BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFF038E13

Length=165
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_006845495.1|  hypothetical protein AMTR_s00019p00150410          107   2e-25   Amborella trichopoda
ref|XP_010915435.1|  PREDICTED: trifunctional UDP-glucose 4,6-deh...    106   4e-25   Elaeis guineensis
ref|XP_003546628.1|  PREDICTED: probable rhamnose biosynthetic en...    106   4e-25   Glycine max [soybeans]
ref|XP_010093448.1|  putative rhamnose biosynthetic enzyme 1            106   7e-25   Morus notabilis
gb|KJB61503.1|  hypothetical protein B456_009G362500                    105   8e-25   Gossypium raimondii
ref|XP_009376726.1|  PREDICTED: probable rhamnose biosynthetic en...    105   1e-24   Pyrus x bretschneideri [bai li]
gb|KHG22077.1|  putative rhamnose biosynthetic enzyme 1 -like pro...    105   1e-24   Gossypium arboreum [tree cotton]
gb|KJB12934.1|  hypothetical protein B456_002G046200                    105   2e-24   Gossypium raimondii
gb|ACJ11756.1|  rhamnose synthase                                       105   2e-24   Gossypium hirsutum [American cotton]
ref|XP_009783771.1|  PREDICTED: probable rhamnose biosynthetic en...    104   2e-24   Nicotiana sylvestris
ref|XP_004488984.1|  PREDICTED: probable rhamnose biosynthetic en...    104   2e-24   
ref|XP_009776312.1|  PREDICTED: probable rhamnose biosynthetic en...    104   2e-24   Nicotiana sylvestris
ref|XP_009590265.1|  PREDICTED: probable rhamnose biosynthetic en...    104   2e-24   Nicotiana tomentosiformis
ref|XP_007022008.1|  Rhamnose biosynthesis 1                            104   2e-24   Theobroma cacao [chocolate]
gb|KCW47402.1|  hypothetical protein EUGRSUZ_K01196                     103   2e-24   Eucalyptus grandis [rose gum]
ref|XP_003531412.1|  PREDICTED: probable rhamnose biosynthetic en...    104   2e-24   Glycine max [soybeans]
ref|XP_006585327.1|  PREDICTED: probable rhamnose biosynthetic en...    104   3e-24   
ref|XP_006585326.1|  PREDICTED: probable rhamnose biosynthetic en...    104   3e-24   Glycine max [soybeans]
ref|XP_006360030.1|  PREDICTED: probable rhamnose biosynthetic en...    104   3e-24   Solanum tuberosum [potatoes]
ref|XP_010487282.1|  PREDICTED: probable rhamnose biosynthetic en...    104   3e-24   Camelina sativa [gold-of-pleasure]
gb|KEH38548.1|  rhamnose biosynthetic-like enzyme                       104   3e-24   Medicago truncatula
emb|CDY25850.1|  BnaA05g14410D                                          102   4e-24   Brassica napus [oilseed rape]
ref|XP_002285634.1|  PREDICTED: trifunctional UDP-glucose 4,6-deh...    103   4e-24   Vitis vinifera
gb|KJB61502.1|  hypothetical protein B456_009G362500                    103   4e-24   Gossypium raimondii
gb|EYU38237.1|  hypothetical protein MIMGU_mgv1a002436mg                103   4e-24   Erythranthe guttata [common monkey flower]
ref|XP_010273412.1|  PREDICTED: probable rhamnose biosynthetic en...    103   4e-24   Nelumbo nucifera [Indian lotus]
ref|XP_006407044.1|  hypothetical protein EUTSA_v10020227mg             103   4e-24   
ref|XP_006297150.1|  hypothetical protein CARUB_v10013153mg             103   4e-24   Capsella rubella
ref|XP_010465388.1|  PREDICTED: probable rhamnose biosynthetic en...    103   5e-24   Camelina sativa [gold-of-pleasure]
ref|XP_010502125.1|  PREDICTED: probable rhamnose biosynthetic en...    103   5e-24   Camelina sativa [gold-of-pleasure]
ref|NP_188097.1|  rhamnose biosynthetic enzyme 3                        103   6e-24   Arabidopsis thaliana [mouse-ear cress]
gb|KJB45830.1|  hypothetical protein B456_007G332000                    101   6e-24   Gossypium raimondii
ref|XP_011098163.1|  PREDICTED: trifunctional UDP-glucose 4,6-deh...    103   6e-24   Sesamum indicum [beniseed]
ref|XP_004294169.1|  PREDICTED: trifunctional UDP-glucose 4,6-deh...    103   6e-24   Fragaria vesca subsp. vesca
ref|XP_007149511.1|  hypothetical protein PHAVU_005G076400g             103   7e-24   Phaseolus vulgaris [French bean]
emb|CDY20084.1|  BnaA01g29180D                                          103   7e-24   Brassica napus [oilseed rape]
ref|XP_007213598.1|  hypothetical protein PRUPE_ppa002453mg             103   7e-24   Prunus persica
ref|XP_008226345.1|  PREDICTED: probable rhamnose biosynthetic en...    103   7e-24   Prunus mume [ume]
ref|XP_002531238.1|  NAD dependent epimerase/dehydratase, putative      102   7e-24   
ref|XP_009610279.1|  PREDICTED: probable rhamnose biosynthetic en...    103   8e-24   Nicotiana tomentosiformis
gb|KHN36936.1|  Putative rhamnose biosynthetic enzyme 1                 103   8e-24   Glycine soja [wild soybean]
gb|KHN19477.1|  Putative rhamnose biosynthetic enzyme 1                 103   8e-24   Glycine soja [wild soybean]
ref|XP_003543185.1|  PREDICTED: probable rhamnose biosynthetic en...    103   8e-24   Glycine max [soybeans]
ref|XP_002882893.1|  hypothetical protein ARALYDRAFT_478892             102   9e-24   
ref|XP_009394841.1|  PREDICTED: probable rhamnose biosynthetic en...    102   9e-24   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_003540514.1|  PREDICTED: probable rhamnose biosynthetic en...    102   9e-24   Glycine max [soybeans]
ref|XP_008451740.1|  PREDICTED: probable rhamnose biosynthetic en...    102   1e-23   Cucumis melo [Oriental melon]
ref|XP_004137224.1|  PREDICTED: probable rhamnose biosynthetic en...    102   1e-23   Cucumis sativus [cucumbers]
emb|CDX97601.1|  BnaA05g24780D                                          102   1e-23   
emb|CDX98494.1|  BnaC05g38810D                                          102   1e-23   
ref|XP_010537694.1|  PREDICTED: trifunctional UDP-glucose 4,6-deh...    102   1e-23   Tarenaya hassleriana [spider flower]
ref|XP_009146324.1|  PREDICTED: probable rhamnose biosynthetic en...    102   1e-23   Brassica rapa
ref|XP_002317559.2|  NAD-dependent epimerase/dehydratase family p...    102   1e-23   
ref|XP_008792282.1|  PREDICTED: probable rhamnose biosynthetic en...    102   1e-23   Phoenix dactylifera
emb|CDY32340.1|  BnaC01g36590D                                          102   1e-23   Brassica napus [oilseed rape]
ref|XP_010035897.1|  PREDICTED: probable rhamnose biosynthetic en...    102   1e-23   Eucalyptus grandis [rose gum]
ref|XP_011082806.1|  PREDICTED: trifunctional UDP-glucose 4,6-deh...    102   1e-23   Sesamum indicum [beniseed]
ref|XP_004248232.1|  PREDICTED: probable rhamnose biosynthetic en...    102   1e-23   Solanum lycopersicum
ref|XP_006370064.1|  hypothetical protein POPTR_0001s39210g             102   1e-23   Populus trichocarpa [western balsam poplar]
gb|KEH17189.1|  rhamnose biosynthetic-like enzyme                       102   1e-23   Medicago truncatula
ref|XP_010916151.1|  PREDICTED: trifunctional UDP-glucose 4,6-deh...    102   1e-23   Elaeis guineensis
ref|XP_010675265.1|  PREDICTED: trifunctional UDP-glucose 4,6-deh...    102   2e-23   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_010675264.1|  PREDICTED: trifunctional UDP-glucose 4,6-deh...    102   2e-23   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_011006811.1|  PREDICTED: trifunctional UDP-glucose 4,6-deh...    102   2e-23   Populus euphratica
ref|XP_007146360.1|  hypothetical protein PHAVU_006G034000g             102   2e-23   Phaseolus vulgaris [French bean]
ref|XP_010552134.1|  PREDICTED: trifunctional UDP-glucose 4,6-deh...    102   2e-23   Tarenaya hassleriana [spider flower]
ref|XP_011045548.1|  PREDICTED: trifunctional UDP-glucose 4,6-deh...    102   2e-23   Populus euphratica
ref|NP_001151455.1|  RHM1                                               102   2e-23   Zea mays [maize]
ref|XP_006301908.1|  hypothetical protein CARUB_v10022384mg             102   2e-23   Capsella rubella
ref|XP_004244296.1|  PREDICTED: probable rhamnose biosynthetic en...    102   2e-23   Solanum lycopersicum
ref|XP_008791880.1|  PREDICTED: probable rhamnose biosynthetic en...    102   2e-23   Phoenix dactylifera
gb|KJB45829.1|  hypothetical protein B456_007G332000                    101   2e-23   Gossypium raimondii
ref|XP_010429684.1|  PREDICTED: probable rhamnose biosynthetic en...    101   2e-23   
ref|XP_010417456.1|  PREDICTED: probable rhamnose biosynthetic en...    101   2e-23   Camelina sativa [gold-of-pleasure]
ref|NP_177978.1|  UDP-L-rhamnose synthase                               101   2e-23   Arabidopsis thaliana [mouse-ear cress]
ref|XP_004984748.1|  PREDICTED: probable rhamnose biosynthetic en...    101   2e-23   Setaria italica
ref|XP_003551914.1|  PREDICTED: probable rhamnose biosynthetic en...    101   2e-23   Glycine max [soybeans]
ref|XP_006389974.1|  hypothetical protein EUTSA_v10018232mg             101   2e-23   Eutrema salsugineum [saltwater cress]
gb|KHN18103.1|  Putative rhamnose biosynthetic enzyme 1                 101   3e-23   Glycine soja [wild soybean]
gb|KJB45828.1|  hypothetical protein B456_007G332000                    101   3e-23   Gossypium raimondii
emb|CDP06058.1|  unnamed protein product                                101   3e-23   Coffea canephora [robusta coffee]
ref|XP_006348335.1|  PREDICTED: probable rhamnose biosynthetic en...    101   3e-23   Solanum tuberosum [potatoes]
ref|XP_010535018.1|  PREDICTED: trifunctional UDP-glucose 4,6-deh...    101   3e-23   Tarenaya hassleriana [spider flower]
gb|EMS45937.1|  putative rhamnose biosynthetic enzyme 1                 101   3e-23   Triticum urartu
gb|KHG29785.1|  putative rhamnose biosynthetic enzyme 1 -like pro...    101   4e-23   Gossypium arboreum [tree cotton]
dbj|BAJ86835.1|  predicted protein                                      101   4e-23   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|ADB24773.1|  rhamnose synthase                                       101   4e-23   Gossypium hirsutum [American cotton]
ref|XP_004509959.1|  PREDICTED: probable rhamnose biosynthetic en...    100   5e-23   Cicer arietinum [garbanzo]
ref|XP_010062770.1|  PREDICTED: probable rhamnose biosynthetic en...    100   5e-23   Eucalyptus grandis [rose gum]
ref|XP_006647099.1|  PREDICTED: probable rhamnose biosynthetic en...    100   5e-23   Oryza brachyantha
ref|XP_009144768.1|  PREDICTED: probable rhamnose biosynthetic en...    100   5e-23   Brassica rapa
emb|CDY60210.1|  BnaCnng35880D                                          100   5e-23   Brassica napus [oilseed rape]
emb|CDP21573.1|  unnamed protein product                              97.1    7e-23   Coffea canephora [robusta coffee]
gb|KJB12930.1|  hypothetical protein B456_002G046100                  98.2    7e-23   Gossypium raimondii
ref|XP_009149137.1|  PREDICTED: probable rhamnose biosynthetic en...    100   7e-23   Brassica rapa
gb|KJB45831.1|  hypothetical protein B456_007G332000                    100   8e-23   Gossypium raimondii
dbj|BAJ97692.1|  predicted protein                                      100   8e-23   Hordeum vulgare subsp. vulgare [two-rowed barley]
emb|CDY35137.1|  BnaA06g11470D                                          100   8e-23   Brassica napus [oilseed rape]
emb|CDY40003.1|  BnaC05g13120D                                          100   8e-23   Brassica napus [oilseed rape]
gb|EMT23371.1|  Putative rhamnose biosynthetic enzyme 1                 100   9e-23   
gb|EMS59810.1|  putative rhamnose biosynthetic enzyme 1                 100   9e-23   Triticum urartu
ref|XP_009395981.1|  PREDICTED: probable rhamnose biosynthetic en...    100   9e-23   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_006306947.1|  hypothetical protein CARUB_v10008513mg             100   1e-22   Capsella rubella
ref|XP_001775697.1|  predicted protein                                  100   1e-22   
ref|XP_002894444.1|  mucilage-modified 4                                100   1e-22   
ref|XP_003571828.1|  PREDICTED: probable rhamnose biosynthetic en...    100   1e-22   Brachypodium distachyon [annual false brome]
ref|XP_002887744.1|  RHM1/ROL1                                        99.8    1e-22   
ref|XP_010479911.1|  PREDICTED: probable rhamnose biosynthetic en...  99.8    1e-22   Camelina sativa [gold-of-pleasure]
ref|XP_010462242.1|  PREDICTED: probable rhamnose biosynthetic en...  99.8    1e-22   Camelina sativa [gold-of-pleasure]
ref|XP_010501002.1|  PREDICTED: probable rhamnose biosynthetic en...  99.8    1e-22   Camelina sativa [gold-of-pleasure]
gb|EYU26294.1|  hypothetical protein MIMGU_mgv1a002474mg              99.8    1e-22   Erythranthe guttata [common monkey flower]
ref|XP_009147602.1|  PREDICTED: probable rhamnose biosynthetic en...  99.0    2e-22   Brassica rapa
ref|XP_001779703.1|  predicted protein                                99.0    2e-22   
emb|CDY24092.1|  BnaA06g00900D                                        99.0    2e-22   Brassica napus [oilseed rape]
ref|XP_009106565.1|  PREDICTED: probable rhamnose biosynthetic en...  99.0    2e-22   Brassica rapa
ref|XP_002515360.1|  dtdp-glucose 4,6-dehydratase, putative           96.7    2e-22   Ricinus communis
ref|XP_010671686.1|  PREDICTED: trifunctional UDP-glucose 4,6-deh...  99.0    2e-22   Beta vulgaris subsp. vulgaris [field beet]
emb|CDY45116.1|  BnaC06g06370D                                        99.0    3e-22   Brassica napus [oilseed rape]
ref|XP_003569141.1|  PREDICTED: probable rhamnose biosynthetic en...  96.7    3e-22   Brachypodium distachyon [annual false brome]
ref|XP_006392784.1|  hypothetical protein EUTSA_v10011290mg           98.6    3e-22   Eutrema salsugineum [saltwater cress]
emb|CDX88455.1|  BnaC06g38990D                                        98.6    3e-22   
gb|KHG15836.1|  putative rhamnose biosynthetic enzyme 1 -like pro...  98.6    3e-22   Gossypium arboreum [tree cotton]
ref|NP_564633.2|  putative NDP-L-rhamnose synthase                    98.6    4e-22   Arabidopsis thaliana [mouse-ear cress]
ref|XP_001775602.1|  predicted protein                                98.6    4e-22   
ref|XP_004984749.1|  PREDICTED: probable rhamnose biosynthetic en...  98.2    4e-22   Setaria italica
gb|ADB24774.1|  rhamnose synthase                                     98.2    4e-22   Gossypium hirsutum [American cotton]
gb|ABF95280.1|  rhamnose biosynthetic enzyme 1, putative, expressed   97.8    4e-22   Oryza sativa Japonica Group [Japonica rice]
ref|XP_002468088.1|  hypothetical protein SORBIDRAFT_01g039340        98.2    4e-22   Sorghum bicolor [broomcorn]
ref|XP_009421279.1|  PREDICTED: probable rhamnose biosynthetic en...  98.2    4e-22   Musa acuminata subsp. malaccensis [pisang utan]
gb|KHG07031.1|  putative rhamnose biosynthetic enzyme 1 -like pro...  98.2    4e-22   Gossypium arboreum [tree cotton]
ref|XP_004303854.1|  PREDICTED: trifunctional UDP-glucose 4,6-deh...  97.8    6e-22   Fragaria vesca subsp. vesca
ref|XP_001766894.1|  predicted protein                                97.8    6e-22   
ref|NP_001049724.1|  Os03g0278200                                     97.4    8e-22   
ref|XP_010924680.1|  PREDICTED: trifunctional UDP-glucose 4,6-deh...  97.4    9e-22   Elaeis guineensis
ref|XP_006649857.1|  PREDICTED: probable rhamnose biosynthetic en...  97.4    9e-22   Oryza brachyantha
ref|XP_009356652.1|  PREDICTED: probable rhamnose biosynthetic en...  97.4    9e-22   Pyrus x bretschneideri [bai li]
ref|XP_008812156.1|  PREDICTED: probable rhamnose biosynthetic en...  97.4    9e-22   Phoenix dactylifera
gb|KDP30504.1|  hypothetical protein JCGZ_17141                       96.7    1e-21   Jatropha curcas
gb|ADB24772.1|  rhamnose synthase                                     96.7    1e-21   Gossypium hirsutum [American cotton]
ref|XP_007215006.1|  hypothetical protein PRUPE_ppa002417mg           96.7    1e-21   Prunus persica
ref|XP_008229395.1|  PREDICTED: probable rhamnose biosynthetic en...  96.7    2e-21   Prunus mume [ume]
gb|KDO49287.1|  hypothetical protein CISIN_1g005941mg                 96.7    2e-21   Citrus sinensis [apfelsine]
ref|XP_006442344.1|  hypothetical protein CICLE_v10019182mg           96.7    2e-21   Citrus clementina [clementine]
ref|XP_002964674.1|  hypothetical protein SELMODRAFT_266803           96.7    2e-21   Selaginella moellendorffii
ref|XP_002989472.1|  hypothetical protein SELMODRAFT_129972           96.7    2e-21   
ref|XP_006477818.1|  PREDICTED: probable rhamnose biosynthetic en...  96.3    2e-21   Citrus sinensis [apfelsine]
ref|XP_010268536.1|  PREDICTED: probable rhamnose biosynthetic en...  96.3    2e-21   Nelumbo nucifera [Indian lotus]
ref|XP_004172221.1|  PREDICTED: probable rhamnose biosynthetic en...  93.6    3e-21   
ref|XP_009377674.1|  PREDICTED: probable rhamnose biosynthetic en...  95.9    3e-21   Pyrus x bretschneideri [bai li]
gb|EMT08126.1|  Putative rhamnose biosynthetic enzyme 1               94.4    3e-21   
gb|EMS55907.1|  putative rhamnose biosynthetic enzyme 3               94.4    4e-21   Triticum urartu
ref|XP_009394163.1|  PREDICTED: probable rhamnose biosynthetic en...  95.5    5e-21   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010060763.1|  PREDICTED: probable rhamnose biosynthetic en...  95.1    5e-21   Eucalyptus grandis [rose gum]
ref|XP_008380346.1|  PREDICTED: probable rhamnose biosynthetic en...  95.1    5e-21   Malus domestica [apple tree]
ref|XP_002468080.1|  hypothetical protein SORBIDRAFT_01g039220        94.7    7e-21   Sorghum bicolor [broomcorn]
ref|XP_008380229.1|  PREDICTED: probable rhamnose biosynthetic en...  94.7    8e-21   Malus domestica [apple tree]
gb|AFW77499.1|  hypothetical protein ZEAMMB73_283149                  94.0    8e-21   
ref|XP_007048831.1|  Rhamnose biosynthesis 1 isoform 1                94.4    1e-20   
gb|KJB75445.1|  hypothetical protein B456_012G042300                  94.4    1e-20   Gossypium raimondii
ref|XP_010109352.1|  putative rhamnose biosynthetic enzyme 1          94.4    1e-20   Morus notabilis
gb|KDO60921.1|  hypothetical protein CISIN_1g005818mg                 93.6    2e-20   Citrus sinensis [apfelsine]
ref|XP_006437200.1|  hypothetical protein CICLE_v10030887mg           93.6    2e-20   
ref|XP_006484833.1|  PREDICTED: probable rhamnose biosynthetic en...  93.6    2e-20   Citrus sinensis [apfelsine]
ref|XP_008445073.1|  PREDICTED: probable rhamnose biosynthetic en...  93.6    2e-20   Cucumis melo [Oriental melon]
ref|XP_004960685.1|  PREDICTED: probable rhamnose biosynthetic en...  93.6    2e-20   Setaria italica
ref|XP_002440852.1|  hypothetical protein SORBIDRAFT_09g008220        93.6    2e-20   
ref|XP_008342373.1|  PREDICTED: probable rhamnose biosynthetic en...  93.6    2e-20   Malus domestica [apple tree]
ref|XP_004138882.1|  PREDICTED: probable rhamnose biosynthetic en...  93.2    2e-20   
gb|ACG33666.1|  RHM1                                                  92.8    4e-20   Zea mays [maize]
ref|NP_001130297.1|  uncharacterized protein LOC100191391             92.8    4e-20   Zea mays [maize]
ref|XP_007225132.1|  hypothetical protein PRUPE_ppa002547mg           92.8    4e-20   Prunus persica
ref|XP_008654228.1|  PREDICTED: probable rhamnose biosynthetic en...  92.8    4e-20   
emb|CDP18722.1|  unnamed protein product                              92.4    6e-20   Coffea canephora [robusta coffee]
ref|XP_002271970.1|  PREDICTED: trifunctional UDP-glucose 4,6-deh...  92.0    6e-20   Vitis vinifera
emb|CAN62061.1|  hypothetical protein VITISV_001928                   91.7    7e-20   Vitis vinifera
ref|XP_008393937.1|  PREDICTED: probable rhamnose biosynthetic en...  91.7    1e-19   
ref|XP_009356708.1|  PREDICTED: probable rhamnose biosynthetic en...  91.7    1e-19   Pyrus x bretschneideri [bai li]
ref|XP_006450198.1|  hypothetical protein CICLE_v10010306mg           91.3    1e-19   
ref|XP_006483733.1|  PREDICTED: probable rhamnose biosynthetic en...  91.3    1e-19   
ref|XP_009363628.1|  PREDICTED: probable rhamnose biosynthetic en...  91.3    1e-19   Pyrus x bretschneideri [bai li]
gb|KDO67325.1|  hypothetical protein CISIN_1g035631mg                 91.3    1e-19   Citrus sinensis [apfelsine]
ref|XP_011031381.1|  PREDICTED: trifunctional UDP-glucose 4,6-deh...  90.9    2e-19   Populus euphratica
ref|XP_006382137.1|  hypothetical protein POPTR_0006s28750g           90.1    3e-19   Populus trichocarpa [western balsam poplar]
ref|XP_008351771.1|  PREDICTED: LOW QUALITY PROTEIN: probable rha...  87.4    5e-19   
ref|XP_003566438.1|  PREDICTED: probable rhamnose biosynthetic en...  87.4    6e-19   Brachypodium distachyon [annual false brome]
ref|XP_008220004.1|  PREDICTED: probable rhamnose biosynthetic en...  89.4    7e-19   Prunus mume [ume]
ref|XP_009803668.1|  PREDICTED: probable rhamnose biosynthetic en...  89.0    8e-19   Nicotiana sylvestris
ref|XP_009586858.1|  PREDICTED: probable rhamnose biosynthetic en...  89.0    8e-19   Nicotiana tomentosiformis
gb|KHM99622.1|  Putative rhamnose biosynthetic enzyme 1               87.8    2e-18   Glycine soja [wild soybean]
ref|XP_006355193.1|  PREDICTED: probable rhamnose biosynthetic en...  87.8    2e-18   Solanum tuberosum [potatoes]
ref|XP_010325193.1|  PREDICTED: probable rhamnose biosynthetic en...  87.8    2e-18   
ref|XP_011082935.1|  PREDICTED: trifunctional UDP-glucose 4,6-deh...  86.3    2e-18   Sesamum indicum [beniseed]
ref|XP_007011619.1|  Rhamnose biosynthesis 1                          87.4    2e-18   
gb|AFW66842.1|  hypothetical protein ZEAMMB73_620875                  83.6    2e-17   
gb|EYU29575.1|  hypothetical protein MIMGU_mgv1a008395mg              82.0    5e-17   Erythranthe guttata [common monkey flower]
ref|XP_003545554.1|  PREDICTED: probable rhamnose biosynthetic en...  83.6    7e-17   Glycine max [soybeans]
ref|NP_001054887.1|  Os05g0203400                                     79.0    2e-16   
ref|XP_004498563.1|  PREDICTED: probable rhamnose biosynthetic en...  80.5    8e-16   Cicer arietinum [garbanzo]
ref|XP_004292875.1|  PREDICTED: trifunctional UDP-glucose 4,6-deh...  79.7    1e-15   Fragaria vesca subsp. vesca
ref|XP_007161328.1|  hypothetical protein PHAVU_001G060400g           79.7    1e-15   Phaseolus vulgaris [French bean]
ref|XP_003588651.1|  Rhamnose synthase                                79.7    1e-15   Medicago truncatula
ref|XP_004256510.1|  DTDP-glucose 4,6-dehydratase, putative           75.9    7e-15   Entamoeba invadens IP1
ref|XP_003057320.1|  predicted protein                                77.0    1e-14   Micromonas pusilla CCMP1545
ref|XP_011401232.1|  DEAD-box ATP-dependent RNA helicase 20           76.6    2e-14   Auxenochlorella protothecoides
ref|XP_001701714.1|  NAD-dependent epimerase/dehydratase              73.9    4e-14   Chlamydomonas reinhardtii
ref|XP_003551160.1|  PREDICTED: probable rhamnose biosynthetic en...  75.1    5e-14   
gb|KHN30780.1|  Putative rhamnose biosynthetic enzyme 1               75.1    6e-14   Glycine soja [wild soybean]
ref|XP_005535008.1|  dTDP-glucose 4,6-dehydratase                     73.9    7e-14   Cyanidioschyzon merolae strain 10D
ref|XP_005537192.1|  dTDP-glucose 4,6-dehydratase                     73.6    7e-14   Cyanidioschyzon merolae strain 10D
ref|XP_005536953.1|  dTDP-glucose 4,6-dehydratase                     73.6    7e-14   Cyanidioschyzon merolae strain 10D
ref|WP_039452843.1|  dTDP-glucose 4,6-dehydratase                     73.6    7e-14   Pedobacter glucosidilyticus
gb|AGE59831.1|  GDP-L-fucose synthase 2                               73.2    8e-14   Acanthocystis turfacea Chlorella virus TN603.4.2
ref|WP_026904621.1|  dTDP-glucose 4,6-dehydratase                     73.2    1e-13   Pedobacter glucosidilyticus
gb|AGE56705.1|  GDP-L-fucose synthase 2                               72.8    1e-13   Acanthocystis turfacea Chlorella virus NE-JV-2
gb|AGE53603.1|  GDP-L-fucose synthase 2                               72.8    1e-13   Acanthocystis turfacea Chlorella virus GM0701.1
gb|AGE60164.1|  GDP-L-fucose synthase 2                               72.8    1e-13   Acanthocystis turfacea Chlorella virus WI0606
gb|AGE59487.1|  GDP-L-fucose synthase 2                               72.8    1e-13   Acanthocystis turfacea Chlorella virus OR0704.3
gb|AGE57735.1|  GDP-L-fucose synthase 2                               72.8    1e-13   Acanthocystis turfacea Chlorella virus NTS-1
gb|AGE57039.1|  GDP-L-fucose synthase 2                               72.8    1e-13   Acanthocystis turfacea Chlorella virus NE-JV-3
gb|AGE56041.1|  GDP-L-fucose synthase 2                               72.8    1e-13   Acanthocystis turfacea Chlorella virus MO0605SPH
gb|AGE49559.1|  GDP-L-fucose synthase 2                               72.8    1e-13   Acanthocystis turfacea Chlorella virus Can0610SP
gb|AGE49233.1|  GDP-L-fucose synthase 2                               72.8    1e-13   Acanthocystis turfacea Chlorella virus Br0604L
ref|YP_001427025.1|  hypothetical protein ATCV1_Z544R                 72.8    1e-13   Acanthocystis turfacea chlorella virus 1
gb|AGE50238.1|  GDP-L-fucose synthase 2                               72.4    2e-13   Acanthocystis turfacea Chlorella virus Canal-1
ref|XP_005648752.1|  NAD-dependent epimerase/dehydratase              72.4    2e-13   Coccomyxa subellipsoidea C-169
gb|AGE55724.1|  GDP-L-fucose synthase 2                               72.0    2e-13   Acanthocystis turfacea Chlorella virus MN0810.1
ref|XP_004253556.1|  DTDP-glucose 4,6-dehydratase, putative           71.6    3e-13   Entamoeba invadens IP1
ref|WP_017256850.1|  dTDP-glucose 4,6-dehydratase                     71.6    3e-13   Pedobacter arcticus
ref|XP_004336227.1|  dTDPD-glucose 4,6-dehydratase                    72.0    3e-13   Acanthamoeba castellanii str. Neff
ref|XP_005644844.1|  NAD(P)-binding protein                           71.6    4e-13   Coccomyxa subellipsoidea C-169
gb|EDL00565.1|  TDP-glucose 4,6-dehydratase, isoform CRA_b            68.2    4e-13   Mus musculus [mouse]
ref|XP_004184621.1|  DTDP-glucose 4,6-dehydratase, putative           70.9    5e-13   Entamoeba invadens IP1
ref|XP_011401987.1|  putative rhamnose biosynthetic enzyme 3          71.2    6e-13   Auxenochlorella protothecoides
ref|WP_041882446.1|  dTDP-glucose 4,6-dehydratase                     70.9    6e-13   Pedobacter lusitanus
gb|ERE88473.1|  dTDP-D-glucose 4,6-dehydratase-like protein           70.5    7e-13   Cricetulus griseus [Chinese hamsters]
gb|KDD73904.1|  NAD dependent epimerase/dehydratase                   70.9    7e-13   Helicosporidium sp. ATCC 50920
gb|ERE88474.1|  dTDP-D-glucose 4,6-dehydratase-like protein           70.5    7e-13   Cricetulus griseus [Chinese hamsters]
gb|EDM02523.1|  TDP-glucose 4,6-dehydratase (predicted), isoform ...  68.9    8e-13   Rattus norvegicus [brown rat]
gb|EMS11387.1|  dTDP-D-glucose 4,6-dehydratase                        68.2    8e-13   Entamoeba histolytica HM-3:IMSS
gb|EDM02522.1|  TDP-glucose 4,6-dehydratase (predicted), isoform ...  68.9    1e-12   Rattus norvegicus [brown rat]
ref|XP_001422283.1|  putative NAD-dependent epimerase/dehydratase     70.1    1e-12   Ostreococcus lucimarinus CCE9901
ref|XP_002500589.1|  predicted protein                                71.2    1e-12   Micromonas commoda
ref|XP_005079467.1|  PREDICTED: dTDP-D-glucose 4,6-dehydratase        70.1    1e-12   Mesocricetus auratus [Syrian golden hamster]
ref|XP_006978807.1|  PREDICTED: dTDP-D-glucose 4,6-dehydratase        70.1    1e-12   Peromyscus maniculatus bairdii
ref|XP_005355717.1|  PREDICTED: dTDP-D-glucose 4,6-dehydratase        69.3    2e-12   
ref|XP_001422288.1|  predicted protein                                69.3    2e-12   Ostreococcus lucimarinus CCE9901
ref|XP_001737366.1|  DTDP-glucose 4,6-dehydratase                     69.3    2e-12   Entamoeba dispar SAW760
ref|XP_005778340.1|  hypothetical protein EMIHUDRAFT_367182           69.3    3e-12   Emiliania huxleyi CCMP1516
ref|WP_010602149.1|  dTDP-glucose 4,6-dehydratase                     69.3    3e-12   Pedobacter agri
dbj|BAB27693.1|  unnamed protein product                              68.9    3e-12   Mus musculus [mouse]
ref|XP_416988.1|  PREDICTED: dTDP-D-glucose 4,6-dehydratase isofo...  68.9    3e-12   Gallus gallus [bantam]
ref|WP_039475896.1|  dTDP-glucose 4,6-dehydratase                     68.9    3e-12   Pedobacter kyungheensis
gb|AAH21419.1|  TDP-glucose 4,6-dehydratase                           68.9    4e-12   Mus musculus [mouse]
ref|NP_083854.3|  dTDP-D-glucose 4,6-dehydratase                      68.9    4e-12   Mus musculus [mouse]
gb|EDL00567.1|  TDP-glucose 4,6-dehydratase, isoform CRA_d            68.9    4e-12   Mus musculus [mouse]
ref|WP_008243218.1|  dTDP-glucose 4,6-dehydratase                     68.9    4e-12   Pedobacter sp. BAL39
gb|EDL00564.1|  TDP-glucose 4,6-dehydratase, isoform CRA_a            68.6    5e-12   Mus musculus [mouse]
ref|XP_005781167.1|  hypothetical protein EMIHUDRAFT_442934           68.6    5e-12   Emiliania huxleyi CCMP1516
ref|WP_029278571.1|  dTDP-glucose 4,6-dehydratase                     68.6    5e-12   Pedobacter borealis
ref|XP_002939327.2|  PREDICTED: dTDP-D-glucose 4,6-dehydratase is...  67.8    5e-12   
gb|EWM30544.1|  dTDP-glucose 4,6-dehydratase                          68.9    5e-12   Nannochloropsis gaditana
ref|WP_016195933.1|  dTDP-glucose 4,6-dehydratase                     68.2    6e-12   Arcticibacter svalbardensis
emb|CBK22816.2|  unnamed protein product                              68.9    6e-12   Blastocystis hominis
ref|WP_025145054.1|  dTDP-glucose 4,6-dehydratase                     68.2    6e-12   Pedobacter jeongneungensis
ref|XP_010628993.1|  PREDICTED: dTDP-D-glucose 4,6-dehydratase is...  67.4    6e-12   
gb|ETZ24261.1|  dTDP-glucose 4,6-dehydratase                          68.2    6e-12   Pedobacter sp. V48
ref|XP_005757838.1|  hypothetical protein EMIHUDRAFT_433184           68.6    6e-12   Emiliania huxleyi CCMP1516
ref|XP_005516855.1|  PREDICTED: dTDP-D-glucose 4,6-dehydratase        68.2    7e-12   Pseudopodoces humilis [Tibetan ground-jay]
ref|WP_027453690.1|  hypothetical protein                             64.7    7e-12   
ref|WP_026624666.1|  spore coat protein                               67.8    8e-12   Eggerthia catenaformis
ref|XP_005037773.1|  PREDICTED: dTDP-D-glucose 4,6-dehydratase        67.8    8e-12   Ficedula albicollis
ref|WP_004801505.1|  dTDP-glucose 4,6-dehydratase                     67.8    8e-12   Eggerthia catenaformis
ref|XP_007101812.1|  PREDICTED: dTDP-D-glucose 4,6-dehydratase is...  67.0    8e-12   Physeter catodon
ref|XP_005487541.1|  PREDICTED: dTDP-D-glucose 4,6-dehydratase        67.8    9e-12   Zonotrichia albicollis
ref|WP_015809411.1|  dTDP-glucose 4,6-dehydratase                     67.8    9e-12   Pedobacter heparinus
ref|WP_016197199.1|  dTDP-glucose 4,6-dehydratase                     67.8    9e-12   Arcticibacter svalbardensis
dbj|BAH13961.1|  unnamed protein product                              64.7    1e-11   Homo sapiens [man]
ref|XP_002196929.2|  PREDICTED: dTDP-D-glucose 4,6-dehydratase        67.8    1e-11   Taeniopygia guttata
gb|ELT91052.1|  hypothetical protein CAPTEDRAFT_223439                67.8    1e-11   Capitella teleta
gb|ENY60225.1|  dTDP-D-glucose 4,6-dehydratase, putative              65.1    1e-11   
ref|XP_005014901.1|  PREDICTED: dTDP-D-glucose 4,6-dehydratase        67.8    1e-11   
ref|WP_038563096.1|  dTDP-glucose 4,6-dehydratase                     67.4    1e-11   
ref|XP_009899796.1|  PREDICTED: dTDP-D-glucose 4,6-dehydratase        67.4    1e-11   
ref|XP_005144815.1|  PREDICTED: dTDP-D-glucose 4,6-dehydratase        67.4    1e-11   
ref|WP_013634856.1|  dTDP-glucose 4,6-dehydratase                     67.4    1e-11   
ref|XP_001741245.1|  DTDP-glucose 4,6-dehydratase                     67.4    1e-11   
ref|WP_012508962.1|  dTDP-glucose 4,6-dehydratase                     67.4    1e-11   
ref|XP_656509.1|  dTDP-D-glucose 4,6-dehydratase                      67.0    1e-11   
ref|WP_022309236.1|  dTDP-glucose 4 6-dehydratase                     67.4    1e-11   
ref|WP_029281081.1|  dTDP-glucose 4,6-dehydratase                     67.0    1e-11   
ref|XP_003218711.1|  PREDICTED: dTDP-D-glucose 4,6-dehydratase        67.0    1e-11   
ref|XP_008825223.1|  PREDICTED: dTDP-D-glucose 4,6-dehydratase is...  66.6    1e-11   
ref|XP_007101813.1|  PREDICTED: dTDP-D-glucose 4,6-dehydratase is...  66.2    1e-11   
ref|XP_007101808.1|  PREDICTED: dTDP-D-glucose 4,6-dehydratase is...  67.0    2e-11   
ref|XP_005374169.1|  PREDICTED: dTDP-D-glucose 4,6-dehydratase is...  67.0    2e-11   
ref|XP_010957995.1|  PREDICTED: dTDP-D-glucose 4,6-dehydratase is...  67.0    2e-11   
ref|XP_007196914.1|  PREDICTED: dTDP-D-glucose 4,6-dehydratase is...  67.0    2e-11   
ref|XP_004604078.1|  PREDICTED: dTDP-D-glucose 4,6-dehydratase        67.0    2e-11   
gb|KJF43043.1|  dTDP-glucose 4,6-dehydratase                          67.0    2e-11   
ref|XP_003084264.1|  UDP-glucose 4-epimerase/UDP-sulfoquinovose s...  68.2    2e-11   
ref|XP_007101811.1|  PREDICTED: dTDP-D-glucose 4,6-dehydratase is...  66.2    2e-11   
ref|WP_039436106.1|  dTDP-glucose 4,6-dehydratase                     67.0    2e-11   
ref|XP_008154704.1|  PREDICTED: dTDP-D-glucose 4,6-dehydratase        67.0    2e-11   
ref|XP_002181238.1|  predicted protein                                67.4    2e-11   
ref|XP_010628984.1|  PREDICTED: dTDP-D-glucose 4,6-dehydratase is...  66.6    2e-11   
ref|XP_005586151.1|  PREDICTED: dTDP-D-glucose 4,6-dehydratase is...  66.2    2e-11   
ref|XP_005305067.1|  PREDICTED: dTDP-D-glucose 4,6-dehydratase is...  65.9    2e-11   
ref|WP_038558128.1|  dTDP-glucose 4,6-dehydratase                     66.6    2e-11   
ref|XP_004371454.1|  PREDICTED: dTDP-D-glucose 4,6-dehydratase        66.6    2e-11   
ref|XP_002953659.1|  hypothetical protein VOLCADRAFT_82358            66.6    2e-11   
emb|CEG01892.1|  NAD-dependent epimerase/dehydratase                  67.8    2e-11   
ref|NP_001088301.1|  dTDP-glucose 4,6-dehydratase                     66.6    2e-11   
ref|XP_008825221.1|  PREDICTED: dTDP-D-glucose 4,6-dehydratase is...  66.6    2e-11   
ref|XP_002713048.1|  PREDICTED: dTDP-D-glucose 4,6-dehydratase is...  66.6    3e-11   
ref|XP_005374168.1|  PREDICTED: dTDP-D-glucose 4,6-dehydratase is...  66.6    3e-11   
ref|XP_010587692.1|  PREDICTED: dTDP-D-glucose 4,6-dehydratase is...  65.9    3e-11   
ref|XP_007456437.1|  PREDICTED: dTDP-D-glucose 4,6-dehydratase        66.6    3e-11   
ref|XP_004626312.1|  PREDICTED: dTDP-D-glucose 4,6-dehydratase        66.6    3e-11   
ref|XP_003409363.1|  PREDICTED: dTDP-D-glucose 4,6-dehydratase is...  66.6    3e-11   
ref|XP_005882453.1|  PREDICTED: dTDP-D-glucose 4,6-dehydratase is...  65.9    3e-11   
ref|XP_006156670.1|  PREDICTED: dTDP-D-glucose 4,6-dehydratase is...  65.9    3e-11   
ref|XP_006879634.1|  PREDICTED: dTDP-D-glucose 4,6-dehydratase        66.2    3e-11   
ref|XP_009002779.1|  PREDICTED: dTDP-D-glucose 4,6-dehydratase is...  66.2    3e-11   
gb|KDD76685.1|  NAD dependent epimerase/dehydratase                   66.6    3e-11   
ref|XP_005317101.1|  PREDICTED: dTDP-D-glucose 4,6-dehydratase        66.2    3e-11   
ref|XP_003131096.2|  PREDICTED: dTDP-D-glucose 4,6-dehydratase is...  66.2    3e-11   
ref|XP_006191479.1|  PREDICTED: dTDP-D-glucose 4,6-dehydratase        66.2    3e-11   
ref|XP_005882452.1|  PREDICTED: dTDP-D-glucose 4,6-dehydratase is...  66.2    3e-11   
ref|WP_019246838.1|  hypothetical protein                             64.3    3e-11   
ref|XP_006156669.1|  PREDICTED: dTDP-D-glucose 4,6-dehydratase is...  66.2    3e-11   
ref|XP_006089900.1|  PREDICTED: dTDP-D-glucose 4,6-dehydratase is...  65.5    3e-11   
ref|WP_025862796.1|  dTDP-glucose 4,6-dehydratase                     66.2    3e-11   
ref|XP_005586149.1|  PREDICTED: dTDP-D-glucose 4,6-dehydratase is...  66.2    3e-11   
ref|WP_019245479.1|  hypothetical protein                             63.9    3e-11   
ref|XP_007101809.1|  PREDICTED: dTDP-D-glucose 4,6-dehydratase is...  65.9    3e-11   
ref|XP_010957996.1|  PREDICTED: dTDP-D-glucose 4,6-dehydratase is...  66.2    3e-11   
ref|XP_006089899.1|  PREDICTED: dTDP-D-glucose 4,6-dehydratase is...  66.2    3e-11   
ref|WP_031446149.1|  dTDP-glucose 4,6-dehydratase                     66.2    3e-11   
emb|CBN76510.1|  conserved unknown protein                            66.2    3e-11   
ref|XP_007101807.1|  PREDICTED: dTDP-D-glucose 4,6-dehydratase is...  66.2    3e-11   
ref|XP_006211070.1|  PREDICTED: dTDP-D-glucose 4,6-dehydratase        66.2    3e-11   
ref|XP_008569757.1|  PREDICTED: dTDP-D-glucose 4,6-dehydratase        66.2    3e-11   
ref|XP_007196913.1|  PREDICTED: dTDP-D-glucose 4,6-dehydratase is...  66.2    4e-11   
ref|XP_003928247.1|  PREDICTED: dTDP-D-glucose 4,6-dehydratase        66.2    4e-11   
emb|CEG78287.1|  Putative dTDP-glucose 4,6-dehydratase                63.9    4e-11   
ref|XP_007942199.1|  PREDICTED: dTDP-D-glucose 4,6-dehydratase        66.2    4e-11   
ref|XP_006927417.1|  PREDICTED: dTDP-D-glucose 4,6-dehydratase is...  65.5    4e-11   
emb|CEG62761.1|  Putative dTDP-glucose 4,6-dehydratase                63.9    4e-11   
ref|XP_010628976.1|  PREDICTED: dTDP-D-glucose 4,6-dehydratase is...  66.2    4e-11   
ref|XP_009031751.1|  hypothetical protein HELRODRAFT_104422           66.2    4e-11   
ref|XP_004884841.1|  PREDICTED: dTDP-D-glucose 4,6-dehydratase is...  65.1    4e-11   
ref|XP_008057635.1|  PREDICTED: dTDP-D-glucose 4,6-dehydratase        65.9    4e-11   
ref|XP_005601353.1|  PREDICTED: dTDP-D-glucose 4,6-dehydratase is...  65.5    4e-11   
ref|XP_004709829.1|  PREDICTED: dTDP-D-glucose 4,6-dehydratase        65.9    4e-11   
ref|XP_003980524.1|  PREDICTED: dTDP-D-glucose 4,6-dehydratase is...  65.9    4e-11   
ref|WP_028911869.1|  dTDP-glucose 4,6-dehydratase                     66.2    4e-11   
ref|XP_009632893.1|  PREDICTED: dTDP-D-glucose 4,6-dehydratase        65.9    4e-11   
ref|XP_006270243.1|  PREDICTED: dTDP-D-glucose 4,6-dehydratase        65.9    4e-11   
ref|XP_002742523.1|  PREDICTED: dTDP-D-glucose 4,6-dehydratase is...  65.9    4e-11   
ref|XP_004313346.1|  PREDICTED: LOW QUALITY PROTEIN: dTDP-D-gluco...  65.9    4e-11   
ref|WP_028298815.1|  dTDP-glucose 4,6-dehydratase                     65.9    4e-11   
ref|XP_006769641.1|  PREDICTED: dTDP-D-glucose 4,6-dehydratase        65.9    4e-11   
ref|NP_055120.1|  dTDP-D-glucose 4,6-dehydratase isoform 1            65.9    5e-11   
ref|XP_522697.2|  PREDICTED: dTDP-D-glucose 4,6-dehydratase isofo...  65.9    5e-11   
ref|WP_038030515.1|  dTDP-glucose 4,6-dehydratase                     65.9    5e-11   
ref|WP_024986886.1|  dTDP-glucose 4,6-dehydratase                     65.9    5e-11   
ref|XP_001512139.2|  PREDICTED: dTDP-D-glucose 4,6-dehydratase        65.9    5e-11   
ref|XP_001297395.1|  NAD dependent epimerase/dehydratase family p...  65.9    5e-11   
ref|NP_001270865.1|  uncharacterized protein LOC101926513             65.9    5e-11   
ref|XP_003477586.2|  PREDICTED: dTDP-D-glucose 4,6-dehydratase        65.9    5e-11   
ref|XP_004054696.1|  PREDICTED: dTDP-D-glucose 4,6-dehydratase        65.9    5e-11   
ref|XP_004884840.1|  PREDICTED: dTDP-D-glucose 4,6-dehydratase is...  65.9    5e-11   
ref|XP_004273708.1|  PREDICTED: LOW QUALITY PROTEIN: dTDP-D-gluco...  65.9    5e-11   
ref|XP_003832071.1|  PREDICTED: dTDP-D-glucose 4,6-dehydratase is...  65.9    5e-11   
ref|XP_008683235.1|  PREDICTED: dTDP-D-glucose 4,6-dehydratase is...  65.9    5e-11   
ref|WP_039425685.1|  dTDP-glucose 4,6-dehydratase                     65.5    5e-11   
ref|XP_003257436.1|  PREDICTED: dTDP-D-glucose 4,6-dehydratase        65.5    5e-11   
ref|XP_002918693.1|  PREDICTED: dTDP-D-glucose 4,6-dehydratase is...  65.5    5e-11   
ref|XP_002824410.1|  PREDICTED: dTDP-D-glucose 4,6-dehydratase is...  65.5    5e-11   
ref|WP_022479714.1|  dTDP-glucose 4 6-dehydratase                     65.9    6e-11   
ref|WP_027453889.1|  dTDP-glucose 4,6-dehydratase                     65.9    6e-11   
ref|WP_022460526.1|  dTDP-glucose 4 6-dehydratase                     65.5    6e-11   
ref|XP_542640.3|  PREDICTED: dTDP-D-glucose 4,6-dehydratase           65.5    6e-11   
gb|AAH05284.1|  TGDS protein                                          65.1    6e-11   
ref|XP_005305066.1|  PREDICTED: dTDP-D-glucose 4,6-dehydratase is...  65.5    6e-11   
ref|WP_004327762.1|  dTDP-glucose 4,6-dehydratase                     65.5    6e-11   
ref|WP_015027465.1|  dTDP-glucose 4,6-dehydratase                     65.5    6e-11   
ref|WP_039419691.1|  MULTISPECIES: dTDP-glucose 4,6-dehydratase       65.5    6e-11   
ref|WP_008244826.1|  dTDP-glucose 4,6-dehydratase                     65.5    6e-11   
gb|EHH58661.1|  dTDP-D-glucose 4,6-dehydratase                        65.5    6e-11   
ref|XP_006743512.1|  PREDICTED: dTDP-D-glucose 4,6-dehydratase        65.5    6e-11   
ref|WP_044075148.1|  dTDP-glucose 4,6-dehydratase                     65.9    6e-11   
ref|XP_004408787.1|  PREDICTED: dTDP-D-glucose 4,6-dehydratase        65.5    6e-11   
ref|XP_004577690.1|  PREDICTED: dTDP-D-glucose 4,6-dehydratase        66.2    6e-11   
gb|AAL18013.1|  dTDP-glucose 4,6-dehydratase                          65.5    6e-11   
gb|EHO63786.1|  dTDP-glucose 4,6-dehydratase                          65.1    7e-11   
ref|WP_025114725.1|  spore coat protein                               65.1    7e-11   
ref|XP_004012251.1|  PREDICTED: dTDP-D-glucose 4,6-dehydratase        65.5    7e-11   
ref|XP_005909299.1|  PREDICTED: dTDP-D-glucose 4,6-dehydratase        65.5    7e-11   
ref|WP_027453899.1|  dTDP-glucose 4,6-dehydratase                     65.5    7e-11   
ref|WP_039422364.1|  dTDP-glucose 4,6-dehydratase                     65.5    7e-11   
ref|XP_010357203.1|  PREDICTED: dTDP-D-glucose 4,6-dehydratase is...  65.5    7e-11   
ref|WP_040379758.1|  spore coat protein                               65.1    7e-11   
ref|WP_026999044.1|  dTDP-glucose 4,6-dehydratase                     65.1    7e-11   
ref|WP_021665163.1|  dTDP-glucose 4,6-dehydratase                     65.5    7e-11   
ref|WP_004584097.1|  dTDP-glucose 4,6-dehydratase                     65.5    7e-11   
ref|WP_024282076.1|  dTDP-glucose 4,6-dehydratase                     65.1    7e-11   
ref|NP_001094629.1|  dTDP-D-glucose 4,6-dehydratase                   65.5    7e-11   
ref|XP_001491790.2|  PREDICTED: dTDP-D-glucose 4,6-dehydratase is...  65.5    7e-11   
ref|WP_037439598.1|  dTDP-glucose 4,6-dehydratase                     65.1    7e-11   
ref|XP_005687758.1|  PREDICTED: dTDP-D-glucose 4,6-dehydratase        65.1    7e-11   
ref|WP_041880858.1|  dTDP-glucose 4,6-dehydratase                     65.1    8e-11   
ref|XP_006080395.1|  PREDICTED: dTDP-D-glucose 4,6-dehydratase is...  65.1    8e-11   
ref|XP_004650848.1|  PREDICTED: dTDP-D-glucose 4,6-dehydratase        65.5    8e-11   
ref|WP_009133376.1|  dTDP-glucose 4,6-dehydratase                     65.5    8e-11   
ref|XP_009190350.1|  PREDICTED: dTDP-D-glucose 4,6-dehydratase is...  65.1    8e-11   
ref|WP_022130560.1|  dTDP-glucose 4 6-dehydratase                     65.5    8e-11   
ref|WP_039446062.1|  dTDP-glucose 4,6-dehydratase                     65.1    8e-11   
ref|XP_004423167.1|  PREDICTED: dTDP-D-glucose 4,6-dehydratase        65.1    9e-11   
ref|WP_021664463.1|  dTDP-glucose 4,6-dehydratase                     65.1    9e-11   
ref|WP_005874689.1|  dTDP-glucose 4,6-dehydratase                     65.1    9e-11   
ref|WP_027420371.1|  dTDP-glucose 4,6-dehydratase                     65.1    9e-11   
ref|XP_002291084.1|  dtdp-glucose 4,6-dehydratase                     65.1    9e-11   
ref|WP_037300607.1|  dTDP-glucose 4,6-dehydratase                     64.7    1e-10   
ref|WP_008505115.1|  dTDP-glucose 4,6-dehydratase                     64.7    1e-10   
ref|WP_022333339.1|  dTDP-glucose 4 6-dehydratase                     65.1    1e-10   
ref|WP_018629359.1|  dTDP-glucose 4,6-dehydratase                     64.7    1e-10   
ref|WP_026945982.1|  dTDP-glucose 4,6-dehydratase                     64.7    1e-10   
ref|XP_010809203.1|  PREDICTED: dTDP-D-glucose 4,6-dehydratase is...  64.7    1e-10   
ref|WP_019151643.1|  dTDP-glucose 4,6-dehydratase                     65.1    1e-10   
ref|WP_022047606.1|  dTDP-glucose 4 6-dehydratase                     64.7    1e-10   
ref|XP_003765842.1|  PREDICTED: dTDP-D-glucose 4,6-dehydratase        64.7    1e-10   
ref|WP_009135498.1|  dTDP-glucose 4,6-dehydratase                     64.7    1e-10   
ref|WP_021847322.1|  hypothetical protein                             64.7    1e-10   
ref|XP_007440567.1|  PREDICTED: dTDP-D-glucose 4,6-dehydratase        64.7    1e-10   
ref|WP_026810890.1|  dTDP-glucose 4,6-dehydratase                     64.7    1e-10   
ref|WP_013815625.1|  dTDP-glucose 4,6-dehydratase                     64.7    1e-10   
ref|XP_006913872.1|  PREDICTED: dTDP-D-glucose 4,6-dehydratase        64.7    1e-10   
ref|XP_001628519.1|  predicted protein                                64.7    1e-10   
ref|XP_011353793.1|  PREDICTED: dTDP-D-glucose 4,6-dehydratase        64.7    1e-10   
ref|WP_022405553.1|  dTDP-glucose 4 6-dehydratase                     64.3    1e-10   
ref|XP_003789623.1|  PREDICTED: dTDP-D-glucose 4,6-dehydratase        64.3    1e-10   
ref|XP_004457791.1|  PREDICTED: dTDP-D-glucose 4,6-dehydratase        63.9    1e-10   
ref|WP_021992008.1|  dTDP-glucose 4 6-dehydratase                     64.3    2e-10   
ref|XP_007526909.1|  PREDICTED: dTDP-D-glucose 4,6-dehydratase        64.3    2e-10   
ref|WP_014775267.1|  dTDP-glucose 4,6-dehydratase                     64.3    2e-10   
ref|WP_009596842.1|  dTDP-glucose 4,6-dehydratase                     64.3    2e-10   
ref|WP_014776387.1|  dTDP-glucose 4,6-dehydratase                     64.3    2e-10   
ref|WP_009598179.1|  dTDP-glucose 4,6-dehydratase                     64.3    2e-10   
ref|XP_652489.1|  dTDP-D-glucose 4,6-dehydratase                      64.3    2e-10   
ref|WP_042001329.1|  dTDP-glucose 4,6-dehydratase                     64.3    2e-10   
ref|WP_010266954.1|  dTDP-glucose 4,6-dehydratase                     64.3    2e-10   
ref|XP_005970989.1|  PREDICTED: dTDP-D-glucose 4,6-dehydratase        64.3    2e-10   
ref|XP_005704072.1|  dTDP-glucose 4,6-dehydratase                     64.3    2e-10   
ref|XP_006832128.1|  PREDICTED: LOW QUALITY PROTEIN: dTDP-D-gluco...  64.3    2e-10   
ref|XP_010223810.1|  PREDICTED: dTDP-D-glucose 4,6-dehydratase        63.9    2e-10   
ref|WP_026896839.1|  dTDP-glucose 4,6-dehydratase                     64.3    2e-10   
ref|WP_021886903.1|  dTDP-glucose 4 6-dehydratase                     63.9    2e-10   
ref|WP_044102205.1|  dTDP-glucose 4,6-dehydratase                     64.3    2e-10   
ref|WP_010665144.1|  dTDP-glucose 4,6-dehydratase                     64.3    2e-10   
ref|WP_042347058.1|  dTDP-glucose 4,6-dehydratase                     64.3    2e-10   
ref|WP_013998363.1|  dTDP-glucose 4,6-dehydratase                     64.3    2e-10   
ref|WP_012502954.1|  dTDP-glucose 4,6-dehydratase                     63.9    2e-10   
ref|WP_022460241.1|  dTDP-glucose 4 6-dehydratase                     64.3    2e-10   
ref|WP_042007584.1|  dTDP-glucose 4,6-dehydratase                     63.9    2e-10   
ref|WP_032134258.1|  dTDP-glucose 4,6-dehydratase                     63.9    2e-10   
ref|XP_001377580.2|  PREDICTED: dTDP-D-glucose 4,6-dehydratase is...  63.9    2e-10   
ref|XP_005845105.1|  hypothetical protein CHLNCDRAFT_7301             63.9    2e-10   
ref|XP_007508076.1|  predicted protein                                65.1    2e-10   
ref|WP_041991678.1|  dTDP-glucose 4,6-dehydratase                     63.9    2e-10   
ref|WP_042343652.1|  dTDP-glucose 4,6-dehydratase                     63.9    2e-10   
ref|WP_044299326.1|  dTDP-glucose 4,6-dehydratase                     63.9    2e-10   
ref|WP_018695454.1|  dTDP-glucose 4,6-dehydratase                     63.9    2e-10   
ref|WP_021839700.1|  dTDP-glucose 4 6-dehydratase                     63.9    2e-10   
ref|XP_005854661.1|  dTDP-glucose 4,6-dehydratase                     63.9    2e-10   
ref|WP_018697450.1|  dTDP-glucose 4,6-dehydratase                     63.9    2e-10   
ref|WP_018696978.1|  dTDP-glucose 4,6-dehydratase                     63.9    2e-10   
ref|XP_007888982.1|  PREDICTED: dTDP-D-glucose 4,6-dehydratase is...  63.9    2e-10   
ref|XP_004746205.1|  PREDICTED: LOW QUALITY PROTEIN: dTDP-D-gluco...  63.9    2e-10   
ref|WP_005819176.1|  dTDP-glucose 4,6-dehydratase                     63.9    2e-10   
ref|WP_005786328.1|  dTDP-glucose 4,6-dehydratase                     63.9    2e-10   
ref|WP_032531294.1|  dTDP-glucose 4,6-dehydratase                     63.9    2e-10   
ref|WP_021864202.1|  dTDP-D-glucose 4 6-dehydratase RfbB              63.5    2e-10   
gb|KFQ37860.1|  dTDP-D-glucose 4,6-dehydratase                        63.9    2e-10   
ref|XP_007888979.1|  PREDICTED: dTDP-D-glucose 4,6-dehydratase is...  63.9    2e-10   
ref|WP_022307720.1|  hypothetical protein                             63.9    3e-10   
ref|WP_014083328.1|  dTDP-glucose 4,6-dehydratase                     63.5    3e-10   
ref|WP_021668034.1|  dTDP-glucose 4,6-dehydratase                     63.9    3e-10   
ref|WP_018279396.1|  dTDP-glucose 4,6-dehydratase                     63.5    3e-10   
ref|WP_006745296.1|  dTDP-glucose 4,6-dehydratase                     63.5    3e-10   
ref|XP_010185292.1|  PREDICTED: dTDP-D-glucose 4,6-dehydratase        63.5    3e-10   
ref|WP_012475309.1|  dTDP-glucose 4,6-dehydratase                     63.5    3e-10   
ref|WP_044656886.1|  dTDP-glucose 4,6-dehydratase                     63.9    3e-10   
ref|WP_022021680.1|  hypothetical protein                             63.9    3e-10   
ref|WP_009433436.1|  dTDP-glucose 4,6-dehydratase                     63.5    3e-10   
ref|XP_007098479.1|  PREDICTED: dTDP-D-glucose 4,6-dehydratase        63.9    3e-10   
ref|WP_031532160.1|  MULTISPECIES: dTDP-glucose 4,6-dehydratase       63.5    3e-10   
ref|WP_025075576.1|  dTDP-glucose 4,6-dehydratase                     63.5    3e-10   
ref|WP_026952396.1|  dTDP-glucose 4,6-dehydratase                     63.5    3e-10   
ref|WP_013188363.1|  dTDP-glucose 4,6-dehydratase                     63.5    3e-10   



>ref|XP_006845495.1| hypothetical protein AMTR_s00019p00150410 [Amborella trichopoda]
 gb|ERN07170.1| hypothetical protein AMTR_s00019p00150410 [Amborella trichopoda]
Length=681

 Score =   107 bits (268),  Expect = 2e-25, Method: Composition-based stats.
 Identities = 49/54 (91%), Positives = 53/54 (98%), Gaps = 0/54 (0%)
 Frame = +3

Query  3    ILITGAAGFIASHVANRLVRSYPNYKIVIVDKLXYCSNLKNLLPSRSSPNFKFV  164
            ILITGAAGFIASHVANRL+R+YPNYKIV++DKL YCSNLKNLLPSRSSPNFKFV
Sbjct  19   ILITGAAGFIASHVANRLIRNYPNYKIVVLDKLDYCSNLKNLLPSRSSPNFKFV  72



>ref|XP_010915435.1| PREDICTED: trifunctional UDP-glucose 4,6-dehydratase/UDP-4-keto-6-deoxy-D-glucose 
3,5-epimerase/UDP-4-keto-L-rhamnose-reductase 
RHM1 [Elaeis guineensis]
 ref|XP_010915436.1| PREDICTED: trifunctional UDP-glucose 4,6-dehydratase/UDP-4-keto-6-deoxy-D-glucose 
3,5-epimerase/UDP-4-keto-L-rhamnose-reductase 
RHM1 [Elaeis guineensis]
 ref|XP_010915438.1| PREDICTED: trifunctional UDP-glucose 4,6-dehydratase/UDP-4-keto-6-deoxy-D-glucose 
3,5-epimerase/UDP-4-keto-L-rhamnose-reductase 
RHM1 [Elaeis guineensis]
Length=678

 Score =   106 bits (265),  Expect = 4e-25, Method: Composition-based stats.
 Identities = 49/54 (91%), Positives = 53/54 (98%), Gaps = 0/54 (0%)
 Frame = +3

Query  3    ILITGAAGFIASHVANRLVRSYPNYKIVIVDKLXYCSNLKNLLPSRSSPNFKFV  164
            ILITGAAGFIASHVANRL+R+YPNYKIV++DKL YCSNLKNLLPSRSSPNFKFV
Sbjct  9    ILITGAAGFIASHVANRLIRNYPNYKIVVLDKLDYCSNLKNLLPSRSSPNFKFV  62



>ref|XP_003546628.1| PREDICTED: probable rhamnose biosynthetic enzyme 1-like isoform 
X1 [Glycine max]
 ref|XP_006597976.1| PREDICTED: probable rhamnose biosynthetic enzyme 1-like isoform 
X2 [Glycine max]
 ref|XP_006597977.1| PREDICTED: probable rhamnose biosynthetic enzyme 1-like isoform 
X3 [Glycine max]
Length=668

 Score =   106 bits (265),  Expect = 4e-25, Method: Composition-based stats.
 Identities = 49/54 (91%), Positives = 53/54 (98%), Gaps = 0/54 (0%)
 Frame = +3

Query  3    ILITGAAGFIASHVANRLVRSYPNYKIVIVDKLXYCSNLKNLLPSRSSPNFKFV  164
            ILITGAAGFIASHVANRLVRSYP+YKIV++DKL YCSNLKNLLPS+SSPNFKFV
Sbjct  9    ILITGAAGFIASHVANRLVRSYPDYKIVVLDKLDYCSNLKNLLPSKSSPNFKFV  62



>ref|XP_010093448.1| putative rhamnose biosynthetic enzyme 1 [Morus notabilis]
 gb|EXB54072.1| putative rhamnose biosynthetic enzyme 1 [Morus notabilis]
Length=671

 Score =   106 bits (264),  Expect = 7e-25, Method: Composition-based stats.
 Identities = 48/54 (89%), Positives = 53/54 (98%), Gaps = 0/54 (0%)
 Frame = +3

Query  3    ILITGAAGFIASHVANRLVRSYPNYKIVIVDKLXYCSNLKNLLPSRSSPNFKFV  164
            ILITGAAGFIASHVANRL+RSYP+YKIV++DKL YCSNLKNLLPS+SSPNFKFV
Sbjct  9    ILITGAAGFIASHVANRLIRSYPDYKIVVLDKLDYCSNLKNLLPSKSSPNFKFV  62



>gb|KJB61503.1| hypothetical protein B456_009G362500 [Gossypium raimondii]
Length=535

 Score =   105 bits (261),  Expect = 8e-25, Method: Composition-based stats.
 Identities = 47/54 (87%), Positives = 53/54 (98%), Gaps = 0/54 (0%)
 Frame = +3

Query  3    ILITGAAGFIASHVANRLVRSYPNYKIVIVDKLXYCSNLKNLLPSRSSPNFKFV  164
            ILITGAAGFIASHVANRLVR+YP+YKIV++DKL YCSNLKNL+PS+SSPNFKFV
Sbjct  9    ILITGAAGFIASHVANRLVRNYPDYKIVVLDKLDYCSNLKNLIPSQSSPNFKFV  62



>ref|XP_009376726.1| PREDICTED: probable rhamnose biosynthetic enzyme 1 isoform X1 
[Pyrus x bretschneideri]
 ref|XP_009376727.1| PREDICTED: probable rhamnose biosynthetic enzyme 1 isoform X2 
[Pyrus x bretschneideri]
Length=668

 Score =   105 bits (261),  Expect = 1e-24, Method: Composition-based stats.
 Identities = 48/54 (89%), Positives = 52/54 (96%), Gaps = 0/54 (0%)
 Frame = +3

Query  3    ILITGAAGFIASHVANRLVRSYPNYKIVIVDKLXYCSNLKNLLPSRSSPNFKFV  164
            ILITGAAGFIASHVANRL+RSYP YKIV++DKL YCSNLKNLLPS+SSPNFKFV
Sbjct  9    ILITGAAGFIASHVANRLIRSYPGYKIVVLDKLDYCSNLKNLLPSKSSPNFKFV  62



>gb|KHG22077.1| putative rhamnose biosynthetic enzyme 1 -like protein [Gossypium 
arboreum]
Length=667

 Score =   105 bits (261),  Expect = 1e-24, Method: Composition-based stats.
 Identities = 47/54 (87%), Positives = 53/54 (98%), Gaps = 0/54 (0%)
 Frame = +3

Query  3    ILITGAAGFIASHVANRLVRSYPNYKIVIVDKLXYCSNLKNLLPSRSSPNFKFV  164
            ILITGAAGFIASHVANRL+R+YP+YKIV++DKL YCSNLKNLLPS+SSPNFKFV
Sbjct  9    ILITGAAGFIASHVANRLIRNYPDYKIVVLDKLDYCSNLKNLLPSKSSPNFKFV  62



>gb|KJB12934.1| hypothetical protein B456_002G046200 [Gossypium raimondii]
 gb|KJB12935.1| hypothetical protein B456_002G046200 [Gossypium raimondii]
 gb|KJB12936.1| hypothetical protein B456_002G046200 [Gossypium raimondii]
Length=667

 Score =   105 bits (261),  Expect = 2e-24, Method: Composition-based stats.
 Identities = 47/54 (87%), Positives = 53/54 (98%), Gaps = 0/54 (0%)
 Frame = +3

Query  3    ILITGAAGFIASHVANRLVRSYPNYKIVIVDKLXYCSNLKNLLPSRSSPNFKFV  164
            ILITGAAGFIASHVANRL+R+YP+YKIV++DKL YCSNLKNLLPS+SSPNFKFV
Sbjct  9    ILITGAAGFIASHVANRLIRNYPDYKIVVLDKLDYCSNLKNLLPSKSSPNFKFV  62



>gb|ACJ11756.1| rhamnose synthase [Gossypium hirsutum]
Length=667

 Score =   105 bits (261),  Expect = 2e-24, Method: Composition-based stats.
 Identities = 47/54 (87%), Positives = 53/54 (98%), Gaps = 0/54 (0%)
 Frame = +3

Query  3    ILITGAAGFIASHVANRLVRSYPNYKIVIVDKLXYCSNLKNLLPSRSSPNFKFV  164
            ILITGAAGFIASHVANRL+R+YP+YKIV++DKL YCSNLKNLLPS+SSPNFKFV
Sbjct  9    ILITGAAGFIASHVANRLIRNYPDYKIVVLDKLDYCSNLKNLLPSKSSPNFKFV  62



>ref|XP_009783771.1| PREDICTED: probable rhamnose biosynthetic enzyme 1 [Nicotiana 
sylvestris]
Length=674

 Score =   104 bits (260),  Expect = 2e-24, Method: Composition-based stats.
 Identities = 48/54 (89%), Positives = 52/54 (96%), Gaps = 0/54 (0%)
 Frame = +3

Query  3    ILITGAAGFIASHVANRLVRSYPNYKIVIVDKLXYCSNLKNLLPSRSSPNFKFV  164
            ILITGAAGFIA HVANRLVRSYP+YKIV++DKL YCSNLKNL+PSRSSPNFKFV
Sbjct  9    ILITGAAGFIACHVANRLVRSYPDYKIVVLDKLDYCSNLKNLIPSRSSPNFKFV  62



>ref|XP_004488984.1| PREDICTED: probable rhamnose biosynthetic enzyme 1-like isoform 
X1 [Cicer arietinum]
 ref|XP_004488985.1| PREDICTED: probable rhamnose biosynthetic enzyme 1-like isoform 
X2 [Cicer arietinum]
Length=670

 Score =   104 bits (260),  Expect = 2e-24, Method: Composition-based stats.
 Identities = 47/54 (87%), Positives = 53/54 (98%), Gaps = 0/54 (0%)
 Frame = +3

Query  3    ILITGAAGFIASHVANRLVRSYPNYKIVIVDKLXYCSNLKNLLPSRSSPNFKFV  164
            ILITGAAGFIASHVANRL+R+YP+YKIV++DKL YCSNLKNL+PSRSSPNFKFV
Sbjct  9    ILITGAAGFIASHVANRLIRNYPDYKIVVLDKLDYCSNLKNLIPSRSSPNFKFV  62



>ref|XP_009776312.1| PREDICTED: probable rhamnose biosynthetic enzyme 1 [Nicotiana 
sylvestris]
Length=671

 Score =   104 bits (260),  Expect = 2e-24, Method: Composition-based stats.
 Identities = 49/54 (91%), Positives = 52/54 (96%), Gaps = 0/54 (0%)
 Frame = +3

Query  3    ILITGAAGFIASHVANRLVRSYPNYKIVIVDKLXYCSNLKNLLPSRSSPNFKFV  164
            ILITGAAGFIASHVANRLVRSYP+YKIV++DKL YCSNLKNL PSRSSPNFKFV
Sbjct  9    ILITGAAGFIASHVANRLVRSYPDYKIVVLDKLDYCSNLKNLNPSRSSPNFKFV  62



>ref|XP_009590265.1| PREDICTED: probable rhamnose biosynthetic enzyme 1 [Nicotiana 
tomentosiformis]
 ref|XP_009590274.1| PREDICTED: probable rhamnose biosynthetic enzyme 1 [Nicotiana 
tomentosiformis]
Length=671

 Score =   104 bits (260),  Expect = 2e-24, Method: Composition-based stats.
 Identities = 49/54 (91%), Positives = 52/54 (96%), Gaps = 0/54 (0%)
 Frame = +3

Query  3    ILITGAAGFIASHVANRLVRSYPNYKIVIVDKLXYCSNLKNLLPSRSSPNFKFV  164
            ILITGAAGFIASHVANRLVRSYP+YKIV++DKL YCSNLKNL PSRSSPNFKFV
Sbjct  9    ILITGAAGFIASHVANRLVRSYPDYKIVVLDKLDYCSNLKNLNPSRSSPNFKFV  62



>ref|XP_007022008.1| Rhamnose biosynthesis 1 [Theobroma cacao]
 gb|EOY13533.1| Rhamnose biosynthesis 1 [Theobroma cacao]
Length=667

 Score =   104 bits (260),  Expect = 2e-24, Method: Composition-based stats.
 Identities = 47/54 (87%), Positives = 53/54 (98%), Gaps = 0/54 (0%)
 Frame = +3

Query  3    ILITGAAGFIASHVANRLVRSYPNYKIVIVDKLXYCSNLKNLLPSRSSPNFKFV  164
            ILITGAAGFIASHVANRL+R+YP+YKIV++DKL YCSNLKNLLPS+SSPNFKFV
Sbjct  9    ILITGAAGFIASHVANRLIRNYPDYKIVVLDKLDYCSNLKNLLPSKSSPNFKFV  62



>gb|KCW47402.1| hypothetical protein EUGRSUZ_K01196 [Eucalyptus grandis]
Length=530

 Score =   103 bits (257),  Expect = 2e-24, Method: Composition-based stats.
 Identities = 46/54 (85%), Positives = 51/54 (94%), Gaps = 0/54 (0%)
 Frame = +3

Query  3    ILITGAAGFIASHVANRLVRSYPNYKIVIVDKLXYCSNLKNLLPSRSSPNFKFV  164
            ILITGAAGFIASHV NRL+R+YP YKIV++DKL YCSNLKNLLPSRSSPNFKF+
Sbjct  10   ILITGAAGFIASHVCNRLIRNYPGYKIVVLDKLDYCSNLKNLLPSRSSPNFKFI  63



>ref|XP_003531412.1| PREDICTED: probable rhamnose biosynthetic enzyme 1-like isoform 
X1 [Glycine max]
 ref|XP_006585328.1| PREDICTED: probable rhamnose biosynthetic enzyme 1-like isoform 
X4 [Glycine max]
 ref|XP_006585329.1| PREDICTED: probable rhamnose biosynthetic enzyme 1-like isoform 
X5 [Glycine max]
 ref|XP_006585330.1| PREDICTED: probable rhamnose biosynthetic enzyme 1-like isoform 
X6 [Glycine max]
Length=668

 Score =   104 bits (259),  Expect = 2e-24, Method: Composition-based stats.
 Identities = 48/54 (89%), Positives = 53/54 (98%), Gaps = 0/54 (0%)
 Frame = +3

Query  3    ILITGAAGFIASHVANRLVRSYPNYKIVIVDKLXYCSNLKNLLPSRSSPNFKFV  164
            ILITGAAGFIASHVANRLVRSYP+YKIV++DKL YCS+LKNLLPS+SSPNFKFV
Sbjct  9    ILITGAAGFIASHVANRLVRSYPDYKIVVLDKLDYCSSLKNLLPSKSSPNFKFV  62



>ref|XP_006585327.1| PREDICTED: probable rhamnose biosynthetic enzyme 1-like isoform 
X3 [Glycine max]
Length=690

 Score =   104 bits (259),  Expect = 3e-24, Method: Composition-based stats.
 Identities = 48/54 (89%), Positives = 53/54 (98%), Gaps = 0/54 (0%)
 Frame = +3

Query  3    ILITGAAGFIASHVANRLVRSYPNYKIVIVDKLXYCSNLKNLLPSRSSPNFKFV  164
            ILITGAAGFIASHVANRLVRSYP+YKIV++DKL YCS+LKNLLPS+SSPNFKFV
Sbjct  31   ILITGAAGFIASHVANRLVRSYPDYKIVVLDKLDYCSSLKNLLPSKSSPNFKFV  84



>ref|XP_006585326.1| PREDICTED: probable rhamnose biosynthetic enzyme 1-like isoform 
X2 [Glycine max]
Length=691

 Score =   104 bits (259),  Expect = 3e-24, Method: Composition-based stats.
 Identities = 48/54 (89%), Positives = 53/54 (98%), Gaps = 0/54 (0%)
 Frame = +3

Query  3    ILITGAAGFIASHVANRLVRSYPNYKIVIVDKLXYCSNLKNLLPSRSSPNFKFV  164
            ILITGAAGFIASHVANRLVRSYP+YKIV++DKL YCS+LKNLLPS+SSPNFKFV
Sbjct  32   ILITGAAGFIASHVANRLVRSYPDYKIVVLDKLDYCSSLKNLLPSKSSPNFKFV  85



>ref|XP_006360030.1| PREDICTED: probable rhamnose biosynthetic enzyme 1-like isoform 
X1 [Solanum tuberosum]
 ref|XP_006360031.1| PREDICTED: probable rhamnose biosynthetic enzyme 1-like isoform 
X2 [Solanum tuberosum]
Length=674

 Score =   104 bits (259),  Expect = 3e-24, Method: Composition-based stats.
 Identities = 48/54 (89%), Positives = 52/54 (96%), Gaps = 0/54 (0%)
 Frame = +3

Query  3    ILITGAAGFIASHVANRLVRSYPNYKIVIVDKLXYCSNLKNLLPSRSSPNFKFV  164
            ILITGAAGFIA HVANRLVRSYP+YKIV++DKL YCSNLKNL+PSRSSPNFKFV
Sbjct  9    ILITGAAGFIACHVANRLVRSYPDYKIVVLDKLDYCSNLKNLIPSRSSPNFKFV  62



>ref|XP_010487282.1| PREDICTED: probable rhamnose biosynthetic enzyme 3 [Camelina 
sativa]
Length=664

 Score =   104 bits (259),  Expect = 3e-24, Method: Composition-based stats.
 Identities = 48/54 (89%), Positives = 52/54 (96%), Gaps = 0/54 (0%)
 Frame = +3

Query  3    ILITGAAGFIASHVANRLVRSYPNYKIVIVDKLXYCSNLKNLLPSRSSPNFKFV  164
            ILITGAAGFIASHVANRLVRSYP+YKIV++DKL YCSNLKNL PS+SSPNFKFV
Sbjct  9    ILITGAAGFIASHVANRLVRSYPDYKIVVLDKLDYCSNLKNLNPSKSSPNFKFV  62



>gb|KEH38548.1| rhamnose biosynthetic-like enzyme [Medicago truncatula]
Length=682

 Score =   104 bits (259),  Expect = 3e-24, Method: Composition-based stats.
 Identities = 47/54 (87%), Positives = 53/54 (98%), Gaps = 0/54 (0%)
 Frame = +3

Query  3    ILITGAAGFIASHVANRLVRSYPNYKIVIVDKLXYCSNLKNLLPSRSSPNFKFV  164
            ILITGAAGFIASHVANRL+R+YP+YKIV++DKL YCSNLKNL+PSRSSPNFKFV
Sbjct  21   ILITGAAGFIASHVANRLIRNYPDYKIVVLDKLDYCSNLKNLIPSRSSPNFKFV  74



>emb|CDY25850.1| BnaA05g14410D [Brassica napus]
Length=428

 Score =   102 bits (253),  Expect = 4e-24, Method: Composition-based stats.
 Identities = 46/54 (85%), Positives = 51/54 (94%), Gaps = 0/54 (0%)
 Frame = +3

Query  3    ILITGAAGFIASHVANRLVRSYPNYKIVIVDKLXYCSNLKNLLPSRSSPNFKFV  164
            ILITGAAGFIASHVANRL+RSYP+YKIV++DKL YCS+LKNL PS SSPNFKFV
Sbjct  10   ILITGAAGFIASHVANRLIRSYPDYKIVVLDKLDYCSDLKNLNPSHSSPNFKFV  63



>ref|XP_002285634.1| PREDICTED: trifunctional UDP-glucose 4,6-dehydratase/UDP-4-keto-6-deoxy-D-glucose 
3,5-epimerase/UDP-4-keto-L-rhamnose-reductase 
RHM1 [Vitis vinifera]
Length=675

 Score =   103 bits (258),  Expect = 4e-24, Method: Composition-based stats.
 Identities = 47/54 (87%), Positives = 53/54 (98%), Gaps = 0/54 (0%)
 Frame = +3

Query  3    ILITGAAGFIASHVANRLVRSYPNYKIVIVDKLXYCSNLKNLLPSRSSPNFKFV  164
            ILITGAAGFIASHVANRL+R+YP+YKIV++DKL YCSNLKNLLPS+SSPNFKFV
Sbjct  9    ILITGAAGFIASHVANRLIRNYPDYKIVVLDKLDYCSNLKNLLPSKSSPNFKFV  62



>gb|KJB61502.1| hypothetical protein B456_009G362500 [Gossypium raimondii]
Length=667

 Score =   103 bits (258),  Expect = 4e-24, Method: Composition-based stats.
 Identities = 47/54 (87%), Positives = 53/54 (98%), Gaps = 0/54 (0%)
 Frame = +3

Query  3    ILITGAAGFIASHVANRLVRSYPNYKIVIVDKLXYCSNLKNLLPSRSSPNFKFV  164
            ILITGAAGFIASHVANRLVR+YP+YKIV++DKL YCSNLKNL+PS+SSPNFKFV
Sbjct  9    ILITGAAGFIASHVANRLVRNYPDYKIVVLDKLDYCSNLKNLIPSQSSPNFKFV  62



>gb|EYU38237.1| hypothetical protein MIMGU_mgv1a002436mg [Erythranthe guttata]
Length=675

 Score =   103 bits (258),  Expect = 4e-24, Method: Composition-based stats.
 Identities = 48/54 (89%), Positives = 51/54 (94%), Gaps = 0/54 (0%)
 Frame = +3

Query  3    ILITGAAGFIASHVANRLVRSYPNYKIVIVDKLXYCSNLKNLLPSRSSPNFKFV  164
            ILITGAAGFIASHVANRLVR+YP YKIV++DKL YCSNLKNLLPS SSPNFKFV
Sbjct  9    ILITGAAGFIASHVANRLVRTYPGYKIVVLDKLDYCSNLKNLLPSNSSPNFKFV  62



>ref|XP_010273412.1| PREDICTED: probable rhamnose biosynthetic enzyme 1 [Nelumbo nucifera]
Length=676

 Score =   103 bits (258),  Expect = 4e-24, Method: Composition-based stats.
 Identities = 47/54 (87%), Positives = 52/54 (96%), Gaps = 0/54 (0%)
 Frame = +3

Query  3    ILITGAAGFIASHVANRLVRSYPNYKIVIVDKLXYCSNLKNLLPSRSSPNFKFV  164
            ILITGAAGFIASHV NRL+R+YP+YKIV++DKL YCSNLKNLLPSRSSPNFKFV
Sbjct  9    ILITGAAGFIASHVCNRLIRNYPDYKIVVLDKLDYCSNLKNLLPSRSSPNFKFV  62



>ref|XP_006407044.1| hypothetical protein EUTSA_v10020227mg [Eutrema salsugineum]
 ref|XP_006407045.1| hypothetical protein EUTSA_v10020227mg [Eutrema salsugineum]
 gb|ESQ48497.1| hypothetical protein EUTSA_v10020227mg [Eutrema salsugineum]
 gb|ESQ48498.1| hypothetical protein EUTSA_v10020227mg [Eutrema salsugineum]
Length=664

 Score =   103 bits (258),  Expect = 4e-24, Method: Composition-based stats.
 Identities = 48/54 (89%), Positives = 52/54 (96%), Gaps = 0/54 (0%)
 Frame = +3

Query  3    ILITGAAGFIASHVANRLVRSYPNYKIVIVDKLXYCSNLKNLLPSRSSPNFKFV  164
            ILITGAAGFIASHVANRLVRSYP+YKIV++DKL YCSNLKNL PS+SSPNFKFV
Sbjct  9    ILITGAAGFIASHVANRLVRSYPDYKIVVLDKLDYCSNLKNLNPSKSSPNFKFV  62



>ref|XP_006297150.1| hypothetical protein CARUB_v10013153mg [Capsella rubella]
 gb|EOA30048.1| hypothetical protein CARUB_v10013153mg [Capsella rubella]
Length=664

 Score =   103 bits (258),  Expect = 4e-24, Method: Composition-based stats.
 Identities = 48/54 (89%), Positives = 52/54 (96%), Gaps = 0/54 (0%)
 Frame = +3

Query  3    ILITGAAGFIASHVANRLVRSYPNYKIVIVDKLXYCSNLKNLLPSRSSPNFKFV  164
            ILITGAAGFIASHVANRLVRSYP+YKIV++DKL YCSNLKNL PS+SSPNFKFV
Sbjct  9    ILITGAAGFIASHVANRLVRSYPDYKIVVLDKLDYCSNLKNLNPSKSSPNFKFV  62



>ref|XP_010465388.1| PREDICTED: probable rhamnose biosynthetic enzyme 3 [Camelina 
sativa]
Length=664

 Score =   103 bits (257),  Expect = 5e-24, Method: Composition-based stats.
 Identities = 48/54 (89%), Positives = 52/54 (96%), Gaps = 0/54 (0%)
 Frame = +3

Query  3    ILITGAAGFIASHVANRLVRSYPNYKIVIVDKLXYCSNLKNLLPSRSSPNFKFV  164
            ILITGAAGFIASHVANRLVRSYP+YKIV++DKL YCSNLKNL PS+SSPNFKFV
Sbjct  9    ILITGAAGFIASHVANRLVRSYPDYKIVVLDKLDYCSNLKNLNPSKSSPNFKFV  62



>ref|XP_010502125.1| PREDICTED: probable rhamnose biosynthetic enzyme 3 [Camelina 
sativa]
Length=664

 Score =   103 bits (257),  Expect = 5e-24, Method: Composition-based stats.
 Identities = 48/54 (89%), Positives = 52/54 (96%), Gaps = 0/54 (0%)
 Frame = +3

Query  3    ILITGAAGFIASHVANRLVRSYPNYKIVIVDKLXYCSNLKNLLPSRSSPNFKFV  164
            ILITGAAGFIASHVANRLVRSYP+YKIV++DKL YCSNLKNL PS+SSPNFKFV
Sbjct  9    ILITGAAGFIASHVANRLVRSYPDYKIVVLDKLDYCSNLKNLNPSKSSPNFKFV  62



>ref|NP_188097.1| rhamnose biosynthetic enzyme 3 [Arabidopsis thaliana]
 sp|Q9LH76.1|RHM3_ARATH RecName: Full=Trifunctional UDP-glucose 4,6-dehydratase/UDP-4-keto-6-deoxy-D-glucose 
3,5-epimerase/UDP-4-keto-L-rhamnose-reductase 
RHM3; AltName: Full=Probable rhamnose biosynthetic 
enzyme 3; Short=AtRHM3; Includes: RecName: Full=UDP-glucose 
4,6-dehydratase; Includes: RecName: Full=UDP-4-keto-6-deoxy-D-glucose 
3,5-epimerase/UDP-4-keto-L-rhamnose 4-keto-reductase 
[Arabidopsis thaliana]
 dbj|BAB02645.1| unnamed protein product [Arabidopsis thaliana]
 gb|AAL84958.1| AT3g14790/T21E2_4 [Arabidopsis thaliana]
 gb|AAM98324.1| At3g14790/T21E2_4 [Arabidopsis thaliana]
 gb|AEE75567.1| rhamnose biosynthetic enzyme 3 [Arabidopsis thaliana]
Length=664

 Score =   103 bits (257),  Expect = 6e-24, Method: Composition-based stats.
 Identities = 48/54 (89%), Positives = 52/54 (96%), Gaps = 0/54 (0%)
 Frame = +3

Query  3    ILITGAAGFIASHVANRLVRSYPNYKIVIVDKLXYCSNLKNLLPSRSSPNFKFV  164
            ILITGAAGFIASHVANRLVRSYP+YKIV++DKL YCSNLKNL PS+SSPNFKFV
Sbjct  9    ILITGAAGFIASHVANRLVRSYPDYKIVVLDKLDYCSNLKNLNPSKSSPNFKFV  62



>gb|KJB45830.1| hypothetical protein B456_007G332000 [Gossypium raimondii]
Length=403

 Score =   101 bits (251),  Expect = 6e-24, Method: Composition-based stats.
 Identities = 46/54 (85%), Positives = 50/54 (93%), Gaps = 0/54 (0%)
 Frame = +3

Query  3    ILITGAAGFIASHVANRLVRSYPNYKIVIVDKLXYCSNLKNLLPSRSSPNFKFV  164
            ILITGAAGFIASHVANRLVR+YP YKIV++DKL YCSN KNLLPS+ SPNFKFV
Sbjct  9    ILITGAAGFIASHVANRLVRNYPEYKIVVLDKLDYCSNTKNLLPSKLSPNFKFV  62



>ref|XP_011098163.1| PREDICTED: trifunctional UDP-glucose 4,6-dehydratase/UDP-4-keto-6-deoxy-D-glucose 
3,5-epimerase/UDP-4-keto-L-rhamnose-reductase 
RHM1-like [Sesamum indicum]
 ref|XP_011098164.1| PREDICTED: trifunctional UDP-glucose 4,6-dehydratase/UDP-4-keto-6-deoxy-D-glucose 
3,5-epimerase/UDP-4-keto-L-rhamnose-reductase 
RHM1-like [Sesamum indicum]
Length=675

 Score =   103 bits (257),  Expect = 6e-24, Method: Composition-based stats.
 Identities = 46/54 (85%), Positives = 53/54 (98%), Gaps = 0/54 (0%)
 Frame = +3

Query  3    ILITGAAGFIASHVANRLVRSYPNYKIVIVDKLXYCSNLKNLLPSRSSPNFKFV  164
            ILITGAAGFIASHVANRL+R+YP+YKIV++DKL YCSNLKNL+PS+SSPNFKFV
Sbjct  9    ILITGAAGFIASHVANRLIRNYPHYKIVVLDKLDYCSNLKNLIPSKSSPNFKFV  62



>ref|XP_004294169.1| PREDICTED: trifunctional UDP-glucose 4,6-dehydratase/UDP-4-keto-6-deoxy-D-glucose 
3,5-epimerase/UDP-4-keto-L-rhamnose-reductase 
RHM1 [Fragaria vesca subsp. vesca]
 ref|XP_011460833.1| PREDICTED: trifunctional UDP-glucose 4,6-dehydratase/UDP-4-keto-6-deoxy-D-glucose 
3,5-epimerase/UDP-4-keto-L-rhamnose-reductase 
RHM1 [Fragaria vesca subsp. vesca]
Length=671

 Score =   103 bits (257),  Expect = 6e-24, Method: Composition-based stats.
 Identities = 48/54 (89%), Positives = 52/54 (96%), Gaps = 0/54 (0%)
 Frame = +3

Query  3    ILITGAAGFIASHVANRLVRSYPNYKIVIVDKLXYCSNLKNLLPSRSSPNFKFV  164
            ILITGAAGFIASHVANRLVRS+P YKIV++DKL YCSNLKNLLPS+SSPNFKFV
Sbjct  9    ILITGAAGFIASHVANRLVRSHPEYKIVVLDKLDYCSNLKNLLPSKSSPNFKFV  62



>ref|XP_007149511.1| hypothetical protein PHAVU_005G076400g [Phaseolus vulgaris]
 gb|ESW21505.1| hypothetical protein PHAVU_005G076400g [Phaseolus vulgaris]
Length=669

 Score =   103 bits (256),  Expect = 7e-24, Method: Composition-based stats.
 Identities = 46/54 (85%), Positives = 52/54 (96%), Gaps = 0/54 (0%)
 Frame = +3

Query  3    ILITGAAGFIASHVANRLVRSYPNYKIVIVDKLXYCSNLKNLLPSRSSPNFKFV  164
            ILITGAAGFIASHVANRL+R+YP YKIV++DKL YCSNLKNL+PS+SSPNFKFV
Sbjct  9    ILITGAAGFIASHVANRLIRNYPQYKIVVLDKLDYCSNLKNLIPSKSSPNFKFV  62



>emb|CDY20084.1| BnaA01g29180D [Brassica napus]
Length=644

 Score =   103 bits (256),  Expect = 7e-24, Method: Composition-based stats.
 Identities = 47/54 (87%), Positives = 52/54 (96%), Gaps = 0/54 (0%)
 Frame = +3

Query  3    ILITGAAGFIASHVANRLVRSYPNYKIVIVDKLXYCSNLKNLLPSRSSPNFKFV  164
            ILITGAAGFIASHVANRLVR+YP+YKIV++DKL YCSNLKNL PS+SSPNFKFV
Sbjct  9    ILITGAAGFIASHVANRLVRTYPDYKIVVLDKLDYCSNLKNLNPSKSSPNFKFV  62



>ref|XP_007213598.1| hypothetical protein PRUPE_ppa002453mg [Prunus persica]
 ref|XP_007213599.1| hypothetical protein PRUPE_ppa002453mg [Prunus persica]
 gb|EMJ14797.1| hypothetical protein PRUPE_ppa002453mg [Prunus persica]
 gb|EMJ14798.1| hypothetical protein PRUPE_ppa002453mg [Prunus persica]
Length=671

 Score =   103 bits (256),  Expect = 7e-24, Method: Composition-based stats.
 Identities = 47/54 (87%), Positives = 52/54 (96%), Gaps = 0/54 (0%)
 Frame = +3

Query  3    ILITGAAGFIASHVANRLVRSYPNYKIVIVDKLXYCSNLKNLLPSRSSPNFKFV  164
            ILITGAAGFIASHVANRL+RSYP+Y IV++DKL YCSNLKNLLPS+SSPNFKFV
Sbjct  9    ILITGAAGFIASHVANRLIRSYPDYNIVVLDKLDYCSNLKNLLPSKSSPNFKFV  62



>ref|XP_008226345.1| PREDICTED: probable rhamnose biosynthetic enzyme 1 [Prunus mume]
Length=671

 Score =   103 bits (256),  Expect = 7e-24, Method: Composition-based stats.
 Identities = 47/54 (87%), Positives = 52/54 (96%), Gaps = 0/54 (0%)
 Frame = +3

Query  3    ILITGAAGFIASHVANRLVRSYPNYKIVIVDKLXYCSNLKNLLPSRSSPNFKFV  164
            ILITGAAGFIASHVANRL+RSYP+Y IV++DKL YCSNLKNLLPS+SSPNFKFV
Sbjct  9    ILITGAAGFIASHVANRLIRSYPDYNIVVLDKLDYCSNLKNLLPSKSSPNFKFV  62



>ref|XP_002531238.1| NAD dependent epimerase/dehydratase, putative [Ricinus communis]
 gb|EEF31135.1| NAD dependent epimerase/dehydratase, putative [Ricinus communis]
Length=622

 Score =   102 bits (255),  Expect = 7e-24, Method: Composition-based stats.
 Identities = 46/54 (85%), Positives = 52/54 (96%), Gaps = 0/54 (0%)
 Frame = +3

Query  3    ILITGAAGFIASHVANRLVRSYPNYKIVIVDKLXYCSNLKNLLPSRSSPNFKFV  164
            ILITGAAGFIASHV NRL+R+YP+YKIV++DKL YCSNLKNLLPS+SSPNFKFV
Sbjct  9    ILITGAAGFIASHVCNRLIRNYPDYKIVVLDKLDYCSNLKNLLPSKSSPNFKFV  62



>ref|XP_009610279.1| PREDICTED: probable rhamnose biosynthetic enzyme 1 [Nicotiana 
tomentosiformis]
Length=674

 Score =   103 bits (256),  Expect = 8e-24, Method: Composition-based stats.
 Identities = 47/54 (87%), Positives = 51/54 (94%), Gaps = 0/54 (0%)
 Frame = +3

Query  3    ILITGAAGFIASHVANRLVRSYPNYKIVIVDKLXYCSNLKNLLPSRSSPNFKFV  164
            ILITGAAGFIA HVANRLVRSYP+YKIV++DKL YCSNLKNL+PSR SPNFKFV
Sbjct  9    ILITGAAGFIACHVANRLVRSYPDYKIVVLDKLDYCSNLKNLIPSRPSPNFKFV  62



>gb|KHN36936.1| Putative rhamnose biosynthetic enzyme 1 [Glycine soja]
Length=669

 Score =   103 bits (256),  Expect = 8e-24, Method: Composition-based stats.
 Identities = 46/54 (85%), Positives = 52/54 (96%), Gaps = 0/54 (0%)
 Frame = +3

Query  3    ILITGAAGFIASHVANRLVRSYPNYKIVIVDKLXYCSNLKNLLPSRSSPNFKFV  164
            ILITGAAGFIASHVANRL+R+YP YKIV++DKL YCSNLKNL+PS+SSPNFKFV
Sbjct  9    ILITGAAGFIASHVANRLIRNYPQYKIVVLDKLDYCSNLKNLIPSKSSPNFKFV  62



>gb|KHN19477.1| Putative rhamnose biosynthetic enzyme 1 [Glycine soja]
Length=669

 Score =   103 bits (256),  Expect = 8e-24, Method: Composition-based stats.
 Identities = 46/54 (85%), Positives = 52/54 (96%), Gaps = 0/54 (0%)
 Frame = +3

Query  3    ILITGAAGFIASHVANRLVRSYPNYKIVIVDKLXYCSNLKNLLPSRSSPNFKFV  164
            ILITGAAGFIASHVANRL+R+YP YKIV++DKL YCSNLKNL+PS+SSPNFKFV
Sbjct  9    ILITGAAGFIASHVANRLIRNYPQYKIVVLDKLDYCSNLKNLIPSKSSPNFKFV  62



>ref|XP_003543185.1| PREDICTED: probable rhamnose biosynthetic enzyme 1-like isoform 
X1 [Glycine max]
 ref|XP_006594709.1| PREDICTED: probable rhamnose biosynthetic enzyme 1-like isoform 
X2 [Glycine max]
Length=669

 Score =   103 bits (256),  Expect = 8e-24, Method: Composition-based stats.
 Identities = 46/54 (85%), Positives = 52/54 (96%), Gaps = 0/54 (0%)
 Frame = +3

Query  3    ILITGAAGFIASHVANRLVRSYPNYKIVIVDKLXYCSNLKNLLPSRSSPNFKFV  164
            ILITGAAGFIASHVANRL+R+YP YKIV++DKL YCSNLKNL+PS+SSPNFKFV
Sbjct  9    ILITGAAGFIASHVANRLIRNYPQYKIVVLDKLDYCSNLKNLIPSKSSPNFKFV  62



>ref|XP_002882893.1| hypothetical protein ARALYDRAFT_478892 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH59152.1| hypothetical protein ARALYDRAFT_478892 [Arabidopsis lyrata subsp. 
lyrata]
Length=664

 Score =   102 bits (255),  Expect = 9e-24, Method: Composition-based stats.
 Identities = 48/54 (89%), Positives = 51/54 (94%), Gaps = 0/54 (0%)
 Frame = +3

Query  3    ILITGAAGFIASHVANRLVRSYPNYKIVIVDKLXYCSNLKNLLPSRSSPNFKFV  164
            ILITGAAGFIASHVANRLVRSYP YKIV++DKL YCSNLKNL PS+SSPNFKFV
Sbjct  9    ILITGAAGFIASHVANRLVRSYPEYKIVVLDKLDYCSNLKNLNPSKSSPNFKFV  62



>ref|XP_009394841.1| PREDICTED: probable rhamnose biosynthetic enzyme 1 [Musa acuminata 
subsp. malaccensis]
 ref|XP_009394842.1| PREDICTED: probable rhamnose biosynthetic enzyme 1 [Musa acuminata 
subsp. malaccensis]
Length=672

 Score =   102 bits (255),  Expect = 9e-24, Method: Composition-based stats.
 Identities = 48/54 (89%), Positives = 51/54 (94%), Gaps = 0/54 (0%)
 Frame = +3

Query  3    ILITGAAGFIASHVANRLVRSYPNYKIVIVDKLXYCSNLKNLLPSRSSPNFKFV  164
            ILITGAAGFIASHVANRLVR+YP YKIV++DKL YCSNLKNL PSRSSPNFKFV
Sbjct  9    ILITGAAGFIASHVANRLVRNYPEYKIVVLDKLDYCSNLKNLNPSRSSPNFKFV  62



>ref|XP_003540514.1| PREDICTED: probable rhamnose biosynthetic enzyme 1-like isoform 
X1 [Glycine max]
 ref|XP_006592951.1| PREDICTED: probable rhamnose biosynthetic enzyme 1-like isoform 
X2 [Glycine max]
Length=669

 Score =   102 bits (255),  Expect = 9e-24, Method: Composition-based stats.
 Identities = 46/54 (85%), Positives = 52/54 (96%), Gaps = 0/54 (0%)
 Frame = +3

Query  3    ILITGAAGFIASHVANRLVRSYPNYKIVIVDKLXYCSNLKNLLPSRSSPNFKFV  164
            ILITGAAGFIASHVANRL+R+YP YKIV++DKL YCSNLKNL+PS+SSPNFKFV
Sbjct  9    ILITGAAGFIASHVANRLIRNYPQYKIVVLDKLDYCSNLKNLIPSKSSPNFKFV  62



>ref|XP_008451740.1| PREDICTED: probable rhamnose biosynthetic enzyme 1 [Cucumis melo]
 ref|XP_008451741.1| PREDICTED: probable rhamnose biosynthetic enzyme 1 [Cucumis melo]
 ref|XP_008451742.1| PREDICTED: probable rhamnose biosynthetic enzyme 1 [Cucumis melo]
Length=670

 Score =   102 bits (255),  Expect = 1e-23, Method: Composition-based stats.
 Identities = 47/54 (87%), Positives = 51/54 (94%), Gaps = 0/54 (0%)
 Frame = +3

Query  3    ILITGAAGFIASHVANRLVRSYPNYKIVIVDKLXYCSNLKNLLPSRSSPNFKFV  164
            ILITGAAGFIASHVANRLVR+YP YKIV++DKL YCSNLKNLLPS+ SPNFKFV
Sbjct  9    ILITGAAGFIASHVANRLVRNYPGYKIVVLDKLDYCSNLKNLLPSKPSPNFKFV  62



>ref|XP_004137224.1| PREDICTED: probable rhamnose biosynthetic enzyme 1-like [Cucumis 
sativus]
 ref|XP_004156513.1| PREDICTED: probable rhamnose biosynthetic enzyme 1-like [Cucumis 
sativus]
 gb|KGN53576.1| hypothetical protein Csa_4G083510 [Cucumis sativus]
Length=670

 Score =   102 bits (255),  Expect = 1e-23, Method: Composition-based stats.
 Identities = 47/54 (87%), Positives = 51/54 (94%), Gaps = 0/54 (0%)
 Frame = +3

Query  3    ILITGAAGFIASHVANRLVRSYPNYKIVIVDKLXYCSNLKNLLPSRSSPNFKFV  164
            ILITGAAGFIASHVANRLVR+YP YKIV++DKL YCSNLKNLLPS+ SPNFKFV
Sbjct  9    ILITGAAGFIASHVANRLVRNYPGYKIVVLDKLDYCSNLKNLLPSKPSPNFKFV  62



>emb|CDX97601.1| BnaA05g24780D [Brassica napus]
Length=646

 Score =   102 bits (254),  Expect = 1e-23, Method: Composition-based stats.
 Identities = 47/54 (87%), Positives = 52/54 (96%), Gaps = 0/54 (0%)
 Frame = +3

Query  3    ILITGAAGFIASHVANRLVRSYPNYKIVIVDKLXYCSNLKNLLPSRSSPNFKFV  164
            ILITGAAGFIASHVANRLVR+YP+YKIV++DKL YCSNLKNL PS+SSPNFKFV
Sbjct  9    ILITGAAGFIASHVANRLVRTYPDYKIVVLDKLDYCSNLKNLNPSKSSPNFKFV  62



>emb|CDX98494.1| BnaC05g38810D [Brassica napus]
Length=646

 Score =   102 bits (254),  Expect = 1e-23, Method: Composition-based stats.
 Identities = 47/54 (87%), Positives = 52/54 (96%), Gaps = 0/54 (0%)
 Frame = +3

Query  3    ILITGAAGFIASHVANRLVRSYPNYKIVIVDKLXYCSNLKNLLPSRSSPNFKFV  164
            ILITGAAGFIASHVANRLVR+YP+YKIV++DKL YCSNLKNL PS+SSPNFKFV
Sbjct  9    ILITGAAGFIASHVANRLVRTYPDYKIVVLDKLDYCSNLKNLNPSKSSPNFKFV  62



>ref|XP_010537694.1| PREDICTED: trifunctional UDP-glucose 4,6-dehydratase/UDP-4-keto-6-deoxy-D-glucose 
3,5-epimerase/UDP-4-keto-L-rhamnose-reductase 
RHM1 [Tarenaya hassleriana]
Length=670

 Score =   102 bits (255),  Expect = 1e-23, Method: Composition-based stats.
 Identities = 46/54 (85%), Positives = 52/54 (96%), Gaps = 0/54 (0%)
 Frame = +3

Query  3    ILITGAAGFIASHVANRLVRSYPNYKIVIVDKLXYCSNLKNLLPSRSSPNFKFV  164
            ILITGAAGFIASHVANRL+R+YP+YKIV++DKL YCSNLKNL PS+SSPNFKFV
Sbjct  9    ILITGAAGFIASHVANRLIRNYPDYKIVVLDKLDYCSNLKNLNPSKSSPNFKFV  62



>ref|XP_009146324.1| PREDICTED: probable rhamnose biosynthetic enzyme 3 [Brassica 
rapa]
Length=665

 Score =   102 bits (254),  Expect = 1e-23, Method: Composition-based stats.
 Identities = 47/54 (87%), Positives = 52/54 (96%), Gaps = 0/54 (0%)
 Frame = +3

Query  3    ILITGAAGFIASHVANRLVRSYPNYKIVIVDKLXYCSNLKNLLPSRSSPNFKFV  164
            ILITGAAGFIASHVANRLVR+YP+YKIV++DKL YCSNLKNL PS+SSPNFKFV
Sbjct  9    ILITGAAGFIASHVANRLVRTYPDYKIVVLDKLDYCSNLKNLNPSKSSPNFKFV  62



>ref|XP_002317559.2| NAD-dependent epimerase/dehydratase family protein [Populus trichocarpa]
 gb|EEE98171.2| NAD-dependent epimerase/dehydratase family protein [Populus trichocarpa]
Length=670

 Score =   102 bits (254),  Expect = 1e-23, Method: Composition-based stats.
 Identities = 46/54 (85%), Positives = 52/54 (96%), Gaps = 0/54 (0%)
 Frame = +3

Query  3    ILITGAAGFIASHVANRLVRSYPNYKIVIVDKLXYCSNLKNLLPSRSSPNFKFV  164
            ILITGAAGFIASHV NRL+R+YP+YKIV++DKL YCSNLKNLLPS+SSPNFKFV
Sbjct  9    ILITGAAGFIASHVCNRLIRNYPDYKIVVLDKLDYCSNLKNLLPSKSSPNFKFV  62



>ref|XP_008792282.1| PREDICTED: probable rhamnose biosynthetic enzyme 1 [Phoenix dactylifera]
Length=673

 Score =   102 bits (254),  Expect = 1e-23, Method: Composition-based stats.
 Identities = 47/54 (87%), Positives = 51/54 (94%), Gaps = 0/54 (0%)
 Frame = +3

Query  3    ILITGAAGFIASHVANRLVRSYPNYKIVIVDKLXYCSNLKNLLPSRSSPNFKFV  164
            ILITGAAGFIASHVANRL+R+YP YKIV++DKL YCSNLKNL PSRSSPNFKFV
Sbjct  9    ILITGAAGFIASHVANRLIRNYPEYKIVVLDKLDYCSNLKNLNPSRSSPNFKFV  62



>emb|CDY32340.1| BnaC01g36590D [Brassica napus]
Length=643

 Score =   102 bits (254),  Expect = 1e-23, Method: Composition-based stats.
 Identities = 47/54 (87%), Positives = 52/54 (96%), Gaps = 0/54 (0%)
 Frame = +3

Query  3    ILITGAAGFIASHVANRLVRSYPNYKIVIVDKLXYCSNLKNLLPSRSSPNFKFV  164
            ILITGAAGFIASHVANRLVR+YP+YKIV++DKL YCSNLKNL PS+SSPNFKFV
Sbjct  9    ILITGAAGFIASHVANRLVRTYPHYKIVVLDKLDYCSNLKNLNPSKSSPNFKFV  62



>ref|XP_010035897.1| PREDICTED: probable rhamnose biosynthetic enzyme 1 [Eucalyptus 
grandis]
 gb|KCW47401.1| hypothetical protein EUGRSUZ_K01196 [Eucalyptus grandis]
Length=674

 Score =   102 bits (254),  Expect = 1e-23, Method: Composition-based stats.
 Identities = 46/54 (85%), Positives = 51/54 (94%), Gaps = 0/54 (0%)
 Frame = +3

Query  3    ILITGAAGFIASHVANRLVRSYPNYKIVIVDKLXYCSNLKNLLPSRSSPNFKFV  164
            ILITGAAGFIASHV NRL+R+YP YKIV++DKL YCSNLKNLLPSRSSPNFKF+
Sbjct  10   ILITGAAGFIASHVCNRLIRNYPGYKIVVLDKLDYCSNLKNLLPSRSSPNFKFI  63



>ref|XP_011082806.1| PREDICTED: trifunctional UDP-glucose 4,6-dehydratase/UDP-4-keto-6-deoxy-D-glucose 
3,5-epimerase/UDP-4-keto-L-rhamnose-reductase 
RHM1 [Sesamum indicum]
Length=671

 Score =   102 bits (254),  Expect = 1e-23, Method: Composition-based stats.
 Identities = 47/54 (87%), Positives = 52/54 (96%), Gaps = 0/54 (0%)
 Frame = +3

Query  3    ILITGAAGFIASHVANRLVRSYPNYKIVIVDKLXYCSNLKNLLPSRSSPNFKFV  164
            ILITGAAGFIASHVANRLVR+YP+YKIV++DKL YCSNLKNLLPS +SPNFKFV
Sbjct  9    ILITGAAGFIASHVANRLVRNYPDYKIVVLDKLDYCSNLKNLLPSNASPNFKFV  62



>ref|XP_004248232.1| PREDICTED: probable rhamnose biosynthetic enzyme 3 [Solanum lycopersicum]
 ref|XP_010327108.1| PREDICTED: probable rhamnose biosynthetic enzyme 3 [Solanum lycopersicum]
Length=674

 Score =   102 bits (254),  Expect = 1e-23, Method: Composition-based stats.
 Identities = 47/54 (87%), Positives = 52/54 (96%), Gaps = 0/54 (0%)
 Frame = +3

Query  3    ILITGAAGFIASHVANRLVRSYPNYKIVIVDKLXYCSNLKNLLPSRSSPNFKFV  164
            ILITGAAGFIA HVANRLVRSYP+YKIV++DKL YCS+LKNL+PSRSSPNFKFV
Sbjct  9    ILITGAAGFIACHVANRLVRSYPDYKIVVLDKLDYCSSLKNLIPSRSSPNFKFV  62



>ref|XP_006370064.1| hypothetical protein POPTR_0001s39210g [Populus trichocarpa]
 gb|ERP66633.1| hypothetical protein POPTR_0001s39210g [Populus trichocarpa]
Length=670

 Score =   102 bits (254),  Expect = 1e-23, Method: Composition-based stats.
 Identities = 46/54 (85%), Positives = 52/54 (96%), Gaps = 0/54 (0%)
 Frame = +3

Query  3    ILITGAAGFIASHVANRLVRSYPNYKIVIVDKLXYCSNLKNLLPSRSSPNFKFV  164
            ILITGAAGFIASHV NRL+R+YP+YKIV++DKL YCSNLKNLLPS+SSPNFKFV
Sbjct  9    ILITGAAGFIASHVCNRLIRNYPDYKIVVLDKLDYCSNLKNLLPSKSSPNFKFV  62



>gb|KEH17189.1| rhamnose biosynthetic-like enzyme [Medicago truncatula]
Length=798

 Score =   102 bits (255),  Expect = 1e-23, Method: Composition-based stats.
 Identities = 47/54 (87%), Positives = 52/54 (96%), Gaps = 0/54 (0%)
 Frame = +3

Query  3    ILITGAAGFIASHVANRLVRSYPNYKIVIVDKLXYCSNLKNLLPSRSSPNFKFV  164
            ILITGAAGFIASHVANRLVRS+P YKIV++DKL YCSNLKNLLPS++SPNFKFV
Sbjct  139  ILITGAAGFIASHVANRLVRSHPEYKIVVLDKLDYCSNLKNLLPSKASPNFKFV  192



>ref|XP_010916151.1| PREDICTED: trifunctional UDP-glucose 4,6-dehydratase/UDP-4-keto-6-deoxy-D-glucose 
3,5-epimerase/UDP-4-keto-L-rhamnose-reductase 
RHM3-like [Elaeis guineensis]
Length=673

 Score =   102 bits (254),  Expect = 1e-23, Method: Composition-based stats.
 Identities = 47/54 (87%), Positives = 51/54 (94%), Gaps = 0/54 (0%)
 Frame = +3

Query  3    ILITGAAGFIASHVANRLVRSYPNYKIVIVDKLXYCSNLKNLLPSRSSPNFKFV  164
            ILITGAAGFIASHVANRL+R+YP YKIV++DKL YCSNLKNL PSRSSPNFKFV
Sbjct  9    ILITGAAGFIASHVANRLIRNYPEYKIVVLDKLDYCSNLKNLNPSRSSPNFKFV  62



>ref|XP_010675265.1| PREDICTED: trifunctional UDP-glucose 4,6-dehydratase/UDP-4-keto-6-deoxy-D-glucose 
3,5-epimerase/UDP-4-keto-L-rhamnose-reductase 
RHM1-like [Beta vulgaris subsp. vulgaris]
 ref|XP_010675266.1| PREDICTED: trifunctional UDP-glucose 4,6-dehydratase/UDP-4-keto-6-deoxy-D-glucose 
3,5-epimerase/UDP-4-keto-L-rhamnose-reductase 
RHM1-like [Beta vulgaris subsp. vulgaris]
 ref|XP_010675267.1| PREDICTED: trifunctional UDP-glucose 4,6-dehydratase/UDP-4-keto-6-deoxy-D-glucose 
3,5-epimerase/UDP-4-keto-L-rhamnose-reductase 
RHM1-like [Beta vulgaris subsp. vulgaris]
Length=674

 Score =   102 bits (254),  Expect = 2e-23, Method: Composition-based stats.
 Identities = 47/54 (87%), Positives = 52/54 (96%), Gaps = 0/54 (0%)
 Frame = +3

Query  3    ILITGAAGFIASHVANRLVRSYPNYKIVIVDKLXYCSNLKNLLPSRSSPNFKFV  164
            ILITGAAGFIASHVANRL+RSYP+YKIV++DKL YCSNLKNL PS+SSPNFKFV
Sbjct  9    ILITGAAGFIASHVANRLIRSYPDYKIVVLDKLDYCSNLKNLRPSQSSPNFKFV  62



>ref|XP_010675264.1| PREDICTED: trifunctional UDP-glucose 4,6-dehydratase/UDP-4-keto-6-deoxy-D-glucose 
3,5-epimerase/UDP-4-keto-L-rhamnose-reductase 
RHM1 [Beta vulgaris subsp. vulgaris]
Length=674

 Score =   102 bits (254),  Expect = 2e-23, Method: Composition-based stats.
 Identities = 47/54 (87%), Positives = 52/54 (96%), Gaps = 0/54 (0%)
 Frame = +3

Query  3    ILITGAAGFIASHVANRLVRSYPNYKIVIVDKLXYCSNLKNLLPSRSSPNFKFV  164
            ILITGAAGFIASHVANRL+RSYP+YKIV++DKL YCSNLKNL PS+SSPNFKFV
Sbjct  9    ILITGAAGFIASHVANRLIRSYPDYKIVVLDKLDYCSNLKNLRPSQSSPNFKFV  62



>ref|XP_011006811.1| PREDICTED: trifunctional UDP-glucose 4,6-dehydratase/UDP-4-keto-6-deoxy-D-glucose 
3,5-epimerase/UDP-4-keto-L-rhamnose-reductase 
RHM1-like [Populus euphratica]
 ref|XP_011006812.1| PREDICTED: trifunctional UDP-glucose 4,6-dehydratase/UDP-4-keto-6-deoxy-D-glucose 
3,5-epimerase/UDP-4-keto-L-rhamnose-reductase 
RHM1-like [Populus euphratica]
Length=670

 Score =   102 bits (254),  Expect = 2e-23, Method: Composition-based stats.
 Identities = 46/54 (85%), Positives = 52/54 (96%), Gaps = 0/54 (0%)
 Frame = +3

Query  3    ILITGAAGFIASHVANRLVRSYPNYKIVIVDKLXYCSNLKNLLPSRSSPNFKFV  164
            ILITGAAGFIASHV NRL+R+YP+YKIV++DKL YCSNLKNLLPS+SSPNFKFV
Sbjct  9    ILITGAAGFIASHVCNRLIRNYPDYKIVVLDKLDYCSNLKNLLPSKSSPNFKFV  62



>ref|XP_007146360.1| hypothetical protein PHAVU_006G034000g [Phaseolus vulgaris]
 gb|ESW18354.1| hypothetical protein PHAVU_006G034000g [Phaseolus vulgaris]
Length=666

 Score =   102 bits (253),  Expect = 2e-23, Method: Composition-based stats.
 Identities = 45/54 (83%), Positives = 52/54 (96%), Gaps = 0/54 (0%)
 Frame = +3

Query  3    ILITGAAGFIASHVANRLVRSYPNYKIVIVDKLXYCSNLKNLLPSRSSPNFKFV  164
            ILITGAAGFIASHV NR+VR+YP+YKIV++DKL YCSNLKNL+PSRSSPNFKF+
Sbjct  10   ILITGAAGFIASHVCNRIVRNYPDYKIVVLDKLDYCSNLKNLMPSRSSPNFKFI  63



>ref|XP_010552134.1| PREDICTED: trifunctional UDP-glucose 4,6-dehydratase/UDP-4-keto-6-deoxy-D-glucose 
3,5-epimerase/UDP-4-keto-L-rhamnose-reductase 
RHM3-like [Tarenaya hassleriana]
Length=668

 Score =   102 bits (253),  Expect = 2e-23, Method: Composition-based stats.
 Identities = 47/54 (87%), Positives = 52/54 (96%), Gaps = 0/54 (0%)
 Frame = +3

Query  3    ILITGAAGFIASHVANRLVRSYPNYKIVIVDKLXYCSNLKNLLPSRSSPNFKFV  164
            ILITGAAGFIASHVAN+LVRSYP+YKIV++DKL YCSNLKNL PS+SSPNFKFV
Sbjct  9    ILITGAAGFIASHVANKLVRSYPDYKIVVLDKLDYCSNLKNLNPSKSSPNFKFV  62



>ref|XP_011045548.1| PREDICTED: trifunctional UDP-glucose 4,6-dehydratase/UDP-4-keto-6-deoxy-D-glucose 
3,5-epimerase/UDP-4-keto-L-rhamnose-reductase 
RHM1 [Populus euphratica]
Length=670

 Score =   102 bits (253),  Expect = 2e-23, Method: Composition-based stats.
 Identities = 46/54 (85%), Positives = 52/54 (96%), Gaps = 0/54 (0%)
 Frame = +3

Query  3    ILITGAAGFIASHVANRLVRSYPNYKIVIVDKLXYCSNLKNLLPSRSSPNFKFV  164
            ILITGAAGFIASHV NRL+R+YP+YKIV++DKL YCSNLKNLLPS+SSPNFKFV
Sbjct  9    ILITGAAGFIASHVCNRLIRNYPDYKIVVLDKLDYCSNLKNLLPSKSSPNFKFV  62



>ref|NP_001151455.1| RHM1 [Zea mays]
 ref|XP_008658705.1| PREDICTED: RHM1 isoform X1 [Zea mays]
 gb|ACG42927.1| RHM1 [Zea mays]
 gb|ACN32027.1| unknown [Zea mays]
 gb|AFW88805.1| RHM1 isoform 1 [Zea mays]
 gb|AFW88806.1| RHM1 isoform 2 [Zea mays]
Length=672

 Score =   102 bits (253),  Expect = 2e-23, Method: Composition-based stats.
 Identities = 47/54 (87%), Positives = 51/54 (94%), Gaps = 0/54 (0%)
 Frame = +3

Query  3    ILITGAAGFIASHVANRLVRSYPNYKIVIVDKLXYCSNLKNLLPSRSSPNFKFV  164
            ILITGAAGFIASHVANRLVR+YP YKIV++DK+ YCSNLKNL PSRSSPNFKFV
Sbjct  9    ILITGAAGFIASHVANRLVRNYPQYKIVVLDKIDYCSNLKNLNPSRSSPNFKFV  62



>ref|XP_006301908.1| hypothetical protein CARUB_v10022384mg [Capsella rubella]
 gb|EOA34806.1| hypothetical protein CARUB_v10022384mg [Capsella rubella]
Length=669

 Score =   102 bits (253),  Expect = 2e-23, Method: Composition-based stats.
 Identities = 46/54 (85%), Positives = 51/54 (94%), Gaps = 0/54 (0%)
 Frame = +3

Query  3    ILITGAAGFIASHVANRLVRSYPNYKIVIVDKLXYCSNLKNLLPSRSSPNFKFV  164
            ILITGAAGFIASHVANRL+RSYP+YKIV++DKL YCSNLKNL PS+ SPNFKFV
Sbjct  9    ILITGAAGFIASHVANRLIRSYPDYKIVVLDKLDYCSNLKNLNPSKQSPNFKFV  62



>ref|XP_004244296.1| PREDICTED: probable rhamnose biosynthetic enzyme 1 [Solanum lycopersicum]
Length=674

 Score =   102 bits (253),  Expect = 2e-23, Method: Composition-based stats.
 Identities = 48/54 (89%), Positives = 51/54 (94%), Gaps = 0/54 (0%)
 Frame = +3

Query  3    ILITGAAGFIASHVANRLVRSYPNYKIVIVDKLXYCSNLKNLLPSRSSPNFKFV  164
            ILITGAAGFIASHVANRLVRSYP+Y IV++DKL YCSNLKNL PSRSSPNFKFV
Sbjct  9    ILITGAAGFIASHVANRLVRSYPDYNIVVLDKLDYCSNLKNLSPSRSSPNFKFV  62



>ref|XP_008791880.1| PREDICTED: probable rhamnose biosynthetic enzyme 1 [Phoenix dactylifera]
 ref|XP_008791888.1| PREDICTED: probable rhamnose biosynthetic enzyme 1 [Phoenix dactylifera]
Length=682

 Score =   102 bits (253),  Expect = 2e-23, Method: Composition-based stats.
 Identities = 46/54 (85%), Positives = 51/54 (94%), Gaps = 0/54 (0%)
 Frame = +3

Query  3    ILITGAAGFIASHVANRLVRSYPNYKIVIVDKLXYCSNLKNLLPSRSSPNFKFV  164
            ILITGAAGFIASHVANRL+R+YP+YKIV++DKL YCSNL N LPSRSSPNFKFV
Sbjct  9    ILITGAAGFIASHVANRLIRNYPDYKIVVLDKLDYCSNLNNFLPSRSSPNFKFV  62



>gb|KJB45829.1| hypothetical protein B456_007G332000 [Gossypium raimondii]
Length=546

 Score =   101 bits (251),  Expect = 2e-23, Method: Composition-based stats.
 Identities = 46/54 (85%), Positives = 50/54 (93%), Gaps = 0/54 (0%)
 Frame = +3

Query  3    ILITGAAGFIASHVANRLVRSYPNYKIVIVDKLXYCSNLKNLLPSRSSPNFKFV  164
            ILITGAAGFIASHVANRLVR+YP YKIV++DKL YCSN KNLLPS+ SPNFKFV
Sbjct  9    ILITGAAGFIASHVANRLVRNYPEYKIVVLDKLDYCSNTKNLLPSKLSPNFKFV  62



>ref|XP_010429684.1| PREDICTED: probable rhamnose biosynthetic enzyme 1 [Camelina 
sativa]
 ref|XP_010472689.1| PREDICTED: probable rhamnose biosynthetic enzyme 1 [Camelina 
sativa]
 ref|XP_010472690.1| PREDICTED: probable rhamnose biosynthetic enzyme 1 [Camelina 
sativa]
Length=670

 Score =   101 bits (252),  Expect = 2e-23, Method: Composition-based stats.
 Identities = 46/54 (85%), Positives = 51/54 (94%), Gaps = 0/54 (0%)
 Frame = +3

Query  3    ILITGAAGFIASHVANRLVRSYPNYKIVIVDKLXYCSNLKNLLPSRSSPNFKFV  164
            ILITGAAGFIASHVANRL+R+YP+YKIV++DKL YCSNLKNL PSR SPNFKFV
Sbjct  9    ILITGAAGFIASHVANRLIRTYPHYKIVVLDKLDYCSNLKNLNPSRHSPNFKFV  62



>ref|XP_010417456.1| PREDICTED: probable rhamnose biosynthetic enzyme 1 isoform X1 
[Camelina sativa]
 ref|XP_010417457.1| PREDICTED: probable rhamnose biosynthetic enzyme 1 isoform X2 
[Camelina sativa]
 ref|XP_010417458.1| PREDICTED: probable rhamnose biosynthetic enzyme 1 isoform X3 
[Camelina sativa]
Length=671

 Score =   101 bits (252),  Expect = 2e-23, Method: Composition-based stats.
 Identities = 46/54 (85%), Positives = 51/54 (94%), Gaps = 0/54 (0%)
 Frame = +3

Query  3    ILITGAAGFIASHVANRLVRSYPNYKIVIVDKLXYCSNLKNLLPSRSSPNFKFV  164
            ILITGAAGFIASHVANRL+R+YP+YKIV++DKL YCSNLKNL PSR SPNFKFV
Sbjct  9    ILITGAAGFIASHVANRLIRTYPHYKIVVLDKLDYCSNLKNLNPSRHSPNFKFV  62



>ref|NP_177978.1| UDP-L-rhamnose synthase [Arabidopsis thaliana]
 sp|Q9SYM5.1|RHM1_ARATH RecName: Full=Trifunctional UDP-glucose 4,6-dehydratase/UDP-4-keto-6-deoxy-D-glucose 
3,5-epimerase/UDP-4-keto-L-rhamnose-reductase 
RHM1; AltName: Full=Protein REPRESSOR OF LRX1 1; AltName: 
Full=Rhamnose biosynthetic enzyme 1; Short=AtRHM1; Includes: 
RecName: Full=UDP-glucose 4,6-dehydratase; Includes: 
RecName: Full=UDP-4-keto-6-deoxy-D-glucose 3,5-epimerase/UDP-4-keto-L-rhamnose 
4-keto-reductase [Arabidopsis thaliana]
 gb|AAD30579.1|AC007260_10 Similar to dTDP-D-glucose 4,6-dehydratase [Arabidopsis thaliana]
 gb|AAK68773.1| Similar to dTDP-D-glucose 4,6-dehydratase [Arabidopsis thaliana]
 gb|AAM10033.1| similar to dTDP-D-glucose 4,6-dehydratase [Arabidopsis thaliana]
 gb|AEE36122.1| UDP-L-rhamnose synthase [Arabidopsis thaliana]
Length=669

 Score =   101 bits (252),  Expect = 2e-23, Method: Composition-based stats.
 Identities = 46/54 (85%), Positives = 51/54 (94%), Gaps = 0/54 (0%)
 Frame = +3

Query  3    ILITGAAGFIASHVANRLVRSYPNYKIVIVDKLXYCSNLKNLLPSRSSPNFKFV  164
            ILITGAAGFIASHVANRL+RSYP+YKIV++DKL YCSNLKNL PS+ SPNFKFV
Sbjct  9    ILITGAAGFIASHVANRLIRSYPDYKIVVLDKLDYCSNLKNLNPSKHSPNFKFV  62



>ref|XP_004984748.1| PREDICTED: probable rhamnose biosynthetic enzyme 1-like [Setaria 
italica]
Length=673

 Score =   101 bits (252),  Expect = 2e-23, Method: Composition-based stats.
 Identities = 47/54 (87%), Positives = 51/54 (94%), Gaps = 0/54 (0%)
 Frame = +3

Query  3    ILITGAAGFIASHVANRLVRSYPNYKIVIVDKLXYCSNLKNLLPSRSSPNFKFV  164
            ILITGAAGFIASHVANRLVR+YP+YKIV++DKL YCSNLKNL PSR SPNFKFV
Sbjct  9    ILITGAAGFIASHVANRLVRNYPHYKIVVLDKLDYCSNLKNLNPSRPSPNFKFV  62



>ref|XP_003551914.1| PREDICTED: probable rhamnose biosynthetic enzyme 1-like isoform 
X1 [Glycine max]
 ref|XP_006602243.1| PREDICTED: probable rhamnose biosynthetic enzyme 1-like isoform 
X2 [Glycine max]
Length=660

 Score =   101 bits (252),  Expect = 2e-23, Method: Composition-based stats.
 Identities = 44/54 (81%), Positives = 52/54 (96%), Gaps = 0/54 (0%)
 Frame = +3

Query  3    ILITGAAGFIASHVANRLVRSYPNYKIVIVDKLXYCSNLKNLLPSRSSPNFKFV  164
            ILITGAAGFIASHV NR+VR+YP+YKI+++DKL YCSNLKNL+PSRSSPNFKF+
Sbjct  10   ILITGAAGFIASHVCNRIVRNYPDYKIIVLDKLDYCSNLKNLIPSRSSPNFKFI  63



>ref|XP_006389974.1| hypothetical protein EUTSA_v10018232mg [Eutrema salsugineum]
 gb|ESQ27260.1| hypothetical protein EUTSA_v10018232mg [Eutrema salsugineum]
Length=669

 Score =   101 bits (252),  Expect = 2e-23, Method: Composition-based stats.
 Identities = 46/54 (85%), Positives = 51/54 (94%), Gaps = 0/54 (0%)
 Frame = +3

Query  3    ILITGAAGFIASHVANRLVRSYPNYKIVIVDKLXYCSNLKNLLPSRSSPNFKFV  164
            ILITGAAGFIASHVANRL+RSYP+YKIV++DKL YCSNLKNL PS+ SPNFKFV
Sbjct  9    ILITGAAGFIASHVANRLIRSYPDYKIVVLDKLDYCSNLKNLNPSKQSPNFKFV  62



>gb|KHN18103.1| Putative rhamnose biosynthetic enzyme 1 [Glycine soja]
Length=660

 Score =   101 bits (252),  Expect = 3e-23, Method: Composition-based stats.
 Identities = 44/54 (81%), Positives = 52/54 (96%), Gaps = 0/54 (0%)
 Frame = +3

Query  3    ILITGAAGFIASHVANRLVRSYPNYKIVIVDKLXYCSNLKNLLPSRSSPNFKFV  164
            ILITGAAGFIASHV NR+VR+YP+YKI+++DKL YCSNLKNL+PSRSSPNFKF+
Sbjct  10   ILITGAAGFIASHVCNRIVRNYPDYKIIVLDKLDYCSNLKNLIPSRSSPNFKFI  63



>gb|KJB45828.1| hypothetical protein B456_007G332000 [Gossypium raimondii]
Length=564

 Score =   101 bits (251),  Expect = 3e-23, Method: Composition-based stats.
 Identities = 46/54 (85%), Positives = 50/54 (93%), Gaps = 0/54 (0%)
 Frame = +3

Query  3    ILITGAAGFIASHVANRLVRSYPNYKIVIVDKLXYCSNLKNLLPSRSSPNFKFV  164
            ILITGAAGFIASHVANRLVR+YP YKIV++DKL YCSN KNLLPS+ SPNFKFV
Sbjct  9    ILITGAAGFIASHVANRLVRNYPEYKIVVLDKLDYCSNTKNLLPSKLSPNFKFV  62



>emb|CDP06058.1| unnamed protein product [Coffea canephora]
Length=653

 Score =   101 bits (252),  Expect = 3e-23, Method: Composition-based stats.
 Identities = 46/54 (85%), Positives = 52/54 (96%), Gaps = 0/54 (0%)
 Frame = +3

Query  3    ILITGAAGFIASHVANRLVRSYPNYKIVIVDKLXYCSNLKNLLPSRSSPNFKFV  164
            ILITGAAGFIASHVANRLVRSYP+YKIV++DKL YCSN+KNLLPS+SSP +KFV
Sbjct  9    ILITGAAGFIASHVANRLVRSYPDYKIVVLDKLDYCSNMKNLLPSQSSPKYKFV  62



>ref|XP_006348335.1| PREDICTED: probable rhamnose biosynthetic enzyme 1-like [Solanum 
tuberosum]
Length=674

 Score =   101 bits (251),  Expect = 3e-23, Method: Composition-based stats.
 Identities = 48/54 (89%), Positives = 50/54 (93%), Gaps = 0/54 (0%)
 Frame = +3

Query  3    ILITGAAGFIASHVANRLVRSYPNYKIVIVDKLXYCSNLKNLLPSRSSPNFKFV  164
            ILITGAAGFIASHVANRLVRSYP Y IV++DKL YCSNLKNL PSRSSPNFKFV
Sbjct  9    ILITGAAGFIASHVANRLVRSYPEYNIVVLDKLDYCSNLKNLSPSRSSPNFKFV  62



>ref|XP_010535018.1| PREDICTED: trifunctional UDP-glucose 4,6-dehydratase/UDP-4-keto-6-deoxy-D-glucose 
3,5-epimerase/UDP-4-keto-L-rhamnose-reductase 
RHM3 [Tarenaya hassleriana]
Length=667

 Score =   101 bits (251),  Expect = 3e-23, Method: Composition-based stats.
 Identities = 46/54 (85%), Positives = 52/54 (96%), Gaps = 0/54 (0%)
 Frame = +3

Query  3    ILITGAAGFIASHVANRLVRSYPNYKIVIVDKLXYCSNLKNLLPSRSSPNFKFV  164
            IL+TGAAGFIASHVANRLVRSYP+YKIV++DKL YCS+LKNL PS+SSPNFKFV
Sbjct  9    ILVTGAAGFIASHVANRLVRSYPDYKIVVLDKLDYCSSLKNLNPSKSSPNFKFV  62



>gb|EMS45937.1| putative rhamnose biosynthetic enzyme 1 [Triticum urartu]
Length=675

 Score =   101 bits (251),  Expect = 3e-23, Method: Composition-based stats.
 Identities = 46/54 (85%), Positives = 51/54 (94%), Gaps = 0/54 (0%)
 Frame = +3

Query  3    ILITGAAGFIASHVANRLVRSYPNYKIVIVDKLXYCSNLKNLLPSRSSPNFKFV  164
            ILITGAAGFIASHVANRL+RSYP+YKIV++DK+ YCSNLKNL PSR SPNFKFV
Sbjct  9    ILITGAAGFIASHVANRLIRSYPHYKIVVLDKIDYCSNLKNLNPSRPSPNFKFV  62



>gb|KHG29785.1| putative rhamnose biosynthetic enzyme 1 -like protein [Gossypium 
arboreum]
Length=667

 Score =   101 bits (251),  Expect = 4e-23, Method: Composition-based stats.
 Identities = 47/54 (87%), Positives = 52/54 (96%), Gaps = 0/54 (0%)
 Frame = +3

Query  3    ILITGAAGFIASHVANRLVRSYPNYKIVIVDKLXYCSNLKNLLPSRSSPNFKFV  164
            ILITGAAGFIASHVANRLVR+YP+YKIV++DKL YCSNLKNLLPS+SS NFKFV
Sbjct  9    ILITGAAGFIASHVANRLVRNYPDYKIVVLDKLDYCSNLKNLLPSQSSRNFKFV  62



>dbj|BAJ86835.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ93619.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=675

 Score =   101 bits (251),  Expect = 4e-23, Method: Composition-based stats.
 Identities = 46/54 (85%), Positives = 51/54 (94%), Gaps = 0/54 (0%)
 Frame = +3

Query  3    ILITGAAGFIASHVANRLVRSYPNYKIVIVDKLXYCSNLKNLLPSRSSPNFKFV  164
            ILITGAAGFIASHVANRL+RSYP+YKIV++DK+ YCSNLKNL PSR SPNFKFV
Sbjct  9    ILITGAAGFIASHVANRLIRSYPHYKIVVLDKIDYCSNLKNLNPSRPSPNFKFV  62



>gb|ADB24773.1| rhamnose synthase [Gossypium hirsutum]
Length=667

 Score =   101 bits (251),  Expect = 4e-23, Method: Composition-based stats.
 Identities = 47/54 (87%), Positives = 52/54 (96%), Gaps = 0/54 (0%)
 Frame = +3

Query  3    ILITGAAGFIASHVANRLVRSYPNYKIVIVDKLXYCSNLKNLLPSRSSPNFKFV  164
            ILITGAAGFIASHVANRLVR+YP+YKIV++DKL YCSNLKNLLPS+SS NFKFV
Sbjct  9    ILITGAAGFIASHVANRLVRNYPDYKIVVLDKLDYCSNLKNLLPSQSSRNFKFV  62



>ref|XP_004509959.1| PREDICTED: probable rhamnose biosynthetic enzyme 1-like [Cicer 
arietinum]
Length=667

 Score =   100 bits (250),  Expect = 5e-23, Method: Composition-based stats.
 Identities = 47/54 (87%), Positives = 51/54 (94%), Gaps = 0/54 (0%)
 Frame = +3

Query  3    ILITGAAGFIASHVANRLVRSYPNYKIVIVDKLXYCSNLKNLLPSRSSPNFKFV  164
            ILITGAAGFIASHVANRLVRS+P YKIV++DKL YCSNLKNLLPS+SS NFKFV
Sbjct  9    ILITGAAGFIASHVANRLVRSHPEYKIVVLDKLDYCSNLKNLLPSKSSSNFKFV  62



>ref|XP_010062770.1| PREDICTED: probable rhamnose biosynthetic enzyme 1 [Eucalyptus 
grandis]
 ref|XP_010062771.1| PREDICTED: probable rhamnose biosynthetic enzyme 1 [Eucalyptus 
grandis]
 gb|KCW69901.1| hypothetical protein EUGRSUZ_F03231 [Eucalyptus grandis]
 gb|KCW69902.1| hypothetical protein EUGRSUZ_F03231 [Eucalyptus grandis]
Length=671

 Score =   100 bits (250),  Expect = 5e-23, Method: Composition-based stats.
 Identities = 46/54 (85%), Positives = 51/54 (94%), Gaps = 0/54 (0%)
 Frame = +3

Query  3    ILITGAAGFIASHVANRLVRSYPNYKIVIVDKLXYCSNLKNLLPSRSSPNFKFV  164
            ILITGAAGFIASHVANRL+R+YP YKIV++DKL YCSNLKNL PS+SSPNFKFV
Sbjct  9    ILITGAAGFIASHVANRLIRNYPEYKIVVLDKLDYCSNLKNLSPSQSSPNFKFV  62



>ref|XP_006647099.1| PREDICTED: probable rhamnose biosynthetic enzyme 3-like [Oryza 
brachyantha]
Length=667

 Score =   100 bits (250),  Expect = 5e-23, Method: Composition-based stats.
 Identities = 46/54 (85%), Positives = 51/54 (94%), Gaps = 0/54 (0%)
 Frame = +3

Query  3    ILITGAAGFIASHVANRLVRSYPNYKIVIVDKLXYCSNLKNLLPSRSSPNFKFV  164
            ILITGAAGFIASHV NR+VRSYP+YKIV++DKL YCSNLKNLLP+ SSPNFKFV
Sbjct  10   ILITGAAGFIASHVTNRIVRSYPDYKIVVLDKLDYCSNLKNLLPASSSPNFKFV  63



>ref|XP_009144768.1| PREDICTED: probable rhamnose biosynthetic enzyme 2 [Brassica 
rapa]
 ref|XP_009144769.1| PREDICTED: probable rhamnose biosynthetic enzyme 2 [Brassica 
rapa]
Length=668

 Score =   100 bits (250),  Expect = 5e-23, Method: Composition-based stats.
 Identities = 46/54 (85%), Positives = 51/54 (94%), Gaps = 0/54 (0%)
 Frame = +3

Query  3    ILITGAAGFIASHVANRLVRSYPNYKIVIVDKLXYCSNLKNLLPSRSSPNFKFV  164
            ILITGAAGFIASHVANRL+RSYP+YKIV++DKL YCS+LKNL PS SSPNFKFV
Sbjct  10   ILITGAAGFIASHVANRLIRSYPDYKIVVLDKLDYCSDLKNLNPSHSSPNFKFV  63



>emb|CDY60210.1| BnaCnng35880D [Brassica napus]
Length=668

 Score =   100 bits (250),  Expect = 5e-23, Method: Composition-based stats.
 Identities = 46/54 (85%), Positives = 51/54 (94%), Gaps = 0/54 (0%)
 Frame = +3

Query  3    ILITGAAGFIASHVANRLVRSYPNYKIVIVDKLXYCSNLKNLLPSRSSPNFKFV  164
            ILITGAAGFIASHVANRL+RSYP+YKIV++DKL YCS+LKNL PS SSPNFKFV
Sbjct  10   ILITGAAGFIASHVANRLIRSYPDYKIVVLDKLDYCSDLKNLNPSHSSPNFKFV  63



>emb|CDP21573.1| unnamed protein product, partial [Coffea canephora]
Length=247

 Score = 97.1 bits (240),  Expect = 7e-23, Method: Compositional matrix adjust.
 Identities = 45/54 (83%), Positives = 51/54 (94%), Gaps = 0/54 (0%)
 Frame = +3

Query  3    ILITGAAGFIASHVANRLVRSYPNYKIVIVDKLXYCSNLKNLLPSRSSPNFKFV  164
            ILITGAAGF+ASHVANRL+R+YP+YKIV++DKL YCSN KNL PSRSSPNFKFV
Sbjct  9    ILITGAAGFVASHVANRLIRNYPSYKIVVLDKLDYCSNEKNLNPSRSSPNFKFV  62



>gb|KJB12930.1| hypothetical protein B456_002G046100 [Gossypium raimondii]
Length=371

 Score = 98.2 bits (243),  Expect = 7e-23, Method: Composition-based stats.
 Identities = 45/54 (83%), Positives = 50/54 (93%), Gaps = 0/54 (0%)
 Frame = +3

Query  3    ILITGAAGFIASHVANRLVRSYPNYKIVIVDKLXYCSNLKNLLPSRSSPNFKFV  164
            ILITGAAGFIASHV NRL+R+YP+YKIV +DKL YCSNLKNL PS+SSPNFKFV
Sbjct  9    ILITGAAGFIASHVTNRLIRNYPSYKIVALDKLDYCSNLKNLHPSKSSPNFKFV  62



>ref|XP_009149137.1| PREDICTED: probable rhamnose biosynthetic enzyme 1 [Brassica 
rapa]
Length=672

 Score =   100 bits (249),  Expect = 7e-23, Method: Composition-based stats.
 Identities = 45/54 (83%), Positives = 51/54 (94%), Gaps = 0/54 (0%)
 Frame = +3

Query  3    ILITGAAGFIASHVANRLVRSYPNYKIVIVDKLXYCSNLKNLLPSRSSPNFKFV  164
            ILITGAAGFIASHVANRL+R+YP+YKIV++DKL YCSNLKNL PS+ SPNFKFV
Sbjct  10   ILITGAAGFIASHVANRLIRTYPDYKIVVLDKLDYCSNLKNLNPSKHSPNFKFV  63



>gb|KJB45831.1| hypothetical protein B456_007G332000 [Gossypium raimondii]
Length=667

 Score =   100 bits (248),  Expect = 8e-23, Method: Composition-based stats.
 Identities = 46/54 (85%), Positives = 50/54 (93%), Gaps = 0/54 (0%)
 Frame = +3

Query  3    ILITGAAGFIASHVANRLVRSYPNYKIVIVDKLXYCSNLKNLLPSRSSPNFKFV  164
            ILITGAAGFIASHVANRLVR+YP YKIV++DKL YCSN KNLLPS+ SPNFKFV
Sbjct  9    ILITGAAGFIASHVANRLVRNYPEYKIVVLDKLDYCSNTKNLLPSKLSPNFKFV  62



>dbj|BAJ97692.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=667

 Score =   100 bits (248),  Expect = 8e-23, Method: Composition-based stats.
 Identities = 45/54 (83%), Positives = 51/54 (94%), Gaps = 0/54 (0%)
 Frame = +3

Query  3    ILITGAAGFIASHVANRLVRSYPNYKIVIVDKLXYCSNLKNLLPSRSSPNFKFV  164
            ILITGAAGFIASHV NR+VR+YP+YKIV++DKL YCSNLKNLLP+ SSPNFKFV
Sbjct  10   ILITGAAGFIASHVTNRIVRNYPDYKIVVLDKLDYCSNLKNLLPASSSPNFKFV  63



>emb|CDY35137.1| BnaA06g11470D [Brassica napus]
Length=670

 Score =   100 bits (248),  Expect = 8e-23, Method: Composition-based stats.
 Identities = 45/54 (83%), Positives = 51/54 (94%), Gaps = 0/54 (0%)
 Frame = +3

Query  3    ILITGAAGFIASHVANRLVRSYPNYKIVIVDKLXYCSNLKNLLPSRSSPNFKFV  164
            ILITGAAGFIASHVANRL+R+YP+YKIV++DKL YCSNLKNL PS+ SPNFKFV
Sbjct  10   ILITGAAGFIASHVANRLIRTYPDYKIVVLDKLDYCSNLKNLNPSKHSPNFKFV  63



>emb|CDY40003.1| BnaC05g13120D [Brassica napus]
Length=670

 Score =   100 bits (248),  Expect = 8e-23, Method: Composition-based stats.
 Identities = 45/54 (83%), Positives = 51/54 (94%), Gaps = 0/54 (0%)
 Frame = +3

Query  3    ILITGAAGFIASHVANRLVRSYPNYKIVIVDKLXYCSNLKNLLPSRSSPNFKFV  164
            ILITGAAGFIASHVANRL+R+YP+YKIV++DKL YCSNLKNL PS+ SPNFKFV
Sbjct  10   ILITGAAGFIASHVANRLIRTYPDYKIVVLDKLDYCSNLKNLNPSKHSPNFKFV  63



>gb|EMT23371.1| Putative rhamnose biosynthetic enzyme 1 [Aegilops tauschii]
Length=667

 Score =   100 bits (248),  Expect = 9e-23, Method: Composition-based stats.
 Identities = 45/54 (83%), Positives = 51/54 (94%), Gaps = 0/54 (0%)
 Frame = +3

Query  3    ILITGAAGFIASHVANRLVRSYPNYKIVIVDKLXYCSNLKNLLPSRSSPNFKFV  164
            ILITGAAGFIASHV NR+VR+YP+YKIV++DKL YCSNLKNLLP+ SSPNFKFV
Sbjct  10   ILITGAAGFIASHVTNRIVRNYPDYKIVVLDKLDYCSNLKNLLPASSSPNFKFV  63



>gb|EMS59810.1| putative rhamnose biosynthetic enzyme 1 [Triticum urartu]
Length=667

 Score =   100 bits (248),  Expect = 9e-23, Method: Composition-based stats.
 Identities = 45/54 (83%), Positives = 51/54 (94%), Gaps = 0/54 (0%)
 Frame = +3

Query  3    ILITGAAGFIASHVANRLVRSYPNYKIVIVDKLXYCSNLKNLLPSRSSPNFKFV  164
            ILITGAAGFIASHV NR+VR+YP+YKIV++DKL YCSNLKNLLP+ SSPNFKFV
Sbjct  10   ILITGAAGFIASHVTNRIVRNYPDYKIVVLDKLDYCSNLKNLLPASSSPNFKFV  63



>ref|XP_009395981.1| PREDICTED: probable rhamnose biosynthetic enzyme 3 [Musa acuminata 
subsp. malaccensis]
Length=672

 Score =   100 bits (248),  Expect = 9e-23, Method: Composition-based stats.
 Identities = 46/54 (85%), Positives = 50/54 (93%), Gaps = 0/54 (0%)
 Frame = +3

Query  3    ILITGAAGFIASHVANRLVRSYPNYKIVIVDKLXYCSNLKNLLPSRSSPNFKFV  164
            ILITGAAGFIASHVANRLVR+YP YKIV++DKL YCSNLKNL PSRS PNF+FV
Sbjct  9    ILITGAAGFIASHVANRLVRNYPKYKIVVLDKLDYCSNLKNLNPSRSCPNFRFV  62



>ref|XP_006306947.1| hypothetical protein CARUB_v10008513mg [Capsella rubella]
 gb|EOA39845.1| hypothetical protein CARUB_v10008513mg [Capsella rubella]
Length=668

 Score =   100 bits (248),  Expect = 1e-22, Method: Composition-based stats.
 Identities = 46/54 (85%), Positives = 51/54 (94%), Gaps = 0/54 (0%)
 Frame = +3

Query  3    ILITGAAGFIASHVANRLVRSYPNYKIVIVDKLXYCSNLKNLLPSRSSPNFKFV  164
            ILITGAAGFIASHVANRL+RSYP+YKIV++DKL YCS+LKNL PS SSPNFKFV
Sbjct  12   ILITGAAGFIASHVANRLIRSYPDYKIVVLDKLDYCSDLKNLDPSFSSPNFKFV  65



>ref|XP_001775697.1| predicted protein [Physcomitrella patens]
 gb|EDQ59500.1| predicted protein [Physcomitrella patens]
Length=669

 Score =   100 bits (248),  Expect = 1e-22, Method: Composition-based stats.
 Identities = 45/54 (83%), Positives = 50/54 (93%), Gaps = 0/54 (0%)
 Frame = +3

Query  3    ILITGAAGFIASHVANRLVRSYPNYKIVIVDKLXYCSNLKNLLPSRSSPNFKFV  164
            ILITGAAGFIASHVANRL+R+YP YKIV++DKL YCSNLKNL PSR+S NFKFV
Sbjct  11   ILITGAAGFIASHVANRLIRNYPQYKIVVLDKLDYCSNLKNLFPSRASKNFKFV  64



>ref|XP_002894444.1| mucilage-modified 4 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH70703.1| mucilage-modified 4 [Arabidopsis lyrata subsp. lyrata]
Length=668

 Score =   100 bits (248),  Expect = 1e-22, Method: Composition-based stats.
 Identities = 46/54 (85%), Positives = 51/54 (94%), Gaps = 0/54 (0%)
 Frame = +3

Query  3    ILITGAAGFIASHVANRLVRSYPNYKIVIVDKLXYCSNLKNLLPSRSSPNFKFV  164
            ILITGAAGFIASHVANRL+RSYP+YKIV++DKL YCS+LKNL PS SSPNFKFV
Sbjct  12   ILITGAAGFIASHVANRLIRSYPDYKIVVLDKLDYCSDLKNLDPSFSSPNFKFV  65



>ref|XP_003571828.1| PREDICTED: probable rhamnose biosynthetic enzyme 1 [Brachypodium 
distachyon]
 ref|XP_010234080.1| PREDICTED: probable rhamnose biosynthetic enzyme 1 [Brachypodium 
distachyon]
Length=667

 Score =   100 bits (248),  Expect = 1e-22, Method: Composition-based stats.
 Identities = 45/54 (83%), Positives = 51/54 (94%), Gaps = 0/54 (0%)
 Frame = +3

Query  3    ILITGAAGFIASHVANRLVRSYPNYKIVIVDKLXYCSNLKNLLPSRSSPNFKFV  164
            ILITGAAGFIASHV NR+VR+YP+YKIV++DKL YCSNLKNLLP+ SSPNFKFV
Sbjct  10   ILITGAAGFIASHVTNRIVRNYPDYKIVVLDKLDYCSNLKNLLPASSSPNFKFV  63



>ref|XP_002887744.1| RHM1/ROL1 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH64003.1| RHM1/ROL1 [Arabidopsis lyrata subsp. lyrata]
Length=669

 Score = 99.8 bits (247),  Expect = 1e-22, Method: Composition-based stats.
 Identities = 45/54 (83%), Positives = 50/54 (93%), Gaps = 0/54 (0%)
 Frame = +3

Query  3    ILITGAAGFIASHVANRLVRSYPNYKIVIVDKLXYCSNLKNLLPSRSSPNFKFV  164
            ILITGAAGFIASHVANRL+RSYP+Y IV++DKL YCSNLKNL PS+ SPNFKFV
Sbjct  9    ILITGAAGFIASHVANRLIRSYPHYNIVVLDKLDYCSNLKNLNPSKQSPNFKFV  62



>ref|XP_010479911.1| PREDICTED: probable rhamnose biosynthetic enzyme 2 [Camelina 
sativa]
Length=668

 Score = 99.8 bits (247),  Expect = 1e-22, Method: Composition-based stats.
 Identities = 46/54 (85%), Positives = 51/54 (94%), Gaps = 0/54 (0%)
 Frame = +3

Query  3    ILITGAAGFIASHVANRLVRSYPNYKIVIVDKLXYCSNLKNLLPSRSSPNFKFV  164
            ILITGAAGFIASHVANRL+RSYP+YKIV++DKL YCS+LKNL PS SSPNFKFV
Sbjct  12   ILITGAAGFIASHVANRLIRSYPDYKIVVLDKLDYCSDLKNLDPSFSSPNFKFV  65



>ref|XP_010462242.1| PREDICTED: probable rhamnose biosynthetic enzyme 2 [Camelina 
sativa]
Length=668

 Score = 99.8 bits (247),  Expect = 1e-22, Method: Composition-based stats.
 Identities = 46/54 (85%), Positives = 51/54 (94%), Gaps = 0/54 (0%)
 Frame = +3

Query  3    ILITGAAGFIASHVANRLVRSYPNYKIVIVDKLXYCSNLKNLLPSRSSPNFKFV  164
            ILITGAAGFIASHVANRL+RSYP+YKIV++DKL YCS+LKNL PS SSPNFKFV
Sbjct  12   ILITGAAGFIASHVANRLIRSYPDYKIVVLDKLDYCSDLKNLDPSFSSPNFKFV  65



>ref|XP_010501002.1| PREDICTED: probable rhamnose biosynthetic enzyme 2 [Camelina 
sativa]
Length=668

 Score = 99.8 bits (247),  Expect = 1e-22, Method: Composition-based stats.
 Identities = 46/54 (85%), Positives = 51/54 (94%), Gaps = 0/54 (0%)
 Frame = +3

Query  3    ILITGAAGFIASHVANRLVRSYPNYKIVIVDKLXYCSNLKNLLPSRSSPNFKFV  164
            ILITGAAGFIASHVANRL+RSYP+YKIV++DKL YCS+LKNL PS SSPNFKFV
Sbjct  12   ILITGAAGFIASHVANRLIRSYPDYKIVVLDKLDYCSDLKNLDPSFSSPNFKFV  65



>gb|EYU26294.1| hypothetical protein MIMGU_mgv1a002474mg [Erythranthe guttata]
Length=669

 Score = 99.8 bits (247),  Expect = 1e-22, Method: Composition-based stats.
 Identities = 45/54 (83%), Positives = 51/54 (94%), Gaps = 0/54 (0%)
 Frame = +3

Query  3    ILITGAAGFIASHVANRLVRSYPNYKIVIVDKLXYCSNLKNLLPSRSSPNFKFV  164
            ILITGAAGFIASHVANRL+R+YP YKIV++DKL YCSNLKNLLPS++S NFKFV
Sbjct  9    ILITGAAGFIASHVANRLIRNYPEYKIVVLDKLDYCSNLKNLLPSKASANFKFV  62



>ref|XP_009147602.1| PREDICTED: probable rhamnose biosynthetic enzyme 2 [Brassica 
rapa]
Length=665

 Score = 99.0 bits (245),  Expect = 2e-22, Method: Composition-based stats.
 Identities = 45/54 (83%), Positives = 51/54 (94%), Gaps = 0/54 (0%)
 Frame = +3

Query  3    ILITGAAGFIASHVANRLVRSYPNYKIVIVDKLXYCSNLKNLLPSRSSPNFKFV  164
            ILITGAAGFIASHVANRL+RSYP+YKIV++DKL YCS+LKNL PS SSPNF+FV
Sbjct  10   ILITGAAGFIASHVANRLIRSYPDYKIVVLDKLDYCSDLKNLDPSFSSPNFRFV  63



>ref|XP_001779703.1| predicted protein [Physcomitrella patens]
 gb|EDQ55499.1| predicted protein [Physcomitrella patens]
Length=666

 Score = 99.0 bits (245),  Expect = 2e-22, Method: Composition-based stats.
 Identities = 44/54 (81%), Positives = 50/54 (93%), Gaps = 0/54 (0%)
 Frame = +3

Query  3    ILITGAAGFIASHVANRLVRSYPNYKIVIVDKLXYCSNLKNLLPSRSSPNFKFV  164
            ILITGAAGFIASHVANRL+R+YP+YKIV++DKL YCSNLKNL PS+ S NFKFV
Sbjct  7    ILITGAAGFIASHVANRLIRNYPHYKIVVLDKLDYCSNLKNLFPSKGSKNFKFV  60



>emb|CDY24092.1| BnaA06g00900D [Brassica napus]
Length=665

 Score = 99.0 bits (245),  Expect = 2e-22, Method: Composition-based stats.
 Identities = 45/54 (83%), Positives = 51/54 (94%), Gaps = 0/54 (0%)
 Frame = +3

Query  3    ILITGAAGFIASHVANRLVRSYPNYKIVIVDKLXYCSNLKNLLPSRSSPNFKFV  164
            ILITGAAGFIASHVANRL+RSYP+YKIV++DKL YCS+LKNL PS SSPNF+FV
Sbjct  10   ILITGAAGFIASHVANRLIRSYPDYKIVVLDKLDYCSDLKNLDPSFSSPNFRFV  63



>ref|XP_009106565.1| PREDICTED: probable rhamnose biosynthetic enzyme 1 [Brassica 
rapa]
 ref|XP_009106567.1| PREDICTED: probable rhamnose biosynthetic enzyme 1 [Brassica 
rapa]
Length=670

 Score = 99.0 bits (245),  Expect = 2e-22, Method: Composition-based stats.
 Identities = 44/54 (81%), Positives = 52/54 (96%), Gaps = 0/54 (0%)
 Frame = +3

Query  3    ILITGAAGFIASHVANRLVRSYPNYKIVIVDKLXYCSNLKNLLPSRSSPNFKFV  164
            ILITGAAGFIASHVANRL+R+YP+YKIV++DKL YCSNLKNL PS++SP+FKFV
Sbjct  9    ILITGAAGFIASHVANRLIRTYPHYKIVVLDKLDYCSNLKNLNPSKNSPSFKFV  62



>ref|XP_002515360.1| dtdp-glucose 4,6-dehydratase, putative [Ricinus communis]
 gb|EEF46809.1| dtdp-glucose 4,6-dehydratase, putative [Ricinus communis]
Length=369

 Score = 96.7 bits (239),  Expect = 2e-22, Method: Composition-based stats.
 Identities = 43/54 (80%), Positives = 49/54 (91%), Gaps = 0/54 (0%)
 Frame = +3

Query  3    ILITGAAGFIASHVANRLVRSYPNYKIVIVDKLXYCSNLKNLLPSRSSPNFKFV  164
            ILITGAAGFIASHV NRL+R+YP+YKIV +DKL YCS+L+NL P RSSPNFKFV
Sbjct  13   ILITGAAGFIASHVTNRLIRNYPDYKIVALDKLDYCSSLRNLTPCRSSPNFKFV  66



>ref|XP_010671686.1| PREDICTED: trifunctional UDP-glucose 4,6-dehydratase/UDP-4-keto-6-deoxy-D-glucose 
3,5-epimerase/UDP-4-keto-L-rhamnose-reductase 
RHM1-like [Beta vulgaris subsp. vulgaris]
Length=675

 Score = 99.0 bits (245),  Expect = 2e-22, Method: Composition-based stats.
 Identities = 45/54 (83%), Positives = 51/54 (94%), Gaps = 0/54 (0%)
 Frame = +3

Query  3    ILITGAAGFIASHVANRLVRSYPNYKIVIVDKLXYCSNLKNLLPSRSSPNFKFV  164
            ILITGAAGFIASHVANRL+R+YP+YKIV++DKL YCS LKNLLPS+SS NFKFV
Sbjct  9    ILITGAAGFIASHVANRLIRTYPDYKIVVLDKLDYCSELKNLLPSQSSANFKFV  62



>emb|CDY45116.1| BnaC06g06370D [Brassica napus]
Length=665

 Score = 99.0 bits (245),  Expect = 3e-22, Method: Composition-based stats.
 Identities = 45/54 (83%), Positives = 51/54 (94%), Gaps = 0/54 (0%)
 Frame = +3

Query  3    ILITGAAGFIASHVANRLVRSYPNYKIVIVDKLXYCSNLKNLLPSRSSPNFKFV  164
            ILITGAAGFIASHVANRL+RSYP+YKIV++DKL YCS+LKNL PS SSPNF+FV
Sbjct  10   ILITGAAGFIASHVANRLIRSYPDYKIVVLDKLDYCSDLKNLDPSFSSPNFRFV  63



>ref|XP_003569141.1| PREDICTED: probable rhamnose biosynthetic enzyme 2 [Brachypodium 
distachyon]
Length=361

 Score = 96.7 bits (239),  Expect = 3e-22, Method: Composition-based stats.
 Identities = 42/54 (78%), Positives = 49/54 (91%), Gaps = 0/54 (0%)
 Frame = +3

Query  3    ILITGAAGFIASHVANRLVRSYPNYKIVIVDKLXYCSNLKNLLPSRSSPNFKFV  164
            ILITGAAGFI SHVANRLVRSYP+Y ++++DK+ YCS+LKNL PSR SPNFKFV
Sbjct  10   ILITGAAGFIGSHVANRLVRSYPHYNVLVLDKMDYCSSLKNLDPSRGSPNFKFV  63



>ref|XP_006392784.1| hypothetical protein EUTSA_v10011290mg [Eutrema salsugineum]
 gb|ESQ30070.1| hypothetical protein EUTSA_v10011290mg [Eutrema salsugineum]
Length=667

 Score = 98.6 bits (244),  Expect = 3e-22, Method: Composition-based stats.
 Identities = 45/54 (83%), Positives = 51/54 (94%), Gaps = 0/54 (0%)
 Frame = +3

Query  3    ILITGAAGFIASHVANRLVRSYPNYKIVIVDKLXYCSNLKNLLPSRSSPNFKFV  164
            ILITGAAGFIASHVANRL+RSYP+YKIV++DKL YCS+LKNL PS SSPNF+FV
Sbjct  10   ILITGAAGFIASHVANRLIRSYPDYKIVVLDKLDYCSDLKNLDPSFSSPNFRFV  63



>emb|CDX88455.1| BnaC06g38990D [Brassica napus]
Length=707

 Score = 98.6 bits (244),  Expect = 3e-22, Method: Composition-based stats.
 Identities = 44/54 (81%), Positives = 52/54 (96%), Gaps = 0/54 (0%)
 Frame = +3

Query  3    ILITGAAGFIASHVANRLVRSYPNYKIVIVDKLXYCSNLKNLLPSRSSPNFKFV  164
            ILITGAAGFIASHVANRL+R+YP+YKIV++DKL YCSNLKNL PS++SP+FKFV
Sbjct  46   ILITGAAGFIASHVANRLIRTYPHYKIVVLDKLDYCSNLKNLNPSKNSPSFKFV  99



>gb|KHG15836.1| putative rhamnose biosynthetic enzyme 1 -like protein [Gossypium 
arboreum]
Length=681

 Score = 98.6 bits (244),  Expect = 3e-22, Method: Composition-based stats.
 Identities = 44/54 (81%), Positives = 51/54 (94%), Gaps = 0/54 (0%)
 Frame = +3

Query  3    ILITGAAGFIASHVANRLVRSYPNYKIVIVDKLXYCSNLKNLLPSRSSPNFKFV  164
            ILITGAAGFIASHV NRL+R+YP+YKIV++DKL YCS+LKNL PSRSSPNFKF+
Sbjct  10   ILITGAAGFIASHVCNRLIRNYPDYKIVVLDKLDYCSSLKNLDPSRSSPNFKFI  63



>ref|NP_564633.2| putative NDP-L-rhamnose synthase [Arabidopsis thaliana]
 sp|Q9LPG6.1|RHM2_ARATH RecName: Full=Trifunctional UDP-glucose 4,6-dehydratase/UDP-4-keto-6-deoxy-D-glucose 
3,5-epimerase/UDP-4-keto-L-rhamnose-reductase 
RHM2; AltName: Full=NDP-rhamnose synthase; AltName: 
Full=Protein MUCILAGE-MODIFIED 4; AltName: Full=Protein RHAMNOSE 
BIOSYNTHESIS 2; AltName: Full=Rhamnose biosynthetic enzyme 
2; Short=AtRHM2; AltName: Full=UDP-L-rhamnose synthase 
MUM4; Includes: RecName: Full=UDP-glucose 4,6-dehydratase; 
Includes: RecName: Full=UDP-4-keto-6-deoxy-D-glucose 3,5-epimerase/UDP-4-keto-L-rhamnose 
4-keto-reductase [Arabidopsis thaliana]
 gb|AAF78439.1|AC018748_18 Contains similarity to dTPD-D-glucose-4,6-dehydratase from Sphingomonas 
sp.S88 gb|U51197 and contains a NAD dependent epimerase/dehydratase 
PF|01370 domain [Arabidopsis thaliana]
 gb|AAG51981.1|AC024260_19 dTDP-D-glucose 4,6-dehydratase, putative; 102946-105028 [Arabidopsis 
thaliana]
 emb|CAD92667.1| putative NDP-rhamnose synthase [Arabidopsis thaliana]
 gb|AAP93963.1| putative UDP-L-rhamnose synthase MUM4 [Arabidopsis thaliana]
 gb|AEE32949.1| putative NDP-L-rhamnose synthase [Arabidopsis thaliana]
Length=667

 Score = 98.6 bits (244),  Expect = 4e-22, Method: Composition-based stats.
 Identities = 45/54 (83%), Positives = 51/54 (94%), Gaps = 0/54 (0%)
 Frame = +3

Query  3    ILITGAAGFIASHVANRLVRSYPNYKIVIVDKLXYCSNLKNLLPSRSSPNFKFV  164
            ILITGAAGFIASHVANRL+R+YP+YKIV++DKL YCS+LKNL PS SSPNFKFV
Sbjct  11   ILITGAAGFIASHVANRLIRNYPDYKIVVLDKLDYCSDLKNLDPSFSSPNFKFV  64



>ref|XP_001775602.1| predicted protein [Physcomitrella patens]
 gb|EDQ59549.1| predicted protein [Physcomitrella patens]
Length=679

 Score = 98.6 bits (244),  Expect = 4e-22, Method: Composition-based stats.
 Identities = 44/54 (81%), Positives = 50/54 (93%), Gaps = 0/54 (0%)
 Frame = +3

Query  3    ILITGAAGFIASHVANRLVRSYPNYKIVIVDKLXYCSNLKNLLPSRSSPNFKFV  164
            ILITGAAGFIASHVANRL+R+YP YKIV++DKL YCSNLKNL PS++S NFKFV
Sbjct  15   ILITGAAGFIASHVANRLIRNYPQYKIVVLDKLDYCSNLKNLFPSKASKNFKFV  68



>ref|XP_004984749.1| PREDICTED: probable rhamnose biosynthetic enzyme 1-like [Setaria 
italica]
Length=672

 Score = 98.2 bits (243),  Expect = 4e-22, Method: Composition-based stats.
 Identities = 45/54 (83%), Positives = 51/54 (94%), Gaps = 0/54 (0%)
 Frame = +3

Query  3    ILITGAAGFIASHVANRLVRSYPNYKIVIVDKLXYCSNLKNLLPSRSSPNFKFV  164
            ILITGAAGFIASHVANRL+R+YP+YKIV++DKL YCS+LKNL PSRSSPN KFV
Sbjct  9    ILITGAAGFIASHVANRLIRNYPHYKIVVLDKLDYCSSLKNLNPSRSSPNLKFV  62



>gb|ADB24774.1| rhamnose synthase [Gossypium hirsutum]
Length=681

 Score = 98.2 bits (243),  Expect = 4e-22, Method: Composition-based stats.
 Identities = 44/54 (81%), Positives = 51/54 (94%), Gaps = 0/54 (0%)
 Frame = +3

Query  3    ILITGAAGFIASHVANRLVRSYPNYKIVIVDKLXYCSNLKNLLPSRSSPNFKFV  164
            ILITGAAGFIASHV NRL+R+YP+YKIV++DKL YCS+LKNL PSRSSPNFKF+
Sbjct  10   ILITGAAGFIASHVCNRLIRNYPDYKIVVLDKLDYCSSLKNLDPSRSSPNFKFI  63



>gb|ABF95280.1| rhamnose biosynthetic enzyme 1, putative, expressed [Oryza sativa 
Japonica Group]
Length=545

 Score = 97.8 bits (242),  Expect = 4e-22, Method: Composition-based stats.
 Identities = 45/54 (83%), Positives = 50/54 (93%), Gaps = 0/54 (0%)
 Frame = +3

Query  3    ILITGAAGFIASHVANRLVRSYPNYKIVIVDKLXYCSNLKNLLPSRSSPNFKFV  164
            ILITGAAGFIASHVANRLVR+YP+YKIV++DKL YCS+L NL PSR SPNFKFV
Sbjct  9    ILITGAAGFIASHVANRLVRNYPHYKIVVLDKLDYCSSLSNLNPSRPSPNFKFV  62



>ref|XP_002468088.1| hypothetical protein SORBIDRAFT_01g039340 [Sorghum bicolor]
 gb|EER95086.1| hypothetical protein SORBIDRAFT_01g039340 [Sorghum bicolor]
Length=672

 Score = 98.2 bits (243),  Expect = 4e-22, Method: Composition-based stats.
 Identities = 45/54 (83%), Positives = 51/54 (94%), Gaps = 0/54 (0%)
 Frame = +3

Query  3    ILITGAAGFIASHVANRLVRSYPNYKIVIVDKLXYCSNLKNLLPSRSSPNFKFV  164
            ILITGAAGFIASHVANRLVR+YP+YKIV++DKL YCS+LKNL PSR+SPN KFV
Sbjct  9    ILITGAAGFIASHVANRLVRNYPHYKIVVLDKLDYCSSLKNLNPSRASPNLKFV  62



>ref|XP_009421279.1| PREDICTED: probable rhamnose biosynthetic enzyme 1 [Musa acuminata 
subsp. malaccensis]
Length=678

 Score = 98.2 bits (243),  Expect = 4e-22, Method: Composition-based stats.
 Identities = 45/54 (83%), Positives = 50/54 (93%), Gaps = 0/54 (0%)
 Frame = +3

Query  3    ILITGAAGFIASHVANRLVRSYPNYKIVIVDKLXYCSNLKNLLPSRSSPNFKFV  164
            ILITGAAGFIASHVANRLVR+YP+YK+V++DKL YCSNLKNL PS  SPNFKFV
Sbjct  9    ILITGAAGFIASHVANRLVRNYPDYKVVVLDKLDYCSNLKNLHPSLCSPNFKFV  62



>gb|KHG07031.1| putative rhamnose biosynthetic enzyme 1 -like protein [Gossypium 
arboreum]
Length=667

 Score = 98.2 bits (243),  Expect = 4e-22, Method: Composition-based stats.
 Identities = 45/54 (83%), Positives = 50/54 (93%), Gaps = 0/54 (0%)
 Frame = +3

Query  3    ILITGAAGFIASHVANRLVRSYPNYKIVIVDKLXYCSNLKNLLPSRSSPNFKFV  164
            ILITGAAGFIASHVANRLVR+YP YKIV++DKL YCSN KNLLPS+ SP+FKFV
Sbjct  9    ILITGAAGFIASHVANRLVRNYPEYKIVVLDKLDYCSNTKNLLPSKLSPSFKFV  62



>ref|XP_004303854.1| PREDICTED: trifunctional UDP-glucose 4,6-dehydratase/UDP-4-keto-6-deoxy-D-glucose 
3,5-epimerase/UDP-4-keto-L-rhamnose-reductase 
RHM1-like [Fragaria vesca subsp. vesca]
Length=679

 Score = 97.8 bits (242),  Expect = 6e-22, Method: Composition-based stats.
 Identities = 44/54 (81%), Positives = 49/54 (91%), Gaps = 0/54 (0%)
 Frame = +3

Query  3    ILITGAAGFIASHVANRLVRSYPNYKIVIVDKLXYCSNLKNLLPSRSSPNFKFV  164
            ILITGAAGFIASHV NRL+R+YP Y IV++DKL YCSNLKNL PSRSSPNFKF+
Sbjct  10   ILITGAAGFIASHVCNRLIRNYPEYNIVVLDKLDYCSNLKNLHPSRSSPNFKFI  63



>ref|XP_001766894.1| predicted protein [Physcomitrella patens]
 gb|EDQ68296.1| predicted protein [Physcomitrella patens]
Length=677

 Score = 97.8 bits (242),  Expect = 6e-22, Method: Composition-based stats.
 Identities = 44/54 (81%), Positives = 51/54 (94%), Gaps = 0/54 (0%)
 Frame = +3

Query  3    ILITGAAGFIASHVANRLVRSYPNYKIVIVDKLXYCSNLKNLLPSRSSPNFKFV  164
            ILITGAAGFIASHVANRL+R+YP+YKIV++DKL YCSNLKNL PS++S NFKFV
Sbjct  15   ILITGAAGFIASHVANRLIRNYPHYKIVVLDKLDYCSNLKNLFPSKASKNFKFV  68



>ref|NP_001049724.1| Os03g0278200 [Oryza sativa Japonica Group]
 gb|ABF95277.1| rhamnose biosynthetic enzyme 1, putative, expressed [Oryza sativa 
Japonica Group]
 gb|ABF95278.1| rhamnose biosynthetic enzyme 1, putative, expressed [Oryza sativa 
Japonica Group]
 gb|ABF95279.1| rhamnose biosynthetic enzyme 1, putative, expressed [Oryza sativa 
Japonica Group]
 dbj|BAF11638.1| Os03g0278200 [Oryza sativa Japonica Group]
 gb|EEC74971.1| hypothetical protein OsI_10998 [Oryza sativa Indica Group]
 gb|EEE58799.1| hypothetical protein OsJ_10344 [Oryza sativa Japonica Group]
 gb|AJB98437.1| NAD-dependent epimerase/dehydratase family domain containing 
protein, partial [Oryza sativa]
Length=675

 Score = 97.4 bits (241),  Expect = 8e-22, Method: Composition-based stats.
 Identities = 45/54 (83%), Positives = 50/54 (93%), Gaps = 0/54 (0%)
 Frame = +3

Query  3    ILITGAAGFIASHVANRLVRSYPNYKIVIVDKLXYCSNLKNLLPSRSSPNFKFV  164
            ILITGAAGFIASHVANRLVR+YP+YKIV++DKL YCS+L NL PSR SPNFKFV
Sbjct  9    ILITGAAGFIASHVANRLVRNYPHYKIVVLDKLDYCSSLSNLNPSRPSPNFKFV  62



>ref|XP_010924680.1| PREDICTED: trifunctional UDP-glucose 4,6-dehydratase/UDP-4-keto-6-deoxy-D-glucose 
3,5-epimerase/UDP-4-keto-L-rhamnose-reductase 
RHM3 [Elaeis guineensis]
Length=673

 Score = 97.4 bits (241),  Expect = 9e-22, Method: Composition-based stats.
 Identities = 45/54 (83%), Positives = 49/54 (91%), Gaps = 0/54 (0%)
 Frame = +3

Query  3    ILITGAAGFIASHVANRLVRSYPNYKIVIVDKLXYCSNLKNLLPSRSSPNFKFV  164
            ILITGA GFIASHVAN L+R+YP YKIV++DKL YCSNLKNL PSRSSPNFKFV
Sbjct  9    ILITGAGGFIASHVANCLIRNYPEYKIVVLDKLDYCSNLKNLNPSRSSPNFKFV  62



>ref|XP_006649857.1| PREDICTED: probable rhamnose biosynthetic enzyme 1-like [Oryza 
brachyantha]
Length=673

 Score = 97.4 bits (241),  Expect = 9e-22, Method: Composition-based stats.
 Identities = 45/54 (83%), Positives = 50/54 (93%), Gaps = 0/54 (0%)
 Frame = +3

Query  3    ILITGAAGFIASHVANRLVRSYPNYKIVIVDKLXYCSNLKNLLPSRSSPNFKFV  164
            ILITGAAGFIASHVANRLVR+YP+YKIV++DKL YCS+LKNL PSR SPN KFV
Sbjct  9    ILITGAAGFIASHVANRLVRNYPHYKIVVLDKLDYCSSLKNLNPSRPSPNLKFV  62



>ref|XP_009356652.1| PREDICTED: probable rhamnose biosynthetic enzyme 1 [Pyrus x bretschneideri]
Length=679

 Score = 97.4 bits (241),  Expect = 9e-22, Method: Composition-based stats.
 Identities = 43/54 (80%), Positives = 50/54 (93%), Gaps = 0/54 (0%)
 Frame = +3

Query  3    ILITGAAGFIASHVANRLVRSYPNYKIVIVDKLXYCSNLKNLLPSRSSPNFKFV  164
            IL+TGAAGFIASHV NRL+R+YP YKIV++DKL YCSNLKNL PS+SSPNFKF+
Sbjct  10   ILLTGAAGFIASHVCNRLIRNYPAYKIVVLDKLDYCSNLKNLHPSKSSPNFKFI  63



>ref|XP_008812156.1| PREDICTED: probable rhamnose biosynthetic enzyme 1 [Phoenix dactylifera]
Length=673

 Score = 97.4 bits (241),  Expect = 9e-22, Method: Composition-based stats.
 Identities = 44/54 (81%), Positives = 49/54 (91%), Gaps = 0/54 (0%)
 Frame = +3

Query  3    ILITGAAGFIASHVANRLVRSYPNYKIVIVDKLXYCSNLKNLLPSRSSPNFKFV  164
            ILITGAAGFIASHV NRL+R+YP YKIV++D+L YCSNLKNL PS SSPNFKFV
Sbjct  9    ILITGAAGFIASHVTNRLIRNYPEYKIVVLDRLDYCSNLKNLNPSSSSPNFKFV  62



>gb|KDP30504.1| hypothetical protein JCGZ_17141 [Jatropha curcas]
Length=671

 Score = 96.7 bits (239),  Expect = 1e-21, Method: Composition-based stats.
 Identities = 44/54 (81%), Positives = 50/54 (93%), Gaps = 0/54 (0%)
 Frame = +3

Query  3    ILITGAAGFIASHVANRLVRSYPNYKIVIVDKLXYCSNLKNLLPSRSSPNFKFV  164
            ILITGAAGFIASHV NRL+R+YP+YKIV++DKL YCSNLKNLLPS+ S NFKFV
Sbjct  9    ILITGAAGFIASHVCNRLIRNYPDYKIVVLDKLDYCSNLKNLLPSKLSANFKFV  62



>gb|ADB24772.1| rhamnose synthase [Gossypium hirsutum]
Length=667

 Score = 96.7 bits (239),  Expect = 1e-21, Method: Composition-based stats.
 Identities = 44/54 (81%), Positives = 49/54 (91%), Gaps = 0/54 (0%)
 Frame = +3

Query  3    ILITGAAGFIASHVANRLVRSYPNYKIVIVDKLXYCSNLKNLLPSRSSPNFKFV  164
            ILITGAAGFIASHVANRLVR+YP YKIV++DKL YCSN KNL PS+ SP+FKFV
Sbjct  9    ILITGAAGFIASHVANRLVRNYPEYKIVVLDKLDYCSNTKNLFPSKLSPSFKFV  62



>ref|XP_007215006.1| hypothetical protein PRUPE_ppa002417mg [Prunus persica]
 gb|EMJ16205.1| hypothetical protein PRUPE_ppa002417mg [Prunus persica]
Length=675

 Score = 96.7 bits (239),  Expect = 1e-21, Method: Composition-based stats.
 Identities = 44/54 (81%), Positives = 49/54 (91%), Gaps = 0/54 (0%)
 Frame = +3

Query  3    ILITGAAGFIASHVANRLVRSYPNYKIVIVDKLXYCSNLKNLLPSRSSPNFKFV  164
            ILITGAAGFIASHV NRL+R+YP YKIV++DKL YCSNLKNL PSRSS NFKF+
Sbjct  10   ILITGAAGFIASHVCNRLIRNYPEYKIVVLDKLDYCSNLKNLHPSRSSSNFKFI  63



>ref|XP_008229395.1| PREDICTED: probable rhamnose biosynthetic enzyme 1 [Prunus mume]
Length=669

 Score = 96.7 bits (239),  Expect = 2e-21, Method: Composition-based stats.
 Identities = 44/54 (81%), Positives = 49/54 (91%), Gaps = 0/54 (0%)
 Frame = +3

Query  3    ILITGAAGFIASHVANRLVRSYPNYKIVIVDKLXYCSNLKNLLPSRSSPNFKFV  164
            ILITGAAGFIASHV NRL+R+YP YKIV++DKL YCSNLKNL PSRSS NFKF+
Sbjct  10   ILITGAAGFIASHVCNRLIRNYPEYKIVVLDKLDYCSNLKNLHPSRSSSNFKFI  63



>gb|KDO49287.1| hypothetical protein CISIN_1g005941mg [Citrus sinensis]
 gb|KDO49288.1| hypothetical protein CISIN_1g005941mg [Citrus sinensis]
Length=668

 Score = 96.7 bits (239),  Expect = 2e-21, Method: Composition-based stats.
 Identities = 43/54 (80%), Positives = 50/54 (93%), Gaps = 0/54 (0%)
 Frame = +3

Query  3    ILITGAAGFIASHVANRLVRSYPNYKIVIVDKLXYCSNLKNLLPSRSSPNFKFV  164
            ILITGAAGFIASHV NRL+R+YP YKIV++DKL YCSNLKNL+PS++S NFKFV
Sbjct  9    ILITGAAGFIASHVCNRLIRNYPEYKIVVLDKLDYCSNLKNLIPSKASSNFKFV  62



>ref|XP_006442344.1| hypothetical protein CICLE_v10019182mg [Citrus clementina]
 ref|XP_006442345.1| hypothetical protein CICLE_v10019182mg [Citrus clementina]
 ref|XP_006442346.1| hypothetical protein CICLE_v10019182mg [Citrus clementina]
 gb|ESR55584.1| hypothetical protein CICLE_v10019182mg [Citrus clementina]
 gb|ESR55585.1| hypothetical protein CICLE_v10019182mg [Citrus clementina]
 gb|ESR55586.1| hypothetical protein CICLE_v10019182mg [Citrus clementina]
Length=668

 Score = 96.7 bits (239),  Expect = 2e-21, Method: Composition-based stats.
 Identities = 43/54 (80%), Positives = 50/54 (93%), Gaps = 0/54 (0%)
 Frame = +3

Query  3    ILITGAAGFIASHVANRLVRSYPNYKIVIVDKLXYCSNLKNLLPSRSSPNFKFV  164
            ILITGAAGFIASHV NRL+R+YP YKIV++DKL YCSNLKNL+PS++S NFKFV
Sbjct  9    ILITGAAGFIASHVCNRLIRNYPEYKIVVLDKLDYCSNLKNLIPSKASSNFKFV  62



>ref|XP_002964674.1| hypothetical protein SELMODRAFT_266803 [Selaginella moellendorffii]
 gb|EFJ35007.1| hypothetical protein SELMODRAFT_266803 [Selaginella moellendorffii]
Length=676

 Score = 96.7 bits (239),  Expect = 2e-21, Method: Composition-based stats.
 Identities = 45/54 (83%), Positives = 48/54 (89%), Gaps = 0/54 (0%)
 Frame = +3

Query  3    ILITGAAGFIASHVANRLVRSYPNYKIVIVDKLXYCSNLKNLLPSRSSPNFKFV  164
            ILITGAAGFIASHVANRLVRSYP YKIV++DKL YCSNLKNL  S+ S NFKFV
Sbjct  19   ILITGAAGFIASHVANRLVRSYPGYKIVVLDKLDYCSNLKNLYQSKESANFKFV  72



>ref|XP_002989472.1| hypothetical protein SELMODRAFT_129972 [Selaginella moellendorffii]
 gb|EFJ09348.1| hypothetical protein SELMODRAFT_129972 [Selaginella moellendorffii]
Length=675

 Score = 96.7 bits (239),  Expect = 2e-21, Method: Composition-based stats.
 Identities = 45/54 (83%), Positives = 48/54 (89%), Gaps = 0/54 (0%)
 Frame = +3

Query  3    ILITGAAGFIASHVANRLVRSYPNYKIVIVDKLXYCSNLKNLLPSRSSPNFKFV  164
            ILITGAAGFIASHVANRLVRSYP YKIV++DKL YCSNLKNL  S+ S NFKFV
Sbjct  19   ILITGAAGFIASHVANRLVRSYPGYKIVVLDKLDYCSNLKNLYQSKESANFKFV  72



>ref|XP_006477818.1| PREDICTED: probable rhamnose biosynthetic enzyme 1-like isoform 
X1 [Citrus sinensis]
 ref|XP_006477819.1| PREDICTED: probable rhamnose biosynthetic enzyme 1-like isoform 
X2 [Citrus sinensis]
Length=668

 Score = 96.3 bits (238),  Expect = 2e-21, Method: Composition-based stats.
 Identities = 43/54 (80%), Positives = 50/54 (93%), Gaps = 0/54 (0%)
 Frame = +3

Query  3    ILITGAAGFIASHVANRLVRSYPNYKIVIVDKLXYCSNLKNLLPSRSSPNFKFV  164
            ILITGAAGFIASHV NRL+R+YP YKIV++DKL YCSNLKNL+PS++S NFKFV
Sbjct  9    ILITGAAGFIASHVCNRLIRNYPEYKIVVLDKLDYCSNLKNLIPSKASSNFKFV  62



>ref|XP_010268536.1| PREDICTED: probable rhamnose biosynthetic enzyme 3 [Nelumbo nucifera]
Length=665

 Score = 96.3 bits (238),  Expect = 2e-21, Method: Composition-based stats.
 Identities = 42/54 (78%), Positives = 50/54 (93%), Gaps = 0/54 (0%)
 Frame = +3

Query  3    ILITGAAGFIASHVANRLVRSYPNYKIVIVDKLXYCSNLKNLLPSRSSPNFKFV  164
            IL+TGAAGFIASHV NRL+++YPNY IV +DKL YCS++KNLLPS+SSPNFKFV
Sbjct  14   ILLTGAAGFIASHVTNRLIKNYPNYNIVALDKLDYCSSIKNLLPSQSSPNFKFV  67



>ref|XP_004172221.1| PREDICTED: probable rhamnose biosynthetic enzyme 2-like, partial 
[Cucumis sativus]
Length=354

 Score = 93.6 bits (231),  Expect = 3e-21, Method: Composition-based stats.
 Identities = 40/54 (74%), Positives = 50/54 (93%), Gaps = 0/54 (0%)
 Frame = +3

Query  3    ILITGAAGFIASHVANRLVRSYPNYKIVIVDKLXYCSNLKNLLPSRSSPNFKFV  164
            ILITGAAGFIASHV NRL+++YP+YKIV +DKL YCSN+KNL PS++SPNF+F+
Sbjct  14   ILITGAAGFIASHVTNRLIKNYPHYKIVALDKLDYCSNIKNLGPSQTSPNFRFI  67



>ref|XP_009377674.1| PREDICTED: probable rhamnose biosynthetic enzyme 1 [Pyrus x bretschneideri]
Length=679

 Score = 95.9 bits (237),  Expect = 3e-21, Method: Composition-based stats.
 Identities = 42/54 (78%), Positives = 50/54 (93%), Gaps = 0/54 (0%)
 Frame = +3

Query  3    ILITGAAGFIASHVANRLVRSYPNYKIVIVDKLXYCSNLKNLLPSRSSPNFKFV  164
            IL+TGAAGFIASHV NRL+++YP YKIV++DKL YCSNLKNL PS+SSPNFKF+
Sbjct  10   ILLTGAAGFIASHVCNRLIQNYPGYKIVVLDKLDYCSNLKNLNPSKSSPNFKFI  63



>gb|EMT08126.1| Putative rhamnose biosynthetic enzyme 1 [Aegilops tauschii]
Length=433

 Score = 94.4 bits (233),  Expect = 3e-21, Method: Composition-based stats.
 Identities = 43/54 (80%), Positives = 49/54 (91%), Gaps = 0/54 (0%)
 Frame = +3

Query  3    ILITGAAGFIASHVANRLVRSYPNYKIVIVDKLXYCSNLKNLLPSRSSPNFKFV  164
            ILITGAAGFIASHVANRLVR+YP Y IVI+D++ YCS+L+NL PSR SPNFKFV
Sbjct  74   ILITGAAGFIASHVANRLVRNYPRYNIVILDRVDYCSSLRNLDPSRGSPNFKFV  127



>gb|EMS55907.1| putative rhamnose biosynthetic enzyme 3 [Triticum urartu]
Length=492

 Score = 94.4 bits (233),  Expect = 4e-21, Method: Composition-based stats.
 Identities = 43/54 (80%), Positives = 49/54 (91%), Gaps = 0/54 (0%)
 Frame = +3

Query  3    ILITGAAGFIASHVANRLVRSYPNYKIVIVDKLXYCSNLKNLLPSRSSPNFKFV  164
            ILITGAAGFIASHVANRLVR+YP Y IVI+D++ YCS+L+NL PSR SPNFKFV
Sbjct  100  ILITGAAGFIASHVANRLVRNYPRYNIVILDRVDYCSSLRNLDPSRGSPNFKFV  153



>ref|XP_009394163.1| PREDICTED: probable rhamnose biosynthetic enzyme 1 [Musa acuminata 
subsp. malaccensis]
Length=675

 Score = 95.5 bits (236),  Expect = 5e-21, Method: Composition-based stats.
 Identities = 46/54 (85%), Positives = 49/54 (91%), Gaps = 0/54 (0%)
 Frame = +3

Query  3    ILITGAAGFIASHVANRLVRSYPNYKIVIVDKLXYCSNLKNLLPSRSSPNFKFV  164
            ILITGAAGFIASHVANRLV +YP YKIV++DKL YCSNLKNL  SRSSPNFKFV
Sbjct  9    ILITGAAGFIASHVANRLVWNYPEYKIVVLDKLDYCSNLKNLNLSRSSPNFKFV  62



>ref|XP_010060763.1| PREDICTED: probable rhamnose biosynthetic enzyme 1 [Eucalyptus 
grandis]
 gb|KCW67616.1| hypothetical protein EUGRSUZ_F01369 [Eucalyptus grandis]
Length=666

 Score = 95.1 bits (235),  Expect = 5e-21, Method: Composition-based stats.
 Identities = 43/54 (80%), Positives = 49/54 (91%), Gaps = 0/54 (0%)
 Frame = +3

Query  3    ILITGAAGFIASHVANRLVRSYPNYKIVIVDKLXYCSNLKNLLPSRSSPNFKFV  164
            ILITGAAGFIA HVANRL R++  YKIV++DKL YCSNLKNLLPS+S+PNFKFV
Sbjct  9    ILITGAAGFIACHVANRLTRNFTEYKIVVLDKLDYCSNLKNLLPSKSAPNFKFV  62



>ref|XP_008380346.1| PREDICTED: probable rhamnose biosynthetic enzyme 2 [Malus domestica]
 ref|XP_008358039.1| PREDICTED: probable rhamnose biosynthetic enzyme 2 [Malus domestica]
Length=688

 Score = 95.1 bits (235),  Expect = 5e-21, Method: Composition-based stats.
 Identities = 42/54 (78%), Positives = 49/54 (91%), Gaps = 0/54 (0%)
 Frame = +3

Query  3    ILITGAAGFIASHVANRLVRSYPNYKIVIVDKLXYCSNLKNLLPSRSSPNFKFV  164
            IL+TGAAGFIASHV NRL+R+YP+Y IV++DKL YCSNLKNL PS SSPNFKF+
Sbjct  10   ILLTGAAGFIASHVCNRLIRNYPDYNIVVLDKLDYCSNLKNLHPSMSSPNFKFI  63



>ref|XP_002468080.1| hypothetical protein SORBIDRAFT_01g039220 [Sorghum bicolor]
 gb|EER95078.1| hypothetical protein SORBIDRAFT_01g039220 [Sorghum bicolor]
Length=672

 Score = 94.7 bits (234),  Expect = 7e-21, Method: Composition-based stats.
 Identities = 44/54 (81%), Positives = 50/54 (93%), Gaps = 0/54 (0%)
 Frame = +3

Query  3    ILITGAAGFIASHVANRLVRSYPNYKIVIVDKLXYCSNLKNLLPSRSSPNFKFV  164
            ILITGAAGFIASHVANRLVR+YP+YKIV++DKL YCS+LKNL PSR+S N KFV
Sbjct  9    ILITGAAGFIASHVANRLVRNYPHYKIVVLDKLDYCSSLKNLNPSRASQNLKFV  62



>ref|XP_008380229.1| PREDICTED: probable rhamnose biosynthetic enzyme 1 [Malus domestica]
Length=679

 Score = 94.7 bits (234),  Expect = 8e-21, Method: Composition-based stats.
 Identities = 42/54 (78%), Positives = 49/54 (91%), Gaps = 0/54 (0%)
 Frame = +3

Query  3    ILITGAAGFIASHVANRLVRSYPNYKIVIVDKLXYCSNLKNLLPSRSSPNFKFV  164
            IL+TGAAGFIASHV NRL+R+YP YKIV++DKL YCSNLKNL PS+SSP FKF+
Sbjct  10   ILLTGAAGFIASHVCNRLIRNYPAYKIVVLDKLDYCSNLKNLNPSKSSPKFKFI  63



>gb|AFW77499.1| hypothetical protein ZEAMMB73_283149 [Zea mays]
Length=529

 Score = 94.0 bits (232),  Expect = 8e-21, Method: Composition-based stats.
 Identities = 42/54 (78%), Positives = 48/54 (89%), Gaps = 0/54 (0%)
 Frame = +3

Query  3    ILITGAAGFIASHVANRLVRSYPNYKIVIVDKLXYCSNLKNLLPSRSSPNFKFV  164
            ILITGAAGFIASHVA R+ + YP+YKI+++DKL YCSNLKNLLP  SSPNFKFV
Sbjct  20   ILITGAAGFIASHVAIRITKKYPDYKIIVLDKLDYCSNLKNLLPVSSSPNFKFV  73



>ref|XP_007048831.1| Rhamnose biosynthesis 1 isoform 1 [Theobroma cacao]
 ref|XP_007048832.1| Rhamnose biosynthesis 1 isoform 1 [Theobroma cacao]
 gb|EOX92988.1| Rhamnose biosynthesis 1 isoform 1 [Theobroma cacao]
 gb|EOX92989.1| Rhamnose biosynthesis 1 isoform 1 [Theobroma cacao]
Length=732

 Score = 94.4 bits (233),  Expect = 1e-20, Method: Composition-based stats.
 Identities = 42/54 (78%), Positives = 50/54 (93%), Gaps = 0/54 (0%)
 Frame = +3

Query  3    ILITGAAGFIASHVANRLVRSYPNYKIVIVDKLXYCSNLKNLLPSRSSPNFKFV  164
            ILITGAAGFIASHV NRL+R+YP+YKIV++DKL YCS+LKNL P+R SPNFKF+
Sbjct  10   ILITGAAGFIASHVCNRLIRNYPDYKIVVLDKLDYCSSLKNLNPARLSPNFKFI  63



>gb|KJB75445.1| hypothetical protein B456_012G042300 [Gossypium raimondii]
Length=681

 Score = 94.4 bits (233),  Expect = 1e-20, Method: Composition-based stats.
 Identities = 43/54 (80%), Positives = 50/54 (93%), Gaps = 0/54 (0%)
 Frame = +3

Query  3    ILITGAAGFIASHVANRLVRSYPNYKIVIVDKLXYCSNLKNLLPSRSSPNFKFV  164
            ILITGAAGFIASHV NRL+R+YP+YKIV++DKL YCS+LKNL  SRSSPNFKF+
Sbjct  10   ILITGAAGFIASHVCNRLIRNYPDYKIVVLDKLDYCSSLKNLDRSRSSPNFKFI  63



>ref|XP_010109352.1| putative rhamnose biosynthetic enzyme 1 [Morus notabilis]
 gb|EXC21996.1| putative rhamnose biosynthetic enzyme 1 [Morus notabilis]
Length=673

 Score = 94.4 bits (233),  Expect = 1e-20, Method: Composition-based stats.
 Identities = 43/54 (80%), Positives = 48/54 (89%), Gaps = 0/54 (0%)
 Frame = +3

Query  3    ILITGAAGFIASHVANRLVRSYPNYKIVIVDKLXYCSNLKNLLPSRSSPNFKFV  164
            ILITGAAGFIASHV NRL+R+YP Y IV++DKL YCSNLKNLLPSRSS N KF+
Sbjct  10   ILITGAAGFIASHVCNRLIRNYPEYNIVVLDKLDYCSNLKNLLPSRSSLNIKFI  63



>gb|KDO60921.1| hypothetical protein CISIN_1g005818mg [Citrus sinensis]
Length=676

 Score = 93.6 bits (231),  Expect = 2e-20, Method: Composition-based stats.
 Identities = 43/54 (80%), Positives = 48/54 (89%), Gaps = 0/54 (0%)
 Frame = +3

Query  3    ILITGAAGFIASHVANRLVRSYPNYKIVIVDKLXYCSNLKNLLPSRSSPNFKFV  164
            ILITGAAGFIASHV NRL+ +YP YKIV++DKL YCSNLKNL PSR SPNFKF+
Sbjct  10   ILITGAAGFIASHVCNRLIGNYPEYKIVVLDKLDYCSNLKNLNPSRLSPNFKFI  63



>ref|XP_006437200.1| hypothetical protein CICLE_v10030887mg [Citrus clementina]
 gb|ESR50440.1| hypothetical protein CICLE_v10030887mg [Citrus clementina]
Length=676

 Score = 93.6 bits (231),  Expect = 2e-20, Method: Composition-based stats.
 Identities = 43/54 (80%), Positives = 48/54 (89%), Gaps = 0/54 (0%)
 Frame = +3

Query  3    ILITGAAGFIASHVANRLVRSYPNYKIVIVDKLXYCSNLKNLLPSRSSPNFKFV  164
            ILITGAAGFIASHV NRL+ +YP YKIV++DKL YCSNLKNL PSR SPNFKF+
Sbjct  10   ILITGAAGFIASHVCNRLIGNYPEYKIVVLDKLDYCSNLKNLNPSRLSPNFKFI  63



>ref|XP_006484833.1| PREDICTED: probable rhamnose biosynthetic enzyme 1-like [Citrus 
sinensis]
Length=676

 Score = 93.6 bits (231),  Expect = 2e-20, Method: Composition-based stats.
 Identities = 43/54 (80%), Positives = 48/54 (89%), Gaps = 0/54 (0%)
 Frame = +3

Query  3    ILITGAAGFIASHVANRLVRSYPNYKIVIVDKLXYCSNLKNLLPSRSSPNFKFV  164
            ILITGAAGFIASHV NRL+ +YP YKIV++DKL YCSNLKNL PSR SPNFKF+
Sbjct  10   ILITGAAGFIASHVCNRLIGNYPEYKIVVLDKLDYCSNLKNLNPSRLSPNFKFI  63



>ref|XP_008445073.1| PREDICTED: probable rhamnose biosynthetic enzyme 2 [Cucumis melo]
Length=667

 Score = 93.6 bits (231),  Expect = 2e-20, Method: Composition-based stats.
 Identities = 40/54 (74%), Positives = 50/54 (93%), Gaps = 0/54 (0%)
 Frame = +3

Query  3    ILITGAAGFIASHVANRLVRSYPNYKIVIVDKLXYCSNLKNLLPSRSSPNFKFV  164
            ILITGAAGFIASHV NRL+++YP+YKIV +DKL YCSN+KNL PS++SPNF+F+
Sbjct  13   ILITGAAGFIASHVTNRLIKNYPHYKIVALDKLDYCSNIKNLGPSQTSPNFRFI  66



>ref|XP_004960685.1| PREDICTED: probable rhamnose biosynthetic enzyme 1-like [Setaria 
italica]
Length=666

 Score = 93.6 bits (231),  Expect = 2e-20, Method: Composition-based stats.
 Identities = 43/54 (80%), Positives = 48/54 (89%), Gaps = 0/54 (0%)
 Frame = +3

Query  3    ILITGAAGFIASHVANRLVRSYPNYKIVIVDKLXYCSNLKNLLPSRSSPNFKFV  164
            ILITGAAGFIASHVA R+ + YP+YKIV++DKL YCSNLKNLLP  SSPNFKFV
Sbjct  10   ILITGAAGFIASHVAIRITKKYPDYKIVVLDKLDYCSNLKNLLPVSSSPNFKFV  63



>ref|XP_002440852.1| hypothetical protein SORBIDRAFT_09g008220 [Sorghum bicolor]
 gb|EES19282.1| hypothetical protein SORBIDRAFT_09g008220 [Sorghum bicolor]
Length=666

 Score = 93.6 bits (231),  Expect = 2e-20, Method: Composition-based stats.
 Identities = 43/54 (80%), Positives = 48/54 (89%), Gaps = 0/54 (0%)
 Frame = +3

Query  3    ILITGAAGFIASHVANRLVRSYPNYKIVIVDKLXYCSNLKNLLPSRSSPNFKFV  164
            ILITGAAGFIASHVA R+ + YP+YKIV++DKL YCSNLKNLLP  SSPNFKFV
Sbjct  10   ILITGAAGFIASHVAIRVTKKYPDYKIVVLDKLDYCSNLKNLLPVSSSPNFKFV  63



>ref|XP_008342373.1| PREDICTED: probable rhamnose biosynthetic enzyme 1 [Malus domestica]
Length=679

 Score = 93.6 bits (231),  Expect = 2e-20, Method: Composition-based stats.
 Identities = 41/54 (76%), Positives = 49/54 (91%), Gaps = 0/54 (0%)
 Frame = +3

Query  3    ILITGAAGFIASHVANRLVRSYPNYKIVIVDKLXYCSNLKNLLPSRSSPNFKFV  164
            IL+TGAAGFIASHV NRL+++YP YKIV++DKL YCSNLKNL PS+SSPN KF+
Sbjct  10   ILLTGAAGFIASHVCNRLIQNYPGYKIVVLDKLDYCSNLKNLNPSKSSPNLKFI  63



>ref|XP_004138882.1| PREDICTED: probable rhamnose biosynthetic enzyme 1-like [Cucumis 
sativus]
 gb|KGN62859.1| hypothetical protein Csa_2G377950 [Cucumis sativus]
Length=668

 Score = 93.2 bits (230),  Expect = 2e-20, Method: Composition-based stats.
 Identities = 40/54 (74%), Positives = 50/54 (93%), Gaps = 0/54 (0%)
 Frame = +3

Query  3    ILITGAAGFIASHVANRLVRSYPNYKIVIVDKLXYCSNLKNLLPSRSSPNFKFV  164
            ILITGAAGFIASHV NRL+++YP+YKIV +DKL YCSN+KNL PS++SPNF+F+
Sbjct  14   ILITGAAGFIASHVTNRLIKNYPHYKIVALDKLDYCSNIKNLGPSQTSPNFRFI  67



>gb|ACG33666.1| RHM1 [Zea mays]
Length=666

 Score = 92.8 bits (229),  Expect = 4e-20, Method: Composition-based stats.
 Identities = 42/54 (78%), Positives = 48/54 (89%), Gaps = 0/54 (0%)
 Frame = +3

Query  3    ILITGAAGFIASHVANRLVRSYPNYKIVIVDKLXYCSNLKNLLPSRSSPNFKFV  164
            ILITGAAGFIASHVA R+ + YP+YKI+++DKL YCSNLKNLLP  SSPNFKFV
Sbjct  10   ILITGAAGFIASHVAIRITKKYPDYKIIVLDKLDYCSNLKNLLPVSSSPNFKFV  63



>ref|NP_001130297.1| uncharacterized protein LOC100191391 [Zea mays]
 gb|ACF78472.1| unknown [Zea mays]
 gb|AFW77498.1| RHM1 [Zea mays]
Length=676

 Score = 92.8 bits (229),  Expect = 4e-20, Method: Composition-based stats.
 Identities = 42/54 (78%), Positives = 48/54 (89%), Gaps = 0/54 (0%)
 Frame = +3

Query  3    ILITGAAGFIASHVANRLVRSYPNYKIVIVDKLXYCSNLKNLLPSRSSPNFKFV  164
            ILITGAAGFIASHVA R+ + YP+YKI+++DKL YCSNLKNLLP  SSPNFKFV
Sbjct  20   ILITGAAGFIASHVAIRITKKYPDYKIIVLDKLDYCSNLKNLLPVSSSPNFKFV  73



>ref|XP_007225132.1| hypothetical protein PRUPE_ppa002547mg [Prunus persica]
 gb|EMJ26331.1| hypothetical protein PRUPE_ppa002547mg [Prunus persica]
Length=660

 Score = 92.8 bits (229),  Expect = 4e-20, Method: Composition-based stats.
 Identities = 41/54 (76%), Positives = 48/54 (89%), Gaps = 0/54 (0%)
 Frame = +3

Query  3    ILITGAAGFIASHVANRLVRSYPNYKIVIVDKLXYCSNLKNLLPSRSSPNFKFV  164
            ILITGAAGFI SHV NRL+++YP+YKIV +DKL YCS+ KNL PSR+SPNFKFV
Sbjct  13   ILITGAAGFIGSHVTNRLIKNYPSYKIVALDKLDYCSSFKNLRPSRASPNFKFV  66



>ref|XP_008654228.1| PREDICTED: probable rhamnose biosynthetic enzyme 1 [Zea mays]
 ref|XP_008654237.1| PREDICTED: probable rhamnose biosynthetic enzyme 1 [Zea mays]
 ref|XP_008654239.1| PREDICTED: probable rhamnose biosynthetic enzyme 1 [Zea mays]
 ref|XP_008654245.1| PREDICTED: probable rhamnose biosynthetic enzyme 1 [Zea mays]
 tpg|DAA44692.1| TPA: hypothetical protein ZEAMMB73_493445 [Zea mays]
 tpg|DAA44693.1| TPA: hypothetical protein ZEAMMB73_493445 [Zea mays]
 tpg|DAA44694.1| TPA: hypothetical protein ZEAMMB73_493445 [Zea mays]
Length=672

 Score = 92.8 bits (229),  Expect = 4e-20, Method: Composition-based stats.
 Identities = 43/54 (80%), Positives = 49/54 (91%), Gaps = 0/54 (0%)
 Frame = +3

Query  3    ILITGAAGFIASHVANRLVRSYPNYKIVIVDKLXYCSNLKNLLPSRSSPNFKFV  164
            ILITGAAGFIASHV N LVR+YP+YKIV++DKL YCS+LKNL PSR+SPN KFV
Sbjct  9    ILITGAAGFIASHVTNCLVRNYPHYKIVVLDKLDYCSSLKNLNPSRASPNLKFV  62



>emb|CDP18722.1| unnamed protein product [Coffea canephora]
Length=676

 Score = 92.4 bits (228),  Expect = 6e-20, Method: Compositional matrix adjust.
 Identities = 44/54 (81%), Positives = 48/54 (89%), Gaps = 0/54 (0%)
 Frame = +3

Query  3    ILITGAAGFIASHVANRLVRSYPNYKIVIVDKLXYCSNLKNLLPSRSSPNFKFV  164
            ILITGAAGFIA HVANRL+R+YP YKIV++DKL YCSN KNL PS SSPNFKFV
Sbjct  9    ILITGAAGFIACHVANRLIRNYPRYKIVVLDKLDYCSNKKNLDPSCSSPNFKFV  62



>ref|XP_002271970.1| PREDICTED: trifunctional UDP-glucose 4,6-dehydratase/UDP-4-keto-6-deoxy-D-glucose 
3,5-epimerase/UDP-4-keto-L-rhamnose-reductase 
RHM1 [Vitis vinifera]
 ref|XP_010648843.1| PREDICTED: trifunctional UDP-glucose 4,6-dehydratase/UDP-4-keto-6-deoxy-D-glucose 
3,5-epimerase/UDP-4-keto-L-rhamnose-reductase 
RHM1 [Vitis vinifera]
Length=657

 Score = 92.0 bits (227),  Expect = 6e-20, Method: Composition-based stats.
 Identities = 42/54 (78%), Positives = 49/54 (91%), Gaps = 0/54 (0%)
 Frame = +3

Query  3    ILITGAAGFIASHVANRLVRSYPNYKIVIVDKLXYCSNLKNLLPSRSSPNFKFV  164
            ILITGAAGFIASHV NRLV+++P+Y+IV +DKL YCSN+KNL PSRSS NFKFV
Sbjct  13   ILITGAAGFIASHVTNRLVKNHPDYRIVALDKLDYCSNVKNLGPSRSSSNFKFV  66



>emb|CAN62061.1| hypothetical protein VITISV_001928 [Vitis vinifera]
Length=619

 Score = 91.7 bits (226),  Expect = 7e-20, Method: Composition-based stats.
 Identities = 42/54 (78%), Positives = 49/54 (91%), Gaps = 0/54 (0%)
 Frame = +3

Query  3    ILITGAAGFIASHVANRLVRSYPNYKIVIVDKLXYCSNLKNLLPSRSSPNFKFV  164
            ILITGAAGFIASHV NRLV+++P+Y+IV +DKL YCSN+KNL PSRSS NFKFV
Sbjct  13   ILITGAAGFIASHVTNRLVKNHPDYRIVALDKLDYCSNVKNLGPSRSSSNFKFV  66



>ref|XP_008393937.1| PREDICTED: probable rhamnose biosynthetic enzyme 1 [Malus domestica]
Length=660

 Score = 91.7 bits (226),  Expect = 1e-19, Method: Composition-based stats.
 Identities = 40/54 (74%), Positives = 47/54 (87%), Gaps = 0/54 (0%)
 Frame = +3

Query  3    ILITGAAGFIASHVANRLVRSYPNYKIVIVDKLXYCSNLKNLLPSRSSPNFKFV  164
            ILITGAAGFI SHV NRL+++YP+YKIV +DK+ YCS+ KNL P RSSPNFKFV
Sbjct  13   ILITGAAGFIGSHVTNRLIKNYPSYKIVALDKIDYCSSFKNLRPCRSSPNFKFV  66



>ref|XP_009356708.1| PREDICTED: probable rhamnose biosynthetic enzyme 2 [Pyrus x bretschneideri]
Length=689

 Score = 91.7 bits (226),  Expect = 1e-19, Method: Composition-based stats.
 Identities = 41/54 (76%), Positives = 48/54 (89%), Gaps = 0/54 (0%)
 Frame = +3

Query  3    ILITGAAGFIASHVANRLVRSYPNYKIVIVDKLXYCSNLKNLLPSRSSPNFKFV  164
            IL+TGAAGFIASHV NRL+R+YP+Y IV++DKL YCSNLKNL PS SS NFKF+
Sbjct  10   ILLTGAAGFIASHVCNRLIRNYPDYNIVVLDKLDYCSNLKNLHPSMSSANFKFI  63



>ref|XP_006450198.1| hypothetical protein CICLE_v10010306mg [Citrus clementina]
 gb|ESR63438.1| hypothetical protein CICLE_v10010306mg [Citrus clementina]
Length=661

 Score = 91.3 bits (225),  Expect = 1e-19, Method: Composition-based stats.
 Identities = 40/54 (74%), Positives = 49/54 (91%), Gaps = 0/54 (0%)
 Frame = +3

Query  3    ILITGAAGFIASHVANRLVRSYPNYKIVIVDKLXYCSNLKNLLPSRSSPNFKFV  164
            ILITGAAGFI SHV NRL+++YP+Y+IV +DKL YCS+LKNL PSR+SPNFKF+
Sbjct  15   ILITGAAGFIGSHVTNRLIKNYPDYEIVALDKLDYCSSLKNLHPSRASPNFKFL  68



>ref|XP_006483733.1| PREDICTED: probable rhamnose biosynthetic enzyme 1-like [Citrus 
sinensis]
Length=681

 Score = 91.3 bits (225),  Expect = 1e-19, Method: Composition-based stats.
 Identities = 40/54 (74%), Positives = 49/54 (91%), Gaps = 0/54 (0%)
 Frame = +3

Query  3    ILITGAAGFIASHVANRLVRSYPNYKIVIVDKLXYCSNLKNLLPSRSSPNFKFV  164
            ILITGAAGFI SHV NRL+++YP+Y+IV +DKL YCS+LKNL PSR+SPNFKF+
Sbjct  35   ILITGAAGFIGSHVTNRLIKNYPDYEIVALDKLDYCSSLKNLHPSRASPNFKFL  88



>ref|XP_009363628.1| PREDICTED: probable rhamnose biosynthetic enzyme 1 [Pyrus x bretschneideri]
 ref|XP_009367987.1| PREDICTED: probable rhamnose biosynthetic enzyme 1 [Pyrus x bretschneideri]
Length=660

 Score = 91.3 bits (225),  Expect = 1e-19, Method: Composition-based stats.
 Identities = 40/54 (74%), Positives = 47/54 (87%), Gaps = 0/54 (0%)
 Frame = +3

Query  3    ILITGAAGFIASHVANRLVRSYPNYKIVIVDKLXYCSNLKNLLPSRSSPNFKFV  164
            ILITGAAGFI SHV NRL+++YP+YKIV +DK+ YCS+ KNL P RSSPNFKFV
Sbjct  13   ILITGAAGFIGSHVTNRLIKNYPSYKIVALDKIDYCSSFKNLRPCRSSPNFKFV  66



>gb|KDO67325.1| hypothetical protein CISIN_1g035631mg [Citrus sinensis]
Length=684

 Score = 91.3 bits (225),  Expect = 1e-19, Method: Composition-based stats.
 Identities = 40/54 (74%), Positives = 49/54 (91%), Gaps = 0/54 (0%)
 Frame = +3

Query  3    ILITGAAGFIASHVANRLVRSYPNYKIVIVDKLXYCSNLKNLLPSRSSPNFKFV  164
            ILITGAAGFI SHV NRL+++YP+Y+IV +DKL YCS+LKNL PSR+SPNFKF+
Sbjct  15   ILITGAAGFIGSHVTNRLIKNYPDYEIVALDKLDYCSSLKNLHPSRASPNFKFL  68



>ref|XP_011031381.1| PREDICTED: trifunctional UDP-glucose 4,6-dehydratase/UDP-4-keto-6-deoxy-D-glucose 
3,5-epimerase/UDP-4-keto-L-rhamnose-reductase 
RHM1-like [Populus euphratica]
Length=660

 Score = 90.9 bits (224),  Expect = 2e-19, Method: Composition-based stats.
 Identities = 41/54 (76%), Positives = 45/54 (83%), Gaps = 0/54 (0%)
 Frame = +3

Query  3    ILITGAAGFIASHVANRLVRSYPNYKIVIVDKLXYCSNLKNLLPSRSSPNFKFV  164
            ILITGAAGFIASHV  RL++ YP+YKIV +DKL YCSNLKNL   R SPNFKFV
Sbjct  13   ILITGAAGFIASHVTRRLIKDYPDYKIVALDKLDYCSNLKNLAKCRGSPNFKFV  66



>ref|XP_006382137.1| hypothetical protein POPTR_0006s28750g [Populus trichocarpa]
 gb|ERP59934.1| hypothetical protein POPTR_0006s28750g [Populus trichocarpa]
Length=660

 Score = 90.1 bits (222),  Expect = 3e-19, Method: Composition-based stats.
 Identities = 41/54 (76%), Positives = 45/54 (83%), Gaps = 0/54 (0%)
 Frame = +3

Query  3    ILITGAAGFIASHVANRLVRSYPNYKIVIVDKLXYCSNLKNLLPSRSSPNFKFV  164
            ILITGAAGFIASHV  RL++ YP+YKIV +DKL YCSNLKNL   R SPNFKFV
Sbjct  13   ILITGAAGFIASHVIRRLIKDYPDYKIVALDKLDYCSNLKNLATCRGSPNFKFV  66



>ref|XP_008351771.1| PREDICTED: LOW QUALITY PROTEIN: probable rhamnose biosynthetic 
enzyme 1, partial [Malus domestica]
Length=340

 Score = 87.4 bits (215),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 39/54 (72%), Positives = 46/54 (85%), Gaps = 0/54 (0%)
 Frame = +3

Query  3    ILITGAAGFIASHVANRLVRSYPNYKIVIVDKLXYCSNLKNLLPSRSSPNFKFV  164
            ILITGAAGFI  HV N+L+R+YP YKI+++DKL YCSNLKNL PS SSPN KF+
Sbjct  1    ILITGAAGFIGXHVVNQLMRNYPEYKILVLDKLDYCSNLKNLHPSHSSPNLKFI  54



>ref|XP_003566438.1| PREDICTED: probable rhamnose biosynthetic enzyme 2 [Brachypodium 
distachyon]
Length=370

 Score = 87.4 bits (215),  Expect = 6e-19, Method: Composition-based stats.
 Identities = 39/54 (72%), Positives = 47/54 (87%), Gaps = 0/54 (0%)
 Frame = +3

Query  3    ILITGAAGFIASHVANRLVRSYPNYKIVIVDKLXYCSNLKNLLPSRSSPNFKFV  164
            ILITGAAGFIASHVANRLVR YP Y+I+ +DKL YC++L NL P+ +SPNF+FV
Sbjct  23   ILITGAAGFIASHVANRLVRDYPWYRILALDKLDYCASLNNLAPALASPNFRFV  76



>ref|XP_008220004.1| PREDICTED: probable rhamnose biosynthetic enzyme 1 [Prunus mume]
Length=660

 Score = 89.4 bits (220),  Expect = 7e-19, Method: Composition-based stats.
 Identities = 39/54 (72%), Positives = 47/54 (87%), Gaps = 0/54 (0%)
 Frame = +3

Query  3    ILITGAAGFIASHVANRLVRSYPNYKIVIVDKLXYCSNLKNLLPSRSSPNFKFV  164
            ILITGAAGFI SHV N+L+++YP+Y IV +DKL YCS+ KNL PSR+SPNFKFV
Sbjct  13   ILITGAAGFIGSHVTNQLIKNYPSYNIVALDKLDYCSSFKNLRPSRASPNFKFV  66



>ref|XP_009803668.1| PREDICTED: probable rhamnose biosynthetic enzyme 1 [Nicotiana 
sylvestris]
Length=653

 Score = 89.0 bits (219),  Expect = 8e-19, Method: Composition-based stats.
 Identities = 41/54 (76%), Positives = 46/54 (85%), Gaps = 0/54 (0%)
 Frame = +3

Query  3    ILITGAAGFIASHVANRLVRSYPNYKIVIVDKLXYCSNLKNLLPSRSSPNFKFV  164
            ILITGAAGFI SHV NRL + YP+Y+IV +DKL YCS+LKNL PS SSPNFKFV
Sbjct  12   ILITGAAGFIPSHVTNRLTKLYPDYRIVALDKLDYCSSLKNLEPSYSSPNFKFV  65



>ref|XP_009586858.1| PREDICTED: probable rhamnose biosynthetic enzyme 1 [Nicotiana 
tomentosiformis]
 ref|XP_009586859.1| PREDICTED: probable rhamnose biosynthetic enzyme 1 [Nicotiana 
tomentosiformis]
 ref|XP_009586860.1| PREDICTED: probable rhamnose biosynthetic enzyme 1 [Nicotiana 
tomentosiformis]
Length=653

 Score = 89.0 bits (219),  Expect = 8e-19, Method: Composition-based stats.
 Identities = 41/54 (76%), Positives = 46/54 (85%), Gaps = 0/54 (0%)
 Frame = +3

Query  3    ILITGAAGFIASHVANRLVRSYPNYKIVIVDKLXYCSNLKNLLPSRSSPNFKFV  164
            ILITGAAGFI SHV NRL + YP+Y+IV +DKL YCS+LKNL PS SSPNFKFV
Sbjct  12   ILITGAAGFIPSHVTNRLTKLYPDYRIVALDKLDYCSSLKNLEPSYSSPNFKFV  65



>gb|KHM99622.1| Putative rhamnose biosynthetic enzyme 1 [Glycine soja]
Length=582

 Score = 87.8 bits (216),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 40/54 (74%), Positives = 49/54 (91%), Gaps = 0/54 (0%)
 Frame = +3

Query  3    ILITGAAGFIASHVANRLVRSYPNYKIVIVDKLXYCSNLKNLLPSRSSPNFKFV  164
            ILITGAAGFIASHV NR+V++YP+YKI+++DKL YCSNLKNL+   SSPNFKF+
Sbjct  10   ILITGAAGFIASHVCNRIVQNYPDYKIIVLDKLDYCSNLKNLIHLCSSPNFKFI  63



>ref|XP_006355193.1| PREDICTED: probable rhamnose biosynthetic enzyme 1-like [Solanum 
tuberosum]
Length=654

 Score = 87.8 bits (216),  Expect = 2e-18, Method: Composition-based stats.
 Identities = 40/54 (74%), Positives = 45/54 (83%), Gaps = 0/54 (0%)
 Frame = +3

Query  3    ILITGAAGFIASHVANRLVRSYPNYKIVIVDKLXYCSNLKNLLPSRSSPNFKFV  164
            +LITGAAGFI SHV NRL + YPNY+IV +DKL YCS+LKNL PS S PNFKFV
Sbjct  13   VLITGAAGFIPSHVTNRLTKLYPNYRIVALDKLDYCSSLKNLEPSYSCPNFKFV  66



>ref|XP_010325193.1| PREDICTED: probable rhamnose biosynthetic enzyme 1 [Solanum lycopersicum]
Length=651

 Score = 87.8 bits (216),  Expect = 2e-18, Method: Composition-based stats.
 Identities = 40/54 (74%), Positives = 45/54 (83%), Gaps = 0/54 (0%)
 Frame = +3

Query  3    ILITGAAGFIASHVANRLVRSYPNYKIVIVDKLXYCSNLKNLLPSRSSPNFKFV  164
            +LITGAAGFI SHV NRL + YPNY+IV +DKL YCS+LKNL PS S PNFKFV
Sbjct  13   VLITGAAGFIPSHVTNRLTKLYPNYRIVALDKLDYCSSLKNLEPSYSCPNFKFV  66



>ref|XP_011082935.1| PREDICTED: trifunctional UDP-glucose 4,6-dehydratase/UDP-4-keto-6-deoxy-D-glucose 
3,5-epimerase/UDP-4-keto-L-rhamnose-reductase 
RHM2-like [Sesamum indicum]
Length=384

 Score = 86.3 bits (212),  Expect = 2e-18, Method: Composition-based stats.
 Identities = 40/54 (74%), Positives = 46/54 (85%), Gaps = 0/54 (0%)
 Frame = +3

Query  3    ILITGAAGFIASHVANRLVRSYPNYKIVIVDKLXYCSNLKNLLPSRSSPNFKFV  164
            ILITGAAGFIASHVAN L R+Y  Y+I+++DKL YCSNLKNL PS+S  NFKFV
Sbjct  9    ILITGAAGFIASHVANWLTRNYSEYRIIVLDKLDYCSNLKNLDPSQSHHNFKFV  62



>ref|XP_007011619.1| Rhamnose biosynthesis 1 [Theobroma cacao]
 gb|EOY29238.1| Rhamnose biosynthesis 1 [Theobroma cacao]
Length=659

 Score = 87.4 bits (215),  Expect = 2e-18, Method: Composition-based stats.
 Identities = 41/54 (76%), Positives = 46/54 (85%), Gaps = 0/54 (0%)
 Frame = +3

Query  3    ILITGAAGFIASHVANRLVRSYPNYKIVIVDKLXYCSNLKNLLPSRSSPNFKFV  164
            ILITGAAGFIASHV +RL+ +YP YKIV +DKL YCS+LKNL P  SSPNFKFV
Sbjct  13   ILITGAAGFIASHVTSRLINNYPEYKIVALDKLDYCSSLKNLQPCFSSPNFKFV  66



>gb|AFW66842.1| hypothetical protein ZEAMMB73_620875 [Zea mays]
Length=407

 Score = 83.6 bits (205),  Expect = 2e-17, Method: Composition-based stats.
 Identities = 41/56 (73%), Positives = 45/56 (80%), Gaps = 2/56 (4%)
 Frame = +3

Query  3    ILITGAAGFIASHVANRLVRSYPNYKIVIVDKLXYCSNLKNLLPSRSS--PNFKFV  164
            ILITGAAGFIASHVA R+V  YP YK+V++DKL YCSNLKNLLP   S   NFKFV
Sbjct  12   ILITGAAGFIASHVAIRIVNRYPEYKVVVLDKLDYCSNLKNLLPVMGSGGNNFKFV  67



>gb|EYU29575.1| hypothetical protein MIMGU_mgv1a008395mg [Erythranthe guttata]
Length=375

 Score = 82.0 bits (201),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 40/54 (74%), Positives = 44/54 (81%), Gaps = 0/54 (0%)
 Frame = +3

Query  3    ILITGAAGFIASHVANRLVRSYPNYKIVIVDKLXYCSNLKNLLPSRSSPNFKFV  164
            ILITG AGFIASHV+N L R+Y  Y IV++DKL YCSNLKNL  SRS PNFKFV
Sbjct  9    ILITGGAGFIASHVSNWLTRNYSQYIIVVLDKLDYCSNLKNLDSSRSFPNFKFV  62



>ref|XP_003545554.1| PREDICTED: probable rhamnose biosynthetic enzyme 1-like [Glycine 
max]
 gb|KHN14574.1| Putative rhamnose biosynthetic enzyme 1 [Glycine soja]
Length=655

 Score = 83.6 bits (205),  Expect = 7e-17, Method: Composition-based stats.
 Identities = 38/54 (70%), Positives = 43/54 (80%), Gaps = 0/54 (0%)
 Frame = +3

Query  3    ILITGAAGFIASHVANRLVRSYPNYKIVIVDKLXYCSNLKNLLPSRSSPNFKFV  164
            ILITGAAGFIASHV  RL+ SYP+YKIV +DK+ YCS  KNL    SSPNFKF+
Sbjct  7    ILITGAAGFIASHVTTRLIDSYPSYKIVALDKVDYCSTFKNLQSCASSPNFKFI  60



>ref|NP_001054887.1| Os05g0203400 [Oryza sativa Japonica Group]
 gb|AAT44327.1| hypothetical protein, contains NAD-dependent epimerase/dehydratase 
domain [Oryza sativa Japonica Group]
 gb|AAT85110.1| hypothetical protein [Oryza sativa Japonica Group]
 dbj|BAF16801.1| Os05g0203400 [Oryza sativa Japonica Group]
 gb|EAY96901.1| hypothetical protein OsI_18823 [Oryza sativa Indica Group]
 gb|EEE62680.1| hypothetical protein OsJ_17483 [Oryza sativa Japonica Group]
Length=200

 Score = 79.0 bits (193),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 37/55 (67%), Positives = 46/55 (84%), Gaps = 1/55 (2%)
 Frame = +3

Query  3    ILITGAAGFIASHVANRLVRSYPNYKIVIVDKL-XYCSNLKNLLPSRSSPNFKFV  164
            ILITGAAGFIASHVANRL+R +P+Y++V +DKL  YC+ L NL P+ +SPNF FV
Sbjct  26   ILITGAAGFIASHVANRLLRDHPSYRVVALDKLDDYCATLNNLAPAMASPNFAFV  80



>ref|XP_004498563.1| PREDICTED: probable rhamnose biosynthetic enzyme 1-like isoform 
X1 [Cicer arietinum]
 ref|XP_004498564.1| PREDICTED: probable rhamnose biosynthetic enzyme 1-like isoform 
X2 [Cicer arietinum]
Length=655

 Score = 80.5 bits (197),  Expect = 8e-16, Method: Composition-based stats.
 Identities = 37/54 (69%), Positives = 41/54 (76%), Gaps = 0/54 (0%)
 Frame = +3

Query  3    ILITGAAGFIASHVANRLVRSYPNYKIVIVDKLXYCSNLKNLLPSRSSPNFKFV  164
            ILITGAAGFIASHV  RL+  YP+YKIV +DKL YCS  KNL P  SS  FKF+
Sbjct  7    ILITGAAGFIASHVTKRLINKYPSYKIVALDKLDYCSTFKNLEPCTSSQKFKFI  60



>ref|XP_004292875.1| PREDICTED: trifunctional UDP-glucose 4,6-dehydratase/UDP-4-keto-6-deoxy-D-glucose 
3,5-epimerase/UDP-4-keto-L-rhamnose-reductase 
RHM2-like [Fragaria vesca subsp. vesca]
 ref|XP_011459027.1| PREDICTED: trifunctional UDP-glucose 4,6-dehydratase/UDP-4-keto-6-deoxy-D-glucose 
3,5-epimerase/UDP-4-keto-L-rhamnose-reductase 
RHM2-like [Fragaria vesca subsp. vesca]
Length=660

 Score = 79.7 bits (195),  Expect = 1e-15, Method: Composition-based stats.
 Identities = 35/54 (65%), Positives = 44/54 (81%), Gaps = 0/54 (0%)
 Frame = +3

Query  3    ILITGAAGFIASHVANRLVRSYPNYKIVIVDKLXYCSNLKNLLPSRSSPNFKFV  164
            ILITGAAGFI SHV +RL+++YPNY IV +DKL YCS+ KNL   ++S NFKF+
Sbjct  13   ILITGAAGFIGSHVTSRLIKNYPNYNIVALDKLDYCSSFKNLHACKASHNFKFI  66



>ref|XP_007161328.1| hypothetical protein PHAVU_001G060400g [Phaseolus vulgaris]
 gb|ESW33322.1| hypothetical protein PHAVU_001G060400g [Phaseolus vulgaris]
Length=655

 Score = 79.7 bits (195),  Expect = 1e-15, Method: Composition-based stats.
 Identities = 36/54 (67%), Positives = 42/54 (78%), Gaps = 0/54 (0%)
 Frame = +3

Query  3    ILITGAAGFIASHVANRLVRSYPNYKIVIVDKLXYCSNLKNLLPSRSSPNFKFV  164
            ILITGAAGFIASHV  +L+  YP+YKIV +DKL YCS  +NL    SSPNFKF+
Sbjct  7    ILITGAAGFIASHVTTKLINKYPSYKIVALDKLDYCSTFRNLKSCISSPNFKFI  60



>ref|XP_003588651.1| Rhamnose synthase [Medicago truncatula]
 gb|AES58902.1| rhamnose biosynthetic-like enzyme [Medicago truncatula]
Length=655

 Score = 79.7 bits (195),  Expect = 1e-15, Method: Composition-based stats.
 Identities = 36/54 (67%), Positives = 41/54 (76%), Gaps = 0/54 (0%)
 Frame = +3

Query  3    ILITGAAGFIASHVANRLVRSYPNYKIVIVDKLXYCSNLKNLLPSRSSPNFKFV  164
            ILITGAAGFIASHV  R++  YP+YKIV +DKL YCS  KNL    SSP FKF+
Sbjct  7    ILITGAAGFIASHVTTRIINKYPSYKIVALDKLDYCSTFKNLQSCTSSPKFKFI  60



>ref|XP_004256510.1| DTDP-glucose 4,6-dehydratase, putative [Entamoeba invadens IP1]
 gb|ELP89739.1| DTDP-glucose 4,6-dehydratase, putative [Entamoeba invadens IP1]
Length=342

 Score = 75.9 bits (185),  Expect = 7e-15, Method: Composition-based stats.
 Identities = 35/53 (66%), Positives = 40/53 (75%), Gaps = 0/53 (0%)
 Frame = +3

Query  3    ILITGAAGFIASHVANRLVRSYPNYKIVIVDKLXYCSNLKNLLPSRSSPNFKF  161
            ILITG AGFIASHV    V  YP YKIV+VDKL YC++LKNL   + +PNFKF
Sbjct  8    ILITGGAGFIASHVVIHFVTQYPQYKIVVVDKLDYCASLKNLDAVKGAPNFKF  60



>ref|XP_003057320.1| predicted protein [Micromonas pusilla CCMP1545]
 gb|EEH58965.1| predicted protein [Micromonas pusilla CCMP1545]
Length=691

 Score = 77.0 bits (188),  Expect = 1e-14, Method: Composition-based stats.
 Identities = 34/54 (63%), Positives = 40/54 (74%), Gaps = 0/54 (0%)
 Frame = +3

Query  3    ILITGAAGFIASHVANRLVRSYPNYKIVIVDKLXYCSNLKNLLPSRSSPNFKFV  164
            +LITG AGFIASHVA R  + YP Y +V+VDKL YC+NL NL    + PNFKFV
Sbjct  28   VLITGGAGFIASHVALRFAKRYPRYNVVVVDKLDYCANLNNLREIAALPNFKFV  81



>ref|XP_011401232.1| DEAD-box ATP-dependent RNA helicase 20 [Auxenochlorella protothecoides]
 gb|KFM28219.1| DEAD-box ATP-dependent RNA helicase 20 [Auxenochlorella protothecoides]
Length=746

 Score = 76.6 bits (187),  Expect = 2e-14, Method: Composition-based stats.
 Identities = 34/54 (63%), Positives = 42/54 (78%), Gaps = 0/54 (0%)
 Frame = +3

Query  3    ILITGAAGFIASHVANRLVRSYPNYKIVIVDKLXYCSNLKNLLPSRSSPNFKFV  164
            ILITG AGFIASHV  +LV+ YP+ K+V++DKL YC+ L+NL   R  PNFKFV
Sbjct  402  ILITGGAGFIASHVTIKLVKRYPHVKVVVLDKLDYCATLENLKSIRDCPNFKFV  455



>ref|XP_001701714.1| NAD-dependent epimerase/dehydratase [Chlamydomonas reinhardtii]
 gb|EDP06689.1| NAD-dependent epimerase/dehydratase [Chlamydomonas reinhardtii]
Length=328

 Score = 73.9 bits (180),  Expect = 4e-14, Method: Composition-based stats.
 Identities = 32/54 (59%), Positives = 43/54 (80%), Gaps = 0/54 (0%)
 Frame = +3

Query  3    ILITGAAGFIASHVANRLVRSYPNYKIVIVDKLXYCSNLKNLLPSRSSPNFKFV  164
            ILITG AGFIASHV  R+ ++YP YK+V++DKL YC++LKNL    + PNF+F+
Sbjct  20   ILITGGAGFIASHVVIRITKNYPQYKVVVLDKLDYCASLKNLGSVANLPNFRFI  73



>ref|XP_003551160.1| PREDICTED: probable rhamnose biosynthetic enzyme 1-like [Glycine 
max]
Length=655

 Score = 75.1 bits (183),  Expect = 5e-14, Method: Composition-based stats.
 Identities = 37/54 (69%), Positives = 41/54 (76%), Gaps = 0/54 (0%)
 Frame = +3

Query  3    ILITGAAGFIASHVANRLVRSYPNYKIVIVDKLXYCSNLKNLLPSRSSPNFKFV  164
            ILITGAAGFIASHV  RL+  YP+YKIV +DKL YCS  KNLL   SS  FKF+
Sbjct  7    ILITGAAGFIASHVTTRLIDRYPSYKIVALDKLDYCSTFKNLLSCSSSSKFKFI  60



>gb|KHN30780.1| Putative rhamnose biosynthetic enzyme 1 [Glycine soja]
Length=655

 Score = 75.1 bits (183),  Expect = 6e-14, Method: Composition-based stats.
 Identities = 37/54 (69%), Positives = 41/54 (76%), Gaps = 0/54 (0%)
 Frame = +3

Query  3    ILITGAAGFIASHVANRLVRSYPNYKIVIVDKLXYCSNLKNLLPSRSSPNFKFV  164
            ILITGAAGFIASHV  RL+  YP+YKIV +DKL YCS  KNLL   SS  FKF+
Sbjct  7    ILITGAAGFIASHVTTRLIDRYPSYKIVALDKLDYCSTFKNLLSCSSSSKFKFI  60



>ref|XP_005535008.1| dTDP-glucose 4,6-dehydratase [Cyanidioschyzon merolae strain 
10D]
 ref|XP_005536685.1| dTDP-glucose 4,6-dehydratase [Cyanidioschyzon merolae strain 
10D]
 ref|XP_005537980.1| dTDP-glucose 4,6-dehydratase [Cyanidioschyzon merolae strain 
10D]
 dbj|BAM80401.1| dTDP-glucose 4,6-dehydratase [Cyanidioschyzon merolae strain 
10D]
 dbj|BAM80649.1| dTDP-glucose 4,6-dehydratase [Cyanidioschyzon merolae strain 
10D]
 dbj|BAM81944.1| dTDP-glucose 4,6-dehydratase [Cyanidioschyzon merolae strain 
10D]
Length=376

 Score = 73.9 bits (180),  Expect = 7e-14, Method: Compositional matrix adjust.
 Identities = 32/54 (59%), Positives = 41/54 (76%), Gaps = 0/54 (0%)
 Frame = +3

Query  3    ILITGAAGFIASHVANRLVRSYPNYKIVIVDKLXYCSNLKNLLPSRSSPNFKFV  164
            IL+TG AGFIASHV  RLV  YP+Y++ ++DKL YCS+L NL    + PNFKF+
Sbjct  41   ILVTGGAGFIASHVVERLVSRYPHYRVTVLDKLDYCSSLSNLAQVANRPNFKFI  94



>ref|XP_005537192.1| dTDP-glucose 4,6-dehydratase [Cyanidioschyzon merolae strain 
10D]
 dbj|BAM81156.1| dTDP-glucose 4,6-dehydratase [Cyanidioschyzon merolae strain 
10D]
Length=376

 Score = 73.6 bits (179),  Expect = 7e-14, Method: Compositional matrix adjust.
 Identities = 32/54 (59%), Positives = 41/54 (76%), Gaps = 0/54 (0%)
 Frame = +3

Query  3    ILITGAAGFIASHVANRLVRSYPNYKIVIVDKLXYCSNLKNLLPSRSSPNFKFV  164
            IL+TG AGFIASHV  RLV  YP+Y++ ++DKL YCS+L NL    + PNFKF+
Sbjct  41   ILVTGGAGFIASHVVERLVSRYPHYRVTVLDKLDYCSSLSNLAQVANRPNFKFI  94



>ref|XP_005536953.1| dTDP-glucose 4,6-dehydratase [Cyanidioschyzon merolae strain 
10D]
 dbj|BAM80917.1| dTDP-glucose 4,6-dehydratase [Cyanidioschyzon merolae strain 
10D]
Length=376

 Score = 73.6 bits (179),  Expect = 7e-14, Method: Compositional matrix adjust.
 Identities = 32/54 (59%), Positives = 41/54 (76%), Gaps = 0/54 (0%)
 Frame = +3

Query  3    ILITGAAGFIASHVANRLVRSYPNYKIVIVDKLXYCSNLKNLLPSRSSPNFKFV  164
            IL+TG AGFIASHV  RLV  YP+Y++ ++DKL YCS+L NL    + PNFKF+
Sbjct  41   ILVTGGAGFIASHVVERLVSRYPHYRVTVLDKLDYCSSLSNLAQVANRPNFKFI  94



>ref|WP_039452843.1| dTDP-glucose 4,6-dehydratase [Pedobacter glucosidilyticus]
 gb|KHJ37545.1| dTDP-glucose 4,6-dehydratase [Pedobacter glucosidilyticus]
Length=351

 Score = 73.6 bits (179),  Expect = 7e-14, Method: Composition-based stats.
 Identities = 33/54 (61%), Positives = 39/54 (72%), Gaps = 0/54 (0%)
 Frame = +3

Query  3    ILITGAAGFIASHVANRLVRSYPNYKIVIVDKLXYCSNLKNLLPSRSSPNFKFV  164
            ILITG AGFI SHV  R V +YPNY+IV +DKL Y  NL+NL     +PN+KFV
Sbjct  4    ILITGGAGFIGSHVVRRFVNTYPNYQIVNLDKLTYAGNLENLRDVEQAPNYKFV  57



>gb|AGE59831.1| GDP-L-fucose synthase 2 [Acanthocystis turfacea Chlorella virus 
TN603.4.2]
Length=347

 Score = 73.2 bits (178),  Expect = 8e-14, Method: Composition-based stats.
 Identities = 30/54 (56%), Positives = 39/54 (72%), Gaps = 0/54 (0%)
 Frame = +3

Query  3    ILITGAAGFIASHVANRLVRSYPNYKIVIVDKLXYCSNLKNLLPSRSSPNFKFV  164
            +L+TG AGFI SHV  +LV  YP  K+V++DK+ YC+ L NL   R +PNFKFV
Sbjct  8    VLVTGGAGFIGSHVVMKLVHRYPECKVVVIDKMDYCATLNNLATVRDAPNFKFV  61



>ref|WP_026904621.1| dTDP-glucose 4,6-dehydratase [Pedobacter glucosidilyticus]
Length=351

 Score = 73.2 bits (178),  Expect = 1e-13, Method: Composition-based stats.
 Identities = 33/54 (61%), Positives = 39/54 (72%), Gaps = 0/54 (0%)
 Frame = +3

Query  3    ILITGAAGFIASHVANRLVRSYPNYKIVIVDKLXYCSNLKNLLPSRSSPNFKFV  164
            ILITG AGFI SHV  R V +YPNY+IV +DKL Y  NL+NL     +PN+KFV
Sbjct  4    ILITGGAGFIGSHVVRRFVNTYPNYQIVNLDKLTYAGNLENLRDVEQAPNYKFV  57



>gb|AGE56705.1| GDP-L-fucose synthase 2 [Acanthocystis turfacea Chlorella virus 
NE-JV-2]
Length=347

 Score = 72.8 bits (177),  Expect = 1e-13, Method: Composition-based stats.
 Identities = 30/54 (56%), Positives = 40/54 (74%), Gaps = 0/54 (0%)
 Frame = +3

Query  3    ILITGAAGFIASHVANRLVRSYPNYKIVIVDKLXYCSNLKNLLPSRSSPNFKFV  164
            +L+TG AGFI SHV  +LV+ YP  K+V++DK+ YC+ L NL   R +PNFKFV
Sbjct  8    VLVTGGAGFIGSHVVMKLVQRYPECKVVVLDKMDYCATLNNLATVRDAPNFKFV  61



>gb|AGE53603.1| GDP-L-fucose synthase 2 [Acanthocystis turfacea Chlorella virus 
GM0701.1]
Length=347

 Score = 72.8 bits (177),  Expect = 1e-13, Method: Composition-based stats.
 Identities = 30/54 (56%), Positives = 40/54 (74%), Gaps = 0/54 (0%)
 Frame = +3

Query  3    ILITGAAGFIASHVANRLVRSYPNYKIVIVDKLXYCSNLKNLLPSRSSPNFKFV  164
            +L+TG AGFI SHV  +LV+ YP  K+V++DK+ YC+ L NL   R +PNFKFV
Sbjct  8    VLVTGGAGFIGSHVVMKLVQRYPECKVVVLDKMDYCATLNNLATVRDAPNFKFV  61



>gb|AGE60164.1| GDP-L-fucose synthase 2 [Acanthocystis turfacea Chlorella virus 
WI0606]
Length=350

 Score = 72.8 bits (177),  Expect = 1e-13, Method: Composition-based stats.
 Identities = 30/54 (56%), Positives = 40/54 (74%), Gaps = 0/54 (0%)
 Frame = +3

Query  3    ILITGAAGFIASHVANRLVRSYPNYKIVIVDKLXYCSNLKNLLPSRSSPNFKFV  164
            +L+TG AGFI SHV  +LV+ YP  K+V++DK+ YC+ L NL   R +PNFKFV
Sbjct  11   VLVTGGAGFIGSHVVMKLVQRYPECKVVVLDKMDYCATLNNLATVRDAPNFKFV  64



>gb|AGE59487.1| GDP-L-fucose synthase 2 [Acanthocystis turfacea Chlorella virus 
OR0704.3]
Length=350

 Score = 72.8 bits (177),  Expect = 1e-13, Method: Composition-based stats.
 Identities = 30/54 (56%), Positives = 40/54 (74%), Gaps = 0/54 (0%)
 Frame = +3

Query  3    ILITGAAGFIASHVANRLVRSYPNYKIVIVDKLXYCSNLKNLLPSRSSPNFKFV  164
            +L+TG AGFI SHV  +LV+ YP  K+V++DK+ YC+ L NL   R +PNFKFV
Sbjct  11   VLVTGGAGFIGSHVVMKLVQRYPECKVVVLDKMDYCATLNNLATVRDAPNFKFV  64



>gb|AGE57735.1| GDP-L-fucose synthase 2 [Acanthocystis turfacea Chlorella virus 
NTS-1]
Length=350

 Score = 72.8 bits (177),  Expect = 1e-13, Method: Composition-based stats.
 Identities = 30/54 (56%), Positives = 40/54 (74%), Gaps = 0/54 (0%)
 Frame = +3

Query  3    ILITGAAGFIASHVANRLVRSYPNYKIVIVDKLXYCSNLKNLLPSRSSPNFKFV  164
            +L+TG AGFI SHV  +LV+ YP  K+V++DK+ YC+ L NL   R +PNFKFV
Sbjct  11   VLVTGGAGFIGSHVVMKLVQRYPECKVVVLDKMDYCATLNNLATVRDAPNFKFV  64



>gb|AGE57039.1| GDP-L-fucose synthase 2 [Acanthocystis turfacea Chlorella virus 
NE-JV-3]
Length=350

 Score = 72.8 bits (177),  Expect = 1e-13, Method: Composition-based stats.
 Identities = 30/54 (56%), Positives = 40/54 (74%), Gaps = 0/54 (0%)
 Frame = +3

Query  3    ILITGAAGFIASHVANRLVRSYPNYKIVIVDKLXYCSNLKNLLPSRSSPNFKFV  164
            +L+TG AGFI SHV  +LV+ YP  K+V++DK+ YC+ L NL   R +PNFKFV
Sbjct  11   VLVTGGAGFIGSHVVMKLVQRYPECKVVVLDKMDYCATLNNLATVRDAPNFKFV  64



>gb|AGE56041.1| GDP-L-fucose synthase 2 [Acanthocystis turfacea Chlorella virus 
MO0605SPH]
Length=350

 Score = 72.8 bits (177),  Expect = 1e-13, Method: Composition-based stats.
 Identities = 30/54 (56%), Positives = 40/54 (74%), Gaps = 0/54 (0%)
 Frame = +3

Query  3    ILITGAAGFIASHVANRLVRSYPNYKIVIVDKLXYCSNLKNLLPSRSSPNFKFV  164
            +L+TG AGFI SHV  +LV+ YP  K+V++DK+ YC+ L NL   R +PNFKFV
Sbjct  11   VLVTGGAGFIGSHVVMKLVQRYPECKVVVLDKMDYCATLNNLATVRDAPNFKFV  64



>gb|AGE49559.1| GDP-L-fucose synthase 2 [Acanthocystis turfacea Chlorella virus 
Can0610SP]
Length=350

 Score = 72.8 bits (177),  Expect = 1e-13, Method: Composition-based stats.
 Identities = 30/54 (56%), Positives = 40/54 (74%), Gaps = 0/54 (0%)
 Frame = +3

Query  3    ILITGAAGFIASHVANRLVRSYPNYKIVIVDKLXYCSNLKNLLPSRSSPNFKFV  164
            +L+TG AGFI SHV  +LV+ YP  K+V++DK+ YC+ L NL   R +PNFKFV
Sbjct  11   VLVTGGAGFIGSHVVMKLVQRYPECKVVVLDKMDYCATLNNLATVRDAPNFKFV  64



>gb|AGE49233.1| GDP-L-fucose synthase 2 [Acanthocystis turfacea Chlorella virus 
Br0604L]
Length=350

 Score = 72.8 bits (177),  Expect = 1e-13, Method: Composition-based stats.
 Identities = 30/54 (56%), Positives = 40/54 (74%), Gaps = 0/54 (0%)
 Frame = +3

Query  3    ILITGAAGFIASHVANRLVRSYPNYKIVIVDKLXYCSNLKNLLPSRSSPNFKFV  164
            +L+TG AGFI SHV  +LV+ YP  K+V++DK+ YC+ L NL   R +PNFKFV
Sbjct  11   VLVTGGAGFIGSHVVMKLVQRYPECKVVVLDKMDYCATLNNLATVRDAPNFKFV  64



>ref|YP_001427025.1| hypothetical protein ATCV1_Z544R [Acanthocystis turfacea Chlorella 
virus 1]
 gb|ABT16678.1| hypothetical protein ATCV1_Z544R [Acanthocystis turfacea Chlorella 
virus 1]
Length=350

 Score = 72.8 bits (177),  Expect = 1e-13, Method: Composition-based stats.
 Identities = 30/54 (56%), Positives = 40/54 (74%), Gaps = 0/54 (0%)
 Frame = +3

Query  3    ILITGAAGFIASHVANRLVRSYPNYKIVIVDKLXYCSNLKNLLPSRSSPNFKFV  164
            +L+TG AGFI SHV  +LV+ YP  K+V++DK+ YC+ L NL   R +PNFKFV
Sbjct  11   VLVTGGAGFIGSHVVMKLVQRYPECKVVVLDKMDYCATLNNLATVRDAPNFKFV  64



>gb|AGE50238.1| GDP-L-fucose synthase 2 [Acanthocystis turfacea Chlorella virus 
Canal-1]
Length=359

 Score = 72.4 bits (176),  Expect = 2e-13, Method: Composition-based stats.
 Identities = 32/54 (59%), Positives = 40/54 (74%), Gaps = 0/54 (0%)
 Frame = +3

Query  3    ILITGAAGFIASHVANRLVRSYPNYKIVIVDKLXYCSNLKNLLPSRSSPNFKFV  164
            +LITG AGFIAS V  +LVR YP  K+V++DKL YC+ L NL   R +PNFKF+
Sbjct  20   VLITGGAGFIASWVTIKLVRRYPECKVVVLDKLDYCATLNNLATIRDAPNFKFI  73



>ref|XP_005648752.1| NAD-dependent epimerase/dehydratase [Coccomyxa subellipsoidea 
C-169]
 gb|EIE24208.1| NAD-dependent epimerase/dehydratase [Coccomyxa subellipsoidea 
C-169]
Length=363

 Score = 72.4 bits (176),  Expect = 2e-13, Method: Composition-based stats.
 Identities = 32/54 (59%), Positives = 40/54 (74%), Gaps = 0/54 (0%)
 Frame = +3

Query  3    ILITGAAGFIASHVANRLVRSYPNYKIVIVDKLXYCSNLKNLLPSRSSPNFKFV  164
            IL+TG AGFIASHV  RL   YPN K+V++DKL YC+++ NL   +  PNFKFV
Sbjct  30   ILLTGGAGFIASHVVIRLCSRYPNTKVVVLDKLDYCASMHNLDAVKDLPNFKFV  83



>gb|AGE55724.1| GDP-L-fucose synthase 2 [Acanthocystis turfacea Chlorella virus 
MN0810.1]
Length=353

 Score = 72.0 bits (175),  Expect = 2e-13, Method: Composition-based stats.
 Identities = 32/54 (59%), Positives = 40/54 (74%), Gaps = 0/54 (0%)
 Frame = +3

Query  3    ILITGAAGFIASHVANRLVRSYPNYKIVIVDKLXYCSNLKNLLPSRSSPNFKFV  164
            +LITG AGFIAS V  +LV+ YP  K+V++DKL YC+ L NL   R +PNFKFV
Sbjct  12   VLITGGAGFIASWVTIKLVKRYPECKVVVLDKLDYCATLNNLAAVRDAPNFKFV  65



>ref|XP_004253556.1| DTDP-glucose 4,6-dehydratase, putative [Entamoeba invadens IP1]
 gb|ELP86785.1| DTDP-glucose 4,6-dehydratase, putative [Entamoeba invadens IP1]
Length=342

 Score = 71.6 bits (174),  Expect = 3e-13, Method: Composition-based stats.
 Identities = 33/53 (62%), Positives = 38/53 (72%), Gaps = 0/53 (0%)
 Frame = +3

Query  3    ILITGAAGFIASHVANRLVRSYPNYKIVIVDKLXYCSNLKNLLPSRSSPNFKF  161
            ILITG AGFIASHV    V  YP Y+IV+VDKL YC++L NL   +  PNFKF
Sbjct  8    ILITGGAGFIASHVVVHFVTQYPQYRIVVVDKLDYCASLNNLNNVKGCPNFKF  60



>ref|WP_017256850.1| dTDP-glucose 4,6-dehydratase [Pedobacter arcticus]
Length=351

 Score = 71.6 bits (174),  Expect = 3e-13, Method: Composition-based stats.
 Identities = 33/54 (61%), Positives = 38/54 (70%), Gaps = 0/54 (0%)
 Frame = +3

Query  3    ILITGAAGFIASHVANRLVRSYPNYKIVIVDKLXYCSNLKNLLPSRSSPNFKFV  164
            ILITG AGFI SHV  R V +YPNY+IV +DKL Y  NL+NL     S N+KFV
Sbjct  4    ILITGGAGFIGSHVVRRFVNTYPNYQIVNLDKLTYAGNLENLRDVEQSANYKFV  57



>ref|XP_004336227.1| dTDPD-glucose 4,6-dehydratase [Acanthamoeba castellanii str. 
Neff]
 gb|ELR14214.1| dTDPD-glucose 4,6-dehydratase [Acanthamoeba castellanii str. 
Neff]
Length=386

 Score = 72.0 bits (175),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 34/54 (63%), Positives = 41/54 (76%), Gaps = 0/54 (0%)
 Frame = +3

Query  3    ILITGAAGFIASHVANRLVRSYPNYKIVIVDKLXYCSNLKNLLPSRSSPNFKFV  164
            ILITG AGFI SHV + LV  YP+YKIV  DKL YCS+LKN+   +S PN++FV
Sbjct  10   ILITGGAGFIGSHVVSLLVNKYPDYKIVNYDKLDYCSSLKNIASLQSKPNYRFV  63



>ref|XP_005644844.1| NAD(P)-binding protein [Coccomyxa subellipsoidea C-169]
 gb|EIE20300.1| NAD(P)-binding protein [Coccomyxa subellipsoidea C-169]
Length=361

 Score = 71.6 bits (174),  Expect = 4e-13, Method: Composition-based stats.
 Identities = 31/54 (57%), Positives = 37/54 (69%), Gaps = 0/54 (0%)
 Frame = +3

Query  3    ILITGAAGFIASHVANRLVRSYPNYKIVIVDKLXYCSNLKNLLPSRSSPNFKFV  164
            IL+TG AGFI SHVA  L R YP YK+++ DKL YC   KNL     +PNFKF+
Sbjct  13   ILVTGGAGFIGSHVAVCLTRKYPQYKVIVFDKLDYCGTQKNLASLMDAPNFKFI  66



>gb|EDL00565.1| TDP-glucose 4,6-dehydratase, isoform CRA_b [Mus musculus]
Length=95

 Score = 68.2 bits (165),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 31/54 (57%), Positives = 40/54 (74%), Gaps = 0/54 (0%)
 Frame = +3

Query  3    ILITGAAGFIASHVANRLVRSYPNYKIVIVDKLXYCSNLKNLLPSRSSPNFKFV  164
            +L+TG AGFIASHV   LV  YP+Y IV +DKL YC++LKNL P  +  N+KF+
Sbjct  20   VLVTGGAGFIASHVIVSLVEDYPDYMIVNLDKLDYCASLKNLEPVSNKQNYKFI  73



>ref|XP_004184621.1| DTDP-glucose 4,6-dehydratase, putative [Entamoeba invadens IP1]
 gb|ELP85275.1| DTDP-glucose 4,6-dehydratase, putative [Entamoeba invadens IP1]
Length=341

 Score = 70.9 bits (172),  Expect = 5e-13, Method: Composition-based stats.
 Identities = 34/53 (64%), Positives = 39/53 (74%), Gaps = 0/53 (0%)
 Frame = +3

Query  3    ILITGAAGFIASHVANRLVRSYPNYKIVIVDKLXYCSNLKNLLPSRSSPNFKF  161
            ILITG AGFIASHV    V  YP Y+IV VDKL YCS+LKNL    ++PN+KF
Sbjct  10   ILITGGAGFIASHVVIHFVTKYPQYQIVNVDKLDYCSSLKNLEEIENAPNYKF  62



>ref|XP_011401987.1| putative rhamnose biosynthetic enzyme 3 [Auxenochlorella protothecoides]
 gb|KFM28938.1| putative rhamnose biosynthetic enzyme 3 [Auxenochlorella protothecoides]
Length=372

 Score = 71.2 bits (173),  Expect = 6e-13, Method: Composition-based stats.
 Identities = 30/54 (56%), Positives = 39/54 (72%), Gaps = 0/54 (0%)
 Frame = +3

Query  3    ILITGAAGFIASHVANRLVRSYPNYKIVIVDKLXYCSNLKNLLPSRSSPNFKFV  164
            IL+TG AGFI SHV  RLV+ YP Y++V+ D L YC+ L NL   + +PNFKF+
Sbjct  12   ILVTGGAGFIGSHVVVRLVQRYPQYRVVVFDCLDYCATLHNLQAVKDAPNFKFI  65



>ref|WP_041882446.1| dTDP-glucose 4,6-dehydratase [Pedobacter sp. NL19]
 gb|KIO76902.1| dTDP-glucose 4,6-dehydratase [Pedobacter sp. NL19]
Length=349

 Score = 70.9 bits (172),  Expect = 6e-13, Method: Composition-based stats.
 Identities = 32/54 (59%), Positives = 38/54 (70%), Gaps = 0/54 (0%)
 Frame = +3

Query  3    ILITGAAGFIASHVANRLVRSYPNYKIVIVDKLXYCSNLKNLLPSRSSPNFKFV  164
            ILITG AGFI SHV  R V  YP+Y+IV +DKL Y  NL NL    ++PN+KFV
Sbjct  4    ILITGGAGFIGSHVVRRFVNKYPDYQIVNLDKLTYAGNLANLTDIEANPNYKFV  57



>gb|ERE88473.1| dTDP-D-glucose 4,6-dehydratase-like protein [Cricetulus griseus]
Length=339

 Score = 70.5 bits (171),  Expect = 7e-13, Method: Composition-based stats.
 Identities = 30/54 (56%), Positives = 40/54 (74%), Gaps = 0/54 (0%)
 Frame = +3

Query  3    ILITGAAGFIASHVANRLVRSYPNYKIVIVDKLXYCSNLKNLLPSRSSPNFKFV  164
            +L+TG AGFIASHV   LV  YPNY ++ +DKL YC++LKNL P  +  N+KF+
Sbjct  20   VLVTGGAGFIASHVIASLVEDYPNYMVINLDKLDYCASLKNLEPVSNKQNYKFI  73



>gb|KDD73904.1| NAD dependent epimerase/dehydratase [Helicosporidium sp. ATCC 
50920]
Length=365

 Score = 70.9 bits (172),  Expect = 7e-13, Method: Composition-based stats.
 Identities = 32/54 (59%), Positives = 39/54 (72%), Gaps = 0/54 (0%)
 Frame = +3

Query  3    ILITGAAGFIASHVANRLVRSYPNYKIVIVDKLXYCSNLKNLLPSRSSPNFKFV  164
            IL+TG AGFIASHV  +LV+ YP  KIV++DKL YC+ L NL   +   NFKFV
Sbjct  11   ILVTGGAGFIASHVTIKLVQQYPGCKIVVLDKLDYCATLNNLTSVKDCSNFKFV  64



>gb|ERE88474.1| dTDP-D-glucose 4,6-dehydratase-like protein [Cricetulus griseus]
Length=322

 Score = 70.5 bits (171),  Expect = 7e-13, Method: Composition-based stats.
 Identities = 30/54 (56%), Positives = 40/54 (74%), Gaps = 0/54 (0%)
 Frame = +3

Query  3    ILITGAAGFIASHVANRLVRSYPNYKIVIVDKLXYCSNLKNLLPSRSSPNFKFV  164
            +L+TG AGFIASHV   LV  YPNY ++ +DKL YC++LKNL P  +  N+KF+
Sbjct  20   VLVTGGAGFIASHVIASLVEDYPNYMVINLDKLDYCASLKNLEPVSNKQNYKFI  73



>gb|EDM02523.1| TDP-glucose 4,6-dehydratase (predicted), isoform CRA_c [Rattus 
norvegicus]
Length=212

 Score = 68.9 bits (167),  Expect = 8e-13, Method: Compositional matrix adjust.
 Identities = 31/54 (57%), Positives = 40/54 (74%), Gaps = 0/54 (0%)
 Frame = +3

Query  3    ILITGAAGFIASHVANRLVRSYPNYKIVIVDKLXYCSNLKNLLPSRSSPNFKFV  164
            +L+TG AGFIASHV   LV  YPNY I+ +DKL YC++LKNL P  +  N+KF+
Sbjct  20   VLVTGGAGFIASHVIVSLVEDYPNYMIINLDKLDYCASLKNLEPVSNKQNYKFI  73



>gb|EMS11387.1| dTDP-D-glucose 4,6-dehydratase, partial [Entamoeba histolytica 
HM-3:IMSS]
Length=134

 Score = 68.2 bits (165),  Expect = 8e-13, Method: Compositional matrix adjust.
 Identities = 32/53 (60%), Positives = 37/53 (70%), Gaps = 0/53 (0%)
 Frame = +3

Query  3    ILITGAAGFIASHVANRLVRSYPNYKIVIVDKLXYCSNLKNLLPSRSSPNFKF  161
            ILITG AGFIASHV    V  YP   I+ VDKL YCS+LKNL   + +PN+KF
Sbjct  8    ILITGGAGFIASHVVIHFVNEYPQCTIINVDKLDYCSSLKNLEEIQDAPNYKF  60



>gb|EDM02522.1| TDP-glucose 4,6-dehydratase (predicted), isoform CRA_b [Rattus 
norvegicus]
Length=239

 Score = 68.9 bits (167),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 31/54 (57%), Positives = 40/54 (74%), Gaps = 0/54 (0%)
 Frame = +3

Query  3    ILITGAAGFIASHVANRLVRSYPNYKIVIVDKLXYCSNLKNLLPSRSSPNFKFV  164
            +L+TG AGFIASHV   LV  YPNY I+ +DKL YC++LKNL P  +  N+KF+
Sbjct  20   VLVTGGAGFIASHVIVSLVEDYPNYMIINLDKLDYCASLKNLEPVSNKQNYKFI  73



>ref|XP_001422283.1| putative NAD-dependent epimerase/dehydratase [Ostreococcus lucimarinus 
CCE9901]
 ref|XP_001422349.1| predicted protein [Ostreococcus lucimarinus CCE9901]
 gb|ABP00600.1| putative NAD-dependent epimerase/dehydratase [Ostreococcus lucimarinus 
CCE9901]
 gb|ABP00666.1| predicted protein [Ostreococcus lucimarinus CCE9901]
Length=360

 Score = 70.1 bits (170),  Expect = 1e-12, Method: Composition-based stats.
 Identities = 32/54 (59%), Positives = 39/54 (72%), Gaps = 0/54 (0%)
 Frame = +3

Query  3    ILITGAAGFIASHVANRLVRSYPNYKIVIVDKLXYCSNLKNLLPSRSSPNFKFV  164
            IL+TG AGFI SHVA RL   +P Y IVI+DKL YCS+LKNL  ++   N +FV
Sbjct  3    ILLTGGAGFIGSHVAERLASRHPEYTIVILDKLDYCSSLKNLERAKECANVRFV  56



>ref|XP_002500589.1| predicted protein [Micromonas sp. RCC299]
 gb|ACO61847.1| predicted protein [Micromonas sp. RCC299]
Length=682

 Score = 71.2 bits (173),  Expect = 1e-12, Method: Composition-based stats.
 Identities = 33/54 (61%), Positives = 38/54 (70%), Gaps = 0/54 (0%)
 Frame = +3

Query  3    ILITGAAGFIASHVANRLVRSYPNYKIVIVDKLXYCSNLKNLLPSRSSPNFKFV  164
            +LITG AGFIASHVA    + YP YK+V+VDKL YC+NL NL       NFKFV
Sbjct  17   VLITGGAGFIASHVAILFAKKYPQYKVVVVDKLDYCANLNNLRSIAGLLNFKFV  70



>ref|XP_005079467.1| PREDICTED: dTDP-D-glucose 4,6-dehydratase [Mesocricetus auratus]
Length=356

 Score = 70.1 bits (170),  Expect = 1e-12, Method: Composition-based stats.
 Identities = 31/54 (57%), Positives = 40/54 (74%), Gaps = 0/54 (0%)
 Frame = +3

Query  3    ILITGAAGFIASHVANRLVRSYPNYKIVIVDKLXYCSNLKNLLPSRSSPNFKFV  164
            +L+TG AGFIASHV   LV  YPNY I+ +DKL YC++LKNL P  +  N+KF+
Sbjct  21   VLVTGGAGFIASHVIVSLVEDYPNYMIINLDKLDYCASLKNLEPVSNKRNYKFI  74



>ref|XP_006978807.1| PREDICTED: dTDP-D-glucose 4,6-dehydratase [Peromyscus maniculatus 
bairdii]
Length=355

 Score = 70.1 bits (170),  Expect = 1e-12, Method: Composition-based stats.
 Identities = 31/54 (57%), Positives = 40/54 (74%), Gaps = 0/54 (0%)
 Frame = +3

Query  3    ILITGAAGFIASHVANRLVRSYPNYKIVIVDKLXYCSNLKNLLPSRSSPNFKFV  164
            +L+TG AGFIASHV   LV  YPNY I+ +DKL YC++LKNL P  +  N+KF+
Sbjct  20   VLVTGGAGFIASHVIVSLVEDYPNYMIINLDKLDYCASLKNLEPISNKQNYKFI  73



>ref|XP_005355717.1| PREDICTED: dTDP-D-glucose 4,6-dehydratase [Microtus ochrogaster]
Length=355

 Score = 69.3 bits (168),  Expect = 2e-12, Method: Composition-based stats.
 Identities = 31/54 (57%), Positives = 40/54 (74%), Gaps = 0/54 (0%)
 Frame = +3

Query  3    ILITGAAGFIASHVANRLVRSYPNYKIVIVDKLXYCSNLKNLLPSRSSPNFKFV  164
            +L+TG AGFIASHV   LV  YPNY I+ +DKL YC++LKNL P  +  N+KF+
Sbjct  20   VLVTGGAGFIASHVIVSLVEDYPNYLIINLDKLDYCASLKNLEPVSNKQNYKFI  73



>ref|XP_001422288.1| predicted protein [Ostreococcus lucimarinus CCE9901]
 gb|ABP00605.1| predicted protein [Ostreococcus lucimarinus CCE9901]
Length=360

 Score = 69.3 bits (168),  Expect = 2e-12, Method: Composition-based stats.
 Identities = 31/54 (57%), Positives = 39/54 (72%), Gaps = 0/54 (0%)
 Frame = +3

Query  3    ILITGAAGFIASHVANRLVRSYPNYKIVIVDKLXYCSNLKNLLPSRSSPNFKFV  164
            IL+TG AGFI SHVA RL   +P Y IV++DKL YCS+LKNL  ++   N +FV
Sbjct  3    ILLTGGAGFIGSHVAERLASRHPEYTIVVLDKLDYCSSLKNLERAKECANVRFV  56



>ref|XP_001737366.1| DTDP-glucose 4,6-dehydratase [Entamoeba dispar SAW760]
 gb|EDR26373.1| DTDP-glucose 4,6-dehydratase, putative [Entamoeba dispar SAW760]
Length=341

 Score = 69.3 bits (168),  Expect = 2e-12, Method: Composition-based stats.
 Identities = 32/53 (60%), Positives = 40/53 (75%), Gaps = 0/53 (0%)
 Frame = +3

Query  3    ILITGAAGFIASHVANRLVRSYPNYKIVIVDKLXYCSNLKNLLPSRSSPNFKF  161
            ILITG AGFIASH+    V+ YP+ +IV VDKL YCS+LKNL   + +PN+KF
Sbjct  10   ILITGGAGFIASHIVIHFVKRYPDCRIVNVDKLDYCSSLKNLEEIQDAPNYKF  62



>ref|XP_005778340.1| hypothetical protein EMIHUDRAFT_367182 [Emiliania huxleyi CCMP1516]
 ref|XP_005784020.1| dTDP-glucose 4,6-dehydratase [Emiliania huxleyi CCMP1516]
 gb|EOD25911.1| hypothetical protein EMIHUDRAFT_367182 [Emiliania huxleyi CCMP1516]
 gb|EOD31591.1| dTDP-glucose 4,6-dehydratase [Emiliania huxleyi CCMP1516]
Length=378

 Score = 69.3 bits (168),  Expect = 3e-12, Method: Composition-based stats.
 Identities = 32/54 (59%), Positives = 38/54 (70%), Gaps = 0/54 (0%)
 Frame = +3

Query  3    ILITGAAGFIASHVANRLVRSYPNYKIVIVDKLXYCSNLKNLLPSRSSPNFKFV  164
            IL+TG AGFIASHV   LV  YP YK+V +DK+ YCS+L NL   +  PNFK V
Sbjct  30   ILVTGGAGFIASHVVIGLVEKYPQYKVVCLDKMDYCSSLHNLDQVKDKPNFKMV  83



>ref|WP_010602149.1| dTDP-glucose 4,6-dehydratase [Pedobacter agri]
Length=350

 Score = 69.3 bits (168),  Expect = 3e-12, Method: Composition-based stats.
 Identities = 32/54 (59%), Positives = 37/54 (69%), Gaps = 0/54 (0%)
 Frame = +3

Query  3    ILITGAAGFIASHVANRLVRSYPNYKIVIVDKLXYCSNLKNLLPSRSSPNFKFV  164
            ILITG AGFI SHV  R V +YPNY+IV +D L Y  NL NL    + PN+KFV
Sbjct  4    ILITGGAGFIGSHVVRRFVNNYPNYEIVNLDALTYAGNLANLTDIENKPNYKFV  57



>dbj|BAB27693.1| unnamed protein product [Mus musculus]
 gb|EDL00566.1| TDP-glucose 4,6-dehydratase, isoform CRA_c [Mus musculus]
Length=343

 Score = 68.9 bits (167),  Expect = 3e-12, Method: Composition-based stats.
 Identities = 31/54 (57%), Positives = 40/54 (74%), Gaps = 0/54 (0%)
 Frame = +3

Query  3    ILITGAAGFIASHVANRLVRSYPNYKIVIVDKLXYCSNLKNLLPSRSSPNFKFV  164
            +L+TG AGFIASHV   LV  YP+Y IV +DKL YC++LKNL P  +  N+KF+
Sbjct  20   VLVTGGAGFIASHVIVSLVEDYPDYMIVNLDKLDYCASLKNLEPVSNKQNYKFI  73



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 561945875400