSQCKPNAKIVDICEKGDAFIREQTGNMYKNVK  182
            ELDLT+PEVVTKYKSAAEI NK L+LV+S+CKP AKIVDICEKGD+FIREQTGNMYKNVK
Sbjct  11   ELDLTSPEVVTKYKSAAEIANKALQLVISECKPKAKIVDICEKGDSFIREQTGNMYKNVK  70

Query  183  KKIERGVAFPTCISVNNTVCHFSPLSNDDTVLEDGDMVKIDMGCHIDGFIAVVGHTHLLQ  362
            KKIERGVAFPTCISVNNT+CHFSPLS+D+T+LE+GDMVKID+GCHIDGFIAVV HTH+LQ
Sbjct  71   KKIERGVAFPTCISVNNTICHFSPLSSDETLLEEGDMVKIDLGCHIDGFIAVVAHTHVLQ  130

Query  363  EGPVTGRaadviaaantaaevaLRLVRPGKK--NSDVTEAIQKVAAAYDCK  509
            EGPVTGRAADVIAAANTAAEVALRLVRPGK+  N DVTEAIQKVAA+YDCK
Sbjct  131  EGPVTGRAADVIAAANTAAEVALRLVRPGKRXHNKDVTEAIQKVAASYDCK  181



>ref|XP_008464212.1| PREDICTED: proliferation-associated protein 2G4-like [Cucumis 
melo]
Length=454

 Score =   285 bits (728),  Expect = 4e-91, Method: Compositional matrix adjust.
 Identities = 149/169 (88%), Positives = 164/169 (97%), Gaps = 0/169 (0%)
 Frame = +3

Query  3    ELDLTTPEVVTKYKSAAEILNKGLELVVSQCKPNAKIVDICEKGDAFIREQTGNMYKNVK  182
            ELDL++P+VVTKYKSAAEI+NK L+LV+SQCKP AKIVDICEKGD+FIREQTGNMYKNVK
Sbjct  68   ELDLSSPDVVTKYKSAAEIINKALQLVISQCKPKAKIVDICEKGDSFIREQTGNMYKNVK  127

Query  183  KKIERGVAFPTCISVNNTVCHFSPLSNDDTVLEDGDMVKIDMGCHIDGFIAVVGHTHLLQ  362
            KKIERGVAFPTCISVNNTV HFSPL++D+TV+E+GD++KIDMGCHIDGFIAVV HTH+LQ
Sbjct  128  KKIERGVAFPTCISVNNTVGHFSPLASDETVMEEGDILKIDMGCHIDGFIAVVAHTHVLQ  187

Query  363  EGPVTGRaadviaaantaaevaLRLVRPGKKNSDVTEAIQKVAAAYDCK  509
            EGPVTGRAADVIAAANTAAEVALRLVRPGKKN DVTEAIQKVAAAYDCK
Sbjct  188  EGPVTGRAADVIAAANTAAEVALRLVRPGKKNKDVTEAIQKVAAAYDCK  236



>ref|XP_010037691.1| PREDICTED: proliferation-associated protein 2G4 [Eucalyptus grandis]
 gb|KCW49439.1| hypothetical protein EUGRSUZ_K02971 [Eucalyptus grandis]
Length=392

 Score =   282 bits (722),  Expect = 4e-91, Method: Compositional matrix adjust.
 Identities = 147/169 (87%), Positives = 163/169 (96%), Gaps = 0/169 (0%)
 Frame = +3

Query  3    ELDLTTPEVVTKYKSAAEILNKGLELVVSQCKPNAKIVDICEKGDAFIREQTGNMYKNVK  182
            ELDLT+P+VVTKYKSAAEI+NK L+LV+S+CKP AK+VD+CEKGD+FIREQTGNMYKNVK
Sbjct  10   ELDLTSPDVVTKYKSAAEIVNKALQLVISECKPKAKVVDVCEKGDSFIREQTGNMYKNVK  69

Query  183  KKIERGVAFPTCISVNNTVCHFSPLSNDDTVLEDGDMVKIDMGCHIDGFIAVVGHTHLLQ  362
            KKIERGVAFPTCISVNNTVCHFSPL++D+TVLE+GD++KIDMGCHIDGFIAVV HTH+LQ
Sbjct  70   KKIERGVAFPTCISVNNTVCHFSPLASDETVLEEGDILKIDMGCHIDGFIAVVAHTHVLQ  129

Query  363  EGPVTGRaadviaaantaaevaLRLVRPGKKNSDVTEAIQKVAAAYDCK  509
            EGPVTGRAADVIAAANTAAEVALRLVRPGK N DVTEAI KVAAAYDCK
Sbjct  130  EGPVTGRAADVIAAANTAAEVALRLVRPGKNNKDVTEAINKVAAAYDCK  178



>ref|XP_004240407.1| PREDICTED: proliferation-associated protein 2G4-like isoform 
X2 [Solanum lycopersicum]
Length=390

 Score =   282 bits (721),  Expect = 7e-91, Method: Compositional matrix adjust.
 Identities = 149/169 (88%), Positives = 163/169 (96%), Gaps = 0/169 (0%)
 Frame = +3

Query  3    ELDLTTPEVVTKYKSAAEILNKGLELVVSQCKPNAKIVDICEKGDAFIREQTGNMYKNVK  182
            ELDLT+PEVVTKYK AAEI+NK L+LVVS+CK  AKIVD+CEKGDAFI+EQTGNMYKNVK
Sbjct  10   ELDLTSPEVVTKYKGAAEIVNKALQLVVSECKAKAKIVDLCEKGDAFIKEQTGNMYKNVK  69

Query  183  KKIERGVAFPTCISVNNTVCHFSPLSNDDTVLEDGDMVKIDMGCHIDGFIAVVGHTHLLQ  362
            KKIERGVAFPTCISVNNTVCHFSPLS+D+TVLE+GD+VKIDMGCHIDGFIAVV HTH++Q
Sbjct  70   KKIERGVAFPTCISVNNTVCHFSPLSSDETVLEEGDIVKIDMGCHIDGFIAVVAHTHVVQ  129

Query  363  EGPVTGRaadviaaantaaevaLRLVRPGKKNSDVTEAIQKVAAAYDCK  509
             GPVTGRAADV+AAANTAAEVALRLVRPG+KNSDVTEAIQKVAAAYDCK
Sbjct  130  GGPVTGRAADVLAAANTAAEVALRLVRPGRKNSDVTEAIQKVAAAYDCK  178



>ref|XP_010321752.1| PREDICTED: proliferation-associated protein 2G4-like isoform 
X1 [Solanum lycopersicum]
Length=391

 Score =   282 bits (721),  Expect = 7e-91, Method: Compositional matrix adjust.
 Identities = 149/169 (88%), Positives = 163/169 (96%), Gaps = 0/169 (0%)
 Frame = +3

Query  3    ELDLTTPEVVTKYKSAAEILNKGLELVVSQCKPNAKIVDICEKGDAFIREQTGNMYKNVK  182
            ELDLT+PEVVTKYK AAEI+NK L+LVVS+CK  AKIVD+CEKGDAFI+EQTGNMYKNVK
Sbjct  10   ELDLTSPEVVTKYKGAAEIVNKALQLVVSECKAKAKIVDLCEKGDAFIKEQTGNMYKNVK  69

Query  183  KKIERGVAFPTCISVNNTVCHFSPLSNDDTVLEDGDMVKIDMGCHIDGFIAVVGHTHLLQ  362
            KKIERGVAFPTCISVNNTVCHFSPLS+D+TVLE+GD+VKIDMGCHIDGFIAVV HTH++Q
Sbjct  70   KKIERGVAFPTCISVNNTVCHFSPLSSDETVLEEGDIVKIDMGCHIDGFIAVVAHTHVVQ  129

Query  363  EGPVTGRaadviaaantaaevaLRLVRPGKKNSDVTEAIQKVAAAYDCK  509
             GPVTGRAADV+AAANTAAEVALRLVRPG+KNSDVTEAIQKVAAAYDCK
Sbjct  130  GGPVTGRAADVLAAANTAAEVALRLVRPGRKNSDVTEAIQKVAAAYDCK  178



>ref|XP_006576221.1| PREDICTED: uncharacterized protein LOC100784176 isoform X1 [Glycine 
max]
Length=390

 Score =   281 bits (720),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 142/169 (84%), Positives = 162/169 (96%), Gaps = 0/169 (0%)
 Frame = +3

Query  3    ELDLTTPEVVTKYKSAAEILNKGLELVVSQCKPNAKIVDICEKGDAFIREQTGNMYKNVK  182
            ELDLT+PEVVTKYKSAAEI+N+ L+LV+S+CKP AKIVD+CEKGD++IREQTG+MYKNVK
Sbjct  10   ELDLTSPEVVTKYKSAAEIVNRALQLVISECKPKAKIVDLCEKGDSYIREQTGSMYKNVK  69

Query  183  KKIERGVAFPTCISVNNTVCHFSPLSNDDTVLEDGDMVKIDMGCHIDGFIAVVGHTHLLQ  362
            +KIERGVAFPTC+SVNNTVCHFSPL++D+TVLEDGD+VKIDM CHIDGFIA V HTH+LQ
Sbjct  70   RKIERGVAFPTCVSVNNTVCHFSPLASDETVLEDGDIVKIDMACHIDGFIAAVAHTHVLQ  129

Query  363  EGPVTGRaadviaaantaaevaLRLVRPGKKNSDVTEAIQKVAAAYDCK  509
            EGPVTGRAAD +AAANTAAEVALRLVRPG+KN DVTEAIQK+AAAYDCK
Sbjct  130  EGPVTGRAADALAAANTAAEVALRLVRPGRKNKDVTEAIQKIAAAYDCK  178



>gb|AEY75257.1| putative DNA binding protein [Atriplex canescens]
Length=396

 Score =   281 bits (720),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 142/169 (84%), Positives = 160/169 (95%), Gaps = 0/169 (0%)
 Frame = +3

Query  3    ELDLTTPEVVTKYKSAAEILNKGLELVVSQCKPNAKIVDICEKGDAFIREQTGNMYKNVK  182
            ELDL+ PEVVTKYKSAA+I+N+ L+LVV++CKP AKIVD+CEKGD FIREQTGNMYKNVK
Sbjct  10   ELDLSYPEVVTKYKSAADIVNRALQLVVAECKPKAKIVDLCEKGDNFIREQTGNMYKNVK  69

Query  183  KKIERGVAFPTCISVNNTVCHFSPLSNDDTVLEDGDMVKIDMGCHIDGFIAVVGHTHLLQ  362
            KKIERGVAFPTC+S+NN VCHFSPL++DD+VLE+GD+VKIDMGCHIDGFIAVV HTH++Q
Sbjct  70   KKIERGVAFPTCLSINNVVCHFSPLASDDSVLEEGDLVKIDMGCHIDGFIAVVAHTHVIQ  129

Query  363  EGPVTGRaadviaaantaaevaLRLVRPGKKNSDVTEAIQKVAAAYDCK  509
            EGPVTGR ADV+AA NTAAEVALRLVRPGKKN DVTEAIQKVAAAYDCK
Sbjct  130  EGPVTGRKADVLAATNTAAEVALRLVRPGKKNKDVTEAIQKVAAAYDCK  178



>ref|XP_009402229.1| PREDICTED: proliferation-associated protein 2G4-like [Musa acuminata 
subsp. malaccensis]
 ref|XP_009402230.1| PREDICTED: proliferation-associated protein 2G4-like [Musa acuminata 
subsp. malaccensis]
Length=395

 Score =   281 bits (719),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 147/169 (87%), Positives = 162/169 (96%), Gaps = 0/169 (0%)
 Frame = +3

Query  3    ELDLTTPEVVTKYKSAAEILNKGLELVVSQCKPNAKIVDICEKGDAFIREQTGNMYKNVK  182
            ELDLT+P+VVTKYKSAAEI+NK L+LV S+CKP AKIVD+CE+GDAFIREQ GN+YKNVK
Sbjct  11   ELDLTSPDVVTKYKSAAEIVNKALQLVTSKCKPKAKIVDLCEQGDAFIREQAGNIYKNVK  70

Query  183  KKIERGVAFPTCISVNNTVCHFSPLSNDDTVLEDGDMVKIDMGCHIDGFIAVVGHTHLLQ  362
            +KIERGVAFPTCISVNNTVCHFSPL++DD VLE+ D+VKIDMGCHIDGFIAVVGHTH++Q
Sbjct  71   RKIERGVAFPTCISVNNTVCHFSPLASDDAVLEENDIVKIDMGCHIDGFIAVVGHTHVIQ  130

Query  363  EGPVTGRaadviaaantaaevaLRLVRPGKKNSDVTEAIQKVAAAYDCK  509
            EGPVTGRAADVIAAANTAAEVALRLVRPGKKN DVTEAIQKVAAAYDCK
Sbjct  131  EGPVTGRAADVIAAANTAAEVALRLVRPGKKNKDVTEAIQKVAAAYDCK  179



>ref|NP_001242070.1| uncharacterized protein LOC100784176 [Glycine max]
 gb|ACU23134.1| unknown [Glycine max]
Length=390

 Score =   281 bits (718),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 142/169 (84%), Positives = 162/169 (96%), Gaps = 0/169 (0%)
 Frame = +3

Query  3    ELDLTTPEVVTKYKSAAEILNKGLELVVSQCKPNAKIVDICEKGDAFIREQTGNMYKNVK  182
            ELDLT+PEVVTKYKSAAEI+N+ L+LV+S+CKP AKIVD+CEKGD++IREQTG+MYKNVK
Sbjct  10   ELDLTSPEVVTKYKSAAEIVNRALQLVISECKPKAKIVDLCEKGDSYIREQTGSMYKNVK  69

Query  183  KKIERGVAFPTCISVNNTVCHFSPLSNDDTVLEDGDMVKIDMGCHIDGFIAVVGHTHLLQ  362
            +KIERGVAFPTC+SVNNTVCHFSPL++D+TVLEDGD+VKIDM CHIDGFIA V HTH+LQ
Sbjct  70   RKIERGVAFPTCVSVNNTVCHFSPLASDETVLEDGDIVKIDMACHIDGFIAAVAHTHVLQ  129

Query  363  EGPVTGRaadviaaantaaevaLRLVRPGKKNSDVTEAIQKVAAAYDCK  509
            EGPVTGRAAD +AAANTAAEVALRLVRPG+KN DVTEAIQK+AAAYDCK
Sbjct  130  EGPVTGRAADALAAANTAAEVALRLVRPGRKNKDVTEAIQKIAAAYDCK  178



>gb|KDP22867.1| hypothetical protein JCGZ_00454 [Jatropha curcas]
Length=396

 Score =   281 bits (719),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 147/169 (87%), Positives = 162/169 (96%), Gaps = 0/169 (0%)
 Frame = +3

Query  3    ELDLTTPEVVTKYKSAAEILNKGLELVVSQCKPNAKIVDICEKGDAFIREQTGNMYKNVK  182
            ELDLT+PEVVTKYKSAAEI+NK L+LV+S CKP AKIVD+CEKGD +IREQTGNMYKNVK
Sbjct  10   ELDLTSPEVVTKYKSAAEIVNKALQLVISGCKPKAKIVDLCEKGDTYIREQTGNMYKNVK  69

Query  183  KKIERGVAFPTCISVNNTVCHFSPLSNDDTVLEDGDMVKIDMGCHIDGFIAVVGHTHLLQ  362
            KKIERGVAFPTC+SVNNTVCHFSPL++D++VLEDGD+VKIDMGCHIDGFIAVV HTH++Q
Sbjct  70   KKIERGVAFPTCVSVNNTVCHFSPLASDESVLEDGDIVKIDMGCHIDGFIAVVAHTHVIQ  129

Query  363  EGPVTGRaadviaaantaaevaLRLVRPGKKNSDVTEAIQKVAAAYDCK  509
             GPVTG+AADVIAAANTAAEVALRLVRPGKKN DVTEAIQKVAAAYDCK
Sbjct  130  SGPVTGKAADVIAAANTAAEVALRLVRPGKKNKDVTEAIQKVAAAYDCK  178



>ref|XP_009376423.1| PREDICTED: proliferation-associated protein 2G4 isoform X2 [Pyrus 
x bretschneideri]
Length=387

 Score =   280 bits (717),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 144/169 (85%), Positives = 164/169 (97%), Gaps = 0/169 (0%)
 Frame = +3

Query  3    ELDLTTPEVVTKYKSAAEILNKGLELVVSQCKPNAKIVDICEKGDAFIREQTGNMYKNVK  182
            ELDLT+PEVVTKYKSAAEI+NK L+LV+S+CKP AKIV++CEKGD++IREQTGNMYKNVK
Sbjct  10   ELDLTSPEVVTKYKSAAEIVNKALQLVISECKPKAKIVELCEKGDSYIREQTGNMYKNVK  69

Query  183  KKIERGVAFPTCISVNNTVCHFSPLSNDDTVLEDGDMVKIDMGCHIDGFIAVVGHTHLLQ  362
            KKIERGVAFPTCISVNNTVCHFSPL++D++VLE+GD++KID+GCHIDGFIA+V HTH+LQ
Sbjct  70   KKIERGVAFPTCISVNNTVCHFSPLASDESVLEEGDILKIDLGCHIDGFIAIVAHTHVLQ  129

Query  363  EGPVTGRaadviaaantaaevaLRLVRPGKKNSDVTEAIQKVAAAYDCK  509
             GPVTGRAADVIAAANTAAEVALRLVRPG+KN DVTEAIQKVAAAYDCK
Sbjct  130  AGPVTGRAADVIAAANTAAEVALRLVRPGRKNKDVTEAIQKVAAAYDCK  178



>gb|KHN42848.1| Proliferation-associated protein 2G4 [Glycine soja]
Length=390

 Score =   280 bits (717),  Expect = 3e-90, Method: Compositional matrix adjust.
 Identities = 144/169 (85%), Positives = 160/169 (95%), Gaps = 0/169 (0%)
 Frame = +3

Query  3    ELDLTTPEVVTKYKSAAEILNKGLELVVSQCKPNAKIVDICEKGDAFIREQTGNMYKNVK  182
            ELDLT+PEVVTKYKSAAEI+NK L+LV+S+CKP  KIVD+CEKGD++IREQTGNMYKNVK
Sbjct  10   ELDLTSPEVVTKYKSAAEIVNKALQLVISECKPKTKIVDLCEKGDSYIREQTGNMYKNVK  69

Query  183  KKIERGVAFPTCISVNNTVCHFSPLSNDDTVLEDGDMVKIDMGCHIDGFIAVVGHTHLLQ  362
            +KIERGVAFPTC+SVNNTVCHFSPL++D+TVLEDGD+VKIDM CHIDGFIA V HTH+L 
Sbjct  70   RKIERGVAFPTCVSVNNTVCHFSPLASDETVLEDGDIVKIDMACHIDGFIAAVAHTHVLH  129

Query  363  EGPVTGRaadviaaantaaevaLRLVRPGKKNSDVTEAIQKVAAAYDCK  509
            EGPVTGRAAD IAAANTAAEVALRLVRPG+KN DVTEAIQKVAAAYDCK
Sbjct  130  EGPVTGRAADAIAAANTAAEVALRLVRPGRKNKDVTEAIQKVAAAYDCK  178



>ref|XP_003516956.1| PREDICTED: proliferation-associated protein 2G4 [Glycine max]
Length=390

 Score =   280 bits (717),  Expect = 3e-90, Method: Compositional matrix adjust.
 Identities = 144/169 (85%), Positives = 160/169 (95%), Gaps = 0/169 (0%)
 Frame = +3

Query  3    ELDLTTPEVVTKYKSAAEILNKGLELVVSQCKPNAKIVDICEKGDAFIREQTGNMYKNVK  182
            ELDLT+PEVVTKYKSAAEI+NK L+LV+S+CKP  KIVD+CEKGD++IREQTGNMYKNVK
Sbjct  10   ELDLTSPEVVTKYKSAAEIVNKALQLVISECKPKTKIVDLCEKGDSYIREQTGNMYKNVK  69

Query  183  KKIERGVAFPTCISVNNTVCHFSPLSNDDTVLEDGDMVKIDMGCHIDGFIAVVGHTHLLQ  362
            +KIERGVAFPTC+SVNNTVCHFSPL++D+TVLEDGD+VKIDM CHIDGFIA V HTH+L 
Sbjct  70   RKIERGVAFPTCVSVNNTVCHFSPLASDETVLEDGDIVKIDMACHIDGFIAAVAHTHVLH  129

Query  363  EGPVTGRaadviaaantaaevaLRLVRPGKKNSDVTEAIQKVAAAYDCK  509
            EGPVTGRAAD IAAANTAAEVALRLVRPG+KN DVTEAIQKVAAAYDCK
Sbjct  130  EGPVTGRAADAIAAANTAAEVALRLVRPGRKNKDVTEAIQKVAAAYDCK  178



>ref|XP_009376419.1| PREDICTED: proliferation-associated protein 2G4 isoform X1 [Pyrus 
x bretschneideri]
 ref|XP_009376420.1| PREDICTED: proliferation-associated protein 2G4 isoform X1 [Pyrus 
x bretschneideri]
Length=394

 Score =   280 bits (717),  Expect = 3e-90, Method: Compositional matrix adjust.
 Identities = 144/169 (85%), Positives = 164/169 (97%), Gaps = 0/169 (0%)
 Frame = +3

Query  3    ELDLTTPEVVTKYKSAAEILNKGLELVVSQCKPNAKIVDICEKGDAFIREQTGNMYKNVK  182
            ELDLT+PEVVTKYKSAAEI+NK L+LV+S+CKP AKIV++CEKGD++IREQTGNMYKNVK
Sbjct  10   ELDLTSPEVVTKYKSAAEIVNKALQLVISECKPKAKIVELCEKGDSYIREQTGNMYKNVK  69

Query  183  KKIERGVAFPTCISVNNTVCHFSPLSNDDTVLEDGDMVKIDMGCHIDGFIAVVGHTHLLQ  362
            KKIERGVAFPTCISVNNTVCHFSPL++D++VLE+GD++KID+GCHIDGFIA+V HTH+LQ
Sbjct  70   KKIERGVAFPTCISVNNTVCHFSPLASDESVLEEGDILKIDLGCHIDGFIAIVAHTHVLQ  129

Query  363  EGPVTGRaadviaaantaaevaLRLVRPGKKNSDVTEAIQKVAAAYDCK  509
             GPVTGRAADVIAAANTAAEVALRLVRPG+KN DVTEAIQKVAAAYDCK
Sbjct  130  AGPVTGRAADVIAAANTAAEVALRLVRPGRKNKDVTEAIQKVAAAYDCK  178



>ref|XP_007205303.1| hypothetical protein PRUPE_ppa006778mg [Prunus persica]
 ref|XP_007205304.1| hypothetical protein PRUPE_ppa006778mg [Prunus persica]
 ref|XP_008243362.1| PREDICTED: proliferation-associated protein 2G4 [Prunus mume]
 gb|EMJ06502.1| hypothetical protein PRUPE_ppa006778mg [Prunus persica]
 gb|EMJ06503.1| hypothetical protein PRUPE_ppa006778mg [Prunus persica]
Length=395

 Score =   280 bits (717),  Expect = 4e-90, Method: Compositional matrix adjust.
 Identities = 145/169 (86%), Positives = 163/169 (96%), Gaps = 0/169 (0%)
 Frame = +3

Query  3    ELDLTTPEVVTKYKSAAEILNKGLELVVSQCKPNAKIVDICEKGDAFIREQTGNMYKNVK  182
            ELDL++PEVVTKYKSAAEI+NK L+LV+S+CKP AKIVD+CEKGD++IREQTGNMYKNVK
Sbjct  10   ELDLSSPEVVTKYKSAAEIVNKALQLVISECKPKAKIVDLCEKGDSYIREQTGNMYKNVK  69

Query  183  KKIERGVAFPTCISVNNTVCHFSPLSNDDTVLEDGDMVKIDMGCHIDGFIAVVGHTHLLQ  362
            KKIERGVAFPTCISVNNTVCHFSPL++D+TVLE+GD++KID+GCHIDGFIA+V HTH LQ
Sbjct  70   KKIERGVAFPTCISVNNTVCHFSPLASDETVLEEGDILKIDLGCHIDGFIAIVAHTHALQ  129

Query  363  EGPVTGRaadviaaantaaevaLRLVRPGKKNSDVTEAIQKVAAAYDCK  509
             GPVTG+AADVIAAANTAAEVALRLVRPGKKN DVTEAIQKVAAAYDCK
Sbjct  130  AGPVTGKAADVIAAANTAAEVALRLVRPGKKNKDVTEAIQKVAAAYDCK  178



>ref|XP_008805004.1| PREDICTED: proliferation-associated protein 2G4-like [Phoenix 
dactylifera]
 ref|XP_008805005.1| PREDICTED: proliferation-associated protein 2G4-like [Phoenix 
dactylifera]
Length=396

 Score =   280 bits (717),  Expect = 4e-90, Method: Compositional matrix adjust.
 Identities = 147/169 (87%), Positives = 160/169 (95%), Gaps = 0/169 (0%)
 Frame = +3

Query  3    ELDLTTPEVVTKYKSAAEILNKGLELVVSQCKPNAKIVDICEKGDAFIREQTGNMYKNVK  182
            ELDLT+ +VVTKYKSAAEI+NK L+LV+S+CKP AKIVDICEKGDAFIREQ GNMYKNVK
Sbjct  10   ELDLTSSDVVTKYKSAAEIVNKALQLVLSECKPKAKIVDICEKGDAFIREQAGNMYKNVK  69

Query  183  KKIERGVAFPTCISVNNTVCHFSPLSNDDTVLEDGDMVKIDMGCHIDGFIAVVGHTHLLQ  362
            KKIERGVAFPTCISVNNTVCHFSPL+ D+TVLE+ D+VKID+GCHIDGFIAVV HTH+LQ
Sbjct  70   KKIERGVAFPTCISVNNTVCHFSPLAGDETVLEENDIVKIDIGCHIDGFIAVVAHTHVLQ  129

Query  363  EGPVTGRaadviaaantaaevaLRLVRPGKKNSDVTEAIQKVAAAYDCK  509
            EGPVTGRAADVIAA+NTAAEVALRLVRPGKKN DVTEAIQKVAA YDCK
Sbjct  130  EGPVTGRAADVIAASNTAAEVALRLVRPGKKNKDVTEAIQKVAATYDCK  178



>ref|XP_007026647.1| Metallopeptidase M24 family protein isoform 2 [Theobroma cacao]
 gb|EOY07149.1| Metallopeptidase M24 family protein isoform 2 [Theobroma cacao]
Length=286

 Score =   276 bits (707),  Expect = 4e-90, Method: Compositional matrix adjust.
 Identities = 141/169 (83%), Positives = 157/169 (93%), Gaps = 0/169 (0%)
 Frame = +3

Query  3    ELDLTTPEVVTKYKSAAEILNKGLELVVSQCKPNAKIVDICEKGDAFIREQTGNMYKNVK  182
            ELDLT+PEVVTKYKSAAEI+NK L+LVV  CKP AKIVDICEKGD FIREQTGNMYKNVK
Sbjct  10   ELDLTSPEVVTKYKSAAEIVNKALQLVVKDCKPKAKIVDICEKGDVFIREQTGNMYKNVK  69

Query  183  KKIERGVAFPTCISVNNTVCHFSPLSNDDTVLEDGDMVKIDMGCHIDGFIAVVGHTHLLQ  362
            +KIERGVAFPTCISVNNTVCH SPL++D + LE+GDMVKID+GCHIDGFIA+V HTH++Q
Sbjct  70   RKIERGVAFPTCISVNNTVCHISPLASDTSELEEGDMVKIDLGCHIDGFIAIVAHTHVVQ  129

Query  363  EGPVTGRaadviaaantaaevaLRLVRPGKKNSDVTEAIQKVAAAYDCK  509
            +GP+TGR ADV+AA NTAAEVALRLVRPGKKN DVT+AIQKVAAAYDCK
Sbjct  130  DGPITGRQADVVAAVNTAAEVALRLVRPGKKNKDVTDAIQKVAAAYDCK  178



>ref|XP_006843644.1| hypothetical protein AMTR_s00007p00167240 [Amborella trichopoda]
 gb|ERN05319.1| hypothetical protein AMTR_s00007p00167240 [Amborella trichopoda]
Length=318

 Score =   277 bits (709),  Expect = 4e-90, Method: Compositional matrix adjust.
 Identities = 147/169 (87%), Positives = 161/169 (95%), Gaps = 0/169 (0%)
 Frame = +3

Query  3    ELDLTTPEVVTKYKSAAEILNKGLELVVSQCKPNAKIVDICEKGDAFIREQTGNMYKNVK  182
            ELDLT+P+VVTKYK+AAEILNK L+LVVS+CKP AK+VDICEKGDAFIREQTG++YKN K
Sbjct  11   ELDLTSPDVVTKYKTAAEILNKALQLVVSECKPKAKVVDICEKGDAFIREQTGSVYKNAK  70

Query  183  KKIERGVAFPTCISVNNTVCHFSPLSNDDTVLEDGDMVKIDMGCHIDGFIAVVGHTHLLQ  362
            KKIERGVAFPTCISVNNTVCHFSPL++D+T L + DMVKIDMGCHIDGFIAVV HTH+LQ
Sbjct  71   KKIERGVAFPTCISVNNTVCHFSPLASDETTLVENDMVKIDMGCHIDGFIAVVAHTHVLQ  130

Query  363  EGPVTGRaadviaaantaaevaLRLVRPGKKNSDVTEAIQKVAAAYDCK  509
            EGPVTGRAADVIAAANTAAEVALRLVRPG+KN DVTEAIQKVAAAYDCK
Sbjct  131  EGPVTGRAADVIAAANTAAEVALRLVRPGRKNKDVTEAIQKVAAAYDCK  179



>gb|KDO56711.1| hypothetical protein CISIN_1g016183mg [Citrus sinensis]
 gb|KDO56712.1| hypothetical protein CISIN_1g016183mg [Citrus sinensis]
Length=394

 Score =   280 bits (716),  Expect = 5e-90, Method: Compositional matrix adjust.
 Identities = 145/169 (86%), Positives = 163/169 (96%), Gaps = 0/169 (0%)
 Frame = +3

Query  3    ELDLTTPEVVTKYKSAAEILNKGLELVVSQCKPNAKIVDICEKGDAFIREQTGNMYKNVK  182
            ELDLT+PEVVTKYKSAAEI NK L+LVVS+CKP  KIVD+CEKGD+FIREQTGNMYKNVK
Sbjct  10   ELDLTSPEVVTKYKSAAEIANKALQLVVSECKPGVKIVDLCEKGDSFIREQTGNMYKNVK  69

Query  183  KKIERGVAFPTCISVNNTVCHFSPLSNDDTVLEDGDMVKIDMGCHIDGFIAVVGHTHLLQ  362
            KKIERGVAFP+C+SVNNT+CHFSPL++D+TVL++GDM+KID+GCHIDGFIAVV HTH+LQ
Sbjct  70   KKIERGVAFPSCVSVNNTLCHFSPLASDETVLQEGDMIKIDLGCHIDGFIAVVAHTHVLQ  129

Query  363  EGPVTGRaadviaaantaaevaLRLVRPGKKNSDVTEAIQKVAAAYDCK  509
            +GPVTGRAADVIAAANTAAEVALRLVRPGKKN DVTEAIQKVAAA+DCK
Sbjct  130  DGPVTGRAADVIAAANTAAEVALRLVRPGKKNKDVTEAIQKVAAAHDCK  178



>ref|XP_008388269.1| PREDICTED: proliferation-associated protein 2G4-like isoform 
X1 [Malus domestica]
Length=395

 Score =   280 bits (715),  Expect = 6e-90, Method: Compositional matrix adjust.
 Identities = 144/169 (85%), Positives = 162/169 (96%), Gaps = 0/169 (0%)
 Frame = +3

Query  3    ELDLTTPEVVTKYKSAAEILNKGLELVVSQCKPNAKIVDICEKGDAFIREQTGNMYKNVK  182
            ELDLT+PEVVTKYKSAAEI+NK L+LV+S+CKP AKIVD+CEKGD++IREQTGNMYKN K
Sbjct  10   ELDLTSPEVVTKYKSAAEIVNKALQLVISECKPKAKIVDLCEKGDSYIREQTGNMYKNAK  69

Query  183  KKIERGVAFPTCISVNNTVCHFSPLSNDDTVLEDGDMVKIDMGCHIDGFIAVVGHTHLLQ  362
            KKIERGVAFPTCISVNNTVCHFSPL +D++VLE+GD++KID+GCHIDGFIA+V HTH+LQ
Sbjct  70   KKIERGVAFPTCISVNNTVCHFSPLGSDESVLEEGDILKIDLGCHIDGFIAIVAHTHVLQ  129

Query  363  EGPVTGRaadviaaantaaevaLRLVRPGKKNSDVTEAIQKVAAAYDCK  509
             GPVTGRAADVIAAANTAAEVALRLVRPG+KN DVTEAIQKVAAAYDCK
Sbjct  130  AGPVTGRAADVIAAANTAAEVALRLVRPGRKNKDVTEAIQKVAAAYDCK  178



>ref|XP_002322994.2| hypothetical protein POPTR_0016s12720g [Populus trichocarpa]
 gb|EEF04755.2| hypothetical protein POPTR_0016s12720g [Populus trichocarpa]
Length=375

 Score =   279 bits (713),  Expect = 8e-90, Method: Compositional matrix adjust.
 Identities = 146/169 (86%), Positives = 162/169 (96%), Gaps = 0/169 (0%)
 Frame = +3

Query  3    ELDLTTPEVVTKYKSAAEILNKGLELVVSQCKPNAKIVDICEKGDAFIREQTGNMYKNVK  182
            ELDLT+PEVVTKYKSAAEI+NK L+L +S+CKP  KIVDICEK D++IREQ+GNMYKNVK
Sbjct  11   ELDLTSPEVVTKYKSAAEIVNKALQLAISECKPKVKIVDICEKADSYIREQSGNMYKNVK  70

Query  183  KKIERGVAFPTCISVNNTVCHFSPLSNDDTVLEDGDMVKIDMGCHIDGFIAVVGHTHLLQ  362
            KKIERGVAFPTC+SVNNTVCHFSPL++D++VLE+GD+VKIDMGCHIDGFIAVVGHTH+LQ
Sbjct  71   KKIERGVAFPTCVSVNNTVCHFSPLASDESVLEEGDVVKIDMGCHIDGFIAVVGHTHVLQ  130

Query  363  EGPVTGRaadviaaantaaevaLRLVRPGKKNSDVTEAIQKVAAAYDCK  509
             GPVTGRAADVIAAANTAAEVALRLVRPGKKN DVTEAIQKVAAAYDCK
Sbjct  131  LGPVTGRAADVIAAANTAAEVALRLVRPGKKNKDVTEAIQKVAAAYDCK  179



>ref|XP_008388270.1| PREDICTED: proliferation-associated protein 2G4-like isoform 
X2 [Malus domestica]
Length=388

 Score =   279 bits (714),  Expect = 8e-90, Method: Compositional matrix adjust.
 Identities = 144/169 (85%), Positives = 162/169 (96%), Gaps = 0/169 (0%)
 Frame = +3

Query  3    ELDLTTPEVVTKYKSAAEILNKGLELVVSQCKPNAKIVDICEKGDAFIREQTGNMYKNVK  182
            ELDLT+PEVVTKYKSAAEI+NK L+LV+S+CKP AKIVD+CEKGD++IREQTGNMYKN K
Sbjct  10   ELDLTSPEVVTKYKSAAEIVNKALQLVISECKPKAKIVDLCEKGDSYIREQTGNMYKNAK  69

Query  183  KKIERGVAFPTCISVNNTVCHFSPLSNDDTVLEDGDMVKIDMGCHIDGFIAVVGHTHLLQ  362
            KKIERGVAFPTCISVNNTVCHFSPL +D++VLE+GD++KID+GCHIDGFIA+V HTH+LQ
Sbjct  70   KKIERGVAFPTCISVNNTVCHFSPLGSDESVLEEGDILKIDLGCHIDGFIAIVAHTHVLQ  129

Query  363  EGPVTGRaadviaaantaaevaLRLVRPGKKNSDVTEAIQKVAAAYDCK  509
             GPVTGRAADVIAAANTAAEVALRLVRPG+KN DVTEAIQKVAAAYDCK
Sbjct  130  AGPVTGRAADVIAAANTAAEVALRLVRPGRKNKDVTEAIQKVAAAYDCK  178



>ref|XP_006429434.1| hypothetical protein CICLE_v10011909mg [Citrus clementina]
 ref|XP_006429435.1| hypothetical protein CICLE_v10011909mg [Citrus clementina]
 ref|XP_006481067.1| PREDICTED: proliferation-associated protein 2G4-like [Citrus 
sinensis]
 gb|ESR42674.1| hypothetical protein CICLE_v10011909mg [Citrus clementina]
 gb|ESR42675.1| hypothetical protein CICLE_v10011909mg [Citrus clementina]
Length=394

 Score =   279 bits (714),  Expect = 9e-90, Method: Compositional matrix adjust.
 Identities = 145/169 (86%), Positives = 162/169 (96%), Gaps = 0/169 (0%)
 Frame = +3

Query  3    ELDLTTPEVVTKYKSAAEILNKGLELVVSQCKPNAKIVDICEKGDAFIREQTGNMYKNVK  182
            ELDLT+PEVVTKYKSAAEI NK L+LVVS+CKP  KIVD+CEKGD+FIREQTGNMYKNVK
Sbjct  10   ELDLTSPEVVTKYKSAAEIANKALQLVVSECKPGVKIVDLCEKGDSFIREQTGNMYKNVK  69

Query  183  KKIERGVAFPTCISVNNTVCHFSPLSNDDTVLEDGDMVKIDMGCHIDGFIAVVGHTHLLQ  362
            KKIERGVAFP+C+SVNNT+CHFSPL++D+TVL++GDM+KID+GCHIDGFIAVV HTH+LQ
Sbjct  70   KKIERGVAFPSCVSVNNTLCHFSPLASDETVLQEGDMIKIDLGCHIDGFIAVVAHTHVLQ  129

Query  363  EGPVTGRaadviaaantaaevaLRLVRPGKKNSDVTEAIQKVAAAYDCK  509
            + PVTGRAADVIAAANTAAEVALRLVRPGKKN DVTEAIQKVAAAYDCK
Sbjct  130  DEPVTGRAADVIAAANTAAEVALRLVRPGKKNKDVTEAIQKVAAAYDCK  178



>ref|XP_011095038.1| PREDICTED: proliferation-associated protein 2G4-like [Sesamum 
indicum]
Length=394

 Score =   279 bits (713),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 146/165 (88%), Positives = 160/165 (97%), Gaps = 0/165 (0%)
 Frame = +3

Query  15   TTPEVVTKYKSAAEILNKGLELVVSQCKPNAKIVDICEKGDAFIREQTGNMYKNVKKKIE  194
            T+PEVVTKYKSAAEI+NK L+LV+S+CKP AKIVD+CEKGDAFIREQTGNMYKNVKKKIE
Sbjct  14   TSPEVVTKYKSAAEIVNKALQLVISECKPKAKIVDVCEKGDAFIREQTGNMYKNVKKKIE  73

Query  195  RGVAFPTCISVNNTVCHFSPLSNDDTVLEDGDMVKIDMGCHIDGFIAVVGHTHLLQEGPV  374
            RGVAFPTCISVNNTVCHFSPL++D+TVL+D D+VKIDMGCHIDGFIAVV HTH++Q+GPV
Sbjct  74   RGVAFPTCISVNNTVCHFSPLASDETVLQDEDIVKIDMGCHIDGFIAVVAHTHVIQQGPV  133

Query  375  TGRaadviaaantaaevaLRLVRPGKKNSDVTEAIQKVAAAYDCK  509
            TGRAADVIAAANTAAEVALRLVRPGKKN DVTEAIQKVAAAYDCK
Sbjct  134  TGRAADVIAAANTAAEVALRLVRPGKKNKDVTEAIQKVAAAYDCK  178



>ref|XP_008362268.1| PREDICTED: proliferation-associated protein 2G4-like [Malus domestica]
Length=394

 Score =   279 bits (713),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 143/169 (85%), Positives = 163/169 (96%), Gaps = 0/169 (0%)
 Frame = +3

Query  3    ELDLTTPEVVTKYKSAAEILNKGLELVVSQCKPNAKIVDICEKGDAFIREQTGNMYKNVK  182
            ELDLT+PEVVTKYKSAAEI+NK L+LV+S+CKP AKIV++CEKGD++IREQTGNMYKN K
Sbjct  10   ELDLTSPEVVTKYKSAAEIVNKALQLVISECKPKAKIVELCEKGDSYIREQTGNMYKNAK  69

Query  183  KKIERGVAFPTCISVNNTVCHFSPLSNDDTVLEDGDMVKIDMGCHIDGFIAVVGHTHLLQ  362
            KKIERGVAFPTCISVNNTVCHFSPL++D++VLE+GD++KID+GCHIDGFIA+V HTH+LQ
Sbjct  70   KKIERGVAFPTCISVNNTVCHFSPLASDESVLEEGDILKIDLGCHIDGFIAIVAHTHVLQ  129

Query  363  EGPVTGRaadviaaantaaevaLRLVRPGKKNSDVTEAIQKVAAAYDCK  509
             GPVTGRAADVIAAANTAAEVALRLVRPG+KN DVTEAIQKVAAAYDCK
Sbjct  130  AGPVTGRAADVIAAANTAAEVALRLVRPGRKNKDVTEAIQKVAAAYDCK  178



>ref|XP_009384793.1| PREDICTED: proliferation-associated protein 2G4-like [Musa acuminata 
subsp. malaccensis]
 ref|XP_009384794.1| PREDICTED: proliferation-associated protein 2G4-like [Musa acuminata 
subsp. malaccensis]
Length=395

 Score =   279 bits (713),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 147/169 (87%), Positives = 160/169 (95%), Gaps = 0/169 (0%)
 Frame = +3

Query  3    ELDLTTPEVVTKYKSAAEILNKGLELVVSQCKPNAKIVDICEKGDAFIREQTGNMYKNVK  182
            ELDLT+P+VVTKYKSAAEI+NK L+LVVS+CKP AKIVD+CEKGDAFIREQTGNMYKNVK
Sbjct  11   ELDLTSPDVVTKYKSAAEIVNKALQLVVSECKPKAKIVDLCEKGDAFIREQTGNMYKNVK  70

Query  183  KKIERGVAFPTCISVNNTVCHFSPLSNDDTVLEDGDMVKIDMGCHIDGFIAVVGHTHLLQ  362
            +KIERGV FPTC+SVNNTVCHFSPL +D+ VLE  D+VKIDMGCHIDGFIAVV HTH++Q
Sbjct  71   RKIERGVGFPTCVSVNNTVCHFSPLGSDEAVLEANDIVKIDMGCHIDGFIAVVAHTHVIQ  130

Query  363  EGPVTGRaadviaaantaaevaLRLVRPGKKNSDVTEAIQKVAAAYDCK  509
            EGPVTGRAADVIAAANTAAEVALRLVRPGKKN DVTEAIQKVAAAYDCK
Sbjct  131  EGPVTGRAADVIAAANTAAEVALRLVRPGKKNKDVTEAIQKVAAAYDCK  179



>ref|XP_010503881.1| PREDICTED: proliferation-associated protein 2G4-like [Camelina 
sativa]
Length=393

 Score =   278 bits (711),  Expect = 3e-89, Method: Compositional matrix adjust.
 Identities = 143/169 (85%), Positives = 160/169 (95%), Gaps = 0/169 (0%)
 Frame = +3

Query  3    ELDLTTPEVVTKYKSAAEILNKGLELVVSQCKPNAKIVDICEKGDAFIREQTGNMYKNVK  182
            EL LT+PEVVTKYK AAEI+NK L++V+++CKP AKIVDICEKGDAFI+EQT +MYKN K
Sbjct  11   ELSLTSPEVVTKYKGAAEIVNKALQVVLAECKPKAKIVDICEKGDAFIKEQTASMYKNAK  70

Query  183  KKIERGVAFPTCISVNNTVCHFSPLSNDDTVLEDGDMVKIDMGCHIDGFIAVVGHTHLLQ  362
            KKIERGVAFPTCISVNNTV HFSPL++D+TVLEDGDMVKIDMGCHIDGFIA+VGHTH+LQ
Sbjct  71   KKIERGVAFPTCISVNNTVGHFSPLASDETVLEDGDMVKIDMGCHIDGFIALVGHTHVLQ  130

Query  363  EGPVTGRaadviaaantaaevaLRLVRPGKKNSDVTEAIQKVAAAYDCK  509
            +GPV+GR ADVI AANTAAEVALRLVRPGKKN+DVTEAIQKVAAAYDCK
Sbjct  131  DGPVSGRKADVITAANTAAEVALRLVRPGKKNTDVTEAIQKVAAAYDCK  179



>ref|XP_011077533.1| PREDICTED: proliferation-associated protein 2G4-like [Sesamum 
indicum]
Length=394

 Score =   278 bits (710),  Expect = 3e-89, Method: Compositional matrix adjust.
 Identities = 146/165 (88%), Positives = 161/165 (98%), Gaps = 0/165 (0%)
 Frame = +3

Query  15   TTPEVVTKYKSAAEILNKGLELVVSQCKPNAKIVDICEKGDAFIREQTGNMYKNVKKKIE  194
            T+PEVVTKYKSAA+I+NK L+LVVS+CKP AKIVD+CEKGDAFIREQTGNMYKNVKKKIE
Sbjct  14   TSPEVVTKYKSAADIVNKALQLVVSECKPKAKIVDLCEKGDAFIREQTGNMYKNVKKKIE  73

Query  195  RGVAFPTCISVNNTVCHFSPLSNDDTVLEDGDMVKIDMGCHIDGFIAVVGHTHLLQEGPV  374
            +GVAFPTCISVNNTVCHFSPL++D+TVLEDGD++KIDMGCHIDGFIAVV HTH+L++GPV
Sbjct  74   KGVAFPTCISVNNTVCHFSPLASDETVLEDGDILKIDMGCHIDGFIAVVAHTHVLKQGPV  133

Query  375  TGRaadviaaantaaevaLRLVRPGKKNSDVTEAIQKVAAAYDCK  509
            TGRAADVIAAANTAAEVALRLVRPGKKN DVTEAIQKVAAAYDCK
Sbjct  134  TGRAADVIAAANTAAEVALRLVRPGKKNKDVTEAIQKVAAAYDCK  178



>ref|XP_010529897.1| PREDICTED: proliferation-associated protein 2G4-like [Tarenaya 
hassleriana]
Length=394

 Score =   278 bits (710),  Expect = 4e-89, Method: Compositional matrix adjust.
 Identities = 146/169 (86%), Positives = 161/169 (95%), Gaps = 0/169 (0%)
 Frame = +3

Query  3    ELDLTTPEVVTKYKSAAEILNKGLELVVSQCKPNAKIVDICEKGDAFIREQTGNMYKNVK  182
            ELDLT+ EVVTKYKSAAEI+NK L+LVVS+CKP AKIVDICEKGDAFIREQTGNMYKNVK
Sbjct  11   ELDLTSSEVVTKYKSAAEIVNKALQLVVSECKPKAKIVDICEKGDAFIREQTGNMYKNVK  70

Query  183  KKIERGVAFPTCISVNNTVCHFSPLSNDDTVLEDGDMVKIDMGCHIDGFIAVVGHTHLLQ  362
            KKIERG+AFPTCISVNNTVCHFSPL++DDT+LE+GD++KIDMGCHIDGFIAVV HT +LQ
Sbjct  71   KKIERGIAFPTCISVNNTVCHFSPLASDDTLLEEGDVMKIDMGCHIDGFIAVVAHTVVLQ  130

Query  363  EGPVTGRaadviaaantaaevaLRLVRPGKKNSDVTEAIQKVAAAYDCK  509
            EGP+TGR ADVIAAANTAAEVALRLVRPGKKN +V+EAIQKVA AYDCK
Sbjct  131  EGPITGRKADVIAAANTAAEVALRLVRPGKKNQEVSEAIQKVAEAYDCK  179



>ref|XP_010426749.1| PREDICTED: proliferation-associated protein 2G4-like [Camelina 
sativa]
Length=393

 Score =   278 bits (710),  Expect = 4e-89, Method: Compositional matrix adjust.
 Identities = 142/169 (84%), Positives = 161/169 (95%), Gaps = 0/169 (0%)
 Frame = +3

Query  3    ELDLTTPEVVTKYKSAAEILNKGLELVVSQCKPNAKIVDICEKGDAFIREQTGNMYKNVK  182
            EL L++PEVVTKYK AAEI+NK L++V+++CKP AKIVDICEKGD+FI+EQTG+MYKN K
Sbjct  11   ELSLSSPEVVTKYKGAAEIVNKALQVVLAECKPKAKIVDICEKGDSFIKEQTGSMYKNAK  70

Query  183  KKIERGVAFPTCISVNNTVCHFSPLSNDDTVLEDGDMVKIDMGCHIDGFIAVVGHTHLLQ  362
            KKIERGVAFPTCISVNNTV HFSPL++D+TVLEDGDMVKIDMGCHIDGFIA+VGHTH+LQ
Sbjct  71   KKIERGVAFPTCISVNNTVGHFSPLASDETVLEDGDMVKIDMGCHIDGFIALVGHTHVLQ  130

Query  363  EGPVTGRaadviaaantaaevaLRLVRPGKKNSDVTEAIQKVAAAYDCK  509
            +GPV+GR ADVI AANTAAEVALRLVRPGKKN+DVTEAIQKVAAAYDCK
Sbjct  131  DGPVSGRKADVITAANTAAEVALRLVRPGKKNTDVTEAIQKVAAAYDCK  179



>ref|XP_004489059.1| PREDICTED: proliferation-associated protein 2G4-like isoform 
X2 [Cicer arietinum]
Length=394

 Score =   277 bits (709),  Expect = 4e-89, Method: Compositional matrix adjust.
 Identities = 142/169 (84%), Positives = 162/169 (96%), Gaps = 0/169 (0%)
 Frame = +3

Query  3    ELDLTTPEVVTKYKSAAEILNKGLELVVSQCKPNAKIVDICEKGDAFIREQTGNMYKNVK  182
            ELDLT+P+VVTKYKSAAEI+NK L+L++S+CKP  K+V+ICEKGD+FIREQTGNMYKNVK
Sbjct  10   ELDLTSPDVVTKYKSAAEIVNKALQLIISECKPKVKVVEICEKGDSFIREQTGNMYKNVK  69

Query  183  KKIERGVAFPTCISVNNTVCHFSPLSNDDTVLEDGDMVKIDMGCHIDGFIAVVGHTHLLQ  362
            KKIERGVAFPTCIS+NNTVCHFSPL++D+TVLE+GD++KID+ CHIDGFIA V HTH+LQ
Sbjct  70   KKIERGVAFPTCISINNTVCHFSPLASDETVLEEGDILKIDLACHIDGFIAAVAHTHVLQ  129

Query  363  EGPVTGRaadviaaantaaevaLRLVRPGKKNSDVTEAIQKVAAAYDCK  509
            EGPVTGRAADVIAAANTAAEVALRLVRPGKKN DVT+AIQKVAAAYDCK
Sbjct  130  EGPVTGRAADVIAAANTAAEVALRLVRPGKKNKDVTDAIQKVAAAYDCK  178



>gb|ABF66654.1| EBP1 [Ammopiptanthus mongolicus]
 gb|ABQ23586.1| EBP1 [Ammopiptanthus mongolicus]
Length=395

 Score =   277 bits (709),  Expect = 5e-89, Method: Compositional matrix adjust.
 Identities = 141/169 (83%), Positives = 162/169 (96%), Gaps = 0/169 (0%)
 Frame = +3

Query  3    ELDLTTPEVVTKYKSAAEILNKGLELVVSQCKPNAKIVDICEKGDAFIREQTGNMYKNVK  182
            ELDL++PEVVTKYK+AAEI+NK L+LV+S+CKP AKIVD+CEKGD++IREQTGN+YKNVK
Sbjct  10   ELDLSSPEVVTKYKTAAEIVNKALKLVISECKPKAKIVDLCEKGDSYIREQTGNVYKNVK  69

Query  183  KKIERGVAFPTCISVNNTVCHFSPLSNDDTVLEDGDMVKIDMGCHIDGFIAVVGHTHLLQ  362
            +KIERGVAFPTCISVNNTVCHFSPL++D+TVLE+GD++KIDM CHIDGFIA V HTH+L+
Sbjct  70   RKIERGVAFPTCISVNNTVCHFSPLASDETVLEEGDILKIDMACHIDGFIAAVAHTHVLE  129

Query  363  EGPVTGRaadviaaantaaevaLRLVRPGKKNSDVTEAIQKVAAAYDCK  509
            EGPVTGRAADVI AANTAAEVALRLVRPGKKN DVT+AIQKVAAAYDCK
Sbjct  130  EGPVTGRAADVITAANTAAEVALRLVRPGKKNKDVTDAIQKVAAAYDCK  178



>ref|XP_010515611.1| PREDICTED: proliferation-associated protein 2G4-like isoform 
X1 [Camelina sativa]
 ref|XP_010515612.1| PREDICTED: proliferation-associated protein 2G4-like isoform 
X2 [Camelina sativa]
Length=393

 Score =   277 bits (708),  Expect = 7e-89, Method: Compositional matrix adjust.
 Identities = 143/169 (85%), Positives = 161/169 (95%), Gaps = 0/169 (0%)
 Frame = +3

Query  3    ELDLTTPEVVTKYKSAAEILNKGLELVVSQCKPNAKIVDICEKGDAFIREQTGNMYKNVK  182
            EL LT+PEVVTKYK AAEI+NK L++V+++CKP AKIVDICEKGDAFI+EQTG+MYKN K
Sbjct  11   ELSLTSPEVVTKYKGAAEIVNKALQVVLAECKPKAKIVDICEKGDAFIKEQTGSMYKNAK  70

Query  183  KKIERGVAFPTCISVNNTVCHFSPLSNDDTVLEDGDMVKIDMGCHIDGFIAVVGHTHLLQ  362
            KKIERGVAFPTCISVNNTV HFSPL++D+TVLE+GDMVKIDMGCHIDGFIA+VGHTH+LQ
Sbjct  71   KKIERGVAFPTCISVNNTVGHFSPLASDETVLEEGDMVKIDMGCHIDGFIALVGHTHVLQ  130

Query  363  EGPVTGRaadviaaantaaevaLRLVRPGKKNSDVTEAIQKVAAAYDCK  509
            EG V+GR ADVI+AANTAAEVALRLVRPGKKN+DVTEAIQKVAAAYDCK
Sbjct  131  EGTVSGRKADVISAANTAAEVALRLVRPGKKNTDVTEAIQKVAAAYDCK  179



>ref|XP_010650887.1| PREDICTED: proliferation-associated protein 2G4 isoform X2 [Vitis 
vinifera]
Length=384

 Score =   276 bits (706),  Expect = 9e-89, Method: Compositional matrix adjust.
 Identities = 144/169 (85%), Positives = 164/169 (97%), Gaps = 0/169 (0%)
 Frame = +3

Query  3    ELDLTTPEVVTKYKSAAEILNKGLELVVSQCKPNAKIVDICEKGDAFIREQTGNMYKNVK  182
            ELDLT+PEVVTKYK+AAEI+NK L++V+S+CKP AKIVD+CEKGDAFIREQTGN+YKNVK
Sbjct  10   ELDLTSPEVVTKYKTAAEIVNKALQVVLSECKPKAKIVDVCEKGDAFIREQTGNVYKNVK  69

Query  183  KKIERGVAFPTCISVNNTVCHFSPLSNDDTVLEDGDMVKIDMGCHIDGFIAVVGHTHLLQ  362
            KKIERGVAFPTCISVNNTVCHFSPLS+D+T+LE GD++KIDMGCHIDGFIAVV HTH+LQ
Sbjct  70   KKIERGVAFPTCISVNNTVCHFSPLSSDETLLEAGDILKIDMGCHIDGFIAVVAHTHVLQ  129

Query  363  EGPVTGRaadviaaantaaevaLRLVRPGKKNSDVTEAIQKVAAAYDCK  509
            +GPVTGRAADVIAAANTAAEVALRL+RPG+KN +VT+AIQKVAAAYDCK
Sbjct  130  DGPVTGRAADVIAAANTAAEVALRLLRPGRKNKEVTDAIQKVAAAYDCK  178



>gb|AFG29445.1| Erb3 binding protein [Nervilia fordii]
Length=395

 Score =   276 bits (707),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 146/169 (86%), Positives = 160/169 (95%), Gaps = 0/169 (0%)
 Frame = +3

Query  3    ELDLTTPEVVTKYKSAAEILNKGLELVVSQCKPNAKIVDICEKGDAFIREQTGNMYKNVK  182
            ELDLT+ +VVTKYK+A+EI+NK L+LVVS CKP AKIVDICEKGDAFIREQ G+MYKNVK
Sbjct  11   ELDLTSSDVVTKYKAASEIVNKALQLVVSGCKPKAKIVDICEKGDAFIREQAGSMYKNVK  70

Query  183  KKIERGVAFPTCISVNNTVCHFSPLSNDDTVLEDGDMVKIDMGCHIDGFIAVVGHTHLLQ  362
            KKIERGVAFPTCISVNNTVCHFSP+++DDTVLE+ D+VKIDMGCHIDGFIAVV HTH+LQ
Sbjct  71   KKIERGVAFPTCISVNNTVCHFSPMASDDTVLEENDIVKIDMGCHIDGFIAVVAHTHVLQ  130

Query  363  EGPVTGRaadviaaantaaevaLRLVRPGKKNSDVTEAIQKVAAAYDCK  509
            EGPV+GR ADVIAAANTAAEVALRLVRPGKKN DVTEAIQKVAAAYDCK
Sbjct  131  EGPVSGRVADVIAAANTAAEVALRLVRPGKKNKDVTEAIQKVAAAYDCK  179



>ref|XP_002877825.1| hypothetical protein ARALYDRAFT_906530 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH54084.1| hypothetical protein ARALYDRAFT_906530 [Arabidopsis lyrata subsp. 
lyrata]
Length=393

 Score =   276 bits (707),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 141/169 (83%), Positives = 160/169 (95%), Gaps = 0/169 (0%)
 Frame = +3

Query  3    ELDLTTPEVVTKYKSAAEILNKGLELVVSQCKPNAKIVDICEKGDAFIREQTGNMYKNVK  182
            EL LT+PEVVTKYK+AAEI+NK L++V+++CKP AKIVDICEKGDAFI+EQT +MYKN K
Sbjct  11   ELSLTSPEVVTKYKTAAEIVNKALQVVLAECKPKAKIVDICEKGDAFIKEQTASMYKNAK  70

Query  183  KKIERGVAFPTCISVNNTVCHFSPLSNDDTVLEDGDMVKIDMGCHIDGFIAVVGHTHLLQ  362
            KKIERGVAFPTCISVNNTV HFSPL++D++VLEDGDMVKIDMGCHIDGFIA+VGHTH+LQ
Sbjct  71   KKIERGVAFPTCISVNNTVGHFSPLASDESVLEDGDMVKIDMGCHIDGFIALVGHTHVLQ  130

Query  363  EGPVTGRaadviaaantaaevaLRLVRPGKKNSDVTEAIQKVAAAYDCK  509
            EGPVTGR ADVI AANTAA+VALRLVRPGKKN++VTEAIQKVA AYDCK
Sbjct  131  EGPVTGRKADVIRAANTAADVALRLVRPGKKNTEVTEAIQKVARAYDCK  179



>ref|NP_001190060.1| putative nuclear DNA-binding protein G2p  [Arabidopsis thaliana]
 gb|AEE78846.1| putative nuclear DNA-binding protein G2p [Arabidopsis thaliana]
Length=385

 Score =   276 bits (706),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 142/169 (84%), Positives = 162/169 (96%), Gaps = 0/169 (0%)
 Frame = +3

Query  3    ELDLTTPEVVTKYKSAAEILNKGLELVVSQCKPNAKIVDICEKGDAFIREQTGNMYKNVK  182
            EL LT+PEVVTKYKSAAEI+NK L++V+++CKP AKIVDICEKGD+FI+EQT +MYKN K
Sbjct  11   ELSLTSPEVVTKYKSAAEIVNKALQVVLAECKPKAKIVDICEKGDSFIKEQTASMYKNSK  70

Query  183  KKIERGVAFPTCISVNNTVCHFSPLSNDDTVLEDGDMVKIDMGCHIDGFIAVVGHTHLLQ  362
            KKIERGVAFPTCISVNNTV HFSPL++D++VLEDGDMVKIDMGCHIDGFIA+VGHTH+LQ
Sbjct  71   KKIERGVAFPTCISVNNTVGHFSPLASDESVLEDGDMVKIDMGCHIDGFIALVGHTHVLQ  130

Query  363  EGPVTGRaadviaaantaaevaLRLVRPGKKNSDVTEAIQKVAAAYDCK  509
            EGP++GR ADVIAAANTAA+VALRLVRPGKKN+DVTEAIQKVAAAYDCK
Sbjct  131  EGPLSGRKADVIAAANTAADVALRLVRPGKKNTDVTEAIQKVAAAYDCK  179



>ref|XP_002278744.2| PREDICTED: proliferation-associated protein 2G4 isoform X1 [Vitis 
vinifera]
 emb|CBI15928.3| unnamed protein product [Vitis vinifera]
Length=391

 Score =   276 bits (706),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 144/169 (85%), Positives = 164/169 (97%), Gaps = 0/169 (0%)
 Frame = +3

Query  3    ELDLTTPEVVTKYKSAAEILNKGLELVVSQCKPNAKIVDICEKGDAFIREQTGNMYKNVK  182
            ELDLT+PEVVTKYK+AAEI+NK L++V+S+CKP AKIVD+CEKGDAFIREQTGN+YKNVK
Sbjct  10   ELDLTSPEVVTKYKTAAEIVNKALQVVLSECKPKAKIVDVCEKGDAFIREQTGNVYKNVK  69

Query  183  KKIERGVAFPTCISVNNTVCHFSPLSNDDTVLEDGDMVKIDMGCHIDGFIAVVGHTHLLQ  362
            KKIERGVAFPTCISVNNTVCHFSPLS+D+T+LE GD++KIDMGCHIDGFIAVV HTH+LQ
Sbjct  70   KKIERGVAFPTCISVNNTVCHFSPLSSDETLLEAGDILKIDMGCHIDGFIAVVAHTHVLQ  129

Query  363  EGPVTGRaadviaaantaaevaLRLVRPGKKNSDVTEAIQKVAAAYDCK  509
            +GPVTGRAADVIAAANTAAEVALRL+RPG+KN +VT+AIQKVAAAYDCK
Sbjct  130  DGPVTGRAADVIAAANTAAEVALRLLRPGRKNKEVTDAIQKVAAAYDCK  178



>dbj|BAH19507.1| AT3G51800 [Arabidopsis thaliana]
Length=362

 Score =   275 bits (703),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 142/169 (84%), Positives = 162/169 (96%), Gaps = 0/169 (0%)
 Frame = +3

Query  3    ELDLTTPEVVTKYKSAAEILNKGLELVVSQCKPNAKIVDICEKGDAFIREQTGNMYKNVK  182
            EL LT+PEVVTKYKSAAEI+NK L++V+++CKP AKIVDICEKGD+FI+EQT +MYKN K
Sbjct  11   ELSLTSPEVVTKYKSAAEIVNKALQVVLAECKPKAKIVDICEKGDSFIKEQTASMYKNSK  70

Query  183  KKIERGVAFPTCISVNNTVCHFSPLSNDDTVLEDGDMVKIDMGCHIDGFIAVVGHTHLLQ  362
            KKIERGVAFPTCISVNNTV HFSPL++D++VLEDGDMVKIDMGCHIDGFIA+VGHTH+LQ
Sbjct  71   KKIERGVAFPTCISVNNTVGHFSPLASDESVLEDGDMVKIDMGCHIDGFIALVGHTHVLQ  130

Query  363  EGPVTGRaadviaaantaaevaLRLVRPGKKNSDVTEAIQKVAAAYDCK  509
            EGP++GR ADVIAAANTAA+VALRLVRPGKKN+DVTEAIQKVAAAYDCK
Sbjct  131  EGPLSGRKADVIAAANTAADVALRLVRPGKKNTDVTEAIQKVAAAYDCK  179



>ref|XP_010907411.1| PREDICTED: proliferation-associated protein 2G4-like isoform 
X1 [Elaeis guineensis]
 ref|XP_010907412.1| PREDICTED: proliferation-associated protein 2G4-like isoform 
X1 [Elaeis guineensis]
Length=394

 Score =   276 bits (706),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 146/169 (86%), Positives = 160/169 (95%), Gaps = 0/169 (0%)
 Frame = +3

Query  3    ELDLTTPEVVTKYKSAAEILNKGLELVVSQCKPNAKIVDICEKGDAFIREQTGNMYKNVK  182
            ELDLT+P+VVTKYKSAA+I++K L+L VS+CKP AKIVDICEKGDAFIREQ GN+YKNVK
Sbjct  10   ELDLTSPDVVTKYKSAADIVSKALQLAVSECKPKAKIVDICEKGDAFIREQAGNIYKNVK  69

Query  183  KKIERGVAFPTCISVNNTVCHFSPLSNDDTVLEDGDMVKIDMGCHIDGFIAVVGHTHLLQ  362
            KKIERG+AFPTCISVNN VCHFSPL+ D+TVLE+ D+VKIDMGCHIDGFIAVV HTH+LQ
Sbjct  70   KKIERGLAFPTCISVNNIVCHFSPLAGDETVLEENDIVKIDMGCHIDGFIAVVAHTHVLQ  129

Query  363  EGPVTGRaadviaaantaaevaLRLVRPGKKNSDVTEAIQKVAAAYDCK  509
            EGPVTGRAADVIAAANTAAEVALRLVRPGKKN DVTEAIQKVAAAYDCK
Sbjct  130  EGPVTGRAADVIAAANTAAEVALRLVRPGKKNKDVTEAIQKVAAAYDCK  178



>ref|XP_010253797.1| PREDICTED: proliferation-associated protein 2G4-like [Nelumbo 
nucifera]
Length=397

 Score =   276 bits (705),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 143/165 (87%), Positives = 160/165 (97%), Gaps = 0/165 (0%)
 Frame = +3

Query  15   TTPEVVTKYKSAAEILNKGLELVVSQCKPNAKIVDICEKGDAFIREQTGNMYKNVKKKIE  194
            T+PEVVTKYK+AAEI+NK L+LV+S+CKP AKIVDICEKGDAFIREQTGNMYKNVK+KIE
Sbjct  15   TSPEVVTKYKNAAEIVNKALQLVLSECKPKAKIVDICEKGDAFIREQTGNMYKNVKRKIE  74

Query  195  RGVAFPTCISVNNTVCHFSPLSNDDTVLEDGDMVKIDMGCHIDGFIAVVGHTHLLQEGPV  374
            RGVAFPTCISVNNTVCHFSPL++D+TVLE+GDM+KIDMGCHIDGFI VV HTH+L+EGPV
Sbjct  75   RGVAFPTCISVNNTVCHFSPLASDETVLEEGDMLKIDMGCHIDGFITVVAHTHVLKEGPV  134

Query  375  TGRaadviaaantaaevaLRLVRPGKKNSDVTEAIQKVAAAYDCK  509
            TGRAADV+AAANTAAEVALRLVRPG+KN DVT+AIQKVAAAYDCK
Sbjct  135  TGRAADVMAAANTAAEVALRLVRPGRKNKDVTDAIQKVAAAYDCK  179



>ref|XP_007026646.1| Metallopeptidase M24 family protein isoform 1 [Theobroma cacao]
 gb|EOY07148.1| Metallopeptidase M24 family protein isoform 1 [Theobroma cacao]
Length=393

 Score =   276 bits (705),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 141/169 (83%), Positives = 157/169 (93%), Gaps = 0/169 (0%)
 Frame = +3

Query  3    ELDLTTPEVVTKYKSAAEILNKGLELVVSQCKPNAKIVDICEKGDAFIREQTGNMYKNVK  182
            ELDLT+PEVVTKYKSAAEI+NK L+LVV  CKP AKIVDICEKGD FIREQTGNMYKNVK
Sbjct  10   ELDLTSPEVVTKYKSAAEIVNKALQLVVKDCKPKAKIVDICEKGDVFIREQTGNMYKNVK  69

Query  183  KKIERGVAFPTCISVNNTVCHFSPLSNDDTVLEDGDMVKIDMGCHIDGFIAVVGHTHLLQ  362
            +KIERGVAFPTCISVNNTVCH SPL++D + LE+GDMVKID+GCHIDGFIA+V HTH++Q
Sbjct  70   RKIERGVAFPTCISVNNTVCHISPLASDTSELEEGDMVKIDLGCHIDGFIAIVAHTHVVQ  129

Query  363  EGPVTGRaadviaaantaaevaLRLVRPGKKNSDVTEAIQKVAAAYDCK  509
            +GP+TGR ADV+AA NTAAEVALRLVRPGKKN DVT+AIQKVAAAYDCK
Sbjct  130  DGPITGRQADVVAAVNTAAEVALRLVRPGKKNKDVTDAIQKVAAAYDCK  178



>ref|NP_190748.1| putative nuclear DNA-binding protein G2p  [Arabidopsis thaliana]
 gb|AAM46648.1|AF422841_1 cell cycle-related nuclear binding protein [Arabidopsis thaliana]
 gb|AAB18127.1| G2p [Arabidopsis thaliana]
 gb|AAC14407.1| putative nuclear DNA-binding protein G2p [Arabidopsis thaliana]
 gb|AAL25197.1| nuclear DNA-binding protein [Arabidopsis thaliana]
 gb|AAL25198.1| nuclear DNA-binding protein [Arabidopsis thaliana]
 gb|AAN13085.1| putative nuclear DNA-binding protein G2p [Arabidopsis thaliana]
 gb|AEE78844.1| putative nuclear DNA-binding protein G2p [Arabidopsis thaliana]
Length=392

 Score =   276 bits (705),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 142/169 (84%), Positives = 162/169 (96%), Gaps = 0/169 (0%)
 Frame = +3

Query  3    ELDLTTPEVVTKYKSAAEILNKGLELVVSQCKPNAKIVDICEKGDAFIREQTGNMYKNVK  182
            EL LT+PEVVTKYKSAAEI+NK L++V+++CKP AKIVDICEKGD+FI+EQT +MYKN K
Sbjct  11   ELSLTSPEVVTKYKSAAEIVNKALQVVLAECKPKAKIVDICEKGDSFIKEQTASMYKNSK  70

Query  183  KKIERGVAFPTCISVNNTVCHFSPLSNDDTVLEDGDMVKIDMGCHIDGFIAVVGHTHLLQ  362
            KKIERGVAFPTCISVNNTV HFSPL++D++VLEDGDMVKIDMGCHIDGFIA+VGHTH+LQ
Sbjct  71   KKIERGVAFPTCISVNNTVGHFSPLASDESVLEDGDMVKIDMGCHIDGFIALVGHTHVLQ  130

Query  363  EGPVTGRaadviaaantaaevaLRLVRPGKKNSDVTEAIQKVAAAYDCK  509
            EGP++GR ADVIAAANTAA+VALRLVRPGKKN+DVTEAIQKVAAAYDCK
Sbjct  131  EGPLSGRKADVIAAANTAADVALRLVRPGKKNTDVTEAIQKVAAAYDCK  179



>ref|XP_010676777.1| PREDICTED: proliferation-associated protein 2G4 [Beta vulgaris 
subsp. vulgaris]
Length=395

 Score =   275 bits (703),  Expect = 4e-88, Method: Compositional matrix adjust.
 Identities = 143/169 (85%), Positives = 160/169 (95%), Gaps = 0/169 (0%)
 Frame = +3

Query  3    ELDLTTPEVVTKYKSAAEILNKGLELVVSQCKPNAKIVDICEKGDAFIREQTGNMYKNVK  182
            ELDLT PEVVTKYKSAA+I+N+ L+LVV++CKP AKIVDICEKGD++IREQ+GNMYKNVK
Sbjct  10   ELDLTYPEVVTKYKSAADIVNRALQLVVAECKPKAKIVDICEKGDSYIREQSGNMYKNVK  69

Query  183  KKIERGVAFPTCISVNNTVCHFSPLSNDDTVLEDGDMVKIDMGCHIDGFIAVVGHTHLLQ  362
            KKIERGVAFPTCISVNN VCHFSPL++D++VLEDGD+VKID+GCHIDGFIA V HTH++Q
Sbjct  70   KKIERGVAFPTCISVNNVVCHFSPLASDESVLEDGDVVKIDLGCHIDGFIAAVAHTHVIQ  129

Query  363  EGPVTGRaadviaaantaaevaLRLVRPGKKNSDVTEAIQKVAAAYDCK  509
            EG VTGR ADVIAAANTAAEVALRLVRPGKKN DVTEAIQKVAAAYDCK
Sbjct  130  EGAVTGRKADVIAAANTAAEVALRLVRPGKKNKDVTEAIQKVAAAYDCK  178



>ref|XP_004489058.1| PREDICTED: proliferation-associated protein 2G4-like isoform 
X1 [Cicer arietinum]
Length=482

 Score =   277 bits (709),  Expect = 5e-88, Method: Compositional matrix adjust.
 Identities = 142/169 (84%), Positives = 162/169 (96%), Gaps = 0/169 (0%)
 Frame = +3

Query  3    ELDLTTPEVVTKYKSAAEILNKGLELVVSQCKPNAKIVDICEKGDAFIREQTGNMYKNVK  182
            ELDLT+P+VVTKYKSAAEI+NK L+L++S+CKP  K+V+ICEKGD+FIREQTGNMYKNVK
Sbjct  10   ELDLTSPDVVTKYKSAAEIVNKALQLIISECKPKVKVVEICEKGDSFIREQTGNMYKNVK  69

Query  183  KKIERGVAFPTCISVNNTVCHFSPLSNDDTVLEDGDMVKIDMGCHIDGFIAVVGHTHLLQ  362
            KKIERGVAFPTCIS+NNTVCHFSPL++D+TVLE+GD++KID+ CHIDGFIA V HTH+LQ
Sbjct  70   KKIERGVAFPTCISINNTVCHFSPLASDETVLEEGDILKIDLACHIDGFIAAVAHTHVLQ  129

Query  363  EGPVTGRaadviaaantaaevaLRLVRPGKKNSDVTEAIQKVAAAYDCK  509
            EGPVTGRAADVIAAANTAAEVALRLVRPGKKN DVT+AIQKVAAAYDCK
Sbjct  130  EGPVTGRAADVIAAANTAAEVALRLVRPGKKNKDVTDAIQKVAAAYDCK  178



>ref|XP_010553237.1| PREDICTED: proliferation-associated protein 2G4-like [Tarenaya 
hassleriana]
Length=389

 Score =   275 bits (702),  Expect = 5e-88, Method: Compositional matrix adjust.
 Identities = 146/169 (86%), Positives = 159/169 (94%), Gaps = 0/169 (0%)
 Frame = +3

Query  3    ELDLTTPEVVTKYKSAAEILNKGLELVVSQCKPNAKIVDICEKGDAFIREQTGNMYKNVK  182
            ELDLT+ +VVTKYKSAAEI+NK L LVVS+CKP AKIVDICEKGDAFIREQTGNMYKNVK
Sbjct  11   ELDLTSSDVVTKYKSAAEIINKALHLVVSECKPKAKIVDICEKGDAFIREQTGNMYKNVK  70

Query  183  KKIERGVAFPTCISVNNTVCHFSPLSNDDTVLEDGDMVKIDMGCHIDGFIAVVGHTHLLQ  362
            KKIERG+AFPTCISVNNTVCHFSPL++D+TVLE+GDMVKIDMGCHIDGFIAVV  T +LQ
Sbjct  71   KKIERGLAFPTCISVNNTVCHFSPLASDETVLEEGDMVKIDMGCHIDGFIAVVAQTIVLQ  130

Query  363  EGPVTGRaadviaaantaaevaLRLVRPGKKNSDVTEAIQKVAAAYDCK  509
            EGP+TGR ADVIAAANTAAEVALRLVRPGKKN +V+EAIQKVA AYDCK
Sbjct  131  EGPITGRKADVIAAANTAAEVALRLVRPGKKNQEVSEAIQKVAEAYDCK  179



>ref|NP_850679.1| putative nuclear DNA-binding protein G2p  [Arabidopsis thaliana]
 gb|AEE78845.1| putative nuclear DNA-binding protein G2p [Arabidopsis thaliana]
Length=401

 Score =   275 bits (702),  Expect = 6e-88, Method: Compositional matrix adjust.
 Identities = 142/169 (84%), Positives = 162/169 (96%), Gaps = 0/169 (0%)
 Frame = +3

Query  3    ELDLTTPEVVTKYKSAAEILNKGLELVVSQCKPNAKIVDICEKGDAFIREQTGNMYKNVK  182
            EL LT+PEVVTKYKSAAEI+NK L++V+++CKP AKIVDICEKGD+FI+EQT +MYKN K
Sbjct  11   ELSLTSPEVVTKYKSAAEIVNKALQVVLAECKPKAKIVDICEKGDSFIKEQTASMYKNSK  70

Query  183  KKIERGVAFPTCISVNNTVCHFSPLSNDDTVLEDGDMVKIDMGCHIDGFIAVVGHTHLLQ  362
            KKIERGVAFPTCISVNNTV HFSPL++D++VLEDGDMVKIDMGCHIDGFIA+VGHTH+LQ
Sbjct  71   KKIERGVAFPTCISVNNTVGHFSPLASDESVLEDGDMVKIDMGCHIDGFIALVGHTHVLQ  130

Query  363  EGPVTGRaadviaaantaaevaLRLVRPGKKNSDVTEAIQKVAAAYDCK  509
            EGP++GR ADVIAAANTAA+VALRLVRPGKKN+DVTEAIQKVAAAYDCK
Sbjct  131  EGPLSGRKADVIAAANTAADVALRLVRPGKKNTDVTEAIQKVAAAYDCK  179



>emb|CDP09213.1| unnamed protein product [Coffea canephora]
Length=394

 Score =   274 bits (701),  Expect = 7e-88, Method: Compositional matrix adjust.
 Identities = 144/169 (85%), Positives = 160/169 (95%), Gaps = 0/169 (0%)
 Frame = +3

Query  3    ELDLTTPEVVTKYKSAAEILNKGLELVVSQCKPNAKIVDICEKGDAFIREQTGNMYKNVK  182
            ELDLT+PEVVTKYKSAAEI+NK L+LV+S+CKP  KIVD+CEKGDAFI+EQTGNMYKNVK
Sbjct  10   ELDLTSPEVVTKYKSAAEIVNKALQLVLSECKPATKIVDLCEKGDAFIKEQTGNMYKNVK  69

Query  183  KKIERGVAFPTCISVNNTVCHFSPLSNDDTVLEDGDMVKIDMGCHIDGFIAVVGHTHLLQ  362
            KKIERGVAFPTCISVNNTVCH SPL++D+ VL+ GD+VKIDMGCHIDGFIAVV HTH+LQ
Sbjct  70   KKIERGVAFPTCISVNNTVCHVSPLASDEAVLQQGDIVKIDMGCHIDGFIAVVAHTHVLQ  129

Query  363  EGPVTGRaadviaaantaaevaLRLVRPGKKNSDVTEAIQKVAAAYDCK  509
            +GPVTGRAADVIAAANTAAEVALRLVRPGKKN +V EAIQKVAAAYDC+
Sbjct  130  DGPVTGRAADVIAAANTAAEVALRLVRPGKKNQEVAEAIQKVAAAYDCR  178



>gb|ACU19222.1| unknown [Glycine max]
Length=219

 Score =   268 bits (686),  Expect = 7e-88, Method: Compositional matrix adjust.
 Identities = 139/169 (82%), Positives = 160/169 (95%), Gaps = 0/169 (0%)
 Frame = +3

Query  3    ELDLTTPEVVTKYKSAAEILNKGLELVVSQCKPNAKIVDICEKGDAFIREQTGNMYKNVK  182
            ELDL++ EVVTKYK+AAEI+NK L+LV+S+CKP AKIVDICEKGD++IREQTGN+YKNVK
Sbjct  10   ELDLSSAEVVTKYKTAAEIVNKALKLVISECKPKAKIVDICEKGDSYIREQTGNVYKNVK  69

Query  183  KKIERGVAFPTCISVNNTVCHFSPLSNDDTVLEDGDMVKIDMGCHIDGFIAVVGHTHLLQ  362
            +KIERGVAFPTC+SVNN VCHFSPL++D+ VLE+GD++KIDM CHIDGFIA V HTH+LQ
Sbjct  70   RKIERGVAFPTCLSVNNVVCHFSPLASDEAVLEEGDILKIDMACHIDGFIAAVAHTHVLQ  129

Query  363  EGPVTGRaadviaaantaaevaLRLVRPGKKNSDVTEAIQKVAAAYDCK  509
            EGPVTGRAADVIAAANTAAEVALRLVRPGKKN DV++AIQKVAAAYDCK
Sbjct  130  EGPVTGRAADVIAAANTAAEVALRLVRPGKKNKDVSDAIQKVAAAYDCK  178



>gb|AAK25936.1|AF360226_1 putative nuclear DNA-binding protein G2p [Arabidopsis thaliana]
 gb|AAK64125.1| putative nuclear DNA-binding protein G2p [Arabidopsis thaliana]
Length=392

 Score =   274 bits (700),  Expect = 9e-88, Method: Compositional matrix adjust.
 Identities = 141/169 (83%), Positives = 162/169 (96%), Gaps = 0/169 (0%)
 Frame = +3

Query  3    ELDLTTPEVVTKYKSAAEILNKGLELVVSQCKPNAKIVDICEKGDAFIREQTGNMYKNVK  182
            EL LT+PEVVTKYKSAAEI+NK L++V+++CKP AKIVDIC+KGD+FI+EQT +MYKN K
Sbjct  11   ELSLTSPEVVTKYKSAAEIVNKALQVVLAECKPKAKIVDICDKGDSFIKEQTASMYKNSK  70

Query  183  KKIERGVAFPTCISVNNTVCHFSPLSNDDTVLEDGDMVKIDMGCHIDGFIAVVGHTHLLQ  362
            KKIERGVAFPTCISVNNTV HFSPL++D++VLEDGDMVKIDMGCHIDGFIA+VGHTH+LQ
Sbjct  71   KKIERGVAFPTCISVNNTVGHFSPLASDESVLEDGDMVKIDMGCHIDGFIALVGHTHVLQ  130

Query  363  EGPVTGRaadviaaantaaevaLRLVRPGKKNSDVTEAIQKVAAAYDCK  509
            EGP++GR ADVIAAANTAA+VALRLVRPGKKN+DVTEAIQKVAAAYDCK
Sbjct  131  EGPLSGRKADVIAAANTAADVALRLVRPGKKNTDVTEAIQKVAAAYDCK  179



>ref|XP_003623305.1| Proliferation-associated protein 2G4 [Medicago truncatula]
 gb|AES79523.1| proliferation-associated 2G4-like protein [Medicago truncatula]
Length=394

 Score =   274 bits (700),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 141/169 (83%), Positives = 162/169 (96%), Gaps = 0/169 (0%)
 Frame = +3

Query  3    ELDLTTPEVVTKYKSAAEILNKGLELVVSQCKPNAKIVDICEKGDAFIREQTGNMYKNVK  182
            ELDLT+P+VVTKYK+AAEI+NK L+LV+S+CKP AK+VDICEKGD+FIREQT N+YKNVK
Sbjct  10   ELDLTSPDVVTKYKTAAEIVNKALKLVISECKPKAKVVDICEKGDSFIREQTSNVYKNVK  69

Query  183  KKIERGVAFPTCISVNNTVCHFSPLSNDDTVLEDGDMVKIDMGCHIDGFIAVVGHTHLLQ  362
            KKIERGVAFPTCISVNNT+CHFSPL++D+TVL++GD+VKID+ CHIDGFIA V HTH+LQ
Sbjct  70   KKIERGVAFPTCISVNNTICHFSPLASDETVLDEGDIVKIDLACHIDGFIAAVAHTHVLQ  129

Query  363  EGPVTGRaadviaaantaaevaLRLVRPGKKNSDVTEAIQKVAAAYDCK  509
            EGPVTGRAADVIAAANTAAEVALRLVRPGKKN DV++AIQKVAAAYDCK
Sbjct  130  EGPVTGRAADVIAAANTAAEVALRLVRPGKKNKDVSDAIQKVAAAYDCK  178



>gb|ACJ85304.1| unknown [Medicago truncatula]
 gb|AFK40979.1| unknown [Medicago truncatula]
Length=394

 Score =   273 bits (699),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 141/169 (83%), Positives = 162/169 (96%), Gaps = 0/169 (0%)
 Frame = +3

Query  3    ELDLTTPEVVTKYKSAAEILNKGLELVVSQCKPNAKIVDICEKGDAFIREQTGNMYKNVK  182
            ELDLT+P+VVTKYK+AAEI+NK L+LV+S+CKP AK+VDICEKGD+FIREQT N+YKNVK
Sbjct  10   ELDLTSPDVVTKYKTAAEIVNKALKLVISECKPKAKVVDICEKGDSFIREQTSNVYKNVK  69

Query  183  KKIERGVAFPTCISVNNTVCHFSPLSNDDTVLEDGDMVKIDMGCHIDGFIAVVGHTHLLQ  362
            KKIERGVAFPTCISVNNT+CHFSPL++D+TVL++GD+VKID+ CHIDGFIA V HTH+LQ
Sbjct  70   KKIERGVAFPTCISVNNTICHFSPLASDETVLDEGDIVKIDLACHIDGFIAAVAHTHVLQ  129

Query  363  EGPVTGRaadviaaantaaevaLRLVRPGKKNSDVTEAIQKVAAAYDCK  509
            EGPVTGRAADVIAAANTAAEVALRLVRPGKKN DV++AIQKVAAAYDCK
Sbjct  130  EGPVTGRAADVIAAANTAAEVALRLVRPGKKNKDVSDAIQKVAAAYDCK  178



>ref|XP_004492468.1| PREDICTED: proliferation-associated protein 2G4-like [Cicer arietinum]
Length=394

 Score =   273 bits (699),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 143/169 (85%), Positives = 161/169 (95%), Gaps = 0/169 (0%)
 Frame = +3

Query  3    ELDLTTPEVVTKYKSAAEILNKGLELVVSQCKPNAKIVDICEKGDAFIREQTGNMYKNVK  182
            ELDL++ EVVTKYK+AAEI+NK L+LV+S+CKP AKIVDICEKGD+FIREQT N+YKNVK
Sbjct  10   ELDLSSSEVVTKYKTAAEIVNKALKLVISECKPKAKIVDICEKGDSFIREQTSNVYKNVK  69

Query  183  KKIERGVAFPTCISVNNTVCHFSPLSNDDTVLEDGDMVKIDMGCHIDGFIAVVGHTHLLQ  362
            KKIERGVAFPTCISVNNT+CHFSPL++D+TVLE+GD+VKID+ CHIDGFIA V HTH+LQ
Sbjct  70   KKIERGVAFPTCISVNNTICHFSPLASDETVLEEGDIVKIDLACHIDGFIAAVAHTHVLQ  129

Query  363  EGPVTGRaadviaaantaaevaLRLVRPGKKNSDVTEAIQKVAAAYDCK  509
            EGPVTGRAADVIAAANTAAEVALRLVRPGKKN DVT+AIQKVAAAYDCK
Sbjct  130  EGPVTGRAADVIAAANTAAEVALRLVRPGKKNKDVTDAIQKVAAAYDCK  178



>gb|KFK34423.1| hypothetical protein AALP_AA5G142900 [Arabis alpina]
Length=393

 Score =   273 bits (698),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 142/169 (84%), Positives = 162/169 (96%), Gaps = 0/169 (0%)
 Frame = +3

Query  3    ELDLTTPEVVTKYKSAAEILNKGLELVVSQCKPNAKIVDICEKGDAFIREQTGNMYKNVK  182
            +LDLT+PEVVTKYKSAAEI+NK L++V+++CKP AKIVDIC+KGDAFI+EQTG+MYKN K
Sbjct  11   QLDLTSPEVVTKYKSAAEIVNKALQVVLAECKPKAKIVDICDKGDAFIKEQTGSMYKNSK  70

Query  183  KKIERGVAFPTCISVNNTVCHFSPLSNDDTVLEDGDMVKIDMGCHIDGFIAVVGHTHLLQ  362
            KKI+RGVAFPTCISVNNTV HFSPL+ D+TVLE+GDMVKIDMGCHIDGFIA+V HTH+LQ
Sbjct  71   KKIDRGVAFPTCISVNNTVGHFSPLAGDETVLEEGDMVKIDMGCHIDGFIALVAHTHVLQ  130

Query  363  EGPVTGRaadviaaantaaevaLRLVRPGKKNSDVTEAIQKVAAAYDCK  509
            +GP+TGR ADVIAAANTAAEVALRLVRPGKKN+DVTEAIQKVAAAYDCK
Sbjct  131  QGPLTGRKADVIAAANTAAEVALRLVRPGKKNNDVTEAIQKVAAAYDCK  179



>gb|KJB17056.1| hypothetical protein B456_002G262700 [Gossypium raimondii]
 gb|KJB17057.1| hypothetical protein B456_002G262700 [Gossypium raimondii]
Length=286

 Score =   270 bits (689),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 140/169 (83%), Positives = 157/169 (93%), Gaps = 0/169 (0%)
 Frame = +3

Query  3    ELDLTTPEVVTKYKSAAEILNKGLELVVSQCKPNAKIVDICEKGDAFIREQTGNMYKNVK  182
            ELDL++ EVVTKYK AAEI+NK L+LVV +CKP AKIVDICEKGDAFIREQTGNMYKN K
Sbjct  10   ELDLSSSEVVTKYKGAAEIVNKALQLVVKECKPKAKIVDICEKGDAFIREQTGNMYKNSK  69

Query  183  KKIERGVAFPTCISVNNTVCHFSPLSNDDTVLEDGDMVKIDMGCHIDGFIAVVGHTHLLQ  362
            KKIERGVAFPTC+SVNNTVCHFSPL++D + LE+GDMVKIDMGCHIDGFIAVV HTH++Q
Sbjct  70   KKIERGVAFPTCLSVNNTVCHFSPLASDTSELEEGDMVKIDMGCHIDGFIAVVAHTHVVQ  129

Query  363  EGPVTGRaadviaaantaaevaLRLVRPGKKNSDVTEAIQKVAAAYDCK  509
             GP+TG+ ADV+AAANTAAEVALRLVRPGKKN DV++AIQKVAAAYDCK
Sbjct  130  SGPITGKQADVVAAANTAAEVALRLVRPGKKNKDVSDAIQKVAAAYDCK  178



>ref|XP_010920808.1| PREDICTED: proliferation-associated protein 2G4 isoform X3 [Elaeis 
guineensis]
Length=397

 Score =   273 bits (697),  Expect = 3e-87, Method: Compositional matrix adjust.
 Identities = 144/169 (85%), Positives = 158/169 (93%), Gaps = 0/169 (0%)
 Frame = +3

Query  3    ELDLTTPEVVTKYKSAAEILNKGLELVVSQCKPNAKIVDICEKGDAFIREQTGNMYKNVK  182
            ELDL+ P+VVTKYK AAEILNK L+LVVS+CKP AKIVDICEKGD FI+EQ+GN+YKNVK
Sbjct  11   ELDLSFPDVVTKYKCAAEILNKALQLVVSECKPKAKIVDICEKGDTFIKEQSGNVYKNVK  70

Query  183  KKIERGVAFPTCISVNNTVCHFSPLSNDDTVLEDGDMVKIDMGCHIDGFIAVVGHTHLLQ  362
            KKIERGVAFPTCISVNNTVCHFSPLS D+ VLE+ D+VKIDMGCHIDGFIAVV HTH+LQ
Sbjct  71   KKIERGVAFPTCISVNNTVCHFSPLSGDEAVLEENDVVKIDMGCHIDGFIAVVAHTHVLQ  130

Query  363  EGPVTGRaadviaaantaaevaLRLVRPGKKNSDVTEAIQKVAAAYDCK  509
            EGP+TGRAADVIAAANTAA+VALRLVRPG+KN DVTEAIQKVA AYDCK
Sbjct  131  EGPITGRAADVIAAANTAADVALRLVRPGRKNKDVTEAIQKVAGAYDCK  179



>gb|KEH38647.1| proliferation-associated 2G4-like protein [Medicago truncatula]
Length=391

 Score =   272 bits (696),  Expect = 3e-87, Method: Compositional matrix adjust.
 Identities = 142/169 (84%), Positives = 161/169 (95%), Gaps = 0/169 (0%)
 Frame = +3

Query  3    ELDLTTPEVVTKYKSAAEILNKGLELVVSQCKPNAKIVDICEKGDAFIREQTGNMYKNVK  182
            ELDLT+P+VVTKYKSAAEI+NK L+LV+S+CKP+ KIVDICEKGD+FIREQTG +YKNVK
Sbjct  10   ELDLTSPDVVTKYKSAAEIVNKALQLVISECKPDVKIVDICEKGDSFIREQTGKLYKNVK  69

Query  183  KKIERGVAFPTCISVNNTVCHFSPLSNDDTVLEDGDMVKIDMGCHIDGFIAVVGHTHLLQ  362
            KKIERGVAFPTCISVNNTVCHFSPL++D+TVLE GD++KIDM CHIDGFIA V HTH+L+
Sbjct  70   KKIERGVAFPTCISVNNTVCHFSPLASDETVLEVGDILKIDMACHIDGFIAAVAHTHVLR  129

Query  363  EGPVTGRaadviaaantaaevaLRLVRPGKKNSDVTEAIQKVAAAYDCK  509
            EGPVTGRAADVIAAANTAAEVALRLV+PGKKN DVT+AIQKVAAAYDC+
Sbjct  130  EGPVTGRAADVIAAANTAAEVALRLVKPGKKNQDVTDAIQKVAAAYDCR  178



>gb|EPS71863.1| hypothetical protein M569_02886, partial [Genlisea aurea]
Length=369

 Score =   271 bits (693),  Expect = 5e-87, Method: Compositional matrix adjust.
 Identities = 142/169 (84%), Positives = 158/169 (93%), Gaps = 0/169 (0%)
 Frame = +3

Query  3    ELDLTTPEVVTKYKSAAEILNKGLELVVSQCKPNAKIVDICEKGDAFIREQTGNMYKNVK  182
            ELDLT+ EVV KYKSAAEI+N+ L+ V+S+CKP AKIVD+CEKGD+FIREQ+GNMYKN K
Sbjct  10   ELDLTSSEVVMKYKSAAEIVNRALQSVLSECKPKAKIVDLCEKGDSFIREQSGNMYKNAK  69

Query  183  KKIERGVAFPTCISVNNTVCHFSPLSNDDTVLEDGDMVKIDMGCHIDGFIAVVGHTHLLQ  362
            KKIERGVAFPTCISVNNTVCHFSPL++D+T LE GD++KIDMGCHIDGFIAVV HTH+LQ
Sbjct  70   KKIERGVAFPTCISVNNTVCHFSPLASDETTLEAGDILKIDMGCHIDGFIAVVAHTHVLQ  129

Query  363  EGPVTGRaadviaaantaaevaLRLVRPGKKNSDVTEAIQKVAAAYDCK  509
            EGPV+GRAADVIAAANTAAEVALRLVRPGKKN DV EAIQKVAAAYDCK
Sbjct  130  EGPVSGRAADVIAAANTAAEVALRLVRPGKKNKDVAEAIQKVAAAYDCK  178



>ref|XP_009123761.1| PREDICTED: proliferation-associated protein 2G4-like [Brassica 
rapa]
Length=393

 Score =   271 bits (694),  Expect = 8e-87, Method: Compositional matrix adjust.
 Identities = 142/169 (84%), Positives = 160/169 (95%), Gaps = 0/169 (0%)
 Frame = +3

Query  3    ELDLTTPEVVTKYKSAAEILNKGLELVVSQCKPNAKIVDICEKGDAFIREQTGNMYKNVK  182
            ELDLT+PEVVTKYKSAAEI+NK L++V+S+CKP AKIVDICEKGDAFI+EQTG+MYKN K
Sbjct  11   ELDLTSPEVVTKYKSAAEIVNKALQVVLSECKPKAKIVDICEKGDAFIKEQTGSMYKNAK  70

Query  183  KKIERGVAFPTCISVNNTVCHFSPLSNDDTVLEDGDMVKIDMGCHIDGFIAVVGHTHLLQ  362
            KKI+RGVAFPTC+SVNNTV HFSPL++D+T+LE+GDM+KIDMGCHIDGFIA+V HTH+LQ
Sbjct  71   KKIDRGVAFPTCVSVNNTVGHFSPLASDETLLEEGDMLKIDMGCHIDGFIALVAHTHVLQ  130

Query  363  EGPVTGRaadviaaantaaevaLRLVRPGKKNSDVTEAIQKVAAAYDCK  509
            EGPVTGR ADVIAAANTAAEVALRLVRPGKKN  VTEAIQKVA AYDCK
Sbjct  131  EGPVTGRKADVIAAANTAAEVALRLVRPGKKNHAVTEAIQKVAEAYDCK  179



>ref|XP_010920804.1| PREDICTED: proliferation-associated protein 2G4 isoform X1 [Elaeis 
guineensis]
 ref|XP_010920805.1| PREDICTED: proliferation-associated protein 2G4 isoform X1 [Elaeis 
guineensis]
Length=431

 Score =   273 bits (697),  Expect = 9e-87, Method: Compositional matrix adjust.
 Identities = 144/169 (85%), Positives = 158/169 (93%), Gaps = 0/169 (0%)
 Frame = +3

Query  3    ELDLTTPEVVTKYKSAAEILNKGLELVVSQCKPNAKIVDICEKGDAFIREQTGNMYKNVK  182
            ELDL+ P+VVTKYK AAEILNK L+LVVS+CKP AKIVDICEKGD FI+EQ+GN+YKNVK
Sbjct  11   ELDLSFPDVVTKYKCAAEILNKALQLVVSECKPKAKIVDICEKGDTFIKEQSGNVYKNVK  70

Query  183  KKIERGVAFPTCISVNNTVCHFSPLSNDDTVLEDGDMVKIDMGCHIDGFIAVVGHTHLLQ  362
            KKIERGVAFPTCISVNNTVCHFSPLS D+ VLE+ D+VKIDMGCHIDGFIAVV HTH+LQ
Sbjct  71   KKIERGVAFPTCISVNNTVCHFSPLSGDEAVLEENDVVKIDMGCHIDGFIAVVAHTHVLQ  130

Query  363  EGPVTGRaadviaaantaaevaLRLVRPGKKNSDVTEAIQKVAAAYDCK  509
            EGP+TGRAADVIAAANTAA+VALRLVRPG+KN DVTEAIQKVA AYDCK
Sbjct  131  EGPITGRAADVIAAANTAADVALRLVRPGRKNKDVTEAIQKVAGAYDCK  179



>emb|CDX73690.1| BnaC08g23130D [Brassica napus]
Length=391

 Score =   271 bits (693),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 142/169 (84%), Positives = 159/169 (94%), Gaps = 0/169 (0%)
 Frame = +3

Query  3    ELDLTTPEVVTKYKSAAEILNKGLELVVSQCKPNAKIVDICEKGDAFIREQTGNMYKNVK  182
            ELDLT+PEVVTKYKSAAEI+NK L++V+++CKP AKIVDICEKGDAFI EQ G+MYKNVK
Sbjct  11   ELDLTSPEVVTKYKSAAEIVNKALQVVLAECKPKAKIVDICEKGDAFINEQAGSMYKNVK  70

Query  183  KKIERGVAFPTCISVNNTVCHFSPLSNDDTVLEDGDMVKIDMGCHIDGFIAVVGHTHLLQ  362
            KKI+RGVAFPTC+SVNNTV HFSPL++D+TVLE+GDMVKIDMGCHIDGFIA+V HTH++Q
Sbjct  71   KKIDRGVAFPTCVSVNNTVGHFSPLASDETVLEEGDMVKIDMGCHIDGFIALVAHTHVIQ  130

Query  363  EGPVTGRaadviaaantaaevaLRLVRPGKKNSDVTEAIQKVAAAYDCK  509
            EGPVTGR ADVIAAANTAAEVALRLVRPGKKN  VTEAIQKVA AYDCK
Sbjct  131  EGPVTGRKADVIAAANTAAEVALRLVRPGKKNHAVTEAIQKVAEAYDCK  179



>ref|XP_009115883.1| PREDICTED: proliferation-associated protein 2G4-like isoform 
X2 [Brassica rapa]
Length=390

 Score =   271 bits (693),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 141/169 (83%), Positives = 159/169 (94%), Gaps = 0/169 (0%)
 Frame = +3

Query  3    ELDLTTPEVVTKYKSAAEILNKGLELVVSQCKPNAKIVDICEKGDAFIREQTGNMYKNVK  182
            ELDLT+PEVVTKYKSAAEI+NK L++V+++CKP AKIVDICEKGDAFI+EQ G+MYKN K
Sbjct  11   ELDLTSPEVVTKYKSAAEIVNKALQVVLAECKPKAKIVDICEKGDAFIKEQAGSMYKNAK  70

Query  183  KKIERGVAFPTCISVNNTVCHFSPLSNDDTVLEDGDMVKIDMGCHIDGFIAVVGHTHLLQ  362
            KKI+RGVAFPTC+SVNNTV HFSPL++D+TVLE+GDMVKIDMGCHIDGFIA+V HTH++Q
Sbjct  71   KKIDRGVAFPTCVSVNNTVGHFSPLASDETVLEEGDMVKIDMGCHIDGFIALVAHTHVIQ  130

Query  363  EGPVTGRaadviaaantaaevaLRLVRPGKKNSDVTEAIQKVAAAYDCK  509
            EGPVTGR ADVIAAANTAAEVALRLVRPGKKN  VTEAIQKVA AYDCK
Sbjct  131  EGPVTGRKADVIAAANTAAEVALRLVRPGKKNHAVTEAIQKVAEAYDCK  179



>ref|XP_009115882.1| PREDICTED: proliferation-associated protein 2G4-like isoform 
X1 [Brassica rapa]
Length=391

 Score =   271 bits (693),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 141/169 (83%), Positives = 159/169 (94%), Gaps = 0/169 (0%)
 Frame = +3

Query  3    ELDLTTPEVVTKYKSAAEILNKGLELVVSQCKPNAKIVDICEKGDAFIREQTGNMYKNVK  182
            ELDLT+PEVVTKYKSAAEI+NK L++V+++CKP AKIVDICEKGDAFI+EQ G+MYKN K
Sbjct  11   ELDLTSPEVVTKYKSAAEIVNKALQVVLAECKPKAKIVDICEKGDAFIKEQAGSMYKNAK  70

Query  183  KKIERGVAFPTCISVNNTVCHFSPLSNDDTVLEDGDMVKIDMGCHIDGFIAVVGHTHLLQ  362
            KKI+RGVAFPTC+SVNNTV HFSPL++D+TVLE+GDMVKIDMGCHIDGFIA+V HTH++Q
Sbjct  71   KKIDRGVAFPTCVSVNNTVGHFSPLASDETVLEEGDMVKIDMGCHIDGFIALVAHTHVIQ  130

Query  363  EGPVTGRaadviaaantaaevaLRLVRPGKKNSDVTEAIQKVAAAYDCK  509
            EGPVTGR ADVIAAANTAAEVALRLVRPGKKN  VTEAIQKVA AYDCK
Sbjct  131  EGPVTGRKADVIAAANTAAEVALRLVRPGKKNHAVTEAIQKVAEAYDCK  179



>ref|XP_008792800.1| PREDICTED: proliferation-associated protein 2G4 isoform X1 [Phoenix 
dactylifera]
 ref|XP_008792807.1| PREDICTED: proliferation-associated protein 2G4 isoform X1 [Phoenix 
dactylifera]
 ref|XP_008792815.1| PREDICTED: proliferation-associated protein 2G4 isoform X1 [Phoenix 
dactylifera]
 ref|XP_008792823.1| PREDICTED: proliferation-associated protein 2G4 isoform X1 [Phoenix 
dactylifera]
Length=397

 Score =   271 bits (693),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 144/169 (85%), Positives = 158/169 (93%), Gaps = 0/169 (0%)
 Frame = +3

Query  3    ELDLTTPEVVTKYKSAAEILNKGLELVVSQCKPNAKIVDICEKGDAFIREQTGNMYKNVK  182
            ELDLT P+VVTKYK  AEI+NK L+LV+S+CKP AKI DICEKGDAFI+EQ+GN+YKNVK
Sbjct  11   ELDLTFPDVVTKYKCNAEIVNKALQLVISECKPKAKIADICEKGDAFIKEQSGNVYKNVK  70

Query  183  KKIERGVAFPTCISVNNTVCHFSPLSNDDTVLEDGDMVKIDMGCHIDGFIAVVGHTHLLQ  362
            KKIERGVAFPTCISVNNTVCHFSPLS+D+TVLE+ D+VKIDMGCHIDGFIAVV HTH+L 
Sbjct  71   KKIERGVAFPTCISVNNTVCHFSPLSSDETVLEENDVVKIDMGCHIDGFIAVVAHTHVLH  130

Query  363  EGPVTGRaadviaaantaaevaLRLVRPGKKNSDVTEAIQKVAAAYDCK  509
            EGP+TGRAADVIAAANTAAEVALRLVRPGKKN DVTEAIQKV AAYDCK
Sbjct  131  EGPITGRAADVIAAANTAAEVALRLVRPGKKNKDVTEAIQKVVAAYDCK  179



>ref|XP_006403880.1| hypothetical protein EUTSA_v10010435mg [Eutrema salsugineum]
 gb|ESQ45333.1| hypothetical protein EUTSA_v10010435mg [Eutrema salsugineum]
Length=393

 Score =   271 bits (692),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 141/169 (83%), Positives = 160/169 (95%), Gaps = 0/169 (0%)
 Frame = +3

Query  3    ELDLTTPEVVTKYKSAAEILNKGLELVVSQCKPNAKIVDICEKGDAFIREQTGNMYKNVK  182
            ELDLT+ EVVTKYKSAAEI+NK L++V+++CKP  KIVDICEKGDAFI+EQTG+MYKN K
Sbjct  11   ELDLTSSEVVTKYKSAAEIVNKALQVVLAECKPKTKIVDICEKGDAFIKEQTGSMYKNAK  70

Query  183  KKIERGVAFPTCISVNNTVCHFSPLSNDDTVLEDGDMVKIDMGCHIDGFIAVVGHTHLLQ  362
            KKIERGVAFPTCISVNNTV HFSPL++D++VLE+GDMVKIDMGCHIDGFIA+VGHTH+LQ
Sbjct  71   KKIERGVAFPTCISVNNTVGHFSPLASDESVLEEGDMVKIDMGCHIDGFIALVGHTHVLQ  130

Query  363  EGPVTGRaadviaaantaaevaLRLVRPGKKNSDVTEAIQKVAAAYDCK  509
            EGP++GR ADVIAAANTAAEVALRLVRPGKKN+ VTEAIQKVA AYDCK
Sbjct  131  EGPISGRKADVIAAANTAAEVALRLVRPGKKNNAVTEAIQKVAEAYDCK  179



>gb|KHG25370.1| Proliferation-associated 2G4 [Gossypium arboreum]
Length=393

 Score =   271 bits (692),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 141/169 (83%), Positives = 157/169 (93%), Gaps = 0/169 (0%)
 Frame = +3

Query  3    ELDLTTPEVVTKYKSAAEILNKGLELVVSQCKPNAKIVDICEKGDAFIREQTGNMYKNVK  182
            ELDLT+ EVVTKYKSAAEI+NK L+LVV +CKP  KIVDICEKGDAFIREQTGNMYKN K
Sbjct  10   ELDLTSSEVVTKYKSAAEIVNKALQLVVKECKPKVKIVDICEKGDAFIREQTGNMYKNSK  69

Query  183  KKIERGVAFPTCISVNNTVCHFSPLSNDDTVLEDGDMVKIDMGCHIDGFIAVVGHTHLLQ  362
            KKIERGVAFPTC+SVNNTVCHFSPL++D + LE+GDMVKIDMGCHIDGFIAVV HTH++Q
Sbjct  70   KKIERGVAFPTCLSVNNTVCHFSPLASDTSELEEGDMVKIDMGCHIDGFIAVVAHTHVVQ  129

Query  363  EGPVTGRaadviaaantaaevaLRLVRPGKKNSDVTEAIQKVAAAYDCK  509
             GP+TG+ ADV+AAANTAAEVALRLVRPGKKN DV++AIQKVAAAYDCK
Sbjct  130  SGPITGKQADVVAAANTAAEVALRLVRPGKKNKDVSDAIQKVAAAYDCK  178



>gb|KHG01253.1| Proliferation-associated 2G4 [Gossypium arboreum]
Length=392

 Score =   271 bits (692),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 142/169 (84%), Positives = 156/169 (92%), Gaps = 0/169 (0%)
 Frame = +3

Query  3    ELDLTTPEVVTKYKSAAEILNKGLELVVSQCKPNAKIVDICEKGDAFIREQTGNMYKNVK  182
            ELDLT+PEVVTKYKSAAEI+NK L+LVV +CKP  KIVDICEKGDAFIREQTGNMYKN K
Sbjct  10   ELDLTSPEVVTKYKSAAEIVNKALQLVVKECKPKTKIVDICEKGDAFIREQTGNMYKNAK  69

Query  183  KKIERGVAFPTCISVNNTVCHFSPLSNDDTVLEDGDMVKIDMGCHIDGFIAVVGHTHLLQ  362
            +KIERGVAFPTC+SVNN VCHFSPL++D + L++GDMVKIDMGCHIDGFIAVV HTH++Q
Sbjct  70   RKIERGVAFPTCLSVNNIVCHFSPLASDTSELQEGDMVKIDMGCHIDGFIAVVAHTHVVQ  129

Query  363  EGPVTGRaadviaaantaaevaLRLVRPGKKNSDVTEAIQKVAAAYDCK  509
            EGPV  R ADVIAAANTAAEVALRLVRPGKKN DVT+AIQKVAAAYDCK
Sbjct  130  EGPVNDRKADVIAAANTAAEVALRLVRPGKKNKDVTDAIQKVAAAYDCK  178



>emb|CDX90633.1| BnaA03g41480D [Brassica napus]
Length=390

 Score =   270 bits (691),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 141/169 (83%), Positives = 159/169 (94%), Gaps = 0/169 (0%)
 Frame = +3

Query  3    ELDLTTPEVVTKYKSAAEILNKGLELVVSQCKPNAKIVDICEKGDAFIREQTGNMYKNVK  182
            ELDLT+PEVVTKYKSAAEI+NK L++V+++CKP AKIVDICEKGDAFI+EQTG+MYKN K
Sbjct  11   ELDLTSPEVVTKYKSAAEIVNKALQVVLAECKPGAKIVDICEKGDAFIKEQTGSMYKNAK  70

Query  183  KKIERGVAFPTCISVNNTVCHFSPLSNDDTVLEDGDMVKIDMGCHIDGFIAVVGHTHLLQ  362
            KKI+RGVAFPTC+SVNN V HFSPL+ D++VLE+GDMVKIDMGCHIDGFIA+VGHTH+LQ
Sbjct  71   KKIDRGVAFPTCVSVNNVVGHFSPLAGDESVLEEGDMVKIDMGCHIDGFIALVGHTHVLQ  130

Query  363  EGPVTGRaadviaaantaaevaLRLVRPGKKNSDVTEAIQKVAAAYDCK  509
            EGPVTGR ADVIAAANTAAEVALRLVRPGKKN  VTEAIQKV+ AYDCK
Sbjct  131  EGPVTGRKADVIAAANTAAEVALRLVRPGKKNHAVTEAIQKVSEAYDCK  179



>ref|XP_009136636.1| PREDICTED: proliferation-associated protein 2G4-like [Brassica 
rapa]
Length=390

 Score =   270 bits (691),  Expect = 3e-86, Method: Compositional matrix adjust.
 Identities = 141/169 (83%), Positives = 159/169 (94%), Gaps = 0/169 (0%)
 Frame = +3

Query  3    ELDLTTPEVVTKYKSAAEILNKGLELVVSQCKPNAKIVDICEKGDAFIREQTGNMYKNVK  182
            ELDLT+PEVVTK+KSAAEI+NK L++V+++CKP AKIVDICEKGDAFI+EQTGNMYKN K
Sbjct  11   ELDLTSPEVVTKHKSAAEIVNKALQVVLAECKPGAKIVDICEKGDAFIKEQTGNMYKNAK  70

Query  183  KKIERGVAFPTCISVNNTVCHFSPLSNDDTVLEDGDMVKIDMGCHIDGFIAVVGHTHLLQ  362
            KKI+RGVAFPTC+SVNN V HFSPL+ D++VLE+GDMVKIDMGCHIDGFIA+VGHTH+LQ
Sbjct  71   KKIDRGVAFPTCVSVNNVVGHFSPLAGDESVLEEGDMVKIDMGCHIDGFIALVGHTHVLQ  130

Query  363  EGPVTGRaadviaaantaaevaLRLVRPGKKNSDVTEAIQKVAAAYDCK  509
            EGPVTGR ADVIAAANTAAEVALRLVRPGKKN  VTEAIQKV+ AYDCK
Sbjct  131  EGPVTGRKADVIAAANTAAEVALRLVRPGKKNHAVTEAIQKVSEAYDCK  179



>ref|XP_004302550.1| PREDICTED: proliferation-associated protein 2G4 [Fragaria vesca 
subsp. vesca]
Length=395

 Score =   270 bits (690),  Expect = 4e-86, Method: Compositional matrix adjust.
 Identities = 141/169 (83%), Positives = 157/169 (93%), Gaps = 0/169 (0%)
 Frame = +3

Query  3    ELDLTTPEVVTKYKSAAEILNKGLELVVSQCKPNAKIVDICEKGDAFIREQTGNMYKNVK  182
            ELDLT+PEVVTKYKSAAEI+NK L+ V+++CKP AKIVD+CE GD+FIREQTGNMYK+ K
Sbjct  11   ELDLTSPEVVTKYKSAAEIVNKALQRVIAECKPKAKIVDVCEIGDSFIREQTGNMYKSAK  70

Query  183  KKIERGVAFPTCISVNNTVCHFSPLSNDDTVLEDGDMVKIDMGCHIDGFIAVVGHTHLLQ  362
            KKIERGVAFPT ISVNNTVCHFSPL+ D+TV E+GD+VKIDMGCHIDGFIA+V HTH LQ
Sbjct  71   KKIERGVAFPTSISVNNTVCHFSPLATDETVFEEGDIVKIDMGCHIDGFIAIVAHTHALQ  130

Query  363  EGPVTGRaadviaaantaaevaLRLVRPGKKNSDVTEAIQKVAAAYDCK  509
             GP+TGRAADVIAAANTAAEVALRLV+PGKKN DVTEAIQKVAAAYDCK
Sbjct  131  TGPITGRAADVIAAANTAAEVALRLVKPGKKNKDVTEAIQKVAAAYDCK  179



>ref|NP_001241588.1| uncharacterized protein LOC100781302 [Glycine max]
 gb|ACU19677.1| unknown [Glycine max]
Length=394

 Score =   270 bits (689),  Expect = 4e-86, Method: Compositional matrix adjust.
 Identities = 139/169 (82%), Positives = 161/169 (95%), Gaps = 0/169 (0%)
 Frame = +3

Query  3    ELDLTTPEVVTKYKSAAEILNKGLELVVSQCKPNAKIVDICEKGDAFIREQTGNMYKNVK  182
            ELDL++ EVVTKYK+AAEI+NK L+LV+S+CKP AKIVDICEKGD++IREQTGN+YKNVK
Sbjct  10   ELDLSSAEVVTKYKTAAEIVNKALKLVISECKPKAKIVDICEKGDSYIREQTGNVYKNVK  69

Query  183  KKIERGVAFPTCISVNNTVCHFSPLSNDDTVLEDGDMVKIDMGCHIDGFIAVVGHTHLLQ  362
            +KIERGVAFPTC+S+NN VCHFSPL++D+ VLE+GD++KIDM CHIDGFIAVV HTH+LQ
Sbjct  70   RKIERGVAFPTCLSINNVVCHFSPLASDEAVLEEGDILKIDMACHIDGFIAVVAHTHVLQ  129

Query  363  EGPVTGRaadviaaantaaevaLRLVRPGKKNSDVTEAIQKVAAAYDCK  509
            EGPVTGRAADVIAAANTAAEVALRLVRPGKKN DV++AIQKVAAAYDCK
Sbjct  130  EGPVTGRAADVIAAANTAAEVALRLVRPGKKNKDVSDAIQKVAAAYDCK  178



>gb|KJB17053.1| hypothetical protein B456_002G262700 [Gossypium raimondii]
 gb|KJB17054.1| hypothetical protein B456_002G262700 [Gossypium raimondii]
 gb|KJB17055.1| hypothetical protein B456_002G262700 [Gossypium raimondii]
Length=393

 Score =   270 bits (689),  Expect = 6e-86, Method: Compositional matrix adjust.
 Identities = 140/169 (83%), Positives = 157/169 (93%), Gaps = 0/169 (0%)
 Frame = +3

Query  3    ELDLTTPEVVTKYKSAAEILNKGLELVVSQCKPNAKIVDICEKGDAFIREQTGNMYKNVK  182
            ELDL++ EVVTKYK AAEI+NK L+LVV +CKP AKIVDICEKGDAFIREQTGNMYKN K
Sbjct  10   ELDLSSSEVVTKYKGAAEIVNKALQLVVKECKPKAKIVDICEKGDAFIREQTGNMYKNSK  69

Query  183  KKIERGVAFPTCISVNNTVCHFSPLSNDDTVLEDGDMVKIDMGCHIDGFIAVVGHTHLLQ  362
            KKIERGVAFPTC+SVNNTVCHFSPL++D + LE+GDMVKIDMGCHIDGFIAVV HTH++Q
Sbjct  70   KKIERGVAFPTCLSVNNTVCHFSPLASDTSELEEGDMVKIDMGCHIDGFIAVVAHTHVVQ  129

Query  363  EGPVTGRaadviaaantaaevaLRLVRPGKKNSDVTEAIQKVAAAYDCK  509
             GP+TG+ ADV+AAANTAAEVALRLVRPGKKN DV++AIQKVAAAYDCK
Sbjct  130  SGPITGKQADVVAAANTAAEVALRLVRPGKKNKDVSDAIQKVAAAYDCK  178



>emb|CDX78041.1| BnaA09g32360D [Brassica napus]
Length=436

 Score =   270 bits (691),  Expect = 7e-86, Method: Compositional matrix adjust.
 Identities = 140/169 (83%), Positives = 159/169 (94%), Gaps = 0/169 (0%)
 Frame = +3

Query  3    ELDLTTPEVVTKYKSAAEILNKGLELVVSQCKPNAKIVDICEKGDAFIREQTGNMYKNVK  182
            ELDLT+PEVVTKYKSAAEI+NK L++V+++CKP AKIVDICEKGDAFI+EQ G+MYKN K
Sbjct  56   ELDLTSPEVVTKYKSAAEIVNKALQVVLAECKPKAKIVDICEKGDAFIKEQAGSMYKNAK  115

Query  183  KKIERGVAFPTCISVNNTVCHFSPLSNDDTVLEDGDMVKIDMGCHIDGFIAVVGHTHLLQ  362
            KKI+RGVAFPTC+SVNNTV HFSPL++D+T+LE+GDMVKIDMGCHIDGFIA+V HTH++Q
Sbjct  116  KKIDRGVAFPTCVSVNNTVGHFSPLASDETLLEEGDMVKIDMGCHIDGFIALVAHTHVIQ  175

Query  363  EGPVTGRaadviaaantaaevaLRLVRPGKKNSDVTEAIQKVAAAYDCK  509
            EGPVTGR ADVIAAANTAAEVALRLVRPGKKN  VTEAIQKVA AYDCK
Sbjct  176  EGPVTGRKADVIAAANTAAEVALRLVRPGKKNHAVTEAIQKVAEAYDCK  224



>emb|CDY33263.1| BnaA01g19300D [Brassica napus]
Length=393

 Score =   269 bits (688),  Expect = 8e-86, Method: Compositional matrix adjust.
 Identities = 139/169 (82%), Positives = 160/169 (95%), Gaps = 0/169 (0%)
 Frame = +3

Query  3    ELDLTTPEVVTKYKSAAEILNKGLELVVSQCKPNAKIVDICEKGDAFIREQTGNMYKNVK  182
            ELDLT+PEVVTKYKSAAEI+NK L++V+++CKP AKIVDICEKGDAFI+EQTG+MYKN K
Sbjct  11   ELDLTSPEVVTKYKSAAEIVNKALQVVLTECKPKAKIVDICEKGDAFIKEQTGSMYKNAK  70

Query  183  KKIERGVAFPTCISVNNTVCHFSPLSNDDTVLEDGDMVKIDMGCHIDGFIAVVGHTHLLQ  362
            KKI+RGVAFPTC+SVNNTV HFSPL++D+T+LE+GDM+KIDMGCHIDGFIA+V HTH+LQ
Sbjct  71   KKIDRGVAFPTCVSVNNTVGHFSPLASDETLLEEGDMLKIDMGCHIDGFIALVAHTHVLQ  130

Query  363  EGPVTGRaadviaaantaaevaLRLVRPGKKNSDVTEAIQKVAAAYDCK  509
            +GPVTGR ADV+AAANTAAEVALRLVRPGKKN  VTEAIQKVA AYDCK
Sbjct  131  DGPVTGRKADVLAAANTAAEVALRLVRPGKKNHAVTEAIQKVAEAYDCK  179



>gb|KJB36944.1| hypothetical protein B456_006G183700 [Gossypium raimondii]
 gb|KJB36947.1| hypothetical protein B456_006G183700 [Gossypium raimondii]
 gb|KJB36948.1| hypothetical protein B456_006G183700 [Gossypium raimondii]
Length=392

 Score =   269 bits (687),  Expect = 9e-86, Method: Compositional matrix adjust.
 Identities = 142/169 (84%), Positives = 156/169 (92%), Gaps = 0/169 (0%)
 Frame = +3

Query  3    ELDLTTPEVVTKYKSAAEILNKGLELVVSQCKPNAKIVDICEKGDAFIREQTGNMYKNVK  182
            ELDLT+PEVVTKYKSAAEI+NK L+LVV +CKP  KIVDICEKGDAFIREQTGNMYKN K
Sbjct  10   ELDLTSPEVVTKYKSAAEIVNKALQLVVKECKPKTKIVDICEKGDAFIREQTGNMYKNAK  69

Query  183  KKIERGVAFPTCISVNNTVCHFSPLSNDDTVLEDGDMVKIDMGCHIDGFIAVVGHTHLLQ  362
            +KIERGVAFPTC+SVNNTVCHFSPL++D + L++GDMVKIDMGCHIDGFIAVV HTH++Q
Sbjct  70   RKIERGVAFPTCLSVNNTVCHFSPLASDTSELQEGDMVKIDMGCHIDGFIAVVAHTHVVQ  129

Query  363  EGPVTGRaadviaaantaaevaLRLVRPGKKNSDVTEAIQKVAAAYDCK  509
            EG V  R ADVIAAANTAAEVALRLVRPGKKN DVT+AIQKVAAAYDCK
Sbjct  130  EGLVNDRKADVIAAANTAAEVALRLVRPGKKNKDVTDAIQKVAAAYDCK  178



>gb|KJB36946.1| hypothetical protein B456_006G183700 [Gossypium raimondii]
Length=371

 Score =   268 bits (685),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 142/169 (84%), Positives = 156/169 (92%), Gaps = 0/169 (0%)
 Frame = +3

Query  3    ELDLTTPEVVTKYKSAAEILNKGLELVVSQCKPNAKIVDICEKGDAFIREQTGNMYKNVK  182
            ELDLT+PEVVTKYKSAAEI+NK L+LVV +CKP  KIVDICEKGDAFIREQTGNMYKN K
Sbjct  10   ELDLTSPEVVTKYKSAAEIVNKALQLVVKECKPKTKIVDICEKGDAFIREQTGNMYKNAK  69

Query  183  KKIERGVAFPTCISVNNTVCHFSPLSNDDTVLEDGDMVKIDMGCHIDGFIAVVGHTHLLQ  362
            +KIERGVAFPTC+SVNNTVCHFSPL++D + L++GDMVKIDMGCHIDGFIAVV HTH++Q
Sbjct  70   RKIERGVAFPTCLSVNNTVCHFSPLASDTSELQEGDMVKIDMGCHIDGFIAVVAHTHVVQ  129

Query  363  EGPVTGRaadviaaantaaevaLRLVRPGKKNSDVTEAIQKVAAAYDCK  509
            EG V  R ADVIAAANTAAEVALRLVRPGKKN DVT+AIQKVAAAYDCK
Sbjct  130  EGLVNDRKADVIAAANTAAEVALRLVRPGKKNKDVTDAIQKVAAAYDCK  178



>ref|XP_003529167.1| PREDICTED: proliferation-associated protein 2G4 [Glycine max]
Length=394

 Score =   268 bits (686),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 139/169 (82%), Positives = 160/169 (95%), Gaps = 0/169 (0%)
 Frame = +3

Query  3    ELDLTTPEVVTKYKSAAEILNKGLELVVSQCKPNAKIVDICEKGDAFIREQTGNMYKNVK  182
            ELDL++ EVVTKYK+AAEI+NK L+LV+S+CKP AKIVDICEKGD++IREQTGN+YKNVK
Sbjct  10   ELDLSSAEVVTKYKTAAEIVNKALKLVISECKPKAKIVDICEKGDSYIREQTGNVYKNVK  69

Query  183  KKIERGVAFPTCISVNNTVCHFSPLSNDDTVLEDGDMVKIDMGCHIDGFIAVVGHTHLLQ  362
            +KIERGVAFPTC+SVNN VCHFSPL++D+ VLE+GD++KIDM CHIDGFIA V HTH+LQ
Sbjct  70   RKIERGVAFPTCLSVNNVVCHFSPLASDEAVLEEGDILKIDMACHIDGFIAAVAHTHVLQ  129

Query  363  EGPVTGRaadviaaantaaevaLRLVRPGKKNSDVTEAIQKVAAAYDCK  509
            EGPVTGRAADVIAAANTAAEVALRLVRPGKKN DV++AIQKVAAAYDCK
Sbjct  130  EGPVTGRAADVIAAANTAAEVALRLVRPGKKNKDVSDAIQKVAAAYDCK  178



>ref|XP_010937887.1| PREDICTED: proliferation-associated protein 2G4-like [Elaeis 
guineensis]
Length=397

 Score =   268 bits (686),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 141/169 (83%), Positives = 158/169 (93%), Gaps = 0/169 (0%)
 Frame = +3

Query  3    ELDLTTPEVVTKYKSAAEILNKGLELVVSQCKPNAKIVDICEKGDAFIREQTGNMYKNVK  182
            ELDLT+P+VVTKYK AAEILNK L+LVVS+CKP A IVDICEKGDAFI+EQTGN+YKNVK
Sbjct  11   ELDLTSPDVVTKYKCAAEILNKALQLVVSECKPKANIVDICEKGDAFIKEQTGNVYKNVK  70

Query  183  KKIERGVAFPTCISVNNTVCHFSPLSNDDTVLEDGDMVKIDMGCHIDGFIAVVGHTHLLQ  362
            KKIE+G+AFPTCISVNNTVCHFSPL  D+TVLE+ D+VKIDMGCHIDGFIA+  HTH+L+
Sbjct  71   KKIEKGIAFPTCISVNNTVCHFSPLGGDETVLEENDVVKIDMGCHIDGFIAIAAHTHVLR  130

Query  363  EGPVTGRaadviaaantaaevaLRLVRPGKKNSDVTEAIQKVAAAYDCK  509
            +GP+TGRAADVIAAANTAAEVALRLVRPGKKN DV EAIQKVA+AYDCK
Sbjct  131  DGPITGRAADVIAAANTAAEVALRLVRPGKKNKDVAEAIQKVASAYDCK  179



>emb|CDY16291.1| BnaC01g23260D [Brassica napus]
Length=393

 Score =   268 bits (686),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 140/169 (83%), Positives = 160/169 (95%), Gaps = 0/169 (0%)
 Frame = +3

Query  3    ELDLTTPEVVTKYKSAAEILNKGLELVVSQCKPNAKIVDICEKGDAFIREQTGNMYKNVK  182
            ELDLT+PEVVTKYKSAAEI+NK L++V+S+CKP AKIVDICEKGDAFI+EQTG+MYK+ K
Sbjct  11   ELDLTSPEVVTKYKSAAEIVNKALQVVLSECKPKAKIVDICEKGDAFIKEQTGSMYKSAK  70

Query  183  KKIERGVAFPTCISVNNTVCHFSPLSNDDTVLEDGDMVKIDMGCHIDGFIAVVGHTHLLQ  362
            KKI+RGVAFPTC+SVNNTV HFSPL++D+T+LE+GDM+KIDMGCHIDGFIA+V HTH+LQ
Sbjct  71   KKIDRGVAFPTCVSVNNTVGHFSPLASDETLLEEGDMLKIDMGCHIDGFIALVAHTHVLQ  130

Query  363  EGPVTGRaadviaaantaaevaLRLVRPGKKNSDVTEAIQKVAAAYDCK  509
            +GPVTGR ADVIAAANTAAEVALRLVRPGKKN  VTEAIQKVA AYDCK
Sbjct  131  DGPVTGRKADVIAAANTAAEVALRLVRPGKKNHAVTEAIQKVAEAYDCK  179



>gb|ADK78215.1| methionine aminopeptiase [Hordeum vulgare]
Length=394

 Score =   268 bits (686),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 139/169 (82%), Positives = 158/169 (93%), Gaps = 0/169 (0%)
 Frame = +3

Query  3    ELDLTTPEVVTKYKSAAEILNKGLELVVSQCKPNAKIVDICEKGDAFIREQTGNMYKNVK  182
            ELDL++ EVVTKYK+AAEI+NK L+LV+S+CKP AKIVDICEKGD FI EQTGN+YKNVK
Sbjct  12   ELDLSSNEVVTKYKTAAEIINKALKLVLSECKPKAKIVDICEKGDNFITEQTGNVYKNVK  71

Query  183  KKIERGVAFPTCISVNNTVCHFSPLSNDDTVLEDGDMVKIDMGCHIDGFIAVVGHTHLLQ  362
            +KIERG+AFPTC+SVNNTVCHFSPL+ DD+VLE+ DMVKIDM CHIDGFIAVV HTH+++
Sbjct  72   RKIERGIAFPTCVSVNNTVCHFSPLATDDSVLEENDMVKIDMACHIDGFIAVVAHTHVIK  131

Query  363  EGPVTGRaadviaaantaaevaLRLVRPGKKNSDVTEAIQKVAAAYDCK  509
             GPVTGRAADV+AAANTAAEVA+RLVRPGKKN DVTEAIQKVAAAYDCK
Sbjct  132  AGPVTGRAADVLAAANTAAEVAMRLVRPGKKNKDVTEAIQKVAAAYDCK  180



>gb|KHN39558.1| Proliferation-associated protein 2G4 [Glycine soja]
Length=394

 Score =   268 bits (686),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 139/169 (82%), Positives = 160/169 (95%), Gaps = 0/169 (0%)
 Frame = +3

Query  3    ELDLTTPEVVTKYKSAAEILNKGLELVVSQCKPNAKIVDICEKGDAFIREQTGNMYKNVK  182
            ELDL++ EVVTKYK+AAEI+NK L+LV+S+CKP AKIVDICEKGD++IREQTGN+YKNVK
Sbjct  10   ELDLSSAEVVTKYKTAAEIVNKALKLVISECKPKAKIVDICEKGDSYIREQTGNVYKNVK  69

Query  183  KKIERGVAFPTCISVNNTVCHFSPLSNDDTVLEDGDMVKIDMGCHIDGFIAVVGHTHLLQ  362
            +KIERGVAFPTC+SVNN VCHFSPL++D+ VLE+GD++KIDM CHIDGFIA V HTH+LQ
Sbjct  70   RKIERGVAFPTCLSVNNVVCHFSPLASDEAVLEEGDILKIDMACHIDGFIAAVAHTHVLQ  129

Query  363  EGPVTGRaadviaaantaaevaLRLVRPGKKNSDVTEAIQKVAAAYDCK  509
            EGPVTGRAADVIAAANTAAEVALRLVRPGKKN DV++AIQKVAAAYDCK
Sbjct  130  EGPVTGRAADVIAAANTAAEVALRLVRPGKKNKDVSDAIQKVAAAYDCK  178



>ref|XP_002440927.1| hypothetical protein SORBIDRAFT_09g016610 [Sorghum bicolor]
 gb|EES19357.1| hypothetical protein SORBIDRAFT_09g016610 [Sorghum bicolor]
Length=392

 Score =   268 bits (685),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 139/169 (82%), Positives = 157/169 (93%), Gaps = 0/169 (0%)
 Frame = +3

Query  3    ELDLTTPEVVTKYKSAAEILNKGLELVVSQCKPNAKIVDICEKGDAFIREQTGNMYKNVK  182
            ELDL++ +VVTKYK+AAEILN  L+LVVS+CKP AKIVD+CEKGD+FIREQTGN+YKN K
Sbjct  12   ELDLSSNDVVTKYKAAAEILNNALKLVVSECKPKAKIVDLCEKGDSFIREQTGNVYKNAK  71

Query  183  KKIERGVAFPTCISVNNTVCHFSPLSNDDTVLEDGDMVKIDMGCHIDGFIAVVGHTHLLQ  362
            +KIERG+AFPTC+SVNNTVCHFSPL+ DD VLE+ DMVKIDMGCHIDGFIAVV HTH++ 
Sbjct  72   RKIERGIAFPTCVSVNNTVCHFSPLATDDAVLEENDMVKIDMGCHIDGFIAVVAHTHVIT  131

Query  363  EGPVTGRaadviaaantaaevaLRLVRPGKKNSDVTEAIQKVAAAYDCK  509
             GPVTGRAADV+AAANTAAEVA+RLVRPGKKN DVTEAIQKVAAAYDCK
Sbjct  132  SGPVTGRAADVLAAANTAAEVAVRLVRPGKKNKDVTEAIQKVAAAYDCK  180



>gb|ABR26103.1| proliferation-associated protein 2g4 [Oryza sativa Indica Group]
Length=231

 Score =   263 bits (671),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 137/169 (81%), Positives = 156/169 (92%), Gaps = 0/169 (0%)
 Frame = +3

Query  3    ELDLTTPEVVTKYKSAAEILNKGLELVVSQCKPNAKIVDICEKGDAFIREQTGNMYKNVK  182
            ELDL++ +VVTKYK AA+I+N  L+LVVS CKP AKIVDICEKGD++IREQTGN+YKNVK
Sbjct  12   ELDLSSSDVVTKYKDAADIINNALKLVVSLCKPKAKIVDICEKGDSYIREQTGNIYKNVK  71

Query  183  KKIERGVAFPTCISVNNTVCHFSPLSNDDTVLEDGDMVKIDMGCHIDGFIAVVGHTHLLQ  362
            +KIERGVAFPTC+SVNNTVCHFSPL+ D+ VLE+ DMVKIDMGCHIDGFIAVV HTH++ 
Sbjct  72   RKIERGVAFPTCVSVNNTVCHFSPLATDEAVLEENDMVKIDMGCHIDGFIAVVAHTHVIH  131

Query  363  EGPVTGRaadviaaantaaevaLRLVRPGKKNSDVTEAIQKVAAAYDCK  509
            +G VTG+AADV+AAANTAAEVALRLVRPGKKN DVTEAIQKVAAAYDCK
Sbjct  132  DGAVTGKAADVLAAANTAAEVALRLVRPGKKNKDVTEAIQKVAAAYDCK  180



>ref|XP_006291295.1| hypothetical protein CARUB_v10017431mg [Capsella rubella]
 gb|EOA24193.1| hypothetical protein CARUB_v10017431mg [Capsella rubella]
Length=381

 Score =   267 bits (683),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 131/169 (78%), Positives = 149/169 (88%), Gaps = 12/169 (7%)
 Frame = +3

Query  3    ELDLTTPEVVTKYKSAAEILNKGLELVVSQCKPNAKIVDICEKGDAFIREQTGNMYKNVK  182
            EL LT+PEVVTKYK AAEI+NK L++V+++CKP AKIVDICEKGDAFI+EQT +MYKN K
Sbjct  11   ELSLTSPEVVTKYKGAAEIVNKALQVVLAECKPKAKIVDICEKGDAFIKEQTASMYKNSK  70

Query  183  KKIERGVAFPTCISVNNTVCHFSPLSNDDTVLEDGDMVKIDMGCHIDGFIAVVGHTHLLQ  362
            KKIE+GVAFPTCISVNNTV HFSPL++D+TVLEDGD+VKIDMGCHIDGFIA+VGHTH+LQ
Sbjct  71   KKIEKGVAFPTCISVNNTVGHFSPLASDETVLEDGDLVKIDMGCHIDGFIALVGHTHVLQ  130

Query  363  EGPVTGRaadviaaantaaevaLRLVRPGKKNSDVTEAIQKVAAAYDCK  509
            EGPV+G             EVALRLVRPGKKN+DVTEAIQKVAAAYDCK
Sbjct  131  EGPVSG------------PEVALRLVRPGKKNTDVTEAIQKVAAAYDCK  167



>ref|XP_007140242.1| hypothetical protein PHAVU_008G095800g [Phaseolus vulgaris]
 gb|ESW12236.1| hypothetical protein PHAVU_008G095800g [Phaseolus vulgaris]
Length=394

 Score =   268 bits (684),  Expect = 3e-85, Method: Compositional matrix adjust.
 Identities = 136/169 (80%), Positives = 160/169 (95%), Gaps = 0/169 (0%)
 Frame = +3

Query  3    ELDLTTPEVVTKYKSAAEILNKGLELVVSQCKPNAKIVDICEKGDAFIREQTGNMYKNVK  182
            ELDL++ EVVTKYK+AAEI+NK L+LV+S+CKP AK+VDICEKGD++IREQTGN+YKNVK
Sbjct  10   ELDLSSAEVVTKYKTAAEIVNKALKLVISECKPKAKVVDICEKGDSYIREQTGNVYKNVK  69

Query  183  KKIERGVAFPTCISVNNTVCHFSPLSNDDTVLEDGDMVKIDMGCHIDGFIAVVGHTHLLQ  362
            +KIERG+AFPTC+SVNN +CHFSPL++D+ VLE+GD++KIDM CHIDGFIA V HTH+LQ
Sbjct  70   RKIERGIAFPTCLSVNNVICHFSPLASDEAVLEEGDILKIDMACHIDGFIAAVAHTHVLQ  129

Query  363  EGPVTGRaadviaaantaaevaLRLVRPGKKNSDVTEAIQKVAAAYDCK  509
            EGP+TGRAADVIAAANTAAEVALRLVRPGKKN DV+EAIQKVAAAYDCK
Sbjct  130  EGPITGRAADVIAAANTAAEVALRLVRPGKKNKDVSEAIQKVAAAYDCK  178



>ref|XP_007140243.1| hypothetical protein PHAVU_008G095900g [Phaseolus vulgaris]
 gb|ESW12237.1| hypothetical protein PHAVU_008G095900g [Phaseolus vulgaris]
Length=392

 Score =   267 bits (683),  Expect = 4e-85, Method: Compositional matrix adjust.
 Identities = 138/169 (82%), Positives = 160/169 (95%), Gaps = 0/169 (0%)
 Frame = +3

Query  3    ELDLTTPEVVTKYKSAAEILNKGLELVVSQCKPNAKIVDICEKGDAFIREQTGNMYKNVK  182
            ELDL++ EVVTKYK+AAEI+NK L+LV+S+CKP AKIVD+CEKGD++IREQTGN+YKNVK
Sbjct  10   ELDLSSAEVVTKYKTAAEIVNKALKLVISECKPKAKIVDLCEKGDSYIREQTGNVYKNVK  69

Query  183  KKIERGVAFPTCISVNNTVCHFSPLSNDDTVLEDGDMVKIDMGCHIDGFIAVVGHTHLLQ  362
            +KIERGVAFPTC+SVNN VCHFSPL++D+ VLE+GD++KIDM CHIDGFIA V HTH+LQ
Sbjct  70   RKIERGVAFPTCLSVNNLVCHFSPLASDEAVLEEGDILKIDMACHIDGFIAAVAHTHVLQ  129

Query  363  EGPVTGRaadviaaantaaevaLRLVRPGKKNSDVTEAIQKVAAAYDCK  509
            EGPV+GRAADVIAAANTAAEVALRLVRPGKKN DVT+AIQKVAAAYDCK
Sbjct  130  EGPVSGRAADVIAAANTAAEVALRLVRPGKKNKDVTDAIQKVAAAYDCK  178



>gb|AHA84129.1| DNA-binding protein GBP16 [Phaseolus vulgaris]
Length=394

 Score =   267 bits (683),  Expect = 4e-85, Method: Compositional matrix adjust.
 Identities = 138/169 (82%), Positives = 160/169 (95%), Gaps = 0/169 (0%)
 Frame = +3

Query  3    ELDLTTPEVVTKYKSAAEILNKGLELVVSQCKPNAKIVDICEKGDAFIREQTGNMYKNVK  182
            ELDL++ EVVTKYK+AAEI+NK L+LV+S+CKP AKIVD+CEKGD++IREQTGN+YKNVK
Sbjct  10   ELDLSSAEVVTKYKTAAEIVNKALKLVISECKPKAKIVDLCEKGDSYIREQTGNVYKNVK  69

Query  183  KKIERGVAFPTCISVNNTVCHFSPLSNDDTVLEDGDMVKIDMGCHIDGFIAVVGHTHLLQ  362
            +KIERGVAFPTC+SVNN VCHFSPL++D+ VLE+GD++KIDM CHIDGFIA V HTH+LQ
Sbjct  70   RKIERGVAFPTCLSVNNLVCHFSPLASDEAVLEEGDILKIDMACHIDGFIAAVAHTHVLQ  129

Query  363  EGPVTGRaadviaaantaaevaLRLVRPGKKNSDVTEAIQKVAAAYDCK  509
            EGPV+GRAADVIAAANTAAEVALRLVRPGKKN DVT+AIQKVAAAYDCK
Sbjct  130  EGPVSGRAADVIAAANTAAEVALRLVRPGKKNKDVTDAIQKVAAAYDCK  178



>ref|XP_006654286.1| PREDICTED: proliferation-associated protein 2G4-like [Oryza brachyantha]
Length=392

 Score =   267 bits (682),  Expect = 6e-85, Method: Compositional matrix adjust.
 Identities = 138/169 (82%), Positives = 158/169 (93%), Gaps = 0/169 (0%)
 Frame = +3

Query  3    ELDLTTPEVVTKYKSAAEILNKGLELVVSQCKPNAKIVDICEKGDAFIREQTGNMYKNVK  182
            ELDL++ +VVTKYK AA+I+N  L+LVVS CKP AKIVDICE+GD++IREQTGN+YKNVK
Sbjct  12   ELDLSSSDVVTKYKDAADIINNALKLVVSLCKPKAKIVDICERGDSYIREQTGNIYKNVK  71

Query  183  KKIERGVAFPTCISVNNTVCHFSPLSNDDTVLEDGDMVKIDMGCHIDGFIAVVGHTHLLQ  362
            +KIERG+AFPTC+SVNNTVCHFSPL+ D+ VLE+ DMVKIDMGCHIDGFIAVVGHTH++ 
Sbjct  72   RKIERGIAFPTCLSVNNTVCHFSPLATDEAVLEENDMVKIDMGCHIDGFIAVVGHTHVIH  131

Query  363  EGPVTGRaadviaaantaaevaLRLVRPGKKNSDVTEAIQKVAAAYDCK  509
            +GPVTGRAADV+AAANTAAEVALRLVRPGKKN DVTEAIQKVAAAYDCK
Sbjct  132  DGPVTGRAADVLAAANTAAEVALRLVRPGKKNKDVTEAIQKVAAAYDCK  180



>ref|XP_008789134.1| PREDICTED: proliferation-associated protein 2G4-like [Phoenix 
dactylifera]
Length=397

 Score =   267 bits (682),  Expect = 7e-85, Method: Compositional matrix adjust.
 Identities = 142/169 (84%), Positives = 158/169 (93%), Gaps = 0/169 (0%)
 Frame = +3

Query  3    ELDLTTPEVVTKYKSAAEILNKGLELVVSQCKPNAKIVDICEKGDAFIREQTGNMYKNVK  182
            ELDLT+P+VVTKYK AAEI+NK L+LVVS+CKP AKIVDICEKGDAFI+EQTG +YKNVK
Sbjct  11   ELDLTSPDVVTKYKCAAEIVNKALQLVVSECKPKAKIVDICEKGDAFIKEQTGTVYKNVK  70

Query  183  KKIERGVAFPTCISVNNTVCHFSPLSNDDTVLEDGDMVKIDMGCHIDGFIAVVGHTHLLQ  362
            KKIE+G+AFPTCISVNNTVCHFSPL +D+TVLE  D+VKIDMGCHIDGF+AVV HTH+LQ
Sbjct  71   KKIEKGIAFPTCISVNNTVCHFSPLGSDETVLEANDVVKIDMGCHIDGFVAVVAHTHVLQ  130

Query  363  EGPVTGRaadviaaantaaevaLRLVRPGKKNSDVTEAIQKVAAAYDCK  509
            +G +TGRAADVIAAANTAAEVALRLVRPGKKN DV EAIQKVAAAYDCK
Sbjct  131  DGSITGRAADVIAAANTAAEVALRLVRPGKKNKDVAEAIQKVAAAYDCK  179



>ref|XP_004962368.1| PREDICTED: proliferation-associated protein 2G4-like [Setaria 
italica]
Length=401

 Score =   267 bits (682),  Expect = 8e-85, Method: Compositional matrix adjust.
 Identities = 138/169 (82%), Positives = 157/169 (93%), Gaps = 0/169 (0%)
 Frame = +3

Query  3    ELDLTTPEVVTKYKSAAEILNKGLELVVSQCKPNAKIVDICEKGDAFIREQTGNMYKNVK  182
            ELDL++ +VVTKYK+AAEILN  L+LVVS+CKP AKIVD+CEKGD+FIREQTGN+YKN K
Sbjct  12   ELDLSSNDVVTKYKAAAEILNNALKLVVSECKPKAKIVDLCEKGDSFIREQTGNVYKNAK  71

Query  183  KKIERGVAFPTCISVNNTVCHFSPLSNDDTVLEDGDMVKIDMGCHIDGFIAVVGHTHLLQ  362
            +KIERG+AFPTC+SVNNTVCHFSPL+ D+ VLE+ DMVKIDMGCHIDGFIAVV HTH++ 
Sbjct  72   RKIERGIAFPTCVSVNNTVCHFSPLATDEAVLEENDMVKIDMGCHIDGFIAVVAHTHVIT  131

Query  363  EGPVTGRaadviaaantaaevaLRLVRPGKKNSDVTEAIQKVAAAYDCK  509
             GPVTGRAADV+AAANTAAEVA+RLVRPGKKN DVTEAIQKVAAAYDCK
Sbjct  132  NGPVTGRAADVLAAANTAAEVAMRLVRPGKKNKDVTEAIQKVAAAYDCK  180



>ref|XP_003568643.1| PREDICTED: proliferation-associated protein 2G4 [Brachypodium 
distachyon]
Length=394

 Score =   266 bits (680),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 138/169 (82%), Positives = 157/169 (93%), Gaps = 0/169 (0%)
 Frame = +3

Query  3    ELDLTTPEVVTKYKSAAEILNKGLELVVSQCKPNAKIVDICEKGDAFIREQTGNMYKNVK  182
            ELDL++ EVVTKYK+AAEI+NK L+LV+S+CKP AKIVDICEKGD FI EQTGN+YKNVK
Sbjct  12   ELDLSSNEVVTKYKTAAEIINKALKLVLSECKPKAKIVDICEKGDNFITEQTGNVYKNVK  71

Query  183  KKIERGVAFPTCISVNNTVCHFSPLSNDDTVLEDGDMVKIDMGCHIDGFIAVVGHTHLLQ  362
            KKIERG+AFPTC+SVNNTVCHFSPL+ DD +LE+ DMVKIDMGCHIDGFIAVV HTH+++
Sbjct  72   KKIERGIAFPTCLSVNNTVCHFSPLATDDAILEENDMVKIDMGCHIDGFIAVVAHTHVIK  131

Query  363  EGPVTGRaadviaaantaaevaLRLVRPGKKNSDVTEAIQKVAAAYDCK  509
            +GPVTGRAADV+AAANTAAEVA+RLVRPGK N DVTEAIQKVA AYDCK
Sbjct  132  DGPVTGRAADVLAAANTAAEVAMRLVRPGKNNKDVTEAIQKVATAYDCK  180



>ref|NP_001149216.1| proliferation-associated protein 2G4 [Zea mays]
 gb|ACG34597.1| proliferation-associated protein 2G4 [Zea mays]
 gb|ACR36319.1| unknown [Zea mays]
 gb|AFW77740.1| hypothetical protein ZEAMMB73_275925 [Zea mays]
Length=394

 Score =   265 bits (677),  Expect = 3e-84, Method: Compositional matrix adjust.
 Identities = 136/169 (80%), Positives = 155/169 (92%), Gaps = 0/169 (0%)
 Frame = +3

Query  3    ELDLTTPEVVTKYKSAAEILNKGLELVVSQCKPNAKIVDICEKGDAFIREQTGNMYKNVK  182
            ELDL++ +VVTKYK+AAEILN  L++VVSQCKP  KIVD+CEKGD+FIREQTGN+YKN K
Sbjct  12   ELDLSSNDVVTKYKAAAEILNNALKIVVSQCKPKVKIVDLCEKGDSFIREQTGNVYKNAK  71

Query  183  KKIERGVAFPTCISVNNTVCHFSPLSNDDTVLEDGDMVKIDMGCHIDGFIAVVGHTHLLQ  362
            +KIERG+AFPTC+SVN+TVCHFSPL+ DD VLE+ DMVKIDMGCHIDGFIAVV HTH++ 
Sbjct  72   RKIERGIAFPTCVSVNDTVCHFSPLATDDAVLEENDMVKIDMGCHIDGFIAVVAHTHVIT  131

Query  363  EGPVTGRaadviaaantaaevaLRLVRPGKKNSDVTEAIQKVAAAYDCK  509
             GPVTGRA DV+AAANTAAEVA+RLVRPGKKN DVTEAIQKVAAAYDCK
Sbjct  132  NGPVTGRAGDVLAAANTAAEVAMRLVRPGKKNKDVTEAIQKVAAAYDCK  180



>gb|EMT31637.1| Proliferation-associated protein 2G4 [Aegilops tauschii]
Length=482

 Score =   267 bits (682),  Expect = 5e-84, Method: Compositional matrix adjust.
 Identities = 138/169 (82%), Positives = 158/169 (93%), Gaps = 0/169 (0%)
 Frame = +3

Query  3    ELDLTTPEVVTKYKSAAEILNKGLELVVSQCKPNAKIVDICEKGDAFIREQTGNMYKNVK  182
            ELDL++ EVVTKYK+AAEI+NK L+LV+S+CKP AKIVDICEKGD FI EQTGN+YKNVK
Sbjct  80   ELDLSSNEVVTKYKTAAEIINKALKLVLSECKPKAKIVDICEKGDNFITEQTGNVYKNVK  139

Query  183  KKIERGVAFPTCISVNNTVCHFSPLSNDDTVLEDGDMVKIDMGCHIDGFIAVVGHTHLLQ  362
            +KIERG+AFPTC+SVNNTVCHFSPL+ DD+VLE+ DMVKIDM CHIDGFIAVV HTH+++
Sbjct  140  RKIERGIAFPTCVSVNNTVCHFSPLATDDSVLEENDMVKIDMACHIDGFIAVVAHTHVIK  199

Query  363  EGPVTGRaadviaaantaaevaLRLVRPGKKNSDVTEAIQKVAAAYDCK  509
             GPVTGRAA+V+AAANTAAEVA+RLVRPGKKN DVTEAIQKVAAAYDCK
Sbjct  200  GGPVTGRAANVLAAANTAAEVAMRLVRPGKKNKDVTEAIQKVAAAYDCK  248



>emb|CDY29047.1| BnaC07g32530D [Brassica napus]
Length=390

 Score =   264 bits (674),  Expect = 7e-84, Method: Compositional matrix adjust.
 Identities = 140/169 (83%), Positives = 157/169 (93%), Gaps = 0/169 (0%)
 Frame = +3

Query  3    ELDLTTPEVVTKYKSAAEILNKGLELVVSQCKPNAKIVDICEKGDAFIREQTGNMYKNVK  182
            ELDLT+PEVVTKYKSAAEI+NK L++V++ CKP AKIVDICEKGDAFI +QTGNMYKN K
Sbjct  11   ELDLTSPEVVTKYKSAAEIVNKALQVVLAICKPGAKIVDICEKGDAFIIKQTGNMYKNAK  70

Query  183  KKIERGVAFPTCISVNNTVCHFSPLSNDDTVLEDGDMVKIDMGCHIDGFIAVVGHTHLLQ  362
            KKI+RGVAFPTC+SVNN V HFSPL+ D++VLE+GDMVKIDMGCHIDGFIA+VGHTH++Q
Sbjct  71   KKIDRGVAFPTCVSVNNVVGHFSPLAGDESVLEEGDMVKIDMGCHIDGFIALVGHTHVIQ  130

Query  363  EGPVTGRaadviaaantaaevaLRLVRPGKKNSDVTEAIQKVAAAYDCK  509
            +GPVTGR ADVIAAANTAAEVALRLVRPGKKN  VTEAIQKVA AYDCK
Sbjct  131  KGPVTGRKADVIAAANTAAEVALRLVRPGKKNHAVTEAIQKVADAYDCK  179



>gb|AGV54689.1| proliferation-associated protein 2G4-like protein [Phaseolus 
vulgaris]
Length=394

 Score =   263 bits (673),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 135/169 (80%), Positives = 159/169 (94%), Gaps = 0/169 (0%)
 Frame = +3

Query  3    ELDLTTPEVVTKYKSAAEILNKGLELVVSQCKPNAKIVDICEKGDAFIREQTGNMYKNVK  182
            ELDL++ EVVTKYK+AAEI+NK L+LV+S+CKP AK+VDICEKGD++IREQTGN+YKNVK
Sbjct  10   ELDLSSAEVVTKYKTAAEIVNKALKLVISECKPKAKVVDICEKGDSYIREQTGNVYKNVK  69

Query  183  KKIERGVAFPTCISVNNTVCHFSPLSNDDTVLEDGDMVKIDMGCHIDGFIAVVGHTHLLQ  362
            +KIERG+AFPTC+SVNN +CHFSPL++D+ VLE+ D++KIDM CHIDGFIA V HTH+LQ
Sbjct  70   RKIERGIAFPTCLSVNNVICHFSPLASDEAVLEERDILKIDMACHIDGFIAAVAHTHVLQ  129

Query  363  EGPVTGRaadviaaantaaevaLRLVRPGKKNSDVTEAIQKVAAAYDCK  509
            EGP+TGRAADVIAAANTAAEVALRLVRPGKKN DV+EAIQKVAAAYDCK
Sbjct  130  EGPITGRAADVIAAANTAAEVALRLVRPGKKNKDVSEAIQKVAAAYDCK  178



>gb|EMS60472.1| Proliferation-associated protein 2G4 [Triticum urartu]
Length=520

 Score =   267 bits (683),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 138/169 (82%), Positives = 158/169 (93%), Gaps = 0/169 (0%)
 Frame = +3

Query  3    ELDLTTPEVVTKYKSAAEILNKGLELVVSQCKPNAKIVDICEKGDAFIREQTGNMYKNVK  182
            ELDL++ EVVTKYK+AAEI+NK L+LV+S+CKP AKIVDICEKGD FI EQTGN+YKNVK
Sbjct  51   ELDLSSNEVVTKYKTAAEIINKALKLVLSECKPKAKIVDICEKGDNFITEQTGNVYKNVK  110

Query  183  KKIERGVAFPTCISVNNTVCHFSPLSNDDTVLEDGDMVKIDMGCHIDGFIAVVGHTHLLQ  362
            +KIERG+AFPTC+SVNNTVCHFSPL+ DD+VLE+ DMVKIDM CHIDGFIAVV HTH+++
Sbjct  111  RKIERGIAFPTCVSVNNTVCHFSPLATDDSVLEENDMVKIDMACHIDGFIAVVAHTHVIK  170

Query  363  EGPVTGRaadviaaantaaevaLRLVRPGKKNSDVTEAIQKVAAAYDCK  509
             GPVTGRAA+V+AAANTAAEVA+RLVRPGKKN DVTEAIQKVAAAYDCK
Sbjct  171  AGPVTGRAANVLAAANTAAEVAMRLVRPGKKNKDVTEAIQKVAAAYDCK  219



>gb|EAY97646.1| hypothetical protein OsI_19569 [Oryza sativa Indica Group]
Length=393

 Score =   262 bits (670),  Expect = 4e-83, Method: Compositional matrix adjust.
 Identities = 137/169 (81%), Positives = 156/169 (92%), Gaps = 0/169 (0%)
 Frame = +3

Query  3    ELDLTTPEVVTKYKSAAEILNKGLELVVSQCKPNAKIVDICEKGDAFIREQTGNMYKNVK  182
            ELDL++ +VVTKYK AA+I+N  L+LVVS CKP AKIVDICEKGD++IREQTGN+YKNVK
Sbjct  12   ELDLSSSDVVTKYKDAADIINNALKLVVSLCKPKAKIVDICEKGDSYIREQTGNIYKNVK  71

Query  183  KKIERGVAFPTCISVNNTVCHFSPLSNDDTVLEDGDMVKIDMGCHIDGFIAVVGHTHLLQ  362
            +KIERGVAFPTC+SVNNTVCHFSPL+ D+ VLE+ DMVKIDMGCHIDGFIAVV HTH++ 
Sbjct  72   RKIERGVAFPTCVSVNNTVCHFSPLATDEAVLEENDMVKIDMGCHIDGFIAVVAHTHVIH  131

Query  363  EGPVTGRaadviaaantaaevaLRLVRPGKKNSDVTEAIQKVAAAYDCK  509
            +G VTG+AADV+AAANTAAEVALRLVRPGKKN DVTEAIQKVAAAYDCK
Sbjct  132  DGAVTGKAADVLAAANTAAEVALRLVRPGKKNKDVTEAIQKVAAAYDCK  180



>ref|NP_001055274.1| Os05g0350500 [Oryza sativa Japonica Group]
 gb|AAV44069.1| putative DNA-binding protein GBP16 [Oryza sativa Japonica Group]
 dbj|BAF17188.1| Os05g0350500 [Oryza sativa Japonica Group]
 dbj|BAG88060.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG95770.1| unnamed protein product [Oryza sativa Japonica Group]
Length=393

 Score =   262 bits (669),  Expect = 5e-83, Method: Compositional matrix adjust.
 Identities = 137/169 (81%), Positives = 156/169 (92%), Gaps = 0/169 (0%)
 Frame = +3

Query  3    ELDLTTPEVVTKYKSAAEILNKGLELVVSQCKPNAKIVDICEKGDAFIREQTGNMYKNVK  182
            ELDL++ +VVTKYK AA+I+N  L+LVVS CKP AKIVDICEKGD++IREQTGN+YKNVK
Sbjct  12   ELDLSSSDVVTKYKDAADIINNALKLVVSLCKPKAKIVDICEKGDSYIREQTGNIYKNVK  71

Query  183  KKIERGVAFPTCISVNNTVCHFSPLSNDDTVLEDGDMVKIDMGCHIDGFIAVVGHTHLLQ  362
            +KIERGVAFPTC+SVNNTVCHFSPL+ D+ VLE+ DMVKIDMGCHIDGFIAVV HTH++ 
Sbjct  72   RKIERGVAFPTCVSVNNTVCHFSPLATDEAVLEENDMVKIDMGCHIDGFIAVVAHTHVIH  131

Query  363  EGPVTGRaadviaaantaaevaLRLVRPGKKNSDVTEAIQKVAAAYDCK  509
            +G VTG+AADV+AAANTAAEVALRLVRPGKKN DVTEAIQKVAAAYDCK
Sbjct  132  DGAVTGKAADVLAAANTAAEVALRLVRPGKKNKDVTEAIQKVAAAYDCK  180



>gb|ABK24337.1| unknown [Picea sitchensis]
Length=394

 Score =   259 bits (662),  Expect = 6e-82, Method: Compositional matrix adjust.
 Identities = 134/169 (79%), Positives = 158/169 (93%), Gaps = 0/169 (0%)
 Frame = +3

Query  3    ELDLTTPEVVTKYKSAAEILNKGLELVVSQCKPNAKIVDICEKGDAFIREQTGNMYKNVK  182
            ELDLT+ +VVTKYK +AEI NK L++V+S+CKP AK+VD+CEKGD++IREQTGN+YKN K
Sbjct  11   ELDLTSHDVVTKYKLSAEIANKALQIVLSECKPKAKVVDLCEKGDSYIREQTGNVYKNAK  70

Query  183  KKIERGVAFPTCISVNNTVCHFSPLSNDDTVLEDGDMVKIDMGCHIDGFIAVVGHTHLLQ  362
            KKIE+GVAFPTCISVN+TVCHFSPL+ D+TVLE+ D+VKID+GCHIDGFI+VV HTH++Q
Sbjct  71   KKIEKGVAFPTCISVNSTVCHFSPLAGDETVLEENDLVKIDLGCHIDGFISVVAHTHVVQ  130

Query  363  EGPVTGRaadviaaantaaevaLRLVRPGKKNSDVTEAIQKVAAAYDCK  509
            EGPV+GR ADVIAAANTAAEVALRLV+PGKKN DVTEAIQKVAAAYDCK
Sbjct  131  EGPVSGRVADVIAAANTAAEVALRLVKPGKKNKDVTEAIQKVAAAYDCK  179



>gb|AAF91445.1|AF281652_1 putative DNA binding protein [Atriplex hortensis]
Length=397

 Score =   257 bits (656),  Expect = 5e-81, Method: Compositional matrix adjust.
 Identities = 133/170 (78%), Positives = 151/170 (89%), Gaps = 1/170 (1%)
 Frame = +3

Query  3    ELDLTTPEVVTKYKSAAEILNKGLELVVSQCKPNAKIVDICEKGDAFIREQTGNMYKNVK  182
            ELDL+ PEVVTKYKSAA+I+N+ L+LVV +CKP AKIVD+CEKGD FIREQTGNMYKNVK
Sbjct  10   ELDLSYPEVVTKYKSAADIVNRALQLVVGECKPKAKIVDLCEKGDNFIREQTGNMYKNVK  69

Query  183  KKIERGVAFPTCISVNNTVCHFSPLSNDDTVLEDGDMVKIDMGCHIDGFIAVVGHTHLLQ  362
            KKIERGVAFPTC+S+NN VCHFSPL++DD+VLE+GD+VKIDMGCHIDGFIAVV HTH++Q
Sbjct  70   KKIERGVAFPTCLSINNVVCHFSPLASDDSVLEEGDLVKIDMGCHIDGFIAVVAHTHVIQ  129

Query  363  EGPVTGRaadviaaantaaevaLRLVRPGKKNSDVTE-AIQKVAAAYDCK  509
            EGPVTGR ADV+AA NTAAEVALRLVRPGK      +   QK AAAYDCK
Sbjct  130  EGPVTGRKADVLAATNTAAEVALRLVRPGKNQYRCNQKQSQKXAAAYDCK  179



>gb|AAB80919.1| DNA-binding protein GBP16 [Oryza sativa Japonica Group]
Length=393

 Score =   256 bits (653),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 134/168 (80%), Positives = 153/168 (91%), Gaps = 0/168 (0%)
 Frame = +3

Query  3    ELDLTTPEVVTKYKSAAEILNKGLELVVSQCKPNAKIVDICEKGDAFIREQTGNMYKNVK  182
            ELDL++ +VVTKYK AA+I+N  L+LVVS CKP AKIVDICEKGD++IREQTGN+YKNVK
Sbjct  12   ELDLSSSDVVTKYKDAADIINNALKLVVSLCKPKAKIVDICEKGDSYIREQTGNIYKNVK  71

Query  183  KKIERGVAFPTCISVNNTVCHFSPLSNDDTVLEDGDMVKIDMGCHIDGFIAVVGHTHLLQ  362
            +KIERGVAFPTC+SVNNTVCHFSPL+ D+ VLE+ DMVKIDMGCHIDGFIAVV HTH++ 
Sbjct  72   RKIERGVAFPTCVSVNNTVCHFSPLATDEAVLEENDMVKIDMGCHIDGFIAVVAHTHVIH  131

Query  363  EGPVTGRaadviaaantaaevaLRLVRPGKKNSDVTEAIQKVAAAYDC  506
            +G VTG+AADV+AAANTAAEVALR VRPGKKN DVTEAIQKVAAAYD 
Sbjct  132  DGAVTGKAADVLAAANTAAEVALRFVRPGKKNKDVTEAIQKVAAAYDS  179



>ref|XP_009338145.1| PREDICTED: proliferation-associated protein 2G4-like, partial 
[Pyrus x bretschneideri]
Length=160

 Score =   244 bits (624),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 127/151 (84%), Positives = 147/151 (97%), Gaps = 0/151 (0%)
 Frame = +3

Query  3    ELDLTTPEVVTKYKSAAEILNKGLELVVSQCKPNAKIVDICEKGDAFIREQTGNMYKNVK  182
            ELDLT+PEVVTKYKSAAEI+NK L+LV+S+CKP AKIVD+CEKGD++IREQTGN+YKNVK
Sbjct  10   ELDLTSPEVVTKYKSAAEIINKALQLVISECKPKAKIVDLCEKGDSYIREQTGNVYKNVK  69

Query  183  KKIERGVAFPTCISVNNTVCHFSPLSNDDTVLEDGDMVKIDMGCHIDGFIAVVGHTHLLQ  362
            KKIERGVAFPTCISVNNTVCHFSPL++D++VLE+GD++KID+GCHIDGFIA+V HTH+LQ
Sbjct  70   KKIERGVAFPTCISVNNTVCHFSPLASDESVLEEGDILKIDLGCHIDGFIAIVAHTHVLQ  129

Query  363  EGPVTGRaadviaaantaaevaLRLVRPGKK  455
             GPVTGRAADVIAAANTAAEVALRLVRPG+K
Sbjct  130  AGPVTGRAADVIAAANTAAEVALRLVRPGRK  160



>ref|XP_008350687.1| PREDICTED: proliferation-associated protein 2G4-like [Malus domestica]
Length=199

 Score =   243 bits (619),  Expect = 4e-78, Method: Compositional matrix adjust.
 Identities = 127/151 (84%), Positives = 145/151 (96%), Gaps = 0/151 (0%)
 Frame = +3

Query  3    ELDLTTPEVVTKYKSAAEILNKGLELVVSQCKPNAKIVDICEKGDAFIREQTGNMYKNVK  182
            ELDLT+PEVVTKYKSAAEI+NK L+LV+S+CKP AKIVD+CEKGD++IREQTGNMYKN K
Sbjct  10   ELDLTSPEVVTKYKSAAEIVNKALQLVISECKPKAKIVDLCEKGDSYIREQTGNMYKNAK  69

Query  183  KKIERGVAFPTCISVNNTVCHFSPLSNDDTVLEDGDMVKIDMGCHIDGFIAVVGHTHLLQ  362
            KKIERGVAFPTCISVNNTVCHFSPL +D++VLE+GD++KID+GCHIDGFIA+V HTH+LQ
Sbjct  70   KKIERGVAFPTCISVNNTVCHFSPLGSDESVLEEGDILKIDLGCHIDGFIAIVAHTHVLQ  129

Query  363  EGPVTGRaadviaaantaaevaLRLVRPGKK  455
             GPVTGRAADVIAAANTAAEVALRLVRPG+K
Sbjct  130  AGPVTGRAADVIAAANTAAEVALRLVRPGRK  160



>ref|XP_010092793.1| Proliferation-associated protein 2G4 [Morus notabilis]
 gb|EXB52379.1| Proliferation-associated protein 2G4 [Morus notabilis]
Length=424

 Score =   250 bits (638),  Expect = 4e-78, Method: Compositional matrix adjust.
 Identities = 144/198 (73%), Positives = 162/198 (82%), Gaps = 29/198 (15%)
 Frame = +3

Query  3    ELDLTTPEVVTKYKSAAEILN--------------KGLELVVSQCKPNAKIVDICEKGDA  140
            ELDLT+PEVVTKYKSAAEI+N              + L+LV+S+CKP AKIVD+CEKGD+
Sbjct  10   ELDLTSPEVVTKYKSAAEIVNSIFVVYNLGIGKNEEALQLVLSECKPKAKIVDLCEKGDS  69

Query  141  FIREQTGNMYKNVKKKIERGVAFPTCISVNNTVCHFSPLSNDDTVLEDGDMVKIDMGCHI  320
            +IREQTGNMYKNVKKKIERGVAFPTC+SVNNTVCHFSPL++D++VLEDGD+VKIDMGCHI
Sbjct  70   YIREQTGNMYKNVKKKIERGVAFPTCVSVNNTVCHFSPLASDESVLEDGDIVKIDMGCHI  129

Query  321  DGFIAVVGHTHLLQEGPVTGRaadviaaantaaevaLR---LVRPGK------------K  455
            DGFIA+V HTH+LQEGPVTGRAADVIAAANTAAEVALR   LV   K            +
Sbjct  130  DGFIAIVAHTHVLQEGPVTGRAADVIAAANTAAEVALRLHILVVSEKLRVEIWFDGNFAE  189

Query  456  NSDVTEAIQKVAAAYDCK  509
            N DVTEAIQKVAAAYDCK
Sbjct  190  NKDVTEAIQKVAAAYDCK  207



>ref|XP_001779761.1| predicted protein [Physcomitrella patens]
 gb|EDQ55445.1| predicted protein [Physcomitrella patens]
Length=399

 Score =   247 bits (631),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 129/169 (76%), Positives = 152/169 (90%), Gaps = 0/169 (0%)
 Frame = +3

Query  3    ELDLTTPEVVTKYKSAAEILNKGLELVVSQCKPNAKIVDICEKGDAFIREQTGNMYKNVK  182
            ELDLT+P+VVTKYK AAE+ NK L+ V++ CKP AKIVD+CEKGD+ IR+ T  MYKN K
Sbjct  11   ELDLTSPDVVTKYKCAAEVANKALQAVLADCKPGAKIVDLCEKGDSSIRDLTALMYKNSK  70

Query  183  KKIERGVAFPTCISVNNTVCHFSPLSNDDTVLEDGDMVKIDMGCHIDGFIAVVGHTHLLQ  362
            KKI++GVAFPTC+SVNNTVCHFSPL++D++VL   D+VKID+GCH+DGFIAVV HTH+L 
Sbjct  71   KKIDKGVAFPTCVSVNNTVCHFSPLASDESVLAANDIVKIDLGCHVDGFIAVVAHTHVLS  130

Query  363  EGPVTGRaadviaaantaaevaLRLVRPGKKNSDVTEAIQKVAAAYDCK  509
            EGPVTGRAADV+AAA+TAAEVALRLVRPGKKN DVT+AIQKVAAAYDCK
Sbjct  131  EGPVTGRAADVLAAAHTAAEVALRLVRPGKKNKDVTDAIQKVAAAYDCK  179



>gb|EEE63363.1| hypothetical protein OsJ_18175 [Oryza sativa Japonica Group]
Length=368

 Score =   242 bits (618),  Expect = 9e-76, Method: Compositional matrix adjust.
 Identities = 132/169 (78%), Positives = 149/169 (88%), Gaps = 7/169 (4%)
 Frame = +3

Query  3    ELDLTTPEVVTKYKSAAEILNKGLELVVSQCKPNAKIVDICEKGDAFIREQTGNMYKNVK  182
            ELDL++ +VVTKYK AA+I+N  L+LVVS CKP AKIVDICEK       QTGN+YKNVK
Sbjct  12   ELDLSSSDVVTKYKDAADIINNALKLVVSLCKPKAKIVDICEK-------QTGNIYKNVK  64

Query  183  KKIERGVAFPTCISVNNTVCHFSPLSNDDTVLEDGDMVKIDMGCHIDGFIAVVGHTHLLQ  362
            +KIERGVAFPTC+SVNNTVCHFSPL+ D+ VLE+ DMVKIDMGCHIDGFIAVV HTH++ 
Sbjct  65   RKIERGVAFPTCVSVNNTVCHFSPLATDEAVLEENDMVKIDMGCHIDGFIAVVAHTHVIH  124

Query  363  EGPVTGRaadviaaantaaevaLRLVRPGKKNSDVTEAIQKVAAAYDCK  509
            +G VTG+AADV+AAANTAAEVALRLVRPGKKN DVTEAIQKVAAAYDCK
Sbjct  125  DGAVTGKAADVLAAANTAAEVALRLVRPGKKNKDVTEAIQKVAAAYDCK  173



>ref|XP_008656355.1| PREDICTED: proliferation-associated protein A-like [Zea mays]
Length=188

 Score =   234 bits (598),  Expect = 5e-75, Method: Compositional matrix adjust.
 Identities = 125/166 (75%), Positives = 148/166 (89%), Gaps = 1/166 (1%)
 Frame = +3

Query  3    ELDLTTPEVVTKYKSAAEILNKGLELVVSQCKPNAKIVDICEKGDAFIREQTGNMYKNVK  182
            ELDL++ +VVTKYK+AAEILN  L+LVVS+CKP AKIVD+CEKGD+FIREQTGN+YKN K
Sbjct  12   ELDLSSNDVVTKYKTAAEILNNALKLVVSECKPKAKIVDLCEKGDSFIREQTGNVYKNAK  71

Query  183  KKIERGVAFPTCISVNNTVCHFSPLSNDDTVLEDGDMVKIDMGCHIDGFIAVVGHTHLLQ  362
            +KIERG+AFPTC+SVNNTVCHFSPL+ DD VLE+ DMVKIDMGCHIDG IAVV HTH++ 
Sbjct  72   RKIERGIAFPTCVSVNNTVCHFSPLTTDDAVLEENDMVKIDMGCHIDGXIAVVAHTHVIA  131

Query  363  EGPVTGRaadviaaantaaevaLRLVRPGKKNSDVTEAIQKVAAAY  500
             GPVTGRAADV+AAANTAAEVA+RLVRPGKKN  V+ A+ + + +Y
Sbjct  132  NGPVTGRAADVLAAANTAAEVAMRLVRPGKKNK-VSPALGRGSPSY  176



>ref|XP_002963479.1| hypothetical protein SELMODRAFT_79780 [Selaginella moellendorffii]
 gb|EFJ35350.1| hypothetical protein SELMODRAFT_79780 [Selaginella moellendorffii]
Length=371

 Score =   240 bits (613),  Expect = 6e-75, Method: Compositional matrix adjust.
 Identities = 122/169 (72%), Positives = 153/169 (91%), Gaps = 0/169 (0%)
 Frame = +3

Query  3    ELDLTTPEVVTKYKSAAEILNKGLELVVSQCKPNAKIVDICEKGDAFIREQTGNMYKNVK  182
            ELDL++ +VVTKYK AAEI+NK L+ V+++CK   K+V++C++GD++I+ QT ++YKN K
Sbjct  11   ELDLSSADVVTKYKLAAEIVNKALQAVLAECKAGTKVVELCDRGDSYIKTQTASVYKNAK  70

Query  183  KKIERGVAFPTCISVNNTVCHFSPLSNDDTVLEDGDMVKIDMGCHIDGFIAVVGHTHLLQ  362
            KKI++GVAFPTC+S+NNTVCHFSPL+ D+T L +GD+VKID+GCHIDGF+AVV HTH+LQ
Sbjct  71   KKIDKGVAFPTCVSLNNTVCHFSPLAGDETALSEGDIVKIDLGCHIDGFVAVVAHTHVLQ  130

Query  363  EGPVTGRaadviaaantaaevaLRLVRPGKKNSDVTEAIQKVAAAYDCK  509
            EGPVTGRAADV+AAANTAAEVALRLVRPGKK  DV+EAIQKVAAAYDCK
Sbjct  131  EGPVTGRAADVLAAANTAAEVALRLVRPGKKTRDVSEAIQKVAAAYDCK  179



>ref|XP_002988189.1| hypothetical protein SELMODRAFT_127648 [Selaginella moellendorffii]
 gb|EFJ10608.1| hypothetical protein SELMODRAFT_127648 [Selaginella moellendorffii]
Length=371

 Score =   240 bits (613),  Expect = 6e-75, Method: Compositional matrix adjust.
 Identities = 122/169 (72%), Positives = 153/169 (91%), Gaps = 0/169 (0%)
 Frame = +3

Query  3    ELDLTTPEVVTKYKSAAEILNKGLELVVSQCKPNAKIVDICEKGDAFIREQTGNMYKNVK  182
            ELDL++ +VVTKYK AAEI+NK L+ V+++CK   K+V++C++GD++I+ QT ++YKN K
Sbjct  11   ELDLSSADVVTKYKLAAEIVNKALQAVLAECKAGTKVVELCDRGDSYIKTQTASVYKNAK  70

Query  183  KKIERGVAFPTCISVNNTVCHFSPLSNDDTVLEDGDMVKIDMGCHIDGFIAVVGHTHLLQ  362
            KKI++GVAFPTC+S+NNTVCHFSPL+ D+T L +GD+VKID+GCHIDGF+AVV HTH+LQ
Sbjct  71   KKIDKGVAFPTCVSLNNTVCHFSPLAGDETALSEGDIVKIDLGCHIDGFVAVVAHTHVLQ  130

Query  363  EGPVTGRaadviaaantaaevaLRLVRPGKKNSDVTEAIQKVAAAYDCK  509
            EGPVTGRAADV+AAANTAAEVALRLVRPGKK  DV+EAIQKVAAAYDCK
Sbjct  131  EGPVTGRAADVLAAANTAAEVALRLVRPGKKTRDVSEAIQKVAAAYDCK  179



>ref|XP_008792832.1| PREDICTED: proliferation-associated protein 2G4 isoform X2 [Phoenix 
dactylifera]
Length=376

 Score =   240 bits (612),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 127/154 (82%), Positives = 141/154 (92%), Gaps = 0/154 (0%)
 Frame = +3

Query  48   AAEILNKGLELVVSQCKPNAKIVDICEKGDAFIREQTGNMYKNVKKKIERGVAFPTCISV  227
            +  +  + L LV+S+CKP AKI DICEKGDAFI+EQ+GN+YKNVKKKIERGVAFPTCISV
Sbjct  5    STSVTPRSLTLVISECKPKAKIADICEKGDAFIKEQSGNVYKNVKKKIERGVAFPTCISV  64

Query  228  NNTVCHFSPLSNDDTVLEDGDMVKIDMGCHIDGFIAVVGHTHLLQEGPVTGRaadviaaa  407
            NNTVCHFSPLS+D+TVLE+ D+VKIDMGCHIDGFIAVV HTH+L EGP+TGRAADVIAAA
Sbjct  65   NNTVCHFSPLSSDETVLEENDVVKIDMGCHIDGFIAVVAHTHVLHEGPITGRAADVIAAA  124

Query  408  ntaaevaLRLVRPGKKNSDVTEAIQKVAAAYDCK  509
            NTAAEVALRLVRPGKKN DVTEAIQKV AAYDCK
Sbjct  125  NTAAEVALRLVRPGKKNKDVTEAIQKVVAAYDCK  158



>ref|XP_010920806.1| PREDICTED: proliferation-associated protein 2G4 isoform X2 [Elaeis 
guineensis]
 ref|XP_010920807.1| PREDICTED: proliferation-associated protein 2G4 isoform X2 [Elaeis 
guineensis]
Length=406

 Score =   240 bits (613),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 127/148 (86%), Positives = 139/148 (94%), Gaps = 0/148 (0%)
 Frame = +3

Query  66   KGLELVVSQCKPNAKIVDICEKGDAFIREQTGNMYKNVKKKIERGVAFPTCISVNNTVCH  245
            K L+LVVS+CKP AKIVDICEKGD FI+EQ+GN+YKNVKKKIERGVAFPTCISVNNTVCH
Sbjct  7    KALQLVVSECKPKAKIVDICEKGDTFIKEQSGNVYKNVKKKIERGVAFPTCISVNNTVCH  66

Query  246  FSPLSNDDTVLEDGDMVKIDMGCHIDGFIAVVGHTHLLQEGPVTGRaadviaaantaaev  425
            FSPLS D+ VLE+ D+VKIDMGCHIDGFIAVV HTH+LQEGP+TGRAADVIAAANTAA+V
Sbjct  67   FSPLSGDEAVLEENDVVKIDMGCHIDGFIAVVAHTHVLQEGPITGRAADVIAAANTAADV  126

Query  426  aLRLVRPGKKNSDVTEAIQKVAAAYDCK  509
            ALRLVRPG+KN DVTEAIQKVA AYDCK
Sbjct  127  ALRLVRPGRKNKDVTEAIQKVAGAYDCK  154



>ref|XP_001769950.1| predicted protein [Physcomitrella patens]
 gb|EDQ65310.1| predicted protein [Physcomitrella patens]
Length=394

 Score =   240 bits (612),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 125/169 (74%), Positives = 147/169 (87%), Gaps = 0/169 (0%)
 Frame = +3

Query  3    ELDLTTPEVVTKYKSAAEILNKGLELVVSQCKPNAKIVDICEKGDAFIREQTGNMYKNVK  182
            ELDLT+P+VVTKYK AAE+ NK L+ V++ C P  KIVD+CEKGD+ IR+ T  MYKN K
Sbjct  11   ELDLTSPDVVTKYKCAAEVANKALQAVLAACAPGFKIVDLCEKGDSVIRDLTAGMYKNFK  70

Query  183  KKIERGVAFPTCISVNNTVCHFSPLSNDDTVLEDGDMVKIDMGCHIDGFIAVVGHTHLLQ  362
            KKI+RGVAFPTC+SVNNTVCHFSPL+ D++ L   D+VKI +GCH+DGF+AVV HTH+L 
Sbjct  71   KKIDRGVAFPTCVSVNNTVCHFSPLAGDESTLAANDLVKIHLGCHVDGFVAVVAHTHVLC  130

Query  363  EGPVTGRaadviaaantaaevaLRLVRPGKKNSDVTEAIQKVAAAYDCK  509
            EGP+TGRAADV+AAA+TAAEVALRLVRPGKKN DVTEAIQKVAAAYDCK
Sbjct  131  EGPITGRAADVLAAAHTAAEVALRLVRPGKKNKDVTEAIQKVAAAYDCK  179



>ref|XP_009799003.1| PREDICTED: LOW QUALITY PROTEIN: proliferation-associated protein 
2G4-like [Nicotiana sylvestris]
Length=361

 Score =   234 bits (597),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 124/146 (85%), Positives = 139/146 (95%), Gaps = 0/146 (0%)
 Frame = +3

Query  72   LELVVSQCKPNAKIVDICEKGDAFIREQTGNMYKNVKKKIERGVAFPTCISVNNTVCHFS  251
            ++LVVS+CK  AKIVD+CEKGDAFI+EQTGN+YKNVKKKIERGVAFPTCISVNNTVCHF 
Sbjct  1    MQLVVSECKTKAKIVDLCEKGDAFIKEQTGNIYKNVKKKIERGVAFPTCISVNNTVCHFX  60

Query  252  PLSNDDTVLEDGDMVKIDMGCHIDGFIAVVGHTHLLQEGPVTGRaadviaaantaaevaL  431
            PLS+D+TVLE+GDMVKIDMGCHIDGFIAVV HTH++Q GP TGRAADV+AAANTAAEVA+
Sbjct  61   PLSSDETVLEEGDMVKIDMGCHIDGFIAVVAHTHVIQGGPATGRAADVVAAANTAAEVAV  120

Query  432  RLVRPGKKNSDVTEAIQKVAAAYDCK  509
            RLV+PG+K SDVTEAIQKVAAAYDCK
Sbjct  121  RLVKPGRKKSDVTEAIQKVAAAYDCK  146



>gb|KJB36945.1| hypothetical protein B456_006G183700 [Gossypium raimondii]
Length=371

 Score =   230 bits (586),  Expect = 8e-71, Method: Compositional matrix adjust.
 Identities = 122/148 (82%), Positives = 135/148 (91%), Gaps = 0/148 (0%)
 Frame = +3

Query  66   KGLELVVSQCKPNAKIVDICEKGDAFIREQTGNMYKNVKKKIERGVAFPTCISVNNTVCH  245
            + L+LVV +CKP  KIVDICEKGDAFIREQTGNMYKN K+KIERGVAFPTC+SVNNTVCH
Sbjct  10   EALQLVVKECKPKTKIVDICEKGDAFIREQTGNMYKNAKRKIERGVAFPTCLSVNNTVCH  69

Query  246  FSPLSNDDTVLEDGDMVKIDMGCHIDGFIAVVGHTHLLQEGPVTGRaadviaaantaaev  425
            FSPL++D + L++GDMVKIDMGCHIDGFIAVV HTH++QEG V  R ADVIAAANTAAEV
Sbjct  70   FSPLASDTSELQEGDMVKIDMGCHIDGFIAVVAHTHVVQEGLVNDRKADVIAAANTAAEV  129

Query  426  aLRLVRPGKKNSDVTEAIQKVAAAYDCK  509
            ALRLVRPGKKN DVT+AIQKVAAAYDCK
Sbjct  130  ALRLVRPGKKNKDVTDAIQKVAAAYDCK  157



>ref|XP_004148633.1| PREDICTED: LOW QUALITY PROTEIN: proliferation-associated protein 
2G4-like [Cucumis sativus]
Length=296

 Score =   202 bits (513),  Expect = 8e-61, Method: Compositional matrix adjust.
 Identities = 118/169 (70%), Positives = 132/169 (78%), Gaps = 26/169 (15%)
 Frame = +3

Query  3    ELDLTTPEVVTKYKSAAEILNKGLELVVSQCKPNAKIVDICEKGDAFIREQTGNMYKNVK  182
            ELDL++P VVTKYK+AAEI+NK L+LV+SQCKP AKIVDICE GD+F  EQT N+YKNVK
Sbjct  11   ELDLSSPGVVTKYKNAAEIINKALQLVISQCKPKAKIVDICEIGDSFTXEQTVNIYKNVK  70

Query  183  KKIERGVAFPTCISVNNTVCHFSPLSNDDTVLEDGDMVKIDMGCHIDGFIAVVGHTHLLQ  362
            K                          D+TV+E+GD++KIDMGCHIDGFIAVV HTH+LQ
Sbjct  71   K--------------------------DETVMEEGDILKIDMGCHIDGFIAVVLHTHVLQ  104

Query  363  EGPVTGRaadviaaantaaevaLRLVRPGKKNSDVTEAIQKVAAAYDCK  509
            EGPVTGRAADVIAAANTAAEV L LVRPGKKN DVTEAIQKVAAAYDCK
Sbjct  105  EGPVTGRAADVIAAANTAAEVTLMLVRPGKKNKDVTEAIQKVAAAYDCK  153



>ref|XP_001765994.1| predicted protein [Physcomitrella patens]
 gb|EDQ69315.1| predicted protein [Physcomitrella patens]
Length=378

 Score =   198 bits (503),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 116/176 (66%), Positives = 137/176 (78%), Gaps = 21/176 (12%)
 Frame = +3

Query  3    ELDLTTPEVVTKYKSAAEILNKGLELVVSQCKPNAKIVDICEKGDAFIREQ---TGN---  164
            E DL +P+VVTKYK AAE+              N KIVD+CEKGD+ IREQ   TG+   
Sbjct  11   EPDLRSPDVVTKYKCAAEV-------------ANTKIVDLCEKGDSLIREQKLFTGSQIA  57

Query  165  -MYKNVKKKIERGVAFPTCISVNNTVCHFSPLSNDDTVLEDGDMVKIDMGCHIDGFIAVV  341
             +YKN KKKI++GVAFPTC+SVNNTVCHFSPL++D++VL   D+ K  +GCH+DGF AVV
Sbjct  58   LIYKNSKKKIDKGVAFPTCVSVNNTVCHFSPLASDESVLAANDIAKY-IGCHVDGFTAVV  116

Query  342  GHTHLLQEGPVTGRaadviaaantaaevaLRLVRPGKKNSDVTEAIQKVAAAYDCK  509
             HTH+L EGPVTG AADV+AAA+TA EVALRLVRPGKKN DVTEAIQKVA+AYDCK
Sbjct  117  AHTHVLSEGPVTGCAADVLAAAHTAVEVALRLVRPGKKNKDVTEAIQKVASAYDCK  172



>ref|XP_008366899.1| PREDICTED: proliferation-associated protein 2G4-like [Malus domestica]
Length=352

 Score =   196 bits (498),  Expect = 5e-58, Method: Compositional matrix adjust.
 Identities = 102/169 (60%), Positives = 118/169 (70%), Gaps = 43/169 (25%)
 Frame = +3

Query  3    ELDLTTPEVVTKYKSAAEILNKGLELVVSQCKPNAKIVDICEKGDAFIREQTGNMYKNVK  182
            ELDLT+PEVVTKYKSAAEI+NK L+LV+S+CKP AKIVD+CEKGD++IREQTGNMYKN K
Sbjct  10   ELDLTSPEVVTKYKSAAEIVNKALQLVISECKPKAKIVDLCEKGDSYIREQTGNMYKNAK  69

Query  183  KKIERGVAFPTCISVNNTVCHFSPLSNDDTVLEDGDMVKIDMGCHIDGFIAVVGHTHLLQ  362
            KKIERGVAFPTCISVNNTVCHFSPL +D++VLE+GD++KI       G+I V+       
Sbjct  70   KKIERGVAFPTCISVNNTVCHFSPLGSDESVLEEGDILKIPT-----GYILVL-------  117

Query  363  EGPVTGRaadviaaantaaevaLRLVRPGKKNSDVTEAIQKVAAAYDCK  509
                                           N DVTEAIQKVAAAYDCK
Sbjct  118  -------------------------------NKDVTEAIQKVAAAYDCK  135



>gb|KHN22549.1| Proliferation-associated protein 2G4 [Glycine soja]
Length=327

 Score =   190 bits (482),  Expect = 7e-56, Method: Compositional matrix adjust.
 Identities = 100/115 (87%), Positives = 110/115 (96%), Gaps = 0/115 (0%)
 Frame = +3

Query  165  MYKNVKKKIERGVAFPTCISVNNTVCHFSPLSNDDTVLEDGDMVKIDMGCHIDGFIAVVG  344
            MYKNVK+KIERGVAFPTC+SVNNTVCHFSPL++D+TVLEDGD+VKIDM CHIDGFIA V 
Sbjct  1    MYKNVKRKIERGVAFPTCVSVNNTVCHFSPLASDETVLEDGDIVKIDMACHIDGFIAAVA  60

Query  345  HTHLLQEGPVTGRaadviaaantaaevaLRLVRPGKKNSDVTEAIQKVAAAYDCK  509
            HTH+LQEGPVTGRAAD +AAANTAAEVALRLVRPG+KN DVTEAIQK+AAAYDCK
Sbjct  61   HTHVLQEGPVTGRAADALAAANTAAEVALRLVRPGRKNKDVTEAIQKIAAAYDCK  115



>ref|XP_002947167.1| hypothetical protein VOLCADRAFT_79596 [Volvox carteri f. nagariensis]
 gb|EFJ51757.1| hypothetical protein VOLCADRAFT_79596 [Volvox carteri f. nagariensis]
Length=382

 Score =   176 bits (446),  Expect = 6e-50, Method: Compositional matrix adjust.
 Identities = 99/170 (58%), Positives = 128/170 (75%), Gaps = 4/170 (2%)
 Frame = +3

Query  3    ELDLTTPEVVTKYKSAAEILNKGLELVVSQCKPNAKIVDICEKGDAFIREQTGNMYKNVK  182
            E +L+ PEVVTKYK+AA+I N+ L+ V+  CK  +KIVD+C  GD FI ++ GN+YK   
Sbjct  12   EPNLSVPEVVTKYKAAADICNRALQAVIDGCKDGSKIVDLCRTGDNFITKECGNIYKG--  69

Query  183  KKIERGVAFPTCISVNNTVCHFSPLSNDDTVLEDGDMVKIDMGCHIDGFIAVVGHTHLLQ  362
            K+IE+GVAFPTC+SVN+ V HFSP ++D + L+ GD+VK DMGCHIDGFIA    T ++Q
Sbjct  70   KQIEKGVAFPTCVSVNSVVGHFSPNADDTSALKAGDVVKFDMGCHIDGFIATQATTVVVQ  129

Query  363  EG--PVTGRaadviaaantaaevaLRLVRPGKKNSDVTEAIQKVAAAYDC  506
             G  P+TGRAADVIAAA TA + A+RL+RPGK  SDV   +QK+A AY C
Sbjct  130  AGEVPITGRAADVIAAARTAFDAAVRLIRPGKHISDVAGPLQKIAEAYGC  179



>ref|XP_001699126.1| hypothetical protein CHLREDRAFT_139416 [Chlamydomonas reinhardtii]
 gb|EDO98981.1| predicted protein [Chlamydomonas reinhardtii]
Length=387

 Score =   166 bits (420),  Expect = 4e-46, Method: Compositional matrix adjust.
 Identities = 93/168 (55%), Positives = 124/168 (74%), Gaps = 2/168 (1%)
 Frame = +3

Query  3    ELDLTTPEVVTKYKSAAEILNKGLELVVSQCKPNAKIVDICEKGDAFIREQTGNMYKNVK  182
            E +L+ PEVVTKYK+AA+I N+ L  VV   K  AK+VD+C  GD FI ++  N+YK   
Sbjct  11   EPNLSVPEVVTKYKAAADICNRALLAVVEAAKDGAKVVDLCRMGDQFINKECANIYKG--  68

Query  183  KKIERGVAFPTCISVNNTVCHFSPLSNDDTVLEDGDMVKIDMGCHIDGFIAVVGHTHLLQ  362
            K+IE+GVAFPTC+S N+ V HFSP S D T L++GD+VKIDMGCHIDGFIA    T ++ 
Sbjct  69   KEIEKGVAFPTCVSANSIVGHFSPNSEDATALKNGDVVKIDMGCHIDGFIATQATTIVVG  128

Query  363  EGPVTGRaadviaaantaaevaLRLVRPGKKNSDVTEAIQKVAAAYDC  506
            +  ++G+AADVIAAA TA + A+RL+RPGK  +DV+  +QKVA ++ C
Sbjct  129  DAAISGKAADVIAAARTAFDAAVRLIRPGKHIADVSAPLQKVAESFGC  176



>ref|XP_007253393.1| PREDICTED: proliferation-associated protein 2G4-like [Astyanax 
mexicanus]
Length=392

 Score =   166 bits (420),  Expect = 5e-46, Method: Compositional matrix adjust.
 Identities = 86/164 (52%), Positives = 122/164 (74%), Gaps = 5/164 (3%)
 Frame = +3

Query  27   VVTKYKSAAEILNKGLELVVSQCKPNAKIVDICEKGDAFIREQTGNMYKNVKKKIERGVA  206
            VVTKYK + +I N+ L+LV+   KP   ++ +CEKGDA+I  +TG ++K  +K +++G+A
Sbjct  16   VVTKYKMSGDIANQALKLVIEAAKPGVSVLSLCEKGDAYIMAETGKVFKR-EKDMKKGIA  74

Query  207  FPTCISVNNTVCHFSPLSND-DTVLEDGDMVKIDMGCHIDGFIAVVGHTHLL---QEGPV  374
            FPTC+SVNN VCHFSPL +D D  L+DGD+VKID+G H+DGFIA V H+ ++   +E PV
Sbjct  75   FPTCVSVNNCVCHFSPLKSDPDYTLKDGDLVKIDLGVHVDGFIANVAHSFVIGASKEAPV  134

Query  375  TGRaadviaaantaaevaLRLVRPGKKNSDVTEAIQKVAAAYDC  506
            TG+ ADV+ AA   AE ALRLV+PG +N+ +TEA  K+A ++ C
Sbjct  135  TGKKADVVKAAYLCAEAALRLVKPGNQNTQITEAWNKIAHSFKC  178



>ref|XP_002423336.1| Proliferation-associated protein 2G4, putative [Pediculus humanus 
corporis]
 gb|EEB10598.1| Proliferation-associated protein 2G4, putative [Pediculus humanus 
corporis]
Length=389

 Score =   165 bits (418),  Expect = 8e-46, Method: Compositional matrix adjust.
 Identities = 89/165 (54%), Positives = 126/165 (76%), Gaps = 5/165 (3%)
 Frame = +3

Query  27   VVTKYKSAAEILNKGLELVVSQCKPNAKIVDICEKGDAFIREQTGNMYKNVKKKIERGVA  206
            VVTKYK A EI+N+ L+ V+ +C+PNA +  ICE GD+ I E+T  ++K  +K++++G+A
Sbjct  16   VVTKYKLAGEIVNRVLKQVIDKCQPNASVRQICESGDSLILEETNKVFKK-EKELKKGIA  74

Query  207  FPTCISVNNTVCHFSPLSND-DTVLEDGDMVKIDMGCHIDGFIAVVGHTHLL---QEGPV  374
            FPTCISVNN +CHFSP+ ND D +L+DGD+VKID+G HIDGFIAVV H+ +L    E  V
Sbjct  75   FPTCISVNNCICHFSPIPNDPDVILQDGDLVKIDLGAHIDGFIAVVAHSLILGASAENKV  134

Query  375  TGRaadviaaantaaevaLRLVRPGKKNSDVTEAIQKVAAAYDCK  509
             G+ ADVI AA+ A++VALRL++PG +   +T+A+QKV  ++ CK
Sbjct  135  EGKKADVIVAAHYASQVALRLLKPGNETYMITDAVQKVCESFKCK  179



>ref|NP_001002070.1| proliferation-associated 2G4, a [Danio rerio]
 emb|CAD58759.1| novel protein similar to human proliferation-associated 2G4 protein 
(PA2G4) [Danio rerio]
 gb|AAH71407.1| Proliferation-associated 2G4, a [Danio rerio]
Length=392

 Score =   164 bits (416),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 87/164 (53%), Positives = 121/164 (74%), Gaps = 5/164 (3%)
 Frame = +3

Query  27   VVTKYKSAAEILNKGLELVVSQCKPNAKIVDICEKGDAFIREQTGNMYKNVKKKIERGVA  206
            VVTKYK   +I N+ L  V+   KP   ++ +C+KGDAFI  +TG ++K  +K +++G+A
Sbjct  16   VVTKYKMGGDIANQALRAVIEAAKPGVSVLSLCQKGDAFIMAETGKIFKR-EKDMKKGIA  74

Query  207  FPTCISVNNTVCHFSPLSND-DTVLEDGDMVKIDMGCHIDGFIAVVGHTHLL---QEGPV  374
            FPTC+SVNN VCHFSPL +D D +L+DGD+VKID+G H+DGFI+ V H+ ++   +E PV
Sbjct  75   FPTCVSVNNCVCHFSPLKSDPDYMLKDGDLVKIDLGVHVDGFISNVAHSFVIGATKEAPV  134

Query  375  TGRaadviaaantaaevaLRLVRPGKKNSDVTEAIQKVAAAYDC  506
            TGR ADVI AA+  AE ALRLV+PG +N+ VTEA  K+A ++ C
Sbjct  135  TGRKADVIKAAHLCAEAALRLVKPGNQNTQVTEAWNKIAHSFKC  178



>ref|XP_008294311.1| PREDICTED: proliferation-associated protein 2G4 [Stegastes partitus]
Length=391

 Score =   164 bits (416),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 87/164 (53%), Positives = 121/164 (74%), Gaps = 5/164 (3%)
 Frame = +3

Query  27   VVTKYKSAAEILNKGLELVVSQCKPNAKIVDICEKGDAFIREQTGNMYKNVKKKIERGVA  206
            VVTKYK   +I N+ L LVV   KP   ++ +CEKGDA+I  +TG ++K  +K++++G+A
Sbjct  15   VVTKYKMGGDIANQALRLVVETAKPGVSVLSLCEKGDAYIMAETGKVFKK-EKEMKKGIA  73

Query  207  FPTCISVNNTVCHFSPLSND-DTVLEDGDMVKIDMGCHIDGFIAVVGHTHLL---QEGPV  374
            FPT +SVNN VCHFSPL +D D  L+DGD+VKID+G H+DGFIA V H+ ++   +E P+
Sbjct  74   FPTSVSVNNCVCHFSPLKSDPDYTLKDGDLVKIDLGVHVDGFIANVAHSFVVGASKENPI  133

Query  375  TGRaadviaaantaaevaLRLVRPGKKNSDVTEAIQKVAAAYDC  506
            TGR ADV+ AA+  AE ALRLV+PG +N+ VTEA  K+A ++ C
Sbjct  134  TGRKADVVKAAHLCAEAALRLVKPGNQNTQVTEAWNKIAQSFKC  177



>ref|XP_003441515.1| PREDICTED: proliferation-associated protein 2G4-like [Oreochromis 
niloticus]
Length=391

 Score =   164 bits (416),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 88/164 (54%), Positives = 121/164 (74%), Gaps = 5/164 (3%)
 Frame = +3

Query  27   VVTKYKSAAEILNKGLELVVSQCKPNAKIVDICEKGDAFIREQTGNMYKNVKKKIERGVA  206
            VVTKYK   +I N+ L LV+   KP   ++ +CEKGDA+I  +TG ++K  +K++++G+A
Sbjct  15   VVTKYKMGGDIANQALRLVMEAAKPGVSVLSLCEKGDAYIMAETGKVFKK-EKEMKKGIA  73

Query  207  FPTCISVNNTVCHFSPLSND-DTVLEDGDMVKIDMGCHIDGFIAVVGHTHLL---QEGPV  374
            FPT +SVNN VCHFSPL +D D  L+DGD+VKID+G H+DGFIA V H+ ++   +E PV
Sbjct  74   FPTSVSVNNCVCHFSPLKSDPDYTLKDGDLVKIDLGVHVDGFIANVAHSFIVGASKENPV  133

Query  375  TGRaadviaaantaaevaLRLVRPGKKNSDVTEAIQKVAAAYDC  506
            TGR ADVI AA+  AE ALRLV+PG +N+ VTEA  K+A ++ C
Sbjct  134  TGRKADVIKAAHLCAEAALRLVKPGNQNTQVTEAWNKIAQSFKC  177



>ref|XP_010747198.1| PREDICTED: proliferation-associated protein 2G4 [Larimichthys 
crocea]
Length=391

 Score =   164 bits (415),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 88/164 (54%), Positives = 121/164 (74%), Gaps = 5/164 (3%)
 Frame = +3

Query  27   VVTKYKSAAEILNKGLELVVSQCKPNAKIVDICEKGDAFIREQTGNMYKNVKKKIERGVA  206
            VVTKYK   +I N+ L LVV   KP   ++ +CEKGDA+I  +TG ++K  +K++++G+A
Sbjct  15   VVTKYKMGGDIANQALRLVVETAKPGVSVLSLCEKGDAYIMAETGKVFKK-EKEMKKGIA  73

Query  207  FPTCISVNNTVCHFSPLSND-DTVLEDGDMVKIDMGCHIDGFIAVVGHTHLL---QEGPV  374
            FPT +SVNN VCHFSPL +D D  L+DGD+VKID+G H+DGFIA V H+ ++   +E P+
Sbjct  74   FPTSVSVNNCVCHFSPLKSDPDYTLKDGDLVKIDLGVHVDGFIANVAHSFVVGASKENPI  133

Query  375  TGRaadviaaantaaevaLRLVRPGKKNSDVTEAIQKVAAAYDC  506
            TGR ADVI AA+  AE ALRLV+PG +N+ VTEA  K+A ++ C
Sbjct  134  TGRKADVIKAAHLCAEAALRLVKPGNQNTQVTEAWNKIAQSFKC  177



>gb|ADX97052.1| proliferation-associated protein 2g4, partial [Perca flavescens]
Length=391

 Score =   164 bits (414),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 88/164 (54%), Positives = 121/164 (74%), Gaps = 5/164 (3%)
 Frame = +3

Query  27   VVTKYKSAAEILNKGLELVVSQCKPNAKIVDICEKGDAFIREQTGNMYKNVKKKIERGVA  206
            VVTKYK   +I N+ L LVV   KP   ++ +CEKGDA+I  +TG ++K  +K++++G+A
Sbjct  15   VVTKYKMGGDIANQALRLVVETAKPGVSVLSLCEKGDAYIMAETGKVFKK-EKEMKKGIA  73

Query  207  FPTCISVNNTVCHFSPLSND-DTVLEDGDMVKIDMGCHIDGFIAVVGHTHLL---QEGPV  374
            FPT +SVNN VCHFSPL +D D  L+DGD+VKID+G H+DGFIA V H+ ++   +E P+
Sbjct  74   FPTSVSVNNCVCHFSPLKSDPDYALKDGDLVKIDLGVHVDGFIANVAHSFVVGASKENPI  133

Query  375  TGRaadviaaantaaevaLRLVRPGKKNSDVTEAIQKVAAAYDC  506
            TGR ADVI AA+  AE ALRLV+PG +N+ VTEA  K+A ++ C
Sbjct  134  TGRKADVIKAAHLCAEAALRLVKPGNQNNQVTEAWNKIAQSFKC  177



>ref|XP_003448224.1| PREDICTED: proliferation-associated protein 2G4-like [Oreochromis 
niloticus]
Length=392

 Score =   164 bits (414),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 87/164 (53%), Positives = 123/164 (75%), Gaps = 5/164 (3%)
 Frame = +3

Query  27   VVTKYKSAAEILNKGLELVVSQCKPNAKIVDICEKGDAFIREQTGNMYKNVKKKIERGVA  206
            VVTKYK  AEI N+ L+ VV   K    ++ +CEKGDAFI  +TG ++K  +K++++G+A
Sbjct  17   VVTKYKMGAEIANQALKAVVEAAKAGVSVLSLCEKGDAFIAAETGKIFKR-EKEMKKGIA  75

Query  207  FPTCISVNNTVCHFSPLSND-DTVLEDGDMVKIDMGCHIDGFIAVVGHTHLL---QEGPV  374
            FPTC+SVNN VCHFSPL +D + +L+DGD+VKID+G H+DGFI+ V H+ ++   ++ P+
Sbjct  76   FPTCVSVNNCVCHFSPLKSDPEIILKDGDLVKIDLGVHVDGFISNVAHSFVVGVTKDNPL  135

Query  375  TGRaadviaaantaaevaLRLVRPGKKNSDVTEAIQKVAAAYDC  506
            TGR ADVI AA+  AE ALRLV+PG +N+ VTEA  K+A ++ C
Sbjct  136  TGRKADVIKAAHLCAEAALRLVKPGNQNTQVTEAWNKIAKSFKC  179



>ref|XP_006807648.1| PREDICTED: proliferation-associated protein 2G4-like [Neolamprologus 
brichardi]
Length=391

 Score =   164 bits (414),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 87/164 (53%), Positives = 121/164 (74%), Gaps = 5/164 (3%)
 Frame = +3

Query  27   VVTKYKSAAEILNKGLELVVSQCKPNAKIVDICEKGDAFIREQTGNMYKNVKKKIERGVA  206
            VVTKYK   +I N+ L LV+   KP   ++ +CEKGDA+I  +TG ++K  +K++++G+A
Sbjct  15   VVTKYKMGGDIANQALRLVMEAAKPGVSVLSLCEKGDAYIMAETGKVFKK-EKEMKKGIA  73

Query  207  FPTCISVNNTVCHFSPLSND-DTVLEDGDMVKIDMGCHIDGFIAVVGHTHLL---QEGPV  374
            FPT +SVNN VCHFSPL +D D  L+DGD+VKID+G H+DGFIA V H+ ++   +E P+
Sbjct  74   FPTSVSVNNCVCHFSPLKSDPDYTLKDGDLVKIDLGVHVDGFIANVAHSFIVGASKENPI  133

Query  375  TGRaadviaaantaaevaLRLVRPGKKNSDVTEAIQKVAAAYDC  506
            TGR ADVI AA+  AE ALRLV+PG +N+ VTEA  K+A ++ C
Sbjct  134  TGRKADVIKAAHLCAEAALRLVKPGNQNTQVTEAWNKIAQSFKC  177



>ref|XP_004558839.1| PREDICTED: proliferation-associated protein 2G4-like [Maylandia 
zebra]
 ref|XP_005732632.1| PREDICTED: proliferation-associated protein 2G4-like [Pundamilia 
nyererei]
 ref|XP_005914803.1| PREDICTED: proliferation-associated protein 2G4-like [Haplochromis 
burtoni]
 ref|XP_006785707.1| PREDICTED: proliferation-associated protein 2G4-like [Neolamprologus 
brichardi]
Length=392

 Score =   163 bits (413),  Expect = 5e-45, Method: Compositional matrix adjust.
 Identities = 87/164 (53%), Positives = 123/164 (75%), Gaps = 5/164 (3%)
 Frame = +3

Query  27   VVTKYKSAAEILNKGLELVVSQCKPNAKIVDICEKGDAFIREQTGNMYKNVKKKIERGVA  206
            VVTKYK  AEI N+ L+ VV   K    ++ +CEKGDAFI  +TG ++K  +K++++G+A
Sbjct  17   VVTKYKMGAEIANQALKAVVEAAKTGVSVLSLCEKGDAFIVAETGKIFKR-EKEMKKGIA  75

Query  207  FPTCISVNNTVCHFSPLSND-DTVLEDGDMVKIDMGCHIDGFIAVVGHTHLL---QEGPV  374
            FPTC+SVNN VCHFSPL +D + +L+DGD+VKID+G H+DGFI+ V H+ ++   ++ P+
Sbjct  76   FPTCVSVNNCVCHFSPLKSDPEVILKDGDLVKIDLGVHVDGFISNVAHSFIVGVTKDNPL  135

Query  375  TGRaadviaaantaaevaLRLVRPGKKNSDVTEAIQKVAAAYDC  506
            TGR ADVI AA+  AE ALRLV+PG +N+ VTEA  K+A ++ C
Sbjct  136  TGRKADVIKAAHLCAEAALRLVKPGNQNTQVTEAWNKIAKSFKC  179



>ref|XP_005741395.1| PREDICTED: proliferation-associated protein 2G4-like [Pundamilia 
nyererei]
 ref|XP_005944019.1| PREDICTED: proliferation-associated protein 2G4-like [Haplochromis 
burtoni]
Length=391

 Score =   163 bits (413),  Expect = 5e-45, Method: Compositional matrix adjust.
 Identities = 88/164 (54%), Positives = 121/164 (74%), Gaps = 5/164 (3%)
 Frame = +3

Query  27   VVTKYKSAAEILNKGLELVVSQCKPNAKIVDICEKGDAFIREQTGNMYKNVKKKIERGVA  206
            VVTKYK   +I N+ L LV+   KP   ++ +CEKGDA+I  +TG ++K  +K++++G+A
Sbjct  15   VVTKYKMGGDIANQALRLVMEAAKPGVSVLSLCEKGDAYIMVETGKVFKK-EKEMKKGIA  73

Query  207  FPTCISVNNTVCHFSPLSND-DTVLEDGDMVKIDMGCHIDGFIAVVGHTHLL---QEGPV  374
            FPT +SVNN VCHFSPL +D D  L+DGD+VKID+G H+DGFIA V H+ ++   +E PV
Sbjct  74   FPTSVSVNNCVCHFSPLKSDPDYTLKDGDLVKIDLGVHVDGFIANVAHSFIVGASKENPV  133

Query  375  TGRaadviaaantaaevaLRLVRPGKKNSDVTEAIQKVAAAYDC  506
            TGR ADVI AA+  AE ALRLV+PG +N+ VTEA  K+A ++ C
Sbjct  134  TGRKADVIKAAHLCAEAALRLVKPGNQNTQVTEAWNKIAQSFKC  177



>gb|KHN18040.1| Proliferation-associated protein 2G4, partial [Glycine soja]
Length=167

 Score =   157 bits (397),  Expect = 5e-45, Method: Compositional matrix adjust.
 Identities = 100/163 (61%), Positives = 118/163 (72%), Gaps = 22/163 (13%)
 Frame = +3

Query  3    ELDLTTPEVVTKYKSAAEILNKGLELVVSQCKPNAKIVDICEKGDAFIREQTGNMYKNVK  182
            ELDL++ EVVTKYK+AAEI+N    L ++   P    +        F   QTGN+YKNVK
Sbjct  2    ELDLSSAEVVTKYKTAAEIVN---SLFLTLLMPLWSQI-------LFGFWQTGNVYKNVK  51

Query  183  KKIERGVAFPTCISVNNTVCHFSPLSNDDTVLE------DGDMVKI------DMGCHIDG  326
            +KIERGVAFPTC+SVNN VCHFSPL++D+ V+E         ++ +      DM CHIDG
Sbjct  52   RKIERGVAFPTCLSVNNVVCHFSPLASDEAVMEFVVFYTTWKLMFVSLVGCSDMACHIDG  111

Query  327  FIAVVGHTHLLQEGPVTGRaadviaaantaaevaLRLVRPGKK  455
            FIA V HTH+LQEGPVTGRAADVIAAANTAAEVALRLVRPGKK
Sbjct  112  FIAAVAHTHVLQEGPVTGRAADVIAAANTAAEVALRLVRPGKK  154



>ref|XP_004544946.1| PREDICTED: proliferation-associated protein 2G4-like [Maylandia 
zebra]
Length=424

 Score =   164 bits (414),  Expect = 7e-45, Method: Compositional matrix adjust.
 Identities = 88/164 (54%), Positives = 121/164 (74%), Gaps = 5/164 (3%)
 Frame = +3

Query  27   VVTKYKSAAEILNKGLELVVSQCKPNAKIVDICEKGDAFIREQTGNMYKNVKKKIERGVA  206
            VVTKYK   +I N+ L LV+   KP   ++ +CEKGDA+I  +TG ++K  +K++++G+A
Sbjct  48   VVTKYKMGGDIANQALRLVMEAAKPGVSVLSLCEKGDAYIMVETGKVFKK-EKEMKKGIA  106

Query  207  FPTCISVNNTVCHFSPLSND-DTVLEDGDMVKIDMGCHIDGFIAVVGHTHLL---QEGPV  374
            FPT +SVNN VCHFSPL +D D  L+DGD+VKID+G H+DGFIA V H+ ++   +E PV
Sbjct  107  FPTSVSVNNCVCHFSPLKSDPDYTLKDGDLVKIDLGVHVDGFIANVAHSFIVGASKENPV  166

Query  375  TGRaadviaaantaaevaLRLVRPGKKNSDVTEAIQKVAAAYDC  506
            TGR ADVI AA+  AE ALRLV+PG +N+ VTEA  K+A ++ C
Sbjct  167  TGRKADVIKAAHLCAEAALRLVKPGNQNTQVTEAWNKIAQSFKC  210



>emb|CAG06775.1| unnamed protein product [Tetraodon nigroviridis]
Length=391

 Score =   162 bits (411),  Expect = 8e-45, Method: Compositional matrix adjust.
 Identities = 91/164 (55%), Positives = 119/164 (73%), Gaps = 5/164 (3%)
 Frame = +3

Query  27   VVTKYKSAAEILNKGLELVVSQCKPNAKIVDICEKGDAFIREQTGNMYKNVKKKIERGVA  206
            VVTKYK   +I N+ L LVV    P A ++ +CEKGDA+I  +TG ++K  +K++++G+A
Sbjct  15   VVTKYKMGGDIANQALRLVVESACPGASVLSLCEKGDAYIMAETGKVFKK-EKEMKKGIA  73

Query  207  FPTCISVNNTVCHFSPLSND-DTVLEDGDMVKIDMGCHIDGFIAVVGHTHLL---QEGPV  374
            FPT ISVNN VCHFSPL +D D  L DGD+VKID+G HIDGFIA V H+  +   +E PV
Sbjct  74   FPTSISVNNCVCHFSPLKSDPDYTLNDGDLVKIDLGVHIDGFIANVAHSFAVGASKEKPV  133

Query  375  TGRaadviaaantaaevaLRLVRPGKKNSDVTEAIQKVAAAYDC  506
            TGR ADVI AA+  AE ALRLV+PG +N+ VTEA  K+A ++ C
Sbjct  134  TGRKADVIRAAHLCAEAALRLVKPGNQNTQVTEAWNKIAQSFKC  177



>ref|XP_005311138.1| PREDICTED: LOW QUALITY PROTEIN: proliferation-associated protein 
2G4 [Chrysemys picta bellii]
Length=394

 Score =   162 bits (411),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 90/172 (52%), Positives = 124/172 (72%), Gaps = 5/172 (3%)
 Frame = +3

Query  3    ELDLTTPEVVTKYKSAAEILNKGLELVVSQCKPNAKIVDICEKGDAFIREQTGNMYKNVK  182
            EL +    VVTKYK   +I N+ L  VV   K    ++ +CEKGDA I E+TG ++K  +
Sbjct  9    ELTIAEDLVVTKYKMGGDIANRVLRAVVEAAKSGGSVLSLCEKGDAMIMEETGKIFKK-E  67

Query  183  KKIERGVAFPTCISVNNTVCHFSPLSND-DTVLEDGDMVKIDMGCHIDGFIAVVGHTHLL  359
            K++++G+AFPT ISVNN VCHFSPL +D D +L+DGD+VKID+G H+DGFIA V H+ L+
Sbjct  68   KEMKKGIAFPTSISVNNCVCHFSPLKSDQDYILKDGDLVKIDLGVHVDGFIANVAHSFLV  127

Query  360  ---QEGPVTGRaadviaaantaaevaLRLVRPGKKNSDVTEAIQKVAAAYDC  506
               +E PVTGR ADV+ AA+  AE ALRLV+PG +N+ VT+A  K+A +++C
Sbjct  128  DAAKETPVTGRKADVVKAAHLCAEAALRLVKPGNQNTQVTDAWNKIAHSFNC  179



>ref|XP_003741970.1| PREDICTED: proliferation-associated protein 2G4-like [Metaseiulus 
occidentalis]
Length=381

 Score =   162 bits (410),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 93/164 (57%), Positives = 116/164 (71%), Gaps = 5/164 (3%)
 Frame = +3

Query  27   VVTKYKSAAEILNKGLELVVSQCKPNAKIVDICEKGDAFIREQTGNMYKNVKKKIERGVA  206
            VVTKYK+A EI+N+ L  VV  CK  A ++DICE GD  + E+T  +YK   K++ +G+A
Sbjct  16   VVTKYKTAGEIVNRTLAKVVEMCKAGAVVLDICEAGDKMLLEETAGIYKK-DKELRKGIA  74

Query  207  FPTCISVNNTVCHFSPL-SNDDTVLEDGDMVKIDMGCHIDGFIAVVGHTHLL---QEGPV  374
            FPTCI VNN +CHFSPL S    VL+DGD+VKIDMG HIDGFIAVV HT ++   ++  V
Sbjct  75   FPTCICVNNCICHFSPLKSESPVVLKDGDVVKIDMGAHIDGFIAVVAHTLVIGASKDNKV  134

Query  375  TGRaadviaaantaaevaLRLVRPGKKNSDVTEAIQKVAAAYDC  506
            TG+ ADVI AA  + E ALRLV+PG +NS VTE   KV  AY C
Sbjct  135  TGKKADVILAAYKSMEAALRLVKPGGQNSKVTEITSKVCEAYKC  178



>ref|XP_005801435.1| PREDICTED: proliferation-associated protein 2G4-like [Xiphophorus 
maculatus]
Length=392

 Score =   162 bits (410),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 90/177 (51%), Positives = 124/177 (70%), Gaps = 12/177 (7%)
 Frame = +3

Query  9    DLTTPE-------VVTKYKSAAEILNKGLELVVSQCKPNAKIVDICEKGDAFIREQTGNM  167
            D  TPE       VVTKYK  AEI N+ L+ V     P   ++ +C+KGD FI  +TG +
Sbjct  4    DEETPEQTIAEDLVVTKYKMGAEIANQALKKVAEAAAPGVSVLSLCQKGDEFIAAETGKI  63

Query  168  YKNVKKKIERGVAFPTCISVNNTVCHFSPLSND-DTVLEDGDMVKIDMGCHIDGFIAVVG  344
            +K  +K +++G+AFPTC+SVNN VCHFSPL +D D +L+DGD+VKID+G H+DGFI+ V 
Sbjct  64   FKR-EKDMKKGIAFPTCVSVNNCVCHFSPLKSDPDVILKDGDLVKIDLGVHVDGFISNVA  122

Query  345  HTHLL---QEGPVTGRaadviaaantaaevaLRLVRPGKKNSDVTEAIQKVAAAYDC  506
            H+ ++   ++ PVTGR ADVI AA+  AE ALRLV+PG +N+ VTEA  K+A ++ C
Sbjct  123  HSFVVGATKDNPVTGRKADVIKAAHLCAEAALRLVKPGNQNTQVTEAWNKIAKSFKC  179



>ref|XP_004085494.1| PREDICTED: proliferation-associated protein 2G4-like [Oryzias 
latipes]
Length=391

 Score =   162 bits (410),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 88/164 (54%), Positives = 120/164 (73%), Gaps = 5/164 (3%)
 Frame = +3

Query  27   VVTKYKSAAEILNKGLELVVSQCKPNAKIVDICEKGDAFIREQTGNMYKNVKKKIERGVA  206
            VVTKYK   +I N+ L LV+   KP   ++ +CEKGDA+I  +TG ++K  +K++++G+A
Sbjct  15   VVTKYKMGGDIANQTLRLVMEAAKPGVSVISLCEKGDAYIMAETGKVFKK-EKEMKKGIA  73

Query  207  FPTCISVNNTVCHFSPLSND-DTVLEDGDMVKIDMGCHIDGFIAVVGHTHLL---QEGPV  374
            FPT ISVNN VCHFSPL +D D  L+DGD+VKID+G H+DGFIA V H+ ++   +E P 
Sbjct  74   FPTSISVNNCVCHFSPLKSDPDYTLKDGDLVKIDLGVHVDGFIANVAHSFVVGASKEQPA  133

Query  375  TGRaadviaaantaaevaLRLVRPGKKNSDVTEAIQKVAAAYDC  506
            TGR ADVI AA+  AE ALRLV+PG +N+ VTEA  K+A ++ C
Sbjct  134  TGRKADVIKAAHLCAEAALRLVKPGNQNTQVTEAWNKIAQSFKC  177



>ref|XP_008411912.1| PREDICTED: proliferation-associated protein 2G4-like [Poecilia 
reticulata]
Length=392

 Score =   162 bits (410),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 90/177 (51%), Positives = 123/177 (69%), Gaps = 12/177 (7%)
 Frame = +3

Query  9    DLTTPE-------VVTKYKSAAEILNKGLELVVSQCKPNAKIVDICEKGDAFIREQTGNM  167
            D  TPE       VVTKYK  AEI N+ L+ +     P   ++ +C+KGD FI  +TG +
Sbjct  4    DEETPEQTIAEDLVVTKYKMGAEIANQALKTLAEAAAPGVSVLSLCQKGDEFIAAETGKI  63

Query  168  YKNVKKKIERGVAFPTCISVNNTVCHFSPLSND-DTVLEDGDMVKIDMGCHIDGFIAVVG  344
            +K  +K +++G+AFPTC+SVNN VCHFSPL +D D  L+DGD+VKID+G H+DGFI+ V 
Sbjct  64   FKR-EKDMKKGIAFPTCVSVNNCVCHFSPLKSDPDVTLKDGDLVKIDLGVHVDGFISNVA  122

Query  345  HTHLL---QEGPVTGRaadviaaantaaevaLRLVRPGKKNSDVTEAIQKVAAAYDC  506
            H+ ++   +E PVTGR ADVI AA+  AE ALRLV+PG +N+ VTEA  K+A ++ C
Sbjct  123  HSFVVGATKENPVTGRKADVIKAAHLCAEAALRLVKPGNQNTQVTEAWNKIAKSFKC  179



>ref|XP_004931156.1| PREDICTED: proliferation-associated protein 2G4-like [Bombyx 
mori]
Length=379

 Score =   162 bits (409),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 87/162 (54%), Positives = 124/162 (77%), Gaps = 2/162 (1%)
 Frame = +3

Query  27   VVTKYKSAAEILNKGLELVVSQCKPNAKIVDICEKGDAFIREQTGNMYKNVKKKIERGVA  206
            VVTKYK A +I+N+ LE V+++C P+A   +ICE GD  + E+T  ++K  +K  ++G+A
Sbjct  16   VVTKYKLAGQIVNRVLEQVIAKCVPDASAREICEFGDKLVLEETNKVFKK-EKDSKKGIA  74

Query  207  FPTCISVNNTVCHFSPLSND-DTVLEDGDMVKIDMGCHIDGFIAVVGHTHLLQEGPVTGR  383
            F TC+SVNN +CHFSP++++ D +L+ GD+ KID+G HIDGFIAVV HT ++ E  V+GR
Sbjct  75   FSTCVSVNNCICHFSPIASEPDYILKKGDLAKIDLGAHIDGFIAVVAHTVVVGESEVSGR  134

Query  384  aadviaaantaaevaLRLVRPGKKNSDVTEAIQKVAAAYDCK  509
            AADV+ AA+ A+E ALRL++PG +N  VTEAIQK++A Y CK
Sbjct  135  AADVLLAAHHASEAALRLLKPGTENYAVTEAIQKISAEYGCK  176



>ref|XP_969584.1| PREDICTED: proliferation-associated protein 2G4 [Tribolium castaneum]
 gb|EFA11745.1| hypothetical protein TcasGA2_TC004235 [Tribolium castaneum]
Length=386

 Score =   162 bits (409),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 87/165 (53%), Positives = 123/165 (75%), Gaps = 5/165 (3%)
 Frame = +3

Query  27   VVTKYKSAAEILNKGLELVVSQCKPNAKIVDICEKGDAFIREQTGNMYKNVKKKIERGVA  206
            VVTKYK A EI+N+ L+ V+ +CKP + + +ICE GD  I E+T  ++K  +K++++G+A
Sbjct  16   VVTKYKMAGEIVNRILKQVLEKCKPGSSVREICEFGDQLITEETSKVFKK-EKELKKGIA  74

Query  207  FPTCISVNNTVCHFSPL-SNDDTVLEDGDMVKIDMGCHIDGFIAVVGHTHLL---QEGPV  374
            FPTC+SVNN +CHFSP+ S  D VL+DGDMVK+D+G HIDGFIAVV HT +L    E   
Sbjct  75   FPTCVSVNNCICHFSPIASESDYVLKDGDMVKVDLGAHIDGFIAVVAHTIILGVSSEHKA  134

Query  375  TGRaadviaaantaaevaLRLVRPGKKNSDVTEAIQKVAAAYDCK  509
            T R ADV+ AA+ A+E ALRL++PG +   +T+A+Q+VA ++ CK
Sbjct  135  TDRKADVMLAAHYASEAALRLLKPGNETYTITDAVQRVAESFKCK  179



>ref|XP_008317097.1| PREDICTED: proliferation-associated protein 2G4-like [Cynoglossus 
semilaevis]
Length=392

 Score =   162 bits (409),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 85/164 (52%), Positives = 123/164 (75%), Gaps = 5/164 (3%)
 Frame = +3

Query  27   VVTKYKSAAEILNKGLELVVSQCKPNAKIVDICEKGDAFIREQTGNMYKNVKKKIERGVA  206
            VVTKYK  AEI N+ L++VV   K    ++ +CEKGD+FI  +TG ++K  +K++++G+A
Sbjct  17   VVTKYKMGAEIANQALKVVVEAAKSGVSVLSLCEKGDSFIMTETGKIFKK-EKEMKKGIA  75

Query  207  FPTCISVNNTVCHFSPLSND-DTVLEDGDMVKIDMGCHIDGFIAVVGHTHLL---QEGPV  374
            FPTC+SVNN VCHFSPL +D D +L+DGD+VKID+G H+DGFI+ V H+ ++   +E P+
Sbjct  76   FPTCVSVNNCVCHFSPLKSDADIILKDGDLVKIDLGVHVDGFISNVAHSFVVGVTKENPL  135

Query  375  TGRaadviaaantaaevaLRLVRPGKKNSDVTEAIQKVAAAYDC  506
            TGR ADVI AA+  AE A+RLV+PG +N+ VT+   K+A ++ C
Sbjct  136  TGRKADVIKAAHLCAEAAIRLVKPGNQNTQVTDVWNKIAKSFKC  179



>ref|XP_006629280.1| PREDICTED: proliferation-associated protein 2G4-like [Lepisosteus 
oculatus]
Length=394

 Score =   162 bits (409),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 88/164 (54%), Positives = 120/164 (73%), Gaps = 5/164 (3%)
 Frame = +3

Query  27   VVTKYKSAAEILNKGLELVVSQCKPNAKIVDICEKGDAFIREQTGNMYKNVKKKIERGVA  206
            VVTKYK   +I N+ L  VV   KP   ++ +CEKGDA I E+TG ++K  +K++++G+A
Sbjct  17   VVTKYKMGGDIANQALRKVVEAAKPGVSVLALCEKGDALIMEETGKIFKK-EKEMKKGIA  75

Query  207  FPTCISVNNTVCHFSPLSND-DTVLEDGDMVKIDMGCHIDGFIAVVGHTHLL---QEGPV  374
            FPT +SVNN VCHFSPL +D D  L++GD+VKID+G H+DGFIA V H+ ++   +E PV
Sbjct  76   FPTSVSVNNCVCHFSPLKSDPDYTLKEGDLVKIDLGVHVDGFIANVAHSFVVGATKEAPV  135

Query  375  TGRaadviaaantaaevaLRLVRPGKKNSDVTEAIQKVAAAYDC  506
            TGR ADVI AA+  AE ALRLV+PG +N+ VTEA  K+A ++ C
Sbjct  136  TGRKADVIKAAHLCAEAALRLVKPGNQNTQVTEAWNKIAQSFKC  179



>ref|XP_007556640.1| PREDICTED: proliferation-associated protein 2G4-like [Poecilia 
formosa]
Length=392

 Score =   161 bits (408),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 90/177 (51%), Positives = 123/177 (69%), Gaps = 12/177 (7%)
 Frame = +3

Query  9    DLTTPE-------VVTKYKSAAEILNKGLELVVSQCKPNAKIVDICEKGDAFIREQTGNM  167
            D  TPE       VVTKYK  AEI N+ L+ V     P   ++ +C+KGD FI  +TG +
Sbjct  4    DEETPEQTIAEDLVVTKYKMGAEIANQALKTVAEAAAPGVSVLSLCQKGDEFIAAETGKI  63

Query  168  YKNVKKKIERGVAFPTCISVNNTVCHFSPLSND-DTVLEDGDMVKIDMGCHIDGFIAVVG  344
            +K  +K +++G+AFPTC+SVNN VCHFSPL +D D  L+DGD+VKID+G H+DGFI+ V 
Sbjct  64   FKR-EKDMKKGIAFPTCVSVNNCVCHFSPLKSDPDVTLKDGDLVKIDLGVHVDGFISNVA  122

Query  345  HTHLL---QEGPVTGRaadviaaantaaevaLRLVRPGKKNSDVTEAIQKVAAAYDC  506
            H+ ++   ++ PVTGR ADVI AA+  AE ALRLV+PG +N+ VTEA  K+A ++ C
Sbjct  123  HSFVVGATKDKPVTGRKADVIKAAHLCAEAALRLVKPGNQNTQVTEAWNKIAKSFKC  179



>ref|XP_009011773.1| hypothetical protein HELRODRAFT_156370 [Helobdella robusta]
 gb|ESO09959.1| hypothetical protein HELRODRAFT_156370 [Helobdella robusta]
Length=401

 Score =   161 bits (408),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 92/165 (56%), Positives = 122/165 (74%), Gaps = 5/165 (3%)
 Frame = +3

Query  27   VVTKYKSAAEILNKGLELVVSQCKPNAKIVDICEKGDAFIREQTGNMYKNVKKKIERGVA  206
            VVTKYK AAEI+N  L+ ++ +C+ NAKI D+C+ GD  + EQT  ++K  KK +++G+A
Sbjct  22   VVTKYKMAAEIVNDVLKKLIEKCETNAKIQDLCDLGDQLLTEQTNKVFKT-KKDMKKGIA  80

Query  207  FPTCISVNNTVCHFSPL-SNDDTVLEDGDMVKIDMGCHIDGFIAVVGHTHLLQEGP---V  374
            FPTCISVNN +CHFSPL S  D+ L++GD+VKID+G HIDGFIAVV H+ ++   P    
Sbjct  81   FPTCISVNNCICHFSPLKSEADSFLKEGDLVKIDLGAHIDGFIAVVAHSLIVGATPENKA  140

Query  375  TGRaadviaaantaaevaLRLVRPGKKNSDVTEAIQKVAAAYDCK  509
            TGR ADV+ AA+ A+EVALRLV+PG +   VT+AIQK    Y CK
Sbjct  141  TGRKADVVLAAHLASEVALRLVKPGSEVYSVTDAIQKATECYKCK  185



>ref|XP_010764812.1| PREDICTED: proliferation-associated protein 2G4 [Notothenia coriiceps]
Length=391

 Score =   161 bits (407),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 87/164 (53%), Positives = 120/164 (73%), Gaps = 5/164 (3%)
 Frame = +3

Query  27   VVTKYKSAAEILNKGLELVVSQCKPNAKIVDICEKGDAFIREQTGNMYKNVKKKIERGVA  206
            VVTKYK   +I N+ L LVV    P   ++ +CEKGDA+I  +TG ++K  +K++++G+A
Sbjct  15   VVTKYKMGGDIANQALRLVVETAMPGVSVLSLCEKGDAYIMAETGKVFKK-EKEMKKGIA  73

Query  207  FPTCISVNNTVCHFSPLSND-DTVLEDGDMVKIDMGCHIDGFIAVVGHTHLL---QEGPV  374
            FPT +SVNN VCHFSPL +D D  L+DGD+VKID+G H+DGFIA V H+ ++   +E P+
Sbjct  74   FPTSVSVNNCVCHFSPLKSDPDFTLKDGDLVKIDLGVHVDGFIANVAHSFVVGASKENPI  133

Query  375  TGRaadviaaantaaevaLRLVRPGKKNSDVTEAIQKVAAAYDC  506
            TG+ ADVI AA+  AE ALRLV+PG +NS VTEA  K+A ++ C
Sbjct  134  TGKKADVIKAAHLCAEAALRLVKPGSQNSKVTEAWNKIAKSFKC  177



>ref|XP_008279469.1| PREDICTED: proliferation-associated protein 2G4-like [Stegastes 
partitus]
Length=392

 Score =   161 bits (407),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 85/164 (52%), Positives = 121/164 (74%), Gaps = 5/164 (3%)
 Frame = +3

Query  27   VVTKYKSAAEILNKGLELVVSQCKPNAKIVDICEKGDAFIREQTGNMYKNVKKKIERGVA  206
            VVTKYK  AEI N+ L+ VV        ++ +CEKGDAFI  +TG ++K  +K +++G+A
Sbjct  17   VVTKYKMGAEIANQALKTVVGAATAGVSVLSLCEKGDAFIAAETGKIFKK-EKDMKKGIA  75

Query  207  FPTCISVNNTVCHFSPLSND-DTVLEDGDMVKIDMGCHIDGFIAVVGHTHLL---QEGPV  374
            FPTC+SVNN VCH+SPL +D D +L+DGD++KID+G H+DGFI+ V H+ ++   +E P+
Sbjct  76   FPTCVSVNNCVCHYSPLKSDPDVILKDGDLIKIDLGVHVDGFISNVAHSFVVGVTKENPL  135

Query  375  TGRaadviaaantaaevaLRLVRPGKKNSDVTEAIQKVAAAYDC  506
            TGR ADVI AA+  AE A+RLV+PG +N+ VTEA  K+A ++ C
Sbjct  136  TGRKADVIKAAHLCAEAAIRLVKPGNQNTQVTEAWNKIAKSFKC  179



>ref|XP_010782747.1| PREDICTED: proliferation-associated protein 2G4-like [Notothenia 
coriiceps]
Length=392

 Score =   160 bits (406),  Expect = 5e-44, Method: Compositional matrix adjust.
 Identities = 86/164 (52%), Positives = 121/164 (74%), Gaps = 5/164 (3%)
 Frame = +3

Query  27   VVTKYKSAAEILNKGLELVVSQCKPNAKIVDICEKGDAFIREQTGNMYKNVKKKIERGVA  206
            VVTKYK  AEI N+ L+ VV    P   ++ +C+KGDAF+  +TG ++K  +K +++G A
Sbjct  17   VVTKYKMGAEIANQALKTVVEAALPGVSVLSLCQKGDAFVMAETGKIFKK-EKDMKKGSA  75

Query  207  FPTCISVNNTVCHFSPLSND-DTVLEDGDMVKIDMGCHIDGFIAVVGHTHLL---QEGPV  374
            FPTC+SVNNTVCH SPL +D D +L+DGD+VKID+G H+DGFI+ V H+ ++   +E P+
Sbjct  76   FPTCVSVNNTVCHHSPLKSDPDVILKDGDVVKIDLGVHVDGFISNVAHSFVVGVTKETPL  135

Query  375  TGRaadviaaantaaevaLRLVRPGKKNSDVTEAIQKVAAAYDC  506
            TGR ADV+ AA+  AE A+RLV+PG KNS VT+A  K+A ++ C
Sbjct  136  TGRKADVLIAAHLCAEAAIRLVKPGNKNSQVTDAWNKIAKSFKC  179



>ref|XP_008318205.1| PREDICTED: proliferation-associated protein 2G4-like [Cynoglossus 
semilaevis]
Length=391

 Score =   160 bits (405),  Expect = 6e-44, Method: Compositional matrix adjust.
 Identities = 89/164 (54%), Positives = 118/164 (72%), Gaps = 5/164 (3%)
 Frame = +3

Query  27   VVTKYKSAAEILNKGLELVVSQCKPNAKIVDICEKGDAFIREQTGNMYKNVKKKIERGVA  206
            VVTKYK   +I N+ L LVV   KP   ++ +CE GDA+I  +TG ++K  +K++++G+A
Sbjct  15   VVTKYKMGGDIANQALRLVVGAAKPGLSVLSLCEMGDAYIMTETGKVFKK-EKEMKKGIA  73

Query  207  FPTCISVNNTVCHFSPLSND-DTVLEDGDMVKIDMGCHIDGFIAVVGHTHLL---QEGPV  374
            FPT ISVNN VCHFSPL +D D  L+DGD+VKID+G H+DGFIA V H+ ++   +E PV
Sbjct  74   FPTSISVNNCVCHFSPLKSDPDCTLKDGDLVKIDLGVHVDGFIANVAHSFVVGATKEAPV  133

Query  375  TGRaadviaaantaaevaLRLVRPGKKNSDVTEAIQKVAAAYDC  506
            TGR ADVI AA+  AE ALRLV+PG +N  VTEA  K+A  + C
Sbjct  134  TGRKADVIKAAHLCAEAALRLVKPGNQNFQVTEAWNKIAKEFKC  177



>ref|XP_010907413.1| PREDICTED: proliferation-associated protein 2G4-like isoform 
X2 [Elaeis guineensis]
Length=344

 Score =   158 bits (400),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 102/169 (60%), Positives = 112/169 (66%), Gaps = 50/169 (30%)
 Frame = +3

Query  3    ELDLTTPEVVTKYKSAAEILNKGLELVVSQCKPNAKIVDICEKGDAFIREQTGNMYKNVK  182
            ELDLT+P+VVTKYKSAA+I++K L+L VS+CKP AKIVDICEKGDA              
Sbjct  10   ELDLTSPDVVTKYKSAADIVSKALQLAVSECKPKAKIVDICEKGDA--------------  55

Query  183  KKIERGVAFPTCISVNNTVCHFSPLSNDDTVLEDGDMVKIDMGCHIDGFIAVVGHTHLLQ  362
                                                 ++ DMGCHIDGFIAVV HTH+LQ
Sbjct  56   ------------------------------------FIRDDMGCHIDGFIAVVAHTHVLQ  79

Query  363  EGPVTGRaadviaaantaaevaLRLVRPGKKNSDVTEAIQKVAAAYDCK  509
            EGPVTGRAADVIAAANTAAEVALRLVRPGKKN DVTEAIQKVAAAYDCK
Sbjct  80   EGPVTGRAADVIAAANTAAEVALRLVRPGKKNKDVTEAIQKVAAAYDCK  128



>gb|ACI68772.1| Proliferation-associated protein 2G4 [Salmo salar]
Length=256

 Score =   156 bits (394),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 86/164 (52%), Positives = 120/164 (73%), Gaps = 5/164 (3%)
 Frame = +3

Query  27   VVTKYKSAAEILNKGLELVVSQCKPNAKIVDICEKGDAFIREQTGNMYKNVKKKIERGVA  206
            VVTKYK  AEI N+ L+ VV   K    +V +C KGDAFI  +TG +++  +K +++G+A
Sbjct  17   VVTKYKMGAEIANQALKAVVGAAKAGETVVSLCAKGDAFIMAETGKVFRK-EKDLKKGIA  75

Query  207  FPTCISVNNTVCHFSPLSND-DTVLEDGDMVKIDMGCHIDGFIAVVGHTHLL---QEGPV  374
            FPT +SVNN VCHFSPL +D + VL+DGD+VKID+G H+DGFI+ + H+ ++   ++ P+
Sbjct  76   FPTSVSVNNCVCHFSPLKSDPEIVLKDGDLVKIDLGVHVDGFISNLAHSFVVGVTKDAPL  135

Query  375  TGRaadviaaantaaevaLRLVRPGKKNSDVTEAIQKVAAAYDC  506
            TGR ADVI AA+  AE ALRLV+PG +NS VTEA  K+A ++ C
Sbjct  136  TGRKADVIIAAHLCAEAALRLVKPGNQNSQVTEAWNKIAKSFKC  179



>ref|XP_001984453.1| GH15010 [Drosophila grimshawi]
 gb|EDV96801.1| GH15010 [Drosophila grimshawi]
Length=394

 Score =   159 bits (401),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 87/165 (53%), Positives = 119/165 (72%), Gaps = 5/165 (3%)
 Frame = +3

Query  27   VVTKYKSAAEILNKGLELVVSQCKPNAKIVDICEKGDAFIREQTGNMYKNVKKKIERGVA  206
            VVTKYK A EI+NK L+ V+  C  +A + DIC KGD  + E+TG +YK  +K++++G+A
Sbjct  17   VVTKYKLAGEIVNKTLKTVIGLCVNDASVRDICTKGDNLLTEETGKVYKK-EKELKKGIA  75

Query  207  FPTCISVNNTVCHFSPLSND-DTVLEDGDMVKIDMGCHIDGFIAVVGHTHLLQEG---PV  374
            FPTC+SVNN VCHFSP  ND D  L+ GD+VKIDMG HIDGFIAV  HT ++ +G    +
Sbjct  76   FPTCLSVNNCVCHFSPAKNDADYTLKVGDVVKIDMGAHIDGFIAVAAHTIVIGDGTDQKI  135

Query  375  TGRaadviaaantaaevaLRLVRPGKKNSDVTEAIQKVAAAYDCK  509
            +GR ADVI AA  A + ALRL++ G  N  +T+A+Q+++ +Y CK
Sbjct  136  SGRQADVILAAYWAVQAALRLLKSGSNNYSITDAVQQISESYKCK  180



>emb|CAJ82581.1| proliferation-associated 2G4 [Xenopus (Silurana) tropicalis]
Length=367

 Score =   157 bits (398),  Expect = 5e-43, Method: Compositional matrix adjust.
 Identities = 87/164 (53%), Positives = 120/164 (73%), Gaps = 5/164 (3%)
 Frame = +3

Query  27   VVTKYKSAAEILNKGLELVVSQCKPNAKIVDICEKGDAFIREQTGNMYKNVKKKIERGVA  206
            VVTKYK   +I N+ L  +V      A ++++CEKGDA I E+TG ++K  +K++++G+A
Sbjct  17   VVTKYKMGGDIANRVLRTLVDAATAGASLLNLCEKGDAMIMEETGKIFKK-EKEMKKGIA  75

Query  207  FPTCISVNNTVCHFSPLSND-DTVLEDGDMVKIDMGCHIDGFIAVVGHTHLL---QEGPV  374
            FPT ISVNN VCHFSPL +D D +L+DGD+VKID+G H+DGFIA V H+ ++   +E PV
Sbjct  76   FPTSISVNNCVCHFSPLKSDQDYLLKDGDLVKIDLGVHVDGFIANVAHSFVVGASKECPV  135

Query  375  TGRaadviaaantaaevaLRLVRPGKKNSDVTEAIQKVAAAYDC  506
            TGR ADVI AA+   E ALRLV+PG +NS VTEA  K++ ++ C
Sbjct  136  TGRKADVIKAAHLCGEAALRLVKPGNQNSQVTEAWNKISPSFKC  179



>ref|XP_005650680.1| proliferation-associated protein 1 [Coccomyxa subellipsoidea 
C-169]
 gb|EIE26136.1| proliferation-associated protein 1 [Coccomyxa subellipsoidea 
C-169]
Length=402

 Score =   158 bits (400),  Expect = 5e-43, Method: Compositional matrix adjust.
 Identities = 91/169 (54%), Positives = 120/169 (71%), Gaps = 5/169 (3%)
 Frame = +3

Query  3    ELDLTTPEVVTKYKSAAEILNKGLELVVSQCKPNAKIVDICEKGDAFIREQTGNMYKNVK  182
            ELDL+  +VVTKYK+AA+I N  L  V+   K  AK+VD+C  GD  I + +  ++K   
Sbjct  13   ELDLSNSDVVTKYKAAADITNNALAAVIKAAKAGAKLVDLCSLGDKSIEDASAKVFKG--  70

Query  183  KKIERGVAFPTCISVNNTVCHFSPLSNDDTVLEDGDMVKIDMGCHIDGFIAVVGHTHLLQ  362
            K IE+G+AFPTC SVNN + H SPL+ D   L++GD+VKID+G HIDGF+A   HT ++Q
Sbjct  71   KTIEKGIAFPTCTSVNNVIGHVSPLAEDTVELKEGDVVKIDLGSHIDGFVATAAHTIVVQ  130

Query  363  ---EGPVTGRaadviaaantaaevaLRLVRPGKKNSDVTEAIQKVAAAY  500
               E PVTG+AADVI AANTA E A+RL+RPGK+ S+VT  + +VA AY
Sbjct  131  SDAEAPVTGKAADVIVAANTALEAAIRLIRPGKRISEVTGVLGQVAEAY  179



>ref|XP_003973252.1| PREDICTED: proliferation-associated protein 2G4-like [Takifugu 
rubripes]
Length=391

 Score =   157 bits (398),  Expect = 7e-43, Method: Compositional matrix adjust.
 Identities = 87/164 (53%), Positives = 119/164 (73%), Gaps = 5/164 (3%)
 Frame = +3

Query  27   VVTKYKSAAEILNKGLELVVSQCKPNAKIVDICEKGDAFIREQTGNMYKNVKKKIERGVA  206
            VVTKYK   +I N+ L LVV      A ++ +CEKGDA+I  +TG ++K  +K++++G+A
Sbjct  15   VVTKYKMGGDIANQALRLVVESASSGASVLGLCEKGDAYIMAETGKVFKK-EKEMKKGIA  73

Query  207  FPTCISVNNTVCHFSPLSND-DTVLEDGDMVKIDMGCHIDGFIAVVGHTHLL---QEGPV  374
            FPT +SVNN VCHFSPL +D D  L+DGD+VKID+G HIDGFIA V H+ ++   +E  +
Sbjct  74   FPTSVSVNNCVCHFSPLKSDPDYTLKDGDLVKIDLGVHIDGFIANVAHSFVVGASKENLI  133

Query  375  TGRaadviaaantaaevaLRLVRPGKKNSDVTEAIQKVAAAYDC  506
            TGR ADVI AA+  AE ALRLV+PG +N+ VTEA  K+A ++ C
Sbjct  134  TGRKADVIKAAHLCAEAALRLVKPGNQNAQVTEAWNKIAQSFKC  177



>ref|XP_002047403.1| GJ11948 [Drosophila virilis]
 gb|EDW69745.1| GJ11948 [Drosophila virilis]
Length=394

 Score =   157 bits (398),  Expect = 8e-43, Method: Compositional matrix adjust.
 Identities = 85/165 (52%), Positives = 118/165 (72%), Gaps = 5/165 (3%)
 Frame = +3

Query  27   VVTKYKSAAEILNKGLELVVSQCKPNAKIVDICEKGDAFIREQTGNMYKNVKKKIERGVA  206
            VVTKYK A EI NK L+ V+  C P+A + +IC KGD  + E+TG +YK  +K++++G+A
Sbjct  17   VVTKYKLAGEIANKTLKTVIGLCVPDASVREICTKGDNLLTEETGKVYKK-EKELKKGIA  75

Query  207  FPTCISVNNTVCHFSPLSND-DTVLEDGDMVKIDMGCHIDGFIAVVGHTHLLQEGP---V  374
            FPTC+SVNN VCHFSP  ND D  L+ GD+VKID+G HIDGFIAV  HT ++  G    +
Sbjct  76   FPTCLSVNNCVCHFSPAKNDADYTLKAGDVVKIDLGGHIDGFIAVAAHTIVVGAGADQKI  135

Query  375  TGRaadviaaantaaevaLRLVRPGKKNSDVTEAIQKVAAAYDCK  509
            +GR ADVI AA  + + ALRL++ G  N  +T+A+Q+++ +Y CK
Sbjct  136  SGRQADVILAAYWSVQAALRLLKSGSSNYSITDAVQQISESYKCK  180



>ref|NP_001008439.1| ErbB3-binding protein 1 [Xenopus (Silurana) tropicalis]
 gb|AAH80337.1| MGC79578 protein [Xenopus (Silurana) tropicalis]
Length=390

 Score =   157 bits (398),  Expect = 8e-43, Method: Compositional matrix adjust.
 Identities = 87/164 (53%), Positives = 120/164 (73%), Gaps = 5/164 (3%)
 Frame = +3

Query  27   VVTKYKSAAEILNKGLELVVSQCKPNAKIVDICEKGDAFIREQTGNMYKNVKKKIERGVA  206
            VVTKYK   +I N+ L  +V      A ++++CEKGDA I E+TG ++K  +K++++G+A
Sbjct  17   VVTKYKMGGDIANRVLRTLVDAATAGASLLNLCEKGDAMIMEETGKIFKK-EKEMKKGIA  75

Query  207  FPTCISVNNTVCHFSPLSND-DTVLEDGDMVKIDMGCHIDGFIAVVGHTHLL---QEGPV  374
            FPT ISVNN VCHFSPL +D D +L+DGD+VKID+G H+DGFIA V H+ ++   +E PV
Sbjct  76   FPTSISVNNCVCHFSPLKSDQDYLLKDGDLVKIDLGVHVDGFIANVAHSFVVGASKECPV  135

Query  375  TGRaadviaaantaaevaLRLVRPGKKNSDVTEAIQKVAAAYDC  506
            TGR ADVI AA+   E ALRLV+PG +NS VTEA  K++ ++ C
Sbjct  136  TGRKADVIKAAHLCGEAALRLVKPGNQNSQVTEAWNKISPSFKC  179



>ref|NP_001083993.1| proliferation-associated 2G4, 38kD [Xenopus laevis]
 gb|AAH84760.1| Pa2g4 protein [Xenopus laevis]
Length=390

 Score =   157 bits (398),  Expect = 9e-43, Method: Compositional matrix adjust.
 Identities = 87/164 (53%), Positives = 120/164 (73%), Gaps = 5/164 (3%)
 Frame = +3

Query  27   VVTKYKSAAEILNKGLELVVSQCKPNAKIVDICEKGDAFIREQTGNMYKNVKKKIERGVA  206
            VVTKYK   +I N+ L  +V      A ++++CEKGDA I E+TG ++K  +K++++G+A
Sbjct  17   VVTKYKMGGDIANRVLRALVDTATAGASLLNLCEKGDAMIMEETGKIFKK-EKEMKKGIA  75

Query  207  FPTCISVNNTVCHFSPLSND-DTVLEDGDMVKIDMGCHIDGFIAVVGHTHLL---QEGPV  374
            FPT ISVNN VCHFSPL +D D +L+DGD+VKID+G H+DGFIA V H+ ++   +E PV
Sbjct  76   FPTSISVNNCVCHFSPLKSDQDYLLKDGDLVKIDLGVHVDGFIANVAHSFVVGASKECPV  135

Query  375  TGRaadviaaantaaevaLRLVRPGKKNSDVTEAIQKVAAAYDC  506
            TGR ADVI AA+   E ALRLV+PG +NS VTEA  K++ ++ C
Sbjct  136  TGRKADVIKAAHLCVEAALRLVKPGNQNSQVTEAWNKISPSFKC  179



>gb|AAH44287.1| Pa2g4 protein, partial [Xenopus laevis]
Length=395

 Score =   157 bits (398),  Expect = 9e-43, Method: Compositional matrix adjust.
 Identities = 87/164 (53%), Positives = 120/164 (73%), Gaps = 5/164 (3%)
 Frame = +3

Query  27   VVTKYKSAAEILNKGLELVVSQCKPNAKIVDICEKGDAFIREQTGNMYKNVKKKIERGVA  206
            VVTKYK   +I N+ L  +V      A ++++CEKGDA I E+TG ++K  +K++++G+A
Sbjct  22   VVTKYKMGGDIANRVLRALVDTATAGASLLNLCEKGDAMIMEETGKIFKK-EKEMKKGIA  80

Query  207  FPTCISVNNTVCHFSPLSND-DTVLEDGDMVKIDMGCHIDGFIAVVGHTHLL---QEGPV  374
            FPT ISVNN VCHFSPL +D D +L+DGD+VKID+G H+DGFIA V H+ ++   +E PV
Sbjct  81   FPTSISVNNCVCHFSPLKSDQDYLLKDGDLVKIDLGVHVDGFIANVAHSFVVGASKECPV  140

Query  375  TGRaadviaaantaaevaLRLVRPGKKNSDVTEAIQKVAAAYDC  506
            TGR ADVI AA+   E ALRLV+PG +NS VTEA  K++ ++ C
Sbjct  141  TGRKADVIKAAHLCVEAALRLVKPGNQNSQVTEAWNKISPSFKC  184



>ref|XP_004070502.1| PREDICTED: proliferation-associated protein 2G4-like [Oryzias 
latipes]
Length=392

 Score =   157 bits (397),  Expect = 9e-43, Method: Compositional matrix adjust.
 Identities = 86/164 (52%), Positives = 120/164 (73%), Gaps = 5/164 (3%)
 Frame = +3

Query  27   VVTKYKSAAEILNKGLELVVSQCKPNAKIVDICEKGDAFIREQTGNMYKNVKKKIERGVA  206
            VVTKYK  AEI N+ L+ VV+       ++ +CEKGDA I  +TG ++K  +K +++G+A
Sbjct  17   VVTKYKMGAEIANQALKAVVTAATAGVSVLSLCEKGDALIVAETGKIFKR-EKDMKKGIA  75

Query  207  FPTCISVNNTVCHFSPLSND-DTVLEDGDMVKIDMGCHIDGFIAVVGHTHLL---QEGPV  374
            FPTC+SVNN VCH SPL +D D +L+DGD+VKID+G H+DGFI+ V H+ ++   ++ PV
Sbjct  76   FPTCVSVNNCVCHHSPLKSDPDVILKDGDIVKIDLGVHVDGFISNVAHSFVVGATKDNPV  135

Query  375  TGRaadviaaantaaevaLRLVRPGKKNSDVTEAIQKVAAAYDC  506
            TGR ADVI AA+  AE ALRLV+PG +N+ VTEA  K+A ++ C
Sbjct  136  TGRKADVIKAAHLCAEAALRLVKPGNQNTQVTEAWNKIAKSFKC  179



>ref|XP_010745944.1| PREDICTED: proliferation-associated protein 2G4-like [Larimichthys 
crocea]
Length=392

 Score =   157 bits (397),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 83/164 (51%), Positives = 119/164 (73%), Gaps = 5/164 (3%)
 Frame = +3

Query  27   VVTKYKSAAEILNKGLELVVSQCKPNAKIVDICEKGDAFIREQTGNMYKNVKKKIERGVA  206
            VVTKYK  AEI N+ ++  V        ++ +CEKGDAFI  +TG ++K  +K +++G+A
Sbjct  17   VVTKYKMGAEIANQAMKTTVGAAMAGVSVLSLCEKGDAFIMAETGKIFKK-EKDMKKGIA  75

Query  207  FPTCISVNNTVCHFSPLSND-DTVLEDGDMVKIDMGCHIDGFIAVVGHTHLL---QEGPV  374
            FPTC+SVNN VCH SPL +D D +L+DGD+VKID+G H+DGFI+ V H+ ++   ++ P+
Sbjct  76   FPTCVSVNNCVCHHSPLKSDPDVILKDGDLVKIDLGVHVDGFISNVAHSFIVGVTKDNPL  135

Query  375  TGRaadviaaantaaevaLRLVRPGKKNSDVTEAIQKVAAAYDC  506
            TGR ADV+ AA+  AE ALRLV+PG +N+ VTEA  K+A ++ C
Sbjct  136  TGRKADVLKAAHLCAEAALRLVKPGNQNTQVTEAWNKIAKSFKC  179



>emb|CDQ89185.1| unnamed protein product [Oncorhynchus mykiss]
Length=393

 Score =   157 bits (396),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 84/164 (51%), Positives = 119/164 (73%), Gaps = 5/164 (3%)
 Frame = +3

Query  27   VVTKYKSAAEILNKGLELVVSQCKPNAKIVDICEKGDAFIREQTGNMYKNVKKKIERGVA  206
            VVTKYK   +I N+ L +V+ + K    ++ +CEKGDA I  +TG +++  +K +++G+A
Sbjct  16   VVTKYKMGGDIANQALRMVIEEAKSGVSVLSLCEKGDAHIMAETGKVFRK-EKDLKKGIA  74

Query  207  FPTCISVNNTVCHFSPLSND-DTVLEDGDMVKIDMGCHIDGFIAVVGHTHLL---QEGPV  374
            FPT +SVNN VCHFSPL +D D  L+DGD+VKID+G H+DGFI+ V H+ ++   +E PV
Sbjct  75   FPTSVSVNNCVCHFSPLKSDPDYTLKDGDLVKIDLGVHVDGFISNVAHSFVVGATKEAPV  134

Query  375  TGRaadviaaantaaevaLRLVRPGKKNSDVTEAIQKVAAAYDC  506
            TG+ ADVI AA+  AE ALRLV+PG +NS VTEA  K+A ++ C
Sbjct  135  TGKKADVIKAAHLCAEAALRLVKPGNQNSKVTEAWNKIAQSFKC  178



>ref|XP_005184671.1| PREDICTED: proliferation-associated protein 2G4 [Musca domestica]
Length=393

 Score =   157 bits (396),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 86/165 (52%), Positives = 116/165 (70%), Gaps = 5/165 (3%)
 Frame = +3

Query  27   VVTKYKSAAEILNKGLELVVSQCKPNAKIVDICEKGDAFIREQTGNMYKNVKKKIERGVA  206
            VVTKYK A EI+N+ L+ V+  C  +A + DIC K D  + E+T  +YK  +K +++G+A
Sbjct  16   VVTKYKLAGEIVNRTLKTVIDLCVADASVRDICTKSDNLLTEETNKVYKK-EKDLKKGIA  74

Query  207  FPTCISVNNTVCHFSPLSND-DTVLEDGDMVKIDMGCHIDGFIAVVGHTHLL---QEGPV  374
            FPTC+SVNN VCHFSP  ND D VL+DGD+VKID+G HIDGFIAV  HT ++    +  V
Sbjct  75   FPTCLSVNNCVCHFSPSKNDPDYVLKDGDVVKIDLGAHIDGFIAVAAHTVIVGASADKKV  134

Query  375  TGRaadviaaantaaevaLRLVRPGKKNSDVTEAIQKVAAAYDCK  509
            TGR ADV  AA  A + ALRL++ G  N  +TEA+Q+++ +Y CK
Sbjct  135  TGRKADVTLAAYWAVQAALRLLKSGNNNYAITEAVQQISESYKCK  179



>ref|XP_010879916.1| PREDICTED: proliferation-associated protein 2G4-like [Esox lucius]
Length=393

 Score =   156 bits (395),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 84/164 (51%), Positives = 120/164 (73%), Gaps = 5/164 (3%)
 Frame = +3

Query  27   VVTKYKSAAEILNKGLELVVSQCKPNAKIVDICEKGDAFIREQTGNMYKNVKKKIERGVA  206
            VVTKYK   +I N+ L +V+   K    ++ +CEKGDA+I  +TG +++  +K++++G+A
Sbjct  16   VVTKYKMGGDIANQALCVVIEAAKSGMSVLSLCEKGDAYIMAETGKVFRK-EKELKKGIA  74

Query  207  FPTCISVNNTVCHFSPLSND-DTVLEDGDMVKIDMGCHIDGFIAVVGHTHLL---QEGPV  374
            FPT +SVNN VCHFSPL +D D +L+DGD+VKID+G H+DGFI+ V H+ ++   +E PV
Sbjct  75   FPTSVSVNNCVCHFSPLKSDPDYILKDGDLVKIDLGVHVDGFISNVAHSFIVGATKEAPV  134

Query  375  TGRaadviaaantaaevaLRLVRPGKKNSDVTEAIQKVAAAYDC  506
            TGR ADVI AA+  AE ALRLV+PG +NS VTEA   +A ++ C
Sbjct  135  TGRKADVIMAAHLCAEAALRLVKPGNQNSQVTEAWNNIAKSFKC  178



>gb|ACI33074.1| Proliferation-associated protein 2G4 [Salmo salar]
Length=398

 Score =   156 bits (395),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 84/164 (51%), Positives = 119/164 (73%), Gaps = 5/164 (3%)
 Frame = +3

Query  27   VVTKYKSAAEILNKGLELVVSQCKPNAKIVDICEKGDAFIREQTGNMYKNVKKKIERGVA  206
            VVTKYK  AEI N+ L+ VV   K    +V +CE GDAFI  +TG +++  +K +++G+A
Sbjct  17   VVTKYKMGAEIANQALKAVVESAKAGVTVVSLCETGDAFIMAETGKVFRK-EKDLKKGIA  75

Query  207  FPTCISVNNTVCHFSPLSND-DTVLEDGDMVKIDMGCHIDGFIAVVGHTHLL---QEGPV  374
            FPT +SVNN VCHFSPL +D +  L+DGD++KID+G H+DGFI+ + H+ ++   ++ P+
Sbjct  76   FPTSVSVNNCVCHFSPLKSDPEITLKDGDLIKIDLGVHVDGFISNLAHSFVVGVTKDAPL  135

Query  375  TGRaadviaaantaaevaLRLVRPGKKNSDVTEAIQKVAAAYDC  506
            TGR ADVI AA+  AE ALRLV+PG +NS VTEA  K+A ++ C
Sbjct  136  TGRKADVIKAAHLCAEAALRLVKPGNQNSQVTEAWNKIAKSFKC  179



>gb|ACI33868.1| Proliferation-associated protein 2G4 [Salmo salar]
Length=393

 Score =   156 bits (395),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 85/164 (52%), Positives = 118/164 (72%), Gaps = 5/164 (3%)
 Frame = +3

Query  27   VVTKYKSAAEILNKGLELVVSQCKPNAKIVDICEKGDAFIREQTGNMYKNVKKKIERGVA  206
            VVTKYK   +I N+ L +V+   K    ++ +CEKGDA I  +TG +++  +K +++G+A
Sbjct  16   VVTKYKMGGDIANQALRVVIEASKSGVSVLSLCEKGDAHIMAETGKVFRK-EKDLKKGIA  74

Query  207  FPTCISVNNTVCHFSPLSND-DTVLEDGDMVKIDMGCHIDGFIAVVGHTHLL---QEGPV  374
            FPT +SVNN VCHFSPL +D D  L+DGD+VKID+G H+DGFIA V H+ ++   +E PV
Sbjct  75   FPTSVSVNNCVCHFSPLKSDPDYTLKDGDLVKIDLGVHVDGFIANVAHSFVVGATKEAPV  134

Query  375  TGRaadviaaantaaevaLRLVRPGKKNSDVTEAIQKVAAAYDC  506
            TG+ ADVI AA+  AE ALRLV+PG +NS VTEA  K+A ++ C
Sbjct  135  TGKKADVIKAAHLCAEAALRLVKPGNQNSKVTEAWNKIAQSFKC  178



>gb|ENN76413.1| hypothetical protein YQE_07074, partial [Dendroctonus ponderosae]
Length=389

 Score =   156 bits (394),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 86/165 (52%), Positives = 119/165 (72%), Gaps = 5/165 (3%)
 Frame = +3

Query  27   VVTKYKSAAEILNKGLELVVSQCKPNAKIVDICEKGDAFIREQTGNMYKNVKKKIERGVA  206
            VVTKYK A EI+N+ L+LV+++C P A +  +C  GD  + E+TG ++K   K +++G+A
Sbjct  16   VVTKYKMAGEIVNRILKLVIAKCVPGASVKAVCLYGDELLTEETGKVFKK-DKDLKKGIA  74

Query  207  FPTCISVNNTVCHFSPL-SNDDTVLEDGDMVKIDMGCHIDGFIAVVGHTHLLQEGPV---  374
            FPTC+SVNN +CHFSP+ S  D VL+ GD+ KID+G H+DGFIAVV HT ++   PV   
Sbjct  75   FPTCVSVNNCICHFSPVPSEPDCVLKAGDVAKIDLGAHVDGFIAVVAHTIIVGANPVEKI  134

Query  375  TGRaadviaaantaaevaLRLVRPGKKNSDVTEAIQKVAAAYDCK  509
            TGR ADVI AA+ A++ ALRL++PG     +TEA+QK A A+ CK
Sbjct  135  TGRKADVILAAHYASQAALRLLKPGNDTYAITEAVQKAAEAFKCK  179



>ref|XP_001363571.1| PREDICTED: proliferation-associated protein 2G4 [Monodelphis 
domestica]
Length=394

 Score =   156 bits (394),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 87/164 (53%), Positives = 120/164 (73%), Gaps = 5/164 (3%)
 Frame = +3

Query  27   VVTKYKSAAEILNKGLELVVSQCKPNAKIVDICEKGDAFIREQTGNMYKNVKKKIERGVA  206
            VVTKYK   +I N+ L +VV      A ++ +CEKGDA I E+TG ++K  +K++++G+A
Sbjct  17   VVTKYKMGGDIANRVLRVVVEASTSGASVLGLCEKGDAMIMEETGKIFKK-EKEMKKGIA  75

Query  207  FPTCISVNNTVCHFSPLSND-DTVLEDGDMVKIDMGCHIDGFIAVVGHTHLLQEG---PV  374
            FPT ISVNN VCHFSPL +D D +L++GD+VKID+G H+DGFIA V H+ ++      PV
Sbjct  76   FPTSISVNNCVCHFSPLKSDQDYILKEGDLVKIDLGVHVDGFIANVAHSFVVNASKGTPV  135

Query  375  TGRaadviaaantaaevaLRLVRPGKKNSDVTEAIQKVAAAYDC  506
            TGR ADVI AA+  AE ALRLV+PG +N+ VT+A  KVA +++C
Sbjct  136  TGRKADVIRAAHLCAEAALRLVKPGNQNTQVTDAWNKVAHSFNC  179



>gb|AEE62360.1| unknown [Dendroctonus ponderosae]
Length=389

 Score =   156 bits (394),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 86/165 (52%), Positives = 119/165 (72%), Gaps = 5/165 (3%)
 Frame = +3

Query  27   VVTKYKSAAEILNKGLELVVSQCKPNAKIVDICEKGDAFIREQTGNMYKNVKKKIERGVA  206
            VVTKYK A EI+N+ L+LV+++C P A +  +C  GD  + E+TG ++K   K +++G+A
Sbjct  16   VVTKYKMAGEIVNRILKLVIAKCVPGASVKAVCLYGDELLTEETGKVFKK-DKDLKKGIA  74

Query  207  FPTCISVNNTVCHFSPL-SNDDTVLEDGDMVKIDMGCHIDGFIAVVGHTHLLQEGPV---  374
            FPTC+SVNN +CHFSP+ S  D VL+ GD+ KID+G H+DGFIAVV HT ++   PV   
Sbjct  75   FPTCVSVNNCICHFSPVPSEPDCVLKAGDVAKIDLGAHVDGFIAVVAHTIIVGANPVEKI  134

Query  375  TGRaadviaaantaaevaLRLVRPGKKNSDVTEAIQKVAAAYDCK  509
            TGR ADVI AA+ A++ ALRL++PG     +TEA+QK A A+ CK
Sbjct  135  TGRKADVILAAHYASQAALRLLKPGNDTYAITEAVQKAAEAFKCK  179



>emb|CDQ74715.1| unnamed protein product [Oncorhynchus mykiss]
Length=393

 Score =   155 bits (393),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 85/164 (52%), Positives = 119/164 (73%), Gaps = 5/164 (3%)
 Frame = +3

Query  27   VVTKYKSAAEILNKGLELVVSQCKPNAKIVDICEKGDAFIREQTGNMYKNVKKKIERGVA  206
            VVTKYK   +I N+ L +V+   K    +V++CEKGDA I  +TG +++  +K +++G+A
Sbjct  16   VVTKYKMGGDIANQALRVVIEAAKSGVSVVNLCEKGDAHIMVETGKVFRK-EKDLKKGIA  74

Query  207  FPTCISVNNTVCHFSPLSND-DTVLEDGDMVKIDMGCHIDGFIAVVGHTHLL---QEGPV  374
            FPT +SVNN VCHFSPL +D D  L+DGD+VKID+G H+DGFI+ V H+ ++   +E PV
Sbjct  75   FPTSVSVNNCVCHFSPLKSDPDYTLKDGDLVKIDLGVHVDGFISNVAHSFVVGATKEAPV  134

Query  375  TGRaadviaaantaaevaLRLVRPGKKNSDVTEAIQKVAAAYDC  506
            TG+ ADVI AA+  AE ALRLV+PG +NS VTEA  K+A ++ C
Sbjct  135  TGKKADVINAAHMCAEAALRLVKPGNQNSKVTEAWNKIAQSFKC  178



>gb|AFM86347.1| proliferation-associated 2G4, partial [Callorhinchus milii]
Length=365

 Score =   155 bits (391),  Expect = 5e-42, Method: Compositional matrix adjust.
 Identities = 84/164 (51%), Positives = 119/164 (73%), Gaps = 5/164 (3%)
 Frame = +3

Query  27   VVTKYKSAAEILNKGLELVVSQCKPNAKIVDICEKGDAFIREQTGNMYKNVKKKIERGVA  206
            VVTKYK   +I N+ L  VV   K    +  +CEKGDA I E+TG ++K  +K++++G+A
Sbjct  16   VVTKYKMGGDIANRVLRTVVEAAKEGESVFSLCEKGDAMIMEETGKIFKK-EKEMKKGIA  74

Query  207  FPTCISVNNTVCHFSPLSND-DTVLEDGDMVKIDMGCHIDGFIAVVGHTHLL---QEGPV  374
            FPTC+SVNN VCH+SPL +D D +L+D D+VK+D+G H+DGFIA V H+ ++   ++ P+
Sbjct  75   FPTCVSVNNCVCHYSPLKSDPDYILKDEDLVKVDLGVHVDGFIANVAHSFIVGIKKDKPL  134

Query  375  TGRaadviaaantaaevaLRLVRPGKKNSDVTEAIQKVAAAYDC  506
            TGR ADVI AA+  AE ALRLV+PG +N+ VTEA  K+A ++ C
Sbjct  135  TGRKADVIKAAHLCAEAALRLVKPGNQNTQVTEAWNKIAQSFKC  178



>gb|ACO12262.1| Proliferation-associated protein 2G4 [Lepeophtheirus salmonis]
 gb|ADD38881.1| Proliferation-associated protein 2G4 [Lepeophtheirus salmonis]
Length=397

 Score =   155 bits (392),  Expect = 6e-42, Method: Compositional matrix adjust.
 Identities = 84/165 (51%), Positives = 117/165 (71%), Gaps = 5/165 (3%)
 Frame = +3

Query  27   VVTKYKSAAEILNKGLELVVSQCKPNAKIVDICEKGDAFIREQTGNMYKNVKKKIERGVA  206
            VVTKYK A++I+N+ L+  V++C   A + ++C+  D  + E+TG  +K   +K+ +G+A
Sbjct  21   VVTKYKMASDIVNRVLKETVAKCIVGASVKELCKWADGKLEEETGKAFKK-DRKLLKGIA  79

Query  207  FPTCISVNNTVCHFSPLSND-DTVLEDGDMVKIDMGCHIDGFIAVVGHTHLLQEGP---V  374
            FP CIS NN +CH SPL++D D +LEDGDMVKIDMG HIDGFIAVV HT ++Q  P   +
Sbjct  80   FPCCISRNNCICHLSPLASDPDVLLEDGDMVKIDMGAHIDGFIAVVAHTLVVQADPNKKI  139

Query  375  TGRaadviaaantaaevaLRLVRPGKKNSDVTEAIQKVAAAYDCK  509
             GR AD + AA+ A+  ALRLVRPGK    +T+ +QK+A +Y CK
Sbjct  140  DGRKADALLAAHYASVAALRLVRPGKNTYTITDCVQKIAESYSCK  184



>ref|XP_002062021.1| GK16873 [Drosophila willistoni]
 gb|EDW73007.1| GK16873 [Drosophila willistoni]
Length=399

 Score =   155 bits (392),  Expect = 6e-42, Method: Compositional matrix adjust.
 Identities = 85/163 (52%), Positives = 118/163 (72%), Gaps = 3/163 (2%)
 Frame = +3

Query  27   VVTKYKSAAEILNKGLELVVSQCKPNAKIVDICEKGDAFIREQTGNMYKNVKKKIERGVA  206
            VVTKYK A EI+NK L+ ++  C  +A + DIC KGD  + E+TG +YK  +K +++G+A
Sbjct  17   VVTKYKLAGEIVNKILKSLIDLCVVDASVRDICSKGDQLLTEETGKVYKK-EKDLKKGIA  75

Query  207  FPTCISVNNTVCHFSPLSND-DTVLEDGDMVKIDMGCHIDGFIAVVGHTHLL-QEGPVTG  380
            FPTC+SVNN VCHFSP  ND D +L+ GD+VKID+G HIDGFIAV  HT ++ +   +TG
Sbjct  76   FPTCLSVNNCVCHFSPAKNDTDYLLKSGDVVKIDLGAHIDGFIAVAAHTIVVGKNDKITG  135

Query  381  RaadviaaantaaevaLRLVRPGKKNSDVTEAIQKVAAAYDCK  509
            R ADVI AA  A + ALRL++ G  N  +T+A+Q+++ +Y CK
Sbjct  136  RQADVILAAYWAVQAALRLLKSGANNYSITDAVQQISESYKCK  178



>ref|XP_011209005.1| PREDICTED: proliferation-associated protein 2G4 [Bactrocera dorsalis]
 ref|XP_011209006.1| PREDICTED: proliferation-associated protein 2G4 [Bactrocera dorsalis]
Length=403

 Score =   155 bits (392),  Expect = 6e-42, Method: Compositional matrix adjust.
 Identities = 86/165 (52%), Positives = 118/165 (72%), Gaps = 5/165 (3%)
 Frame = +3

Query  27   VVTKYKSAAEILNKGLELVVSQCKPNAKIVDICEKGDAFIREQTGNMYKNVKKKIERGVA  206
            VVTKYK A EI+NK L+ V+  C   A + DIC KGD  I ++T  +YK  +K +++G+A
Sbjct  18   VVTKYKLAGEIVNKTLKAVIDLCVVEASVRDICTKGDNLIVDETSKVYKK-EKDLKKGIA  76

Query  207  FPTCISVNNTVCHFSPLSND-DTVLEDGDMVKIDMGCHIDGFIAVVGHTHLL---QEGPV  374
            FPTC+SVNN VCHFSP  ND D +L++GD+VKID+G HIDGFIAV  HT ++   +E  V
Sbjct  77   FPTCLSVNNCVCHFSPSKNDADYILKEGDVVKIDLGAHIDGFIAVAAHTVVIGASKEKKV  136

Query  375  TGRaadviaaantaaevaLRLVRPGKKNSDVTEAIQKVAAAYDCK  509
            +GR ADV+ AA  A + ALRL++ G  N  +T+A+Q+V+ +Y CK
Sbjct  137  SGRQADVVLAAYWAVQAALRLLKSGNSNYTITDAVQQVSESYKCK  181



>ref|XP_011180648.1| PREDICTED: proliferation-associated protein 2G4 [Bactrocera cucurbitae]
Length=402

 Score =   155 bits (392),  Expect = 6e-42, Method: Compositional matrix adjust.
 Identities = 86/165 (52%), Positives = 118/165 (72%), Gaps = 5/165 (3%)
 Frame = +3

Query  27   VVTKYKSAAEILNKGLELVVSQCKPNAKIVDICEKGDAFIREQTGNMYKNVKKKIERGVA  206
            VVTKYK A EI+NK L+ V+  C   A + DIC KGD  I ++T  +YK  +K +++G+A
Sbjct  18   VVTKYKLAGEIVNKTLKAVIDVCVAEASVRDICTKGDNLIIDETSKVYKK-EKDLKKGIA  76

Query  207  FPTCISVNNTVCHFSPLSND-DTVLEDGDMVKIDMGCHIDGFIAVVGHTHLL---QEGPV  374
            FPTC+SVNN VCHFSP  ND D +L++GD+VKID+G HIDGFIAV  HT ++   ++  V
Sbjct  77   FPTCLSVNNCVCHFSPSKNDADYILKEGDVVKIDLGAHIDGFIAVAAHTVVIGASKDKKV  136

Query  375  TGRaadviaaantaaevaLRLVRPGKKNSDVTEAIQKVAAAYDCK  509
            TGR ADV+ AA  A + ALRL++ G  N  +T+A+Q+V+ +Y CK
Sbjct  137  TGRQADVVLAAYWAVQAALRLLKSGNSNYTITDAVQQVSESYKCK  181



>emb|CDQ85755.1| unnamed protein product [Oncorhynchus mykiss]
Length=398

 Score =   155 bits (392),  Expect = 7e-42, Method: Compositional matrix adjust.
 Identities = 83/164 (51%), Positives = 119/164 (73%), Gaps = 5/164 (3%)
 Frame = +3

Query  27   VVTKYKSAAEILNKGLELVVSQCKPNAKIVDICEKGDAFIREQTGNMYKNVKKKIERGVA  206
            VVTKYK  AEI N+ L+ VV   +    +V +CE GDAFI  +TG +++  +K +++G+A
Sbjct  17   VVTKYKMGAEIANQALKAVVEAARAGVTVVSLCETGDAFIMAETGKVFRK-EKDLKKGIA  75

Query  207  FPTCISVNNTVCHFSPLSND-DTVLEDGDMVKIDMGCHIDGFIAVVGHTHLL---QEGPV  374
            FPT +SVNN VCHFSPL +D +  L+DGD++KID+G H+DGFI+ + H+ ++   ++ P+
Sbjct  76   FPTSVSVNNCVCHFSPLKSDPEITLKDGDLIKIDLGVHVDGFISNLAHSFVVGVTKDAPL  135

Query  375  TGRaadviaaantaaevaLRLVRPGKKNSDVTEAIQKVAAAYDC  506
            TGR ADVI AA+  AE ALRLV+PG +NS VTEA  K+A ++ C
Sbjct  136  TGRKADVIKAAHLCAEAALRLVKPGNQNSQVTEAWNKIAKSFKC  179



>ref|NP_001279838.1| proliferation-associated 2G4, 38kDa [Callorhinchus milii]
 gb|AFK10918.1| proliferation-associated protein 2G4 [Callorhinchus milii]
Length=393

 Score =   155 bits (391),  Expect = 7e-42, Method: Compositional matrix adjust.
 Identities = 84/164 (51%), Positives = 119/164 (73%), Gaps = 5/164 (3%)
 Frame = +3

Query  27   VVTKYKSAAEILNKGLELVVSQCKPNAKIVDICEKGDAFIREQTGNMYKNVKKKIERGVA  206
            VVTKYK   +I N+ L  VV   K    +  +CEKGDA I E+TG ++K  +K++++G+A
Sbjct  16   VVTKYKMGGDIANRVLRTVVEAAKEGESVFSLCEKGDAMIMEETGKIFKK-EKEMKKGIA  74

Query  207  FPTCISVNNTVCHFSPLSND-DTVLEDGDMVKIDMGCHIDGFIAVVGHTHLL---QEGPV  374
            FPTC+SVNN VCH+SPL +D D +L+D D+VK+D+G H+DGFIA V H+ ++   ++ P+
Sbjct  75   FPTCVSVNNCVCHYSPLKSDPDYILKDEDLVKVDLGVHVDGFIANVAHSFIVGIKKDKPL  134

Query  375  TGRaadviaaantaaevaLRLVRPGKKNSDVTEAIQKVAAAYDC  506
            TGR ADVI AA+  AE ALRLV+PG +N+ VTEA  K+A ++ C
Sbjct  135  TGRKADVIKAAHLCAEAALRLVKPGNQNTQVTEAWNKIAQSFKC  178



>gb|ACO10060.1| Proliferation-associated protein 2G4 [Osmerus mordax]
Length=391

 Score =   154 bits (390),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 87/164 (53%), Positives = 116/164 (71%), Gaps = 5/164 (3%)
 Frame = +3

Query  27   VVTKYKSAAEILNKGLELVVSQCKPNAKIVDICEKGDAFIREQTGNMYKNVKKKIERGVA  206
            VVTKYK   +I N+ L +V+        ++ +C KGDA I  +TG ++K  +K I++G+A
Sbjct  15   VVTKYKMGGDIANQALRMVMEAATAGVSVLSLCVKGDAHIMAETGKVFKK-EKDIKKGIA  73

Query  207  FPTCISVNNTVCHFSPLSND-DTVLEDGDMVKIDMGCHIDGFIAVVGHTHLL---QEGPV  374
            FPT +SVNN VCHFSPL +D D  L+DGD+VKID+G HIDGFIA V H+ ++   +E PV
Sbjct  74   FPTSVSVNNCVCHFSPLKSDPDYTLKDGDLVKIDLGVHIDGFIANVAHSFVIGATKETPV  133

Query  375  TGRaadviaaantaaevaLRLVRPGKKNSDVTEAIQKVAAAYDC  506
            TGR ADVI AA+  AE ALRLV+PG +NS VTEA  K+A ++ C
Sbjct  134  TGRKADVIKAAHLCAEAALRLVKPGNQNSQVTEAWNKIAQSFKC  177



>ref|XP_002734317.1| PREDICTED: proliferation-associated protein 2G4-like isoform 
X1 [Saccoglossus kowalevskii]
Length=396

 Score =   154 bits (390),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 90/165 (55%), Positives = 123/165 (75%), Gaps = 5/165 (3%)
 Frame = +3

Query  27   VVTKYKSAAEILNKGLELVVSQCKPNAKIVDICEKGDAFIREQTGNMYKNVKKKIERGVA  206
            VVTKYK   EI+N+ +  +V + K     + +CE GD  I E+T  +YK  +K++++G+A
Sbjct  16   VVTKYKMVGEIVNRIVRKLVEKAKDGESSLGLCEFGDTMILEETTKVYKK-EKEMKKGIA  74

Query  207  FPTCISVNNTVCHFSPLSND-DTVLEDGDMVKIDMGCHIDGFIAVVGHTHLL---QEGPV  374
            FPTC+S+NN VCHFSPL +D D +L+DGD+VKID+G HIDGFIAVV HT ++   ++  V
Sbjct  75   FPTCVSINNGVCHFSPLKSDPDVLLKDGDVVKIDLGAHIDGFIAVVAHTFVVGASKDNKV  134

Query  375  TGRaadviaaantaaevaLRLVRPGKKNSDVTEAIQKVAAAYDCK  509
            +GR ADVI AA+ AAE ALRLV+PG +NS VT+ IQKVA AY+C+
Sbjct  135  SGRKADVIVAAHQAAEAALRLVKPGNENSLVTDTIQKVAEAYNCQ  179



>emb|CDQ78322.1| unnamed protein product [Oncorhynchus mykiss]
Length=412

 Score =   155 bits (391),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 85/164 (52%), Positives = 119/164 (73%), Gaps = 5/164 (3%)
 Frame = +3

Query  27   VVTKYKSAAEILNKGLELVVSQCKPNAKIVDICEKGDAFIREQTGNMYKNVKKKIERGVA  206
            VVTKYK  AEI N+ L+ VV   K    +V +C KGDAFI  +TG +++  +K +++G+A
Sbjct  17   VVTKYKMGAEIANQALKAVVEAAKAGETVVSLCAKGDAFIMAETGKVFRK-EKDLKKGIA  75

Query  207  FPTCISVNNTVCHFSPLSND-DTVLEDGDMVKIDMGCHIDGFIAVVGHTHLL---QEGPV  374
            FPT +SVNN VCHFSPL +D + VL+ GD+VKID+G H+DGFI+ + H+ ++   ++ P+
Sbjct  76   FPTSVSVNNCVCHFSPLKSDPEIVLKGGDLVKIDLGVHVDGFISNLAHSFVVGVTKDAPL  135

Query  375  TGRaadviaaantaaevaLRLVRPGKKNSDVTEAIQKVAAAYDC  506
            TGR ADVI AA+  AE ALRLV+PG +NS VTEA  K+A ++ C
Sbjct  136  TGRKADVIKAAHLCAEAALRLVKPGNQNSQVTEAWNKIAKSFKC  179



>ref|XP_003223249.1| PREDICTED: proliferation-associated protein 2G4 [Anolis carolinensis]
Length=394

 Score =   154 bits (390),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 86/172 (50%), Positives = 120/172 (70%), Gaps = 5/172 (3%)
 Frame = +3

Query  3    ELDLTTPEVVTKYKSAAEILNKGLELVVSQCKPNAKIVDICEKGDAFIREQTGNMYKNVK  182
            EL +    VV KYK   EI N+ L  V    KP   ++ +CE+GD  I E+TG ++K  +
Sbjct  9    ELTIAEDVVVNKYKMGGEIANRTLRTVTETAKPGVSVLSLCERGDEMIMEETGKIFKK-E  67

Query  183  KKIERGVAFPTCISVNNTVCHFSPLSND-DTVLEDGDMVKIDMGCHIDGFIAVVGHTHLL  359
            K +++G+AFPT ISVNN VCHFSPL +D D +L++GD+VKID+G H+DGFI+ V H+ ++
Sbjct  68   KDMKKGIAFPTSISVNNCVCHFSPLKSDQDYILKEGDLVKIDLGVHVDGFISNVAHSFVI  127

Query  360  ---QEGPVTGRaadviaaantaaevaLRLVRPGKKNSDVTEAIQKVAAAYDC  506
               +E  VTGR ADVI AA+  AE ALRLV+PG +NS VT+A  K+A +++C
Sbjct  128  GASKESLVTGRKADVIKAAHLCAEAALRLVKPGNQNSQVTDAWNKIAHSFNC  179



>ref|NP_001085830.1| ErbB3-binding protein 1 [Xenopus laevis]
 gb|AAH73401.1| MGC80858 protein [Xenopus laevis]
Length=390

 Score =   154 bits (389),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 85/164 (52%), Positives = 119/164 (73%), Gaps = 5/164 (3%)
 Frame = +3

Query  27   VVTKYKSAAEILNKGLELVVSQCKPNAKIVDICEKGDAFIREQTGNMYKNVKKKIERGVA  206
            VVTKYK   +I N+ L  ++      A ++++CEKGDA I E+TG ++K  +K++++G+A
Sbjct  17   VVTKYKMGGDIANRVLRTLLDTATAGASLLNLCEKGDAMIMEETGKIFKK-EKEMKKGIA  75

Query  207  FPTCISVNNTVCHFSPLSND-DTVLEDGDMVKIDMGCHIDGFIAVVGHTHLL---QEGPV  374
            FPT ISVNN VCHFSPL +D D +L+DGD+VKID+G H+DGFIA V H+ ++   +E PV
Sbjct  76   FPTSISVNNCVCHFSPLKSDQDYLLKDGDLVKIDLGVHVDGFIANVAHSFVVGASKECPV  135

Query  375  TGRaadviaaantaaevaLRLVRPGKKNSDVTEAIQKVAAAYDC  506
            TGR ADVI AA+   E ALRLV+PG +N+ VTEA  K++  + C
Sbjct  136  TGRKADVIKAAHLCGEAALRLVKPGNQNTQVTEAWNKISPEFKC  179



>ref|XP_003963121.1| PREDICTED: proliferation-associated protein 2G4-like [Takifugu 
rubripes]
Length=392

 Score =   154 bits (388),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 79/164 (48%), Positives = 121/164 (74%), Gaps = 5/164 (3%)
 Frame = +3

Query  27   VVTKYKSAAEILNKGLELVVSQCKPNAKIVDICEKGDAFIREQTGNMYKNVKKKIERGVA  206
            VVTK+K  A+I N+ L++VV        ++ +CEKGD +I E+ G ++K  +K++++G+A
Sbjct  17   VVTKFKMGADIANRALKMVVEAAVAGTSVLSLCEKGDTYIMEEIGKIFKK-EKEMKKGIA  75

Query  207  FPTCISVNNTVCHFSPLSND-DTVLEDGDMVKIDMGCHIDGFIAVVGHTHLL---QEGPV  374
            FPTC+SVNN VCHFSP+ +D + +L+DGD+VKID+G H+DGFI+ V H+ ++   ++ P 
Sbjct  76   FPTCVSVNNCVCHFSPVKSDPNVILKDGDLVKIDLGVHVDGFISNVAHSLIVGVTKDNPQ  135

Query  375  TGRaadviaaantaaevaLRLVRPGKKNSDVTEAIQKVAAAYDC  506
            TGR AD++ AA+  AE ALRLV+PG +N+ VTEA  K+A ++ C
Sbjct  136  TGRKADLMMAAHLCAEAALRLVKPGNQNTQVTEAWNKIAKSFKC  179



>ref|XP_005371237.1| PREDICTED: proliferation-associated protein 2G4 [Microtus ochrogaster]
Length=394

 Score =   154 bits (388),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 87/164 (53%), Positives = 118/164 (72%), Gaps = 5/164 (3%)
 Frame = +3

Query  27   VVTKYKSAAEILNKGLELVVSQCKPNAKIVDICEKGDAFIREQTGNMYKNVKKKIERGVA  206
            VVTKYK   +I N+ L  +V        ++ +CEKGDA I E+TG ++K  +K++++G+A
Sbjct  17   VVTKYKMGGDIANRVLRSLVDAASSGVSVLSLCEKGDAMIMEETGKIFKK-EKEMKKGIA  75

Query  207  FPTCISVNNTVCHFSPLSND-DTVLEDGDMVKIDMGCHIDGFIAVVGHTHLL---QEGPV  374
            FPT ISVNN VCHFSPL +D D +L++GD+VKID+G H+DGFIA V HT ++   Q   V
Sbjct  76   FPTSISVNNCVCHFSPLKSDQDYILKEGDLVKIDLGVHVDGFIANVAHTFVIGVAQGTQV  135

Query  375  TGRaadviaaantaaevaLRLVRPGKKNSDVTEAIQKVAAAYDC  506
            TGR ADVI AA+  AE ALRLV+PG +N+ VTEA  KVA +++C
Sbjct  136  TGRKADVIKAAHLCAEAALRLVKPGNQNTQVTEAWNKVAHSFNC  179



>ref|XP_002007862.1| GI13173 [Drosophila mojavensis]
 gb|EDW18338.1| GI13173 [Drosophila mojavensis]
Length=390

 Score =   153 bits (387),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 85/163 (52%), Positives = 119/163 (73%), Gaps = 3/163 (2%)
 Frame = +3

Query  27   VVTKYKSAAEILNKGLELVVSQCKPNAKIVDICEKGDAFIREQTGNMYKNVKKKIERGVA  206
            VVTKYK A EI+NK L+ V+  C  +A + +IC KGD  + E+TG +YK  +K++++G+A
Sbjct  17   VVTKYKLAGEIVNKTLKTVIELCVADASVREICTKGDNLLTEETGKVYKK-EKELKKGIA  75

Query  207  FPTCISVNNTVCHFSPLSND-DTVLEDGDMVKIDMGCHIDGFIAVVGHTHLL-QEGPVTG  380
            FPTC+SVNN VCHFSP  ND D  L+ GD+VKID+G HIDGFIAV  HT ++  +  ++G
Sbjct  76   FPTCLSVNNCVCHFSPAKNDADYTLKAGDVVKIDLGAHIDGFIAVAAHTIVVGADQKISG  135

Query  381  RaadviaaantaaevaLRLVRPGKKNSDVTEAIQKVAAAYDCK  509
            R ADVI AA  AA+ ALRL++ G  N  +T+A+Q+++ +Y CK
Sbjct  136  RQADVILAAYWAAQAALRLLKAGSSNYSITDAVQQISESYKCK  178



>ref|XP_001957516.1| GF10449 [Drosophila ananassae]
 gb|EDV40322.1| GF10449 [Drosophila ananassae]
Length=394

 Score =   153 bits (387),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 84/165 (51%), Positives = 117/165 (71%), Gaps = 5/165 (3%)
 Frame = +3

Query  27   VVTKYKSAAEILNKGLELVVSQCKPNAKIVDICEKGDAFIREQTGNMYKNVKKKIERGVA  206
            VVTKYK A EI+NK L+ V+  C  +A + DIC +GD  + E+TG +YK  +K +++G+A
Sbjct  17   VVTKYKLAGEIVNKTLKTVIGLCVADASVRDICTQGDNLLTEETGKVYKK-EKDLKKGIA  75

Query  207  FPTCISVNNTVCHFSPLSND-DTVLEDGDMVKIDMGCHIDGFIAVVGHTHLL---QEGPV  374
            FPTC+SVNN VCHFSP  ND D  L+ GD+VKID+G HIDGFIAV  HT ++    +  +
Sbjct  76   FPTCLSVNNCVCHFSPAKNDTDYTLKAGDVVKIDLGAHIDGFIAVAAHTVVVGASADQKI  135

Query  375  TGRaadviaaantaaevaLRLVRPGKKNSDVTEAIQKVAAAYDCK  509
            +GR ADVI AA  A + ALRL++ G  N  +T+A+Q+++ +Y CK
Sbjct  136  SGRQADVILAAYWAVQAALRLLKAGANNYSITDAVQQISESYKCK  180



>ref|XP_001647519.1| predicted protein [Nematostella vectensis]
 gb|EDO35730.1| predicted protein [Nematostella vectensis]
Length=397

 Score =   153 bits (387),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 90/165 (55%), Positives = 117/165 (71%), Gaps = 5/165 (3%)
 Frame = +3

Query  27   VVTKYKSAAEILNKGLELVVSQCKPNAKIVDICEKGDAFIREQTGNMYKNVKKKIERGVA  206
            VVTKYK A ++ N+ L  ++           +CEKGDA I E+T  +YK  +K++++G+A
Sbjct  21   VVTKYKMAGDMANRILLKLIEAANAGTTARTLCEKGDALILEETDKVYKK-EKELKKGIA  79

Query  207  FPTCISVNNTVCHFSPL-SNDDTVLEDGDMVKIDMGCHIDGFIAVVGHTHLL---QEGPV  374
            FPTCISVNN VCHFSPL S  D  L DGD+VKID G HIDGFIAV+GHT ++   +E  V
Sbjct  80   FPTCISVNNCVCHFSPLLSEPDITLNDGDLVKIDFGVHIDGFIAVIGHTIVVGCSKENKV  139

Query  375  TGRaadviaaantaaevaLRLVRPGKKNSDVTEAIQKVAAAYDCK  509
            TGR ADV+ AA  A+EVA R+V+PG +NS VTE +QKVA ++ CK
Sbjct  140  TGRKADVLLAAYLASEVAQRMVKPGAENSTVTELVQKVAESFKCK  184



>ref|XP_005335677.1| PREDICTED: proliferation-associated protein 2G4 [Ictidomys tridecemlineatus]
Length=394

 Score =   153 bits (387),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 88/164 (54%), Positives = 119/164 (73%), Gaps = 5/164 (3%)
 Frame = +3

Query  27   VVTKYKSAAEILNKGLELVVSQCKPNAKIVDICEKGDAFIREQTGNMYKNVKKKIERGVA  206
            VVTKYK   +I N+ L  +V    P   ++ +CEKGD  I E+TG ++K  +K++++G+A
Sbjct  17   VVTKYKMGGDIANRVLRSLVEASSPGVSVLSLCEKGDNMIMEETGKIFKK-EKEMKKGIA  75

Query  207  FPTCISVNNTVCHFSPLSND-DTVLEDGDMVKIDMGCHIDGFIAVVGHTHL--LQEG-PV  374
            FPT ISVNN VCHFSPL +D D +L++GD+VKID+G H+DGFIA V HT +  + EG  V
Sbjct  76   FPTSISVNNCVCHFSPLKSDQDYILKEGDLVKIDLGVHVDGFIANVAHTFVVGVAEGTQV  135

Query  375  TGRaadviaaantaaevaLRLVRPGKKNSDVTEAIQKVAAAYDC  506
            TGR ADVI AA+  AE ALRLV+PG +N+ VTEA  KVA +++C
Sbjct  136  TGRKADVIKAAHLCAEAALRLVKPGNQNTQVTEAWNKVAHSFNC  179



>ref|XP_007533407.1| PREDICTED: proliferation-associated protein 2G4 [Erinaceus europaeus]
Length=394

 Score =   153 bits (386),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 87/164 (53%), Positives = 118/164 (72%), Gaps = 5/164 (3%)
 Frame = +3

Query  27   VVTKYKSAAEILNKGLELVVSQCKPNAKIVDICEKGDAFIREQTGNMYKNVKKKIERGVA  206
            VVTKYK   +I N+ L  +V        ++ +CEKGDA I E+TG ++K  +K++++G+A
Sbjct  17   VVTKYKMGGDIANRVLRSLVEASNSGVSVLSLCEKGDAMIMEETGKIFKK-EKEMKKGIA  75

Query  207  FPTCISVNNTVCHFSPLSND-DTVLEDGDMVKIDMGCHIDGFIAVVGHTHLL---QEGPV  374
            FPT ISVNN VCHFSPL +D D +L++GD+VKID+G H+DGFIA V HT ++   Q   V
Sbjct  76   FPTSISVNNCVCHFSPLKSDQDYILKEGDLVKIDLGVHVDGFIANVAHTFVVNVAQGTQV  135

Query  375  TGRaadviaaantaaevaLRLVRPGKKNSDVTEAIQKVAAAYDC  506
            TGR ADVI AA+  AE ALRLV+PG +N+ VTEA  KVA +++C
Sbjct  136  TGRKADVIKAAHLCAEAALRLVKPGNQNTQVTEAWNKVAHSFNC  179



>ref|XP_005680429.1| PREDICTED: proliferation-associated protein 2G4 isoform X2 [Capra 
hircus]
Length=323

 Score =   151 bits (382),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 87/164 (53%), Positives = 118/164 (72%), Gaps = 5/164 (3%)
 Frame = +3

Query  27   VVTKYKSAAEILNKGLELVVSQCKPNAKIVDICEKGDAFIREQTGNMYKNVKKKIERGVA  206
            VVTKYK   +I N+ L  +V        ++ +CEKGDA I E+TG ++K  +K++++G+A
Sbjct  17   VVTKYKMGGDIANRVLRSLVEASCSGVSVLSLCEKGDAMIMEETGKIFKK-EKEMKKGIA  75

Query  207  FPTCISVNNTVCHFSPLSND-DTVLEDGDMVKIDMGCHIDGFIAVVGHTHLL---QEGPV  374
            FPT ISVNN VCHFSPL +D D +L++GD+VKID+G H+DGFIA V HT ++   Q   V
Sbjct  76   FPTSISVNNCVCHFSPLKSDQDYILKEGDLVKIDLGVHVDGFIANVAHTFVVDVAQGTQV  135

Query  375  TGRaadviaaantaaevaLRLVRPGKKNSDVTEAIQKVAAAYDC  506
            TGR ADVI AA+  AE ALRLV+PG +N+ VTEA  KVA +++C
Sbjct  136  TGRKADVIKAAHLCAEAALRLVKPGNQNTQVTEAWNKVAHSFNC  179



>gb|AAC34392.1| PAS1 [Takifugu rubripes]
Length=392

 Score =   153 bits (386),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 79/164 (48%), Positives = 121/164 (74%), Gaps = 5/164 (3%)
 Frame = +3

Query  27   VVTKYKSAAEILNKGLELVVSQCKPNAKIVDICEKGDAFIREQTGNMYKNVKKKIERGVA  206
            VVTK+K  A+I N+ L++VV        ++ +CEKGD +I E+ G ++K  +K++++G+A
Sbjct  17   VVTKFKMGADIANRKLKMVVEAAVAGTSVLSLCEKGDTYIMEEIGKIFKK-EKEMKKGIA  75

Query  207  FPTCISVNNTVCHFSPLSND-DTVLEDGDMVKIDMGCHIDGFIAVVGHTHLL---QEGPV  374
            FPTC+SVNN VCHFSP+ +D + +L+DGD+VKID+G H+DGFI+ V H+ ++   ++ P 
Sbjct  76   FPTCVSVNNCVCHFSPVKSDPNVILKDGDLVKIDLGVHVDGFISNVAHSLIVGVTKDNPQ  135

Query  375  TGRaadviaaantaaevaLRLVRPGKKNSDVTEAIQKVAAAYDC  506
            TGR AD++ AA+  AE ALRLV+PG +N+ VTEA  K+A ++ C
Sbjct  136  TGRKADLMMAAHLCAEAALRLVKPGNQNTQVTEAWNKIAKSFKC  179



>emb|CAG07405.1| unnamed protein product [Tetraodon nigroviridis]
Length=406

 Score =   153 bits (387),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 80/164 (49%), Positives = 120/164 (73%), Gaps = 5/164 (3%)
 Frame = +3

Query  27   VVTKYKSAAEILNKGLELVVSQCKPNAKIVDICEKGDAFIREQTGNMYKNVKKKIERGVA  206
            VVTK+K  A+I N+ L+++V        ++ +C KGDAFI E+TG ++K  +K++++G+A
Sbjct  17   VVTKFKMGADIANRALKMLVEAAVAGTSVLSLCVKGDAFILEETGKIFKK-EKEMKKGIA  75

Query  207  FPTCISVNNTVCHFSPLSND-DTVLEDGDMVKIDMGCHIDGFIAVVGHTHLL---QEGPV  374
            FPTC+SVNN VCHFSP+ +D D  L+DGD+VKID+G H+DGFI+ V H+ ++   ++ P 
Sbjct  76   FPTCVSVNNCVCHFSPVKSDPDVTLKDGDLVKIDLGIHVDGFISNVAHSLIVGVTKDNPQ  135

Query  375  TGRaadviaaantaaevaLRLVRPGKKNSDVTEAIQKVAAAYDC  506
            TGR AD++ AA+  AE ALRLV+PG +N+ VT+   K+A A+ C
Sbjct  136  TGRKADLMMAAHLCAEAALRLVKPGNQNTQVTDTWNKIAKAFKC  179



>gb|KIZ00762.1| hypothetical protein MNEG_7198 [Monoraphidium neglectum]
Length=383

 Score =   152 bits (385),  Expect = 5e-41, Method: Compositional matrix adjust.
 Identities = 89/173 (51%), Positives = 123/173 (71%), Gaps = 6/173 (3%)
 Frame = +3

Query  3    ELDLTTPEVVTKYKSAAEILNKGLELVVSQCKPNAKIVDICEKGDAFIREQTGNMYKNVK  182
            ELDL+  +VVTKYK+AAEI NK +   V   K  AK+VD+C  GD  I ++  N++K   
Sbjct  6    ELDLSNSDVVTKYKAAAEICNKAISAAVEASKDGAKVVDVCRIGDDVITKEVQNIFKG--  63

Query  183  KKIERGVAFPTCISVNNTVCHFSPLSNDDTVLEDGDMVKIDMGCHIDGFIAVVGHTHLLQ  362
            KK E+G+AFPTC+SVN+ V HFSP ++D T ++DGD+VKID+GCHIDG+IA    T  + 
Sbjct  64   KKFEKGIAFPTCVSVNSVVGHFSPATDDTTTIKDGDLVKIDLGCHIDGWIATQATTIQVA  123

Query  363  EG----PVTGRaadviaaantaaevaLRLVRPGKKNSDVTEAIQKVAAAYDCK  509
             G    P+TGRAADV+AAA TA +VA+RL++PGKK S+V++ + K    + C+
Sbjct  124  AGGVATPITGRAADVVAAARTAFDVAIRLIKPGKKVSEVSDKLVKAVEPFGCQ  176



>gb|EFX72560.1| hypothetical protein DAPPUDRAFT_308181 [Daphnia pulex]
Length=387

 Score =   152 bits (385),  Expect = 6e-41, Method: Compositional matrix adjust.
 Identities = 82/165 (50%), Positives = 120/165 (73%), Gaps = 5/165 (3%)
 Frame = +3

Query  27   VVTKYKSAAEILNKGLELVVSQCKPNAKIVDICEKGDAFIREQTGNMYKNVKKKIERGVA  206
            VVTKYK A EI N+ ++ V++QC   A + ++C  GD  + E+T  ++K  +K++++G+A
Sbjct  18   VVTKYKMAGEISNRVIQGVIAQCVAGASVRELCTLGDKLLLEETVKVFKK-EKELKKGIA  76

Query  207  FPTCISVNNTVCHFSPLSND-DTVLEDGDMVKIDMGCHIDGFIAVVGHTHLLQEGP---V  374
            FPTC+SVNN VCHFSPL++D D  L+DGD+VKID+G H+DGFIA V HT ++   P   +
Sbjct  77   FPTCLSVNNCVCHFSPLASDADVELKDGDVVKIDLGAHVDGFIASVAHTVVVGSSPSTKI  136

Query  375  TGRaadviaaantaaevaLRLVRPGKKNSDVTEAIQKVAAAYDCK  509
            TGR AD++ AA+ A+E ALRL++PG +N  VT  +Q +A +Y CK
Sbjct  137  TGRKADILLAAHYASEAALRLMKPGTENQAVTSVVQTIAESYKCK  181



>ref|NP_997806.1| proliferation-associated 2G4-like [Danio rerio]
 gb|AAH56591.1| Proliferation-associated 2G4 ,b [Danio rerio]
 gb|AAH71536.1| Proliferation-associated 2G4 ,b [Danio rerio]
Length=394

 Score =   152 bits (385),  Expect = 6e-41, Method: Compositional matrix adjust.
 Identities = 87/164 (53%), Positives = 120/164 (73%), Gaps = 5/164 (3%)
 Frame = +3

Query  27   VVTKYKSAAEILNKGLELVVSQCKPNAKIVDICEKGDAFIREQTGNMYKNVKKKIERGVA  206
            VVTKYK  A+I N  L+ V+   KP   ++ +CEKGDAFI  +T +     +K+I++G+A
Sbjct  17   VVTKYKMGADIANLALKTVIEAAKPGVSVLSLCEKGDAFIAAET-SKVFKKEKEIKKGIA  75

Query  207  FPTCISVNNTVCHFSPLSND-DTVLEDGDMVKIDMGCHIDGFIAVVGHTHLL---QEGPV  374
            FPTC+SVNN VCHFSP+ +D D +L+DGD+VKID+G H+DGFI+ V H+ ++   ++ PV
Sbjct  76   FPTCVSVNNCVCHFSPIKSDPDYMLKDGDLVKIDLGVHVDGFISNVAHSFVVGATKDAPV  135

Query  375  TGRaadviaaantaaevaLRLVRPGKKNSDVTEAIQKVAAAYDC  506
            TGR ADVI AA+  AE ALRLV+PG +NS VTEA  K+A ++ C
Sbjct  136  TGRKADVIKAAHLCAEAALRLVKPGNQNSQVTEAWNKIAQSFKC  179



>ref|XP_007559711.1| PREDICTED: proliferation-associated protein 2G4 [Poecilia formosa]
Length=391

 Score =   152 bits (385),  Expect = 6e-41, Method: Compositional matrix adjust.
 Identities = 84/164 (51%), Positives = 117/164 (71%), Gaps = 5/164 (3%)
 Frame = +3

Query  27   VVTKYKSAAEILNKGLELVVSQCKPNAKIVDICEKGDAFIREQTGNMYKNVKKKIERGVA  206
            VVTKYK   +I  + L  VV   K    ++ +CE GDA+I  +TG ++K  +K++++G+A
Sbjct  15   VVTKYKMGGDIATQALRKVVEAAKAGISVLSLCEVGDAYIMTETGKVFKK-EKEMKKGIA  73

Query  207  FPTCISVNNTVCHFSPLSND-DTVLEDGDMVKIDMGCHIDGFIAVVGHTHLL---QEGPV  374
            FPT +SVNN VCHFSPL +D D  L+DGD+VKID+G H+DGFIA V H+ ++   +E P+
Sbjct  74   FPTSVSVNNCVCHFSPLKSDPDYTLKDGDLVKIDLGVHVDGFIANVAHSFIVGASKENPI  133

Query  375  TGRaadviaaantaaevaLRLVRPGKKNSDVTEAIQKVAAAYDC  506
            TGR ADVI AA+  AE ALRLV+PG +N+ VTEA  K+A ++ C
Sbjct  134  TGRKADVIKAAHLCAEAALRLVKPGNQNTQVTEAWNKIAHSFKC  177



>ref|XP_003689614.1| PREDICTED: proliferation-associated protein 2G4-like [Apis florea]
Length=387

 Score =   152 bits (384),  Expect = 7e-41, Method: Compositional matrix adjust.
 Identities = 80/165 (48%), Positives = 121/165 (73%), Gaps = 5/165 (3%)
 Frame = +3

Query  27   VVTKYKSAAEILNKGLELVVSQCKPNAKIVDICEKGDAFIREQTGNMYKNVKKKIERGVA  206
            VVTKYK A +I+N+ L+ V+ +C   A + +ICE GD  I ++T  ++K  +K++++G+A
Sbjct  16   VVTKYKMAGDIVNRVLKQVLDKCTAGASVREICEFGDKLILDETSKIFKK-EKELKKGIA  74

Query  207  FPTCISVNNTVCHFSPLSND-DTVLEDGDMVKIDMGCHIDGFIAVVGHTHLLQEGP---V  374
            FPTCISVNN +CHFSP++++ D +L+D DMVK+D+G H+DGFIAVV HT ++   P   V
Sbjct  75   FPTCISVNNCICHFSPIASEPDLILKDEDMVKVDLGAHVDGFIAVVAHTIIIGSSPTKKV  134

Query  375  TGRaadviaaantaaevaLRLVRPGKKNSDVTEAIQKVAAAYDCK  509
            TGR ADV+ AA+ A++ ALRL++PG +   +TE ++K+   Y CK
Sbjct  135  TGRKADVVLAAHFASQAALRLLQPGTETYTITETVEKICDVYKCK  179



>ref|XP_008408124.1| PREDICTED: proliferation-associated protein 2G4 [Poecilia reticulata]
Length=391

 Score =   152 bits (384),  Expect = 7e-41, Method: Compositional matrix adjust.
 Identities = 85/164 (52%), Positives = 118/164 (72%), Gaps = 5/164 (3%)
 Frame = +3

Query  27   VVTKYKSAAEILNKGLELVVSQCKPNAKIVDICEKGDAFIREQTGNMYKNVKKKIERGVA  206
            VVTKYK   +I ++ L  VV   K    ++ +CE GDA+I  +TG ++K  +K++++G+A
Sbjct  15   VVTKYKMGGDIASQALRKVVEAAKVGISVLSLCEVGDAYIMTETGKVFKK-EKEMKKGIA  73

Query  207  FPTCISVNNTVCHFSPLSND-DTVLEDGDMVKIDMGCHIDGFIAVVGHTHLL---QEGPV  374
            FPT ISVNN VCHFSPL +D D  L+DGD+VKID+G H+DGFIA V H+ ++   +E P+
Sbjct  74   FPTSISVNNCVCHFSPLKSDPDYTLKDGDLVKIDLGVHVDGFIANVAHSFVVGASKENPI  133

Query  375  TGRaadviaaantaaevaLRLVRPGKKNSDVTEAIQKVAAAYDC  506
            TGR ADVI AA+  AE ALRLV+PG +N+ VTEA  K+A ++ C
Sbjct  134  TGRKADVIKAAHLCAEAALRLVKPGNQNTQVTEAWNKIAHSFKC  177



>gb|AFM85909.1| proliferation-associated 2G4, partial [Callorhinchus milii]
Length=365

 Score =   152 bits (383),  Expect = 7e-41, Method: Compositional matrix adjust.
 Identities = 83/164 (51%), Positives = 118/164 (72%), Gaps = 5/164 (3%)
 Frame = +3

Query  27   VVTKYKSAAEILNKGLELVVSQCKPNAKIVDICEKGDAFIREQTGNMYKNVKKKIERGVA  206
            VVTKYK   +I N+ L  VV   K    +  +CEKGDA I E+TG ++K  +K++++G+A
Sbjct  16   VVTKYKMGGDIANRVLRTVVEAAKEGESVFSLCEKGDAMIMEETGKIFKK-EKEMKKGIA  74

Query  207  FPTCISVNNTVCHFSPLSND-DTVLEDGDMVKIDMGCHIDGFIAVVGHTHLL---QEGPV  374
            FPTC+SVNN VCH+SPL +D D +L+D D+VK+D+G H+DGFIA V H+ ++   ++ P+
Sbjct  75   FPTCVSVNNCVCHYSPLKSDPDYILKDEDLVKVDLGVHVDGFIANVAHSFIVGIKKDKPL  134

Query  375  TGRaadviaaantaaevaLRLVRPGKKNSDVTEAIQKVAAAYDC  506
            TGR ADVI AA+  AE ALRLV+ G +N+ VTEA  K+A ++ C
Sbjct  135  TGRKADVIKAAHLCAEAALRLVKSGNQNTQVTEAWNKIAQSFKC  178



>ref|XP_005799891.1| PREDICTED: proliferation-associated protein 2G4-like [Xiphophorus 
maculatus]
Length=391

 Score =   152 bits (384),  Expect = 8e-41, Method: Compositional matrix adjust.
 Identities = 84/164 (51%), Positives = 117/164 (71%), Gaps = 5/164 (3%)
 Frame = +3

Query  27   VVTKYKSAAEILNKGLELVVSQCKPNAKIVDICEKGDAFIREQTGNMYKNVKKKIERGVA  206
            VVTKYK   +I  + L  VV   K    ++ +CE GDA+I  +TG ++K  +K++++G+A
Sbjct  15   VVTKYKMGGDIATQALRKVVEAAKAGISVLSLCEVGDAYIMTETGKVFKK-EKEMKKGIA  73

Query  207  FPTCISVNNTVCHFSPLSND-DTVLEDGDMVKIDMGCHIDGFIAVVGHTHLL---QEGPV  374
            FPT +SVNN VCHFSPL +D D  L+DGD+VKID+G H+DGFIA V H+ ++   +E P+
Sbjct  74   FPTSVSVNNCVCHFSPLKSDPDYTLKDGDLVKIDLGVHVDGFIANVAHSFVVGAKKENPI  133

Query  375  TGRaadviaaantaaevaLRLVRPGKKNSDVTEAIQKVAAAYDC  506
            TGR ADVI AA+  AE ALRLV+PG +N+ VTEA  K+A ++ C
Sbjct  134  TGRKADVIKAAHLCAEAALRLVKPGNQNTQVTEAWNKIAHSFKC  177



>ref|WP_028832180.1| hypothetical protein [Proteobacteria bacterium JGI 0000113-E04]
Length=392

 Score =   152 bits (383),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 89/168 (53%), Positives = 117/168 (70%), Gaps = 6/168 (4%)
 Frame = +3

Query  9    DLTTPEVVTKYKSAAEILNKGLELVVSQCKPNAKIVDICEKGDAFIREQTGNMYKNVKKK  188
            DL+   V+TKYK +AEI+ K LE V+SQC  +  + +IC  G+  +  Q  N++K+  KK
Sbjct  17   DLSNDTVMTKYKMSAEIVQKTLEGVISQCVADKSVSEICAFGNLVVEAQCKNIFKS--KK  74

Query  189  IERGVAFPTCISVNNTVCHFSPLSNDDTVLEDGDMVKIDMGCHIDGFIAVVGHTHLL---  359
            +E+G+AFPTCISVNN VCH SPL  D T L+DGD+VKID+G H+DGFIAVV HTH++   
Sbjct  75   VEKGLAFPTCISVNNCVCHNSPLPADSTTLKDGDVVKIDIGAHVDGFIAVVAHTHVVGRT  134

Query  360  -QEGPVTGRaadviaaantaaevaLRLVRPGKKNSDVTEAIQKVAAAY  500
                P+TG  ADV+ A N AA+VAL  ++ G  N+ VTEAI KVA  Y
Sbjct  135  ENSEPITGPLADVLQAGNDAAKVALMTLKVGNTNAMVTEAIAKVAKTY  182



>ref|XP_004525166.1| PREDICTED: proliferation-associated protein 2G4-like [Ceratitis 
capitata]
Length=405

 Score =   152 bits (383),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 84/165 (51%), Positives = 116/165 (70%), Gaps = 5/165 (3%)
 Frame = +3

Query  27   VVTKYKSAAEILNKGLELVVSQCKPNAKIVDICEKGDAFIREQTGNMYKNVKKKIERGVA  206
            VVTKYK A EI+NK L+ V+  C   A + DIC KGD  I ++T  ++K  +K +++G+A
Sbjct  18   VVTKYKLAGEIVNKTLKAVIDLCVAEASVRDICTKGDNLITDETSKVHKK-EKDLKKGIA  76

Query  207  FPTCISVNNTVCHFSPLSND-DTVLEDGDMVKIDMGCHIDGFIAVVGHTHLL---QEGPV  374
            FPTC+SVNN VCHFSP  ND D  L++GD+VKID+G HIDGFIAV  HT ++    +  V
Sbjct  77   FPTCLSVNNCVCHFSPSKNDSDYTLKEGDVVKIDLGAHIDGFIAVAAHTVVIGASNDKKV  136

Query  375  TGRaadviaaantaaevaLRLVRPGKKNSDVTEAIQKVAAAYDCK  509
            TGR ADV+ AA  A + ALRL++ G  N  +T+A+Q+++ +Y CK
Sbjct  137  TGRQADVVLAAYWAVQAALRLLKAGNSNYTITDAVQQISESYKCK  181



>ref|XP_002508417.1| predicted protein [Micromonas sp. RCC299]
 gb|ACO69675.1| predicted protein [Micromonas sp. RCC299]
Length=376

 Score =   151 bits (382),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 88/169 (52%), Positives = 109/169 (64%), Gaps = 6/169 (4%)
 Frame = +3

Query  3    ELDLTTPEVVTKYKSAAEILNKGLELVVSQCKPNAKIVDICEKGDAFIREQTGNMYKNVK  182
            E     P VV KYK AAEI NK L + ++ CKP AKIVDIC  GD  + E+    Y    
Sbjct  13   ETTCANPAVVDKYKVAAEIANKALAVALAACKPGAKIVDICNLGDKTVEEEAAKFYNKKD  72

Query  183  K---KIERGVAFPTCISVNNTVCHFSPLSNDDTVLEDGDMVKIDMGCHIDGFIAVVGHTH  353
            K   KIE+G+AFPTCISVN+ VCH SP S+D T LE+G  VKID+G H+DG++A V HT 
Sbjct  73   KDGNKIEKGIAFPTCISVNHQVCHNSPPSDDATSLEEGQAVKIDLGAHVDGYVATVAHTV  132

Query  354  LL---QEGPVTGRaadviaaantaaevaLRLVRPGKKNSDVTEAIQKVA  491
            +L      PV G  ADV+ A  TA E A+R +RPG  NS+V +AI +VA
Sbjct  133  VLMGDMNAPVVGAQADVMKAVVTAGEAAIRKLRPGVNNSEVAKAIGRVA  181



>ref|XP_011419861.1| PREDICTED: proliferation-associated protein 2G4-like [Crassostrea 
gigas]
 gb|EKC33716.1| Proliferation-associated protein 2G4 [Crassostrea gigas]
Length=384

 Score =   151 bits (382),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 86/165 (52%), Positives = 123/165 (75%), Gaps = 5/165 (3%)
 Frame = +3

Query  27   VVTKYKSAAEILNKGLELVVSQCKPNAKIVDICEKGDAFIREQTGNMYKNVKKKIERGVA  206
            VVTKYK A +++N  ++ +V++C    KI  IC+ GD+ ++E+T  ++K   K++++G+A
Sbjct  16   VVTKYKMAGDMVNGIMQELVTKCVAGEKINTICDFGDSRLQEETSRVFKK-DKEMKKGIA  74

Query  207  FPTCISVNNTVCHFSPLSND-DTVLEDGDMVKIDMGCHIDGFIAVVGHTHLL---QEGPV  374
            FPTC+SVNN +CHFSPL +D D  L DGD+VKID+G  IDG+IAV+ HT ++   +E  V
Sbjct  75   FPTCVSVNNCICHFSPLKSDPDKELADGDVVKIDLGAQIDGYIAVIAHTLVVGASKENKV  134

Query  375  TGRaadviaaantaaevaLRLVRPGKKNSDVTEAIQKVAAAYDCK  509
             GR ADVI AA+ A+E ALRLV+PG +N+ VTEA+QKVA +Y CK
Sbjct  135  KGRKADVIMAAHLASEAALRLVKPGNENNMVTEAVQKVAESYKCK  179



>gb|ERL94099.1| hypothetical protein D910_11381 [Dendroctonus ponderosae]
Length=820

 Score =   155 bits (393),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 86/165 (52%), Positives = 119/165 (72%), Gaps = 5/165 (3%)
 Frame = +3

Query  27   VVTKYKSAAEILNKGLELVVSQCKPNAKIVDICEKGDAFIREQTGNMYKNVKKKIERGVA  206
            VVTKYK A EI+N+ L+LV+++C P A +  +C  GD  + E+TG ++K   K +++G+A
Sbjct  16   VVTKYKMAGEIVNRILKLVIAKCVPGASVKAVCLYGDELLTEETGKVFKK-DKDLKKGIA  74

Query  207  FPTCISVNNTVCHFSPL-SNDDTVLEDGDMVKIDMGCHIDGFIAVVGHTHLLQEGPV---  374
            FPTC+SVNN +CHFSP+ S  D VL+ GD+ KID+G H+DGFIAVV HT ++   PV   
Sbjct  75   FPTCVSVNNCICHFSPVPSEPDCVLKAGDVAKIDLGAHVDGFIAVVAHTIIVGANPVEKI  134

Query  375  TGRaadviaaantaaevaLRLVRPGKKNSDVTEAIQKVAAAYDCK  509
            TGR ADVI AA+ A++ ALRL++PG     +TEA+QK A A+ CK
Sbjct  135  TGRKADVILAAHYASQAALRLLKPGNDTYAITEAVQKAAEAFKCK  179



>ref|XP_003703942.1| PREDICTED: proliferation-associated protein 2G4-like [Megachile 
rotundata]
Length=387

 Score =   151 bits (382),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 82/165 (50%), Positives = 121/165 (73%), Gaps = 5/165 (3%)
 Frame = +3

Query  27   VVTKYKSAAEILNKGLELVVSQCKPNAKIVDICEKGDAFIREQTGNMYKNVKKKIERGVA  206
            VVTKYK A EI+N+ L+ V+ +C   A + +ICE GD  + E+T  ++K  +K++++G+A
Sbjct  16   VVTKYKMAGEIVNRVLKQVLDKCIVGASVREICEYGDKLLLEETSKVFKK-EKELKKGIA  74

Query  207  FPTCISVNNTVCHFSPLSND-DTVLEDGDMVKIDMGCHIDGFIAVVGHTHLL---QEGPV  374
            FPTCISVNN +CHFSP++++ D +L+D DMVK+D+G HIDGFIAVV HT ++    E  V
Sbjct  75   FPTCISVNNCICHFSPIASEPDLILKDEDMVKVDLGAHIDGFIAVVAHTIVIGSSSEKKV  134

Query  375  TGRaadviaaantaaevaLRLVRPGKKNSDVTEAIQKVAAAYDCK  509
            TGR ADV+ AA+ A++ ALRL++PG +   +T  ++K+  AY CK
Sbjct  135  TGRKADVVLAAHYASQAALRLLKPGTETYTITGTVEKICEAYKCK  179



>gb|ELT99251.1| hypothetical protein CAPTEDRAFT_152656 [Capitella teleta]
Length=387

 Score =   151 bits (382),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 82/173 (47%), Positives = 122/173 (71%), Gaps = 5/173 (3%)
 Frame = +3

Query  3    ELDLTTPEVVTKYKSAAEILNKGLELVVSQCKPNAKIVDICEKGDAFIREQTGNMYKNVK  182
            EL ++   VVTKY +AA+I N  + ++       +K++D+CEKGD FI E+T  ++++ K
Sbjct  9    ELTISDDSVVTKYNTAAKIANDAVAMLQKLTVAGSKVIDLCEKGDNFIIEETDKVFRS-K  67

Query  183  KKIERGVAFPTCISVNNTVCHFSPLSND-DTVLEDGDMVKIDMGCHIDGFIAVVGHTHLL  359
            K +++GVAFPTC+S N  +CHFSPL +D D  ++DGD+VKID+G HIDGF AV+ HT ++
Sbjct  68   KSMKKGVAFPTCVSTNACICHFSPLKSDPDVEIQDGDLVKIDLGAHIDGFSAVLAHTFVV  127

Query  360  ---QEGPVTGRaadviaaantaaevaLRLVRPGKKNSDVTEAIQKVAAAYDCK  509
                   VTGR ADVI AA+ A++ A+RLV+PG +N+ VT A+  +A ++ CK
Sbjct  128  GASTSNKVTGRKADVILAAHWASQAAMRLVKPGNQNTAVTSAVTTIAESFHCK  180



>gb|ELR50756.1| Proliferation-associated protein 2G4, partial [Bos mutus]
Length=395

 Score =   151 bits (382),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 87/164 (53%), Positives = 118/164 (72%), Gaps = 5/164 (3%)
 Frame = +3

Query  27   VVTKYKSAAEILNKGLELVVSQCKPNAKIVDICEKGDAFIREQTGNMYKNVKKKIERGVA  206
            VVTKYK   +I N+ L  +V        ++ +CEKGDA I E+TG ++K  +K++++G+A
Sbjct  18   VVTKYKMGGDIANRVLRSLVEASCSGVSVLSLCEKGDAMIMEETGKIFKK-EKEMKKGIA  76

Query  207  FPTCISVNNTVCHFSPLSND-DTVLEDGDMVKIDMGCHIDGFIAVVGHTHLL---QEGPV  374
            FPT ISVNN VCHFSPL +D D +L++GD+VKID+G H+DGFIA V HT ++   Q   V
Sbjct  77   FPTSISVNNCVCHFSPLKSDQDYILKEGDLVKIDLGVHVDGFIANVAHTFVVDVAQGTQV  136

Query  375  TGRaadviaaantaaevaLRLVRPGKKNSDVTEAIQKVAAAYDC  506
            TGR ADVI AA+  AE ALRLV+PG +N+ VTEA  KVA +++C
Sbjct  137  TGRKADVIKAAHLCAEAALRLVKPGNQNTQVTEAWNKVAHSFNC  180



>ref|XP_010865536.1| PREDICTED: proliferation-associated protein 2G4-like [Esox lucius]
Length=396

 Score =   151 bits (382),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 82/164 (50%), Positives = 118/164 (72%), Gaps = 5/164 (3%)
 Frame = +3

Query  27   VVTKYKSAAEILNKGLELVVSQCKPNAKIVDICEKGDAFIREQTGNMYKNVKKKIERGVA  206
            VVTKYK  A+I N+ ++ VV   +    +V +CE GDAFI  +TG +++  K + ++G+A
Sbjct  17   VVTKYKMGADIANQAMKTVVEAARAGVTVVSLCEMGDAFITAETGKVFRKEKDQ-KKGIA  75

Query  207  FPTCISVNNTVCHFSPLSND-DTVLEDGDMVKIDMGCHIDGFIAVVGHTHLL---QEGPV  374
            FPT +SVNN VCHFSPL +D + +L+DGD+VKID+G H+DGFI+ + H+ ++   +  P+
Sbjct  76   FPTSVSVNNCVCHFSPLKSDPEVILKDGDLVKIDLGVHVDGFISNLAHSFVVGVTKHTPL  135

Query  375  TGRaadviaaantaaevaLRLVRPGKKNSDVTEAIQKVAAAYDC  506
            TGR ADVI AA+  AE ALRLV+PG +NS VTEA  K+A ++ C
Sbjct  136  TGRKADVIKAAHLCAEAALRLVKPGNQNSQVTEAWNKIAKSFKC  179



>gb|ACO15498.1| Proliferation-associated protein 2G4 [Caligus clemensi]
Length=357

 Score =   150 bits (380),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 85/165 (52%), Positives = 115/165 (70%), Gaps = 5/165 (3%)
 Frame = +3

Query  27   VVTKYKSAAEILNKGLELVVSQCKPNAKIVDICEKGDAFIREQTGNMYKNVKKKIERGVA  206
            VVTKYK A+EI+N+ L+  V +C     + +IC   DA + E+TG  +K   +K+ +G+A
Sbjct  21   VVTKYKMASEIVNRVLKDTVGKCIVGESVREICIWADATLLEETGKAFKK-DRKLLKGIA  79

Query  207  FPTCISVNNTVCHFSPLSNDDTV-LEDGDMVKIDMGCHIDGFIAVVGHTHLLQEGP---V  374
            FP CIS+NN +CHFSPL++D  V L+DGDMVKIDMG HIDGFIAVV HT ++   P   +
Sbjct  80   FPCCISINNCICHFSPLASDPEVHLKDGDMVKIDMGAHIDGFIAVVAHTLVVSSSPDKKI  139

Query  375  TGRaadviaaantaaevaLRLVRPGKKNSDVTEAIQKVAAAYDCK  509
             G  AD + AA+ A+E ALRLVRPG     +T+A+QK+A +Y CK
Sbjct  140  EGSKADALLAAHYASEAALRLVRPGNDTYTITDAVQKIAESYSCK  184



>ref|XP_005876787.1| PREDICTED: proliferation-associated protein 2G4 [Myotis brandtii]
 ref|XP_006093721.1| PREDICTED: proliferation-associated protein 2G4 [Myotis lucifugus]
 ref|XP_006777912.1| PREDICTED: proliferation-associated protein 2G4 [Myotis davidii]
 ref|XP_008146840.1| PREDICTED: proliferation-associated protein 2G4 [Eptesicus fuscus]
 gb|EPQ14237.1| Proliferation-associated protein 2G4 [Myotis brandtii]
Length=394

 Score =   151 bits (382),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 87/164 (53%), Positives = 118/164 (72%), Gaps = 5/164 (3%)
 Frame = +3

Query  27   VVTKYKSAAEILNKGLELVVSQCKPNAKIVDICEKGDAFIREQTGNMYKNVKKKIERGVA  206
            VVTKYK   +I N+ L  +V        ++ +CEKGDA I E+TG ++K  +K++++G+A
Sbjct  17   VVTKYKMGGDIANRVLRSLVEASCSGVSVLSLCEKGDAMIMEETGKIFKK-EKEMKKGIA  75

Query  207  FPTCISVNNTVCHFSPLSND-DTVLEDGDMVKIDMGCHIDGFIAVVGHTHLL---QEGPV  374
            FPT ISVNN VCHFSPL +D D +L++GD+VKID+G H+DGFIA V HT ++   Q   V
Sbjct  76   FPTSISVNNCVCHFSPLKSDQDYILKEGDLVKIDLGVHVDGFIANVAHTFVVGVAQGTQV  135

Query  375  TGRaadviaaantaaevaLRLVRPGKKNSDVTEAIQKVAAAYDC  506
            TGR ADVI AA+  AE ALRLV+PG +N+ VTEA  KVA +++C
Sbjct  136  TGRKADVIKAAHLCAEAALRLVKPGNQNTQVTEAWNKVAHSFNC  179



>ref|NP_001029871.1| proliferation-associated protein 2G4 [Bos taurus]
 ref|NP_001277540.1| proliferation-associated 2G4, 38kDa [Panthera tigris altaica]
 ref|XP_531629.2| PREDICTED: proliferation-associated protein 2G4 [Canis lupus 
familiaris]
 ref|XP_003988925.1| PREDICTED: proliferation-associated protein 2G4 [Felis catus]
 ref|XP_004401711.1| PREDICTED: proliferation-associated protein 2G4 [Odobenus rosmarus 
divergens]
 ref|XP_004773144.1| PREDICTED: proliferation-associated protein 2G4 [Mustela putorius 
furo]
 ref|XP_004800650.1| PREDICTED: proliferation-associated protein 2G4 [Mustela putorius 
furo]
 ref|XP_005680428.1| PREDICTED: proliferation-associated protein 2G4 isoform X1 [Capra 
hircus]
 ref|XP_005903484.1| PREDICTED: proliferation-associated protein 2G4 [Bos mutus]
 ref|XP_005975566.1| PREDICTED: proliferation-associated protein 2G4 [Pantholops hodgsonii]
 ref|XP_006728833.1| PREDICTED: proliferation-associated protein 2G4 [Leptonychotes 
weddellii]
 ref|XP_006075113.1| PREDICTED: proliferation-associated protein 2G4 [Bubalus bubalis]
 ref|XP_008710451.1| PREDICTED: proliferation-associated protein 2G4 [Ursus maritimus]
 ref|XP_010837513.1| PREDICTED: proliferation-associated protein 2G4 [Bison bison 
bison]
 ref|XP_011219007.1| PREDICTED: proliferation-associated protein 2G4 [Ailuropoda melanoleuca]
 gb|AAI03293.1| Proliferation-associated 2G4, 38kDa [Bos taurus]
 gb|EFB28840.1| hypothetical protein PANDA_004075 [Ailuropoda melanoleuca]
 tpg|DAA29554.1| TPA: ErbB3-binding protein 1 [Bos taurus]
 gb|AHJ25867.1| proliferation-associated 2G4 [Panthera tigris altaica]
Length=394

 Score =   151 bits (382),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 87/164 (53%), Positives = 118/164 (72%), Gaps = 5/164 (3%)
 Frame = +3

Query  27   VVTKYKSAAEILNKGLELVVSQCKPNAKIVDICEKGDAFIREQTGNMYKNVKKKIERGVA  206
            VVTKYK   +I N+ L  +V        ++ +CEKGDA I E+TG ++K  +K++++G+A
Sbjct  17   VVTKYKMGGDIANRVLRSLVEASCSGVSVLSLCEKGDAMIMEETGKIFKK-EKEMKKGIA  75

Query  207  FPTCISVNNTVCHFSPLSND-DTVLEDGDMVKIDMGCHIDGFIAVVGHTHLL---QEGPV  374
            FPT ISVNN VCHFSPL +D D +L++GD+VKID+G H+DGFIA V HT ++   Q   V
Sbjct  76   FPTSISVNNCVCHFSPLKSDQDYILKEGDLVKIDLGVHVDGFIANVAHTFVVDVAQGTQV  135

Query  375  TGRaadviaaantaaevaLRLVRPGKKNSDVTEAIQKVAAAYDC  506
            TGR ADVI AA+  AE ALRLV+PG +N+ VTEA  KVA +++C
Sbjct  136  TGRKADVIKAAHLCAEAALRLVKPGNQNTQVTEAWNKVAHSFNC  179



>ref|XP_001504854.1| PREDICTED: proliferation-associated protein 2G4 isoform 1 [Equus 
caballus]
 ref|XP_004429287.1| PREDICTED: proliferation-associated protein 2G4 [Ceratotherium 
simum simum]
 ref|XP_008528370.1| PREDICTED: proliferation-associated protein 2G4 [Equus przewalskii]
Length=394

 Score =   151 bits (382),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 87/164 (53%), Positives = 118/164 (72%), Gaps = 5/164 (3%)
 Frame = +3

Query  27   VVTKYKSAAEILNKGLELVVSQCKPNAKIVDICEKGDAFIREQTGNMYKNVKKKIERGVA  206
            VVTKYK   +I N+ L  +V        ++ +CEKGDA I E+TG ++K  +K++++G+A
Sbjct  17   VVTKYKMGGDIANRVLRSLVEASCSGVSVLSLCEKGDAMIMEETGKIFKK-EKEMKKGIA  75

Query  207  FPTCISVNNTVCHFSPLSND-DTVLEDGDMVKIDMGCHIDGFIAVVGHTHLL---QEGPV  374
            FPT ISVNN VCHFSPL +D D +L++GD+VKID+G H+DGFIA V HT ++   Q   V
Sbjct  76   FPTSISVNNCVCHFSPLKSDQDYILKEGDLVKIDLGVHVDGFIANVAHTFVVDVAQGTQV  135

Query  375  TGRaadviaaantaaevaLRLVRPGKKNSDVTEAIQKVAAAYDC  506
            TGR ADVI AA+  AE ALRLV+PG +N+ VTEA  KVA +++C
Sbjct  136  TGRKADVIKAAHLCAEAALRLVKPGNQNTQVTEAWNKVAHSFNC  179



>ref|XP_011173347.1| PREDICTED: proliferation-associated protein 2G4 [Solenopsis invicta]
Length=387

 Score =   151 bits (381),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 82/165 (50%), Positives = 122/165 (74%), Gaps = 5/165 (3%)
 Frame = +3

Query  27   VVTKYKSAAEILNKGLELVVSQCKPNAKIVDICEKGDAFIREQTGNMYKNVKKKIERGVA  206
            VVTKYK A EI+N+ L+ V+++C   A + +ICE GD  + E+T  ++K  +K++++G+A
Sbjct  16   VVTKYKMAGEIVNRVLKQVLNKCIAGASVREICEFGDKILTEETSKVFKK-EKELKKGIA  74

Query  207  FPTCISVNNTVCHFSPLSND-DTVLEDGDMVKIDMGCHIDGFIAVVGHTHL---LQEGPV  374
            FPTCISVNN +CHFSP++++ D +L+D DMVK+D+G H+DGFIAVV HT +   L E  V
Sbjct  75   FPTCISVNNCICHFSPIASEPDLILKDEDMVKVDLGAHVDGFIAVVAHTIVIGSLPEKKV  134

Query  375  TGRaadviaaantaaevaLRLVRPGKKNSDVTEAIQKVAAAYDCK  509
            TGR ADV+ AA+ A++ ALRL++PG +   +T  ++K+  AY CK
Sbjct  135  TGRKADVVLAAHYASQAALRLLKPGTETYTITGTVEKICDAYKCK  179



>ref|XP_006908945.1| PREDICTED: proliferation-associated protein 2G4 [Pteropus alecto]
 ref|XP_011374000.1| PREDICTED: proliferation-associated protein 2G4 [Pteropus vampyrus]
Length=394

 Score =   151 bits (382),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 87/164 (53%), Positives = 118/164 (72%), Gaps = 5/164 (3%)
 Frame = +3

Query  27   VVTKYKSAAEILNKGLELVVSQCKPNAKIVDICEKGDAFIREQTGNMYKNVKKKIERGVA  206
            VVTKYK   +I N+ L  +V        ++ +CEKGDA I E+TG ++K  +K++++G+A
Sbjct  17   VVTKYKMGGDIANRVLRSLVEASCSGVSVLSLCEKGDAMIMEETGKIFKK-EKEMKKGIA  75

Query  207  FPTCISVNNTVCHFSPLSND-DTVLEDGDMVKIDMGCHIDGFIAVVGHTHLL---QEGPV  374
            FPT ISVNN VCHFSPL +D D +L++GD+VKID+G H+DGFIA V HT ++   Q   V
Sbjct  76   FPTSISVNNCVCHFSPLKSDQDYILKEGDLVKIDLGVHVDGFIANVAHTFVVDVAQGTQV  135

Query  375  TGRaadviaaantaaevaLRLVRPGKKNSDVTEAIQKVAAAYDC  506
            TGR ADVI AA+  AE ALRLV+PG +N+ VTEA  KVA +++C
Sbjct  136  TGRKADVIKAAHLCAEAALRLVKPGNQNTQVTEAWNKVAHSFNC  179



>ref|XP_004006644.1| PREDICTED: proliferation-associated protein 2G4 [Ovis aries]
Length=394

 Score =   151 bits (382),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 87/164 (53%), Positives = 118/164 (72%), Gaps = 5/164 (3%)
 Frame = +3

Query  27   VVTKYKSAAEILNKGLELVVSQCKPNAKIVDICEKGDAFIREQTGNMYKNVKKKIERGVA  206
            VVTKYK   +I N+ L  +V        ++ +CEKGDA I E+TG ++K  +K++++G+A
Sbjct  17   VVTKYKMGGDIANRVLRSLVEASCSGVSVLSLCEKGDAMIMEETGKIFKK-EKEMKKGIA  75

Query  207  FPTCISVNNTVCHFSPLSND-DTVLEDGDMVKIDMGCHIDGFIAVVGHTHLL---QEGPV  374
            FPT ISVNN VCHFSPL +D D +L++GD+VKID+G H+DGFIA V HT ++   Q   V
Sbjct  76   FPTSISVNNCVCHFSPLKSDQDYILKEGDLVKIDLGVHVDGFIANVAHTFVVDVAQGTQV  135

Query  375  TGRaadviaaantaaevaLRLVRPGKKNSDVTEAIQKVAAAYDC  506
            TGR ADVI AA+  AE ALRLV+PG +N+ VTEA  KVA +++C
Sbjct  136  TGRKADVIKAAHLCAEAALRLVKPGNQNTQVTEAWNKVAHSFNC  179



>ref|XP_006615964.1| PREDICTED: proliferation-associated protein 2G4-like [Apis dorsata]
Length=387

 Score =   151 bits (381),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 80/165 (48%), Positives = 121/165 (73%), Gaps = 5/165 (3%)
 Frame = +3

Query  27   VVTKYKSAAEILNKGLELVVSQCKPNAKIVDICEKGDAFIREQTGNMYKNVKKKIERGVA  206
            VVTKYK A +I+N+ L+ V+ +C   A + +ICE GD  I ++T  ++K  +K++++G+A
Sbjct  16   VVTKYKMAGDIVNRVLKQVLDKCVAGASVREICEFGDKLILDETSKVFKK-EKELKKGIA  74

Query  207  FPTCISVNNTVCHFSPLSND-DTVLEDGDMVKIDMGCHIDGFIAVVGHTHLLQEGP---V  374
            FPTCISVNN +CHFSP++++ D +L+D DMVK+D+G H+DGFIAVV HT ++   P   V
Sbjct  75   FPTCISVNNCICHFSPIASEPDLILKDEDMVKVDLGAHVDGFIAVVAHTIVIGSSPTKKV  134

Query  375  TGRaadviaaantaaevaLRLVRPGKKNSDVTEAIQKVAAAYDCK  509
            TGR ADV+ AA+ A++ ALRL++PG +   +TE ++K+   Y CK
Sbjct  135  TGRKADVVLAAHFASQAALRLLQPGTETYTITETVEKICDVYKCK  179



>ref|XP_002093823.1| GE20541 [Drosophila yakuba]
 gb|EDW93535.1| GE20541 [Drosophila yakuba]
Length=391

 Score =   151 bits (381),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 84/165 (51%), Positives = 117/165 (71%), Gaps = 5/165 (3%)
 Frame = +3

Query  27   VVTKYKSAAEILNKGLELVVSQCKPNAKIVDICEKGDAFIREQTGNMYKNVKKKIERGVA  206
            VVTKYK A EI+NK L+ V+  C  +A + +IC +GD  + E+TG +YK  +K +++G+A
Sbjct  17   VVTKYKLAGEIVNKTLKAVIGLCVVDASVREICTQGDNQLTEETGKVYKK-EKDLKKGIA  75

Query  207  FPTCISVNNTVCHFSPLSND-DTVLEDGDMVKIDMGCHIDGFIAVVGHTHLLQEGP---V  374
            FPTC+SVNN VCHFSP  ND D  L+ GD+VKID+G HIDGFIAV  HT ++  G    +
Sbjct  76   FPTCLSVNNCVCHFSPAKNDADYTLKAGDVVKIDLGAHIDGFIAVAAHTIVVGAGADQKI  135

Query  375  TGRaadviaaantaaevaLRLVRPGKKNSDVTEAIQKVAAAYDCK  509
            +GR ADVI AA  A + ALRL++ G  N  +T+A+Q+++ +Y CK
Sbjct  136  SGRQADVILAAYWAVQAALRLLKSGANNYSLTDAVQQISESYKCK  180



>ref|XP_006560659.1| PREDICTED: proliferation-associated protein 2G4-like [Apis mellifera]
Length=387

 Score =   150 bits (380),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 80/165 (48%), Positives = 121/165 (73%), Gaps = 5/165 (3%)
 Frame = +3

Query  27   VVTKYKSAAEILNKGLELVVSQCKPNAKIVDICEKGDAFIREQTGNMYKNVKKKIERGVA  206
            VVTKYK A +I+N+ L+ V+ +C   A + +ICE GD  I ++T  ++K  +K++++G+A
Sbjct  16   VVTKYKMAGDIVNRVLKQVLDKCVAGASVREICEFGDKLILDETNKVFKK-EKELKKGIA  74

Query  207  FPTCISVNNTVCHFSPLSND-DTVLEDGDMVKIDMGCHIDGFIAVVGHTHLLQEGP---V  374
            FPTCISVNN +CHFSP++++ D +L+D DMVK+D+G H+DGFIAVV HT ++   P   V
Sbjct  75   FPTCISVNNCICHFSPIASEPDLILKDEDMVKVDLGAHVDGFIAVVAHTIVIGSSPTKKV  134

Query  375  TGRaadviaaantaaevaLRLVRPGKKNSDVTEAIQKVAAAYDCK  509
            TGR ADV+ AA+ A++ ALRL++PG +   +TE ++K+   Y CK
Sbjct  135  TGRKADVVLAAHFASQAALRLLQPGTETYTITETVEKICDVYKCK  179



>gb|EFZ09337.1| hypothetical protein SINV_15911 [Solenopsis invicta]
Length=424

 Score =   151 bits (382),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 82/165 (50%), Positives = 122/165 (74%), Gaps = 5/165 (3%)
 Frame = +3

Query  27   VVTKYKSAAEILNKGLELVVSQCKPNAKIVDICEKGDAFIREQTGNMYKNVKKKIERGVA  206
            VVTKYK A EI+N+ L+ V+++C   A + +ICE GD  + E+T  ++K  +K++++G+A
Sbjct  53   VVTKYKMAGEIVNRVLKQVLNKCIAGASVREICEFGDKILTEETSKVFKK-EKELKKGIA  111

Query  207  FPTCISVNNTVCHFSPLSND-DTVLEDGDMVKIDMGCHIDGFIAVVGHTHL---LQEGPV  374
            FPTCISVNN +CHFSP++++ D +L+D DMVK+D+G H+DGFIAVV HT +   L E  V
Sbjct  112  FPTCISVNNCICHFSPIASEPDLILKDEDMVKVDLGAHVDGFIAVVAHTIVIGSLPEKKV  171

Query  375  TGRaadviaaantaaevaLRLVRPGKKNSDVTEAIQKVAAAYDCK  509
            TGR ADV+ AA+ A++ ALRL++PG +   +T  ++K+  AY CK
Sbjct  172  TGRKADVVLAAHYASQAALRLLKPGTETYTITGTVEKICDAYKCK  216



>ref|XP_006859475.1| PREDICTED: proliferation-associated protein 2G4 [Chrysochloris 
asiatica]
Length=394

 Score =   150 bits (380),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 89/164 (54%), Positives = 120/164 (73%), Gaps = 5/164 (3%)
 Frame = +3

Query  27   VVTKYKSAAEILNKGLELVVSQCKPNAKIVDICEKGDAFIREQTGNMYKNVKKKIERGVA  206
            VVTKYK   +I N+ L  +V        ++ +CEKGDA I E+TG ++K  +K++++G+A
Sbjct  17   VVTKYKMGGDIANRVLRSLVEASSSGVSVLSLCEKGDAMIMEETGKIFKK-EKEMKKGIA  75

Query  207  FPTCISVNNTVCHFSPLSND-DTVLEDGDMVKIDMGCHIDGFIAVVGHTHLLQ--EG-PV  374
            FPT ISVNN VCHFSPL +D D +L++GD+VKID+G H+DGFIA V HT ++   EG PV
Sbjct  76   FPTSISVNNCVCHFSPLKSDQDYILKEGDLVKIDLGVHVDGFIANVAHTFVIDVAEGTPV  135

Query  375  TGRaadviaaantaaevaLRLVRPGKKNSDVTEAIQKVAAAYDC  506
            TGR ADVI AA+  AE ALRLV+PG +N+ VTEA  KVA +++C
Sbjct  136  TGRKADVIKAAHLCAEAALRLVKPGNQNTQVTEAWNKVAHSFNC  179



>ref|XP_010395474.1| PREDICTED: proliferation-associated protein 2G4, partial [Corvus 
cornix cornix]
Length=190

 Score =   145 bits (366),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 82/149 (55%), Positives = 111/149 (74%), Gaps = 5/149 (3%)
 Frame = +3

Query  72   LELVVSQCKPNAKIVDICEKGDAFIREQTGNMYKNVKKKIERGVAFPTCISVNNTVCHFS  251
            L  VV    P A ++ +CEKGD+ I E+TG ++K  +K++++G+AFPT ISVNN VCHFS
Sbjct  14   LRAVVEAANPGASVLCLCEKGDSMIMEETGKIFKK-EKEMKKGIAFPTSISVNNCVCHFS  72

Query  252  PLSND-DTVLEDGDMVKIDMGCHIDGFIAVVGHTHLL---QEGPVTGRaadviaaantaa  419
            PL +D D +L+DGD+VKID+G H+DGFIA V HT +L   +E PV+GR ADVI AA+  A
Sbjct  73   PLKSDQDYILKDGDLVKIDLGVHVDGFIANVAHTFVLGASKEKPVSGRKADVIKAAHLCA  132

Query  420  evaLRLVRPGKKNSDVTEAIQKVAAAYDC  506
            E ALRLV+PG +N+ VTEA  K+A ++ C
Sbjct  133  EAALRLVKPGNQNTQVTEAWNKIAHSFHC  161



>ref|XP_004861453.1| PREDICTED: proliferation-associated protein 2G4, partial [Heterocephalus 
glaber]
Length=279

 Score =   148 bits (373),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 87/164 (53%), Positives = 118/164 (72%), Gaps = 5/164 (3%)
 Frame = +3

Query  27   VVTKYKSAAEILNKGLELVVSQCKPNAKIVDICEKGDAFIREQTGNMYKNVKKKIERGVA  206
            VVTKYK   +I N+ L  +V        ++ +CEKGDA I E+TG ++K  +K++++G+A
Sbjct  17   VVTKYKMGGDIANRVLRSLVEASSSGVSVLSLCEKGDAMIMEETGKIFKK-EKEMKKGIA  75

Query  207  FPTCISVNNTVCHFSPLSND-DTVLEDGDMVKIDMGCHIDGFIAVVGHTHLL---QEGPV  374
            FPT ISVNN VCHFSPL +D D +L++GD+VKID+G H+DGFIA V HT ++   Q   V
Sbjct  76   FPTSISVNNCVCHFSPLKSDQDYILKEGDLVKIDLGVHVDGFIANVAHTFVIGVPQGTQV  135

Query  375  TGRaadviaaantaaevaLRLVRPGKKNSDVTEAIQKVAAAYDC  506
            TGR ADVI AA+  AE ALRLV+PG +N+ VTEA  KVA +++C
Sbjct  136  TGRKADVIKAAHLCAEAALRLVKPGNQNTQVTEAWNKVAHSFNC  179



>ref|XP_003405168.1| PREDICTED: proliferation-associated protein 2G4 [Loxodonta africana]
Length=394

 Score =   150 bits (379),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 89/164 (54%), Positives = 120/164 (73%), Gaps = 5/164 (3%)
 Frame = +3

Query  27   VVTKYKSAAEILNKGLELVVSQCKPNAKIVDICEKGDAFIREQTGNMYKNVKKKIERGVA  206
            VVTKYK   +I N+ L  +V        ++ +CEKGDA I E+TG ++K  +K++++G+A
Sbjct  17   VVTKYKMGGDIANRVLRSLVEASSSGVSVLSLCEKGDAMIMEETGKIFKK-EKEMKKGIA  75

Query  207  FPTCISVNNTVCHFSPLSND-DTVLEDGDMVKIDMGCHIDGFIAVVGHTHLLQ--EG-PV  374
            FPT ISVNN VCHFSPL +D D +L++GD+VKID+G H+DGFIA V HT ++   EG PV
Sbjct  76   FPTSISVNNCVCHFSPLKSDQDYILKEGDLVKIDLGVHVDGFIANVAHTFVVDVAEGTPV  135

Query  375  TGRaadviaaantaaevaLRLVRPGKKNSDVTEAIQKVAAAYDC  506
            TGR ADVI AA+  AE ALRLV+PG +N+ VTEA  KVA +++C
Sbjct  136  TGRKADVIKAAHLCAEAALRLVKPGNQNTQVTEAWNKVAHSFNC  179



>ref|XP_007953297.1| PREDICTED: proliferation-associated protein 2G4 [Orycteropus 
afer afer]
Length=394

 Score =   150 bits (379),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 89/164 (54%), Positives = 120/164 (73%), Gaps = 5/164 (3%)
 Frame = +3

Query  27   VVTKYKSAAEILNKGLELVVSQCKPNAKIVDICEKGDAFIREQTGNMYKNVKKKIERGVA  206
            VVTKYK   +I N+ L  +V        ++ +CEKGDA I E+TG ++K  +K++++G+A
Sbjct  17   VVTKYKMGGDIANRVLRSLVEASSSGVSVLSLCEKGDAMIMEETGKIFKK-EKEMKKGIA  75

Query  207  FPTCISVNNTVCHFSPLSND-DTVLEDGDMVKIDMGCHIDGFIAVVGHTHLLQ--EG-PV  374
            FPT ISVNN VCHFSPL +D D +L++GD+VKID+G H+DGFIA V HT ++   EG PV
Sbjct  76   FPTSISVNNCVCHFSPLKSDQDYILKEGDLVKIDLGVHVDGFIANVAHTFVVDVAEGIPV  135

Query  375  TGRaadviaaantaaevaLRLVRPGKKNSDVTEAIQKVAAAYDC  506
            TGR ADVI AA+  AE ALRLV+PG +N+ VTEA  KVA +++C
Sbjct  136  TGRKADVIKAAHLCAEAALRLVKPGNQNTQVTEAWNKVAHSFNC  179



>ref|XP_008877833.1| DNA-binding protein, 42 kDa [Aphanomyces invadans]
 gb|ETV93491.1| DNA-binding protein, 42 kDa [Aphanomyces invadans]
Length=407

 Score =   150 bits (380),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 83/172 (48%), Positives = 115/172 (67%), Gaps = 7/172 (4%)
 Frame = +3

Query  9    DLTTPEVVTKYKSAAEILNKGLELVVSQCKPNAKIVDICEKGDAFIREQTGNMYKNVKKK  188
            D +  +VVTKY+ AAEI    LE V++Q  P   +V++   GDA I  + G +YK+  KK
Sbjct  37   DCSNTDVVTKYRLAAEIAQSALEGVIAQLLPGKSVVEVATFGDALITARAGTVYKS--KK  94

Query  189  IERGVAFPTCISVNNTVCHFSPLSNDDTVLEDGDMVKIDMGCHIDGFIAVVGHTHLLQEG  368
            +E+G+AFPTC+SVN  VCHFSPL ++   L+ GD VKID+GCHIDG+IAVV HT ++ + 
Sbjct  95   VEKGIAFPTCLSVNEVVCHFSPLPSESVTLKAGDWVKIDLGCHIDGYIAVVAHTVIVPDA  154

Query  369  P-----VTGRaadviaaantaaevaLRLVRPGKKNSDVTEAIQKVAAAYDCK  509
                  V G  ADV+ AA+ A E+  RL++PG  N+ VTEA++ +A AY  K
Sbjct  155  EGSDNIVLGTQADVLKAAHDAVELCARLIKPGNTNAQVTEALEALAEAYGVK  206



>gb|KDR23244.1| Proliferation-associated protein 2G4 [Zootermopsis nevadensis]
Length=395

 Score =   150 bits (378),  Expect = 6e-40, Method: Compositional matrix adjust.
 Identities = 83/165 (50%), Positives = 120/165 (73%), Gaps = 5/165 (3%)
 Frame = +3

Query  27   VVTKYKSAAEILNKGLELVVSQCKPNAKIVDICEKGDAFIREQTGNMYKNVKKKIERGVA  206
            VVTKYK A +I+N+ L+ V+ +C   A + +ICE GD+ + E+T  ++K  +K++++G+A
Sbjct  23   VVTKYKMAGDIVNRVLKQVIDKCVVGASVREICEFGDSLLTEETSKVFKK-EKELKKGIA  81

Query  207  FPTCISVNNTVCHFSPL-SNDDTVLEDGDMVKIDMGCHIDGFIAVVGHTHLL---QEGPV  374
            FPTC+SVNN +CHFSP+ S  D  L+D D+VK+D+G H+DGFIAVV HT +L    E  V
Sbjct  82   FPTCVSVNNCICHFSPVPSEADYTLKDEDVVKVDLGAHVDGFIAVVAHTIVLGATSEAKV  141

Query  375  TGRaadviaaantaaevaLRLVRPGKKNSDVTEAIQKVAAAYDCK  509
            TGR ADV+ AA+ A++ ALRL++P  +   VT+A+QKV  AY CK
Sbjct  142  TGRRADVVLAAHYASQAALRLLKPENETYAVTDAVQKVCEAYKCK  186



>gb|EDL84837.1| proliferation-associated 2G4, isoform CRA_b [Rattus norvegicus]
Length=323

 Score =   148 bits (374),  Expect = 6e-40, Method: Compositional matrix adjust.
 Identities = 87/164 (53%), Positives = 118/164 (72%), Gaps = 5/164 (3%)
 Frame = +3

Query  27   VVTKYKSAAEILNKGLELVVSQCKPNAKIVDICEKGDAFIREQTGNMYKNVKKKIERGVA  206
            VVTKYK   +I N+ L  +V        ++ +CEKGDA I E+TG ++K  +K++++G+A
Sbjct  17   VVTKYKMGGDIANRVLRSLVEASSSGVSVLSLCEKGDAMIMEETGKIFKK-EKEMKKGIA  75

Query  207  FPTCISVNNTVCHFSPLSND-DTVLEDGDMVKIDMGCHIDGFIAVVGHTHLL---QEGPV  374
            FPT ISVNN VCHFSPL +D D +L++GD+VKID+G H+DGFIA V HT ++   Q   V
Sbjct  76   FPTSISVNNCVCHFSPLKSDQDYILKEGDLVKIDLGVHVDGFIANVAHTFVIGVAQGSQV  135

Query  375  TGRaadviaaantaaevaLRLVRPGKKNSDVTEAIQKVAAAYDC  506
            TGR ADVI AA+  AE ALRLV+PG +N+ VTEA  KVA +++C
Sbjct  136  TGRKADVIKAAHLCAEAALRLVKPGNQNTQVTEAWNKVAHSFNC  179



>ref|XP_011400941.1| Proliferation-associated protein A [Auxenochlorella protothecoides]
 gb|KFM27934.1| Proliferation-associated protein A [Auxenochlorella protothecoides]
Length=353

 Score =   149 bits (376),  Expect = 6e-40, Method: Compositional matrix adjust.
 Identities = 83/165 (50%), Positives = 113/165 (68%), Gaps = 2/165 (1%)
 Frame = +3

Query  12   LTTPEVVTKYKSAAEILNKGLELVVSQCKPNAKIVDICEKGDAFIREQTGNMYKNVKKKI  191
            ++ P+VVTKYK+AA+I+N  L  V+   KP AKIVD+C  GD  I E     +K   K I
Sbjct  16   ISNPDVVTKYKAAAKIVNDTLAAVIDAAKPGAKIVDLCTLGDKLITEAAAKEFKG--KDI  73

Query  192  ERGVAFPTCISVNNTVCHFSPLSNDDTVLEDGDMVKIDMGCHIDGFIAVVGHTHLLQEGP  371
            E+G+A PTC+SVNN + HFSP +++   L++GD+VKID+G HIDGFIA   H+ +  +GP
Sbjct  74   EKGIAVPTCVSVNNCIGHFSPPADNTATLKEGDVVKIDLGAHIDGFIAQAAHSLVAVDGP  133

Query  372  VTGRaadviaaantaaevaLRLVRPGKKNSDVTEAIQKVAAAYDC  506
              GRAADV+AAA+ A E A RLVR G++  +V   + K+A AY C
Sbjct  134  AKGRAADVVAAAHAAYEAASRLVRAGRRAKEVGPVLSKIAEAYGC  178



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 557408213115