BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFF038C08

Length=526
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

gb|ACL00957.1|  sucrose synthase                                        186   5e-79   Ipomoea batatas [batate]
gb|AEN79500.1|  sucrose synthase 1                                      170   3e-71   Phelipanche ramosa
ref|XP_006353766.1|  PREDICTED: sucrose synthase 2 isoform X2           172   4e-71   
sp|P49039.1|SUS2_SOLTU  RecName: Full=Sucrose synthase; AltName: ...    172   4e-71   Solanum tuberosum [potatoes]
ref|NP_001274911.1|  sucrose synthase 2                                 172   4e-71   Solanum tuberosum [potatoes]
ref|XP_011093886.1|  PREDICTED: sucrose synthase                        170   5e-71   Sesamum indicum [beniseed]
ref|XP_009589756.1|  PREDICTED: sucrose synthase                        168   6e-71   Nicotiana tomentosiformis
ref|XP_009625446.1|  PREDICTED: sucrose synthase                        169   2e-70   Nicotiana tomentosiformis
gb|ABV02029.1|  sucrose sythase                                         168   2e-70   Nicotiana langsdorffii x Nicotiana sanderae
ref|XP_009760458.1|  PREDICTED: sucrose synthase                        166   2e-70   Nicotiana sylvestris
gb|AHL84158.1|  sucrose synthase                                        169   2e-70   Nicotiana tabacum [American tobacco]
ref|XP_010323602.1|  PREDICTED: sucrose synthase isoform X1             171   4e-70   
ref|NP_001234804.1|  sucrose synthase                                   171   4e-70   
ref|NP_001275286.1|  sucrose synthase                                   163   1e-69   Solanum tuberosum [potatoes]
sp|P10691.1|SUS1_SOLTU  RecName: Full=Sucrose synthase; AltName: ...    163   1e-69   Solanum tuberosum [potatoes]
ref|XP_006345244.1|  PREDICTED: uncharacterized LOC102577594            163   1e-69   Solanum tuberosum [potatoes]
gb|AAA97571.1|  sucrose synthase                                        163   1e-69   Solanum tuberosum [potatoes]
ref|XP_009792656.1|  PREDICTED: sucrose synthase                        167   1e-69   Nicotiana sylvestris
emb|CAJ32596.1|  sucrose synthase                                       162   2e-69   Coffea arabica [arabica coffee]
emb|CAI56307.1|  sucrose synthase                                       162   2e-69   Coffea canephora [robusta coffee]
gb|ABI17891.1|  sucrose synthase                                        162   2e-69   Coffea canephora [robusta coffee]
emb|CAA09681.1|  sucrose synthase                                       161   3e-69   Solanum lycopersicum
ref|NP_001234655.1|  sucrose synthase                                   161   4e-69   
dbj|BAP82380.1|  sucrose synthase                                       166   4e-69   Phelipanche aegyptiaca
gb|AAA63685.1|  sucrose synthase                                        163   1e-68   Solanum tuberosum [potatoes]
ref|XP_011078145.1|  PREDICTED: sucrose synthase                        167   1e-67   
gb|ABD61653.1|  sucrose synthase                                        152   4e-66   Cichorium intybus [radicchio]
gb|AFO84090.1|  sucrose synthase                                        148   1e-65   Actinidia chinensis
gb|EYU25805.1|  hypothetical protein MIMGU_mgv1a001207mg                159   9e-64   Erythranthe guttata [common monkey flower]
sp|P49035.1|SUS1_DAUCA  RecName: Full=Sucrose synthase isoform 1;...    149   2e-62   Daucus carota [carrots]
gb|AHL29281.1|  sucrose synthase 1                                      140   1e-61   Camellia sinensis [black tea]
ref|XP_008337809.1|  PREDICTED: sucrose synthase                        136   2e-61   Malus domestica [apple tree]
ref|XP_010107074.1|  Sucrose synthase                                   142   6e-61   Morus notabilis
ref|XP_009359754.1|  PREDICTED: sucrose synthase                        133   4e-60   
gb|KJB82967.1|  hypothetical protein B456_013G222400                    134   7e-60   Gossypium raimondii
gb|KJB82966.1|  hypothetical protein B456_013G222400                    134   9e-60   Gossypium raimondii
dbj|BAA89049.1|  sucrose synthase                                       134   9e-60   Citrus unshiu [satsuma mandarin]
gb|AEK81522.1|  sucrose synthase isoform D                              134   9e-60   Gossypium hirsutum [American cotton]
ref|XP_007012547.1|  Sucrose synthase 4 isoform 2                       131   1e-59   
ref|XP_007012546.1|  Sucrose synthase 4 isoform 1                       132   1e-59   Theobroma cacao [chocolate]
ref|XP_008382924.1|  PREDICTED: sucrose synthase-like                   132   3e-59   
ref|XP_008349074.1|  PREDICTED: sucrose synthase-like                   132   3e-59   
dbj|BAM05649.1|  sucrose synthase 3                                     134   5e-59   Eucalyptus globulus subsp. globulus
ref|XP_009343357.1|  PREDICTED: sucrose synthase                        131   5e-59   Pyrus x bretschneideri [bai li]
ref|XP_009348896.1|  PREDICTED: sucrose synthase-like                   131   6e-59   Pyrus x bretschneideri [bai li]
dbj|BAM05652.1|  sucrose synthase 3                                     134   7e-59   Eucalyptus globulus subsp. globulus
dbj|BAM05650.1|  sucrose synthase 3                                     134   7e-59   Eucalyptus pilularis
ref|XP_006452883.1|  hypothetical protein CICLE_v10007483mg             134   8e-59   Citrus clementina [clementine]
gb|ADY68844.1|  sucrose synthase                                        129   9e-59   Gossypium barbadense [Egyptian cotton]
gb|AIJ28960.1|  sucrose synthase                                        134   9e-59   Manihot esculenta subsp. flabellifolia
gb|AEV40462.1|  sucrose synthase 3                                      129   9e-59   Gossypium arboreum [tree cotton]
gb|AEN71063.1|  sucrose synthase Sus1                                   129   9e-59   Gossypium mustelinum
gb|ADY68846.1|  sucrose synthase                                        129   9e-59   Gossypium herbaceum subsp. africanum
gb|AEV40463.1|  sucrose synthase 4                                      130   9e-59   Gossypium arboreum [tree cotton]
gb|AIJ28962.1|  sucrose synthase                                        134   1e-58   Manihot esculenta [manioc]
ref|XP_006474580.1|  PREDICTED: sucrose synthase-like isoform X1        134   1e-58   Citrus sinensis [apfelsine]
gb|ADY68848.1|  sucrose synthase                                        129   1e-58   Gossypium hirsutum [American cotton]
gb|KDO73786.1|  hypothetical protein CISIN_1g003661mg                   134   1e-58   Citrus sinensis [apfelsine]
gb|KDO73787.1|  hypothetical protein CISIN_1g003661mg                   134   1e-58   Citrus sinensis [apfelsine]
ref|XP_008338289.1|  PREDICTED: sucrose synthase-like                   130   2e-58   
gb|AEN83999.1|  sucrose synthase                                        131   2e-58   Cucumis sativus [cucumbers]
ref|XP_008391788.1|  PREDICTED: sucrose synthase-like isoform X2        130   2e-58   
ref|XP_008450968.1|  PREDICTED: sucrose synthase                        132   2e-58   Cucumis melo [Oriental melon]
gb|KJB54541.1|  hypothetical protein B456_009G038000                    127   2e-58   Gossypium raimondii
dbj|BAA89232.1|  wsus                                                   131   3e-58   Citrullus lanatus [wild melon]
ref|XP_008391777.1|  PREDICTED: sucrose synthase-like isoform X1        130   3e-58   
gb|AEN71078.1|  sucrose synthase Sus1                                   127   3e-58   Gossypium klotzschianum
gb|KJB54539.1|  hypothetical protein B456_009G038000                    127   3e-58   Gossypium raimondii
ref|XP_010047438.1|  PREDICTED: sucrose synthase                        134   3e-58   Eucalyptus grandis [rose gum]
gb|AEN71079.1|  sucrose synthase Sus1                                   128   4e-58   Gossypium aridum
gb|AFY03626.1|  sucrose synthase                                        132   4e-58   Eucalyptus globulus [blue gum]
gb|AEN71061.1|  sucrose synthase Sus1                                   127   4e-58   Gossypium schwendimanii
gb|AAD09568.1|  sucrose synthase                                        131   4e-58   Gossypium hirsutum [American cotton]
gb|AEN71060.1|  sucrose synthase Sus1                                   127   4e-58   Gossypium laxum
gb|AEN71059.1|  sucrose synthase Sus1                                   127   4e-58   Gossypium thurberi
gb|ADY68845.1|  sucrose synthase                                        127   4e-58   Gossypium barbadense [Egyptian cotton]
gb|AEN71075.1|  sucrose synthase Sus1                                   127   4e-58   Gossypium armourianum
gb|AEN71080.1|  sucrose synthase Sus1                                   127   4e-58   Gossypium gossypioides
gb|AEN71068.1|  sucrose synthase Sus1                                   127   4e-58   Gossypium tomentosum
dbj|BAM05651.1|  sucrose synthase 3                                     132   4e-58   Eucalyptus pyrocarpa
gb|KJB54542.1|  hypothetical protein B456_009G038000                    127   4e-58   Gossypium raimondii
gb|KJB65376.1|  hypothetical protein B456_010G092300                    127   5e-58   Gossypium raimondii
ref|XP_002275155.1|  PREDICTED: sucrose synthase                        134   5e-58   Vitis vinifera
emb|CAN82840.1|  hypothetical protein VITISV_024563                     134   5e-58   Vitis vinifera
gb|ACV72640.1|  sucrose synthase 1                                      128   5e-58   Gossypium hirsutum [American cotton]
gb|KJB65372.1|  hypothetical protein B456_010G092300                    127   6e-58   Gossypium raimondii
dbj|BAA88905.1|  sucrose synthase                                       131   9e-58   Citrus unshiu [satsuma mandarin]
gb|AIL23782.1|  sucrose synthase                                        126   9e-58   Prunus serrulata
gb|KCW81848.1|  hypothetical protein EUGRSUZ_C03199                     132   1e-57   Eucalyptus grandis [rose gum]
ref|XP_008242292.1|  PREDICTED: sucrose synthase                        125   1e-57   Prunus mume [ume]
gb|AAD28641.1|  sucrose synthase                                        130   1e-57   Gossypium hirsutum [American cotton]
ref|NP_001289655.1|  sucrose synthase                                   132   1e-57   Eucalyptus grandis [rose gum]
ref|XP_010049327.1|  PREDICTED: sucrose synthase-like                   132   1e-57   Eucalyptus grandis [rose gum]
ref|NP_001289661.1|  sucrose synthase-like                              132   1e-57   Eucalyptus grandis [rose gum]
ref|XP_004144053.1|  PREDICTED: sucrose synthase-like                   131   1e-57   Cucumis sativus [cucumbers]
ref|XP_007204649.1|  hypothetical protein PRUPE_ppa001535mg             125   1e-57   Prunus persica
gb|AEK81520.1|  sucrose synthase isoform B                              130   1e-57   Gossypium hirsutum [American cotton]
gb|AFI57908.1|  sucrose synthase 1                                      125   1e-57   Prunus persica
gb|KGN66333.1|  hypothetical protein Csa_1G597800                       131   1e-57   Cucumis sativus [cucumbers]
gb|AGM14949.1|  sucrose synthase 4                                      132   2e-57   Hevea brasiliensis [jebe]
gb|AGQ57012.1|  sucrose synthase 1                                      132   2e-57   Hevea brasiliensis [jebe]
ref|XP_009348897.1|  PREDICTED: sucrose synthase-like                   132   3e-57   Pyrus x bretschneideri [bai li]
ref|XP_009343356.1|  PREDICTED: sucrose synthase-like                   132   3e-57   Pyrus x bretschneideri [bai li]
gb|KJB54540.1|  hypothetical protein B456_009G038000                    127   5e-57   Gossypium raimondii
gb|KJB65375.1|  hypothetical protein B456_010G092300                    127   7e-57   Gossypium raimondii
ref|XP_010520519.1|  PREDICTED: sucrose synthase 4-like                 128   2e-56   Tarenaya hassleriana [spider flower]
gb|AEF56625.1|  sucrose synthase                                        129   2e-56   Arachis hypogaea var. vulgaris [Spanish peanut]
gb|KDP33978.1|  hypothetical protein JCGZ_07549                         126   2e-56   Jatropha curcas
ref|XP_004287669.1|  PREDICTED: sucrose synthase                        123   3e-56   Fragaria vesca subsp. vesca
gb|AEN71066.1|  sucrose synthase Sus1                                   125   3e-56   Gossypium darwinii
gb|AEN71067.1|  sucrose synthase Sus1                                   124   3e-56   Gossypium tomentosum
gb|AII19313.1|  sucrose synthase 1                                      125   4e-56   Ricinus communis
sp|P31926.1|SUSY_VICFA  RecName: Full=Sucrose synthase; AltName: ...    130   4e-56   Vicia faba [broad bean]
gb|AAC28107.1|  nodule-enhanced sucrose synthase                        130   5e-56   Pisum sativum [garden pea]
emb|CAA09910.1|  sucrose synthase                                       130   5e-56   Pisum sativum [garden pea]
sp|P49034.1|SUSY_ALNGL  RecName: Full=Sucrose synthase; AltName: ...    123   6e-56   Alnus glutinosa
ref|XP_004508033.1|  PREDICTED: sucrose synthase-like isoform X1        127   6e-56   
gb|AFY03624.1|  sucrose synthase                                        129   6e-56   Eucalyptus globulus [blue gum]
ref|XP_004508035.1|  PREDICTED: sucrose synthase-like isoform X3        127   7e-56   Cicer arietinum [garbanzo]
gb|AEE60913.1|  nodule-enhanced sucrose synthase                        127   8e-56   Cicer arietinum [garbanzo]
gb|AGH29112.1|  sucrose synthase                                        124   9e-56   Jatropha curcas
ref|NP_001237525.1|  sucrose synthase                                   129   1e-55   Glycine max [soybeans]
ref|XP_003551045.1|  PREDICTED: sucrose synthase-like isoform X1        129   1e-55   
gb|KHN17754.1|  Sucrose synthase                                        129   1e-55   Glycine soja [wild soybean]
gb|ABD96570.1|  sucrose synthase                                        125   2e-55   Manihot esculenta [manioc]
gb|AIJ28961.1|  sucrose synthase                                        125   2e-55   Manihot esculenta [manioc]
gb|AIJ28959.1|  sucrose synthase                                        125   2e-55   Manihot esculenta subsp. flabellifolia
ref|XP_002516210.1|  sucrose synthase, putative                         125   3e-55   
dbj|BAM68520.1|  sucrose synthase                                       134   3e-55   Mangifera indica
dbj|BAM37539.1|  sucrose synthase                                       134   3e-55   Mangifera indica
dbj|BAM68526.1|  sucrose synthase                                       134   3e-55   Mangifera indica
dbj|BAM68527.1|  sucrose synthase                                       134   3e-55   Mangifera indica
dbj|BAM68521.1|  sucrose synthase                                       134   3e-55   Mangifera indica
sp|Q01390.1|SUSY_VIGRR  RecName: Full=Sucrose synthase; AltName: ...    127   3e-55   Vigna radiata var. radiata [golden gram]
dbj|BAH56282.1|  sucrose synthase                                       127   3e-55   Vigna angularis [azuki bean]
sp|O65026.1|SUSY_MEDSA  RecName: Full=Sucrose synthase; AltName: ...    127   8e-55   Medicago sativa [alfalfa]
ref|XP_003609949.1|  Sucrose synthase                                   125   1e-54   Medicago truncatula
emb|CAB40795.1|  sucrose synthase                                       125   1e-54   Medicago truncatula
ref|XP_003609946.1|  Sucrose synthase                                   126   1e-54   
gb|ADW80558.1|  sucrose synthase 1                                      124   1e-54   Populus tomentosa [Chinese white poplar]
gb|AES92143.2|  sucrose synthase                                        125   1e-54   Medicago truncatula
gb|ADW80550.1|  sucrose synthase 1                                      124   1e-54   Populus tomentosa [Chinese white poplar]
gb|ADW80570.1|  sucrose synthase 1                                      124   1e-54   Populus tomentosa [Chinese white poplar]
gb|AGV22112.1|  sucrose synthase 2                                      120   2e-54   Betula luminifera [liang ye hua]
gb|ADW80555.1|  sucrose synthase 1                                      124   3e-54   Populus tomentosa [Chinese white poplar]
gb|ADR81996.1|  sucrose synthase 1                                      123   3e-54   Populus trichocarpa [western balsam poplar]
gb|ADW80548.1|  sucrose synthase 1                                      124   3e-54   Populus tomentosa [Chinese white poplar]
gb|ADW80563.1|  sucrose synthase 1                                      124   3e-54   Populus tomentosa [Chinese white poplar]
gb|ADW80534.1|  sucrose synthase 1                                      124   3e-54   Populus tomentosa [Chinese white poplar]
gb|ADW80549.1|  sucrose synthase 1                                      124   3e-54   Populus tomentosa [Chinese white poplar]
gb|ADW80560.1|  sucrose synthase 1                                      124   3e-54   Populus tomentosa [Chinese white poplar]
gb|ADW80546.1|  sucrose synthase 1                                      124   3e-54   Populus tomentosa [Chinese white poplar]
gb|ADW80535.1|  sucrose synthase 1                                      124   3e-54   Populus tomentosa [Chinese white poplar]
ref|XP_007154543.1|  hypothetical protein PHAVU_003G127500g             124   3e-54   Phaseolus vulgaris [French bean]
ref|XP_011010968.1|  PREDICTED: sucrose synthase-like isoform X1        124   4e-54   Populus euphratica
gb|AAN76498.1|AF315375_1  sucrose synthase                              124   4e-54   Phaseolus vulgaris [French bean]
gb|ADW80552.1|  sucrose synthase 1                                      124   5e-54   Populus tomentosa [Chinese white poplar]
ref|XP_010271909.1|  PREDICTED: sucrose synthase                        125   5e-54   Nelumbo nucifera [Indian lotus]
gb|ABF50715.1|  sucrose synthase                                        119   6e-54   Viscum album subsp. album
gb|ADW80536.1|  sucrose synthase 1                                      124   6e-54   Populus tomentosa [Chinese white poplar]
gb|ADW80539.1|  sucrose synthase 1                                      124   6e-54   Populus tomentosa [Chinese white poplar]
gb|ADW80545.1|  sucrose synthase 1                                      124   6e-54   Populus tomentosa [Chinese white poplar]
gb|ADW80540.1|  sucrose synthase 1                                      124   7e-54   Populus tomentosa [Chinese white poplar]
gb|ADV71181.1|  sucrose synthase 1                                      124   7e-54   Populus tomentosa [Chinese white poplar]
gb|ADW80541.1|  sucrose synthase 1                                      124   7e-54   Populus tomentosa [Chinese white poplar]
gb|ADW80543.1|  sucrose synthase 1                                      124   7e-54   Populus tomentosa [Chinese white poplar]
gb|ABP88869.1|  sucrose synthase                                        124   7e-54   Medicago falcata [sickle alfalfa]
ref|XP_002324136.2|  sucrose synthase family protein                    121   8e-54   
ref|XP_011010969.1|  PREDICTED: sucrose synthase-like isoform X2        123   1e-53   Populus euphratica
gb|ADW80571.1|  sucrose synthase 1                                      122   1e-53   Populus tomentosa [Chinese white poplar]
gb|ADW80566.1|  sucrose synthase 1                                      122   1e-53   Populus tomentosa [Chinese white poplar]
ref|XP_010247458.1|  PREDICTED: sucrose synthase                        127   1e-53   Nelumbo nucifera [Indian lotus]
ref|XP_010535796.1|  PREDICTED: sucrose synthase 4                      126   2e-53   Tarenaya hassleriana [spider flower]
gb|ADW80562.1|  sucrose synthase 1                                      124   2e-53   Populus tomentosa [Chinese white poplar]
gb|ADW80559.1|  sucrose synthase 1                                      124   2e-53   Populus tomentosa [Chinese white poplar]
gb|AHA41509.1|  sucrose synthase                                        122   2e-53   Populus deltoides
gb|ADW80551.1|  sucrose synthase 1                                      122   2e-53   Populus tomentosa [Chinese white poplar]
gb|AEV40464.1|  sucrose synthase 5                                      130   3e-53   Gossypium arboreum [tree cotton]
gb|AAR03498.1|  sucrose synthase                                        121   4e-53   Populus tremuloides
dbj|BAM05645.1|  sucrose synthase 1                                     117   4e-53   Eucalyptus pilularis
gb|ADR81997.1|  sucrose synthase 2                                      118   5e-53   Populus trichocarpa [western balsam poplar]
ref|XP_011039917.1|  PREDICTED: sucrose synthase                        117   7e-53   Populus euphratica
gb|AAR19769.1|  sucrose synthase                                        119   8e-53   Beta vulgaris [beet]
gb|ADW80579.1|  sucrose synthase 2                                      117   1e-52   Populus tomentosa [Chinese white poplar]
gb|ADW80586.1|  sucrose synthase 2                                      118   1e-52   Populus tomentosa [Chinese white poplar]
gb|ADW80593.1|  sucrose synthase 2                                      118   1e-52   Populus tomentosa [Chinese white poplar]
gb|ADW80587.1|  sucrose synthase 2                                      118   1e-52   Populus tomentosa [Chinese white poplar]
gb|ADW80601.1|  sucrose synthase 2                                      118   1e-52   Populus tomentosa [Chinese white poplar]
gb|ADW80585.1|  sucrose synthase 2                                      118   1e-52   Populus tomentosa [Chinese white poplar]
sp|Q41607.1|SUS2_TULGE  RecName: Full=Sucrose synthase 2; AltName...    119   2e-52   Tulipa gesneriana
gb|ADW80589.1|  sucrose synthase 2                                      118   2e-52   Populus tomentosa [Chinese white poplar]
gb|AGM14948.1|  sucrose synthase 3                                      123   2e-52   Hevea brasiliensis [jebe]
gb|ADW80588.1|  sucrose synthase 2                                      118   2e-52   Populus tomentosa [Chinese white poplar]
gb|ADW80565.1|  sucrose synthase 1                                      118   2e-52   Populus tomentosa [Chinese white poplar]
dbj|BAM05648.1|  sucrose synthase 1                                     118   2e-52   Eucalyptus globulus subsp. globulus
gb|ADW80610.1|  sucrose synthase 2                                      118   2e-52   Populus tomentosa [Chinese white poplar]
gb|ADW80595.1|  sucrose synthase 2                                      118   2e-52   Populus tomentosa [Chinese white poplar]
gb|ADW80599.1|  sucrose synthase 2                                      117   2e-52   Populus tomentosa [Chinese white poplar]
gb|ADW80592.1|  sucrose synthase 2                                      117   2e-52   Populus tomentosa [Chinese white poplar]
gb|ADW80556.1|  sucrose synthase 1                                      118   2e-52   Populus tomentosa [Chinese white poplar]
gb|ADV71182.1|  sucrose synthase 2                                      117   2e-52   Populus tomentosa [Chinese white poplar]
gb|ADW80609.1|  sucrose synthase 2                                      117   2e-52   Populus tomentosa [Chinese white poplar]
gb|ADW80604.1|  sucrose synthase 2                                      117   2e-52   Populus tomentosa [Chinese white poplar]
gb|ADW80591.1|  sucrose synthase 2                                      117   2e-52   Populus tomentosa [Chinese white poplar]
gb|ADW80606.1|  sucrose synthase 2                                      117   2e-52   Populus tomentosa [Chinese white poplar]
gb|ADW80581.1|  sucrose synthase 2                                      117   2e-52   Populus tomentosa [Chinese white poplar]
gb|ADW80584.1|  sucrose synthase 2                                      117   2e-52   Populus tomentosa [Chinese white poplar]
gb|ADW80582.1|  sucrose synthase 2                                      117   2e-52   Populus tomentosa [Chinese white poplar]
gb|ADW80576.1|  sucrose synthase 2                                      117   2e-52   Populus tomentosa [Chinese white poplar]
gb|ADW80575.1|  sucrose synthase 2                                      118   3e-52   Populus tomentosa [Chinese white poplar]
ref|XP_002877269.1|  hypothetical protein ARALYDRAFT_484788             120   3e-52   
gb|AFS17277.1|  sucrose synthase 1                                      115   3e-52   Amaranthus cruentus/Amaranthus hypocondriacus mixed library
ref|XP_010687574.1|  PREDICTED: sucrose synthase                        116   4e-52   
ref|XP_006381564.1|  sucrose synthase family protein                    116   4e-52   Populus trichocarpa [western balsam poplar]
ref|NP_566865.2|  sucrose synthase 4                                    117   5e-52   Arabidopsis thaliana [mouse-ear cress]
gb|ADW80580.1|  sucrose synthase 2                                      116   5e-52   Populus tomentosa [Chinese white poplar]
ref|XP_004488141.1|  PREDICTED: sucrose synthase-like isoform X1        116   6e-52   
ref|XP_010939862.1|  PREDICTED: sucrose synthase 1                      117   6e-52   Elaeis guineensis
gb|ADW80597.1|  sucrose synthase 2                                      115   7e-52   Populus tomentosa [Chinese white poplar]
gb|ABW76422.1|  sucrose synthase                                        118   9e-52   Populus tremuloides
gb|ADW80600.1|  sucrose synthase 2                                      118   9e-52   Populus tomentosa [Chinese white poplar]
gb|AGW23638.1|  sucrose synthase                                        116   1e-51   Lilium davidii
gb|ADW80578.1|  sucrose synthase 2                                      115   1e-51   Populus tomentosa [Chinese white poplar]
gb|ADW80611.1|  sucrose synthase 2                                      115   1e-51   Populus tomentosa [Chinese white poplar]
gb|ADW80607.1|  sucrose synthase 2                                      115   1e-51   Populus tomentosa [Chinese white poplar]
gb|ADW80577.1|  sucrose synthase 2                                      115   1e-51   Populus tomentosa [Chinese white poplar]
gb|ADW80574.1|  sucrose synthase 2                                      115   1e-51   Populus tomentosa [Chinese white poplar]
gb|ADW80608.1|  sucrose synthase 2                                      115   1e-51   Populus tomentosa [Chinese white poplar]
gb|ADW80598.1|  sucrose synthase 2                                      114   1e-51   Populus tomentosa [Chinese white poplar]
gb|ADW80603.1|  sucrose synthase 2                                      115   2e-51   Populus tomentosa [Chinese white poplar]
gb|ADW80583.1|  sucrose synthase 2                                      115   2e-51   Populus tomentosa [Chinese white poplar]
gb|ADW80602.1|  sucrose synthase 2                                      115   2e-51   Populus tomentosa [Chinese white poplar]
ref|XP_006838088.1|  hypothetical protein AMTR_s00106p00019920          116   2e-51   Amborella trichopoda
ref|XP_006290612.1|  hypothetical protein CARUB_v10016702mg             122   3e-51   Capsella rubella
ref|XP_003533802.1|  PREDICTED: sucrose synthase-like isoform X1        117   4e-51   Glycine max [soybeans]
gb|KHN47619.1|  Sucrose synthase                                        117   4e-51   Glycine soja [wild soybean]
dbj|BAE99649.1|  sucrose synthase like protein                          117   4e-51   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010937277.1|  PREDICTED: sucrose synthase 2-like                 115   5e-51   Elaeis guineensis
ref|XP_008783098.1|  PREDICTED: sucrose synthase 1                      115   6e-51   Phoenix dactylifera
ref|XP_004488146.1|  PREDICTED: sucrose synthase-like isoform X6        115   6e-51   
gb|ADW80590.1|  sucrose synthase 2                                      114   1e-50   Populus tomentosa [Chinese white poplar]
gb|ADW80605.1|  sucrose synthase 2                                      114   1e-50   Populus tomentosa [Chinese white poplar]
ref|XP_009390882.1|  PREDICTED: sucrose synthase 2-like                 114   2e-50   
ref|XP_008800466.1|  PREDICTED: sucrose synthase 2                      116   2e-50   Phoenix dactylifera
emb|CAA57881.1|  sucrose synthase                                       119   2e-50   Oxybasis rubra [pigweed]
gb|ADY02961.1|  sucrose synthase                                        112   3e-50   Dendrobium officinale
ref|XP_003546526.1|  PREDICTED: sucrose synthase-like isoform X1        114   3e-50   
gb|KHN49081.1|  Sucrose synthase                                        114   6e-50   Glycine soja [wild soybean]
ref|XP_006287059.1|  hypothetical protein CARUB_v10000208mg             118   8e-50   
ref|XP_009390318.1|  PREDICTED: sucrose synthase 2-like                 112   8e-50   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_002874016.1|  hypothetical protein ARALYDRAFT_910122             117   8e-50   Arabidopsis lyrata subsp. lyrata
sp|O49845.1|SUS2_DAUCA  RecName: Full=Sucrose synthase isoform 2;...    115   8e-50   Daucus carota [carrots]
gb|AEA76429.1|  sucrose synthase 1                                      114   1e-49   Oncidium hybrid cultivar
emb|CAA50317.1|  sucrose synthase                                       116   2e-49   Arabidopsis thaliana [mouse-ear cress]
ref|XP_007138617.1|  hypothetical protein PHAVU_009G223800g             111   3e-49   Phaseolus vulgaris [French bean]
gb|ACP17902.1|  sucrose synthase                                        111   3e-49   Phaseolus vulgaris [French bean]
gb|KEH37657.1|  sucrose synthase                                        111   4e-49   Medicago truncatula
emb|CDX70945.1|  BnaC03g10290D                                          116   4e-49   
emb|CDY16569.1|  BnaC09g37040D                                          116   4e-49   Brassica napus [oilseed rape]
ref|NP_197583.1|  sucrose synthase 1                                    114   5e-49   Arabidopsis thaliana [mouse-ear cress]
pdb|3S28|A  Chain A, The Crystal Structure Of Sucrose Synthase-1 ...    114   5e-49   Arabidopsis thaliana [mouse-ear cress]
emb|CDX92432.1|  BnaA10g14710D                                          115   6e-49   
ref|XP_009404100.1|  PREDICTED: sucrose synthase 2                      112   7e-49   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_006657957.1|  PREDICTED: sucrose synthase 3-like                 112   8e-49   Oryza brachyantha
gb|AAL50570.1|AF412037_1  sucrose synthase                              114   1e-48   Bambusa oldhamii
pdb|3S27|A  Chain A, The Crystal Structure Of Sucrose Synthase-1 ...    114   1e-48   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009131818.1|  PREDICTED: sucrose synthase 1                      116   1e-48   Brassica rapa
gb|AAM95944.1|  sucrose synthase                                        110   1e-48   x Mokara cv. 'Yellow'
ref|XP_008797380.1|  PREDICTED: sucrose synthase 1-like isoform X2      110   2e-48   Phoenix dactylifera
gb|AAM95943.1|  sucrose synthase                                        110   2e-48   Oncidium hybrid cultivar
dbj|BAE06059.1|  sucrose synthase                                       111   2e-48   Potamogeton distinctus
prf||2008300A  sucrose synthase:ISOTYPE=2                               110   3e-48
ref|XP_009120766.1|  PREDICTED: LOW QUALITY PROTEIN: sucrose synt...    113   4e-48   Brassica rapa
ref|XP_009380139.1|  PREDICTED: sucrose synthase 2-like                 109   4e-48   Musa acuminata subsp. malaccensis [pisang utan]
gb|AAV64256.2|  sucrose synthase                                        110   5e-48   Bambusa oldhamii
gb|ADW80596.1|  sucrose synthase 2                                      114   6e-48   Populus tomentosa [Chinese white poplar]
gb|AEO09338.2|  sucrose synthase                                        108   9e-48   Musa acuminata AAA Group [Cavendish banana]
gb|AGI56230.1|  sucrose synthase 1                                      108   1e-47   Saccharum officinarum [noble cane]
ref|XP_004984086.1|  PREDICTED: sucrose synthase 2-like                 108   1e-47   Setaria italica
ref|XP_002465161.1|  hypothetical protein SORBIDRAFT_01g033060          108   1e-47   
ref|XP_006400648.1|  hypothetical protein EUTSA_v10012719mg             111   1e-47   
ref|XP_008659017.1|  PREDICTED: sucrose synthase 2 isoform X1           107   2e-47   
gb|AAA68209.1|  sus1                                                    107   2e-47   
ref|NP_001105323.1|  sucrose synthase 2                                 107   3e-47   
gb|AIS75087.1|  sus1                                                    107   3e-47   
gb|AFW88072.1|  sucrose synthase1                                       107   3e-47   
ref|XP_010917399.1|  PREDICTED: sucrose synthase 1-like                 107   3e-47   
ref|XP_008797379.1|  PREDICTED: sucrose synthase 1-like isoform X1      109   3e-47   
gb|AFW88071.1|  sucrose synthase1                                       107   4e-47   
ref|XP_006655877.1|  PREDICTED: sucrose synthase 2-like                 111   4e-47   
gb|AFW85475.1|  shrunken1 isoform 1                                     109   9e-47   
ref|XP_008659019.1|  PREDICTED: sucrose synthase 1 isoform X1           110   9e-47   
ref|NP_001266691.1|  sucrose synthase 1                                 110   9e-47   
ref|NP_001105411.1|  sucrose synthase 1                                 109   9e-47   
gb|AEX98033.1|  sucrose synthase                                        109   1e-46   
gb|ACM69042.1|  sucrose synthase                                        109   2e-46   
gb|AAL50572.2|AF412039_1  sucrose synthase                              108   2e-46   
gb|AAF85966.1|AF263384_1  sucrose synthase-2                            109   2e-46   
gb|AAL50571.1|AF412038_1  sucrose synthase                              110   2e-46   
emb|CAC32462.1|  sucrose synthase isoform 3                             107   2e-46   
gb|AEX32875.1|  sucrose synthase 2                                      109   2e-46   
ref|NP_001057047.1|  Os06g0194900                                       109   2e-46   
emb|CAA78747.1|  sucrose synthase                                       109   2e-46   
gb|AAM68126.1|  sucrose synthase                                        109   3e-46   
gb|AIO11845.1|  sucrose synthase                                        108   3e-46   
ref|XP_004964611.1|  PREDICTED: sucrose synthase 1-like                 106   6e-46   
ref|XP_008783129.1|  PREDICTED: sucrose synthase 1-like isoform X1      106   6e-46   
gb|ABL74568.1|  sucrose synthase 2                                      107   1e-45   
ref|XP_009601288.1|  PREDICTED: sucrose synthase 2-like                 107   1e-45   
ref|XP_008235123.1|  PREDICTED: sucrose synthase 3                      110   2e-45   
ref|XP_003564156.1|  PREDICTED: sucrose synthase 1                      106   2e-45   
dbj|BAK02964.1|  predicted protein                                      108   5e-45   
gb|EAZ00002.1|  hypothetical protein OsI_22003                          109   5e-45   
dbj|BAJ99820.1|  predicted protein                                      104   7e-45   
ref|XP_010069893.1|  PREDICTED: sucrose synthase 2                      106   9e-45   
gb|EMS66266.1|  Sucrose synthase 1                                      107   1e-44   
ref|XP_003557752.1|  PREDICTED: sucrose synthase 1                      106   1e-44   
emb|CAA75793.1|  sucrose synthase 2                                     103   2e-44   
gb|EMT33394.1|  Sucrose synthase 1                                      103   3e-44   
sp|P31923.1|SUS2_HORVU  RecName: Full=Sucrose synthase 2; AltName...    103   3e-44   
ref|XP_010932353.1|  PREDICTED: sucrose synthase 1-like isoform X1      106   3e-44   
gb|EMS59092.1|  Sucrose synthase 1                                      104   3e-44   
emb|CAZ64535.1|  sucrose synthase                                       104   4e-44   
ref|XP_007050987.1|  Sucrose synthase 3 isoform 4                       103   4e-44   
ref|XP_009410254.1|  PREDICTED: sucrose synthase 1-like                 103   5e-44   
ref|XP_007050985.1|  Sucrose synthase 3 isoform 2                       102   6e-44   
ref|XP_007050984.1|  Sucrose synthase 3 isoform 1                       102   6e-44   
ref|XP_008783137.1|  PREDICTED: sucrose synthase 1-like isoform X2      104   8e-44   
ref|XP_007050986.1|  Sucrose synthase 3 isoform 3                       102   8e-44   
gb|KDO73788.1|  hypothetical protein CISIN_1g003661mg                   119   8e-44   
gb|AFO84091.1|  sucrose synthase                                        107   1e-43   
emb|CAA04543.1|  sucrose synthase type I                                103   2e-43   
gb|KJB07349.1|  hypothetical protein B456_001G017700                    112   3e-43   
gb|AHM02468.1|  sucrose synthase                                        108   3e-43   
sp|Q41608.1|SUS1_TULGE  RecName: Full=Sucrose synthase 1; AltName...    107   3e-43   
sp|P31922.1|SUS1_HORVU  RecName: Full=Sucrose synthase 1; AltName...    101   3e-43   
gb|AFM52233.1|  putative sucrose synthase 2                             114   3e-43   
gb|AAQ18911.1|  sucrose synthase                                        105   5e-43   
gb|AGV22111.1|  sucrose synthase 1                                      105   6e-43   
gb|AGM14950.1|  sucrose synthase 5                                      101   7e-43   
emb|CAB38022.1|  sucrose synthase                                       104   8e-43   
ref|XP_004494390.1|  PREDICTED: sucrose synthase 2-like isoform X1      110   9e-43   
ref|XP_004494391.1|  PREDICTED: sucrose synthase 2-like isoform X2      110   1e-42   
gb|AHL29282.1|  sucrose synthase 2                                      103   1e-42   
ref|XP_002271896.1|  PREDICTED: sucrose synthase 2                      103   1e-42   
gb|AEH27530.1|  putative sucrose synthase                               102   2e-42   
gb|AEN71099.1|  sucrose synthase SusA1                                  100   3e-42   
gb|AEN71086.1|  sucrose synthase SusA1                                  100   3e-42   
gb|AEN71101.1|  sucrose synthase SusA1                                  100   3e-42   
gb|AEN71085.1|  sucrose synthase SusA1                                  100   3e-42   
gb|AEN71093.1|  sucrose synthase SusA1                                  100   3e-42   
gb|AEV40893.1|  sucrose synthase                                        100   3e-42   
gb|AEN71088.1|  sucrose synthase SusA1                                  100   3e-42   
gb|AEN71104.1|  sucrose synthase SusA1                                  100   3e-42   
gb|AEN71087.1|  sucrose synthase SusA1                                  100   3e-42   
gb|AEN71083.1|  sucrose synthase SusA1                                  100   3e-42   
gb|AEN71105.1|  sucrose synthase SusA1                                  100   3e-42   
gb|AEN71092.1|  sucrose synthase SusA1                                  100   3e-42   
ref|XP_004290813.1|  PREDICTED: sucrose synthase 2                      102   3e-42   
gb|AEN71096.1|  sucrose synthase SusA1                                  100   3e-42   
gb|AEN71103.1|  sucrose synthase SusA1                                  100   3e-42   
gb|AEN71090.1|  sucrose synthase SusA1                                  100   3e-42   
gb|AEN71084.1|  sucrose synthase SusA1                                  100   3e-42   
ref|XP_002271530.1|  PREDICTED: sucrose synthase 2                      107   3e-42   
gb|AEV40894.1|  sucrose synthase                                        100   4e-42   
gb|ADP88918.1|  sucrose synthase                                      99.4    4e-42   
gb|AEZ00745.1|  SusA1                                                   100   4e-42   
gb|AEN71091.1|  sucrose synthase SusA1                                  100   4e-42   
gb|AFM52237.1|  putative sucrose synthase 6                             100   4e-42   
gb|AEN71089.1|  sucrose synthase SusA1                                  100   4e-42   
gb|AGM14947.1|  sucrose synthase 2                                      103   4e-42   
gb|AGQ57013.1|  sucrose synthase 2                                      103   4e-42   
gb|AEN71094.1|  sucrose synthase SusA1                                  100   5e-42   
ref|NP_192137.1|  sucrose synthase 3                                    100   5e-42   
gb|AAC28175.1|  T2H3.8                                                  100   5e-42   
gb|AEN79501.1|  sucrose synthase 2                                      100   5e-42   
ref|XP_010456053.1|  PREDICTED: sucrose synthase 3-like                 100   5e-42   
gb|AEV40895.1|  sucrose synthase                                        100   6e-42   
gb|KJB24381.1|  hypothetical protein B456_004G142700                    100   6e-42   
gb|AEZ00746.1|  SusA1                                                 99.8    6e-42   
gb|KJB24379.1|  hypothetical protein B456_004G142700                    100   6e-42   
gb|AEN71106.1|  sucrose synthase SusA1                                  100   7e-42   
ref|XP_009800149.1|  PREDICTED: sucrose synthase 2-like                 102   7e-42   
dbj|BAJ10424.1|  sucrose synthase                                       100   9e-42   
gb|KCW81856.1|  hypothetical protein EUGRSUZ_C03207                     105   1e-41   
gb|AFP23359.1|  sucrose synthase                                        103   1e-41   
dbj|BAE79815.1|  sucrose synthase                                       100   1e-41   
gb|KEH24408.1|  sucrose synthase                                        104   2e-41   
gb|KDO87154.1|  hypothetical protein CISIN_1g003492mg                   100   2e-41   
gb|KDO87150.1|  hypothetical protein CISIN_1g003492mg                   101   2e-41   
ref|XP_010049329.1|  PREDICTED: sucrose synthase-like                   105   2e-41   
ref|XP_002874924.1|  hypothetical protein ARALYDRAFT_490342             100   2e-41   
gb|KDP28192.1|  hypothetical protein JCGZ_13963                         102   2e-41   
dbj|BAA88904.1|  sucrose synthase                                       100   2e-41   
ref|XP_010429475.1|  PREDICTED: sucrose synthase 3                    98.6    2e-41   
gb|KDO87151.1|  hypothetical protein CISIN_1g003492mg                   100   2e-41   
ref|XP_006480003.1|  PREDICTED: sucrose synthase 3-like                 100   2e-41   
ref|XP_006444402.1|  hypothetical protein CICLE_v10018889mg             100   2e-41   
gb|KDO87155.1|  hypothetical protein CISIN_1g003492mg                   100   2e-41   
gb|KDO87157.1|  hypothetical protein CISIN_1g003492mg                   101   2e-41   
dbj|BAA88981.1|  sucrose synthase                                       100   2e-41   
gb|AEV40896.1|  sucrose synthase                                      97.8    3e-41   
ref|XP_010422613.1|  PREDICTED: sucrose synthase 3-like               98.6    3e-41   
ref|XP_003554531.1|  PREDICTED: sucrose synthase 2-like                 107   3e-41   
dbj|BAP47501.1|  sucrose synthase                                       103   3e-41   
ref|XP_004495938.1|  PREDICTED: sucrose synthase 2-like                 104   3e-41   
dbj|BAB20799.1|  sucrose synthase 1                                     104   3e-41   
ref|XP_011006464.1|  PREDICTED: sucrose synthase 2                      108   4e-41   
ref|XP_003521575.1|  PREDICTED: sucrose synthase 2-like                 105   4e-41   
gb|EYU46748.1|  hypothetical protein MIMGU_mgv1a001481mg                103   5e-41   
ref|XP_008784779.1|  PREDICTED: sucrose synthase 4-like               99.0    5e-41   
ref|XP_010092252.1|  Sucrose synthase 2                                 106   6e-41   
ref|XP_010558842.1|  PREDICTED: sucrose synthase 3-like               98.2    6e-41   
ref|XP_010556726.1|  PREDICTED: sucrose synthase 3                    98.6    6e-41   
gb|AAK65960.1|AF273253_1  sucrose synthase                              101   6e-41   
gb|AES61743.2|  sucrose synthase                                        102   7e-41   
ref|XP_003591492.1|  Sucrose synthase                                   102   7e-41   
sp|O24301.1|SUS2_PEA  RecName: Full=Sucrose synthase 2; AltName: ...    102   7e-41   
ref|XP_010684343.1|  PREDICTED: sucrose synthase                        101   8e-41   
gb|ABR87939.1|  sucrose synthase 1                                      101   8e-41   
ref|XP_009414138.1|  PREDICTED: sucrose synthase 4-like                 101   9e-41   
ref|XP_006287087.1|  hypothetical protein CARUB_v10000249mg           98.2    1e-40   
ref|XP_006396436.1|  hypothetical protein EUTSA_v10028435mg             102   1e-40   
ref|XP_002523115.1|  sucrose synthase, putative                       99.8    1e-40   
ref|XP_006396435.1|  hypothetical protein EUTSA_v10028435mg             102   1e-40   
ref|XP_010259474.1|  PREDICTED: sucrose synthase 4-like                 100   2e-40   
ref|XP_008454320.1|  PREDICTED: sucrose synthase 2                      100   2e-40   
gb|KFK30802.1|  hypothetical protein AALP_AA6G027800                  99.0    3e-40   
gb|KGN52828.1|  hypothetical protein Csa_4G001950                     99.8    3e-40   
ref|XP_010938368.1|  PREDICTED: LOW QUALITY PROTEIN: sucrose synt...    100   3e-40   
gb|ABG91018.1|  sucrose synthase                                        124   3e-40   
ref|NP_001268888.1|  sucrose synthase 2-like                            100   3e-40   
emb|CAZ65725.1|  sucrose synthase                                       103   4e-40   
ref|XP_011462741.1|  PREDICTED: sucrose synthase 2                      100   4e-40   
ref|XP_008386674.1|  PREDICTED: sucrose synthase 3                      103   4e-40   
ref|NP_001280838.1|  sucrose synthase 3                                 103   4e-40   
ref|XP_002302727.1|  sucrose synthase family protein                    105   5e-40   
gb|AFS17278.1|  sucrose synthase 2                                      103   7e-40   
gb|EMT16287.1|  Sucrose synthase 2                                      102   7e-40   
ref|NP_001275237.1|  sucrose synthase                                 99.0    7e-40   
ref|XP_010921619.1|  PREDICTED: sucrose synthase 4                    97.4    8e-40   
emb|CDY52781.1|  BnaCnng23260D                                        95.9    9e-40   
gb|ABK78798.1|  putative sucrose synthase                               109   1e-39   
gb|ABF95855.1|  Sucrose synthase 2, putative, expressed                 104   1e-39   
gb|ABK78803.1|  putative sucrose synthase                               109   1e-39   
gb|ABK78797.1|  putative sucrose synthase                               109   1e-39   
gb|ABK78781.1|  putative sucrose synthase                               109   1e-39   
ref|XP_010051346.1|  PREDICTED: sucrose synthase-like                   114   2e-39   
ref|NP_001050064.1|  Os03g0340500                                       103   2e-39   
gb|AFZ78660.1|  sucrose synthase                                        106   2e-39   
ref|XP_007035651.1|  Sucrose synthase 2 isoform 1                       106   2e-39   
ref|XP_007035652.1|  Sucrose synthase 2 isoform 2                       106   2e-39   
ref|XP_009111303.1|  PREDICTED: sucrose synthase 3                    95.1    3e-39   
ref|XP_008789904.1|  PREDICTED: sucrose synthase 4                    96.3    4e-39   
gb|AIL88515.1|  sucrose synthase type 3                                 100   4e-39   
ref|XP_009378749.1|  PREDICTED: LOW QUALITY PROTEIN: sucrose synt...    102   4e-39   
ref|XP_010269598.1|  PREDICTED: sucrose synthase 2-like               95.1    5e-39   
emb|CDY22042.1|  BnaA09g00710D                                        94.4    6e-39   
ref|XP_003557951.1|  PREDICTED: sucrose synthase 4                    99.8    6e-39   
gb|AJA37527.1|  sucrose synthase                                        103   1e-38   
gb|KFK36302.1|  hypothetical protein AALP_AA4G104600                  96.7    2e-38   
gb|AIO11846.1|  sucrose synthase                                        103   2e-38   
tpg|DAA45281.1|  TPA: putative sucrose synthase family protein          102   2e-38   
ref|NP_001105194.1|  sucrose synthase2                                  102   2e-38   
ref|XP_009391495.1|  PREDICTED: LOW QUALITY PROTEIN: sucrose synt...    102   2e-38   
gb|ABK78793.1|  putative sucrose synthase                               104   2e-38   
ref|XP_008655408.1|  PREDICTED: sucrose synthase 4-like                 102   2e-38   
gb|ABK78796.1|  putative sucrose synthase                               105   2e-38   
gb|ABK78782.1|  putative sucrose synthase                               105   2e-38   
emb|CAJ32597.1|  sucrose synthase                                     95.9    3e-38   
gb|ABK78792.1|  putative sucrose synthase                               104   3e-38   
gb|KDP27836.1|  hypothetical protein JCGZ_18916                         104   3e-38   
ref|XP_002465303.1|  hypothetical protein SORBIDRAFT_01g035890          102   3e-38   
emb|CDP17108.1|  unnamed protein product                              95.9    3e-38   
ref|XP_011079962.1|  PREDICTED: sucrose synthase 2                      105   4e-38   
ref|XP_008351185.1|  PREDICTED: sucrose synthase 2-like               99.4    5e-38   
ref|XP_009352312.1|  PREDICTED: sucrose synthase 2-like               98.2    8e-38   
ref|XP_008245454.1|  PREDICTED: sucrose synthase 2-like               99.8    1e-37   
ref|XP_004247973.1|  PREDICTED: sucrose synthase 2-like               96.3    1e-37   
ref|XP_008223243.1|  PREDICTED: sucrose synthase 2-like               98.6    1e-37   
ref|XP_006419508.1|  hypothetical protein CICLE_v10004341mg           96.3    1e-37   
ref|XP_006489034.1|  PREDICTED: sucrose synthase 2-like isoform X2    96.3    2e-37   
gb|AHN50409.1|  sucrose synthase 2                                    97.1    2e-37   
dbj|BAE06058.1|  sucrose synthase                                     94.7    3e-37   
ref|XP_008245453.1|  PREDICTED: sucrose synthase 2-like                 103   3e-37   
ref|XP_010484973.1|  PREDICTED: sucrose synthase 2-like                 102   3e-37   
ref|XP_010558803.1|  PREDICTED: sucrose synthase 2                      100   4e-37   
ref|XP_008245451.1|  PREDICTED: sucrose synthase 2-like                 102   4e-37   
emb|CDX85398.1|  BnaC07g27090D                                          102   5e-37   
ref|XP_010440290.1|  PREDICTED: sucrose synthase 2                      102   5e-37   
ref|XP_006395087.1|  hypothetical protein EUTSA_v10003667mg             102   8e-37   
gb|KDO71750.1|  hypothetical protein CISIN_1g003726mg                 96.3    8e-37   
gb|ABR15470.1|  sucrose synthase                                      95.1    8e-37   
ref|XP_010442378.1|  PREDICTED: sucrose synthase 2-like                 101   9e-37   
ref|XP_009151715.1|  PREDICTED: sucrose synthase 2                      101   9e-37   
emb|CDX86250.1|  BnaA06g29670D                                          100   9e-37   
ref|XP_007225257.1|  hypothetical protein PRUPE_ppa001573mg           97.8    1e-36   
gb|AAL27096.1|  sucrose synthase                                        102   2e-36   
ref|XP_004984440.1|  PREDICTED: sucrose synthase 4-like                 100   2e-36   
ref|XP_006279996.1|  hypothetical protein CARUB_v10025867mg             100   2e-36   



>gb|ACL00957.1| sucrose synthase [Ipomoea batatas]
Length=727

 Score =   186 bits (472),  Expect(2) = 5e-79, Method: Compositional matrix adjust.
 Identities = 90/92 (98%), Positives = 91/92 (99%), Gaps = 0/92 (0%)
 Frame = +2

Query  47   MAERVLTRVHSLRERLDATLTAHRNEILLFMSKIESHGKGILKPHQLLAEFEAICKEDQE  226
            MAER LTRVHSLRERLDATLTAHRNEILLFMSKIESHGKGILKPH+LLAEFEAICKEDQE
Sbjct  1    MAERALTRVHSLRERLDATLTAHRNEILLFMSKIESHGKGILKPHELLAEFEAICKEDQE  60

Query  227  KLNDHAFQQVLKSTQEAIVLPPWVALAIRLRP  322
            KLNDHAFQQVLKSTQEAIVLPPWVALAIRLRP
Sbjct  61   KLNDHAFQQVLKSTQEAIVLPPWVALAIRLRP  92


 Score =   135 bits (339),  Expect(2) = 5e-79, Method: Compositional matrix adjust.
 Identities = 65/68 (96%), Positives = 65/68 (96%), Gaps = 0/68 (0%)
 Frame = +1

Query  322  GVWEYVTVNVHALXVEELTVPEYLQFKEELVDGPANGNFVLELDFEPFTASFPKPTLTKS  501
            GVWEYV VNVHAL VEELTVPEYLQFKEELVDGPANGNFVLELDFEPFTASFPKPTLTKS
Sbjct  93   GVWEYVRVNVHALAVEELTVPEYLQFKEELVDGPANGNFVLELDFEPFTASFPKPTLTKS  152

Query  502  IGXGVEFL  525
            IG GVEFL
Sbjct  153  IGNGVEFL  160



>gb|AEN79500.1| sucrose synthase 1 [Orobanche ramosa]
Length=805

 Score =   170 bits (431),  Expect(2) = 3e-71, Method: Compositional matrix adjust.
 Identities = 80/92 (87%), Positives = 88/92 (96%), Gaps = 0/92 (0%)
 Frame = +2

Query  47   MAERVLTRVHSLRERLDATLTAHRNEILLFMSKIESHGKGILKPHQLLAEFEAICKEDQE  226
            MAERVLTRVHSLRERLDATL AHRNEILLF+S++E+HGKGILKPHQL+AEFEAIC+ D+ 
Sbjct  1    MAERVLTRVHSLRERLDATLAAHRNEILLFLSRVEAHGKGILKPHQLVAEFEAICQADKA  60

Query  227  KLNDHAFQQVLKSTQEAIVLPPWVALAIRLRP  322
            KL DHAFQ+VLKSTQEAIVLPPWVALAIRLRP
Sbjct  61   KLQDHAFQEVLKSTQEAIVLPPWVALAIRLRP  92


 Score =   124 bits (312),  Expect(2) = 3e-71, Method: Compositional matrix adjust.
 Identities = 60/68 (88%), Positives = 63/68 (93%), Gaps = 0/68 (0%)
 Frame = +1

Query  322  GVWEYVTVNVHALXVEELTVPEYLQFKEELVDGPANGNFVLELDFEPFTASFPKPTLTKS  501
            GVWEYV VNV+AL VEELTVP+YL FKEELV+G ANGNFVLELDFEPFTASFPKPTLTKS
Sbjct  93   GVWEYVRVNVNALVVEELTVPQYLHFKEELVNGAANGNFVLELDFEPFTASFPKPTLTKS  152

Query  502  IGXGVEFL  525
            IG GVEFL
Sbjct  153  IGNGVEFL  160



>ref|XP_006353766.1| PREDICTED: sucrose synthase 2 isoform X2 [Solanum tuberosum]
Length=805

 Score =   172 bits (437),  Expect(2) = 4e-71, Method: Compositional matrix adjust.
 Identities = 83/92 (90%), Positives = 90/92 (98%), Gaps = 0/92 (0%)
 Frame = +2

Query  47   MAERVLTRVHSLRERLDATLTAHRNEILLFMSKIESHGKGILKPHQLLAEFEAICKEDQE  226
            MAERVLTRVHSLRERLDATL AHRNEILLF+S+IESHGKGILKPHQLLAEFE+I KED++
Sbjct  1    MAERVLTRVHSLRERLDATLAAHRNEILLFLSRIESHGKGILKPHQLLAEFESIHKEDKD  60

Query  227  KLNDHAFQQVLKSTQEAIVLPPWVALAIRLRP  322
            KLNDHAF++VLKSTQEAIVLPPWVALAIRLRP
Sbjct  61   KLNDHAFEEVLKSTQEAIVLPPWVALAIRLRP  92


 Score =   122 bits (305),  Expect(2) = 4e-71, Method: Compositional matrix adjust.
 Identities = 59/68 (87%), Positives = 63/68 (93%), Gaps = 0/68 (0%)
 Frame = +1

Query  322  GVWEYVTVNVHALXVEELTVPEYLQFKEELVDGPANGNFVLELDFEPFTASFPKPTLTKS  501
            GVWEYV VNV+AL VEELTVPE+LQFKEELV+G +N NFVLELDFEPFTASFPKPTLTKS
Sbjct  93   GVWEYVRVNVNALIVEELTVPEFLQFKEELVNGTSNDNFVLELDFEPFTASFPKPTLTKS  152

Query  502  IGXGVEFL  525
            IG GVEFL
Sbjct  153  IGNGVEFL  160



>sp|P49039.1|SUS2_SOLTU RecName: Full=Sucrose synthase; AltName: Full=SS65; AltName: 
Full=Sucrose-UDP glucosyltransferase [Solanum tuberosum]
 gb|AAA97572.1| sucrose synthase [Solanum tuberosum]
Length=805

 Score =   172 bits (437),  Expect(2) = 4e-71, Method: Compositional matrix adjust.
 Identities = 83/92 (90%), Positives = 90/92 (98%), Gaps = 0/92 (0%)
 Frame = +2

Query  47   MAERVLTRVHSLRERLDATLTAHRNEILLFMSKIESHGKGILKPHQLLAEFEAICKEDQE  226
            MAERVLTRVHSLRERLDATL AHRNEILLF+S+IESHGKGILKPHQLLAEFE+I KED++
Sbjct  1    MAERVLTRVHSLRERLDATLAAHRNEILLFLSRIESHGKGILKPHQLLAEFESIHKEDKD  60

Query  227  KLNDHAFQQVLKSTQEAIVLPPWVALAIRLRP  322
            KLNDHAF++VLKSTQEAIVLPPWVALAIRLRP
Sbjct  61   KLNDHAFEEVLKSTQEAIVLPPWVALAIRLRP  92


 Score =   122 bits (305),  Expect(2) = 4e-71, Method: Compositional matrix adjust.
 Identities = 59/68 (87%), Positives = 63/68 (93%), Gaps = 0/68 (0%)
 Frame = +1

Query  322  GVWEYVTVNVHALXVEELTVPEYLQFKEELVDGPANGNFVLELDFEPFTASFPKPTLTKS  501
            GVWEYV VNV+AL VEELTVPE+LQFKEELV+G +N NFVLELDFEPFTASFPKPTLTKS
Sbjct  93   GVWEYVRVNVNALIVEELTVPEFLQFKEELVNGTSNDNFVLELDFEPFTASFPKPTLTKS  152

Query  502  IGXGVEFL  525
            IG GVEFL
Sbjct  153  IGNGVEFL  160



>ref|NP_001274911.1| sucrose synthase 2 [Solanum tuberosum]
 gb|AAO34668.1| sucrose synthase 2 [Solanum tuberosum]
Length=805

 Score =   172 bits (437),  Expect(2) = 4e-71, Method: Compositional matrix adjust.
 Identities = 83/92 (90%), Positives = 90/92 (98%), Gaps = 0/92 (0%)
 Frame = +2

Query  47   MAERVLTRVHSLRERLDATLTAHRNEILLFMSKIESHGKGILKPHQLLAEFEAICKEDQE  226
            MAERVLTRVHSLRERLDATL AHRNEILLF+S+IESHGKGILKPHQLLAEFE+I KED++
Sbjct  1    MAERVLTRVHSLRERLDATLAAHRNEILLFLSRIESHGKGILKPHQLLAEFESIHKEDKD  60

Query  227  KLNDHAFQQVLKSTQEAIVLPPWVALAIRLRP  322
            KLNDHAF++VLKSTQEAIVLPPWVALAIRLRP
Sbjct  61   KLNDHAFEEVLKSTQEAIVLPPWVALAIRLRP  92


 Score =   122 bits (305),  Expect(2) = 4e-71, Method: Compositional matrix adjust.
 Identities = 59/68 (87%), Positives = 63/68 (93%), Gaps = 0/68 (0%)
 Frame = +1

Query  322  GVWEYVTVNVHALXVEELTVPEYLQFKEELVDGPANGNFVLELDFEPFTASFPKPTLTKS  501
            GVWEYV VNV+AL VEELTVPE+LQFKEELV+G +N NFVLELDFEPFTASFPKPTLTKS
Sbjct  93   GVWEYVRVNVNALIVEELTVPEFLQFKEELVNGTSNDNFVLELDFEPFTASFPKPTLTKS  152

Query  502  IGXGVEFL  525
            IG GVEFL
Sbjct  153  IGNGVEFL  160



>ref|XP_011093886.1| PREDICTED: sucrose synthase [Sesamum indicum]
 ref|XP_011093887.1| PREDICTED: sucrose synthase [Sesamum indicum]
 ref|XP_011093888.1| PREDICTED: sucrose synthase [Sesamum indicum]
 ref|XP_011093889.1| PREDICTED: sucrose synthase [Sesamum indicum]
 ref|XP_011093890.1| PREDICTED: sucrose synthase [Sesamum indicum]
Length=805

 Score =   170 bits (430),  Expect(2) = 5e-71, Method: Compositional matrix adjust.
 Identities = 80/92 (87%), Positives = 87/92 (95%), Gaps = 0/92 (0%)
 Frame = +2

Query  47   MAERVLTRVHSLRERLDATLTAHRNEILLFMSKIESHGKGILKPHQLLAEFEAICKEDQE  226
            MAERVLTRVHSLRERLDATL AHRNEILLF+S+IE+HGKGILKPHQL+AEFEAIC  D+E
Sbjct  1    MAERVLTRVHSLRERLDATLAAHRNEILLFLSRIEAHGKGILKPHQLMAEFEAICAADKE  60

Query  227  KLNDHAFQQVLKSTQEAIVLPPWVALAIRLRP  322
            KL DHAF++VLKSTQEAIV PPWVALAIRLRP
Sbjct  61   KLQDHAFKEVLKSTQEAIVFPPWVALAIRLRP  92


 Score =   124 bits (312),  Expect(2) = 5e-71, Method: Compositional matrix adjust.
 Identities = 61/68 (90%), Positives = 63/68 (93%), Gaps = 0/68 (0%)
 Frame = +1

Query  322  GVWEYVTVNVHALXVEELTVPEYLQFKEELVDGPANGNFVLELDFEPFTASFPKPTLTKS  501
            GVWEYV VNV+AL VEELTVPEYLQFKE LV+G ANGNFVLELDFEPFTASFPKPTLTKS
Sbjct  93   GVWEYVRVNVNALVVEELTVPEYLQFKEVLVNGTANGNFVLELDFEPFTASFPKPTLTKS  152

Query  502  IGXGVEFL  525
            IG GVEFL
Sbjct  153  IGNGVEFL  160



>ref|XP_009589756.1| PREDICTED: sucrose synthase [Nicotiana tomentosiformis]
 ref|XP_009589757.1| PREDICTED: sucrose synthase [Nicotiana tomentosiformis]
Length=805

 Score =   168 bits (425),  Expect(2) = 6e-71, Method: Compositional matrix adjust.
 Identities = 80/92 (87%), Positives = 90/92 (98%), Gaps = 0/92 (0%)
 Frame = +2

Query  47   MAERVLTRVHSLRERLDATLTAHRNEILLFMSKIESHGKGILKPHQLLAEFEAICKEDQE  226
            MAERVLTRVHSLRERLDATL AHRNEILLF+S+IESHGKGILKPHQLLAEF+AI ++D++
Sbjct  1    MAERVLTRVHSLRERLDATLAAHRNEILLFLSRIESHGKGILKPHQLLAEFDAIRQDDKK  60

Query  227  KLNDHAFQQVLKSTQEAIVLPPWVALAIRLRP  322
            KLNDHAF+++LKSTQEAIVLPPWVALAIRLRP
Sbjct  61   KLNDHAFEELLKSTQEAIVLPPWVALAIRLRP  92


 Score =   125 bits (315),  Expect(2) = 6e-71, Method: Compositional matrix adjust.
 Identities = 61/68 (90%), Positives = 63/68 (93%), Gaps = 0/68 (0%)
 Frame = +1

Query  322  GVWEYVTVNVHALXVEELTVPEYLQFKEELVDGPANGNFVLELDFEPFTASFPKPTLTKS  501
            GVWEYV VNV+AL VEELTVPEYL FKEELVDG +NGNFVLELDFEPFTASFPKPTLTKS
Sbjct  93   GVWEYVRVNVNALVVEELTVPEYLHFKEELVDGTSNGNFVLELDFEPFTASFPKPTLTKS  152

Query  502  IGXGVEFL  525
            IG GVEFL
Sbjct  153  IGNGVEFL  160



>ref|XP_009625446.1| PREDICTED: sucrose synthase [Nicotiana tomentosiformis]
Length=805

 Score =   169 bits (427),  Expect(2) = 2e-70, Method: Compositional matrix adjust.
 Identities = 82/92 (89%), Positives = 88/92 (96%), Gaps = 0/92 (0%)
 Frame = +2

Query  47   MAERVLTRVHSLRERLDATLTAHRNEILLFMSKIESHGKGILKPHQLLAEFEAICKEDQE  226
            MAERVLTRVHSLRERLDATL AHRNEILLF+S+IESHGKGILKPHQLLAEFE+I KED+ 
Sbjct  1    MAERVLTRVHSLRERLDATLAAHRNEILLFLSRIESHGKGILKPHQLLAEFESIHKEDKN  60

Query  227  KLNDHAFQQVLKSTQEAIVLPPWVALAIRLRP  322
            KLNDHAF++VLKSTQEAIVL PWVALAIRLRP
Sbjct  61   KLNDHAFEEVLKSTQEAIVLSPWVALAIRLRP  92


 Score =   124 bits (310),  Expect(2) = 2e-70, Method: Compositional matrix adjust.
 Identities = 60/68 (88%), Positives = 63/68 (93%), Gaps = 0/68 (0%)
 Frame = +1

Query  322  GVWEYVTVNVHALXVEELTVPEYLQFKEELVDGPANGNFVLELDFEPFTASFPKPTLTKS  501
            GVWEYV VNV+AL VEELTVPEYLQFKEELV+G +N NFVLELDFEPFTASFPKPTLTKS
Sbjct  93   GVWEYVRVNVNALIVEELTVPEYLQFKEELVNGTSNDNFVLELDFEPFTASFPKPTLTKS  152

Query  502  IGXGVEFL  525
            IG GVEFL
Sbjct  153  IGNGVEFL  160



>gb|ABV02029.1| sucrose sythase [Nicotiana langsdorffii x Nicotiana sanderae]
Length=805

 Score =   168 bits (425),  Expect(2) = 2e-70, Method: Compositional matrix adjust.
 Identities = 80/92 (87%), Positives = 90/92 (98%), Gaps = 0/92 (0%)
 Frame = +2

Query  47   MAERVLTRVHSLRERLDATLTAHRNEILLFMSKIESHGKGILKPHQLLAEFEAICKEDQE  226
            MAERVLTRVHSLRERLDATL AHRNEILLF+S+IESHGKGILKPHQLLAEF+AI ++D++
Sbjct  1    MAERVLTRVHSLRERLDATLAAHRNEILLFLSRIESHGKGILKPHQLLAEFDAIRQDDKK  60

Query  227  KLNDHAFQQVLKSTQEAIVLPPWVALAIRLRP  322
            KLNDHAF+++LKSTQEAIVLPPWVALAIRLRP
Sbjct  61   KLNDHAFEELLKSTQEAIVLPPWVALAIRLRP  92


 Score =   124 bits (311),  Expect(2) = 2e-70, Method: Compositional matrix adjust.
 Identities = 60/68 (88%), Positives = 62/68 (91%), Gaps = 0/68 (0%)
 Frame = +1

Query  322  GVWEYVTVNVHALXVEELTVPEYLQFKEELVDGPANGNFVLELDFEPFTASFPKPTLTKS  501
            GVWEYV VNV+AL VEEL VPEYL FKEELVDG +NGNFVLELDFEPFTASFPKPTLTKS
Sbjct  93   GVWEYVRVNVNALAVEELAVPEYLHFKEELVDGTSNGNFVLELDFEPFTASFPKPTLTKS  152

Query  502  IGXGVEFL  525
            IG GVEFL
Sbjct  153  IGNGVEFL  160



>ref|XP_009760458.1| PREDICTED: sucrose synthase [Nicotiana sylvestris]
 ref|XP_009760459.1| PREDICTED: sucrose synthase [Nicotiana sylvestris]
Length=805

 Score =   166 bits (421),  Expect(2) = 2e-70, Method: Compositional matrix adjust.
 Identities = 79/92 (86%), Positives = 89/92 (97%), Gaps = 0/92 (0%)
 Frame = +2

Query  47   MAERVLTRVHSLRERLDATLTAHRNEILLFMSKIESHGKGILKPHQLLAEFEAICKEDQE  226
            MAER LTRVHSLRERLDATL AHRNEILLF+S+IESHGKGILKPHQLLAEF+AI ++D++
Sbjct  1    MAERALTRVHSLRERLDATLAAHRNEILLFLSRIESHGKGILKPHQLLAEFDAIRQDDKK  60

Query  227  KLNDHAFQQVLKSTQEAIVLPPWVALAIRLRP  322
            KLNDHAF+++LKSTQEAIVLPPWVALAIRLRP
Sbjct  61   KLNDHAFEELLKSTQEAIVLPPWVALAIRLRP  92


 Score =   126 bits (316),  Expect(2) = 2e-70, Method: Compositional matrix adjust.
 Identities = 61/68 (90%), Positives = 63/68 (93%), Gaps = 0/68 (0%)
 Frame = +1

Query  322  GVWEYVTVNVHALXVEELTVPEYLQFKEELVDGPANGNFVLELDFEPFTASFPKPTLTKS  501
            GVWEYV VNV+AL VEELTVPEYL FKEELVDG +NGNFVLELDFEPFTASFPKPTLTKS
Sbjct  93   GVWEYVRVNVNALVVEELTVPEYLHFKEELVDGTSNGNFVLELDFEPFTASFPKPTLTKS  152

Query  502  IGXGVEFL  525
            IG GVEFL
Sbjct  153  IGNGVEFL  160



>gb|AHL84158.1| sucrose synthase [Nicotiana tabacum]
Length=805

 Score =   169 bits (427),  Expect(2) = 2e-70, Method: Compositional matrix adjust.
 Identities = 82/92 (89%), Positives = 88/92 (96%), Gaps = 0/92 (0%)
 Frame = +2

Query  47   MAERVLTRVHSLRERLDATLTAHRNEILLFMSKIESHGKGILKPHQLLAEFEAICKEDQE  226
            MAERVLTRVHSLRERLDATL AHRNEILLF+S+IESHGKGILKPHQLLAEFE+I KED+ 
Sbjct  1    MAERVLTRVHSLRERLDATLAAHRNEILLFLSRIESHGKGILKPHQLLAEFESIHKEDKN  60

Query  227  KLNDHAFQQVLKSTQEAIVLPPWVALAIRLRP  322
            KLNDHAF++VLKSTQEAIVL PWVALAIRLRP
Sbjct  61   KLNDHAFEEVLKSTQEAIVLSPWVALAIRLRP  92


 Score =   123 bits (309),  Expect(2) = 2e-70, Method: Compositional matrix adjust.
 Identities = 60/68 (88%), Positives = 63/68 (93%), Gaps = 0/68 (0%)
 Frame = +1

Query  322  GVWEYVTVNVHALXVEELTVPEYLQFKEELVDGPANGNFVLELDFEPFTASFPKPTLTKS  501
            GVWEYV VNV+AL VEELTVPEYLQFKEELV+G +N NFVLELDFEPFTASFPKPTLTKS
Sbjct  93   GVWEYVRVNVNALIVEELTVPEYLQFKEELVNGTSNDNFVLELDFEPFTASFPKPTLTKS  152

Query  502  IGXGVEFL  525
            IG GVEFL
Sbjct  153  IGNGVEFL  160



>ref|XP_010323602.1| PREDICTED: sucrose synthase isoform X1 [Solanum lycopersicum]
 ref|XP_010323603.1| PREDICTED: sucrose synthase isoform X1 [Solanum lycopersicum]
 ref|XP_010323604.1| PREDICTED: sucrose synthase isoform X1 [Solanum lycopersicum]
 ref|XP_010323605.1| PREDICTED: sucrose synthase isoform X1 [Solanum lycopersicum]
 gb|ADM47608.1| sucrose synthase isoform 3 [Solanum lycopersicum]
Length=805

 Score =   171 bits (434),  Expect(2) = 4e-70, Method: Compositional matrix adjust.
 Identities = 82/92 (89%), Positives = 90/92 (98%), Gaps = 0/92 (0%)
 Frame = +2

Query  47   MAERVLTRVHSLRERLDATLTAHRNEILLFMSKIESHGKGILKPHQLLAEFEAICKEDQE  226
            MA+RVLTRVHSLRERLDATL AHRNEILLF+S+IESHGKGILKPHQLLAEFE+I KED++
Sbjct  1    MAQRVLTRVHSLRERLDATLDAHRNEILLFLSRIESHGKGILKPHQLLAEFESIQKEDKD  60

Query  227  KLNDHAFQQVLKSTQEAIVLPPWVALAIRLRP  322
            KLNDHAF++VLKSTQEAIVLPPWVALAIRLRP
Sbjct  61   KLNDHAFEEVLKSTQEAIVLPPWVALAIRLRP  92


 Score =   120 bits (300),  Expect(2) = 4e-70, Method: Compositional matrix adjust.
 Identities = 58/68 (85%), Positives = 63/68 (93%), Gaps = 0/68 (0%)
 Frame = +1

Query  322  GVWEYVTVNVHALXVEELTVPEYLQFKEELVDGPANGNFVLELDFEPFTASFPKPTLTKS  501
            GVWEYV VNV+AL VEELTVPE+LQFKEELV+G ++ NFVLELDFEPFTASFPKPTLTKS
Sbjct  93   GVWEYVRVNVNALSVEELTVPEFLQFKEELVNGTSSDNFVLELDFEPFTASFPKPTLTKS  152

Query  502  IGXGVEFL  525
            IG GVEFL
Sbjct  153  IGNGVEFL  160



>ref|NP_001234804.1| sucrose synthase [Solanum lycopersicum]
 emb|CAA09593.1| sucrose synthase [Solanum lycopersicum]
Length=805

 Score =   171 bits (434),  Expect(2) = 4e-70, Method: Compositional matrix adjust.
 Identities = 82/92 (89%), Positives = 90/92 (98%), Gaps = 0/92 (0%)
 Frame = +2

Query  47   MAERVLTRVHSLRERLDATLTAHRNEILLFMSKIESHGKGILKPHQLLAEFEAICKEDQE  226
            MA+RVLTRVHSLRERLDATL AHRNEILLF+S+IESHGKGILKPHQLLAEFE+I KED++
Sbjct  1    MAQRVLTRVHSLRERLDATLDAHRNEILLFLSRIESHGKGILKPHQLLAEFESIQKEDKD  60

Query  227  KLNDHAFQQVLKSTQEAIVLPPWVALAIRLRP  322
            KLNDHAF++VLKSTQEAIVLPPWVALAIRLRP
Sbjct  61   KLNDHAFEEVLKSTQEAIVLPPWVALAIRLRP  92


 Score =   120 bits (300),  Expect(2) = 4e-70, Method: Compositional matrix adjust.
 Identities = 58/68 (85%), Positives = 63/68 (93%), Gaps = 0/68 (0%)
 Frame = +1

Query  322  GVWEYVTVNVHALXVEELTVPEYLQFKEELVDGPANGNFVLELDFEPFTASFPKPTLTKS  501
            GVWEYV VNV+AL VEELTVPE+LQFKEELV+G ++ NFVLELDFEPFTASFPKPTLTKS
Sbjct  93   GVWEYVRVNVNALSVEELTVPEFLQFKEELVNGTSSDNFVLELDFEPFTASFPKPTLTKS  152

Query  502  IGXGVEFL  525
            IG GVEFL
Sbjct  153  IGNGVEFL  160



>ref|NP_001275286.1| sucrose synthase [Solanum tuberosum]
 emb|CAD61188.1| sucrose synthase 4 [Solanum tuberosum]
Length=805

 Score =   163 bits (413),  Expect(2) = 1e-69, Method: Compositional matrix adjust.
 Identities = 77/92 (84%), Positives = 89/92 (97%), Gaps = 0/92 (0%)
 Frame = +2

Query  47   MAERVLTRVHSLRERLDATLTAHRNEILLFMSKIESHGKGILKPHQLLAEFEAICKEDQE  226
            MAERVLTRVHSLRER+DATL AHRNEILLF+S+IESHGKGILKPH+LLAEF+AI ++D+ 
Sbjct  1    MAERVLTRVHSLRERVDATLAAHRNEILLFLSRIESHGKGILKPHELLAEFDAIRQDDKN  60

Query  227  KLNDHAFQQVLKSTQEAIVLPPWVALAIRLRP  322
            KLN+HAF+++LKSTQEAIVLPPWVALAIRLRP
Sbjct  61   KLNEHAFEELLKSTQEAIVLPPWVALAIRLRP  92


 Score =   126 bits (317),  Expect(2) = 1e-69, Method: Compositional matrix adjust.
 Identities = 60/68 (88%), Positives = 64/68 (94%), Gaps = 0/68 (0%)
 Frame = +1

Query  322  GVWEYVTVNVHALXVEELTVPEYLQFKEELVDGPANGNFVLELDFEPFTASFPKPTLTKS  501
            GVWEY+ VNV+AL VEEL+VPEYLQFKEELVDG +NGNFVLELDFEPFTASFPKPTLTKS
Sbjct  93   GVWEYIRVNVNALVVEELSVPEYLQFKEELVDGASNGNFVLELDFEPFTASFPKPTLTKS  152

Query  502  IGXGVEFL  525
            IG GVEFL
Sbjct  153  IGNGVEFL  160



>sp|P10691.1|SUS1_SOLTU RecName: Full=Sucrose synthase; AltName: Full=SS16; AltName: 
Full=Sucrose-UDP glucosyltransferase [Solanum tuberosum]
 gb|AAA33841.1| sucrase synthase (EC 2.4.1.13) [Solanum tuberosum]
Length=805

 Score =   163 bits (413),  Expect(2) = 1e-69, Method: Compositional matrix adjust.
 Identities = 77/92 (84%), Positives = 89/92 (97%), Gaps = 0/92 (0%)
 Frame = +2

Query  47   MAERVLTRVHSLRERLDATLTAHRNEILLFMSKIESHGKGILKPHQLLAEFEAICKEDQE  226
            MAERVLTRVHSLRER+DATL AHRNEILLF+S+IESHGKGILKPH+LLAEF+AI ++D+ 
Sbjct  1    MAERVLTRVHSLRERVDATLAAHRNEILLFLSRIESHGKGILKPHELLAEFDAIRQDDKN  60

Query  227  KLNDHAFQQVLKSTQEAIVLPPWVALAIRLRP  322
            KLN+HAF+++LKSTQEAIVLPPWVALAIRLRP
Sbjct  61   KLNEHAFEELLKSTQEAIVLPPWVALAIRLRP  92


 Score =   126 bits (317),  Expect(2) = 1e-69, Method: Compositional matrix adjust.
 Identities = 60/68 (88%), Positives = 64/68 (94%), Gaps = 0/68 (0%)
 Frame = +1

Query  322  GVWEYVTVNVHALXVEELTVPEYLQFKEELVDGPANGNFVLELDFEPFTASFPKPTLTKS  501
            GVWEY+ VNV+AL VEEL+VPEYLQFKEELVDG +NGNFVLELDFEPFTASFPKPTLTKS
Sbjct  93   GVWEYIRVNVNALVVEELSVPEYLQFKEELVDGASNGNFVLELDFEPFTASFPKPTLTKS  152

Query  502  IGXGVEFL  525
            IG GVEFL
Sbjct  153  IGNGVEFL  160



>ref|XP_006345244.1| PREDICTED: uncharacterized LOC102577594 [Solanum tuberosum]
Length=805

 Score =   163 bits (413),  Expect(2) = 1e-69, Method: Compositional matrix adjust.
 Identities = 77/92 (84%), Positives = 89/92 (97%), Gaps = 0/92 (0%)
 Frame = +2

Query  47   MAERVLTRVHSLRERLDATLTAHRNEILLFMSKIESHGKGILKPHQLLAEFEAICKEDQE  226
            MAERVLTRVHSLRER+DATL AHRNEILLF+S+IESHGKGILKPH+LLAEF+AI ++D+ 
Sbjct  1    MAERVLTRVHSLRERVDATLAAHRNEILLFLSRIESHGKGILKPHELLAEFDAIRQDDKN  60

Query  227  KLNDHAFQQVLKSTQEAIVLPPWVALAIRLRP  322
            KLN+HAF+++LKSTQEAIVLPPWVALAIRLRP
Sbjct  61   KLNEHAFEELLKSTQEAIVLPPWVALAIRLRP  92


 Score =   126 bits (317),  Expect(2) = 1e-69, Method: Compositional matrix adjust.
 Identities = 60/68 (88%), Positives = 64/68 (94%), Gaps = 0/68 (0%)
 Frame = +1

Query  322  GVWEYVTVNVHALXVEELTVPEYLQFKEELVDGPANGNFVLELDFEPFTASFPKPTLTKS  501
            GVWEY+ VNV+AL VEEL+VPEYLQFKEELVDG +NGNFVLELDFEPFTASFPKPTLTKS
Sbjct  93   GVWEYIRVNVNALVVEELSVPEYLQFKEELVDGASNGNFVLELDFEPFTASFPKPTLTKS  152

Query  502  IGXGVEFL  525
            IG GVEFL
Sbjct  153  IGNGVEFL  160



>gb|AAA97571.1| sucrose synthase [Solanum tuberosum]
Length=805

 Score =   163 bits (413),  Expect(2) = 1e-69, Method: Compositional matrix adjust.
 Identities = 77/92 (84%), Positives = 89/92 (97%), Gaps = 0/92 (0%)
 Frame = +2

Query  47   MAERVLTRVHSLRERLDATLTAHRNEILLFMSKIESHGKGILKPHQLLAEFEAICKEDQE  226
            MAERVLTRVHSLRER+DATL AHRNEILLF+S+IESHGKGILKPH+LLAEF+AI ++D+ 
Sbjct  1    MAERVLTRVHSLRERVDATLAAHRNEILLFLSRIESHGKGILKPHELLAEFDAIRQDDKN  60

Query  227  KLNDHAFQQVLKSTQEAIVLPPWVALAIRLRP  322
            KLN+HAF+++LKSTQEAIVLPPWVALAIRLRP
Sbjct  61   KLNEHAFEELLKSTQEAIVLPPWVALAIRLRP  92


 Score =   126 bits (317),  Expect(2) = 1e-69, Method: Compositional matrix adjust.
 Identities = 60/68 (88%), Positives = 64/68 (94%), Gaps = 0/68 (0%)
 Frame = +1

Query  322  GVWEYVTVNVHALXVEELTVPEYLQFKEELVDGPANGNFVLELDFEPFTASFPKPTLTKS  501
            GVWEY+ VNV+AL VEEL+VPEYLQFKEELVDG +NGNFVLELDFEPFTASFPKPTLTKS
Sbjct  93   GVWEYIRVNVNALVVEELSVPEYLQFKEELVDGASNGNFVLELDFEPFTASFPKPTLTKS  152

Query  502  IGXGVEFL  525
            IG GVEFL
Sbjct  153  IGNGVEFL  160



>ref|XP_009792656.1| PREDICTED: sucrose synthase [Nicotiana sylvestris]
Length=805

 Score =   167 bits (424),  Expect(2) = 1e-69, Method: Compositional matrix adjust.
 Identities = 81/92 (88%), Positives = 88/92 (96%), Gaps = 0/92 (0%)
 Frame = +2

Query  47   MAERVLTRVHSLRERLDATLTAHRNEILLFMSKIESHGKGILKPHQLLAEFEAICKEDQE  226
            MAERVLTRVHSLRERLDATL AHRNEILLF+S+IESHGKGILKPHQLLAEF++I KED+ 
Sbjct  1    MAERVLTRVHSLRERLDATLAAHRNEILLFLSRIESHGKGILKPHQLLAEFDSIHKEDKN  60

Query  227  KLNDHAFQQVLKSTQEAIVLPPWVALAIRLRP  322
            KLNDHAF++VLKSTQEAIVL PWVALAIRLRP
Sbjct  61   KLNDHAFEEVLKSTQEAIVLSPWVALAIRLRP  92


 Score =   122 bits (305),  Expect(2) = 1e-69, Method: Compositional matrix adjust.
 Identities = 59/68 (87%), Positives = 63/68 (93%), Gaps = 0/68 (0%)
 Frame = +1

Query  322  GVWEYVTVNVHALXVEELTVPEYLQFKEELVDGPANGNFVLELDFEPFTASFPKPTLTKS  501
            GVWEYV VNV+AL VEELTVPEYLQFKEELV+G ++ NFVLELDFEPFTASFPKPTLTKS
Sbjct  93   GVWEYVRVNVNALVVEELTVPEYLQFKEELVNGTSHDNFVLELDFEPFTASFPKPTLTKS  152

Query  502  IGXGVEFL  525
            IG GVEFL
Sbjct  153  IGNGVEFL  160



>emb|CAJ32596.1| sucrose synthase [Coffea arabica]
Length=806

 Score =   162 bits (411),  Expect(2) = 2e-69, Method: Compositional matrix adjust.
 Identities = 76/92 (83%), Positives = 88/92 (96%), Gaps = 0/92 (0%)
 Frame = +2

Query  47   MAERVLTRVHSLRERLDATLTAHRNEILLFMSKIESHGKGILKPHQLLAEFEAICKEDQE  226
            MAERVLTRVHSLRERLDATL AHRN++LLFMS++E+HGKGILKPHQLLAEFE I K+ ++
Sbjct  1    MAERVLTRVHSLRERLDATLAAHRNDVLLFMSRLETHGKGILKPHQLLAEFEEINKDGKQ  60

Query  227  KLNDHAFQQVLKSTQEAIVLPPWVALAIRLRP  322
            K++DHAF++VLKSTQEAIVLPPWVALAIRLRP
Sbjct  61   KIHDHAFEEVLKSTQEAIVLPPWVALAIRLRP  92


 Score =   126 bits (316),  Expect(2) = 2e-69, Method: Compositional matrix adjust.
 Identities = 61/68 (90%), Positives = 61/68 (90%), Gaps = 0/68 (0%)
 Frame = +1

Query  322  GVWEYVTVNVHALXVEELTVPEYLQFKEELVDGPANGNFVLELDFEPFTASFPKPTLTKS  501
            GVWEYV VNVHAL VEELTVPEYL FKEELVDG  NGNFVLELDFEPFTASFPKPTLTK 
Sbjct  93   GVWEYVRVNVHALVVEELTVPEYLHFKEELVDGSKNGNFVLELDFEPFTASFPKPTLTKY  152

Query  502  IGXGVEFL  525
            IG GVEFL
Sbjct  153  IGDGVEFL  160



>emb|CAI56307.1| sucrose synthase [Coffea canephora]
 emb|CDP03035.1| unnamed protein product [Coffea canephora]
Length=806

 Score =   162 bits (411),  Expect(2) = 2e-69, Method: Compositional matrix adjust.
 Identities = 76/92 (83%), Positives = 88/92 (96%), Gaps = 0/92 (0%)
 Frame = +2

Query  47   MAERVLTRVHSLRERLDATLTAHRNEILLFMSKIESHGKGILKPHQLLAEFEAICKEDQE  226
            MAERVLTRVHSLRERLDATL AHRN++LLFMS++E+HGKGILKPHQLLAEFE I K+ ++
Sbjct  1    MAERVLTRVHSLRERLDATLAAHRNDVLLFMSRLETHGKGILKPHQLLAEFEEINKDGKQ  60

Query  227  KLNDHAFQQVLKSTQEAIVLPPWVALAIRLRP  322
            K++DHAF++VLKSTQEAIVLPPWVALAIRLRP
Sbjct  61   KIHDHAFEEVLKSTQEAIVLPPWVALAIRLRP  92


 Score =   126 bits (316),  Expect(2) = 2e-69, Method: Compositional matrix adjust.
 Identities = 61/68 (90%), Positives = 61/68 (90%), Gaps = 0/68 (0%)
 Frame = +1

Query  322  GVWEYVTVNVHALXVEELTVPEYLQFKEELVDGPANGNFVLELDFEPFTASFPKPTLTKS  501
            GVWEYV VNVHAL VEELTVPEYL FKEELVDG  NGNFVLELDFEPFTASFPKPTLTK 
Sbjct  93   GVWEYVRVNVHALVVEELTVPEYLHFKEELVDGSKNGNFVLELDFEPFTASFPKPTLTKY  152

Query  502  IGXGVEFL  525
            IG GVEFL
Sbjct  153  IGDGVEFL  160



>gb|ABI17891.1| sucrose synthase [Coffea canephora]
Length=806

 Score =   162 bits (411),  Expect(2) = 2e-69, Method: Compositional matrix adjust.
 Identities = 76/92 (83%), Positives = 88/92 (96%), Gaps = 0/92 (0%)
 Frame = +2

Query  47   MAERVLTRVHSLRERLDATLTAHRNEILLFMSKIESHGKGILKPHQLLAEFEAICKEDQE  226
            MAERVLTRVHSLRERLDATL AHRN++LLFMS++E+HGKGILKPHQLLAEFE I K+ ++
Sbjct  1    MAERVLTRVHSLRERLDATLAAHRNDVLLFMSRLETHGKGILKPHQLLAEFEEINKDGKQ  60

Query  227  KLNDHAFQQVLKSTQEAIVLPPWVALAIRLRP  322
            K++DHAF++VLKSTQEAIVLPPWVALAIRLRP
Sbjct  61   KIHDHAFEEVLKSTQEAIVLPPWVALAIRLRP  92


 Score =   126 bits (316),  Expect(2) = 2e-69, Method: Compositional matrix adjust.
 Identities = 61/68 (90%), Positives = 61/68 (90%), Gaps = 0/68 (0%)
 Frame = +1

Query  322  GVWEYVTVNVHALXVEELTVPEYLQFKEELVDGPANGNFVLELDFEPFTASFPKPTLTKS  501
            GVWEYV VNVHAL VEELTVPEYL FKEELVDG  NGNFVLELDFEPFTASFPKPTLTK 
Sbjct  93   GVWEYVRVNVHALVVEELTVPEYLHFKEELVDGSKNGNFVLELDFEPFTASFPKPTLTKY  152

Query  502  IGXGVEFL  525
            IG GVEFL
Sbjct  153  IGDGVEFL  160



>emb|CAA09681.1| sucrose synthase [Solanum lycopersicum]
Length=805

 Score =   161 bits (408),  Expect(2) = 3e-69, Method: Compositional matrix adjust.
 Identities = 76/92 (83%), Positives = 89/92 (97%), Gaps = 0/92 (0%)
 Frame = +2

Query  47   MAERVLTRVHSLRERLDATLTAHRNEILLFMSKIESHGKGILKPHQLLAEFEAICKEDQE  226
            MAERVLTRVH LRER+DATL AHRNEILLF+S+IESHGKGILKPH+LLAEF+AI ++D++
Sbjct  1    MAERVLTRVHRLRERVDATLAAHRNEILLFLSRIESHGKGILKPHELLAEFDAIRQDDKD  60

Query  227  KLNDHAFQQVLKSTQEAIVLPPWVALAIRLRP  322
            KLN+HAF+++LKSTQEAIVLPPWVALAIRLRP
Sbjct  61   KLNEHAFEELLKSTQEAIVLPPWVALAIRLRP  92


 Score =   127 bits (318),  Expect(2) = 3e-69, Method: Compositional matrix adjust.
 Identities = 61/68 (90%), Positives = 64/68 (94%), Gaps = 0/68 (0%)
 Frame = +1

Query  322  GVWEYVTVNVHALXVEELTVPEYLQFKEELVDGPANGNFVLELDFEPFTASFPKPTLTKS  501
            GVWEYV VNV+AL VEEL+VPEYLQFKEELVDG +NGNFVLELDFEPFTASFPKPTLTKS
Sbjct  93   GVWEYVRVNVNALVVEELSVPEYLQFKEELVDGASNGNFVLELDFEPFTASFPKPTLTKS  152

Query  502  IGXGVEFL  525
            IG GVEFL
Sbjct  153  IGNGVEFL  160



>ref|NP_001234655.1| sucrose synthase [Solanum lycopersicum]
 sp|P49037.1|SUSY_SOLLC RecName: Full=Sucrose synthase; AltName: Full=Sucrose-UDP glucosyltransferase 
[Solanum lycopersicum]
 gb|AAA34196.1| sucrose synthase [Solanum lycopersicum]
Length=805

 Score =   161 bits (408),  Expect(2) = 4e-69, Method: Compositional matrix adjust.
 Identities = 76/92 (83%), Positives = 89/92 (97%), Gaps = 0/92 (0%)
 Frame = +2

Query  47   MAERVLTRVHSLRERLDATLTAHRNEILLFMSKIESHGKGILKPHQLLAEFEAICKEDQE  226
            MAERVLTRVH LRER+DATL AHRNEILLF+S+IESHGKGILKPH+LLAEF+AI ++D++
Sbjct  1    MAERVLTRVHRLRERVDATLCAHRNEILLFLSRIESHGKGILKPHELLAEFDAIRQDDKD  60

Query  227  KLNDHAFQQVLKSTQEAIVLPPWVALAIRLRP  322
            KLN+HAF+++LKSTQEAIVLPPWVALAIRLRP
Sbjct  61   KLNEHAFEELLKSTQEAIVLPPWVALAIRLRP  92


 Score =   126 bits (317),  Expect(2) = 4e-69, Method: Compositional matrix adjust.
 Identities = 61/68 (90%), Positives = 64/68 (94%), Gaps = 0/68 (0%)
 Frame = +1

Query  322  GVWEYVTVNVHALXVEELTVPEYLQFKEELVDGPANGNFVLELDFEPFTASFPKPTLTKS  501
            GVWEYV VNV+AL VEEL+VPEYLQFKEELVDG +NGNFVLELDFEPFTASFPKPTLTKS
Sbjct  93   GVWEYVRVNVNALVVEELSVPEYLQFKEELVDGASNGNFVLELDFEPFTASFPKPTLTKS  152

Query  502  IGXGVEFL  525
            IG GVEFL
Sbjct  153  IGNGVEFL  160



>dbj|BAP82380.1| sucrose synthase, partial [Orobanche aegyptiaca]
Length=243

 Score =   166 bits (420),  Expect(2) = 4e-69, Method: Compositional matrix adjust.
 Identities = 78/92 (85%), Positives = 87/92 (95%), Gaps = 0/92 (0%)
 Frame = +2

Query  47   MAERVLTRVHSLRERLDATLTAHRNEILLFMSKIESHGKGILKPHQLLAEFEAICKEDQE  226
            MAERVLTRVHSLRERLDATL AHRNEILLF+S++E+HGKGILKPHQL+AEF+ IC+ D+ 
Sbjct  1    MAERVLTRVHSLRERLDATLAAHRNEILLFLSRVEAHGKGILKPHQLVAEFKVICQADKA  60

Query  227  KLNDHAFQQVLKSTQEAIVLPPWVALAIRLRP  322
            KL DHAFQ+VLKSTQEAIVLPPWVALAIRLRP
Sbjct  61   KLQDHAFQEVLKSTQEAIVLPPWVALAIRLRP  92


 Score =   122 bits (305),  Expect(2) = 4e-69, Method: Compositional matrix adjust.
 Identities = 59/68 (87%), Positives = 62/68 (91%), Gaps = 0/68 (0%)
 Frame = +1

Query  322  GVWEYVTVNVHALXVEELTVPEYLQFKEELVDGPANGNFVLELDFEPFTASFPKPTLTKS  501
            GVWEYV VNV+AL VEELTV +YL FKEELV+G ANGNFVLELDFEPFTASFPKPTLTKS
Sbjct  93   GVWEYVRVNVNALVVEELTVSQYLHFKEELVNGTANGNFVLELDFEPFTASFPKPTLTKS  152

Query  502  IGXGVEFL  525
            IG GVEFL
Sbjct  153  IGNGVEFL  160



>gb|AAA63685.1| sucrose synthase, partial [Solanum tuberosum]
Length=158

 Score =   163 bits (412),  Expect(2) = 1e-68, Method: Compositional matrix adjust.
 Identities = 77/92 (84%), Positives = 89/92 (97%), Gaps = 0/92 (0%)
 Frame = +2

Query  47   MAERVLTRVHSLRERLDATLTAHRNEILLFMSKIESHGKGILKPHQLLAEFEAICKEDQE  226
            MAERVLTRVHSLRER+DATL AHRNEILLF+S+IESHGKGILKPH+LLAEF+AI ++D+ 
Sbjct  1    MAERVLTRVHSLRERVDATLAAHRNEILLFLSRIESHGKGILKPHELLAEFDAIRQDDKN  60

Query  227  KLNDHAFQQVLKSTQEAIVLPPWVALAIRLRP  322
            KLN+HAF+++LKSTQEAIVLPPWVALAIRLRP
Sbjct  61   KLNEHAFEELLKSTQEAIVLPPWVALAIRLRP  92


 Score =   123 bits (308),  Expect(2) = 1e-68, Method: Compositional matrix adjust.
 Identities = 58/66 (88%), Positives = 62/66 (94%), Gaps = 0/66 (0%)
 Frame = +1

Query  322  GVWEYVTVNVHALXVEELTVPEYLQFKEELVDGPANGNFVLELDFEPFTASFPKPTLTKS  501
            GVWEY+ VNV+AL VEEL+VPEYLQFKEELVDG +NGNFVLELDFEPFTASFPKPTLTKS
Sbjct  93   GVWEYIRVNVNALVVEELSVPEYLQFKEELVDGASNGNFVLELDFEPFTASFPKPTLTKS  152

Query  502  IGXGVE  519
            IG GVE
Sbjct  153  IGNGVE  158



>ref|XP_011078145.1| PREDICTED: sucrose synthase [Sesamum indicum]
 ref|XP_011078146.1| PREDICTED: sucrose synthase [Sesamum indicum]
 ref|XP_011078147.1| PREDICTED: sucrose synthase [Sesamum indicum]
 ref|XP_011078148.1| PREDICTED: sucrose synthase [Sesamum indicum]
Length=805

 Score =   167 bits (423),  Expect(2) = 1e-67, Method: Compositional matrix adjust.
 Identities = 79/92 (86%), Positives = 87/92 (95%), Gaps = 0/92 (0%)
 Frame = +2

Query  47   MAERVLTRVHSLRERLDATLTAHRNEILLFMSKIESHGKGILKPHQLLAEFEAICKEDQE  226
            MA+ VLTRVHSLRERLDATL AHRNEILLF+S+IE HGKGILKPHQLL+EFEAIC+ D+E
Sbjct  1    MADPVLTRVHSLRERLDATLAAHRNEILLFLSRIEGHGKGILKPHQLLSEFEAICEADKE  60

Query  227  KLNDHAFQQVLKSTQEAIVLPPWVALAIRLRP  322
            KL DHAF++VLKSTQEAIVLPPWVALAIRLRP
Sbjct  61   KLQDHAFKEVLKSTQEAIVLPPWVALAIRLRP  92


 Score =   115 bits (289),  Expect(2) = 1e-67, Method: Compositional matrix adjust.
 Identities = 55/68 (81%), Positives = 62/68 (91%), Gaps = 0/68 (0%)
 Frame = +1

Query  322  GVWEYVTVNVHALXVEELTVPEYLQFKEELVDGPANGNFVLELDFEPFTASFPKPTLTKS  501
            GVWEYV VNV+AL VEE++V +YLQFKEELV+G +N NFVLELDFEPFT+SFPKPTLTKS
Sbjct  93   GVWEYVRVNVNALVVEEVSVSQYLQFKEELVNGTSNDNFVLELDFEPFTSSFPKPTLTKS  152

Query  502  IGXGVEFL  525
            IG GVEFL
Sbjct  153  IGNGVEFL  160



>gb|ABD61653.1| sucrose synthase [Cichorium intybus]
Length=806

 Score =   152 bits (385),  Expect(2) = 4e-66, Method: Compositional matrix adjust.
 Identities = 74/92 (80%), Positives = 83/92 (90%), Gaps = 1/92 (1%)
 Frame = +2

Query  47   MAERVLTRVHSLRERLDATLTAHRNEILLFMSKIESHGKGILKPHQLLAEFEAICKEDQE  226
            MAE+V TRVHSLRERLD+TL  HRNEIL+ +S+IESHGKGILKPHQL+AEF+AI KED  
Sbjct  1    MAEKVFTRVHSLRERLDSTLATHRNEILMVLSRIESHGKGILKPHQLMAEFDAISKEDN-  59

Query  227  KLNDHAFQQVLKSTQEAIVLPPWVALAIRLRP  322
            KL+D AF +VLKSTQEAIVLPPWVALAIRLRP
Sbjct  60   KLHDGAFHEVLKSTQEAIVLPPWVALAIRLRP  91


 Score =   125 bits (314),  Expect(2) = 4e-66, Method: Composition-based stats.
 Identities = 58/68 (85%), Positives = 62/68 (91%), Gaps = 0/68 (0%)
 Frame = +1

Query  322  GVWEYVTVNVHALXVEELTVPEYLQFKEELVDGPANGNFVLELDFEPFTASFPKPTLTKS  501
            GVWEYV VNV+AL VEEL+VPEYL FKEELV G +NGNFVLELDFEPFTASFP+PTLTKS
Sbjct  92   GVWEYVRVNVNALVVEELSVPEYLHFKEELVSGDSNGNFVLELDFEPFTASFPRPTLTKS  151

Query  502  IGXGVEFL  525
            IG GVEFL
Sbjct  152  IGNGVEFL  159



>gb|AFO84090.1| sucrose synthase [Actinidia chinensis]
Length=806

 Score =   148 bits (374),  Expect(2) = 1e-65, Method: Compositional matrix adjust.
 Identities = 71/92 (77%), Positives = 81/92 (88%), Gaps = 0/92 (0%)
 Frame = +2

Query  47   MAERVLTRVHSLRERLDATLTAHRNEILLFMSKIESHGKGILKPHQLLAEFEAICKEDQE  226
            MA +VLTRVHSLRERLD TL+AHRNEILLF+SKIESHGKGILKPHQ+ AE EA+ KE Q+
Sbjct  1    MAGQVLTRVHSLRERLDGTLSAHRNEILLFLSKIESHGKGILKPHQIEAEIEALSKEVQQ  60

Query  227  KLNDHAFQQVLKSTQEAIVLPPWVALAIRLRP  322
            KL D AF ++LKS QEAIVLPPW+A A+RLRP
Sbjct  61   KLYDGAFGELLKSAQEAIVLPPWIAFAVRLRP  92


 Score =   128 bits (321),  Expect(2) = 1e-65, Method: Composition-based stats.
 Identities = 57/68 (84%), Positives = 64/68 (94%), Gaps = 0/68 (0%)
 Frame = +1

Query  322  GVWEYVTVNVHALXVEELTVPEYLQFKEELVDGPANGNFVLELDFEPFTASFPKPTLTKS  501
            GVWEY+ VN++AL VEEL+VPEYLQFKEELVDGP NGNF+LELDFEPFTASFP+PTL+KS
Sbjct  93   GVWEYMRVNLNALVVEELSVPEYLQFKEELVDGPCNGNFILELDFEPFTASFPRPTLSKS  152

Query  502  IGXGVEFL  525
            IG GVEFL
Sbjct  153  IGNGVEFL  160



>gb|EYU25805.1| hypothetical protein MIMGU_mgv1a001207mg [Erythranthe guttata]
Length=866

 Score =   159 bits (401),  Expect(2) = 9e-64, Method: Compositional matrix adjust.
 Identities = 77/95 (81%), Positives = 87/95 (92%), Gaps = 1/95 (1%)
 Frame = +2

Query  41   TAMAERVLTRVHSLRERLDATLTAHRNEILLFMSKIESHGKGILKPHQLLAEFEAICKED  220
            + M ERVLTRVHSLRERLDATL AHRNEILLF+S+IESHGKGILKPHQL+ EFEAI + D
Sbjct  59   STMPERVLTRVHSLRERLDATLAAHRNEILLFLSRIESHGKGILKPHQLVPEFEAIFESD  118

Query  221  QE-KLNDHAFQQVLKSTQEAIVLPPWVALAIRLRP  322
            ++ KL DHAF+Q+LK+TQEAIVLPPWVALAIRLRP
Sbjct  119  KKPKLQDHAFKQLLKTTQEAIVLPPWVALAIRLRP  153


 Score =   111 bits (278),  Expect(2) = 9e-64, Method: Compositional matrix adjust.
 Identities = 54/68 (79%), Positives = 58/68 (85%), Gaps = 0/68 (0%)
 Frame = +1

Query  322  GVWEYVTVNVHALXVEELTVPEYLQFKEELVDGPANGNFVLELDFEPFTASFPKPTLTKS  501
            GVWEYV VNV+ L  E+LTV +YLQFKEELV+G  N  FVLELDFEPFTASFPKPTLTKS
Sbjct  154  GVWEYVRVNVNTLVFEDLTVQQYLQFKEELVNGSGNEKFVLELDFEPFTASFPKPTLTKS  213

Query  502  IGXGVEFL  525
            IG GVEFL
Sbjct  214  IGNGVEFL  221



>sp|P49035.1|SUS1_DAUCA RecName: Full=Sucrose synthase isoform 1; AltName: Full=Sucrose 
synthase isoform I; AltName: Full=Sucrose-UDP glucosyltransferase 
1; AltName: Full=Susy*Dc1 [Daucus carota]
 emb|CAA53081.1| sucrose synthase [Daucus carota]
 emb|CAA76056.1| sucrose synthase isoform I [Daucus carota]
Length=808

 Score =   149 bits (376),  Expect(2) = 2e-62, Method: Compositional matrix adjust.
 Identities = 73/94 (78%), Positives = 83/94 (88%), Gaps = 2/94 (2%)
 Frame = +2

Query  47   MAERVLTRVHSLRERLDATLTAHRNEILLFMSKIESHGKGILKPHQLLAEFEAICKEDQE  226
            M E VLTRVHSLRER+D+TL  HRNEIL+F+S+IESHGKGILKPHQLLAE+EAI KED+ 
Sbjct  1    MGEPVLTRVHSLRERMDSTLANHRNEILMFLSRIESHGKGILKPHQLLAEYEAISKEDKL  60

Query  227  KLND--HAFQQVLKSTQEAIVLPPWVALAIRLRP  322
            KL+D   AF +V+KSTQEAIV PPWVALAIRLRP
Sbjct  61   KLDDGHGAFAEVIKSTQEAIVSPPWVALAIRLRP  94


 Score =   116 bits (290),  Expect(2) = 2e-62, Method: Compositional matrix adjust.
 Identities = 55/68 (81%), Positives = 60/68 (88%), Gaps = 0/68 (0%)
 Frame = +1

Query  322  GVWEYVTVNVHALXVEELTVPEYLQFKEELVDGPANGNFVLELDFEPFTASFPKPTLTKS  501
            GVWEYV VNVH L VEEL+VP+YLQFKEELV G ++ NFVLELDF PFTASFP+PTLTKS
Sbjct  95   GVWEYVRVNVHHLVVEELSVPQYLQFKEELVIGSSDANFVLELDFAPFTASFPRPTLTKS  154

Query  502  IGXGVEFL  525
            IG GVEFL
Sbjct  155  IGNGVEFL  162



>gb|AHL29281.1| sucrose synthase 1 [Camellia sinensis]
Length=805

 Score =   140 bits (354),  Expect(2) = 1e-61, Method: Compositional matrix adjust.
 Identities = 68/92 (74%), Positives = 77/92 (84%), Gaps = 0/92 (0%)
 Frame = +2

Query  47   MAERVLTRVHSLRERLDATLTAHRNEILLFMSKIESHGKGILKPHQLLAEFEAICKEDQE  226
            MA  VLTRVHSLR+RLD TL+ HRNE+LL +S IE HGKGILKPHQ+ AEFEA+ K  Q+
Sbjct  1    MASHVLTRVHSLRDRLDGTLSTHRNELLLLLSNIEKHGKGILKPHQIEAEFEALPKHAQQ  60

Query  227  KLNDHAFQQVLKSTQEAIVLPPWVALAIRLRP  322
            KL+D  F +VLKS QEAIVLPPWVALAIRLRP
Sbjct  61   KLHDGPFGEVLKSAQEAIVLPPWVALAIRLRP  92


 Score =   122 bits (307),  Expect(2) = 1e-61, Method: Compositional matrix adjust.
 Identities = 56/68 (82%), Positives = 63/68 (93%), Gaps = 0/68 (0%)
 Frame = +1

Query  322  GVWEYVTVNVHALXVEELTVPEYLQFKEELVDGPANGNFVLELDFEPFTASFPKPTLTKS  501
            GVWEY+ VN++AL VEEL+VPEYL FKEELV+GP NGNFVLELDFEPFTASFP+PTL+KS
Sbjct  93   GVWEYIRVNINALVVEELSVPEYLHFKEELVEGPRNGNFVLELDFEPFTASFPRPTLSKS  152

Query  502  IGXGVEFL  525
            IG GVEFL
Sbjct  153  IGNGVEFL  160



>ref|XP_008337809.1| PREDICTED: sucrose synthase [Malus domestica]
 ref|XP_008337810.1| PREDICTED: sucrose synthase [Malus domestica]
 ref|XP_008337811.1| PREDICTED: sucrose synthase [Malus domestica]
Length=807

 Score =   136 bits (342),  Expect(2) = 2e-61, Method: Compositional matrix adjust.
 Identities = 67/92 (73%), Positives = 78/92 (85%), Gaps = 0/92 (0%)
 Frame = +2

Query  47   MAERVLTRVHSLRERLDATLTAHRNEILLFMSKIESHGKGILKPHQLLAEFEAICKEDQE  226
            MAERVLTRV SLRERLD TL+AHRNEIL  +S+IES GKG L+PHQLLAEFE I + +++
Sbjct  1    MAERVLTRVQSLRERLDETLSAHRNEILALLSRIESKGKGFLQPHQLLAEFEEIPEANRQ  60

Query  227  KLNDHAFQQVLKSTQEAIVLPPWVALAIRLRP  322
            KL D AF +VLK+TQE IVLPPWVALA+R RP
Sbjct  61   KLLDGAFGEVLKNTQEVIVLPPWVALAVRPRP  92


 Score =   126 bits (316),  Expect(2) = 2e-61, Method: Composition-based stats.
 Identities = 58/68 (85%), Positives = 61/68 (90%), Gaps = 0/68 (0%)
 Frame = +1

Query  322  GVWEYVTVNVHALXVEELTVPEYLQFKEELVDGPANGNFVLELDFEPFTASFPKPTLTKS  501
            GVWEY+ VNVHAL VEEL V EYLQFKEELVDG ANGNFVLELDFEPF ASFP+PTL+KS
Sbjct  93   GVWEYIRVNVHALVVEELRVAEYLQFKEELVDGSANGNFVLELDFEPFNASFPRPTLSKS  152

Query  502  IGXGVEFL  525
            IG GVEFL
Sbjct  153  IGNGVEFL  160



>ref|XP_010107074.1| Sucrose synthase [Morus notabilis]
 gb|EXC13595.1| Sucrose synthase [Morus notabilis]
Length=806

 Score =   142 bits (357),  Expect(2) = 6e-61, Method: Compositional matrix adjust.
 Identities = 69/92 (75%), Positives = 81/92 (88%), Gaps = 0/92 (0%)
 Frame = +2

Query  47   MAERVLTRVHSLRERLDATLTAHRNEILLFMSKIESHGKGILKPHQLLAEFEAICKEDQE  226
            MAERVLTRVHSLRERLD TL+AHRNEIL F+S+IE+ GKG L+PHQL AEFEAI + +++
Sbjct  1    MAERVLTRVHSLRERLDETLSAHRNEILAFLSRIEAKGKGFLQPHQLTAEFEAIPEANRQ  60

Query  227  KLNDHAFQQVLKSTQEAIVLPPWVALAIRLRP  322
            KL D AF +VL+STQEAIVLPPWVALA+R RP
Sbjct  61   KLLDGAFGEVLRSTQEAIVLPPWVALAVRPRP  92


 Score =   119 bits (297),  Expect(2) = 6e-61, Method: Compositional matrix adjust.
 Identities = 55/68 (81%), Positives = 59/68 (87%), Gaps = 0/68 (0%)
 Frame = +1

Query  322  GVWEYVTVNVHALXVEELTVPEYLQFKEELVDGPANGNFVLELDFEPFTASFPKPTLTKS  501
            GVWEY+ VNVHAL +EEL V EYL FKEELVDG  NGNFVLELDFEPF ASFP+PTL+KS
Sbjct  93   GVWEYIRVNVHALVIEELRVAEYLHFKEELVDGSLNGNFVLELDFEPFAASFPRPTLSKS  152

Query  502  IGXGVEFL  525
            IG GVEFL
Sbjct  153  IGNGVEFL  160



>ref|XP_009359754.1| PREDICTED: sucrose synthase [Pyrus x bretschneideri]
Length=837

 Score =   133 bits (335),  Expect(2) = 4e-60, Method: Compositional matrix adjust.
 Identities = 66/92 (72%), Positives = 76/92 (83%), Gaps = 0/92 (0%)
 Frame = +2

Query  47   MAERVLTRVHSLRERLDATLTAHRNEILLFMSKIESHGKGILKPHQLLAEFEAICKEDQE  226
            MAERVLTRV SLRERLD TL+AHRNEIL  +S+IE  GKG L+PHQLLAEFE I + ++ 
Sbjct  1    MAERVLTRVQSLRERLDETLSAHRNEILALLSRIEKKGKGFLQPHQLLAEFEEIPETNRR  60

Query  227  KLNDHAFQQVLKSTQEAIVLPPWVALAIRLRP  322
            KL D AF +VLK+TQE IVLPPWVALA+R RP
Sbjct  61   KLLDGAFGEVLKNTQEVIVLPPWVALAVRPRP  92


 Score =   124 bits (312),  Expect(2) = 4e-60, Method: Composition-based stats.
 Identities = 57/68 (84%), Positives = 60/68 (88%), Gaps = 0/68 (0%)
 Frame = +1

Query  322  GVWEYVTVNVHALXVEELTVPEYLQFKEELVDGPANGNFVLELDFEPFTASFPKPTLTKS  501
            GVWEY+ VNVHAL  EEL V EYLQFKEELVDG ANGNFVLELDFEPF ASFP+PTL+KS
Sbjct  93   GVWEYIRVNVHALVFEELRVAEYLQFKEELVDGSANGNFVLELDFEPFNASFPRPTLSKS  152

Query  502  IGXGVEFL  525
            IG GVEFL
Sbjct  153  IGNGVEFL  160



>gb|KJB82967.1| hypothetical protein B456_013G222400 [Gossypium raimondii]
Length=815

 Score =   134 bits (336),  Expect(2) = 7e-60, Method: Compositional matrix adjust.
 Identities = 65/92 (71%), Positives = 79/92 (86%), Gaps = 0/92 (0%)
 Frame = +2

Query  47   MAERVLTRVHSLRERLDATLTAHRNEILLFMSKIESHGKGILKPHQLLAEFEAICKEDQE  226
            MAER LTRVHSLRERLD+TLTAHRNEIL  +S+IE  GKGIL  HQ++ EFEAI +E+++
Sbjct  1    MAERALTRVHSLRERLDSTLTAHRNEILALLSRIEGKGKGILLHHQIILEFEAIPEENRK  60

Query  227  KLNDHAFQQVLKSTQEAIVLPPWVALAIRLRP  322
            KL D AF ++LK++QEAIVLPPWVALA+R RP
Sbjct  61   KLADGAFFEILKASQEAIVLPPWVALAVRPRP  92


 Score =   123 bits (309),  Expect(2) = 7e-60, Method: Composition-based stats.
 Identities = 56/68 (82%), Positives = 61/68 (90%), Gaps = 0/68 (0%)
 Frame = +1

Query  322  GVWEYVTVNVHALXVEELTVPEYLQFKEELVDGPANGNFVLELDFEPFTASFPKPTLTKS  501
            GVWEY+ VNVHAL VEELTV EYL+FKEELVDG +N NFVLELDFEPF ASFP+PTL+KS
Sbjct  93   GVWEYIRVNVHALVVEELTVAEYLRFKEELVDGSSNANFVLELDFEPFNASFPRPTLSKS  152

Query  502  IGXGVEFL  525
            IG GVEFL
Sbjct  153  IGNGVEFL  160



>gb|KJB82966.1| hypothetical protein B456_013G222400 [Gossypium raimondii]
Length=806

 Score =   134 bits (336),  Expect(2) = 9e-60, Method: Compositional matrix adjust.
 Identities = 65/92 (71%), Positives = 79/92 (86%), Gaps = 0/92 (0%)
 Frame = +2

Query  47   MAERVLTRVHSLRERLDATLTAHRNEILLFMSKIESHGKGILKPHQLLAEFEAICKEDQE  226
            MAER LTRVHSLRERLD+TLTAHRNEIL  +S+IE  GKGIL  HQ++ EFEAI +E+++
Sbjct  1    MAERALTRVHSLRERLDSTLTAHRNEILALLSRIEGKGKGILLHHQIILEFEAIPEENRK  60

Query  227  KLNDHAFQQVLKSTQEAIVLPPWVALAIRLRP  322
            KL D AF ++LK++QEAIVLPPWVALA+R RP
Sbjct  61   KLADGAFFEILKASQEAIVLPPWVALAVRPRP  92


 Score =   123 bits (308),  Expect(2) = 9e-60, Method: Composition-based stats.
 Identities = 56/68 (82%), Positives = 61/68 (90%), Gaps = 0/68 (0%)
 Frame = +1

Query  322  GVWEYVTVNVHALXVEELTVPEYLQFKEELVDGPANGNFVLELDFEPFTASFPKPTLTKS  501
            GVWEY+ VNVHAL VEELTV EYL+FKEELVDG +N NFVLELDFEPF ASFP+PTL+KS
Sbjct  93   GVWEYIRVNVHALVVEELTVAEYLRFKEELVDGSSNANFVLELDFEPFNASFPRPTLSKS  152

Query  502  IGXGVEFL  525
            IG GVEFL
Sbjct  153  IGNGVEFL  160



>dbj|BAA89049.1| sucrose synthase [Citrus unshiu]
Length=805

 Score =   134 bits (337),  Expect(2) = 9e-60, Method: Compositional matrix adjust.
 Identities = 64/92 (70%), Positives = 79/92 (86%), Gaps = 0/92 (0%)
 Frame = +2

Query  47   MAERVLTRVHSLRERLDATLTAHRNEILLFMSKIESHGKGILKPHQLLAEFEAICKEDQE  226
            MAER LTRVHSLRERLD TL+AHRNEIL  +S+IE  GKGIL+ HQL+AEFE+I +E+++
Sbjct  1    MAERALTRVHSLRERLDETLSAHRNEILALLSRIEGKGKGILQNHQLIAEFESISEENRK  60

Query  227  KLNDHAFQQVLKSTQEAIVLPPWVALAIRLRP  322
             L + AF +VL++TQEAIVLPPWVALA+R RP
Sbjct  61   HLTEGAFGEVLRATQEAIVLPPWVALAVRPRP  92


 Score =   122 bits (306),  Expect(2) = 9e-60, Method: Composition-based stats.
 Identities = 56/68 (82%), Positives = 60/68 (88%), Gaps = 0/68 (0%)
 Frame = +1

Query  322  GVWEYVTVNVHALXVEELTVPEYLQFKEELVDGPANGNFVLELDFEPFTASFPKPTLTKS  501
            GVWEY+ VNVHAL VEEL V EYL FKEELVDG +NGNFVLELDFEPF ASFP+PTL+KS
Sbjct  93   GVWEYIRVNVHALVVEELLVAEYLHFKEELVDGGSNGNFVLELDFEPFNASFPRPTLSKS  152

Query  502  IGXGVEFL  525
            IG GVEFL
Sbjct  153  IGNGVEFL  160



>gb|AEK81522.1| sucrose synthase isoform D [Gossypium hirsutum]
Length=806

 Score =   134 bits (336),  Expect(2) = 9e-60, Method: Compositional matrix adjust.
 Identities = 65/92 (71%), Positives = 79/92 (86%), Gaps = 0/92 (0%)
 Frame = +2

Query  47   MAERVLTRVHSLRERLDATLTAHRNEILLFMSKIESHGKGILKPHQLLAEFEAICKEDQE  226
            MAER LTRVHSLRERLD+TLTAHRNEIL  +S+IE  GKGIL  HQ++ EFEAI +E+++
Sbjct  1    MAERALTRVHSLRERLDSTLTAHRNEILALLSRIEGKGKGILLHHQIILEFEAIPEENRK  60

Query  227  KLNDHAFQQVLKSTQEAIVLPPWVALAIRLRP  322
            KL D AF ++LK++QEAIVLPPWVALA+R RP
Sbjct  61   KLADGAFFEILKASQEAIVLPPWVALAVRPRP  92


 Score =   123 bits (308),  Expect(2) = 9e-60, Method: Composition-based stats.
 Identities = 56/68 (82%), Positives = 61/68 (90%), Gaps = 0/68 (0%)
 Frame = +1

Query  322  GVWEYVTVNVHALXVEELTVPEYLQFKEELVDGPANGNFVLELDFEPFTASFPKPTLTKS  501
            GVWEY+ VNVHAL VEELTV EYL+FKEELVDG +N NFVLELDFEPF ASFP+PTL+KS
Sbjct  93   GVWEYIRVNVHALVVEELTVAEYLRFKEELVDGSSNANFVLELDFEPFNASFPRPTLSKS  152

Query  502  IGXGVEFL  525
            IG GVEFL
Sbjct  153  IGNGVEFL  160



>ref|XP_007012547.1| Sucrose synthase 4 isoform 2 [Theobroma cacao]
 gb|EOY30166.1| Sucrose synthase 4 isoform 2 [Theobroma cacao]
Length=806

 Score =   131 bits (330),  Expect(2) = 1e-59, Method: Compositional matrix adjust.
 Identities = 62/92 (67%), Positives = 79/92 (86%), Gaps = 0/92 (0%)
 Frame = +2

Query  47   MAERVLTRVHSLRERLDATLTAHRNEILLFMSKIESHGKGILKPHQLLAEFEAICKEDQE  226
            MAERV+TRVHSLRERLD TLTAHRNEIL  +++IE  GKGIL+ HQ++ EFEAI +E+++
Sbjct  1    MAERVITRVHSLRERLDETLTAHRNEILALLARIEGKGKGILQHHQIILEFEAIPEENRK  60

Query  227  KLNDHAFQQVLKSTQEAIVLPPWVALAIRLRP  322
            KL D AF ++L+++QEAIV PPWVALA+R RP
Sbjct  61   KLADGAFFEILRASQEAIVFPPWVALAVRPRP  92


 Score =   125 bits (313),  Expect(2) = 1e-59, Method: Composition-based stats.
 Identities = 57/68 (84%), Positives = 61/68 (90%), Gaps = 0/68 (0%)
 Frame = +1

Query  322  GVWEYVTVNVHALXVEELTVPEYLQFKEELVDGPANGNFVLELDFEPFTASFPKPTLTKS  501
            GVWEY+ VNVHAL VEELTV EYL FKEELVDG +NGNFVLELDFEPF ASFP+PTL+KS
Sbjct  93   GVWEYIRVNVHALVVEELTVAEYLHFKEELVDGSSNGNFVLELDFEPFNASFPRPTLSKS  152

Query  502  IGXGVEFL  525
            IG GVEFL
Sbjct  153  IGNGVEFL  160



>ref|XP_007012546.1| Sucrose synthase 4 isoform 1 [Theobroma cacao]
 gb|EOY30165.1| Sucrose synthase 4 isoform 1 [Theobroma cacao]
Length=852

 Score =   132 bits (331),  Expect(2) = 1e-59, Method: Compositional matrix adjust.
 Identities = 62/92 (67%), Positives = 79/92 (86%), Gaps = 0/92 (0%)
 Frame = +2

Query  47   MAERVLTRVHSLRERLDATLTAHRNEILLFMSKIESHGKGILKPHQLLAEFEAICKEDQE  226
            MAERV+TRVHSLRERLD TLTAHRNEIL  +++IE  GKGIL+ HQ++ EFEAI +E+++
Sbjct  47   MAERVITRVHSLRERLDETLTAHRNEILALLARIEGKGKGILQHHQIILEFEAIPEENRK  106

Query  227  KLNDHAFQQVLKSTQEAIVLPPWVALAIRLRP  322
            KL D AF ++L+++QEAIV PPWVALA+R RP
Sbjct  107  KLADGAFFEILRASQEAIVFPPWVALAVRPRP  138


 Score =   124 bits (312),  Expect(2) = 1e-59, Method: Composition-based stats.
 Identities = 57/68 (84%), Positives = 61/68 (90%), Gaps = 0/68 (0%)
 Frame = +1

Query  322  GVWEYVTVNVHALXVEELTVPEYLQFKEELVDGPANGNFVLELDFEPFTASFPKPTLTKS  501
            GVWEY+ VNVHAL VEELTV EYL FKEELVDG +NGNFVLELDFEPF ASFP+PTL+KS
Sbjct  139  GVWEYIRVNVHALVVEELTVAEYLHFKEELVDGSSNGNFVLELDFEPFNASFPRPTLSKS  198

Query  502  IGXGVEFL  525
            IG GVEFL
Sbjct  199  IGNGVEFL  206



>ref|XP_008382924.1| PREDICTED: sucrose synthase-like [Malus domestica]
Length=807

 Score =   132 bits (332),  Expect(2) = 3e-59, Method: Compositional matrix adjust.
 Identities = 65/92 (71%), Positives = 76/92 (83%), Gaps = 0/92 (0%)
 Frame = +2

Query  47   MAERVLTRVHSLRERLDATLTAHRNEILLFMSKIESHGKGILKPHQLLAEFEAICKEDQE  226
            MAERVLTRV SLRERLD TL+  RN+ L  +S+IES GKG L+PHQLLAEFEAI + +++
Sbjct  1    MAERVLTRVQSLRERLDETLSTQRNDFLALLSRIESKGKGFLQPHQLLAEFEAIPENNRQ  60

Query  227  KLNDHAFQQVLKSTQEAIVLPPWVALAIRLRP  322
            KL D AF +VLK TQEAIVLPPWVALA+R RP
Sbjct  61   KLLDGAFGEVLKHTQEAIVLPPWVALAVRPRP  92


 Score =   123 bits (308),  Expect(2) = 3e-59, Method: Composition-based stats.
 Identities = 55/68 (81%), Positives = 61/68 (90%), Gaps = 0/68 (0%)
 Frame = +1

Query  322  GVWEYVTVNVHALXVEELTVPEYLQFKEELVDGPANGNFVLELDFEPFTASFPKPTLTKS  501
            GVWEY+ VNVHAL +EEL V EYLQFKEELVDG +NGNFVLELDF+PF ASFP+PTL+KS
Sbjct  93   GVWEYIRVNVHALALEELCVAEYLQFKEELVDGSSNGNFVLELDFQPFNASFPRPTLSKS  152

Query  502  IGXGVEFL  525
            IG GVEFL
Sbjct  153  IGNGVEFL  160



>ref|XP_008349074.1| PREDICTED: sucrose synthase-like [Malus domestica]
Length=807

 Score =   132 bits (332),  Expect(2) = 3e-59, Method: Compositional matrix adjust.
 Identities = 65/92 (71%), Positives = 76/92 (83%), Gaps = 0/92 (0%)
 Frame = +2

Query  47   MAERVLTRVHSLRERLDATLTAHRNEILLFMSKIESHGKGILKPHQLLAEFEAICKEDQE  226
            MAERVLTRV SLRERLD TL+  RN+ L  +S+IES GKG L+PHQLLAEFEAI + +++
Sbjct  1    MAERVLTRVQSLRERLDETLSTQRNDFLALLSRIESKGKGFLQPHQLLAEFEAIPENNRQ  60

Query  227  KLNDHAFQQVLKSTQEAIVLPPWVALAIRLRP  322
            KL D AF +VLK TQEAIVLPPWVALA+R RP
Sbjct  61   KLLDGAFGEVLKHTQEAIVLPPWVALAVRPRP  92


 Score =   123 bits (308),  Expect(2) = 3e-59, Method: Composition-based stats.
 Identities = 55/68 (81%), Positives = 61/68 (90%), Gaps = 0/68 (0%)
 Frame = +1

Query  322  GVWEYVTVNVHALXVEELTVPEYLQFKEELVDGPANGNFVLELDFEPFTASFPKPTLTKS  501
            GVWEY+ VNVHAL +EEL V EYLQFKEELVDG +NGNFVLELDF+PF ASFP+PTL+KS
Sbjct  93   GVWEYIRVNVHALALEELCVAEYLQFKEELVDGSSNGNFVLELDFQPFNASFPRPTLSKS  152

Query  502  IGXGVEFL  525
            IG GVEFL
Sbjct  153  IGNGVEFL  160



>dbj|BAM05649.1| sucrose synthase 3 [Eucalyptus globulus subsp. globulus]
Length=806

 Score =   134 bits (338),  Expect(2) = 5e-59, Method: Compositional matrix adjust.
 Identities = 63/92 (68%), Positives = 82/92 (89%), Gaps = 0/92 (0%)
 Frame = +2

Query  47   MAERVLTRVHSLRERLDATLTAHRNEILLFMSKIESHGKGILKPHQLLAEFEAICKEDQE  226
            MAER+LTRVHSLRERLD TL AHRN+IL F+++IE+ GKGIL+ HQL+AEFEAI +E ++
Sbjct  1    MAERLLTRVHSLRERLDETLLAHRNDILAFLTRIEAKGKGILQHHQLIAEFEAISEEHRK  60

Query  227  KLNDHAFQQVLKSTQEAIVLPPWVALAIRLRP  322
            KL++ AF ++L+S+QEAIVLPPW+ALA+R RP
Sbjct  61   KLSEGAFGEILRSSQEAIVLPPWIALAVRPRP  92


 Score =   120 bits (300),  Expect(2) = 5e-59, Method: Composition-based stats.
 Identities = 54/68 (79%), Positives = 59/68 (87%), Gaps = 0/68 (0%)
 Frame = +1

Query  322  GVWEYVTVNVHALXVEELTVPEYLQFKEELVDGPANGNFVLELDFEPFTASFPKPTLTKS  501
            GVWEY+ VN+HAL VEEL V E+L FKEELVDG  NGNFVLELDFEPFTA FP+PTL+KS
Sbjct  93   GVWEYIRVNIHALVVEELQVTEFLHFKEELVDGNLNGNFVLELDFEPFTAQFPRPTLSKS  152

Query  502  IGXGVEFL  525
            IG GVEFL
Sbjct  153  IGNGVEFL  160



>ref|XP_009343357.1| PREDICTED: sucrose synthase [Pyrus x bretschneideri]
Length=807

 Score =   131 bits (330),  Expect(2) = 5e-59, Method: Compositional matrix adjust.
 Identities = 65/92 (71%), Positives = 76/92 (83%), Gaps = 0/92 (0%)
 Frame = +2

Query  47   MAERVLTRVHSLRERLDATLTAHRNEILLFMSKIESHGKGILKPHQLLAEFEAICKEDQE  226
            MAERVLTRV SLRERLD TL+  RNEIL  +S+IES GKG L+PHQL AEFEAI + +++
Sbjct  1    MAERVLTRVQSLRERLDQTLSTQRNEILALLSRIESKGKGFLQPHQLHAEFEAIPENNRQ  60

Query  227  KLNDHAFQQVLKSTQEAIVLPPWVALAIRLRP  322
            KL D AF +VLK TQEA+VLPPWVALA+R RP
Sbjct  61   KLLDGAFGEVLKHTQEAVVLPPWVALAVRPRP  92


 Score =   122 bits (307),  Expect(2) = 5e-59, Method: Composition-based stats.
 Identities = 55/68 (81%), Positives = 61/68 (90%), Gaps = 0/68 (0%)
 Frame = +1

Query  322  GVWEYVTVNVHALXVEELTVPEYLQFKEELVDGPANGNFVLELDFEPFTASFPKPTLTKS  501
            GVWEY+ VNVHAL +EEL V EYLQFKEELVDG +NGNFVLELDF+PF ASFP+PTL+KS
Sbjct  93   GVWEYIRVNVHALTLEELRVAEYLQFKEELVDGSSNGNFVLELDFQPFNASFPRPTLSKS  152

Query  502  IGXGVEFL  525
            IG GVEFL
Sbjct  153  IGNGVEFL  160



>ref|XP_009348896.1| PREDICTED: sucrose synthase-like [Pyrus x bretschneideri]
Length=807

 Score =   131 bits (330),  Expect(2) = 6e-59, Method: Compositional matrix adjust.
 Identities = 65/92 (71%), Positives = 76/92 (83%), Gaps = 0/92 (0%)
 Frame = +2

Query  47   MAERVLTRVHSLRERLDATLTAHRNEILLFMSKIESHGKGILKPHQLLAEFEAICKEDQE  226
            MAERVLTRV SLRERLD TL+  RNEIL  +S+IES GKG L+PHQL AEFEAI + +++
Sbjct  1    MAERVLTRVQSLRERLDETLSTQRNEILALLSRIESKGKGFLQPHQLHAEFEAIPENNRQ  60

Query  227  KLNDHAFQQVLKSTQEAIVLPPWVALAIRLRP  322
            KL D AF +VLK TQEA+VLPPWVALA+R RP
Sbjct  61   KLLDGAFGEVLKHTQEAVVLPPWVALAVRPRP  92


 Score =   122 bits (307),  Expect(2) = 6e-59, Method: Composition-based stats.
 Identities = 55/68 (81%), Positives = 61/68 (90%), Gaps = 0/68 (0%)
 Frame = +1

Query  322  GVWEYVTVNVHALXVEELTVPEYLQFKEELVDGPANGNFVLELDFEPFTASFPKPTLTKS  501
            GVWEY+ VNVHAL +EEL V EYLQFKEELVDG +NGNFVLELDF+PF ASFP+PTL+KS
Sbjct  93   GVWEYIRVNVHALTLEELRVAEYLQFKEELVDGSSNGNFVLELDFQPFNASFPRPTLSKS  152

Query  502  IGXGVEFL  525
            IG GVEFL
Sbjct  153  IGNGVEFL  160



>dbj|BAM05652.1| sucrose synthase 3, partial [Eucalyptus globulus subsp. globulus]
Length=795

 Score =   134 bits (337),  Expect(2) = 7e-59, Method: Compositional matrix adjust.
 Identities = 63/92 (68%), Positives = 82/92 (89%), Gaps = 0/92 (0%)
 Frame = +2

Query  47   MAERVLTRVHSLRERLDATLTAHRNEILLFMSKIESHGKGILKPHQLLAEFEAICKEDQE  226
            MAER+LTRVHSLRERLD TL AHRN+IL F+++IE+ GKGIL+ HQL+AEFEAI +E ++
Sbjct  1    MAERLLTRVHSLRERLDETLLAHRNDILAFLTRIEAKGKGILQHHQLIAEFEAISEEHRK  60

Query  227  KLNDHAFQQVLKSTQEAIVLPPWVALAIRLRP  322
            KL++ AF ++L+S+QEAIVLPPW+ALA+R RP
Sbjct  61   KLSEGAFGEILRSSQEAIVLPPWIALAVRPRP  92


 Score =   119 bits (299),  Expect(2) = 7e-59, Method: Composition-based stats.
 Identities = 54/68 (79%), Positives = 59/68 (87%), Gaps = 0/68 (0%)
 Frame = +1

Query  322  GVWEYVTVNVHALXVEELTVPEYLQFKEELVDGPANGNFVLELDFEPFTASFPKPTLTKS  501
            GVWEY+ VN+HAL VEEL V E+L FKEELVDG  NGNFVLELDFEPFTA FP+PTL+KS
Sbjct  93   GVWEYIRVNIHALVVEELQVTEFLHFKEELVDGNLNGNFVLELDFEPFTAQFPRPTLSKS  152

Query  502  IGXGVEFL  525
            IG GVEFL
Sbjct  153  IGNGVEFL  160



>dbj|BAM05650.1| sucrose synthase 3, partial [Eucalyptus pilularis]
Length=795

 Score =   134 bits (338),  Expect(2) = 7e-59, Method: Compositional matrix adjust.
 Identities = 63/92 (68%), Positives = 82/92 (89%), Gaps = 0/92 (0%)
 Frame = +2

Query  47   MAERVLTRVHSLRERLDATLTAHRNEILLFMSKIESHGKGILKPHQLLAEFEAICKEDQE  226
            MAER+LTRVHSLRERLD TL AHRN+IL F+++IE+ GKGIL+ HQL+AEFEAI +E ++
Sbjct  1    MAERLLTRVHSLRERLDETLLAHRNDILAFLTRIEAKGKGILQHHQLIAEFEAISEEHRK  60

Query  227  KLNDHAFQQVLKSTQEAIVLPPWVALAIRLRP  322
            KL++ AF ++L+S+QEAIVLPPW+ALA+R RP
Sbjct  61   KLSEGAFGEILRSSQEAIVLPPWIALAVRPRP  92


 Score =   119 bits (298),  Expect(2) = 7e-59, Method: Composition-based stats.
 Identities = 53/68 (78%), Positives = 59/68 (87%), Gaps = 0/68 (0%)
 Frame = +1

Query  322  GVWEYVTVNVHALXVEELTVPEYLQFKEELVDGPANGNFVLELDFEPFTASFPKPTLTKS  501
            GVWEY+ VN+HAL +EEL V E+L FKEELVDG  NGNFVLELDFEPFTA FP+PTL+KS
Sbjct  93   GVWEYIRVNIHALVIEELQVTEFLHFKEELVDGNLNGNFVLELDFEPFTAQFPRPTLSKS  152

Query  502  IGXGVEFL  525
            IG GVEFL
Sbjct  153  IGNGVEFL  160



>ref|XP_006452883.1| hypothetical protein CICLE_v10007483mg [Citrus clementina]
 ref|XP_006452884.1| hypothetical protein CICLE_v10007483mg [Citrus clementina]
 ref|XP_006452885.1| hypothetical protein CICLE_v10007483mg [Citrus clementina]
 ref|XP_006452886.1| hypothetical protein CICLE_v10007483mg [Citrus clementina]
 ref|XP_006452887.1| hypothetical protein CICLE_v10007483mg [Citrus clementina]
 ref|XP_006452888.1| hypothetical protein CICLE_v10007483mg [Citrus clementina]
 ref|XP_006452889.1| hypothetical protein CICLE_v10007483mg [Citrus clementina]
 ref|XP_006452890.1| hypothetical protein CICLE_v10007483mg [Citrus clementina]
 ref|XP_006452891.1| hypothetical protein CICLE_v10007483mg [Citrus clementina]
 gb|ESR66123.1| hypothetical protein CICLE_v10007483mg [Citrus clementina]
 gb|ESR66124.1| hypothetical protein CICLE_v10007483mg [Citrus clementina]
 gb|ESR66125.1| hypothetical protein CICLE_v10007483mg [Citrus clementina]
 gb|ESR66126.1| hypothetical protein CICLE_v10007483mg [Citrus clementina]
 gb|ESR66127.1| hypothetical protein CICLE_v10007483mg [Citrus clementina]
 gb|ESR66128.1| hypothetical protein CICLE_v10007483mg [Citrus clementina]
 gb|ESR66129.1| hypothetical protein CICLE_v10007483mg [Citrus clementina]
 gb|ESR66130.1| hypothetical protein CICLE_v10007483mg [Citrus clementina]
 gb|ESR66131.1| hypothetical protein CICLE_v10007483mg [Citrus clementina]
Length=806

 Score =   134 bits (338),  Expect(2) = 8e-59, Method: Compositional matrix adjust.
 Identities = 64/92 (70%), Positives = 79/92 (86%), Gaps = 0/92 (0%)
 Frame = +2

Query  47   MAERVLTRVHSLRERLDATLTAHRNEILLFMSKIESHGKGILKPHQLLAEFEAICKEDQE  226
            MAER LTRVHSLRERLD TL+AHRNEIL  +S+IE  GKGIL+ HQL+AEFE+I +E+++
Sbjct  1    MAERALTRVHSLRERLDETLSAHRNEILALLSRIEGKGKGILQNHQLIAEFESISEENRK  60

Query  227  KLNDHAFQQVLKSTQEAIVLPPWVALAIRLRP  322
             L + AF +VL++TQEAIVLPPWVALA+R RP
Sbjct  61   HLTEGAFGEVLRATQEAIVLPPWVALAVRPRP  92


 Score =   119 bits (298),  Expect(2) = 8e-59, Method: Compositional matrix adjust.
 Identities = 56/68 (82%), Positives = 60/68 (88%), Gaps = 0/68 (0%)
 Frame = +1

Query  322  GVWEYVTVNVHALXVEELTVPEYLQFKEELVDGPANGNFVLELDFEPFTASFPKPTLTKS  501
            GVWEY+ VNVHAL VEEL V EYL FKEELVDG +NGNFVLELDFEPF ASFP+PTL+KS
Sbjct  93   GVWEYIRVNVHALVVEELLVAEYLHFKEELVDGGSNGNFVLELDFEPFNASFPRPTLSKS  152

Query  502  IGXGVEFL  525
            IG GVEFL
Sbjct  153  IGNGVEFL  160



>gb|ADY68844.1| sucrose synthase [Gossypium barbadense]
Length=805

 Score =   129 bits (325),  Expect(2) = 9e-59, Method: Compositional matrix adjust.
 Identities = 63/92 (68%), Positives = 79/92 (86%), Gaps = 0/92 (0%)
 Frame = +2

Query  47   MAERVLTRVHSLRERLDATLTAHRNEILLFMSKIESHGKGILKPHQLLAEFEAICKEDQE  226
            MA+RV+TRVHSLRERLD TL AHRNEIL  +S+IE  GKGIL+ HQ++ EFEAI +E+++
Sbjct  1    MADRVITRVHSLRERLDETLLAHRNEILALLSRIEGKGKGILQHHQIILEFEAIPEENRK  60

Query  227  KLNDHAFQQVLKSTQEAIVLPPWVALAIRLRP  322
            KL + AF +VLK++QEAIVLPPWVALA+R RP
Sbjct  61   KLANGAFFEVLKASQEAIVLPPWVALAVRPRP  92


 Score =   124 bits (310),  Expect(2) = 9e-59, Method: Composition-based stats.
 Identities = 56/68 (82%), Positives = 61/68 (90%), Gaps = 0/68 (0%)
 Frame = +1

Query  322  GVWEYVTVNVHALXVEELTVPEYLQFKEELVDGPANGNFVLELDFEPFTASFPKPTLTKS  501
            GVWEY+ VNVHAL VEELTV EYL FKEELVDG +NGNFVLELDFEPF +SFP+PTL+KS
Sbjct  93   GVWEYIRVNVHALVVEELTVAEYLHFKEELVDGSSNGNFVLELDFEPFNSSFPRPTLSKS  152

Query  502  IGXGVEFL  525
            IG GVEFL
Sbjct  153  IGNGVEFL  160



>gb|AIJ28960.1| sucrose synthase [Manihot esculenta subsp. flabellifolia]
Length=806

 Score =   134 bits (336),  Expect(2) = 9e-59, Method: Compositional matrix adjust.
 Identities = 64/92 (70%), Positives = 80/92 (87%), Gaps = 0/92 (0%)
 Frame = +2

Query  47   MAERVLTRVHSLRERLDATLTAHRNEILLFMSKIESHGKGILKPHQLLAEFEAICKEDQE  226
            MAERV+TRVHS+RERLD TL+AHRNEI+  +S+IE  GKGIL+ HQ++AEFEAI +E+++
Sbjct  1    MAERVITRVHSIRERLDETLSAHRNEIVALLSRIEGKGKGILQHHQIIAEFEAIPEENRK  60

Query  227  KLNDHAFQQVLKSTQEAIVLPPWVALAIRLRP  322
            KL D AF +VL+S QEAIVLPPWVALA+R RP
Sbjct  61   KLLDGAFGEVLRSAQEAIVLPPWVALAVRPRP  92


 Score =   119 bits (299),  Expect(2) = 9e-59, Method: Composition-based stats.
 Identities = 55/68 (81%), Positives = 58/68 (85%), Gaps = 0/68 (0%)
 Frame = +1

Query  322  GVWEYVTVNVHALXVEELTVPEYLQFKEELVDGPANGNFVLELDFEPFTASFPKPTLTKS  501
            GVWEY+ VNVHAL VEEL V EYL FKEELVDG  NGNFVLELDFEPF ASFP+PTL+K 
Sbjct  93   GVWEYIRVNVHALVVEELRVAEYLHFKEELVDGSVNGNFVLELDFEPFNASFPRPTLSKY  152

Query  502  IGXGVEFL  525
            IG GVEFL
Sbjct  153  IGNGVEFL  160



>gb|AEV40462.1| sucrose synthase 3 [Gossypium arboreum]
 gb|AFM52234.1| putative sucrose synthase 3 [Gossypium arboreum]
 gb|KHG30366.1| Sucrose synthase [Gossypium arboreum]
Length=805

 Score =   129 bits (325),  Expect(2) = 9e-59, Method: Compositional matrix adjust.
 Identities = 63/92 (68%), Positives = 79/92 (86%), Gaps = 0/92 (0%)
 Frame = +2

Query  47   MAERVLTRVHSLRERLDATLTAHRNEILLFMSKIESHGKGILKPHQLLAEFEAICKEDQE  226
            MA+RV+TRVHSLRERLD TL AHRNEIL  +S+IE  GKGIL+ HQ++ EFEAI +E+++
Sbjct  1    MADRVITRVHSLRERLDETLLAHRNEILALLSRIEGKGKGILQHHQIILEFEAIPEENRK  60

Query  227  KLNDHAFQQVLKSTQEAIVLPPWVALAIRLRP  322
            KL + AF +VLK++QEAIVLPPWVALA+R RP
Sbjct  61   KLANGAFFEVLKASQEAIVLPPWVALAVRPRP  92


 Score =   124 bits (310),  Expect(2) = 9e-59, Method: Composition-based stats.
 Identities = 56/68 (82%), Positives = 61/68 (90%), Gaps = 0/68 (0%)
 Frame = +1

Query  322  GVWEYVTVNVHALXVEELTVPEYLQFKEELVDGPANGNFVLELDFEPFTASFPKPTLTKS  501
            GVWEY+ VNVHAL VEELTV EYL FKEELVDG +NGNFVLELDFEPF +SFP+PTL+KS
Sbjct  93   GVWEYIRVNVHALVVEELTVAEYLHFKEELVDGSSNGNFVLELDFEPFNSSFPRPTLSKS  152

Query  502  IGXGVEFL  525
            IG GVEFL
Sbjct  153  IGNGVEFL  160



>gb|AEN71063.1| sucrose synthase Sus1 [Gossypium mustelinum]
 gb|AEN71065.1| sucrose synthase Sus1 [Gossypium darwinii]
 gb|AEN71069.1| sucrose synthase Sus1 [Gossypium barbadense var. brasiliense]
 gb|AEN71071.1| sucrose synthase Sus1 [Gossypium barbadense var. peruvianum]
 gb|AEN71073.1| sucrose synthase Sus1 [Gossypium hirsutum subsp. latifolium]
Length=805

 Score =   129 bits (325),  Expect(2) = 9e-59, Method: Compositional matrix adjust.
 Identities = 63/92 (68%), Positives = 79/92 (86%), Gaps = 0/92 (0%)
 Frame = +2

Query  47   MAERVLTRVHSLRERLDATLTAHRNEILLFMSKIESHGKGILKPHQLLAEFEAICKEDQE  226
            MA+RV+TRVHSLRERLD TL AHRNEIL  +S+IE  GKGIL+ HQ++ EFEAI +E+++
Sbjct  1    MADRVITRVHSLRERLDETLLAHRNEILALLSRIEGKGKGILQHHQIILEFEAIPEENRK  60

Query  227  KLNDHAFQQVLKSTQEAIVLPPWVALAIRLRP  322
            KL + AF +VLK++QEAIVLPPWVALA+R RP
Sbjct  61   KLANGAFFEVLKASQEAIVLPPWVALAVRPRP  92


 Score =   124 bits (310),  Expect(2) = 9e-59, Method: Composition-based stats.
 Identities = 56/68 (82%), Positives = 61/68 (90%), Gaps = 0/68 (0%)
 Frame = +1

Query  322  GVWEYVTVNVHALXVEELTVPEYLQFKEELVDGPANGNFVLELDFEPFTASFPKPTLTKS  501
            GVWEY+ VNVHAL VEELTV EYL FKEELVDG +NGNFVLELDFEPF +SFP+PTL+KS
Sbjct  93   GVWEYIRVNVHALVVEELTVAEYLHFKEELVDGSSNGNFVLELDFEPFNSSFPRPTLSKS  152

Query  502  IGXGVEFL  525
            IG GVEFL
Sbjct  153  IGNGVEFL  160



>gb|ADY68846.1| sucrose synthase [Gossypium herbaceum subsp. africanum]
Length=805

 Score =   129 bits (325),  Expect(2) = 9e-59, Method: Compositional matrix adjust.
 Identities = 63/92 (68%), Positives = 79/92 (86%), Gaps = 0/92 (0%)
 Frame = +2

Query  47   MAERVLTRVHSLRERLDATLTAHRNEILLFMSKIESHGKGILKPHQLLAEFEAICKEDQE  226
            MA+RV+TRVHSLRERLD TL AHRNEIL  +S+IE  GKGIL+ HQ++ EFEAI +E+++
Sbjct  1    MADRVITRVHSLRERLDETLLAHRNEILALLSRIEGKGKGILQHHQIILEFEAIPEENRK  60

Query  227  KLNDHAFQQVLKSTQEAIVLPPWVALAIRLRP  322
            KL + AF +VLK++QEAIVLPPWVALA+R RP
Sbjct  61   KLANGAFFEVLKASQEAIVLPPWVALAVRPRP  92


 Score =   124 bits (310),  Expect(2) = 9e-59, Method: Composition-based stats.
 Identities = 56/68 (82%), Positives = 61/68 (90%), Gaps = 0/68 (0%)
 Frame = +1

Query  322  GVWEYVTVNVHALXVEELTVPEYLQFKEELVDGPANGNFVLELDFEPFTASFPKPTLTKS  501
            GVWEY+ VNVHAL VEELTV EYL FKEELVDG +NGNFVLELDFEPF +SFP+PTL+KS
Sbjct  93   GVWEYIRVNVHALVVEELTVAEYLHFKEELVDGSSNGNFVLELDFEPFNSSFPRPTLSKS  152

Query  502  IGXGVEFL  525
            IG GVEFL
Sbjct  153  IGNGVEFL  160



>gb|AEV40463.1| sucrose synthase 4 [Gossypium arboreum]
 gb|AFM52235.1| putative sucrose synthase 4 [Gossypium arboreum]
 gb|KHG06249.1| Sucrose synthase [Gossypium arboreum]
Length=806

 Score =   130 bits (326),  Expect(2) = 9e-59, Method: Compositional matrix adjust.
 Identities = 61/92 (66%), Positives = 78/92 (85%), Gaps = 0/92 (0%)
 Frame = +2

Query  47   MAERVLTRVHSLRERLDATLTAHRNEILLFMSKIESHGKGILKPHQLLAEFEAICKEDQE  226
            MAERV+TRVHSLRERLD TL AHRNE+L  +++IE  GKGIL+ HQ++ EFEAI +E ++
Sbjct  1    MAERVITRVHSLRERLDDTLIAHRNEVLALLTRIEGKGKGILQHHQIILEFEAIPEETRK  60

Query  227  KLNDHAFQQVLKSTQEAIVLPPWVALAIRLRP  322
            KL D AF ++L+++QEAIVLPPWVALA+R RP
Sbjct  61   KLADGAFSEILRASQEAIVLPPWVALAVRPRP  92


 Score =   123 bits (309),  Expect(2) = 9e-59, Method: Composition-based stats.
 Identities = 57/68 (84%), Positives = 60/68 (88%), Gaps = 0/68 (0%)
 Frame = +1

Query  322  GVWEYVTVNVHALXVEELTVPEYLQFKEELVDGPANGNFVLELDFEPFTASFPKPTLTKS  501
            GVWEY+ VNVHAL VEELTV EYL FKEELVDG ANGNFVLELDFEPF ASFP+ TL+KS
Sbjct  93   GVWEYIKVNVHALVVEELTVAEYLHFKEELVDGSANGNFVLELDFEPFNASFPRSTLSKS  152

Query  502  IGXGVEFL  525
            IG GVEFL
Sbjct  153  IGNGVEFL  160



>gb|AIJ28962.1| sucrose synthase [Manihot esculenta]
Length=806

 Score =   134 bits (336),  Expect(2) = 1e-58, Method: Compositional matrix adjust.
 Identities = 64/92 (70%), Positives = 80/92 (87%), Gaps = 0/92 (0%)
 Frame = +2

Query  47   MAERVLTRVHSLRERLDATLTAHRNEILLFMSKIESHGKGILKPHQLLAEFEAICKEDQE  226
            MAERV+TRVHS+RERLD TL+AHRNEI+  +S+IE  GKGIL+ HQ++AEFEAI +E+++
Sbjct  1    MAERVITRVHSIRERLDETLSAHRNEIVALLSRIEGKGKGILQHHQIIAEFEAIPEENRK  60

Query  227  KLNDHAFQQVLKSTQEAIVLPPWVALAIRLRP  322
            KL D AF +VL+S QEAIVLPPWVALA+R RP
Sbjct  61   KLLDGAFGEVLRSAQEAIVLPPWVALAVRPRP  92


 Score =   119 bits (299),  Expect(2) = 1e-58, Method: Composition-based stats.
 Identities = 55/68 (81%), Positives = 58/68 (85%), Gaps = 0/68 (0%)
 Frame = +1

Query  322  GVWEYVTVNVHALXVEELTVPEYLQFKEELVDGPANGNFVLELDFEPFTASFPKPTLTKS  501
            GVWEY+ VNVHAL VEEL V EYL FKEELVDG  NGNFVLELDFEPF ASFP+PTL+K 
Sbjct  93   GVWEYIRVNVHALVVEELRVAEYLHFKEELVDGSVNGNFVLELDFEPFNASFPRPTLSKY  152

Query  502  IGXGVEFL  525
            IG GVEFL
Sbjct  153  IGNGVEFL  160



>ref|XP_006474580.1| PREDICTED: sucrose synthase-like isoform X1 [Citrus sinensis]
 ref|XP_006474581.1| PREDICTED: sucrose synthase-like isoform X2 [Citrus sinensis]
 ref|XP_006474582.1| PREDICTED: sucrose synthase-like isoform X3 [Citrus sinensis]
 ref|XP_006474583.1| PREDICTED: sucrose synthase-like isoform X4 [Citrus sinensis]
 ref|XP_006474584.1| PREDICTED: sucrose synthase-like isoform X5 [Citrus sinensis]
 ref|XP_006474585.1| PREDICTED: sucrose synthase-like isoform X6 [Citrus sinensis]
 ref|XP_006474586.1| PREDICTED: sucrose synthase-like isoform X7 [Citrus sinensis]
 ref|XP_006474587.1| PREDICTED: sucrose synthase-like isoform X8 [Citrus sinensis]
 gb|KDO73779.1| hypothetical protein CISIN_1g003661mg [Citrus sinensis]
 gb|KDO73780.1| hypothetical protein CISIN_1g003661mg [Citrus sinensis]
 gb|KDO73781.1| hypothetical protein CISIN_1g003661mg [Citrus sinensis]
 gb|KDO73782.1| hypothetical protein CISIN_1g003661mg [Citrus sinensis]
 gb|KDO73783.1| hypothetical protein CISIN_1g003661mg [Citrus sinensis]
 gb|KDO73784.1| hypothetical protein CISIN_1g003661mg [Citrus sinensis]
 gb|KDO73785.1| hypothetical protein CISIN_1g003661mg [Citrus sinensis]
 gb|AIN45138.1| sucrose synthase [Citrus suavissima]
Length=805

 Score =   134 bits (337),  Expect(2) = 1e-58, Method: Compositional matrix adjust.
 Identities = 64/92 (70%), Positives = 79/92 (86%), Gaps = 0/92 (0%)
 Frame = +2

Query  47   MAERVLTRVHSLRERLDATLTAHRNEILLFMSKIESHGKGILKPHQLLAEFEAICKEDQE  226
            MAER LTRVHSLRERLD TL+AHRNEIL  +S+IE  GKGIL+ HQL+AEFE+I +E+++
Sbjct  1    MAERALTRVHSLRERLDETLSAHRNEILALLSRIEGKGKGILQNHQLIAEFESISEENRK  60

Query  227  KLNDHAFQQVLKSTQEAIVLPPWVALAIRLRP  322
             L + AF +VL++TQEAIVLPPWVALA+R RP
Sbjct  61   HLTEGAFGEVLRATQEAIVLPPWVALAVRPRP  92


 Score =   119 bits (297),  Expect(2) = 1e-58, Method: Compositional matrix adjust.
 Identities = 56/68 (82%), Positives = 60/68 (88%), Gaps = 0/68 (0%)
 Frame = +1

Query  322  GVWEYVTVNVHALXVEELTVPEYLQFKEELVDGPANGNFVLELDFEPFTASFPKPTLTKS  501
            GVWEY+ VNVHAL VEEL V EYL FKEELVDG +NGNFVLELDFEPF ASFP+PTL+KS
Sbjct  93   GVWEYIRVNVHALVVEELLVAEYLHFKEELVDGGSNGNFVLELDFEPFNASFPRPTLSKS  152

Query  502  IGXGVEFL  525
            IG GVEFL
Sbjct  153  IGNGVEFL  160



>gb|ADY68848.1| sucrose synthase [Gossypium hirsutum]
Length=805

 Score =   129 bits (325),  Expect(2) = 1e-58, Method: Compositional matrix adjust.
 Identities = 63/92 (68%), Positives = 79/92 (86%), Gaps = 0/92 (0%)
 Frame = +2

Query  47   MAERVLTRVHSLRERLDATLTAHRNEILLFMSKIESHGKGILKPHQLLAEFEAICKEDQE  226
            MA+RV+TRVHSLRERLD TL AHRNEIL  +S+IE  GKGIL+ HQ++ EFEAI +E+++
Sbjct  1    MADRVITRVHSLRERLDETLLAHRNEILALLSRIEGKGKGILQHHQIILEFEAIPEENRK  60

Query  227  KLNDHAFQQVLKSTQEAIVLPPWVALAIRLRP  322
            KL + AF +VLK++QEAIVLPPWVALA+R RP
Sbjct  61   KLANGAFFEVLKASQEAIVLPPWVALAVRPRP  92


 Score =   124 bits (310),  Expect(2) = 1e-58, Method: Composition-based stats.
 Identities = 56/68 (82%), Positives = 61/68 (90%), Gaps = 0/68 (0%)
 Frame = +1

Query  322  GVWEYVTVNVHALXVEELTVPEYLQFKEELVDGPANGNFVLELDFEPFTASFPKPTLTKS  501
            GVWEY+ VNVHAL VEELTV EYL FKEELVDG +NGNFVLELDFEPF +SFP+PTL+KS
Sbjct  93   GVWEYIRVNVHALVVEELTVAEYLHFKEELVDGSSNGNFVLELDFEPFNSSFPRPTLSKS  152

Query  502  IGXGVEFL  525
            IG GVEFL
Sbjct  153  IGNGVEFL  160



>gb|KDO73786.1| hypothetical protein CISIN_1g003661mg [Citrus sinensis]
Length=700

 Score =   134 bits (337),  Expect(2) = 1e-58, Method: Compositional matrix adjust.
 Identities = 64/92 (70%), Positives = 79/92 (86%), Gaps = 0/92 (0%)
 Frame = +2

Query  47   MAERVLTRVHSLRERLDATLTAHRNEILLFMSKIESHGKGILKPHQLLAEFEAICKEDQE  226
            MAER LTRVHSLRERLD TL+AHRNEIL  +S+IE  GKGIL+ HQL+AEFE+I +E+++
Sbjct  1    MAERALTRVHSLRERLDETLSAHRNEILALLSRIEGKGKGILQNHQLIAEFESISEENRK  60

Query  227  KLNDHAFQQVLKSTQEAIVLPPWVALAIRLRP  322
             L + AF +VL++TQEAIVLPPWVALA+R RP
Sbjct  61   HLTEGAFGEVLRATQEAIVLPPWVALAVRPRP  92


 Score =   119 bits (297),  Expect(2) = 1e-58, Method: Compositional matrix adjust.
 Identities = 56/68 (82%), Positives = 60/68 (88%), Gaps = 0/68 (0%)
 Frame = +1

Query  322  GVWEYVTVNVHALXVEELTVPEYLQFKEELVDGPANGNFVLELDFEPFTASFPKPTLTKS  501
            GVWEY+ VNVHAL VEEL V EYL FKEELVDG +NGNFVLELDFEPF ASFP+PTL+KS
Sbjct  93   GVWEYIRVNVHALVVEELLVAEYLHFKEELVDGGSNGNFVLELDFEPFNASFPRPTLSKS  152

Query  502  IGXGVEFL  525
            IG GVEFL
Sbjct  153  IGNGVEFL  160



>gb|KDO73787.1| hypothetical protein CISIN_1g003661mg [Citrus sinensis]
Length=562

 Score =   134 bits (336),  Expect(2) = 1e-58, Method: Compositional matrix adjust.
 Identities = 64/92 (70%), Positives = 79/92 (86%), Gaps = 0/92 (0%)
 Frame = +2

Query  47   MAERVLTRVHSLRERLDATLTAHRNEILLFMSKIESHGKGILKPHQLLAEFEAICKEDQE  226
            MAER LTRVHSLRERLD TL+AHRNEIL  +S+IE  GKGIL+ HQL+AEFE+I +E+++
Sbjct  1    MAERALTRVHSLRERLDETLSAHRNEILALLSRIEGKGKGILQNHQLIAEFESISEENRK  60

Query  227  KLNDHAFQQVLKSTQEAIVLPPWVALAIRLRP  322
             L + AF +VL++TQEAIVLPPWVALA+R RP
Sbjct  61   HLTEGAFGEVLRATQEAIVLPPWVALAVRPRP  92


 Score =   119 bits (297),  Expect(2) = 1e-58, Method: Compositional matrix adjust.
 Identities = 56/68 (82%), Positives = 60/68 (88%), Gaps = 0/68 (0%)
 Frame = +1

Query  322  GVWEYVTVNVHALXVEELTVPEYLQFKEELVDGPANGNFVLELDFEPFTASFPKPTLTKS  501
            GVWEY+ VNVHAL VEEL V EYL FKEELVDG +NGNFVLELDFEPF ASFP+PTL+KS
Sbjct  93   GVWEYIRVNVHALVVEELLVAEYLHFKEELVDGGSNGNFVLELDFEPFNASFPRPTLSKS  152

Query  502  IGXGVEFL  525
            IG GVEFL
Sbjct  153  IGNGVEFL  160



>ref|XP_008338289.1| PREDICTED: sucrose synthase-like [Malus domestica]
Length=807

 Score =   130 bits (327),  Expect(2) = 2e-58, Method: Compositional matrix adjust.
 Identities = 64/92 (70%), Positives = 74/92 (80%), Gaps = 0/92 (0%)
 Frame = +2

Query  47   MAERVLTRVHSLRERLDATLTAHRNEILLFMSKIESHGKGILKPHQLLAEFEAICKEDQE  226
            MAER LTRV SLRERLD TL  HRNEIL  +S+IES GKG L+PHQL AEFEAI + +++
Sbjct  1    MAERALTRVQSLRERLDETLXTHRNEILALLSRIESKGKGFLQPHQLHAEFEAIPENNRQ  60

Query  227  KLNDHAFQQVLKSTQEAIVLPPWVALAIRLRP  322
            KL D AF +VLK TQEA+VLPPWVA A+R RP
Sbjct  61   KLLDGAFGEVLKHTQEAVVLPPWVAFAVRPRP  92


 Score =   122 bits (305),  Expect(2) = 2e-58, Method: Composition-based stats.
 Identities = 55/68 (81%), Positives = 61/68 (90%), Gaps = 0/68 (0%)
 Frame = +1

Query  322  GVWEYVTVNVHALXVEELTVPEYLQFKEELVDGPANGNFVLELDFEPFTASFPKPTLTKS  501
            GVWEY+ VNVHAL +EEL V EYLQFKEELVDG +NGNFVLELDF+PF ASFP+PTL+KS
Sbjct  93   GVWEYIRVNVHALVLEELRVAEYLQFKEELVDGSSNGNFVLELDFQPFHASFPRPTLSKS  152

Query  502  IGXGVEFL  525
            IG GVEFL
Sbjct  153  IGKGVEFL  160



>gb|AEN83999.1| sucrose synthase [Cucumis sativus]
Length=806

 Score =   131 bits (329),  Expect(2) = 2e-58, Method: Compositional matrix adjust.
 Identities = 64/92 (70%), Positives = 77/92 (84%), Gaps = 0/92 (0%)
 Frame = +2

Query  47   MAERVLTRVHSLRERLDATLTAHRNEILLFMSKIESHGKGILKPHQLLAEFEAICKEDQE  226
            MAERVL R+HSLRERLD TL A RNEIL  +SKIE+ GKGIL+ H+L+AEFE I +E++ 
Sbjct  1    MAERVLNRIHSLRERLDETLIAQRNEILGLLSKIEAKGKGILQHHELIAEFETIPEENRR  60

Query  227  KLNDHAFQQVLKSTQEAIVLPPWVALAIRLRP  322
            KL D AF +VL+STQE+IVLPPWVALA+R RP
Sbjct  61   KLADGAFGEVLRSTQESIVLPPWVALAVRPRP  92


 Score =   121 bits (303),  Expect(2) = 2e-58, Method: Composition-based stats.
 Identities = 55/68 (81%), Positives = 60/68 (88%), Gaps = 0/68 (0%)
 Frame = +1

Query  322  GVWEYVTVNVHALXVEELTVPEYLQFKEELVDGPANGNFVLELDFEPFTASFPKPTLTKS  501
            GVWEY+ VNVHAL VEEL   EYL+FKEELVDG +NGNFVLELDFEPF ASFP+PTL+KS
Sbjct  93   GVWEYIKVNVHALVVEELQASEYLRFKEELVDGSSNGNFVLELDFEPFNASFPRPTLSKS  152

Query  502  IGXGVEFL  525
            IG GVEFL
Sbjct  153  IGNGVEFL  160



>ref|XP_008391788.1| PREDICTED: sucrose synthase-like isoform X2 [Malus domestica]
Length=806

 Score =   130 bits (327),  Expect(2) = 2e-58, Method: Compositional matrix adjust.
 Identities = 64/92 (70%), Positives = 74/92 (80%), Gaps = 0/92 (0%)
 Frame = +2

Query  47   MAERVLTRVHSLRERLDATLTAHRNEILLFMSKIESHGKGILKPHQLLAEFEAICKEDQE  226
            MAER LTRV SLRERLD TL  HRNEIL  +S+IES GKG L+PHQL AEFEAI + +++
Sbjct  1    MAERALTRVQSLRERLDETLXTHRNEILALLSRIESKGKGFLQPHQLHAEFEAIPENNRQ  60

Query  227  KLNDHAFQQVLKSTQEAIVLPPWVALAIRLRP  322
            KL D AF +VLK TQEA+VLPPWVA A+R RP
Sbjct  61   KLLDGAFGEVLKHTQEAVVLPPWVAFAVRPRP  92


 Score =   122 bits (305),  Expect(2) = 2e-58, Method: Composition-based stats.
 Identities = 55/68 (81%), Positives = 61/68 (90%), Gaps = 0/68 (0%)
 Frame = +1

Query  322  GVWEYVTVNVHALXVEELTVPEYLQFKEELVDGPANGNFVLELDFEPFTASFPKPTLTKS  501
            GVWEY+ VNVHAL +EEL V EYLQFKEELVDG +NGNFVLELDF+PF ASFP+PTL+KS
Sbjct  93   GVWEYIRVNVHALVLEELRVAEYLQFKEELVDGSSNGNFVLELDFQPFHASFPRPTLSKS  152

Query  502  IGXGVEFL  525
            IG GVEFL
Sbjct  153  IGKGVEFL  160



>ref|XP_008450968.1| PREDICTED: sucrose synthase [Cucumis melo]
 ref|XP_008450969.1| PREDICTED: sucrose synthase [Cucumis melo]
 ref|XP_008450970.1| PREDICTED: sucrose synthase [Cucumis melo]
Length=806

 Score =   132 bits (331),  Expect(2) = 2e-58, Method: Compositional matrix adjust.
 Identities = 65/92 (71%), Positives = 78/92 (85%), Gaps = 0/92 (0%)
 Frame = +2

Query  47   MAERVLTRVHSLRERLDATLTAHRNEILLFMSKIESHGKGILKPHQLLAEFEAICKEDQE  226
            MAERVL RVHSLRERLD TL A RNEIL  +SKIE+ GKGIL+ H+L+AEFE I +E+++
Sbjct  1    MAERVLNRVHSLRERLDETLIAQRNEILGLLSKIEAKGKGILQHHELIAEFETIPEENRK  60

Query  227  KLNDHAFQQVLKSTQEAIVLPPWVALAIRLRP  322
            KL D AF +VL+STQE+IVLPPWVALA+R RP
Sbjct  61   KLADGAFGEVLRSTQESIVLPPWVALAVRPRP  92


 Score =   120 bits (301),  Expect(2) = 2e-58, Method: Compositional matrix adjust.
 Identities = 56/68 (82%), Positives = 61/68 (90%), Gaps = 0/68 (0%)
 Frame = +1

Query  322  GVWEYVTVNVHALXVEELTVPEYLQFKEELVDGPANGNFVLELDFEPFTASFPKPTLTKS  501
            GVWEY+ VNVHAL VEEL V EYL+FKEELVDG +NGNFVLELDFEPF ASFP+PTL+KS
Sbjct  93   GVWEYIKVNVHALVVEELQVSEYLRFKEELVDGSSNGNFVLELDFEPFNASFPRPTLSKS  152

Query  502  IGXGVEFL  525
            IG GVEFL
Sbjct  153  IGNGVEFL  160



>gb|KJB54541.1| hypothetical protein B456_009G038000 [Gossypium raimondii]
Length=819

 Score =   127 bits (320),  Expect(2) = 2e-58, Method: Compositional matrix adjust.
 Identities = 63/92 (68%), Positives = 77/92 (84%), Gaps = 0/92 (0%)
 Frame = +2

Query  47   MAERVLTRVHSLRERLDATLTAHRNEILLFMSKIESHGKGILKPHQLLAEFEAICKEDQE  226
            MA  V+TRVHSLRERLD TL AHRNEIL  +S+IE  GKGIL+ HQ++ EFEAI +E+++
Sbjct  1    MANPVITRVHSLRERLDETLLAHRNEILALLSRIEGKGKGILQHHQIILEFEAIPEENRK  60

Query  227  KLNDHAFQQVLKSTQEAIVLPPWVALAIRLRP  322
            KL D AF +VLK++QEAIVLPPWVALA+R RP
Sbjct  61   KLADGAFFEVLKASQEAIVLPPWVALAVRPRP  92


 Score =   124 bits (311),  Expect(2) = 2e-58, Method: Composition-based stats.
 Identities = 56/68 (82%), Positives = 61/68 (90%), Gaps = 0/68 (0%)
 Frame = +1

Query  322  GVWEYVTVNVHALXVEELTVPEYLQFKEELVDGPANGNFVLELDFEPFTASFPKPTLTKS  501
            GVWEY+ VNVHAL VEELTV EYL FKEELVDG +NGNFVLELDFEPF +SFP+PTL+KS
Sbjct  93   GVWEYIRVNVHALVVEELTVAEYLHFKEELVDGSSNGNFVLELDFEPFNSSFPRPTLSKS  152

Query  502  IGXGVEFL  525
            IG GVEFL
Sbjct  153  IGNGVEFL  160



>dbj|BAA89232.1| wsus [Citrullus lanatus]
Length=806

 Score =   131 bits (330),  Expect(2) = 3e-58, Method: Compositional matrix adjust.
 Identities = 65/92 (71%), Positives = 78/92 (85%), Gaps = 0/92 (0%)
 Frame = +2

Query  47   MAERVLTRVHSLRERLDATLTAHRNEILLFMSKIESHGKGILKPHQLLAEFEAICKEDQE  226
            MAERVL RVHSLRERLD TL A RNEIL  +SKIE+ GKGIL+ HQL+AEFEAI +E+++
Sbjct  1    MAERVLNRVHSLRERLDETLIAQRNEILGLLSKIEAKGKGILQHHQLIAEFEAIPEENRK  60

Query  227  KLNDHAFQQVLKSTQEAIVLPPWVALAIRLRP  322
            KL D  F +VL++TQE+IVLPPWVALA+R RP
Sbjct  61   KLADGDFGEVLRATQESIVLPPWVALAVRPRP  92


 Score =   120 bits (301),  Expect(2) = 3e-58, Method: Composition-based stats.
 Identities = 55/68 (81%), Positives = 59/68 (87%), Gaps = 0/68 (0%)
 Frame = +1

Query  322  GVWEYVTVNVHALXVEELTVPEYLQFKEELVDGPANGNFVLELDFEPFTASFPKPTLTKS  501
            GVWEY+ VNVHAL VEEL V EYL  KEELVDG +NGNFVLELDFEPF ASFP+PTL+KS
Sbjct  93   GVWEYIKVNVHALVVEELQVAEYLHLKEELVDGSSNGNFVLELDFEPFNASFPRPTLSKS  152

Query  502  IGXGVEFL  525
            IG GVEFL
Sbjct  153  IGNGVEFL  160



>ref|XP_008391777.1| PREDICTED: sucrose synthase-like isoform X1 [Malus domestica]
 ref|XP_008391781.1| PREDICTED: sucrose synthase-like isoform X1 [Malus domestica]
Length=806

 Score =   130 bits (326),  Expect(2) = 3e-58, Method: Compositional matrix adjust.
 Identities = 64/92 (70%), Positives = 74/92 (80%), Gaps = 0/92 (0%)
 Frame = +2

Query  47   MAERVLTRVHSLRERLDATLTAHRNEILLFMSKIESHGKGILKPHQLLAEFEAICKEDQE  226
            MAER LTRV SLRERLD TL  HRNEIL  +S+IES GKG L+PHQL AEFEAI + +++
Sbjct  1    MAERALTRVQSLRERLDETLFTHRNEILALLSRIESKGKGFLQPHQLHAEFEAIPENNRQ  60

Query  227  KLNDHAFQQVLKSTQEAIVLPPWVALAIRLRP  322
            KL D AF +VLK TQEA+VLPPWVA A+R RP
Sbjct  61   KLLDGAFGEVLKHTQEAVVLPPWVAFAVRPRP  92


 Score =   122 bits (305),  Expect(2) = 3e-58, Method: Composition-based stats.
 Identities = 55/68 (81%), Positives = 61/68 (90%), Gaps = 0/68 (0%)
 Frame = +1

Query  322  GVWEYVTVNVHALXVEELTVPEYLQFKEELVDGPANGNFVLELDFEPFTASFPKPTLTKS  501
            GVWEY+ VNVHAL +EEL V EYLQFKEELVDG +NGNFVLELDF+PF ASFP+PTL+KS
Sbjct  93   GVWEYIRVNVHALVLEELRVAEYLQFKEELVDGSSNGNFVLELDFQPFHASFPRPTLSKS  152

Query  502  IGXGVEFL  525
            IG GVEFL
Sbjct  153  IGKGVEFL  160



>gb|AEN71078.1| sucrose synthase Sus1 [Gossypium klotzschianum]
Length=805

 Score =   127 bits (320),  Expect(2) = 3e-58, Method: Compositional matrix adjust.
 Identities = 63/92 (68%), Positives = 77/92 (84%), Gaps = 0/92 (0%)
 Frame = +2

Query  47   MAERVLTRVHSLRERLDATLTAHRNEILLFMSKIESHGKGILKPHQLLAEFEAICKEDQE  226
            MA  V+TRVHSLRERLD TL AHRNEIL  +S+IE  GKGIL+ HQ++ EFEAI +E+++
Sbjct  1    MANPVITRVHSLRERLDETLLAHRNEILALLSRIEGKGKGILQHHQIILEFEAIPEENRK  60

Query  227  KLNDHAFQQVLKSTQEAIVLPPWVALAIRLRP  322
            KL D AF +VLK++QEAIVLPPWVALA+R RP
Sbjct  61   KLADGAFFEVLKASQEAIVLPPWVALAVRPRP  92


 Score =   124 bits (310),  Expect(2) = 3e-58, Method: Composition-based stats.
 Identities = 56/68 (82%), Positives = 61/68 (90%), Gaps = 0/68 (0%)
 Frame = +1

Query  322  GVWEYVTVNVHALXVEELTVPEYLQFKEELVDGPANGNFVLELDFEPFTASFPKPTLTKS  501
            GVWEY+ VNVHAL VEELTV EYL FKEELVDG +NGNFVLELDFEPF +SFP+PTL+KS
Sbjct  93   GVWEYIRVNVHALVVEELTVAEYLHFKEELVDGSSNGNFVLELDFEPFNSSFPRPTLSKS  152

Query  502  IGXGVEFL  525
            IG GVEFL
Sbjct  153  IGNGVEFL  160



>gb|KJB54539.1| hypothetical protein B456_009G038000 [Gossypium raimondii]
Length=833

 Score =   127 bits (320),  Expect(2) = 3e-58, Method: Compositional matrix adjust.
 Identities = 63/92 (68%), Positives = 77/92 (84%), Gaps = 0/92 (0%)
 Frame = +2

Query  47   MAERVLTRVHSLRERLDATLTAHRNEILLFMSKIESHGKGILKPHQLLAEFEAICKEDQE  226
            MA  V+TRVHSLRERLD TL AHRNEIL  +S+IE  GKGIL+ HQ++ EFEAI +E+++
Sbjct  1    MANPVITRVHSLRERLDETLLAHRNEILALLSRIEGKGKGILQHHQIILEFEAIPEENRK  60

Query  227  KLNDHAFQQVLKSTQEAIVLPPWVALAIRLRP  322
            KL D AF +VLK++QEAIVLPPWVALA+R RP
Sbjct  61   KLADGAFFEVLKASQEAIVLPPWVALAVRPRP  92


 Score =   124 bits (310),  Expect(2) = 3e-58, Method: Composition-based stats.
 Identities = 56/68 (82%), Positives = 61/68 (90%), Gaps = 0/68 (0%)
 Frame = +1

Query  322  GVWEYVTVNVHALXVEELTVPEYLQFKEELVDGPANGNFVLELDFEPFTASFPKPTLTKS  501
            GVWEY+ VNVHAL VEELTV EYL FKEELVDG +NGNFVLELDFEPF +SFP+PTL+KS
Sbjct  93   GVWEYIRVNVHALVVEELTVAEYLHFKEELVDGSSNGNFVLELDFEPFNSSFPRPTLSKS  152

Query  502  IGXGVEFL  525
            IG GVEFL
Sbjct  153  IGNGVEFL  160



>ref|XP_010047438.1| PREDICTED: sucrose synthase [Eucalyptus grandis]
 gb|KCW79350.1| hypothetical protein EUGRSUZ_C00769 [Eucalyptus grandis]
Length=805

 Score =   134 bits (336),  Expect(2) = 3e-58, Method: Compositional matrix adjust.
 Identities = 62/92 (67%), Positives = 82/92 (89%), Gaps = 0/92 (0%)
 Frame = +2

Query  47   MAERVLTRVHSLRERLDATLTAHRNEILLFMSKIESHGKGILKPHQLLAEFEAICKEDQE  226
            MAER+LTRVHSLRERLD TL AHRN+IL F+++IE+ GKGIL+ HQL+AEFEAI +E ++
Sbjct  1    MAERLLTRVHSLRERLDETLLAHRNDILAFLTRIEAKGKGILQHHQLIAEFEAISEEHRK  60

Query  227  KLNDHAFQQVLKSTQEAIVLPPWVALAIRLRP  322
            KL++ AF ++L+S+QEAI+LPPW+ALA+R RP
Sbjct  61   KLSEGAFGEILRSSQEAIILPPWIALAVRPRP  92


 Score =   117 bits (294),  Expect(2) = 3e-58, Method: Composition-based stats.
 Identities = 53/68 (78%), Positives = 59/68 (87%), Gaps = 0/68 (0%)
 Frame = +1

Query  322  GVWEYVTVNVHALXVEELTVPEYLQFKEELVDGPANGNFVLELDFEPFTASFPKPTLTKS  501
            GVWEY+ VN+HAL VEEL V E+L FKEELV+G  NGNFVLELDFEPFTA FP+PTL+KS
Sbjct  93   GVWEYIRVNIHALVVEELQVTEFLHFKEELVNGNLNGNFVLELDFEPFTAQFPRPTLSKS  152

Query  502  IGXGVEFL  525
            IG GVEFL
Sbjct  153  IGNGVEFL  160



>gb|AEN71079.1| sucrose synthase Sus1 [Gossypium aridum]
Length=805

 Score =   128 bits (321),  Expect(2) = 4e-58, Method: Compositional matrix adjust.
 Identities = 63/92 (68%), Positives = 77/92 (84%), Gaps = 0/92 (0%)
 Frame = +2

Query  47   MAERVLTRVHSLRERLDATLTAHRNEILLFMSKIESHGKGILKPHQLLAEFEAICKEDQE  226
            MA  V+TRVHSLRERLD TL AHRNEIL  +S+IE  GKGIL+ HQ++ EFEAI +E+++
Sbjct  1    MANPVITRVHSLRERLDETLLAHRNEILALLSRIEGKGKGILQHHQIILEFEAIPEENRK  60

Query  227  KLNDHAFQQVLKSTQEAIVLPPWVALAIRLRP  322
            KL D AF +VLK++QEAIVLPPWVALA+R RP
Sbjct  61   KLADGAFFEVLKASQEAIVLPPWVALAVRPRP  92


 Score =   124 bits (310),  Expect(2) = 4e-58, Method: Composition-based stats.
 Identities = 56/68 (82%), Positives = 61/68 (90%), Gaps = 0/68 (0%)
 Frame = +1

Query  322  GVWEYVTVNVHALXVEELTVPEYLQFKEELVDGPANGNFVLELDFEPFTASFPKPTLTKS  501
            GVWEY+ VNVHAL VEELTV EYL FKEELVDG +NGNFVLELDFEPF +SFP+PTL+KS
Sbjct  93   GVWEYIRVNVHALVVEELTVAEYLHFKEELVDGSSNGNFVLELDFEPFNSSFPRPTLSKS  152

Query  502  IGXGVEFL  525
            IG GVEFL
Sbjct  153  IGNGVEFL  160



>gb|AFY03626.1| sucrose synthase, partial [Eucalyptus globulus]
Length=796

 Score =   132 bits (332),  Expect(2) = 4e-58, Method: Compositional matrix adjust.
 Identities = 62/92 (67%), Positives = 81/92 (88%), Gaps = 0/92 (0%)
 Frame = +2

Query  47   MAERVLTRVHSLRERLDATLTAHRNEILLFMSKIESHGKGILKPHQLLAEFEAICKEDQE  226
            MA R+LTRVHSLRERLD TL AHRN+IL F+++IE+ GKGIL+ HQL+AEFEAI +E ++
Sbjct  1    MAXRLLTRVHSLRERLDETLLAHRNDILAFLTRIEAKGKGILQHHQLIAEFEAISEEHRK  60

Query  227  KLNDHAFQQVLKSTQEAIVLPPWVALAIRLRP  322
            KL++ AF ++L+S+QEAIVLPPW+ALA+R RP
Sbjct  61   KLSEGAFGEILRSSQEAIVLPPWIALAVRPRP  92


 Score =   119 bits (298),  Expect(2) = 4e-58, Method: Composition-based stats.
 Identities = 53/68 (78%), Positives = 59/68 (87%), Gaps = 0/68 (0%)
 Frame = +1

Query  322  GVWEYVTVNVHALXVEELTVPEYLQFKEELVDGPANGNFVLELDFEPFTASFPKPTLTKS  501
            GVWEY+ VN+HAL VEEL V E+L FKEELV+G  NGNFVLELDFEPFTA FP+PTL+KS
Sbjct  93   GVWEYIRVNIHALVVEELQVTEFLHFKEELVBGNLNGNFVLELDFEPFTAQFPRPTLSKS  152

Query  502  IGXGVEFL  525
            IG GVEFL
Sbjct  153  IGNGVEFL  160



>gb|AEN71061.1| sucrose synthase Sus1 [Gossypium schwendimanii]
Length=805

 Score =   127 bits (320),  Expect(2) = 4e-58, Method: Compositional matrix adjust.
 Identities = 63/92 (68%), Positives = 77/92 (84%), Gaps = 0/92 (0%)
 Frame = +2

Query  47   MAERVLTRVHSLRERLDATLTAHRNEILLFMSKIESHGKGILKPHQLLAEFEAICKEDQE  226
            MA  V+TRVHSLRERLD TL AHRNEIL  +S+IE  GKGIL+ HQ++ EFEAI +E+++
Sbjct  1    MANPVITRVHSLRERLDETLLAHRNEILALLSRIEGKGKGILQHHQIILEFEAIPEENRK  60

Query  227  KLNDHAFQQVLKSTQEAIVLPPWVALAIRLRP  322
            KL D AF +VLK++QEAIVLPPWVALA+R RP
Sbjct  61   KLADGAFFEVLKASQEAIVLPPWVALAVRPRP  92


 Score =   124 bits (310),  Expect(2) = 4e-58, Method: Composition-based stats.
 Identities = 56/68 (82%), Positives = 61/68 (90%), Gaps = 0/68 (0%)
 Frame = +1

Query  322  GVWEYVTVNVHALXVEELTVPEYLQFKEELVDGPANGNFVLELDFEPFTASFPKPTLTKS  501
            GVWEY+ VNVHAL VEELTV EYL FKEELVDG +NGNFVLELDFEPF +SFP+PTL+KS
Sbjct  93   GVWEYIRVNVHALVVEELTVAEYLHFKEELVDGSSNGNFVLELDFEPFNSSFPRPTLSKS  152

Query  502  IGXGVEFL  525
            IG GVEFL
Sbjct  153  IGNGVEFL  160



>gb|AAD09568.1| sucrose synthase [Gossypium hirsutum]
Length=454

 Score =   131 bits (330),  Expect(2) = 4e-58, Method: Compositional matrix adjust.
 Identities = 64/92 (70%), Positives = 77/92 (84%), Gaps = 0/92 (0%)
 Frame = +2

Query  47   MAERVLTRVHSLRERLDATLTAHRNEILLFMSKIESHGKGILKPHQLLAEFEAICKEDQE  226
            MAER LTRVHSLRERLD+TLTAHRNEIL  +S+IE  GKGIL  HQ++ EFEAI +E++ 
Sbjct  1    MAERALTRVHSLRERLDSTLTAHRNEILALLSRIEGKGKGILLHHQIILEFEAIPEENER  60

Query  227  KLNDHAFQQVLKSTQEAIVLPPWVALAIRLRP  322
            KL D AF ++LK++QE IVLPPWVALA+R RP
Sbjct  61   KLADGAFFEILKASQEXIVLPPWVALAVRPRP  92


 Score =   120 bits (300),  Expect(2) = 4e-58, Method: Compositional matrix adjust.
 Identities = 56/68 (82%), Positives = 61/68 (90%), Gaps = 0/68 (0%)
 Frame = +1

Query  322  GVWEYVTVNVHALXVEELTVPEYLQFKEELVDGPANGNFVLELDFEPFTASFPKPTLTKS  501
            GVWEY+ VNVHAL VEELTV EYL+FKEELVDG +N NFVLELDFEPF ASFP+PTL+KS
Sbjct  93   GVWEYIRVNVHALVVEELTVAEYLRFKEELVDGSSNANFVLELDFEPFNASFPRPTLSKS  152

Query  502  IGXGVEFL  525
            IG GVEFL
Sbjct  153  IGNGVEFL  160



>gb|AEN71060.1| sucrose synthase Sus1 [Gossypium laxum]
 gb|AEN71081.1| sucrose synthase Sus1 [Gossypium lobatum]
Length=805

 Score =   127 bits (320),  Expect(2) = 4e-58, Method: Compositional matrix adjust.
 Identities = 63/92 (68%), Positives = 77/92 (84%), Gaps = 0/92 (0%)
 Frame = +2

Query  47   MAERVLTRVHSLRERLDATLTAHRNEILLFMSKIESHGKGILKPHQLLAEFEAICKEDQE  226
            MA  V+TRVHSLRERLD TL AHRNEIL  +S+IE  GKGIL+ HQ++ EFEAI +E+++
Sbjct  1    MANPVITRVHSLRERLDETLLAHRNEILALLSRIEGKGKGILQHHQIILEFEAIPEENRK  60

Query  227  KLNDHAFQQVLKSTQEAIVLPPWVALAIRLRP  322
            KL D AF +VLK++QEAIVLPPWVALA+R RP
Sbjct  61   KLADGAFFEVLKASQEAIVLPPWVALAVRPRP  92


 Score =   123 bits (309),  Expect(2) = 4e-58, Method: Composition-based stats.
 Identities = 56/68 (82%), Positives = 61/68 (90%), Gaps = 0/68 (0%)
 Frame = +1

Query  322  GVWEYVTVNVHALXVEELTVPEYLQFKEELVDGPANGNFVLELDFEPFTASFPKPTLTKS  501
            GVWEY+ VNVHAL VEELTV EYL FKEELVDG +NGNFVLELDFEPF +SFP+PTL+KS
Sbjct  93   GVWEYIRVNVHALVVEELTVAEYLHFKEELVDGSSNGNFVLELDFEPFNSSFPRPTLSKS  152

Query  502  IGXGVEFL  525
            IG GVEFL
Sbjct  153  IGNGVEFL  160



>gb|AEN71059.1| sucrose synthase Sus1 [Gossypium thurberi]
 gb|AEN71082.1| sucrose synthase Sus1 [Gossypium trilobum]
Length=805

 Score =   127 bits (320),  Expect(2) = 4e-58, Method: Compositional matrix adjust.
 Identities = 63/92 (68%), Positives = 77/92 (84%), Gaps = 0/92 (0%)
 Frame = +2

Query  47   MAERVLTRVHSLRERLDATLTAHRNEILLFMSKIESHGKGILKPHQLLAEFEAICKEDQE  226
            MA  V+TRVHSLRERLD TL AHRNEIL  +S+IE  GKGIL+ HQ++ EFEAI +E+++
Sbjct  1    MANPVITRVHSLRERLDETLLAHRNEILALLSRIEGKGKGILQHHQIILEFEAIPEENRK  60

Query  227  KLNDHAFQQVLKSTQEAIVLPPWVALAIRLRP  322
            KL D AF +VLK++QEAIVLPPWVALA+R RP
Sbjct  61   KLADGAFFEVLKASQEAIVLPPWVALAVRPRP  92


 Score =   123 bits (309),  Expect(2) = 4e-58, Method: Composition-based stats.
 Identities = 56/68 (82%), Positives = 61/68 (90%), Gaps = 0/68 (0%)
 Frame = +1

Query  322  GVWEYVTVNVHALXVEELTVPEYLQFKEELVDGPANGNFVLELDFEPFTASFPKPTLTKS  501
            GVWEY+ VNVHAL VEELTV EYL FKEELVDG +NGNFVLELDFEPF +SFP+PTL+KS
Sbjct  93   GVWEYIRVNVHALVVEELTVAEYLHFKEELVDGSSNGNFVLELDFEPFNSSFPRPTLSKS  152

Query  502  IGXGVEFL  525
            IG GVEFL
Sbjct  153  IGNGVEFL  160



>gb|ADY68845.1| sucrose synthase [Gossypium barbadense]
 gb|ADY68847.1| sucrose synthase [Gossypium raimondii]
 gb|AEN71062.1| sucrose synthase Sus1 [Gossypium turneri]
 gb|AEN71064.1| sucrose synthase Sus1 [Gossypium mustelinum]
 gb|AEN71070.1| sucrose synthase Sus1 [Gossypium barbadense var. brasiliense]
 gb|AEN71072.1| sucrose synthase Sus1 [Gossypium barbadense var. peruvianum]
 gb|AEN71077.1| sucrose synthase Sus1 [Gossypium davidsonii]
 gb|KJB54536.1| hypothetical protein B456_009G038000 [Gossypium raimondii]
 gb|KJB54537.1| hypothetical protein B456_009G038000 [Gossypium raimondii]
 gb|KJB54538.1| hypothetical protein B456_009G038000 [Gossypium raimondii]
Length=805

 Score =   127 bits (320),  Expect(2) = 4e-58, Method: Compositional matrix adjust.
 Identities = 63/92 (68%), Positives = 77/92 (84%), Gaps = 0/92 (0%)
 Frame = +2

Query  47   MAERVLTRVHSLRERLDATLTAHRNEILLFMSKIESHGKGILKPHQLLAEFEAICKEDQE  226
            MA  V+TRVHSLRERLD TL AHRNEIL  +S+IE  GKGIL+ HQ++ EFEAI +E+++
Sbjct  1    MANPVITRVHSLRERLDETLLAHRNEILALLSRIEGKGKGILQHHQIILEFEAIPEENRK  60

Query  227  KLNDHAFQQVLKSTQEAIVLPPWVALAIRLRP  322
            KL D AF +VLK++QEAIVLPPWVALA+R RP
Sbjct  61   KLADGAFFEVLKASQEAIVLPPWVALAVRPRP  92


 Score =   124 bits (310),  Expect(2) = 4e-58, Method: Composition-based stats.
 Identities = 56/68 (82%), Positives = 61/68 (90%), Gaps = 0/68 (0%)
 Frame = +1

Query  322  GVWEYVTVNVHALXVEELTVPEYLQFKEELVDGPANGNFVLELDFEPFTASFPKPTLTKS  501
            GVWEY+ VNVHAL VEELTV EYL FKEELVDG +NGNFVLELDFEPF +SFP+PTL+KS
Sbjct  93   GVWEYIRVNVHALVVEELTVAEYLHFKEELVDGSSNGNFVLELDFEPFNSSFPRPTLSKS  152

Query  502  IGXGVEFL  525
            IG GVEFL
Sbjct  153  IGNGVEFL  160



>gb|AEN71075.1| sucrose synthase Sus1 [Gossypium armourianum]
 gb|AEN71076.1| sucrose synthase Sus1 [Gossypium harknessii]
Length=805

 Score =   127 bits (320),  Expect(2) = 4e-58, Method: Compositional matrix adjust.
 Identities = 63/92 (68%), Positives = 77/92 (84%), Gaps = 0/92 (0%)
 Frame = +2

Query  47   MAERVLTRVHSLRERLDATLTAHRNEILLFMSKIESHGKGILKPHQLLAEFEAICKEDQE  226
            MA  V+TRVHSLRERLD TL AHRNEIL  +S+IE  GKGIL+ HQ++ EFEAI +E+++
Sbjct  1    MANPVITRVHSLRERLDETLLAHRNEILALLSRIEGKGKGILQHHQIILEFEAIPEENRK  60

Query  227  KLNDHAFQQVLKSTQEAIVLPPWVALAIRLRP  322
            KL D AF +VLK++QEAIVLPPWVALA+R RP
Sbjct  61   KLADGAFFEVLKASQEAIVLPPWVALAVRPRP  92


 Score =   123 bits (309),  Expect(2) = 4e-58, Method: Composition-based stats.
 Identities = 56/68 (82%), Positives = 61/68 (90%), Gaps = 0/68 (0%)
 Frame = +1

Query  322  GVWEYVTVNVHALXVEELTVPEYLQFKEELVDGPANGNFVLELDFEPFTASFPKPTLTKS  501
            GVWEY+ VNVHAL VEELTV EYL FKEELVDG +NGNFVLELDFEPF +SFP+PTL+KS
Sbjct  93   GVWEYIRVNVHALVVEELTVAEYLHFKEELVDGSSNGNFVLELDFEPFNSSFPRPTLSKS  152

Query  502  IGXGVEFL  525
            IG GVEFL
Sbjct  153  IGNGVEFL  160



>gb|AEN71080.1| sucrose synthase Sus1 [Gossypium gossypioides]
Length=805

 Score =   127 bits (320),  Expect(2) = 4e-58, Method: Compositional matrix adjust.
 Identities = 63/92 (68%), Positives = 77/92 (84%), Gaps = 0/92 (0%)
 Frame = +2

Query  47   MAERVLTRVHSLRERLDATLTAHRNEILLFMSKIESHGKGILKPHQLLAEFEAICKEDQE  226
            MA  V+TRVHSLRERLD TL AHRNEIL  +S+IE  GKGIL+ HQ++ EFEAI +E+++
Sbjct  1    MANPVITRVHSLRERLDETLLAHRNEILALLSRIEGKGKGILQHHQIILEFEAIPEENRK  60

Query  227  KLNDHAFQQVLKSTQEAIVLPPWVALAIRLRP  322
            KL D AF +VLK++QEAIVLPPWVALA+R RP
Sbjct  61   KLADGAFFEVLKASQEAIVLPPWVALAVRPRP  92


 Score =   123 bits (309),  Expect(2) = 4e-58, Method: Composition-based stats.
 Identities = 56/68 (82%), Positives = 61/68 (90%), Gaps = 0/68 (0%)
 Frame = +1

Query  322  GVWEYVTVNVHALXVEELTVPEYLQFKEELVDGPANGNFVLELDFEPFTASFPKPTLTKS  501
            GVWEY+ VNVHAL VEELTV EYL FKEELVDG +NGNFVLELDFEPF +SFP+PTL+KS
Sbjct  93   GVWEYIRVNVHALVVEELTVAEYLHFKEELVDGSSNGNFVLELDFEPFNSSFPRPTLSKS  152

Query  502  IGXGVEFL  525
            IG GVEFL
Sbjct  153  IGNGVEFL  160



>gb|AEN71068.1| sucrose synthase Sus1 [Gossypium tomentosum]
Length=805

 Score =   127 bits (320),  Expect(2) = 4e-58, Method: Compositional matrix adjust.
 Identities = 63/92 (68%), Positives = 77/92 (84%), Gaps = 0/92 (0%)
 Frame = +2

Query  47   MAERVLTRVHSLRERLDATLTAHRNEILLFMSKIESHGKGILKPHQLLAEFEAICKEDQE  226
            MA  V+TRVHSLRERLD TL AHRNEIL  +S+IE  GKGIL+ HQ++ EFEAI +E+++
Sbjct  1    MANPVITRVHSLRERLDETLLAHRNEILALLSRIEGKGKGILQHHQIILEFEAIPEENRK  60

Query  227  KLNDHAFQQVLKSTQEAIVLPPWVALAIRLRP  322
            KL D AF +VLK++QEAIVLPPWVALA+R RP
Sbjct  61   KLADGAFFEVLKASQEAIVLPPWVALAVRPRP  92


 Score =   123 bits (309),  Expect(2) = 4e-58, Method: Composition-based stats.
 Identities = 56/68 (82%), Positives = 61/68 (90%), Gaps = 0/68 (0%)
 Frame = +1

Query  322  GVWEYVTVNVHALXVEELTVPEYLQFKEELVDGPANGNFVLELDFEPFTASFPKPTLTKS  501
            GVWEY+ VNVHAL VEELTV EYL FKEELVDG +NGNFVLELDFEPF +SFP+PTL+KS
Sbjct  93   GVWEYIRVNVHALVVEELTVAEYLHFKEELVDGSSNGNFVLELDFEPFNSSFPRPTLSKS  152

Query  502  IGXGVEFL  525
            IG GVEFL
Sbjct  153  IGNGVEFL  160



>dbj|BAM05651.1| sucrose synthase 3, partial [Eucalyptus pyrocarpa]
Length=795

 Score =   132 bits (331),  Expect(2) = 4e-58, Method: Compositional matrix adjust.
 Identities = 62/92 (67%), Positives = 81/92 (88%), Gaps = 0/92 (0%)
 Frame = +2

Query  47   MAERVLTRVHSLRERLDATLTAHRNEILLFMSKIESHGKGILKPHQLLAEFEAICKEDQE  226
            MAE +LTRVHSLRERLD TL AHRN+IL F+++IE+ GKGIL+ HQL+AEFEAI +E ++
Sbjct  1    MAESLLTRVHSLRERLDETLLAHRNDILAFLTRIEAKGKGILQHHQLIAEFEAISEEHRK  60

Query  227  KLNDHAFQQVLKSTQEAIVLPPWVALAIRLRP  322
            KL++ AF ++L+S+QEAIVLPPW+ALA+R RP
Sbjct  61   KLSEGAFGEILRSSQEAIVLPPWIALAVRPRP  92


 Score =   119 bits (298),  Expect(2) = 4e-58, Method: Composition-based stats.
 Identities = 53/68 (78%), Positives = 59/68 (87%), Gaps = 0/68 (0%)
 Frame = +1

Query  322  GVWEYVTVNVHALXVEELTVPEYLQFKEELVDGPANGNFVLELDFEPFTASFPKPTLTKS  501
            GVWEY+ VN+HAL +EEL V E+L FKEELVDG  NGNFVLELDFEPFTA FP+PTL+KS
Sbjct  93   GVWEYIRVNIHALVIEELQVTEFLHFKEELVDGNLNGNFVLELDFEPFTAQFPRPTLSKS  152

Query  502  IGXGVEFL  525
            IG GVEFL
Sbjct  153  IGNGVEFL  160



>gb|KJB54542.1| hypothetical protein B456_009G038000 [Gossypium raimondii]
Length=750

 Score =   127 bits (320),  Expect(2) = 4e-58, Method: Compositional matrix adjust.
 Identities = 63/92 (68%), Positives = 77/92 (84%), Gaps = 0/92 (0%)
 Frame = +2

Query  47   MAERVLTRVHSLRERLDATLTAHRNEILLFMSKIESHGKGILKPHQLLAEFEAICKEDQE  226
            MA  V+TRVHSLRERLD TL AHRNEIL  +S+IE  GKGIL+ HQ++ EFEAI +E+++
Sbjct  1    MANPVITRVHSLRERLDETLLAHRNEILALLSRIEGKGKGILQHHQIILEFEAIPEENRK  60

Query  227  KLNDHAFQQVLKSTQEAIVLPPWVALAIRLRP  322
            KL D AF +VLK++QEAIVLPPWVALA+R RP
Sbjct  61   KLADGAFFEVLKASQEAIVLPPWVALAVRPRP  92


 Score =   123 bits (309),  Expect(2) = 4e-58, Method: Composition-based stats.
 Identities = 56/68 (82%), Positives = 61/68 (90%), Gaps = 0/68 (0%)
 Frame = +1

Query  322  GVWEYVTVNVHALXVEELTVPEYLQFKEELVDGPANGNFVLELDFEPFTASFPKPTLTKS  501
            GVWEY+ VNVHAL VEELTV EYL FKEELVDG +NGNFVLELDFEPF +SFP+PTL+KS
Sbjct  93   GVWEYIRVNVHALVVEELTVAEYLHFKEELVDGSSNGNFVLELDFEPFNSSFPRPTLSKS  152

Query  502  IGXGVEFL  525
            IG GVEFL
Sbjct  153  IGNGVEFL  160



>gb|KJB65376.1| hypothetical protein B456_010G092300 [Gossypium raimondii]
Length=818

 Score =   127 bits (320),  Expect(2) = 5e-58, Method: Compositional matrix adjust.
 Identities = 59/92 (64%), Positives = 76/92 (83%), Gaps = 0/92 (0%)
 Frame = +2

Query  47   MAERVLTRVHSLRERLDATLTAHRNEILLFMSKIESHGKGILKPHQLLAEFEAICKEDQE  226
            MAERV+TRVHSLR+RLD T  AHRNE+L  +++IE  GKGIL+ HQ + EFEAI +E ++
Sbjct  1    MAERVITRVHSLRDRLDDTFIAHRNEVLALLTRIEGKGKGILQHHQFILEFEAIPEETRK  60

Query  227  KLNDHAFQQVLKSTQEAIVLPPWVALAIRLRP  322
            KL D AF ++L+++QEAIVLPPWVALA+R RP
Sbjct  61   KLADGAFSEILRASQEAIVLPPWVALAVRPRP  92


 Score =   123 bits (309),  Expect(2) = 5e-58, Method: Composition-based stats.
 Identities = 57/68 (84%), Positives = 60/68 (88%), Gaps = 0/68 (0%)
 Frame = +1

Query  322  GVWEYVTVNVHALXVEELTVPEYLQFKEELVDGPANGNFVLELDFEPFTASFPKPTLTKS  501
            GVWEY+ VNVHAL VEELTV EYL FKEELVDG ANGNFVLELDFEPF ASFP+ TL+KS
Sbjct  93   GVWEYIKVNVHALVVEELTVAEYLHFKEELVDGSANGNFVLELDFEPFNASFPRSTLSKS  152

Query  502  IGXGVEFL  525
            IG GVEFL
Sbjct  153  IGNGVEFL  160



>ref|XP_002275155.1| PREDICTED: sucrose synthase [Vitis vinifera]
 ref|XP_010656083.1| PREDICTED: sucrose synthase [Vitis vinifera]
 ref|XP_010656084.1| PREDICTED: sucrose synthase [Vitis vinifera]
 emb|CBI27755.3| unnamed protein product [Vitis vinifera]
Length=806

 Score =   134 bits (337),  Expect(2) = 5e-58, Method: Compositional matrix adjust.
 Identities = 63/92 (68%), Positives = 77/92 (84%), Gaps = 0/92 (0%)
 Frame = +2

Query  47   MAERVLTRVHSLRERLDATLTAHRNEILLFMSKIESHGKGILKPHQLLAEFEAICKEDQE  226
            MA+ VLT VHSLR R+D TLTAHRNEIL F+S+IE HGKGIL+PHQLLAEFEA+ + +++
Sbjct  1    MADGVLTGVHSLRARVDETLTAHRNEILSFLSRIEGHGKGILQPHQLLAEFEALPEVNRK  60

Query  227  KLNDHAFQQVLKSTQEAIVLPPWVALAIRLRP  322
            KL+D  F  +LKS QEAIVLPPW+A A+R RP
Sbjct  61   KLSDGPFGDILKSIQEAIVLPPWIAFAVRPRP  92


 Score =   117 bits (292),  Expect(2) = 5e-58, Method: Compositional matrix adjust.
 Identities = 56/68 (82%), Positives = 59/68 (87%), Gaps = 0/68 (0%)
 Frame = +1

Query  322  GVWEYVTVNVHALXVEELTVPEYLQFKEELVDGPANGNFVLELDFEPFTASFPKPTLTKS  501
            GVWEY+ VNV AL VEEL VPEYL FKEELVDG  NGNFVLELDFEPFTAS P+PTL+KS
Sbjct  93   GVWEYIRVNVSALVVEELLVPEYLHFKEELVDGSCNGNFVLELDFEPFTASVPRPTLSKS  152

Query  502  IGXGVEFL  525
            IG GVEFL
Sbjct  153  IGNGVEFL  160



>emb|CAN82840.1| hypothetical protein VITISV_024563 [Vitis vinifera]
Length=806

 Score =   134 bits (337),  Expect(2) = 5e-58, Method: Compositional matrix adjust.
 Identities = 63/92 (68%), Positives = 77/92 (84%), Gaps = 0/92 (0%)
 Frame = +2

Query  47   MAERVLTRVHSLRERLDATLTAHRNEILLFMSKIESHGKGILKPHQLLAEFEAICKEDQE  226
            MA+ VLT VHSLR R+D TLTAHRNEIL F+S+IE HGKGIL+PHQLLAEFEA+ + +++
Sbjct  1    MADGVLTGVHSLRARVDETLTAHRNEILSFLSRIEGHGKGILQPHQLLAEFEALPEVNRK  60

Query  227  KLNDHAFQQVLKSTQEAIVLPPWVALAIRLRP  322
            KL+D  F  +LKS QEAIVLPPW+A A+R RP
Sbjct  61   KLSDGPFGDILKSIQEAIVLPPWIAFAVRPRP  92


 Score =   117 bits (292),  Expect(2) = 5e-58, Method: Compositional matrix adjust.
 Identities = 56/68 (82%), Positives = 59/68 (87%), Gaps = 0/68 (0%)
 Frame = +1

Query  322  GVWEYVTVNVHALXVEELTVPEYLQFKEELVDGPANGNFVLELDFEPFTASFPKPTLTKS  501
            GVWEY+ VNV AL VEEL VPEYL FKEELVDG  NGNFVLELDFEPFTAS P+PTL+KS
Sbjct  93   GVWEYIRVNVSALVVEELLVPEYLHFKEELVDGSCNGNFVLELDFEPFTASVPRPTLSKS  152

Query  502  IGXGVEFL  525
            IG GVEFL
Sbjct  153  IGNGVEFL  160



>gb|ACV72640.1| sucrose synthase 1 [Gossypium hirsutum]
 gb|ADY68849.1| sucrose synthase [Gossypium hirsutum]
 gb|AEN71074.1| sucrose synthase Sus1 [Gossypium hirsutum subsp. latifolium]
Length=805

 Score =   128 bits (321),  Expect(2) = 5e-58, Method: Compositional matrix adjust.
 Identities = 63/92 (68%), Positives = 77/92 (84%), Gaps = 0/92 (0%)
 Frame = +2

Query  47   MAERVLTRVHSLRERLDATLTAHRNEILLFMSKIESHGKGILKPHQLLAEFEAICKEDQE  226
            MA  V+TRVHSLRERLD TL AHRNEIL  +S+IE  GKGIL+ HQ++ EFEAI +E+++
Sbjct  1    MANPVITRVHSLRERLDETLLAHRNEILALLSRIEGKGKGILQHHQIILEFEAIPEENRK  60

Query  227  KLNDHAFQQVLKSTQEAIVLPPWVALAIRLRP  322
            KL D AF +VLK++QEAIVLPPWVALA+R RP
Sbjct  61   KLADGAFFEVLKASQEAIVLPPWVALAVRPRP  92


 Score =   123 bits (308),  Expect(2) = 5e-58, Method: Composition-based stats.
 Identities = 55/68 (81%), Positives = 61/68 (90%), Gaps = 0/68 (0%)
 Frame = +1

Query  322  GVWEYVTVNVHALXVEELTVPEYLQFKEELVDGPANGNFVLELDFEPFTASFPKPTLTKS  501
            GVWEY+ VNVHAL VEELTV EYL FKEELVDG +NGNFVLELDFEPF +SFP+PTL+KS
Sbjct  93   GVWEYIRVNVHALVVEELTVAEYLHFKEELVDGSSNGNFVLELDFEPFNSSFPRPTLSKS  152

Query  502  IGXGVEFL  525
            +G GVEFL
Sbjct  153  VGNGVEFL  160



>gb|KJB65372.1| hypothetical protein B456_010G092300 [Gossypium raimondii]
 gb|KJB65373.1| hypothetical protein B456_010G092300 [Gossypium raimondii]
 gb|KJB65374.1| hypothetical protein B456_010G092300 [Gossypium raimondii]
Length=806

 Score =   127 bits (320),  Expect(2) = 6e-58, Method: Compositional matrix adjust.
 Identities = 59/92 (64%), Positives = 76/92 (83%), Gaps = 0/92 (0%)
 Frame = +2

Query  47   MAERVLTRVHSLRERLDATLTAHRNEILLFMSKIESHGKGILKPHQLLAEFEAICKEDQE  226
            MAERV+TRVHSLR+RLD T  AHRNE+L  +++IE  GKGIL+ HQ + EFEAI +E ++
Sbjct  1    MAERVITRVHSLRDRLDDTFIAHRNEVLALLTRIEGKGKGILQHHQFILEFEAIPEETRK  60

Query  227  KLNDHAFQQVLKSTQEAIVLPPWVALAIRLRP  322
            KL D AF ++L+++QEAIVLPPWVALA+R RP
Sbjct  61   KLADGAFSEILRASQEAIVLPPWVALAVRPRP  92


 Score =   123 bits (309),  Expect(2) = 6e-58, Method: Composition-based stats.
 Identities = 57/68 (84%), Positives = 60/68 (88%), Gaps = 0/68 (0%)
 Frame = +1

Query  322  GVWEYVTVNVHALXVEELTVPEYLQFKEELVDGPANGNFVLELDFEPFTASFPKPTLTKS  501
            GVWEY+ VNVHAL VEELTV EYL FKEELVDG ANGNFVLELDFEPF ASFP+ TL+KS
Sbjct  93   GVWEYIKVNVHALVVEELTVAEYLHFKEELVDGSANGNFVLELDFEPFNASFPRSTLSKS  152

Query  502  IGXGVEFL  525
            IG GVEFL
Sbjct  153  IGNGVEFL  160



>dbj|BAA88905.1| sucrose synthase [Citrus unshiu]
Length=805

 Score =   131 bits (329),  Expect(2) = 9e-58, Method: Compositional matrix adjust.
 Identities = 63/92 (68%), Positives = 78/92 (85%), Gaps = 0/92 (0%)
 Frame = +2

Query  47   MAERVLTRVHSLRERLDATLTAHRNEILLFMSKIESHGKGILKPHQLLAEFEAICKEDQE  226
            MAER LTRVHSLRERLD TL+AHRNEIL  +S+IE  GKGIL+ HQL+AEFE+I +E+++
Sbjct  1    MAERALTRVHSLRERLDETLSAHRNEILALLSRIEGKGKGILQNHQLIAEFESISEENRK  60

Query  227  KLNDHAFQQVLKSTQEAIVLPPWVALAIRLRP  322
             L + AF +VL++TQEAIVL PWVALA+R RP
Sbjct  61   HLTEGAFGEVLRATQEAIVLAPWVALAVRPRP  92


 Score =   119 bits (298),  Expect(2) = 9e-58, Method: Compositional matrix adjust.
 Identities = 56/68 (82%), Positives = 60/68 (88%), Gaps = 0/68 (0%)
 Frame = +1

Query  322  GVWEYVTVNVHALXVEELTVPEYLQFKEELVDGPANGNFVLELDFEPFTASFPKPTLTKS  501
            GVWEY+ VNVHAL VEEL V EYL FKEELVDG +NGNFVLELDFEPF ASFP+PTL+KS
Sbjct  93   GVWEYIRVNVHALVVEELLVAEYLHFKEELVDGGSNGNFVLELDFEPFNASFPRPTLSKS  152

Query  502  IGXGVEFL  525
            IG GVEFL
Sbjct  153  IGNGVEFL  160



>gb|AIL23782.1| sucrose synthase [Prunus serrulata]
Length=806

 Score =   126 bits (316),  Expect(2) = 9e-58, Method: Compositional matrix adjust.
 Identities = 60/92 (65%), Positives = 75/92 (82%), Gaps = 0/92 (0%)
 Frame = +2

Query  47   MAERVLTRVHSLRERLDATLTAHRNEILLFMSKIESHGKGILKPHQLLAEFEAICKEDQE  226
            MA+R LTRVHSLRERLD TL+AHRNEI   +S+I + GKG ++PH+L+AEFEAI + +++
Sbjct  1    MADRALTRVHSLRERLDVTLSAHRNEIAALLSRIINKGKGFMQPHELVAEFEAIPESNRQ  60

Query  227  KLNDHAFQQVLKSTQEAIVLPPWVALAIRLRP  322
            KL D AF +VL  TQE IVLPPWVALA+R RP
Sbjct  61   KLLDGAFGEVLTHTQEVIVLPPWVALAVRPRP  92


 Score =   124 bits (310),  Expect(2) = 9e-58, Method: Composition-based stats.
 Identities = 57/68 (84%), Positives = 60/68 (88%), Gaps = 0/68 (0%)
 Frame = +1

Query  322  GVWEYVTVNVHALXVEELTVPEYLQFKEELVDGPANGNFVLELDFEPFTASFPKPTLTKS  501
            GVWEY+ VNV AL VEEL VPEYL FKEELVDG ANGNFVLELDFEPF ASFP+PTL+KS
Sbjct  93   GVWEYIRVNVDALVVEELQVPEYLHFKEELVDGSANGNFVLELDFEPFNASFPRPTLSKS  152

Query  502  IGXGVEFL  525
            IG GVEFL
Sbjct  153  IGNGVEFL  160



>gb|KCW81848.1| hypothetical protein EUGRSUZ_C03199 [Eucalyptus grandis]
Length=820

 Score =   132 bits (332),  Expect(2) = 1e-57, Method: Compositional matrix adjust.
 Identities = 63/92 (68%), Positives = 78/92 (85%), Gaps = 0/92 (0%)
 Frame = +2

Query  47   MAERVLTRVHSLRERLDATLTAHRNEILLFMSKIESHGKGILKPHQLLAEFEAICKEDQE  226
            MA+R+LTR HSLRERLD TL+AHRN+I+ F+S++E+ GKGIL+ HQ+ AEFEAI +E + 
Sbjct  1    MADRMLTRSHSLRERLDETLSAHRNDIVAFLSRVEAKGKGILQRHQIFAEFEAISEESRA  60

Query  227  KLNDHAFQQVLKSTQEAIVLPPWVALAIRLRP  322
            KL D AF +VLKSTQEAIV PPWVALA+R RP
Sbjct  61   KLLDGAFGEVLKSTQEAIVSPPWVALAVRPRP  92


 Score =   118 bits (295),  Expect(2) = 1e-57, Method: Composition-based stats.
 Identities = 53/68 (78%), Positives = 59/68 (87%), Gaps = 0/68 (0%)
 Frame = +1

Query  322  GVWEYVTVNVHALXVEELTVPEYLQFKEELVDGPANGNFVLELDFEPFTASFPKPTLTKS  501
            GVWE++ VNVHAL +E+L V EYL FKEEL DG  NGNFVLELDFEPFTASFP+PTL+KS
Sbjct  93   GVWEHIRVNVHALVLEQLEVAEYLHFKEELADGSLNGNFVLELDFEPFTASFPRPTLSKS  152

Query  502  IGXGVEFL  525
            IG GVEFL
Sbjct  153  IGNGVEFL  160



>ref|XP_008242292.1| PREDICTED: sucrose synthase [Prunus mume]
 ref|XP_008242293.1| PREDICTED: sucrose synthase [Prunus mume]
Length=806

 Score =   125 bits (315),  Expect(2) = 1e-57, Method: Compositional matrix adjust.
 Identities = 60/92 (65%), Positives = 75/92 (82%), Gaps = 0/92 (0%)
 Frame = +2

Query  47   MAERVLTRVHSLRERLDATLTAHRNEILLFMSKIESHGKGILKPHQLLAEFEAICKEDQE  226
            MAER LTRV SLRERLD TL+AHRNEI+  +S+I + GKG ++PH+L+AEFEAI + +++
Sbjct  1    MAERALTRVQSLRERLDVTLSAHRNEIVALLSRIVNKGKGFMQPHELVAEFEAIPESNRQ  60

Query  227  KLNDHAFQQVLKSTQEAIVLPPWVALAIRLRP  322
            KL D AF +VL  TQE IVLPPWVALA+R RP
Sbjct  61   KLLDGAFGEVLTHTQEVIVLPPWVALAVRPRP  92


 Score =   124 bits (311),  Expect(2) = 1e-57, Method: Composition-based stats.
 Identities = 57/68 (84%), Positives = 60/68 (88%), Gaps = 0/68 (0%)
 Frame = +1

Query  322  GVWEYVTVNVHALXVEELTVPEYLQFKEELVDGPANGNFVLELDFEPFTASFPKPTLTKS  501
            GVWEY+ VNV AL VEEL VPEYL FKEELVDG ANGNFVLELDFEPF ASFP+PTL+KS
Sbjct  93   GVWEYIRVNVDALVVEELQVPEYLHFKEELVDGSANGNFVLELDFEPFNASFPRPTLSKS  152

Query  502  IGXGVEFL  525
            IG GVEFL
Sbjct  153  IGNGVEFL  160



>gb|AAD28641.1| sucrose synthase [Gossypium hirsutum]
Length=806

 Score =   130 bits (326),  Expect(2) = 1e-57, Method: Compositional matrix adjust.
 Identities = 64/92 (70%), Positives = 78/92 (85%), Gaps = 0/92 (0%)
 Frame = +2

Query  47   MAERVLTRVHSLRERLDATLTAHRNEILLFMSKIESHGKGILKPHQLLAEFEAICKEDQE  226
            MAER LTRVHSLRERLD TL AHRNEIL  +S+IE  GKGIL+ HQ++ EFEAI +E+++
Sbjct  1    MAERALTRVHSLRERLDETLLAHRNEILALLSRIEGKGKGILQHHQIILEFEAIPEENRK  60

Query  227  KLNDHAFQQVLKSTQEAIVLPPWVALAIRLRP  322
            KL + AF +VLK++QEAIVLPPWVALA+R RP
Sbjct  61   KLANGAFFEVLKASQEAIVLPPWVALAVRPRP  92


 Score =   120 bits (301),  Expect(2) = 1e-57, Method: Compositional matrix adjust.
 Identities = 56/68 (82%), Positives = 61/68 (90%), Gaps = 0/68 (0%)
 Frame = +1

Query  322  GVWEYVTVNVHALXVEELTVPEYLQFKEELVDGPANGNFVLELDFEPFTASFPKPTLTKS  501
            GVWEY+ VNVHAL VEELTV EYL FKEELVDG +NGNFVLELDFEPF +SFP+PTL+KS
Sbjct  93   GVWEYIRVNVHALVVEELTVAEYLHFKEELVDGSSNGNFVLELDFEPFNSSFPRPTLSKS  152

Query  502  IGXGVEFL  525
            IG GVEFL
Sbjct  153  IGNGVEFL  160



>ref|NP_001289655.1| sucrose synthase [Eucalyptus grandis]
 gb|ABB53602.1| sucrose synthase [Eucalyptus grandis]
Length=805

 Score =   132 bits (332),  Expect(2) = 1e-57, Method: Compositional matrix adjust.
 Identities = 62/92 (67%), Positives = 81/92 (88%), Gaps = 0/92 (0%)
 Frame = +2

Query  47   MAERVLTRVHSLRERLDATLTAHRNEILLFMSKIESHGKGILKPHQLLAEFEAICKEDQE  226
            M ER+LTRVHSLRERLD TL AHRN+IL F+++IE+ GKGIL+ HQL+AEFEAI +E ++
Sbjct  1    MPERLLTRVHSLRERLDETLLAHRNDILAFLTRIEAKGKGILQHHQLIAEFEAISEEHRK  60

Query  227  KLNDHAFQQVLKSTQEAIVLPPWVALAIRLRP  322
            KL++ AF ++L+S+QEAIVLPPW+ALA+R RP
Sbjct  61   KLSEGAFGEILRSSQEAIVLPPWIALAVRPRP  92


 Score =   117 bits (294),  Expect(2) = 1e-57, Method: Composition-based stats.
 Identities = 53/68 (78%), Positives = 59/68 (87%), Gaps = 0/68 (0%)
 Frame = +1

Query  322  GVWEYVTVNVHALXVEELTVPEYLQFKEELVDGPANGNFVLELDFEPFTASFPKPTLTKS  501
            GVWEY+ VN+HAL VEEL V E+L FKEELV+G  NGNFVLELDFEPFTA FP+PTL+KS
Sbjct  93   GVWEYIRVNIHALVVEELQVTEFLHFKEELVNGNLNGNFVLELDFEPFTAQFPRPTLSKS  152

Query  502  IGXGVEFL  525
            IG GVEFL
Sbjct  153  IGNGVEFL  160



>ref|XP_010049327.1| PREDICTED: sucrose synthase-like [Eucalyptus grandis]
 ref|XP_010049328.1| PREDICTED: sucrose synthase-like [Eucalyptus grandis]
Length=805

 Score =   132 bits (332),  Expect(2) = 1e-57, Method: Compositional matrix adjust.
 Identities = 63/92 (68%), Positives = 78/92 (85%), Gaps = 0/92 (0%)
 Frame = +2

Query  47   MAERVLTRVHSLRERLDATLTAHRNEILLFMSKIESHGKGILKPHQLLAEFEAICKEDQE  226
            MA+R+LTR HSLRERLD TL+AHRN+I+ F+S++E+ GKGIL+ HQ+ AEFEAI +E + 
Sbjct  1    MADRMLTRSHSLRERLDETLSAHRNDIVAFLSRVEAKGKGILQRHQIFAEFEAISEESRA  60

Query  227  KLNDHAFQQVLKSTQEAIVLPPWVALAIRLRP  322
            KL D AF +VLKSTQEAIV PPWVALA+R RP
Sbjct  61   KLLDGAFGEVLKSTQEAIVSPPWVALAVRPRP  92


 Score =   117 bits (294),  Expect(2) = 1e-57, Method: Composition-based stats.
 Identities = 53/68 (78%), Positives = 59/68 (87%), Gaps = 0/68 (0%)
 Frame = +1

Query  322  GVWEYVTVNVHALXVEELTVPEYLQFKEELVDGPANGNFVLELDFEPFTASFPKPTLTKS  501
            GVWE++ VNVHAL +E+L V EYL FKEEL DG  NGNFVLELDFEPFTASFP+PTL+KS
Sbjct  93   GVWEHIRVNVHALVLEQLEVAEYLHFKEELADGSLNGNFVLELDFEPFTASFPRPTLSKS  152

Query  502  IGXGVEFL  525
            IG GVEFL
Sbjct  153  IGNGVEFL  160



>ref|NP_001289661.1| sucrose synthase-like [Eucalyptus grandis]
 gb|ABB53601.1| sucrose synthase [Eucalyptus grandis]
Length=805

 Score =   132 bits (332),  Expect(2) = 1e-57, Method: Compositional matrix adjust.
 Identities = 63/92 (68%), Positives = 78/92 (85%), Gaps = 0/92 (0%)
 Frame = +2

Query  47   MAERVLTRVHSLRERLDATLTAHRNEILLFMSKIESHGKGILKPHQLLAEFEAICKEDQE  226
            MA+R+LTR HSLRERLD TL+AHRN+I+ F+S++E+ GKGIL+ HQ+ AEFEAI +E + 
Sbjct  1    MADRMLTRSHSLRERLDETLSAHRNDIVAFLSRVEAKGKGILQRHQIFAEFEAISEESRA  60

Query  227  KLNDHAFQQVLKSTQEAIVLPPWVALAIRLRP  322
            KL D AF +VLKSTQEAIV PPWVALA+R RP
Sbjct  61   KLLDGAFGEVLKSTQEAIVSPPWVALAVRPRP  92


 Score =   117 bits (294),  Expect(2) = 1e-57, Method: Composition-based stats.
 Identities = 53/68 (78%), Positives = 59/68 (87%), Gaps = 0/68 (0%)
 Frame = +1

Query  322  GVWEYVTVNVHALXVEELTVPEYLQFKEELVDGPANGNFVLELDFEPFTASFPKPTLTKS  501
            GVWE++ VNVHAL +E+L V EYL FKEEL DG  NGNFVLELDFEPFTASFP+PTL+KS
Sbjct  93   GVWEHIRVNVHALVLEQLEVAEYLHFKEELADGSLNGNFVLELDFEPFTASFPRPTLSKS  152

Query  502  IGXGVEFL  525
            IG GVEFL
Sbjct  153  IGNGVEFL  160



>ref|XP_004144053.1| PREDICTED: sucrose synthase-like [Cucumis sativus]
 ref|XP_004159357.1| PREDICTED: sucrose synthase-like [Cucumis sativus]
Length=806

 Score =   131 bits (329),  Expect(2) = 1e-57, Method: Compositional matrix adjust.
 Identities = 64/92 (70%), Positives = 77/92 (84%), Gaps = 0/92 (0%)
 Frame = +2

Query  47   MAERVLTRVHSLRERLDATLTAHRNEILLFMSKIESHGKGILKPHQLLAEFEAICKEDQE  226
            MAERVL R+HSLRERLD TL A RNEIL  +SKIE+ GKGIL+ H+L+AEFE I +E++ 
Sbjct  1    MAERVLNRIHSLRERLDETLIAQRNEILGLLSKIEAKGKGILQHHELIAEFETIPEENRR  60

Query  227  KLNDHAFQQVLKSTQEAIVLPPWVALAIRLRP  322
            KL D AF +VL+STQE+IVLPPWVALA+R RP
Sbjct  61   KLADGAFGEVLRSTQESIVLPPWVALAVRPRP  92


 Score =   119 bits (297),  Expect(2) = 1e-57, Method: Compositional matrix adjust.
 Identities = 55/68 (81%), Positives = 60/68 (88%), Gaps = 0/68 (0%)
 Frame = +1

Query  322  GVWEYVTVNVHALXVEELTVPEYLQFKEELVDGPANGNFVLELDFEPFTASFPKPTLTKS  501
            GVWEY+ VNVHAL VEEL   EYL+FKEELVDG +NGNFVLELDFEPF ASFP+PTL+KS
Sbjct  93   GVWEYIKVNVHALVVEELQASEYLRFKEELVDGSSNGNFVLELDFEPFNASFPRPTLSKS  152

Query  502  IGXGVEFL  525
            IG GVEFL
Sbjct  153  IGNGVEFL  160



>ref|XP_007204649.1| hypothetical protein PRUPE_ppa001535mg [Prunus persica]
 ref|XP_007204650.1| hypothetical protein PRUPE_ppa001535mg [Prunus persica]
 gb|EMJ05848.1| hypothetical protein PRUPE_ppa001535mg [Prunus persica]
 gb|EMJ05849.1| hypothetical protein PRUPE_ppa001535mg [Prunus persica]
Length=806

 Score =   125 bits (315),  Expect(2) = 1e-57, Method: Compositional matrix adjust.
 Identities = 60/92 (65%), Positives = 75/92 (82%), Gaps = 0/92 (0%)
 Frame = +2

Query  47   MAERVLTRVHSLRERLDATLTAHRNEILLFMSKIESHGKGILKPHQLLAEFEAICKEDQE  226
            MAER LTRV SLRERLD TL+AHRNEI+  +S+I + GKG ++PH+L+AEFEAI + +++
Sbjct  1    MAERALTRVQSLRERLDVTLSAHRNEIVALLSRIVNKGKGFMQPHELVAEFEAIPESNRQ  60

Query  227  KLNDHAFQQVLKSTQEAIVLPPWVALAIRLRP  322
            KL D AF +VL  TQE IVLPPWVALA+R RP
Sbjct  61   KLLDGAFGEVLTHTQEVIVLPPWVALAVRPRP  92


 Score =   124 bits (310),  Expect(2) = 1e-57, Method: Composition-based stats.
 Identities = 57/68 (84%), Positives = 60/68 (88%), Gaps = 0/68 (0%)
 Frame = +1

Query  322  GVWEYVTVNVHALXVEELTVPEYLQFKEELVDGPANGNFVLELDFEPFTASFPKPTLTKS  501
            GVWEY+ VNV AL VEEL VPEYL FKEELVDG ANGNFVLELDFEPF ASFP+PTL+KS
Sbjct  93   GVWEYIRVNVDALVVEELQVPEYLHFKEELVDGSANGNFVLELDFEPFNASFPRPTLSKS  152

Query  502  IGXGVEFL  525
            IG GVEFL
Sbjct  153  IGNGVEFL  160



>gb|AEK81520.1| sucrose synthase isoform B [Gossypium hirsutum]
Length=805

 Score =   130 bits (326),  Expect(2) = 1e-57, Method: Compositional matrix adjust.
 Identities = 61/92 (66%), Positives = 78/92 (85%), Gaps = 0/92 (0%)
 Frame = +2

Query  47   MAERVLTRVHSLRERLDATLTAHRNEILLFMSKIESHGKGILKPHQLLAEFEAICKEDQE  226
            MAERV+TRVHSLRERLD TL AHRNE+L  +++IE  GKGIL+ HQ++ EFEAI +E ++
Sbjct  1    MAERVITRVHSLRERLDDTLIAHRNEVLALLTRIEGKGKGILQHHQIILEFEAIPEETRK  60

Query  227  KLNDHAFQQVLKSTQEAIVLPPWVALAIRLRP  322
            KL D AF ++L+++QEAIVLPPWVALA+R RP
Sbjct  61   KLADGAFSEILRASQEAIVLPPWVALAVRPRP  92


 Score =   120 bits (300),  Expect(2) = 1e-57, Method: Compositional matrix adjust.
 Identities = 57/68 (84%), Positives = 60/68 (88%), Gaps = 0/68 (0%)
 Frame = +1

Query  322  GVWEYVTVNVHALXVEELTVPEYLQFKEELVDGPANGNFVLELDFEPFTASFPKPTLTKS  501
            GVWEY+ VNVHAL VEELTV EYL FKEELVDG ANGNFVLELDFEPF ASFP+ TL+KS
Sbjct  93   GVWEYIKVNVHALVVEELTVAEYLHFKEELVDGSANGNFVLELDFEPFNASFPRSTLSKS  152

Query  502  IGXGVEFL  525
            IG GVEFL
Sbjct  153  IGNGVEFL  160



>gb|AFI57908.1| sucrose synthase 1 [Prunus persica]
Length=806

 Score =   125 bits (315),  Expect(2) = 1e-57, Method: Compositional matrix adjust.
 Identities = 60/92 (65%), Positives = 75/92 (82%), Gaps = 0/92 (0%)
 Frame = +2

Query  47   MAERVLTRVHSLRERLDATLTAHRNEILLFMSKIESHGKGILKPHQLLAEFEAICKEDQE  226
            MAER LTRV SLRERLD TL+AHRNEI+  +S+I + GKG ++PH+L+AEFEAI + +++
Sbjct  1    MAERALTRVQSLRERLDVTLSAHRNEIVALLSRIVNKGKGFMQPHELVAEFEAIPESNRQ  60

Query  227  KLNDHAFQQVLKSTQEAIVLPPWVALAIRLRP  322
            KL D AF +VL  TQE IVLPPWVALA+R RP
Sbjct  61   KLLDGAFGEVLTHTQEVIVLPPWVALAVRPRP  92


 Score =   124 bits (310),  Expect(2) = 1e-57, Method: Composition-based stats.
 Identities = 57/68 (84%), Positives = 60/68 (88%), Gaps = 0/68 (0%)
 Frame = +1

Query  322  GVWEYVTVNVHALXVEELTVPEYLQFKEELVDGPANGNFVLELDFEPFTASFPKPTLTKS  501
            GVWEY+ VNV AL VEEL VPEYL FKEELVDG ANGNFVLELDFEPF ASFP+PTL+KS
Sbjct  93   GVWEYIRVNVDALVVEELQVPEYLHFKEELVDGSANGNFVLELDFEPFNASFPRPTLSKS  152

Query  502  IGXGVEFL  525
            IG GVEFL
Sbjct  153  IGNGVEFL  160



>gb|KGN66333.1| hypothetical protein Csa_1G597800 [Cucumis sativus]
Length=783

 Score =   131 bits (329),  Expect(2) = 1e-57, Method: Compositional matrix adjust.
 Identities = 64/92 (70%), Positives = 77/92 (84%), Gaps = 0/92 (0%)
 Frame = +2

Query  47   MAERVLTRVHSLRERLDATLTAHRNEILLFMSKIESHGKGILKPHQLLAEFEAICKEDQE  226
            MAERVL R+HSLRERLD TL A RNEIL  +SKIE+ GKGIL+ H+L+AEFE I +E++ 
Sbjct  1    MAERVLNRIHSLRERLDETLIAQRNEILGLLSKIEAKGKGILQHHELIAEFETIPEENRR  60

Query  227  KLNDHAFQQVLKSTQEAIVLPPWVALAIRLRP  322
            KL D AF +VL+STQE+IVLPPWVALA+R RP
Sbjct  61   KLADGAFGEVLRSTQESIVLPPWVALAVRPRP  92


 Score =   118 bits (296),  Expect(2) = 1e-57, Method: Compositional matrix adjust.
 Identities = 55/68 (81%), Positives = 60/68 (88%), Gaps = 0/68 (0%)
 Frame = +1

Query  322  GVWEYVTVNVHALXVEELTVPEYLQFKEELVDGPANGNFVLELDFEPFTASFPKPTLTKS  501
            GVWEY+ VNVHAL VEEL   EYL+FKEELVDG +NGNFVLELDFEPF ASFP+PTL+KS
Sbjct  93   GVWEYIKVNVHALVVEELQASEYLRFKEELVDGSSNGNFVLELDFEPFNASFPRPTLSKS  152

Query  502  IGXGVEFL  525
            IG GVEFL
Sbjct  153  IGNGVEFL  160



>gb|AGM14949.1| sucrose synthase 4 [Hevea brasiliensis]
Length=806

 Score =   132 bits (332),  Expect(2) = 2e-57, Method: Compositional matrix adjust.
 Identities = 63/92 (68%), Positives = 79/92 (86%), Gaps = 0/92 (0%)
 Frame = +2

Query  47   MAERVLTRVHSLRERLDATLTAHRNEILLFMSKIESHGKGILKPHQLLAEFEAICKEDQE  226
            MAERV+TRVHS+RERLD TL+AHRNEI+  +S+IE  GKGIL+ H ++AEFEAI +E+++
Sbjct  1    MAERVITRVHSIRERLDETLSAHRNEIVALLSRIEGKGKGILQHHHIIAEFEAIPEENRK  60

Query  227  KLNDHAFQQVLKSTQEAIVLPPWVALAIRLRP  322
            KL D  F +VL+STQEAIVLPPWVALA+R RP
Sbjct  61   KLLDSVFGEVLRSTQEAIVLPPWVALAVRPRP  92


 Score =   117 bits (293),  Expect(2) = 2e-57, Method: Compositional matrix adjust.
 Identities = 55/68 (81%), Positives = 58/68 (85%), Gaps = 0/68 (0%)
 Frame = +1

Query  322  GVWEYVTVNVHALXVEELTVPEYLQFKEELVDGPANGNFVLELDFEPFTASFPKPTLTKS  501
            GVWEY+ VNVHAL VEEL V EYL FKEELVDG  NGNFVLELDFEPF ASFP+PTL+K 
Sbjct  93   GVWEYIRVNVHALVVEELRVAEYLHFKEELVDGSVNGNFVLELDFEPFNASFPRPTLSKY  152

Query  502  IGXGVEFL  525
            IG GVEFL
Sbjct  153  IGNGVEFL  160



>gb|AGQ57012.1| sucrose synthase 1 [Hevea brasiliensis]
Length=806

 Score =   132 bits (332),  Expect(2) = 2e-57, Method: Compositional matrix adjust.
 Identities = 63/92 (68%), Positives = 79/92 (86%), Gaps = 0/92 (0%)
 Frame = +2

Query  47   MAERVLTRVHSLRERLDATLTAHRNEILLFMSKIESHGKGILKPHQLLAEFEAICKEDQE  226
            MAERV+TRVHS+RERLD TL+AHRNEI+  +S+IE  GKGIL+ H ++AEFEAI +E+++
Sbjct  1    MAERVITRVHSIRERLDETLSAHRNEIVALLSRIEGKGKGILQHHHIIAEFEAIPEENRK  60

Query  227  KLNDHAFQQVLKSTQEAIVLPPWVALAIRLRP  322
            KL D  F +VL+STQEAIVLPPWVALA+R RP
Sbjct  61   KLLDSVFGEVLRSTQEAIVLPPWVALAVRPRP  92


 Score =   117 bits (292),  Expect(2) = 2e-57, Method: Compositional matrix adjust.
 Identities = 55/68 (81%), Positives = 58/68 (85%), Gaps = 0/68 (0%)
 Frame = +1

Query  322  GVWEYVTVNVHALXVEELTVPEYLQFKEELVDGPANGNFVLELDFEPFTASFPKPTLTKS  501
            GVWEY+ VNVHAL VEEL V EYL FKEELVDG  NGNFVLELDFEPF ASFP+PTL+K 
Sbjct  93   GVWEYIRVNVHALVVEELRVAEYLHFKEELVDGSVNGNFVLELDFEPFNASFPRPTLSKY  152

Query  502  IGXGVEFL  525
            IG GVEFL
Sbjct  153  IGNGVEFL  160



>ref|XP_009348897.1| PREDICTED: sucrose synthase-like [Pyrus x bretschneideri]
Length=807

 Score =   132 bits (332),  Expect(2) = 3e-57, Method: Compositional matrix adjust.
 Identities = 65/92 (71%), Positives = 76/92 (83%), Gaps = 0/92 (0%)
 Frame = +2

Query  47   MAERVLTRVHSLRERLDATLTAHRNEILLFMSKIESHGKGILKPHQLLAEFEAICKEDQE  226
            MAERVLTRV SLRERLD TL+  RN+ L  +S+IES GKG L+PHQLLAEFEAI + +++
Sbjct  1    MAERVLTRVQSLRERLDETLSTQRNDFLALLSRIESKGKGFLQPHQLLAEFEAIPENNRQ  60

Query  227  KLNDHAFQQVLKSTQEAIVLPPWVALAIRLRP  322
            KL D AF +VLK TQEAIVLPPWVALA+R RP
Sbjct  61   KLLDGAFGEVLKHTQEAIVLPPWVALAVRPRP  92


 Score =   116 bits (290),  Expect(2) = 3e-57, Method: Composition-based stats.
 Identities = 52/68 (76%), Positives = 59/68 (87%), Gaps = 0/68 (0%)
 Frame = +1

Query  322  GVWEYVTVNVHALXVEELTVPEYLQFKEELVDGPANGNFVLELDFEPFTASFPKPTLTKS  501
            GVWEY+ VNVHAL +EEL V EYLQ KEELVD  +NGNFVLELDF+PF ASFP+PTL+KS
Sbjct  93   GVWEYIRVNVHALALEELCVAEYLQLKEELVDRSSNGNFVLELDFQPFNASFPRPTLSKS  152

Query  502  IGXGVEFL  525
            IG GV+FL
Sbjct  153  IGNGVQFL  160



>ref|XP_009343356.1| PREDICTED: sucrose synthase-like [Pyrus x bretschneideri]
Length=807

 Score =   132 bits (332),  Expect(2) = 3e-57, Method: Compositional matrix adjust.
 Identities = 65/92 (71%), Positives = 76/92 (83%), Gaps = 0/92 (0%)
 Frame = +2

Query  47   MAERVLTRVHSLRERLDATLTAHRNEILLFMSKIESHGKGILKPHQLLAEFEAICKEDQE  226
            MAERVLTRV SLRERLD TL+  RN+ L  +S+IES GKG L+PHQLLAEFEAI + +++
Sbjct  1    MAERVLTRVQSLRERLDETLSTQRNDFLALLSRIESKGKGFLQPHQLLAEFEAIPENNRQ  60

Query  227  KLNDHAFQQVLKSTQEAIVLPPWVALAIRLRP  322
            KL D AF +VLK TQEAIVLPPWVALA+R RP
Sbjct  61   KLLDGAFGEVLKHTQEAIVLPPWVALAVRPRP  92


 Score =   116 bits (290),  Expect(2) = 3e-57, Method: Composition-based stats.
 Identities = 52/68 (76%), Positives = 59/68 (87%), Gaps = 0/68 (0%)
 Frame = +1

Query  322  GVWEYVTVNVHALXVEELTVPEYLQFKEELVDGPANGNFVLELDFEPFTASFPKPTLTKS  501
            GVWEY+ VNVHAL +EEL V EYLQ KEELVD  +NGNFVLELDF+PF ASFP+PTL+KS
Sbjct  93   GVWEYIRVNVHALALEELCVAEYLQLKEELVDRSSNGNFVLELDFQPFNASFPRPTLSKS  152

Query  502  IGXGVEFL  525
            IG GV+FL
Sbjct  153  IGNGVQFL  160



>gb|KJB54540.1| hypothetical protein B456_009G038000 [Gossypium raimondii]
Length=562

 Score =   127 bits (320),  Expect(2) = 5e-57, Method: Compositional matrix adjust.
 Identities = 63/92 (68%), Positives = 77/92 (84%), Gaps = 0/92 (0%)
 Frame = +2

Query  47   MAERVLTRVHSLRERLDATLTAHRNEILLFMSKIESHGKGILKPHQLLAEFEAICKEDQE  226
            MA  V+TRVHSLRERLD TL AHRNEIL  +S+IE  GKGIL+ HQ++ EFEAI +E+++
Sbjct  1    MANPVITRVHSLRERLDETLLAHRNEILALLSRIEGKGKGILQHHQIILEFEAIPEENRK  60

Query  227  KLNDHAFQQVLKSTQEAIVLPPWVALAIRLRP  322
            KL D AF +VLK++QEAIVLPPWVALA+R RP
Sbjct  61   KLADGAFFEVLKASQEAIVLPPWVALAVRPRP  92


 Score =   120 bits (300),  Expect(2) = 5e-57, Method: Compositional matrix adjust.
 Identities = 56/68 (82%), Positives = 61/68 (90%), Gaps = 0/68 (0%)
 Frame = +1

Query  322  GVWEYVTVNVHALXVEELTVPEYLQFKEELVDGPANGNFVLELDFEPFTASFPKPTLTKS  501
            GVWEY+ VNVHAL VEELTV EYL FKEELVDG +NGNFVLELDFEPF +SFP+PTL+KS
Sbjct  93   GVWEYIRVNVHALVVEELTVAEYLHFKEELVDGSSNGNFVLELDFEPFNSSFPRPTLSKS  152

Query  502  IGXGVEFL  525
            IG GVEFL
Sbjct  153  IGNGVEFL  160



>gb|KJB65375.1| hypothetical protein B456_010G092300 [Gossypium raimondii]
Length=750

 Score =   127 bits (319),  Expect(2) = 7e-57, Method: Compositional matrix adjust.
 Identities = 59/92 (64%), Positives = 76/92 (83%), Gaps = 0/92 (0%)
 Frame = +2

Query  47   MAERVLTRVHSLRERLDATLTAHRNEILLFMSKIESHGKGILKPHQLLAEFEAICKEDQE  226
            MAERV+TRVHSLR+RLD T  AHRNE+L  +++IE  GKGIL+ HQ + EFEAI +E ++
Sbjct  1    MAERVITRVHSLRDRLDDTFIAHRNEVLALLTRIEGKGKGILQHHQFILEFEAIPEETRK  60

Query  227  KLNDHAFQQVLKSTQEAIVLPPWVALAIRLRP  322
            KL D AF ++L+++QEAIVLPPWVALA+R RP
Sbjct  61   KLADGAFSEILRASQEAIVLPPWVALAVRPRP  92


 Score =   120 bits (300),  Expect(2) = 7e-57, Method: Compositional matrix adjust.
 Identities = 57/68 (84%), Positives = 60/68 (88%), Gaps = 0/68 (0%)
 Frame = +1

Query  322  GVWEYVTVNVHALXVEELTVPEYLQFKEELVDGPANGNFVLELDFEPFTASFPKPTLTKS  501
            GVWEY+ VNVHAL VEELTV EYL FKEELVDG ANGNFVLELDFEPF ASFP+ TL+KS
Sbjct  93   GVWEYIKVNVHALVVEELTVAEYLHFKEELVDGSANGNFVLELDFEPFNASFPRSTLSKS  152

Query  502  IGXGVEFL  525
            IG GVEFL
Sbjct  153  IGNGVEFL  160



>ref|XP_010520519.1| PREDICTED: sucrose synthase 4-like [Tarenaya hassleriana]
Length=807

 Score =   128 bits (321),  Expect(2) = 2e-56, Method: Compositional matrix adjust.
 Identities = 62/92 (67%), Positives = 77/92 (84%), Gaps = 0/92 (0%)
 Frame = +2

Query  47   MAERVLTRVHSLRERLDATLTAHRNEILLFMSKIESHGKGILKPHQLLAEFEAICKEDQE  226
            MAERV+TRVHS RERLD TL A RNE+L  +S++E+ GKGIL+ HQ++AEFE++ +E Q+
Sbjct  1    MAERVITRVHSQRERLDETLAAQRNEVLALLSRVEAKGKGILQHHQIIAEFESLPEETQK  60

Query  227  KLNDHAFQQVLKSTQEAIVLPPWVALAIRLRP  322
            KL   AF +VL+STQEAIVLPPWVALAIR RP
Sbjct  61   KLEGGAFFEVLRSTQEAIVLPPWVALAIRPRP  92


 Score =   118 bits (295),  Expect(2) = 2e-56, Method: Composition-based stats.
 Identities = 54/68 (79%), Positives = 58/68 (85%), Gaps = 0/68 (0%)
 Frame = +1

Query  322  GVWEYVTVNVHALXVEELTVPEYLQFKEELVDGPANGNFVLELDFEPFTASFPKPTLTKS  501
            GVWEY+ VN+HAL VEEL V EYL FKEELVDG ANGNF LELDFEPF ASFP+PTL+K 
Sbjct  93   GVWEYIRVNLHALVVEELRVAEYLHFKEELVDGSANGNFALELDFEPFNASFPRPTLSKY  152

Query  502  IGXGVEFL  525
            IG GVEFL
Sbjct  153  IGDGVEFL  160



>gb|AEF56625.1| sucrose synthase [Arachis hypogaea var. vulgaris]
Length=806

 Score =   129 bits (325),  Expect(2) = 2e-56, Method: Compositional matrix adjust.
 Identities = 64/92 (70%), Positives = 78/92 (85%), Gaps = 0/92 (0%)
 Frame = +2

Query  47   MAERVLTRVHSLRERLDATLTAHRNEILLFMSKIESHGKGILKPHQLLAEFEAICKEDQE  226
            MA   LTRVHSLRERLD TLTA+RNEIL  +S+IE+ GKGIL+ HQ++AEFE I +E+++
Sbjct  1    MAADRLTRVHSLRERLDETLTANRNEILALLSRIEAKGKGILQHHQVIAEFEEIPEENRQ  60

Query  227  KLNDHAFQQVLKSTQEAIVLPPWVALAIRLRP  322
            KL D AF +VL+STQEAIVLPPWVALA+R RP
Sbjct  61   KLTDGAFGEVLRSTQEAIVLPPWVALAVRPRP  92


 Score =   116 bits (290),  Expect(2) = 2e-56, Method: Compositional matrix adjust.
 Identities = 54/68 (79%), Positives = 59/68 (87%), Gaps = 0/68 (0%)
 Frame = +1

Query  322  GVWEYVTVNVHALXVEELTVPEYLQFKEELVDGPANGNFVLELDFEPFTASFPKPTLTKS  501
            GVWEY+ VNVHAL VEEL   EYL+FKEELVDG +N NFVLELDFEPFTASFP+PTL KS
Sbjct  93   GVWEYLRVNVHALVVEELQAAEYLRFKEELVDGSSNANFVLELDFEPFTASFPRPTLNKS  152

Query  502  IGXGVEFL  525
            IG GV+FL
Sbjct  153  IGNGVQFL  160



>gb|KDP33978.1| hypothetical protein JCGZ_07549 [Jatropha curcas]
Length=805

 Score =   126 bits (317),  Expect(2) = 2e-56, Method: Compositional matrix adjust.
 Identities = 61/92 (66%), Positives = 77/92 (84%), Gaps = 0/92 (0%)
 Frame = +2

Query  47   MAERVLTRVHSLRERLDATLTAHRNEILLFMSKIESHGKGILKPHQLLAEFEAICKEDQE  226
            MAERV+TRVHS+RERLD TL AHRNEI+  +S+IE+ GKGIL+ H ++AEFEAI +E+++
Sbjct  1    MAERVITRVHSIRERLDETLKAHRNEIVALLSRIEAKGKGILQHHHIIAEFEAIPEENRK  60

Query  227  KLNDHAFQQVLKSTQEAIVLPPWVALAIRLRP  322
             L D  F +VL+S QEAIVLPPWVALA+R RP
Sbjct  61   ILLDGVFGEVLRSAQEAIVLPPWVALAVRPRP  92


 Score =   119 bits (298),  Expect(2) = 2e-56, Method: Composition-based stats.
 Identities = 55/68 (81%), Positives = 58/68 (85%), Gaps = 0/68 (0%)
 Frame = +1

Query  322  GVWEYVTVNVHALXVEELTVPEYLQFKEELVDGPANGNFVLELDFEPFTASFPKPTLTKS  501
            GVWEY+ VNVHAL VEEL V EYL FKEELVDG  NGNFVLELDFEPF ASFP+PTL+K 
Sbjct  93   GVWEYIRVNVHALVVEELRVAEYLHFKEELVDGSNNGNFVLELDFEPFNASFPRPTLSKY  152

Query  502  IGXGVEFL  525
            IG GVEFL
Sbjct  153  IGNGVEFL  160



>ref|XP_004287669.1| PREDICTED: sucrose synthase [Fragaria vesca subsp. vesca]
 ref|XP_011461050.1| PREDICTED: sucrose synthase [Fragaria vesca subsp. vesca]
Length=806

 Score =   123 bits (308),  Expect(2) = 3e-56, Method: Compositional matrix adjust.
 Identities = 59/89 (66%), Positives = 72/89 (81%), Gaps = 0/89 (0%)
 Frame = +2

Query  56   RVLTRVHSLRERLDATLTAHRNEILLFMSKIESHGKGILKPHQLLAEFEAICKEDQEKLN  235
            R L R HSLRERLD TL+AHRNEIL F+S+IE+ GKG L+PHQL+ EFEAI +  ++ L 
Sbjct  5    RALNRAHSLRERLDDTLSAHRNEILAFLSRIEAKGKGFLQPHQLIDEFEAIPEASRKNLL  64

Query  236  DHAFQQVLKSTQEAIVLPPWVALAIRLRP  322
            +  F +VLK+TQEAIVLPPWVALA+R RP
Sbjct  65   ESEFGEVLKNTQEAIVLPPWVALAVRPRP  93


 Score =   122 bits (306),  Expect(2) = 3e-56, Method: Composition-based stats.
 Identities = 55/68 (81%), Positives = 59/68 (87%), Gaps = 0/68 (0%)
 Frame = +1

Query  322  GVWEYVTVNVHALXVEELTVPEYLQFKEELVDGPANGNFVLELDFEPFTASFPKPTLTKS  501
            GVWEY+ VNVH+L  EEL VPEYL FKEELVDG  NGNFVLELDFEPF A+FPKPTL+KS
Sbjct  94   GVWEYIRVNVHSLVAEELLVPEYLHFKEELVDGSLNGNFVLELDFEPFNATFPKPTLSKS  153

Query  502  IGXGVEFL  525
            IG GVEFL
Sbjct  154  IGNGVEFL  161



>gb|AEN71066.1| sucrose synthase Sus1 [Gossypium darwinii]
Length=805

 Score =   125 bits (313),  Expect(2) = 3e-56, Method: Compositional matrix adjust.
 Identities = 62/92 (67%), Positives = 76/92 (83%), Gaps = 0/92 (0%)
 Frame = +2

Query  47   MAERVLTRVHSLRERLDATLTAHRNEILLFMSKIESHGKGILKPHQLLAEFEAICKEDQE  226
            MA  V+TRVHSLRERLD TL AH NEIL  +S+IE  GKGIL+ HQ++ EFEAI +E+++
Sbjct  1    MANPVITRVHSLRERLDETLLAHGNEILALLSRIEGKGKGILQHHQIILEFEAIPEENRK  60

Query  227  KLNDHAFQQVLKSTQEAIVLPPWVALAIRLRP  322
            KL D AF +VLK++QEAIVLPPWVALA+R RP
Sbjct  61   KLADGAFFEVLKASQEAIVLPPWVALAVRPRP  92


 Score =   120 bits (300),  Expect(2) = 3e-56, Method: Compositional matrix adjust.
 Identities = 56/68 (82%), Positives = 61/68 (90%), Gaps = 0/68 (0%)
 Frame = +1

Query  322  GVWEYVTVNVHALXVEELTVPEYLQFKEELVDGPANGNFVLELDFEPFTASFPKPTLTKS  501
            GVWEY+ VNVHAL VEELTV EYL FKEELVDG +NGNFVLELDFEPF +SFP+PTL+KS
Sbjct  93   GVWEYIRVNVHALVVEELTVAEYLHFKEELVDGSSNGNFVLELDFEPFNSSFPRPTLSKS  152

Query  502  IGXGVEFL  525
            IG GVEFL
Sbjct  153  IGNGVEFL  160



>gb|AEN71067.1| sucrose synthase Sus1 [Gossypium tomentosum]
Length=805

 Score =   124 bits (310),  Expect(2) = 3e-56, Method: Composition-based stats.
 Identities = 56/68 (82%), Positives = 61/68 (90%), Gaps = 0/68 (0%)
 Frame = +1

Query  322  GVWEYVTVNVHALXVEELTVPEYLQFKEELVDGPANGNFVLELDFEPFTASFPKPTLTKS  501
            GVWEY+ VNVHAL VEELTV EYL FKEELVDG +NGNFVLELDFEPF +SFP+PTL+KS
Sbjct  93   GVWEYIRVNVHALVVEELTVAEYLHFKEELVDGSSNGNFVLELDFEPFNSSFPRPTLSKS  152

Query  502  IGXGVEFL  525
            IG GVEFL
Sbjct  153  IGNGVEFL  160


 Score =   121 bits (303),  Expect(2) = 3e-56, Method: Compositional matrix adjust.
 Identities = 61/92 (66%), Positives = 77/92 (84%), Gaps = 0/92 (0%)
 Frame = +2

Query  47   MAERVLTRVHSLRERLDATLTAHRNEILLFMSKIESHGKGILKPHQLLAEFEAICKEDQE  226
            MA+RV+TRVHSLRERLD TL A RNEIL  +S+IE  GKGIL+ HQ++ EFEAI +E+++
Sbjct  1    MADRVITRVHSLRERLDETLLADRNEILALLSRIEGKGKGILQHHQIILEFEAIPEENRK  60

Query  227  KLNDHAFQQVLKSTQEAIVLPPWVALAIRLRP  322
            KL + AF +VLK++QEAIVLPP VALA+R RP
Sbjct  61   KLANGAFFEVLKASQEAIVLPPCVALAVRPRP  92



>gb|AII19313.1| sucrose synthase 1, partial [Ricinus communis]
Length=805

 Score =   125 bits (314),  Expect(2) = 4e-56, Method: Compositional matrix adjust.
 Identities = 60/92 (65%), Positives = 77/92 (84%), Gaps = 0/92 (0%)
 Frame = +2

Query  47   MAERVLTRVHSLRERLDATLTAHRNEILLFMSKIESHGKGILKPHQLLAEFEAICKEDQE  226
            MAERV+TRVHS+RERLD TL A+RNEI+  +++IE  GKGIL+ HQ++AEFEAI ++ ++
Sbjct  1    MAERVITRVHSIRERLDETLAANRNEIVALLTRIEGKGKGILQHHQIIAEFEAIPEDIRK  60

Query  227  KLNDHAFQQVLKSTQEAIVLPPWVALAIRLRP  322
             L D  F +VL+STQEAIVLPPWVALA+R RP
Sbjct  61   NLLDSVFGEVLRSTQEAIVLPPWVALAVRPRP  92


 Score =   119 bits (298),  Expect(2) = 4e-56, Method: Composition-based stats.
 Identities = 55/68 (81%), Positives = 58/68 (85%), Gaps = 0/68 (0%)
 Frame = +1

Query  322  GVWEYVTVNVHALXVEELTVPEYLQFKEELVDGPANGNFVLELDFEPFTASFPKPTLTKS  501
            GVWEY+ VNVHAL VEEL V EYL FKEELVDG  NGNFVLELDFEPF ASFP+PTL+K 
Sbjct  93   GVWEYIRVNVHALVVEELRVAEYLHFKEELVDGSQNGNFVLELDFEPFNASFPRPTLSKY  152

Query  502  IGXGVEFL  525
            IG GVEFL
Sbjct  153  IGNGVEFL  160



>sp|P31926.1|SUSY_VICFA RecName: Full=Sucrose synthase; AltName: Full=Sucrose-UDP glucosyltransferase 
[Vicia faba]
 emb|CAA49428.1| sucrose synthase [Vicia faba]
 gb|AAC37346.1| UDP-glucose:D-fructose-2-glucosyltransferase [Vicia faba]
Length=806

 Score =   130 bits (326),  Expect(2) = 4e-56, Method: Compositional matrix adjust.
 Identities = 64/92 (70%), Positives = 78/92 (85%), Gaps = 0/92 (0%)
 Frame = +2

Query  47   MAERVLTRVHSLRERLDATLTAHRNEILLFMSKIESHGKGILKPHQLLAEFEAICKEDQE  226
            MA   LTRVHSLRERLD TLTA+RNEIL  +S+IE+ GKGIL+ HQ++AEFE I +E+++
Sbjct  1    MATERLTRVHSLRERLDETLTANRNEILALLSRIEAKGKGILQHHQVIAEFEEIPEENRQ  60

Query  227  KLNDHAFQQVLKSTQEAIVLPPWVALAIRLRP  322
            KL D AF +VL+STQEAIVLPPWVALA+R RP
Sbjct  61   KLTDGAFGEVLRSTQEAIVLPPWVALAVRPRP  92


 Score =   114 bits (286),  Expect(2) = 4e-56, Method: Compositional matrix adjust.
 Identities = 54/68 (79%), Positives = 59/68 (87%), Gaps = 0/68 (0%)
 Frame = +1

Query  322  GVWEYVTVNVHALXVEELTVPEYLQFKEELVDGPANGNFVLELDFEPFTASFPKPTLTKS  501
            GVWEY+ VNVHAL VE L   E+L+FKEELVDG ANGNFVLELDFEPFTASFP+PTL KS
Sbjct  93   GVWEYLRVNVHALVVENLQPAEFLKFKEELVDGSANGNFVLELDFEPFTASFPRPTLNKS  152

Query  502  IGXGVEFL  525
            IG GV+FL
Sbjct  153  IGNGVQFL  160



>gb|AAC28107.1| nodule-enhanced sucrose synthase [Pisum sativum]
Length=806

 Score =   130 bits (326),  Expect(2) = 5e-56, Method: Compositional matrix adjust.
 Identities = 64/92 (70%), Positives = 78/92 (85%), Gaps = 0/92 (0%)
 Frame = +2

Query  47   MAERVLTRVHSLRERLDATLTAHRNEILLFMSKIESHGKGILKPHQLLAEFEAICKEDQE  226
            MA   LTRVHSLRERLD TLTA+RNEIL  +S+IE+ GKGIL+ HQ++AEFE I +E+++
Sbjct  1    MATDRLTRVHSLRERLDETLTANRNEILALLSRIEAKGKGILQHHQVIAEFEEIPEENRQ  60

Query  227  KLNDHAFQQVLKSTQEAIVLPPWVALAIRLRP  322
            KL D AF +VL+STQEAIVLPPWVALA+R RP
Sbjct  61   KLTDGAFGEVLRSTQEAIVLPPWVALAVRPRP  92


 Score =   114 bits (286),  Expect(2) = 5e-56, Method: Compositional matrix adjust.
 Identities = 54/68 (79%), Positives = 59/68 (87%), Gaps = 0/68 (0%)
 Frame = +1

Query  322  GVWEYVTVNVHALXVEELTVPEYLQFKEELVDGPANGNFVLELDFEPFTASFPKPTLTKS  501
            GVWEY+ VNVHAL VE L   E+L+FKEELVDG ANGNFVLELDFEPFTASFP+PTL KS
Sbjct  93   GVWEYLRVNVHALVVENLQPAEFLKFKEELVDGSANGNFVLELDFEPFTASFPRPTLNKS  152

Query  502  IGXGVEFL  525
            IG GV+FL
Sbjct  153  IGNGVQFL  160



>emb|CAA09910.1| sucrose synthase [Pisum sativum]
Length=806

 Score =   130 bits (326),  Expect(2) = 5e-56, Method: Compositional matrix adjust.
 Identities = 64/92 (70%), Positives = 78/92 (85%), Gaps = 0/92 (0%)
 Frame = +2

Query  47   MAERVLTRVHSLRERLDATLTAHRNEILLFMSKIESHGKGILKPHQLLAEFEAICKEDQE  226
            MA   LTRVHSLRERLD TLTA+RNEIL  +S+IE+ GKGIL+ HQ++AEFE I +E+++
Sbjct  1    MATDRLTRVHSLRERLDETLTANRNEILALLSRIEAKGKGILQHHQVIAEFEEIPEENRQ  60

Query  227  KLNDHAFQQVLKSTQEAIVLPPWVALAIRLRP  322
            KL D AF +VL+STQEAIVLPPWVALA+R RP
Sbjct  61   KLTDGAFGEVLRSTQEAIVLPPWVALAVRPRP  92


 Score =   114 bits (286),  Expect(2) = 5e-56, Method: Compositional matrix adjust.
 Identities = 54/68 (79%), Positives = 59/68 (87%), Gaps = 0/68 (0%)
 Frame = +1

Query  322  GVWEYVTVNVHALXVEELTVPEYLQFKEELVDGPANGNFVLELDFEPFTASFPKPTLTKS  501
            GVWEY+ VNVHAL VE L   E+L+FKEELVDG ANGNFVLELDFEPFTASFP+PTL KS
Sbjct  93   GVWEYLRVNVHALVVENLQPAEFLKFKEELVDGSANGNFVLELDFEPFTASFPRPTLNKS  152

Query  502  IGXGVEFL  525
            IG GV+FL
Sbjct  153  IGNGVQFL  160



>sp|P49034.1|SUSY_ALNGL RecName: Full=Sucrose synthase; AltName: Full=Sucrose-UDP glucosyltransferase 
[Alnus glutinosa]
 emb|CAA63122.1| sucrose synthase [Alnus glutinosa]
Length=803

 Score =   123 bits (308),  Expect(2) = 6e-56, Method: Compositional matrix adjust.
 Identities = 62/92 (67%), Positives = 74/92 (80%), Gaps = 0/92 (0%)
 Frame = +2

Query  47   MAERVLTRVHSLRERLDATLTAHRNEILLFMSKIESHGKGILKPHQLLAEFEAICKEDQE  226
            MAERVLTRVHSLRERLD TL A+RNEI+  +S+I   GKGI + HQL+AE EAI +  ++
Sbjct  1    MAERVLTRVHSLRERLDETLVANRNEIVALLSRIIGKGKGICRNHQLIAEVEAIPEATRK  60

Query  227  KLNDHAFQQVLKSTQEAIVLPPWVALAIRLRP  322
            KL D AF +VL+S QEAIVLPPWVALA+R RP
Sbjct  61   KLLDGAFGEVLRSAQEAIVLPPWVALAVRPRP  92


 Score =   121 bits (303),  Expect(2) = 6e-56, Method: Compositional matrix adjust.
 Identities = 56/68 (82%), Positives = 60/68 (88%), Gaps = 0/68 (0%)
 Frame = +1

Query  322  GVWEYVTVNVHALXVEELTVPEYLQFKEELVDGPANGNFVLELDFEPFTASFPKPTLTKS  501
            GVWEY+ VNVHAL VEEL VPEYL FKEELVDG  NGNFVLELDF+PF ASFP+PTL+KS
Sbjct  93   GVWEYIRVNVHALVVEELRVPEYLHFKEELVDGSTNGNFVLELDFDPFNASFPRPTLSKS  152

Query  502  IGXGVEFL  525
            IG GVEFL
Sbjct  153  IGNGVEFL  160



>ref|XP_004508033.1| PREDICTED: sucrose synthase-like isoform X1 [Cicer arietinum]
 ref|XP_004508034.1| PREDICTED: sucrose synthase-like isoform X2 [Cicer arietinum]
Length=811

 Score =   127 bits (320),  Expect(2) = 6e-56, Method: Compositional matrix adjust.
 Identities = 63/92 (68%), Positives = 77/92 (84%), Gaps = 0/92 (0%)
 Frame = +2

Query  47   MAERVLTRVHSLRERLDATLTAHRNEILLFMSKIESHGKGILKPHQLLAEFEAICKEDQE  226
            MA   LTRVHSLRER+D TLTA+RNEIL  +S+IE+ GKGIL+ HQ++AEFE I +E ++
Sbjct  1    MATDRLTRVHSLRERIDETLTANRNEILALLSRIEAKGKGILQHHQIIAEFEEIPEEPRQ  60

Query  227  KLNDHAFQQVLKSTQEAIVLPPWVALAIRLRP  322
            KL D AF +VL+STQEAIVLPPWVALA+R RP
Sbjct  61   KLTDGAFGEVLRSTQEAIVLPPWVALAVRPRP  92


 Score =   116 bits (291),  Expect(2) = 6e-56, Method: Compositional matrix adjust.
 Identities = 55/68 (81%), Positives = 60/68 (88%), Gaps = 0/68 (0%)
 Frame = +1

Query  322  GVWEYVTVNVHALXVEELTVPEYLQFKEELVDGPANGNFVLELDFEPFTASFPKPTLTKS  501
            GVWEY+ VNVHAL VEEL   E+L+FKEELVDG ANGNFVLELDFEPFTASFP+PTL KS
Sbjct  93   GVWEYLRVNVHALVVEELQPAEFLKFKEELVDGSANGNFVLELDFEPFTASFPRPTLNKS  152

Query  502  IGXGVEFL  525
            IG GV+FL
Sbjct  153  IGNGVQFL  160



>gb|AFY03624.1| sucrose synthase, partial [Eucalyptus globulus]
Length=274

 Score =   129 bits (323),  Expect(2) = 6e-56, Method: Compositional matrix adjust.
 Identities = 62/92 (67%), Positives = 78/92 (85%), Gaps = 0/92 (0%)
 Frame = +2

Query  47   MAERVLTRVHSLRERLDATLTAHRNEILLFMSKIESHGKGILKPHQLLAEFEAICKEDQE  226
            MA+R+LTR HSLRERLD TL+A+RN+I+ F+S++E+ GKGIL+ HQ+ AEFEAI +E + 
Sbjct  1    MADRMLTRSHSLRERLDETLSANRNDIVAFLSRVEAKGKGILQRHQIFAEFEAISEESRA  60

Query  227  KLNDHAFQQVLKSTQEAIVLPPWVALAIRLRP  322
            KL D AF +VLKSTQEAIV PPWVALA+R RP
Sbjct  61   KLLDGAFGEVLKSTQEAIVSPPWVALAVRPRP  92


 Score =   115 bits (288),  Expect(2) = 6e-56, Method: Compositional matrix adjust.
 Identities = 53/68 (78%), Positives = 59/68 (87%), Gaps = 0/68 (0%)
 Frame = +1

Query  322  GVWEYVTVNVHALXVEELTVPEYLQFKEELVDGPANGNFVLELDFEPFTASFPKPTLTKS  501
            GVWE++ VNVHAL +E+L V EYL FKEEL DG  NGNFVLELDFEPFTASFP+PTL+KS
Sbjct  93   GVWEHIRVNVHALVLEQLEVAEYLHFKEELADGSLNGNFVLELDFEPFTASFPRPTLSKS  152

Query  502  IGXGVEFL  525
            IG GVEFL
Sbjct  153  IGNGVEFL  160



>ref|XP_004508035.1| PREDICTED: sucrose synthase-like isoform X3 [Cicer arietinum]
Length=806

 Score =   127 bits (320),  Expect(2) = 7e-56, Method: Compositional matrix adjust.
 Identities = 63/92 (68%), Positives = 77/92 (84%), Gaps = 0/92 (0%)
 Frame = +2

Query  47   MAERVLTRVHSLRERLDATLTAHRNEILLFMSKIESHGKGILKPHQLLAEFEAICKEDQE  226
            MA   LTRVHSLRER+D TLTA+RNEIL  +S+IE+ GKGIL+ HQ++AEFE I +E ++
Sbjct  1    MATDRLTRVHSLRERIDETLTANRNEILALLSRIEAKGKGILQHHQIIAEFEEIPEEPRQ  60

Query  227  KLNDHAFQQVLKSTQEAIVLPPWVALAIRLRP  322
            KL D AF +VL+STQEAIVLPPWVALA+R RP
Sbjct  61   KLTDGAFGEVLRSTQEAIVLPPWVALAVRPRP  92


 Score =   116 bits (290),  Expect(2) = 7e-56, Method: Compositional matrix adjust.
 Identities = 55/68 (81%), Positives = 60/68 (88%), Gaps = 0/68 (0%)
 Frame = +1

Query  322  GVWEYVTVNVHALXVEELTVPEYLQFKEELVDGPANGNFVLELDFEPFTASFPKPTLTKS  501
            GVWEY+ VNVHAL VEEL   E+L+FKEELVDG ANGNFVLELDFEPFTASFP+PTL KS
Sbjct  93   GVWEYLRVNVHALVVEELQPAEFLKFKEELVDGSANGNFVLELDFEPFTASFPRPTLNKS  152

Query  502  IGXGVEFL  525
            IG GV+FL
Sbjct  153  IGNGVQFL  160



>gb|AEE60913.1| nodule-enhanced sucrose synthase [Cicer arietinum]
Length=806

 Score =   127 bits (320),  Expect(2) = 8e-56, Method: Compositional matrix adjust.
 Identities = 63/92 (68%), Positives = 77/92 (84%), Gaps = 0/92 (0%)
 Frame = +2

Query  47   MAERVLTRVHSLRERLDATLTAHRNEILLFMSKIESHGKGILKPHQLLAEFEAICKEDQE  226
            MA   LTRVHSLRER+D TLTA+RNEIL  +S+IE+ GKGIL+ HQ++AEFE I +E ++
Sbjct  1    MATDRLTRVHSLRERIDETLTANRNEILALLSRIEAKGKGILQHHQIIAEFEEIPEEPRQ  60

Query  227  KLNDHAFQQVLKSTQEAIVLPPWVALAIRLRP  322
            KL D AF +VL+STQEAIVLPPWVALA+R RP
Sbjct  61   KLTDGAFGEVLRSTQEAIVLPPWVALAVRPRP  92


 Score =   116 bits (290),  Expect(2) = 8e-56, Method: Compositional matrix adjust.
 Identities = 55/68 (81%), Positives = 60/68 (88%), Gaps = 0/68 (0%)
 Frame = +1

Query  322  GVWEYVTVNVHALXVEELTVPEYLQFKEELVDGPANGNFVLELDFEPFTASFPKPTLTKS  501
            GVWEY+ VNVHAL VEEL   E+L+FKEELVDG ANGNFVLELDFEPFTASFP+PTL KS
Sbjct  93   GVWEYLRVNVHALVVEELQPAEFLKFKEELVDGSANGNFVLELDFEPFTASFPRPTLNKS  152

Query  502  IGXGVEFL  525
            IG GV+FL
Sbjct  153  IGNGVQFL  160



>gb|AGH29112.1| sucrose synthase [Jatropha curcas]
Length=805

 Score =   124 bits (312),  Expect(2) = 9e-56, Method: Compositional matrix adjust.
 Identities = 60/92 (65%), Positives = 77/92 (84%), Gaps = 0/92 (0%)
 Frame = +2

Query  47   MAERVLTRVHSLRERLDATLTAHRNEILLFMSKIESHGKGILKPHQLLAEFEAICKEDQE  226
            MAERV+TRVHS+RERLD TL A+RNEI+  +S+IE+ GKGIL+ H ++AEFEAI +E+++
Sbjct  1    MAERVITRVHSIRERLDETLKAYRNEIVALLSRIEAKGKGILQHHHIIAEFEAIPEENRK  60

Query  227  KLNDHAFQQVLKSTQEAIVLPPWVALAIRLRP  322
             L D  F +VL+S QEAIVLPPWVALA+R RP
Sbjct  61   ILLDGVFGEVLRSAQEAIVLPPWVALAVRPRP  92


 Score =   119 bits (297),  Expect(2) = 9e-56, Method: Composition-based stats.
 Identities = 55/68 (81%), Positives = 58/68 (85%), Gaps = 0/68 (0%)
 Frame = +1

Query  322  GVWEYVTVNVHALXVEELTVPEYLQFKEELVDGPANGNFVLELDFEPFTASFPKPTLTKS  501
            GVWEY+ VNVHAL VEEL V EYL FKEELVDG  NGNFVLELDFEPF ASFP+PTL+K 
Sbjct  93   GVWEYIRVNVHALVVEELRVAEYLHFKEELVDGSNNGNFVLELDFEPFNASFPRPTLSKY  152

Query  502  IGXGVEFL  525
            IG GVEFL
Sbjct  153  IGNGVEFL  160



>ref|NP_001237525.1| sucrose synthase [Glycine max]
 sp|P13708.2|SUSY_SOYBN RecName: Full=Sucrose synthase; AltName: Full=Nodulin-100; Short=N-100; 
AltName: Full=Sucrose-UDP glucosyltransferase [Glycine 
max]
 gb|AAC39323.1| sucrose synthase [Glycine max]
 gb|KHN45052.1| Sucrose synthase [Glycine soja]
Length=805

 Score =   129 bits (325),  Expect(2) = 1e-55, Method: Compositional matrix adjust.
 Identities = 64/92 (70%), Positives = 78/92 (85%), Gaps = 0/92 (0%)
 Frame = +2

Query  47   MAERVLTRVHSLRERLDATLTAHRNEILLFMSKIESHGKGILKPHQLLAEFEAICKEDQE  226
            MA   LTRVHSLRERLD TLTA+RNEIL  +S+IE+ GKGIL+ HQ++AEFE I +E+++
Sbjct  1    MATDRLTRVHSLRERLDETLTANRNEILALLSRIEAKGKGILQHHQVIAEFEEIPEENRQ  60

Query  227  KLNDHAFQQVLKSTQEAIVLPPWVALAIRLRP  322
            KL D AF +VL+STQEAIVLPPWVALA+R RP
Sbjct  61   KLTDGAFGEVLRSTQEAIVLPPWVALAVRPRP  92


 Score =   114 bits (284),  Expect(2) = 1e-55, Method: Compositional matrix adjust.
 Identities = 53/68 (78%), Positives = 58/68 (85%), Gaps = 0/68 (0%)
 Frame = +1

Query  322  GVWEYVTVNVHALXVEELTVPEYLQFKEELVDGPANGNFVLELDFEPFTASFPKPTLTKS  501
            GVWEY+ VNVHAL VEEL   EYL FKEELVDG +NGNFVLELDFEPF A+FP+PTL KS
Sbjct  93   GVWEYLRVNVHALVVEELQPAEYLHFKEELVDGSSNGNFVLELDFEPFNAAFPRPTLNKS  152

Query  502  IGXGVEFL  525
            IG GV+FL
Sbjct  153  IGNGVQFL  160



>ref|XP_003551045.1| PREDICTED: sucrose synthase-like isoform X1 [Glycine max]
 ref|XP_006600427.1| PREDICTED: sucrose synthase-like isoform X2 [Glycine max]
Length=805

 Score =   129 bits (325),  Expect(2) = 1e-55, Method: Compositional matrix adjust.
 Identities = 64/92 (70%), Positives = 78/92 (85%), Gaps = 0/92 (0%)
 Frame = +2

Query  47   MAERVLTRVHSLRERLDATLTAHRNEILLFMSKIESHGKGILKPHQLLAEFEAICKEDQE  226
            MA   LTRVHSLRERLD TLTA+RNEIL  +S+IE+ GKGIL+ HQ++AEFE I +E+++
Sbjct  1    MATDRLTRVHSLRERLDETLTANRNEILALLSRIEAKGKGILQHHQVIAEFEEIPEENRQ  60

Query  227  KLNDHAFQQVLKSTQEAIVLPPWVALAIRLRP  322
            KL D AF +VL+STQEAIVLPPWVALA+R RP
Sbjct  61   KLTDGAFGEVLRSTQEAIVLPPWVALAVRPRP  92


 Score =   113 bits (283),  Expect(2) = 1e-55, Method: Compositional matrix adjust.
 Identities = 53/68 (78%), Positives = 58/68 (85%), Gaps = 0/68 (0%)
 Frame = +1

Query  322  GVWEYVTVNVHALXVEELTVPEYLQFKEELVDGPANGNFVLELDFEPFTASFPKPTLTKS  501
            GVWEY+ VNVHAL VEEL   EYL FKEELVDG +NGNFVLELDFEPF A+FP+PTL KS
Sbjct  93   GVWEYLKVNVHALVVEELQPAEYLHFKEELVDGSSNGNFVLELDFEPFNAAFPRPTLNKS  152

Query  502  IGXGVEFL  525
            IG GV+FL
Sbjct  153  IGNGVQFL  160



>gb|KHN17754.1| Sucrose synthase [Glycine soja]
Length=805

 Score =   129 bits (325),  Expect(2) = 1e-55, Method: Compositional matrix adjust.
 Identities = 64/92 (70%), Positives = 78/92 (85%), Gaps = 0/92 (0%)
 Frame = +2

Query  47   MAERVLTRVHSLRERLDATLTAHRNEILLFMSKIESHGKGILKPHQLLAEFEAICKEDQE  226
            MA   LTRVHSLRERLD TLTA+RNEIL  +S+IE+ GKGIL+ HQ++AEFE I +E+++
Sbjct  1    MATDRLTRVHSLRERLDETLTANRNEILALLSRIEAKGKGILQHHQVIAEFEEIPEENRQ  60

Query  227  KLNDHAFQQVLKSTQEAIVLPPWVALAIRLRP  322
            KL D AF +VL+STQEAIVLPPWVALA+R RP
Sbjct  61   KLTDGAFGEVLRSTQEAIVLPPWVALAVRPRP  92


 Score =   113 bits (283),  Expect(2) = 1e-55, Method: Compositional matrix adjust.
 Identities = 53/68 (78%), Positives = 58/68 (85%), Gaps = 0/68 (0%)
 Frame = +1

Query  322  GVWEYVTVNVHALXVEELTVPEYLQFKEELVDGPANGNFVLELDFEPFTASFPKPTLTKS  501
            GVWEY+ VNVHAL VEEL   EYL FKEELVDG +NGNFVLELDFEPF A+FP+PTL KS
Sbjct  93   GVWEYLKVNVHALVVEELQPAEYLHFKEELVDGSSNGNFVLELDFEPFNAAFPRPTLNKS  152

Query  502  IGXGVEFL  525
            IG GV+FL
Sbjct  153  IGNGVQFL  160



>gb|ABD96570.1| sucrose synthase [Manihot esculenta]
Length=806

 Score =   125 bits (314),  Expect(2) = 2e-55, Method: Compositional matrix adjust.
 Identities = 60/92 (65%), Positives = 77/92 (84%), Gaps = 0/92 (0%)
 Frame = +2

Query  47   MAERVLTRVHSLRERLDATLTAHRNEILLFMSKIESHGKGILKPHQLLAEFEAICKEDQE  226
            MAERV+TRV S+RERLD TL+AHRNEI+  +S+IE  GKGIL+ HQ++AEFE I +E+++
Sbjct  1    MAERVITRVQSIRERLDETLSAHRNEIVALLSRIEGKGKGILQHHQIIAEFEEIPEENRK  60

Query  227  KLNDHAFQQVLKSTQEAIVLPPWVALAIRLRP  322
            KL +  F +VL+S QEAIVLPPWVALA+R RP
Sbjct  61   KLLESVFGEVLRSAQEAIVLPPWVALAVRPRP  92


 Score =   117 bits (293),  Expect(2) = 2e-55, Method: Compositional matrix adjust.
 Identities = 55/68 (81%), Positives = 58/68 (85%), Gaps = 0/68 (0%)
 Frame = +1

Query  322  GVWEYVTVNVHALXVEELTVPEYLQFKEELVDGPANGNFVLELDFEPFTASFPKPTLTKS  501
            GVWEY+ VNVHAL VEEL V EYL FKEELVDG  NGNFVLELDFEPF ASFP+PTL+K 
Sbjct  93   GVWEYIRVNVHALVVEELRVAEYLHFKEELVDGSVNGNFVLELDFEPFNASFPRPTLSKY  152

Query  502  IGXGVEFL  525
            IG GVEFL
Sbjct  153  IGNGVEFL  160



>gb|AIJ28961.1| sucrose synthase [Manihot esculenta]
Length=806

 Score =   125 bits (314),  Expect(2) = 2e-55, Method: Compositional matrix adjust.
 Identities = 60/92 (65%), Positives = 77/92 (84%), Gaps = 0/92 (0%)
 Frame = +2

Query  47   MAERVLTRVHSLRERLDATLTAHRNEILLFMSKIESHGKGILKPHQLLAEFEAICKEDQE  226
            MAERV+TRV S+RERLD TL+AHRNEI+  +S+IE  GKGIL+ HQ++AEFE I +E+++
Sbjct  1    MAERVITRVQSIRERLDETLSAHRNEIVALLSRIEGKGKGILQHHQIIAEFEEIPEENRK  60

Query  227  KLNDHAFQQVLKSTQEAIVLPPWVALAIRLRP  322
            KL +  F +VL+S QEAIVLPPWVALA+R RP
Sbjct  61   KLLESVFGEVLRSAQEAIVLPPWVALAVRPRP  92


 Score =   117 bits (293),  Expect(2) = 2e-55, Method: Compositional matrix adjust.
 Identities = 55/68 (81%), Positives = 58/68 (85%), Gaps = 0/68 (0%)
 Frame = +1

Query  322  GVWEYVTVNVHALXVEELTVPEYLQFKEELVDGPANGNFVLELDFEPFTASFPKPTLTKS  501
            GVWEY+ VNVHAL VEEL V EYL FKEELVDG  NGNFVLELDFEPF ASFP+PTL+K 
Sbjct  93   GVWEYIRVNVHALVVEELRVAEYLHFKEELVDGSVNGNFVLELDFEPFNASFPRPTLSKY  152

Query  502  IGXGVEFL  525
            IG GVEFL
Sbjct  153  IGNGVEFL  160



>gb|AIJ28959.1| sucrose synthase [Manihot esculenta subsp. flabellifolia]
Length=806

 Score =   125 bits (314),  Expect(2) = 2e-55, Method: Compositional matrix adjust.
 Identities = 60/92 (65%), Positives = 77/92 (84%), Gaps = 0/92 (0%)
 Frame = +2

Query  47   MAERVLTRVHSLRERLDATLTAHRNEILLFMSKIESHGKGILKPHQLLAEFEAICKEDQE  226
            MAERV+TRV S+RERLD TL+AHRNEI+  +S+IE  GKGIL+ HQ++AEFE I +E+++
Sbjct  1    MAERVITRVQSIRERLDETLSAHRNEIVALLSRIEGKGKGILQHHQIIAEFEEIPEENRK  60

Query  227  KLNDHAFQQVLKSTQEAIVLPPWVALAIRLRP  322
            KL +  F +VL+S QEAIVLPPWVALA+R RP
Sbjct  61   KLLESVFGEVLRSAQEAIVLPPWVALAVRPRP  92


 Score =   117 bits (293),  Expect(2) = 2e-55, Method: Compositional matrix adjust.
 Identities = 55/68 (81%), Positives = 58/68 (85%), Gaps = 0/68 (0%)
 Frame = +1

Query  322  GVWEYVTVNVHALXVEELTVPEYLQFKEELVDGPANGNFVLELDFEPFTASFPKPTLTKS  501
            GVWEY+ VNVHAL VEEL V EYL FKEELVDG  NGNFVLELDFEPF ASFP+PTL+K 
Sbjct  93   GVWEYIRVNVHALVVEELRVAEYLHFKEELVDGSVNGNFVLELDFEPFNASFPRPTLSKY  152

Query  502  IGXGVEFL  525
            IG GVEFL
Sbjct  153  IGNGVEFL  160



>ref|XP_002516210.1| sucrose synthase, putative [Ricinus communis]
 gb|EEF46212.1| sucrose synthase, putative [Ricinus communis]
Length=773

 Score =   125 bits (314),  Expect(2) = 3e-55, Method: Compositional matrix adjust.
 Identities = 60/92 (65%), Positives = 77/92 (84%), Gaps = 0/92 (0%)
 Frame = +2

Query  47   MAERVLTRVHSLRERLDATLTAHRNEILLFMSKIESHGKGILKPHQLLAEFEAICKEDQE  226
            MAERV+TRVHS+RERLD TL A+RNEI+  +++IE  GKGIL+ HQ++AEFEAI ++ ++
Sbjct  1    MAERVITRVHSIRERLDETLAANRNEIVALLTRIEGKGKGILQHHQIIAEFEAIPEDIRK  60

Query  227  KLNDHAFQQVLKSTQEAIVLPPWVALAIRLRP  322
             L D  F +VL+STQEAIVLPPWVALA+R RP
Sbjct  61   NLLDSVFGEVLRSTQEAIVLPPWVALAVRPRP  92


 Score =   116 bits (291),  Expect(2) = 3e-55, Method: Compositional matrix adjust.
 Identities = 55/68 (81%), Positives = 58/68 (85%), Gaps = 0/68 (0%)
 Frame = +1

Query  322  GVWEYVTVNVHALXVEELTVPEYLQFKEELVDGPANGNFVLELDFEPFTASFPKPTLTKS  501
            GVWEY+ VNVHAL VEEL V EYL FKEELVDG  NGNFVLELDFEPF ASFP+PTL+K 
Sbjct  93   GVWEYIRVNVHALVVEELRVAEYLHFKEELVDGSQNGNFVLELDFEPFNASFPRPTLSKY  152

Query  502  IGXGVEFL  525
            IG GVEFL
Sbjct  153  IGNGVEFL  160



>dbj|BAM68520.1| sucrose synthase [Mangifera indica]
 dbj|BAM68522.1| sucrose synthase [Mangifera indica]
 dbj|BAM68523.1| sucrose synthase [Mangifera indica]
 dbj|BAM68524.1| sucrose synthase [Mangifera indica]
 dbj|BAM68525.1| sucrose synthase [Mangifera indica]
Length=800

 Score =   134 bits (338),  Expect(2) = 3e-55, Method: Compositional matrix adjust.
 Identities = 65/92 (71%), Positives = 79/92 (86%), Gaps = 0/92 (0%)
 Frame = +2

Query  47   MAERVLTRVHSLRERLDATLTAHRNEILLFMSKIESHGKGILKPHQLLAEFEAICKEDQE  226
            MAER LTRVHSLRERLD TL AHRNEIL  +S++E+ GKGIL+ HQL+ EFEAI  ++++
Sbjct  1    MAERALTRVHSLRERLDETLYAHRNEILALLSRLEAKGKGILQHHQLILEFEAIPADNRK  60

Query  227  KLNDHAFQQVLKSTQEAIVLPPWVALAIRLRP  322
            KL+D AF +VL+STQEAIVLPPWVALA+R RP
Sbjct  61   KLSDGAFSEVLRSTQEAIVLPPWVALAVRPRP  92


 Score =   107 bits (266),  Expect(2) = 3e-55, Method: Compositional matrix adjust.
 Identities = 49/62 (79%), Positives = 53/62 (85%), Gaps = 0/62 (0%)
 Frame = +1

Query  322  GVWEYVTVNVHALXVEELTVPEYLQFKEELVDGPANGNFVLELDFEPFTASFPKPTLTKS  501
            GVWEY+ VNVHAL VEEL V EYL FKEELVDG  NGNFVLELDFEPFTASFP+PTL+  
Sbjct  93   GVWEYIRVNVHALVVEELLVAEYLHFKEELVDGSTNGNFVLELDFEPFTASFPRPTLSSR  152

Query  502  IG  507
            +G
Sbjct  153  LG  154



>dbj|BAM37539.1| sucrose synthase [Mangifera indica]
Length=800

 Score =   134 bits (338),  Expect(2) = 3e-55, Method: Compositional matrix adjust.
 Identities = 65/92 (71%), Positives = 79/92 (86%), Gaps = 0/92 (0%)
 Frame = +2

Query  47   MAERVLTRVHSLRERLDATLTAHRNEILLFMSKIESHGKGILKPHQLLAEFEAICKEDQE  226
            MAER LTRVHSLRERLD TL AHRNEIL  +S++E+ GKGIL+ HQL+ EFEAI  ++++
Sbjct  1    MAERALTRVHSLRERLDETLYAHRNEILALLSRLEAKGKGILQHHQLILEFEAIPADNRK  60

Query  227  KLNDHAFQQVLKSTQEAIVLPPWVALAIRLRP  322
            KL+D AF +VL+STQEAIVLPPWVALA+R RP
Sbjct  61   KLSDGAFSEVLRSTQEAIVLPPWVALAVRPRP  92


 Score =   107 bits (266),  Expect(2) = 3e-55, Method: Compositional matrix adjust.
 Identities = 49/62 (79%), Positives = 53/62 (85%), Gaps = 0/62 (0%)
 Frame = +1

Query  322  GVWEYVTVNVHALXVEELTVPEYLQFKEELVDGPANGNFVLELDFEPFTASFPKPTLTKS  501
            GVWEY+ VNVHAL VEEL V EYL FKEELVDG  NGNFVLELDFEPFTASFP+PTL+  
Sbjct  93   GVWEYIRVNVHALVVEELLVAEYLHFKEELVDGSTNGNFVLELDFEPFTASFPRPTLSSR  152

Query  502  IG  507
            +G
Sbjct  153  LG  154



>dbj|BAM68526.1| sucrose synthase [Mangifera indica]
 dbj|BAM68529.1| sucrose synthase [Mangifera indica]
Length=800

 Score =   134 bits (338),  Expect(2) = 3e-55, Method: Compositional matrix adjust.
 Identities = 65/92 (71%), Positives = 79/92 (86%), Gaps = 0/92 (0%)
 Frame = +2

Query  47   MAERVLTRVHSLRERLDATLTAHRNEILLFMSKIESHGKGILKPHQLLAEFEAICKEDQE  226
            MAER LTRVHSLRERLD TL AHRNEIL  +S++E+ GKGIL+ HQL+ EFEAI  ++++
Sbjct  1    MAERALTRVHSLRERLDETLYAHRNEILALLSRLEAKGKGILQHHQLILEFEAIPADNRK  60

Query  227  KLNDHAFQQVLKSTQEAIVLPPWVALAIRLRP  322
            KL+D AF +VL+STQEAIVLPPWVALA+R RP
Sbjct  61   KLSDGAFSEVLRSTQEAIVLPPWVALAVRPRP  92


 Score =   107 bits (266),  Expect(2) = 3e-55, Method: Compositional matrix adjust.
 Identities = 49/62 (79%), Positives = 53/62 (85%), Gaps = 0/62 (0%)
 Frame = +1

Query  322  GVWEYVTVNVHALXVEELTVPEYLQFKEELVDGPANGNFVLELDFEPFTASFPKPTLTKS  501
            GVWEY+ VNVHAL VEEL V EYL FKEELVDG  NGNFVLELDFEPFTASFP+PTL+  
Sbjct  93   GVWEYIRVNVHALVVEELLVAEYLHFKEELVDGSTNGNFVLELDFEPFTASFPRPTLSSR  152

Query  502  IG  507
            +G
Sbjct  153  LG  154



>dbj|BAM68527.1| sucrose synthase [Mangifera indica]
Length=800

 Score =   134 bits (338),  Expect(2) = 3e-55, Method: Compositional matrix adjust.
 Identities = 65/92 (71%), Positives = 79/92 (86%), Gaps = 0/92 (0%)
 Frame = +2

Query  47   MAERVLTRVHSLRERLDATLTAHRNEILLFMSKIESHGKGILKPHQLLAEFEAICKEDQE  226
            MAER LTRVHSLRERLD TL AHRNEIL  +S++E+ GKGIL+ HQL+ EFEAI  ++++
Sbjct  1    MAERALTRVHSLRERLDETLYAHRNEILALLSRLEAKGKGILQHHQLILEFEAIPADNRK  60

Query  227  KLNDHAFQQVLKSTQEAIVLPPWVALAIRLRP  322
            KL+D AF +VL+STQEAIVLPPWVALA+R RP
Sbjct  61   KLSDGAFSEVLRSTQEAIVLPPWVALAVRPRP  92


 Score =   107 bits (266),  Expect(2) = 3e-55, Method: Compositional matrix adjust.
 Identities = 49/62 (79%), Positives = 53/62 (85%), Gaps = 0/62 (0%)
 Frame = +1

Query  322  GVWEYVTVNVHALXVEELTVPEYLQFKEELVDGPANGNFVLELDFEPFTASFPKPTLTKS  501
            GVWEY+ VNVHAL VEEL V EYL FKEELVDG  NGNFVLELDFEPFTASFP+PTL+  
Sbjct  93   GVWEYIRVNVHALVVEELLVAEYLHFKEELVDGSTNGNFVLELDFEPFTASFPRPTLSSR  152

Query  502  IG  507
            +G
Sbjct  153  LG  154



>dbj|BAM68521.1| sucrose synthase [Mangifera indica]
 dbj|BAM68528.1| sucrose synthase [Mangifera indica]
Length=800

 Score =   134 bits (338),  Expect(2) = 3e-55, Method: Compositional matrix adjust.
 Identities = 65/92 (71%), Positives = 79/92 (86%), Gaps = 0/92 (0%)
 Frame = +2

Query  47   MAERVLTRVHSLRERLDATLTAHRNEILLFMSKIESHGKGILKPHQLLAEFEAICKEDQE  226
            MAER LTRVHSLRERLD TL AHRNEIL  +S++E+ GKGIL+ HQL+ EFEAI  ++++
Sbjct  1    MAERALTRVHSLRERLDETLYAHRNEILALLSRLEAKGKGILQHHQLILEFEAIPADNRK  60

Query  227  KLNDHAFQQVLKSTQEAIVLPPWVALAIRLRP  322
            KL+D AF +VL+STQEAIVLPPWVALA+R RP
Sbjct  61   KLSDGAFSEVLRSTQEAIVLPPWVALAVRPRP  92


 Score =   107 bits (266),  Expect(2) = 3e-55, Method: Compositional matrix adjust.
 Identities = 49/62 (79%), Positives = 53/62 (85%), Gaps = 0/62 (0%)
 Frame = +1

Query  322  GVWEYVTVNVHALXVEELTVPEYLQFKEELVDGPANGNFVLELDFEPFTASFPKPTLTKS  501
            GVWEY+ VNVHAL VEEL V EYL FKEELVDG  NGNFVLELDFEPFTASFP+PTL+  
Sbjct  93   GVWEYIRVNVHALVVEELLVAEYLHFKEELVDGSTNGNFVLELDFEPFTASFPRPTLSSR  152

Query  502  IG  507
            +G
Sbjct  153  LG  154



>sp|Q01390.1|SUSY_VIGRR RecName: Full=Sucrose synthase; AltName: Full=Sucrose-UDP glucosyltransferase 
[Vigna radiata var. radiata]
 dbj|BAA01108.1| sucrose synthase [Vigna radiata var. radiata]
Length=805

 Score =   127 bits (319),  Expect(2) = 3e-55, Method: Compositional matrix adjust.
 Identities = 63/92 (68%), Positives = 76/92 (83%), Gaps = 0/92 (0%)
 Frame = +2

Query  47   MAERVLTRVHSLRERLDATLTAHRNEILLFMSKIESHGKGILKPHQLLAEFEAICKEDQE  226
            MA   LTRVHSLRERLD TL+A+RNEIL  +S+IE  GKGIL+ HQ++AEFE I +E ++
Sbjct  1    MATDRLTRVHSLRERLDETLSANRNEILALLSRIEGKGKGILQHHQVIAEFEEIPEESRQ  60

Query  227  KLNDHAFQQVLKSTQEAIVLPPWVALAIRLRP  322
            KL D AF +VL+STQEAIVLPPWVALA+R RP
Sbjct  61   KLTDGAFGEVLRSTQEAIVLPPWVALAVRPRP  92


 Score =   114 bits (285),  Expect(2) = 3e-55, Method: Compositional matrix adjust.
 Identities = 54/68 (79%), Positives = 59/68 (87%), Gaps = 0/68 (0%)
 Frame = +1

Query  322  GVWEYVTVNVHALXVEELTVPEYLQFKEELVDGPANGNFVLELDFEPFTASFPKPTLTKS  501
            GVWEY+ VNVHAL VE L   EYL+FKEELVDG +NGNFVLELDFEPFTASFP+PTL KS
Sbjct  93   GVWEYLRVNVHALVVEVLQPAEYLRFKEELVDGSSNGNFVLELDFEPFTASFPRPTLNKS  152

Query  502  IGXGVEFL  525
            IG GV+FL
Sbjct  153  IGNGVQFL  160



>dbj|BAH56282.1| sucrose synthase [Vigna angularis]
Length=805

 Score =   127 bits (319),  Expect(2) = 3e-55, Method: Compositional matrix adjust.
 Identities = 63/92 (68%), Positives = 76/92 (83%), Gaps = 0/92 (0%)
 Frame = +2

Query  47   MAERVLTRVHSLRERLDATLTAHRNEILLFMSKIESHGKGILKPHQLLAEFEAICKEDQE  226
            MA   LTRVHSLRERLD TL+A+RNEIL  +S+IE  GKGIL+ HQ++AEFE I +E ++
Sbjct  1    MATDRLTRVHSLRERLDETLSANRNEILALLSRIEGKGKGILQHHQVIAEFEEIPEESRQ  60

Query  227  KLNDHAFQQVLKSTQEAIVLPPWVALAIRLRP  322
            KL D AF +VL+STQEAIVLPPWVALA+R RP
Sbjct  61   KLTDGAFGEVLRSTQEAIVLPPWVALAVRPRP  92


 Score =   114 bits (285),  Expect(2) = 3e-55, Method: Compositional matrix adjust.
 Identities = 54/68 (79%), Positives = 59/68 (87%), Gaps = 0/68 (0%)
 Frame = +1

Query  322  GVWEYVTVNVHALXVEELTVPEYLQFKEELVDGPANGNFVLELDFEPFTASFPKPTLTKS  501
            GVWEY+ VNVHAL VE L   EYL+FKEELVDG +NGNFVLELDFEPFTASFP+PTL KS
Sbjct  93   GVWEYLRVNVHALVVEVLQPAEYLRFKEELVDGSSNGNFVLELDFEPFTASFPRPTLNKS  152

Query  502  IGXGVEFL  525
            IG GV+FL
Sbjct  153  IGNGVQFL  160



>sp|O65026.1|SUSY_MEDSA RecName: Full=Sucrose synthase; AltName: Full=Sucrose-UDP glucosyltransferase 
[Medicago sativa]
 gb|AAC17867.1| sucrose synthase [Medicago sativa]
Length=805

 Score =   127 bits (318),  Expect(2) = 8e-55, Method: Compositional matrix adjust.
 Identities = 62/92 (67%), Positives = 77/92 (84%), Gaps = 0/92 (0%)
 Frame = +2

Query  47   MAERVLTRVHSLRERLDATLTAHRNEILLFMSKIESHGKGILKPHQLLAEFEAICKEDQE  226
            MA   LTRVHSL+ERLD TLTA+RNEIL  +S++E+ GKGIL+ HQ++AEFE I +E ++
Sbjct  1    MATERLTRVHSLKERLDETLTANRNEILALLSRLEAKGKGILQHHQVIAEFEEIPEESRQ  60

Query  227  KLNDHAFQQVLKSTQEAIVLPPWVALAIRLRP  322
            KL D AF +VL+STQEAIVLPPWVALA+R RP
Sbjct  61   KLTDGAFGEVLRSTQEAIVLPPWVALAVRPRP  92


 Score =   113 bits (283),  Expect(2) = 8e-55, Method: Compositional matrix adjust.
 Identities = 53/68 (78%), Positives = 58/68 (85%), Gaps = 0/68 (0%)
 Frame = +1

Query  322  GVWEYVTVNVHALXVEELTVPEYLQFKEELVDGPANGNFVLELDFEPFTASFPKPTLTKS  501
            G+WEY+ VNVHAL VE L   E+L+FKEELVDG ANGNFVLELDFEPFTASFP+PTL KS
Sbjct  93   GIWEYLRVNVHALVVENLQPAEFLKFKEELVDGSANGNFVLELDFEPFTASFPRPTLNKS  152

Query  502  IGXGVEFL  525
            IG GV FL
Sbjct  153  IGNGVHFL  160



>ref|XP_003609949.1| Sucrose synthase [Medicago truncatula]
 emb|CAB40794.1| sucrose synthase [Medicago truncatula]
 gb|AES92146.1| sucrose synthase [Medicago truncatula]
Length=805

 Score =   125 bits (315),  Expect(2) = 1e-54, Method: Compositional matrix adjust.
 Identities = 61/92 (66%), Positives = 77/92 (84%), Gaps = 0/92 (0%)
 Frame = +2

Query  47   MAERVLTRVHSLRERLDATLTAHRNEILLFMSKIESHGKGILKPHQLLAEFEAICKEDQE  226
            MA   LTRVHSL+ERLD TLTA+RNEIL  +S++E+ GKGIL+ HQ++AEFE I ++ ++
Sbjct  1    MATERLTRVHSLKERLDETLTANRNEILALLSRLEAKGKGILQHHQVIAEFEEIPEDSRQ  60

Query  227  KLNDHAFQQVLKSTQEAIVLPPWVALAIRLRP  322
            KL D AF +VL+STQEAIVLPPWVALA+R RP
Sbjct  61   KLTDGAFGEVLRSTQEAIVLPPWVALAVRPRP  92


 Score =   114 bits (285),  Expect(2) = 1e-54, Method: Compositional matrix adjust.
 Identities = 53/68 (78%), Positives = 59/68 (87%), Gaps = 0/68 (0%)
 Frame = +1

Query  322  GVWEYVTVNVHALXVEELTVPEYLQFKEELVDGPANGNFVLELDFEPFTASFPKPTLTKS  501
            G+WEY+ VNVHAL VE L   E+L+FKEELVDG ANGNFVLELDFEPFTASFP+PTL KS
Sbjct  93   GIWEYLRVNVHALVVENLQPAEFLKFKEELVDGSANGNFVLELDFEPFTASFPRPTLNKS  152

Query  502  IGXGVEFL  525
            IG GV+FL
Sbjct  153  IGNGVQFL  160



>emb|CAB40795.1| sucrose synthase [Medicago truncatula]
Length=805

 Score =   125 bits (315),  Expect(2) = 1e-54, Method: Compositional matrix adjust.
 Identities = 61/92 (66%), Positives = 77/92 (84%), Gaps = 0/92 (0%)
 Frame = +2

Query  47   MAERVLTRVHSLRERLDATLTAHRNEILLFMSKIESHGKGILKPHQLLAEFEAICKEDQE  226
            MA   LTRVHSL+ERLD TLTA+RNEIL  +S++E+ GKGIL+ HQ++AEFE I ++ ++
Sbjct  1    MATERLTRVHSLKERLDETLTANRNEILALLSRLEAKGKGILQHHQVIAEFEEIPEDSRQ  60

Query  227  KLNDHAFQQVLKSTQEAIVLPPWVALAIRLRP  322
            KL D AF +VL+STQEAIVLPPWVALA+R RP
Sbjct  61   KLTDGAFGEVLRSTQEAIVLPPWVALAVRPRP  92


 Score =   114 bits (285),  Expect(2) = 1e-54, Method: Compositional matrix adjust.
 Identities = 53/68 (78%), Positives = 59/68 (87%), Gaps = 0/68 (0%)
 Frame = +1

Query  322  GVWEYVTVNVHALXVEELTVPEYLQFKEELVDGPANGNFVLELDFEPFTASFPKPTLTKS  501
            G+WEY+ VNVHAL VE L   E+L+FKEELVDG ANGNFVLELDFEPFTASFP+PTL KS
Sbjct  93   GIWEYLRVNVHALVVENLQPAEFLKFKEELVDGSANGNFVLELDFEPFTASFPRPTLNKS  152

Query  502  IGXGVEFL  525
            IG GV+FL
Sbjct  153  IGNGVQFL  160



>ref|XP_003609946.1| Sucrose synthase [Medicago truncatula]
Length=893

 Score =   126 bits (316),  Expect(2) = 1e-54, Method: Compositional matrix adjust.
 Identities = 61/93 (66%), Positives = 78/93 (84%), Gaps = 0/93 (0%)
 Frame = +2

Query  44   AMAERVLTRVHSLRERLDATLTAHRNEILLFMSKIESHGKGILKPHQLLAEFEAICKEDQ  223
            +MA   LTRVHSL+ERLD TLTA+RNEIL  +S++E+ GKGIL+ HQ++AEFE I ++ +
Sbjct  88   SMATERLTRVHSLKERLDETLTANRNEILALLSRLEAKGKGILQHHQVIAEFEEIPEDSR  147

Query  224  EKLNDHAFQQVLKSTQEAIVLPPWVALAIRLRP  322
            +KL D AF +VL+STQEAIVLPPWVALA+R RP
Sbjct  148  QKLTDGAFGEVLRSTQEAIVLPPWVALAVRPRP  180


 Score =   114 bits (284),  Expect(2) = 1e-54, Method: Compositional matrix adjust.
 Identities = 53/68 (78%), Positives = 59/68 (87%), Gaps = 0/68 (0%)
 Frame = +1

Query  322  GVWEYVTVNVHALXVEELTVPEYLQFKEELVDGPANGNFVLELDFEPFTASFPKPTLTKS  501
            G+WEY+ VNVHAL VE L   E+L+FKEELVDG ANGNFVLELDFEPFTASFP+PTL KS
Sbjct  181  GIWEYLRVNVHALVVENLQPAEFLKFKEELVDGSANGNFVLELDFEPFTASFPRPTLNKS  240

Query  502  IGXGVEFL  525
            IG GV+FL
Sbjct  241  IGNGVQFL  248



>gb|ADW80558.1| sucrose synthase 1 [Populus tomentosa]
Length=805

 Score =   124 bits (312),  Expect(2) = 1e-54, Method: Compositional matrix adjust.
 Identities = 59/92 (64%), Positives = 77/92 (84%), Gaps = 0/92 (0%)
 Frame = +2

Query  47   MAERVLTRVHSLRERLDATLTAHRNEILLFMSKIESHGKGILKPHQLLAEFEAICKEDQE  226
            MAER LTRVHS+RER+D TL AHRNEI+  +++IES GKGIL+ HQ++AEFEAI ++ ++
Sbjct  1    MAERALTRVHSIRERVDETLKAHRNEIVALLTRIESKGKGILQHHQIVAEFEAIPEDTRK  60

Query  227  KLNDHAFQQVLKSTQEAIVLPPWVALAIRLRP  322
             L   AF +VL+STQEAIV+PPW+ALA+R RP
Sbjct  61   TLAGGAFAEVLRSTQEAIVVPPWIALALRPRP  92


 Score =   115 bits (288),  Expect(2) = 1e-54, Method: Composition-based stats.
 Identities = 53/68 (78%), Positives = 57/68 (84%), Gaps = 0/68 (0%)
 Frame = +1

Query  322  GVWEYVTVNVHALXVEELTVPEYLQFKEELVDGPANGNFVLELDFEPFTASFPKPTLTKS  501
            GVWEY+ +NV AL VEEL V EYL FKEELVDG  NGNFVLELDFEPF ASFP+PTL+K 
Sbjct  93   GVWEYIRLNVQALVVEELRVAEYLHFKEELVDGGCNGNFVLELDFEPFNASFPRPTLSKY  152

Query  502  IGXGVEFL  525
            IG GVEFL
Sbjct  153  IGNGVEFL  160



>gb|AES92143.2| sucrose synthase [Medicago truncatula]
Length=750

 Score =   125 bits (315),  Expect(2) = 1e-54, Method: Compositional matrix adjust.
 Identities = 61/92 (66%), Positives = 77/92 (84%), Gaps = 0/92 (0%)
 Frame = +2

Query  47   MAERVLTRVHSLRERLDATLTAHRNEILLFMSKIESHGKGILKPHQLLAEFEAICKEDQE  226
            MA   LTRVHSL+ERLD TLTA+RNEIL  +S++E+ GKGIL+ HQ++AEFE I ++ ++
Sbjct  1    MATERLTRVHSLKERLDETLTANRNEILALLSRLEAKGKGILQHHQVIAEFEEIPEDSRQ  60

Query  227  KLNDHAFQQVLKSTQEAIVLPPWVALAIRLRP  322
            KL D AF +VL+STQEAIVLPPWVALA+R RP
Sbjct  61   KLTDGAFGEVLRSTQEAIVLPPWVALAVRPRP  92


 Score =   114 bits (285),  Expect(2) = 1e-54, Method: Compositional matrix adjust.
 Identities = 53/68 (78%), Positives = 59/68 (87%), Gaps = 0/68 (0%)
 Frame = +1

Query  322  GVWEYVTVNVHALXVEELTVPEYLQFKEELVDGPANGNFVLELDFEPFTASFPKPTLTKS  501
            G+WEY+ VNVHAL VE L   E+L+FKEELVDG ANGNFVLELDFEPFTASFP+PTL KS
Sbjct  93   GIWEYLRVNVHALVVENLQPAEFLKFKEELVDGSANGNFVLELDFEPFTASFPRPTLNKS  152

Query  502  IGXGVEFL  525
            IG GV+FL
Sbjct  153  IGNGVQFL  160



>gb|ADW80550.1| sucrose synthase 1 [Populus tomentosa]
Length=805

 Score =   124 bits (312),  Expect(2) = 1e-54, Method: Compositional matrix adjust.
 Identities = 59/92 (64%), Positives = 77/92 (84%), Gaps = 0/92 (0%)
 Frame = +2

Query  47   MAERVLTRVHSLRERLDATLTAHRNEILLFMSKIESHGKGILKPHQLLAEFEAICKEDQE  226
            MAER LTRVHS+RER+D TL AHRNEI+  +++IES GKGIL+ HQ++AEFEAI ++ ++
Sbjct  1    MAERALTRVHSIRERVDETLKAHRNEIVALLTRIESKGKGILQHHQIVAEFEAIPEDTRK  60

Query  227  KLNDHAFQQVLKSTQEAIVLPPWVALAIRLRP  322
             L   AF +VL+STQEAIV+PPW+ALA+R RP
Sbjct  61   TLAGGAFAEVLRSTQEAIVVPPWIALALRPRP  92


 Score =   115 bits (288),  Expect(2) = 1e-54, Method: Composition-based stats.
 Identities = 53/68 (78%), Positives = 57/68 (84%), Gaps = 0/68 (0%)
 Frame = +1

Query  322  GVWEYVTVNVHALXVEELTVPEYLQFKEELVDGPANGNFVLELDFEPFTASFPKPTLTKS  501
            GVWEY+ +NV AL VEEL V EYL FKEELVDG  NGNFVLELDFEPF ASFP+PTL+K 
Sbjct  93   GVWEYIRLNVQALVVEELRVAEYLHFKEELVDGGCNGNFVLELDFEPFNASFPRPTLSKY  152

Query  502  IGXGVEFL  525
            IG GVEFL
Sbjct  153  IGNGVEFL  160



>gb|ADW80570.1| sucrose synthase 1 [Populus tomentosa]
Length=805

 Score =   124 bits (312),  Expect(2) = 1e-54, Method: Compositional matrix adjust.
 Identities = 59/92 (64%), Positives = 77/92 (84%), Gaps = 0/92 (0%)
 Frame = +2

Query  47   MAERVLTRVHSLRERLDATLTAHRNEILLFMSKIESHGKGILKPHQLLAEFEAICKEDQE  226
            MAER LTRVHS+RER+D TL AHRNEI+  +++IES GKGIL+ HQ++AEFEAI ++ ++
Sbjct  1    MAERALTRVHSIRERVDETLKAHRNEIVALLTRIESKGKGILQHHQIVAEFEAIPEDTRK  60

Query  227  KLNDHAFQQVLKSTQEAIVLPPWVALAIRLRP  322
             L   AF +VL+STQEAIV+PPW+ALA+R RP
Sbjct  61   TLAGGAFAEVLRSTQEAIVVPPWIALALRPRP  92


 Score =   115 bits (288),  Expect(2) = 1e-54, Method: Composition-based stats.
 Identities = 53/68 (78%), Positives = 57/68 (84%), Gaps = 0/68 (0%)
 Frame = +1

Query  322  GVWEYVTVNVHALXVEELTVPEYLQFKEELVDGPANGNFVLELDFEPFTASFPKPTLTKS  501
            GVWEY+ +NV AL VEEL V EYL FKEELVDG  NGNFVLELDFEPF ASFP+PTL+K 
Sbjct  93   GVWEYIRLNVQALVVEELRVAEYLHFKEELVDGGCNGNFVLELDFEPFNASFPRPTLSKY  152

Query  502  IGXGVEFL  525
            IG GVEFL
Sbjct  153  IGNGVEFL  160



>gb|AGV22112.1| sucrose synthase 2 [Betula luminifera]
Length=807

 Score =   120 bits (300),  Expect(2) = 2e-54, Method: Compositional matrix adjust.
 Identities = 61/92 (66%), Positives = 73/92 (79%), Gaps = 0/92 (0%)
 Frame = +2

Query  47   MAERVLTRVHSLRERLDATLTAHRNEILLFMSKIESHGKGILKPHQLLAEFEAICKEDQE  226
            MAERVLTRVHSLRERLD TL A+RNEI+  +S+I   GKGIL+ H L+AE EAI +   +
Sbjct  1    MAERVLTRVHSLRERLDDTLAANRNEIVALLSRIVGKGKGILQHHHLIAEVEAIPEATSK  60

Query  227  KLNDHAFQQVLKSTQEAIVLPPWVALAIRLRP  322
            KL + AF +VL+S QEAIVLPPWVALA+R RP
Sbjct  61   KLLEGAFGEVLRSAQEAIVLPPWVALAVRPRP  92


 Score =   119 bits (298),  Expect(2) = 2e-54, Method: Compositional matrix adjust.
 Identities = 56/68 (82%), Positives = 59/68 (87%), Gaps = 0/68 (0%)
 Frame = +1

Query  322  GVWEYVTVNVHALXVEELTVPEYLQFKEELVDGPANGNFVLELDFEPFTASFPKPTLTKS  501
            GVWEY+ VNVHAL VEEL V EYL FKEELVDG  NGNFVLELDFEPF ASFP+PTL+KS
Sbjct  93   GVWEYIRVNVHALVVEELRVAEYLHFKEELVDGSTNGNFVLELDFEPFNASFPRPTLSKS  152

Query  502  IGXGVEFL  525
            IG GVEFL
Sbjct  153  IGNGVEFL  160



>gb|ADW80555.1| sucrose synthase 1 [Populus tomentosa]
Length=805

 Score =   124 bits (312),  Expect(2) = 3e-54, Method: Compositional matrix adjust.
 Identities = 59/92 (64%), Positives = 77/92 (84%), Gaps = 0/92 (0%)
 Frame = +2

Query  47   MAERVLTRVHSLRERLDATLTAHRNEILLFMSKIESHGKGILKPHQLLAEFEAICKEDQE  226
            MAER LTRVHS+RER+D TL AHRNEI+  +++IES GKGIL+ HQ++AEFEAI ++ ++
Sbjct  1    MAERALTRVHSIRERVDETLKAHRNEIVALLTRIESKGKGILQHHQMVAEFEAIPEDTRK  60

Query  227  KLNDHAFQQVLKSTQEAIVLPPWVALAIRLRP  322
             L   AF +VL+STQEAIV+PPW+ALA+R RP
Sbjct  61   TLAGGAFAEVLRSTQEAIVVPPWIALALRPRP  92


 Score =   114 bits (284),  Expect(2) = 3e-54, Method: Composition-based stats.
 Identities = 52/68 (76%), Positives = 57/68 (84%), Gaps = 0/68 (0%)
 Frame = +1

Query  322  GVWEYVTVNVHALXVEELTVPEYLQFKEELVDGPANGNFVLELDFEPFTASFPKPTLTKS  501
            GVWEY+ +NV AL VE+L V EYL FKEELVDG  NGNFVLELDFEPF ASFP+PTL+K 
Sbjct  93   GVWEYIRLNVQALVVEDLRVAEYLHFKEELVDGGCNGNFVLELDFEPFNASFPRPTLSKY  152

Query  502  IGXGVEFL  525
            IG GVEFL
Sbjct  153  IGNGVEFL  160



>gb|ADR81996.1| sucrose synthase 1 [Populus trichocarpa]
 gb|ADV71183.1| sucrose synthase 1 [Populus trichocarpa]
Length=805

 Score =   123 bits (308),  Expect(2) = 3e-54, Method: Compositional matrix adjust.
 Identities = 58/92 (63%), Positives = 76/92 (83%), Gaps = 0/92 (0%)
 Frame = +2

Query  47   MAERVLTRVHSLRERLDATLTAHRNEILLFMSKIESHGKGILKPHQLLAEFEAICKEDQE  226
            MAER LTRVHS+RER+D TL AHRNEI+  +++IE  GKGIL+ HQ++AEFEAI ++ ++
Sbjct  1    MAERALTRVHSIRERVDETLKAHRNEIVALLTRIEGKGKGILQHHQIVAEFEAIPEDTRK  60

Query  227  KLNDHAFQQVLKSTQEAIVLPPWVALAIRLRP  322
             L   AF +VL+STQEAIV+PPW+ALA+R RP
Sbjct  61   TLAGGAFAEVLRSTQEAIVVPPWIALALRPRP  92


 Score =   115 bits (288),  Expect(2) = 3e-54, Method: Composition-based stats.
 Identities = 53/68 (78%), Positives = 57/68 (84%), Gaps = 0/68 (0%)
 Frame = +1

Query  322  GVWEYVTVNVHALXVEELTVPEYLQFKEELVDGPANGNFVLELDFEPFTASFPKPTLTKS  501
            GVWEY+ +NV AL VEEL V EYL FKEELVDG  NGNFVLELDFEPF ASFP+PTL+K 
Sbjct  93   GVWEYIRLNVQALVVEELRVAEYLHFKEELVDGGCNGNFVLELDFEPFNASFPRPTLSKY  152

Query  502  IGXGVEFL  525
            IG GVEFL
Sbjct  153  IGNGVEFL  160



>gb|ADW80548.1| sucrose synthase 1 [Populus tomentosa]
Length=805

 Score =   124 bits (312),  Expect(2) = 3e-54, Method: Compositional matrix adjust.
 Identities = 59/92 (64%), Positives = 77/92 (84%), Gaps = 0/92 (0%)
 Frame = +2

Query  47   MAERVLTRVHSLRERLDATLTAHRNEILLFMSKIESHGKGILKPHQLLAEFEAICKEDQE  226
            MAER LTRVHS+RER+D TL AHRNEI+  +++IES GKGIL+ HQ++AEFEAI ++ ++
Sbjct  1    MAERALTRVHSIRERVDETLKAHRNEIVALLTRIESKGKGILQHHQIVAEFEAIPEDTRK  60

Query  227  KLNDHAFQQVLKSTQEAIVLPPWVALAIRLRP  322
             L   AF +VL+STQEAIV+PPW+ALA+R RP
Sbjct  61   TLAGGAFAEVLRSTQEAIVVPPWIALALRPRP  92


 Score =   114 bits (284),  Expect(2) = 3e-54, Method: Composition-based stats.
 Identities = 52/68 (76%), Positives = 57/68 (84%), Gaps = 0/68 (0%)
 Frame = +1

Query  322  GVWEYVTVNVHALXVEELTVPEYLQFKEELVDGPANGNFVLELDFEPFTASFPKPTLTKS  501
            GVWEY+ +NV AL VE+L V EYL FKEELVDG  NGNFVLELDFEPF ASFP+PTL+K 
Sbjct  93   GVWEYIRLNVQALVVEDLRVAEYLHFKEELVDGGCNGNFVLELDFEPFNASFPRPTLSKY  152

Query  502  IGXGVEFL  525
            IG GVEFL
Sbjct  153  IGNGVEFL  160



>gb|ADW80563.1| sucrose synthase 1 [Populus tomentosa]
Length=805

 Score =   124 bits (312),  Expect(2) = 3e-54, Method: Compositional matrix adjust.
 Identities = 59/92 (64%), Positives = 77/92 (84%), Gaps = 0/92 (0%)
 Frame = +2

Query  47   MAERVLTRVHSLRERLDATLTAHRNEILLFMSKIESHGKGILKPHQLLAEFEAICKEDQE  226
            MAER LTRVHS+RER+D TL AHRNEI+  +++IES GKGIL+ HQ++AEFEAI ++ ++
Sbjct  1    MAERALTRVHSIRERVDETLKAHRNEIVALLTRIESKGKGILQHHQIVAEFEAIPEDTRK  60

Query  227  KLNDHAFQQVLKSTQEAIVLPPWVALAIRLRP  322
             L   AF +VL+STQEAIV+PPW+ALA+R RP
Sbjct  61   TLAGGAFAEVLRSTQEAIVVPPWIALALRPRP  92


 Score =   114 bits (284),  Expect(2) = 3e-54, Method: Composition-based stats.
 Identities = 52/68 (76%), Positives = 57/68 (84%), Gaps = 0/68 (0%)
 Frame = +1

Query  322  GVWEYVTVNVHALXVEELTVPEYLQFKEELVDGPANGNFVLELDFEPFTASFPKPTLTKS  501
            GVWEY+ +NV AL VE+L V EYL FKEELVDG  NGNFVLELDFEPF ASFP+PTL+K 
Sbjct  93   GVWEYIRLNVQALVVEDLRVAEYLHFKEELVDGGCNGNFVLELDFEPFNASFPRPTLSKY  152

Query  502  IGXGVEFL  525
            IG GVEFL
Sbjct  153  IGNGVEFL  160



>gb|ADW80534.1| sucrose synthase 1 [Populus tomentosa]
Length=805

 Score =   124 bits (312),  Expect(2) = 3e-54, Method: Compositional matrix adjust.
 Identities = 59/92 (64%), Positives = 77/92 (84%), Gaps = 0/92 (0%)
 Frame = +2

Query  47   MAERVLTRVHSLRERLDATLTAHRNEILLFMSKIESHGKGILKPHQLLAEFEAICKEDQE  226
            MAER LTRVHS+RER+D TL AHRNEI+  +++IES GKGIL+ HQ++AEFEAI ++ ++
Sbjct  1    MAERALTRVHSIRERVDETLKAHRNEIVALLTRIESKGKGILQHHQIVAEFEAIPEDTRK  60

Query  227  KLNDHAFQQVLKSTQEAIVLPPWVALAIRLRP  322
             L   AF +VL+STQEAIV+PPW+ALA+R RP
Sbjct  61   TLAGGAFAEVLRSTQEAIVVPPWIALALRPRP  92


 Score =   114 bits (284),  Expect(2) = 3e-54, Method: Composition-based stats.
 Identities = 52/68 (76%), Positives = 57/68 (84%), Gaps = 0/68 (0%)
 Frame = +1

Query  322  GVWEYVTVNVHALXVEELTVPEYLQFKEELVDGPANGNFVLELDFEPFTASFPKPTLTKS  501
            GVWEY+ +NV AL VE+L V EYL FKEELVDG  NGNFVLELDFEPF ASFP+PTL+K 
Sbjct  93   GVWEYIRLNVQALVVEDLRVAEYLHFKEELVDGGCNGNFVLELDFEPFNASFPRPTLSKY  152

Query  502  IGXGVEFL  525
            IG GVEFL
Sbjct  153  IGNGVEFL  160



>gb|ADW80549.1| sucrose synthase 1 [Populus tomentosa]
Length=805

 Score =   124 bits (312),  Expect(2) = 3e-54, Method: Compositional matrix adjust.
 Identities = 59/92 (64%), Positives = 77/92 (84%), Gaps = 0/92 (0%)
 Frame = +2

Query  47   MAERVLTRVHSLRERLDATLTAHRNEILLFMSKIESHGKGILKPHQLLAEFEAICKEDQE  226
            MAER LTRVHS+RER+D TL AHRNEI+  +++IES GKGIL+ HQ++AEFEAI ++ ++
Sbjct  1    MAERALTRVHSIRERVDETLKAHRNEIVALLTRIESKGKGILQHHQIVAEFEAIPEDTRK  60

Query  227  KLNDHAFQQVLKSTQEAIVLPPWVALAIRLRP  322
             L   AF +VL+STQEAIV+PPW+ALA+R RP
Sbjct  61   TLAGGAFAEVLRSTQEAIVVPPWIALALRPRP  92


 Score =   114 bits (284),  Expect(2) = 3e-54, Method: Composition-based stats.
 Identities = 52/68 (76%), Positives = 57/68 (84%), Gaps = 0/68 (0%)
 Frame = +1

Query  322  GVWEYVTVNVHALXVEELTVPEYLQFKEELVDGPANGNFVLELDFEPFTASFPKPTLTKS  501
            GVWEY+ +NV AL VE+L V EYL FKEELVDG  NGNFVLELDFEPF ASFP+PTL+K 
Sbjct  93   GVWEYIRLNVQALVVEDLRVAEYLHFKEELVDGGCNGNFVLELDFEPFNASFPRPTLSKY  152

Query  502  IGXGVEFL  525
            IG GVEFL
Sbjct  153  IGNGVEFL  160



>gb|ADW80560.1| sucrose synthase 1 [Populus tomentosa]
Length=805

 Score =   124 bits (311),  Expect(2) = 3e-54, Method: Compositional matrix adjust.
 Identities = 59/92 (64%), Positives = 77/92 (84%), Gaps = 0/92 (0%)
 Frame = +2

Query  47   MAERVLTRVHSLRERLDATLTAHRNEILLFMSKIESHGKGILKPHQLLAEFEAICKEDQE  226
            MAER LTRVHS+RER+D TL AHRNEI+  +++IES GKGIL+ HQ++AEFEAI ++ ++
Sbjct  1    MAERALTRVHSIRERVDETLKAHRNEIVALLTRIESKGKGILQHHQIVAEFEAIPEDTRK  60

Query  227  KLNDHAFQQVLKSTQEAIVLPPWVALAIRLRP  322
             L   AF +VL+STQEAIV+PPW+ALA+R RP
Sbjct  61   TLAGGAFAEVLRSTQEAIVVPPWIALALRPRP  92


 Score =   114 bits (284),  Expect(2) = 3e-54, Method: Composition-based stats.
 Identities = 52/68 (76%), Positives = 57/68 (84%), Gaps = 0/68 (0%)
 Frame = +1

Query  322  GVWEYVTVNVHALXVEELTVPEYLQFKEELVDGPANGNFVLELDFEPFTASFPKPTLTKS  501
            GVWEY+ +NV AL VE+L V EYL FKEELVDG  NGNFVLELDFEPF ASFP+PTL+K 
Sbjct  93   GVWEYIRLNVQALVVEDLRVAEYLHFKEELVDGGCNGNFVLELDFEPFNASFPRPTLSKY  152

Query  502  IGXGVEFL  525
            IG GVEFL
Sbjct  153  IGNGVEFL  160



>gb|ADW80546.1| sucrose synthase 1 [Populus tomentosa]
Length=805

 Score =   124 bits (311),  Expect(2) = 3e-54, Method: Compositional matrix adjust.
 Identities = 59/92 (64%), Positives = 77/92 (84%), Gaps = 0/92 (0%)
 Frame = +2

Query  47   MAERVLTRVHSLRERLDATLTAHRNEILLFMSKIESHGKGILKPHQLLAEFEAICKEDQE  226
            MAER LTRVHS+RER+D TL AHRNEI+  +++IES GKGIL+ HQ++AEFEAI ++ ++
Sbjct  1    MAERALTRVHSIRERVDETLKAHRNEIVALLTRIESKGKGILQHHQIVAEFEAIPEDTRK  60

Query  227  KLNDHAFQQVLKSTQEAIVLPPWVALAIRLRP  322
             L   AF +VL+STQEAIV+PPW+ALA+R RP
Sbjct  61   TLAGGAFAEVLRSTQEAIVVPPWIALALRPRP  92


 Score =   114 bits (284),  Expect(2) = 3e-54, Method: Composition-based stats.
 Identities = 52/68 (76%), Positives = 57/68 (84%), Gaps = 0/68 (0%)
 Frame = +1

Query  322  GVWEYVTVNVHALXVEELTVPEYLQFKEELVDGPANGNFVLELDFEPFTASFPKPTLTKS  501
            GVWEY+ +NV AL VE+L V EYL FKEELVDG  NGNFVLELDFEPF ASFP+PTL+K 
Sbjct  93   GVWEYIRLNVQALVVEDLRVAEYLHFKEELVDGGCNGNFVLELDFEPFNASFPRPTLSKY  152

Query  502  IGXGVEFL  525
            IG GVEFL
Sbjct  153  IGNGVEFL  160



>gb|ADW80535.1| sucrose synthase 1 [Populus tomentosa]
 gb|ADW80537.1| sucrose synthase 1 [Populus tomentosa]
Length=805

 Score =   124 bits (311),  Expect(2) = 3e-54, Method: Compositional matrix adjust.
 Identities = 59/92 (64%), Positives = 77/92 (84%), Gaps = 0/92 (0%)
 Frame = +2

Query  47   MAERVLTRVHSLRERLDATLTAHRNEILLFMSKIESHGKGILKPHQLLAEFEAICKEDQE  226
            MAER LTRVHS+RER+D TL AHRNEI+  +++IES GKGIL+ HQ++AEFEAI ++ ++
Sbjct  1    MAERALTRVHSIRERVDETLKAHRNEIVALLTRIESKGKGILQHHQIVAEFEAIPEDTRK  60

Query  227  KLNDHAFQQVLKSTQEAIVLPPWVALAIRLRP  322
             L   AF +VL+STQEAIV+PPW+ALA+R RP
Sbjct  61   TLAGGAFAEVLRSTQEAIVVPPWIALALRPRP  92


 Score =   114 bits (284),  Expect(2) = 3e-54, Method: Composition-based stats.
 Identities = 52/68 (76%), Positives = 57/68 (84%), Gaps = 0/68 (0%)
 Frame = +1

Query  322  GVWEYVTVNVHALXVEELTVPEYLQFKEELVDGPANGNFVLELDFEPFTASFPKPTLTKS  501
            GVWEY+ +NV AL VE+L V EYL FKEELVDG  NGNFVLELDFEPF ASFP+PTL+K 
Sbjct  93   GVWEYIRLNVQALVVEDLRVAEYLHFKEELVDGGCNGNFVLELDFEPFNASFPRPTLSKY  152

Query  502  IGXGVEFL  525
            IG GVEFL
Sbjct  153  IGNGVEFL  160



>ref|XP_007154543.1| hypothetical protein PHAVU_003G127500g [Phaseolus vulgaris]
 gb|ESW26537.1| hypothetical protein PHAVU_003G127500g [Phaseolus vulgaris]
Length=805

 Score =   124 bits (311),  Expect(2) = 3e-54, Method: Compositional matrix adjust.
 Identities = 62/92 (67%), Positives = 76/92 (83%), Gaps = 0/92 (0%)
 Frame = +2

Query  47   MAERVLTRVHSLRERLDATLTAHRNEILLFMSKIESHGKGILKPHQLLAEFEAICKEDQE  226
            MA   LTRVHSLRERLD TL+A+RNEIL  +S+IE+ G GIL+ HQ++AEFE I +E ++
Sbjct  1    MAADRLTRVHSLRERLDETLSANRNEILALLSRIEAKGTGILQHHQVIAEFEEIPEESRQ  60

Query  227  KLNDHAFQQVLKSTQEAIVLPPWVALAIRLRP  322
            KL D AF +VL+STQEAIVLPPWVALA+R RP
Sbjct  61   KLIDGAFGEVLRSTQEAIVLPPWVALAVRPRP  92


 Score =   114 bits (285),  Expect(2) = 3e-54, Method: Compositional matrix adjust.
 Identities = 54/68 (79%), Positives = 59/68 (87%), Gaps = 0/68 (0%)
 Frame = +1

Query  322  GVWEYVTVNVHALXVEELTVPEYLQFKEELVDGPANGNFVLELDFEPFTASFPKPTLTKS  501
            GVWEY+ VNVHAL VE L   EYL+FKEELVDG +NGNFVLELDFEPFTASFP+PTL KS
Sbjct  93   GVWEYLRVNVHALVVEVLQPAEYLRFKEELVDGSSNGNFVLELDFEPFTASFPRPTLNKS  152

Query  502  IGXGVEFL  525
            IG GV+FL
Sbjct  153  IGNGVQFL  160



>ref|XP_011010968.1| PREDICTED: sucrose synthase-like isoform X1 [Populus euphratica]
Length=812

 Score =   124 bits (312),  Expect(2) = 4e-54, Method: Compositional matrix adjust.
 Identities = 59/93 (63%), Positives = 77/93 (83%), Gaps = 0/93 (0%)
 Frame = +2

Query  44   AMAERVLTRVHSLRERLDATLTAHRNEILLFMSKIESHGKGILKPHQLLAEFEAICKEDQ  223
            AMAER LTRVHS+RER+D TL AHRNEI+  +++IE  GKGIL+ HQ++AEFEAI ++ +
Sbjct  7    AMAERALTRVHSIRERVDETLKAHRNEIVALLTRIEGKGKGILQHHQIVAEFEAIPEDTR  66

Query  224  EKLNDHAFQQVLKSTQEAIVLPPWVALAIRLRP  322
            + L   AF +VL+STQEAIV+PPW+ALA+R RP
Sbjct  67   KTLAGGAFAEVLRSTQEAIVVPPWIALALRPRP  99


 Score =   113 bits (283),  Expect(2) = 4e-54, Method: Composition-based stats.
 Identities = 52/68 (76%), Positives = 56/68 (82%), Gaps = 0/68 (0%)
 Frame = +1

Query  322  GVWEYVTVNVHALXVEELTVPEYLQFKEELVDGPANGNFVLELDFEPFTASFPKPTLTKS  501
            GVWEY+ +NV AL  EEL V EYL FKEELVDG  NGNFVLELDFEPF ASFP+PTL+K 
Sbjct  100  GVWEYIRLNVQALVAEELRVAEYLHFKEELVDGGCNGNFVLELDFEPFNASFPRPTLSKY  159

Query  502  IGXGVEFL  525
            IG GVEFL
Sbjct  160  IGNGVEFL  167



>gb|AAN76498.1|AF315375_1 sucrose synthase [Phaseolus vulgaris]
Length=805

 Score =   124 bits (311),  Expect(2) = 4e-54, Method: Compositional matrix adjust.
 Identities = 62/92 (67%), Positives = 76/92 (83%), Gaps = 0/92 (0%)
 Frame = +2

Query  47   MAERVLTRVHSLRERLDATLTAHRNEILLFMSKIESHGKGILKPHQLLAEFEAICKEDQE  226
            MA   LTRVHSLRERLD TL+A+RNEIL  +S+IE+ G GIL+ HQ++AEFE I +E ++
Sbjct  1    MAADRLTRVHSLRERLDETLSANRNEILALLSRIEAKGTGILQHHQVIAEFEEIPEESRQ  60

Query  227  KLNDHAFQQVLKSTQEAIVLPPWVALAIRLRP  322
            KL D AF +VL+STQEAIVLPPWVALA+R RP
Sbjct  61   KLIDGAFGEVLRSTQEAIVLPPWVALAVRPRP  92


 Score =   114 bits (285),  Expect(2) = 4e-54, Method: Compositional matrix adjust.
 Identities = 54/68 (79%), Positives = 59/68 (87%), Gaps = 0/68 (0%)
 Frame = +1

Query  322  GVWEYVTVNVHALXVEELTVPEYLQFKEELVDGPANGNFVLELDFEPFTASFPKPTLTKS  501
            GVWEY+ VNVHAL VE L   EYL+FKEELVDG +NGNFVLELDFEPFTASFP+PTL KS
Sbjct  93   GVWEYLRVNVHALVVEVLQPAEYLRFKEELVDGSSNGNFVLELDFEPFTASFPRPTLNKS  152

Query  502  IGXGVEFL  525
            IG GV+FL
Sbjct  153  IGNGVQFL  160



>gb|ADW80552.1| sucrose synthase 1 [Populus tomentosa]
Length=805

 Score =   124 bits (310),  Expect(2) = 5e-54, Method: Compositional matrix adjust.
 Identities = 58/92 (63%), Positives = 77/92 (84%), Gaps = 0/92 (0%)
 Frame = +2

Query  47   MAERVLTRVHSLRERLDATLTAHRNEILLFMSKIESHGKGILKPHQLLAEFEAICKEDQE  226
            MAER LTR+HS+RER+D TL AHRNEI+  +++IES GKGIL+ HQ++AEFEAI ++ ++
Sbjct  1    MAERALTRIHSIRERVDETLKAHRNEIVALLTRIESKGKGILQHHQIVAEFEAIPEDTRK  60

Query  227  KLNDHAFQQVLKSTQEAIVLPPWVALAIRLRP  322
             L   AF +VL+STQEAIV+PPW+ALA+R RP
Sbjct  61   TLAGGAFAEVLRSTQEAIVVPPWIALALRPRP  92


 Score =   114 bits (284),  Expect(2) = 5e-54, Method: Composition-based stats.
 Identities = 52/68 (76%), Positives = 57/68 (84%), Gaps = 0/68 (0%)
 Frame = +1

Query  322  GVWEYVTVNVHALXVEELTVPEYLQFKEELVDGPANGNFVLELDFEPFTASFPKPTLTKS  501
            GVWEY+ +NV AL VE+L V EYL FKEELVDG  NGNFVLELDFEPF ASFP+PTL+K 
Sbjct  93   GVWEYIRLNVQALVVEDLRVAEYLHFKEELVDGGCNGNFVLELDFEPFNASFPRPTLSKY  152

Query  502  IGXGVEFL  525
            IG GVEFL
Sbjct  153  IGNGVEFL  160



>ref|XP_010271909.1| PREDICTED: sucrose synthase [Nelumbo nucifera]
Length=806

 Score =   125 bits (314),  Expect(2) = 5e-54, Method: Compositional matrix adjust.
 Identities = 61/92 (66%), Positives = 72/92 (78%), Gaps = 0/92 (0%)
 Frame = +2

Query  47   MAERVLTRVHSLRERLDATLTAHRNEILLFMSKIESHGKGILKPHQLLAEFEAICKEDQE  226
            MAER L RVHSLRERL  TL+AHRNE+L  +S+IE HGKGIL+PH LL E  AI + D++
Sbjct  1    MAERALARVHSLRERLGETLSAHRNELLHLLSRIEYHGKGILQPHHLLEELGAISEGDRQ  60

Query  227  KLNDHAFQQVLKSTQEAIVLPPWVALAIRLRP  322
            KL D  F  V++STQE IVLPPWVALA+R RP
Sbjct  61   KLLDGVFGDVIRSTQEIIVLPPWVALAVRPRP  92


 Score =   112 bits (280),  Expect(2) = 5e-54, Method: Composition-based stats.
 Identities = 52/68 (76%), Positives = 58/68 (85%), Gaps = 0/68 (0%)
 Frame = +1

Query  322  GVWEYVTVNVHALXVEELTVPEYLQFKEELVDGPANGNFVLELDFEPFTASFPKPTLTKS  501
            GVW+Y+ VNV+AL VEELTV EYLQFKE+LV+G    NFVLELD EPF ASFPKPTL+KS
Sbjct  93   GVWDYIRVNVNALAVEELTVAEYLQFKEDLVNGSPKDNFVLELDLEPFNASFPKPTLSKS  152

Query  502  IGXGVEFL  525
            IG GVEFL
Sbjct  153  IGNGVEFL  160



>gb|ABF50715.1| sucrose synthase [Viscum album subsp. album]
Length=810

 Score =   119 bits (297),  Expect(2) = 6e-54, Method: Compositional matrix adjust.
 Identities = 56/68 (82%), Positives = 61/68 (90%), Gaps = 0/68 (0%)
 Frame = +1

Query  322  GVWEYVTVNVHALXVEELTVPEYLQFKEELVDGPANGNFVLELDFEPFTASFPKPTLTKS  501
            GVW+Y+ VNV+AL VEEL V EYL FKEELVDG ANGNFVLELDFEPFTASFP+PTL+KS
Sbjct  115  GVWDYIRVNVNALAVEELKVAEYLHFKEELVDGSANGNFVLELDFEPFTASFPRPTLSKS  174

Query  502  IGXGVEFL  525
            IG GVEFL
Sbjct  175  IGNGVEFL  182


 Score =   118 bits (296),  Expect(2) = 6e-54, Method: Compositional matrix adjust.
 Identities = 57/93 (61%), Positives = 71/93 (76%), Gaps = 0/93 (0%)
 Frame = +2

Query  44   AMAERVLTRVHSLRERLDATLTAHRNEILLFMSKIESHGKGILKPHQLLAEFEAICKEDQ  223
             MA+R LTRV+SLRERLD TL  HRNEIL  +S+IE++GKGIL+ H +++E EA+ K D 
Sbjct  22   GMADRALTRVYSLRERLDETLADHRNEILALLSRIENNGKGILQHHHIVSELEALPKADM  81

Query  224  EKLNDHAFQQVLKSTQEAIVLPPWVALAIRLRP  322
             KL D AF  V++S QEAIV  PWVALA+R RP
Sbjct  82   LKLTDGAFGDVIRSAQEAIVFSPWVALAVRPRP  114



>gb|ADW80536.1| sucrose synthase 1 [Populus tomentosa]
 gb|ADW80544.1| sucrose synthase 1 [Populus tomentosa]
 gb|ADW80561.1| sucrose synthase 1 [Populus tomentosa]
 gb|ADW80567.1| sucrose synthase 1 [Populus tomentosa]
 gb|ADW80568.1| sucrose synthase 1 [Populus tomentosa]
Length=805

 Score =   124 bits (312),  Expect(2) = 6e-54, Method: Compositional matrix adjust.
 Identities = 59/92 (64%), Positives = 77/92 (84%), Gaps = 0/92 (0%)
 Frame = +2

Query  47   MAERVLTRVHSLRERLDATLTAHRNEILLFMSKIESHGKGILKPHQLLAEFEAICKEDQE  226
            MAER LTRVHS+RER+D TL AHRNEI+  +++IES GKGIL+ HQ++AEFEAI ++ ++
Sbjct  1    MAERALTRVHSIRERVDETLKAHRNEIVALLTRIESKGKGILQHHQIVAEFEAIPEDTRK  60

Query  227  KLNDHAFQQVLKSTQEAIVLPPWVALAIRLRP  322
             L   AF +VL+STQEAIV+PPW+ALA+R RP
Sbjct  61   TLAGGAFAEVLRSTQEAIVVPPWIALALRPRP  92


 Score =   113 bits (282),  Expect(2) = 6e-54, Method: Composition-based stats.
 Identities = 52/68 (76%), Positives = 56/68 (82%), Gaps = 0/68 (0%)
 Frame = +1

Query  322  GVWEYVTVNVHALXVEELTVPEYLQFKEELVDGPANGNFVLELDFEPFTASFPKPTLTKS  501
            GVWEY+ +NV AL VEEL V EYL FKEELVDG  NG FVLELDFEPF ASFP+PTL+K 
Sbjct  93   GVWEYIRLNVQALVVEELRVAEYLHFKEELVDGGCNGKFVLELDFEPFNASFPRPTLSKY  152

Query  502  IGXGVEFL  525
            IG GVEFL
Sbjct  153  IGNGVEFL  160



>gb|ADW80539.1| sucrose synthase 1 [Populus tomentosa]
 gb|ADW80569.1| sucrose synthase 1 [Populus tomentosa]
Length=805

 Score =   124 bits (312),  Expect(2) = 6e-54, Method: Compositional matrix adjust.
 Identities = 59/92 (64%), Positives = 77/92 (84%), Gaps = 0/92 (0%)
 Frame = +2

Query  47   MAERVLTRVHSLRERLDATLTAHRNEILLFMSKIESHGKGILKPHQLLAEFEAICKEDQE  226
            MAER LTRVHS+RER+D TL AHRNEI+  +++IES GKGIL+ HQ++AEFEAI ++ ++
Sbjct  1    MAERALTRVHSIRERVDETLKAHRNEIVALLTRIESKGKGILQHHQIVAEFEAIPEDTRK  60

Query  227  KLNDHAFQQVLKSTQEAIVLPPWVALAIRLRP  322
             L   AF +VL+STQEAIV+PPW+ALA+R RP
Sbjct  61   TLAGGAFAEVLRSTQEAIVVPPWIALALRPRP  92


 Score =   113 bits (282),  Expect(2) = 6e-54, Method: Composition-based stats.
 Identities = 52/68 (76%), Positives = 56/68 (82%), Gaps = 0/68 (0%)
 Frame = +1

Query  322  GVWEYVTVNVHALXVEELTVPEYLQFKEELVDGPANGNFVLELDFEPFTASFPKPTLTKS  501
            GVWEY+ +NV AL VEEL V EYL FKEELVDG  NG FVLELDFEPF ASFP+PTL+K 
Sbjct  93   GVWEYIRLNVQALVVEELRVAEYLHFKEELVDGGCNGKFVLELDFEPFNASFPRPTLSKY  152

Query  502  IGXGVEFL  525
            IG GVEFL
Sbjct  153  IGNGVEFL  160



>gb|ADW80545.1| sucrose synthase 1 [Populus tomentosa]
Length=805

 Score =   124 bits (311),  Expect(2) = 6e-54, Method: Compositional matrix adjust.
 Identities = 59/92 (64%), Positives = 77/92 (84%), Gaps = 0/92 (0%)
 Frame = +2

Query  47   MAERVLTRVHSLRERLDATLTAHRNEILLFMSKIESHGKGILKPHQLLAEFEAICKEDQE  226
            MAER LTRVHS+RER+D TL AHRNEI+  +++IES GKGIL+ HQ++AEFEAI ++ ++
Sbjct  1    MAERALTRVHSIRERVDETLKAHRNEIVALLTRIESKGKGILQHHQIVAEFEAIPEDTRK  60

Query  227  KLNDHAFQQVLKSTQEAIVLPPWVALAIRLRP  322
             L   AF +VL+STQEAIV+PPW+ALA+R RP
Sbjct  61   TLAGGAFAEVLRSTQEAIVVPPWIALALRPRP  92


 Score =   113 bits (282),  Expect(2) = 6e-54, Method: Composition-based stats.
 Identities = 52/68 (76%), Positives = 56/68 (82%), Gaps = 0/68 (0%)
 Frame = +1

Query  322  GVWEYVTVNVHALXVEELTVPEYLQFKEELVDGPANGNFVLELDFEPFTASFPKPTLTKS  501
            GVWEY+ +NV AL VEEL V EYL FKEELVDG  NG FVLELDFEPF ASFP+PTL+K 
Sbjct  93   GVWEYIRLNVQALVVEELRVAEYLHFKEELVDGGCNGKFVLELDFEPFNASFPRPTLSKY  152

Query  502  IGXGVEFL  525
            IG GVEFL
Sbjct  153  IGNGVEFL  160



>gb|ADW80540.1| sucrose synthase 1 [Populus tomentosa]
Length=805

 Score =   124 bits (312),  Expect(2) = 7e-54, Method: Compositional matrix adjust.
 Identities = 59/92 (64%), Positives = 77/92 (84%), Gaps = 0/92 (0%)
 Frame = +2

Query  47   MAERVLTRVHSLRERLDATLTAHRNEILLFMSKIESHGKGILKPHQLLAEFEAICKEDQE  226
            MAER LTRVHS+RER+D TL AHRNEI+  +++IES GKGIL+ HQ++AEFEAI ++ ++
Sbjct  1    MAERALTRVHSIRERVDETLKAHRNEIVALLTRIESKGKGILQHHQIVAEFEAIPEDTRK  60

Query  227  KLNDHAFQQVLKSTQEAIVLPPWVALAIRLRP  322
             L   AF +VL+STQEAIV+PPW+ALA+R RP
Sbjct  61   TLAGGAFAEVLRSTQEAIVVPPWIALALRPRP  92


 Score =   112 bits (281),  Expect(2) = 7e-54, Method: Composition-based stats.
 Identities = 52/68 (76%), Positives = 56/68 (82%), Gaps = 0/68 (0%)
 Frame = +1

Query  322  GVWEYVTVNVHALXVEELTVPEYLQFKEELVDGPANGNFVLELDFEPFTASFPKPTLTKS  501
            GVWEY+ +NV AL VEEL V EYL FKEELVDG  NG FVLELDFEPF ASFP+PTL+K 
Sbjct  93   GVWEYIRLNVQALVVEELRVAEYLHFKEELVDGGCNGKFVLELDFEPFNASFPRPTLSKY  152

Query  502  IGXGVEFL  525
            IG GVEFL
Sbjct  153  IGNGVEFL  160



>gb|ADV71181.1| sucrose synthase 1 [Populus tomentosa]
 gb|ADW80538.1| sucrose synthase 1 [Populus tomentosa]
 gb|ADW80557.1| sucrose synthase 1 [Populus tomentosa]
 gb|AFZ78658.1| sucrose synthase [Populus tomentosa]
Length=805

 Score =   124 bits (312),  Expect(2) = 7e-54, Method: Compositional matrix adjust.
 Identities = 59/92 (64%), Positives = 77/92 (84%), Gaps = 0/92 (0%)
 Frame = +2

Query  47   MAERVLTRVHSLRERLDATLTAHRNEILLFMSKIESHGKGILKPHQLLAEFEAICKEDQE  226
            MAER LTRVHS+RER+D TL AHRNEI+  +++IES GKGIL+ HQ++AEFEAI ++ ++
Sbjct  1    MAERALTRVHSIRERVDETLKAHRNEIVALLTRIESKGKGILQHHQIVAEFEAIPEDTRK  60

Query  227  KLNDHAFQQVLKSTQEAIVLPPWVALAIRLRP  322
             L   AF +VL+STQEAIV+PPW+ALA+R RP
Sbjct  61   TLAGGAFAEVLRSTQEAIVVPPWIALALRPRP  92


 Score =   112 bits (281),  Expect(2) = 7e-54, Method: Composition-based stats.
 Identities = 52/68 (76%), Positives = 56/68 (82%), Gaps = 0/68 (0%)
 Frame = +1

Query  322  GVWEYVTVNVHALXVEELTVPEYLQFKEELVDGPANGNFVLELDFEPFTASFPKPTLTKS  501
            GVWEY+ +NV AL VEEL V EYL FKEELVDG  NG FVLELDFEPF ASFP+PTL+K 
Sbjct  93   GVWEYIRLNVQALVVEELRVAEYLHFKEELVDGGCNGKFVLELDFEPFNASFPRPTLSKY  152

Query  502  IGXGVEFL  525
            IG GVEFL
Sbjct  153  IGNGVEFL  160



>gb|ADW80541.1| sucrose synthase 1 [Populus tomentosa]
 gb|ADW80542.1| sucrose synthase 1 [Populus tomentosa]
 gb|ADW80547.1| sucrose synthase 1 [Populus tomentosa]
 gb|ADW80553.1| sucrose synthase 1 [Populus tomentosa]
 gb|ADW80554.1| sucrose synthase 1 [Populus tomentosa]
 gb|ADW80564.1| sucrose synthase 1 [Populus tomentosa]
Length=805

 Score =   124 bits (312),  Expect(2) = 7e-54, Method: Compositional matrix adjust.
 Identities = 59/92 (64%), Positives = 77/92 (84%), Gaps = 0/92 (0%)
 Frame = +2

Query  47   MAERVLTRVHSLRERLDATLTAHRNEILLFMSKIESHGKGILKPHQLLAEFEAICKEDQE  226
            MAER LTRVHS+RER+D TL AHRNEI+  +++IES GKGIL+ HQ++AEFEAI ++ ++
Sbjct  1    MAERALTRVHSIRERVDETLKAHRNEIVALLTRIESKGKGILQHHQIVAEFEAIPEDTRK  60

Query  227  KLNDHAFQQVLKSTQEAIVLPPWVALAIRLRP  322
             L   AF +VL+STQEAIV+PPW+ALA+R RP
Sbjct  61   TLAGGAFAEVLRSTQEAIVVPPWIALALRPRP  92


 Score =   112 bits (281),  Expect(2) = 7e-54, Method: Composition-based stats.
 Identities = 52/68 (76%), Positives = 56/68 (82%), Gaps = 0/68 (0%)
 Frame = +1

Query  322  GVWEYVTVNVHALXVEELTVPEYLQFKEELVDGPANGNFVLELDFEPFTASFPKPTLTKS  501
            GVWEY+ +NV AL VEEL V EYL FKEELVDG  NG FVLELDFEPF ASFP+PTL+K 
Sbjct  93   GVWEYIRLNVQALVVEELRVAEYLHFKEELVDGGCNGKFVLELDFEPFNASFPRPTLSKY  152

Query  502  IGXGVEFL  525
            IG GVEFL
Sbjct  153  IGNGVEFL  160



>gb|ADW80543.1| sucrose synthase 1 [Populus tomentosa]
Length=805

 Score =   124 bits (311),  Expect(2) = 7e-54, Method: Compositional matrix adjust.
 Identities = 59/92 (64%), Positives = 77/92 (84%), Gaps = 0/92 (0%)
 Frame = +2

Query  47   MAERVLTRVHSLRERLDATLTAHRNEILLFMSKIESHGKGILKPHQLLAEFEAICKEDQE  226
            MAER LTRVHS+RER+D TL AHRNEI+  +++IES GKGIL+ HQ++AEFEAI ++ ++
Sbjct  1    MAERALTRVHSIRERVDETLKAHRNEIVALLTRIESKGKGILQHHQIVAEFEAIPEDTRK  60

Query  227  KLNDHAFQQVLKSTQEAIVLPPWVALAIRLRP  322
             L   AF +VL+STQEAIV+PPW+ALA+R RP
Sbjct  61   TLAGGAFAEVLRSTQEAIVVPPWIALALRPRP  92


 Score =   112 bits (281),  Expect(2) = 7e-54, Method: Composition-based stats.
 Identities = 52/68 (76%), Positives = 56/68 (82%), Gaps = 0/68 (0%)
 Frame = +1

Query  322  GVWEYVTVNVHALXVEELTVPEYLQFKEELVDGPANGNFVLELDFEPFTASFPKPTLTKS  501
            GVWEY+ +NV AL VEEL V EYL FKEELVDG  NG FVLELDFEPF ASFP+PTL+K 
Sbjct  93   GVWEYIRLNVQALVVEELRVAEYLHFKEELVDGGCNGKFVLELDFEPFNASFPRPTLSKY  152

Query  502  IGXGVEFL  525
            IG GVEFL
Sbjct  153  IGNGVEFL  160



>gb|ABP88869.1| sucrose synthase [Medicago falcata]
Length=804

 Score =   124 bits (310),  Expect(2) = 7e-54, Method: Compositional matrix adjust.
 Identities = 60/89 (67%), Positives = 76/89 (85%), Gaps = 0/89 (0%)
 Frame = +2

Query  56   RVLTRVHSLRERLDATLTAHRNEILLFMSKIESHGKGILKPHQLLAEFEAICKEDQEKLN  235
            R LTRVHSL+ERLD TLTA+RNEIL  +S++E+ GKGIL+ H+++AEFE I +E ++KL 
Sbjct  3    RRLTRVHSLKERLDETLTANRNEILALLSRLEAKGKGILQHHRVIAEFEEIPEESRQKLT  62

Query  236  DHAFQQVLKSTQEAIVLPPWVALAIRLRP  322
            D AF +VL+STQEAIVLPPWVALA+R RP
Sbjct  63   DGAFGEVLRSTQEAIVLPPWVALAVRPRP  91


 Score =   113 bits (283),  Expect(2) = 7e-54, Method: Compositional matrix adjust.
 Identities = 53/68 (78%), Positives = 58/68 (85%), Gaps = 0/68 (0%)
 Frame = +1

Query  322  GVWEYVTVNVHALXVEELTVPEYLQFKEELVDGPANGNFVLELDFEPFTASFPKPTLTKS  501
            G+WEY+ VNVHAL VE L   E+L+FKEELVDG ANGNFVLELDFEPFTASFP+PTL KS
Sbjct  92   GIWEYLRVNVHALVVENLQPAEFLKFKEELVDGSANGNFVLELDFEPFTASFPRPTLNKS  151

Query  502  IGXGVEFL  525
            IG GV FL
Sbjct  152  IGNGVHFL  159



>ref|XP_002324136.2| sucrose synthase family protein [Populus trichocarpa]
 gb|EEF02701.2| sucrose synthase family protein [Populus trichocarpa]
Length=805

 Score =   121 bits (304),  Expect(2) = 8e-54, Method: Compositional matrix adjust.
 Identities = 57/92 (62%), Positives = 75/92 (82%), Gaps = 0/92 (0%)
 Frame = +2

Query  47   MAERVLTRVHSLRERLDATLTAHRNEILLFMSKIESHGKGILKPHQLLAEFEAICKEDQE  226
            M ER LTRVHS+RER+D TL AHRNEI+  +++IE  GKGIL+ HQ++AEFEAI ++ ++
Sbjct  1    MTERALTRVHSIRERVDETLKAHRNEIVALLTRIEGKGKGILQHHQIVAEFEAIPEDTRK  60

Query  227  KLNDHAFQQVLKSTQEAIVLPPWVALAIRLRP  322
             L   AF +VL+STQEAIV+PPW+ALA+R RP
Sbjct  61   TLAGGAFAEVLRSTQEAIVVPPWIALALRPRP  92


 Score =   115 bits (288),  Expect(2) = 8e-54, Method: Composition-based stats.
 Identities = 53/68 (78%), Positives = 57/68 (84%), Gaps = 0/68 (0%)
 Frame = +1

Query  322  GVWEYVTVNVHALXVEELTVPEYLQFKEELVDGPANGNFVLELDFEPFTASFPKPTLTKS  501
            GVWEY+ +NV AL VEEL V EYL FKEELVDG  NGNFVLELDFEPF ASFP+PTL+K 
Sbjct  93   GVWEYIRLNVQALVVEELRVAEYLHFKEELVDGGCNGNFVLELDFEPFNASFPRPTLSKY  152

Query  502  IGXGVEFL  525
            IG GVEFL
Sbjct  153  IGNGVEFL  160



>ref|XP_011010969.1| PREDICTED: sucrose synthase-like isoform X2 [Populus euphratica]
Length=805

 Score =   123 bits (308),  Expect(2) = 1e-53, Method: Compositional matrix adjust.
 Identities = 58/92 (63%), Positives = 76/92 (83%), Gaps = 0/92 (0%)
 Frame = +2

Query  47   MAERVLTRVHSLRERLDATLTAHRNEILLFMSKIESHGKGILKPHQLLAEFEAICKEDQE  226
            MAER LTRVHS+RER+D TL AHRNEI+  +++IE  GKGIL+ HQ++AEFEAI ++ ++
Sbjct  1    MAERALTRVHSIRERVDETLKAHRNEIVALLTRIEGKGKGILQHHQIVAEFEAIPEDTRK  60

Query  227  KLNDHAFQQVLKSTQEAIVLPPWVALAIRLRP  322
             L   AF +VL+STQEAIV+PPW+ALA+R RP
Sbjct  61   TLAGGAFAEVLRSTQEAIVVPPWIALALRPRP  92


 Score =   113 bits (283),  Expect(2) = 1e-53, Method: Composition-based stats.
 Identities = 52/68 (76%), Positives = 56/68 (82%), Gaps = 0/68 (0%)
 Frame = +1

Query  322  GVWEYVTVNVHALXVEELTVPEYLQFKEELVDGPANGNFVLELDFEPFTASFPKPTLTKS  501
            GVWEY+ +NV AL  EEL V EYL FKEELVDG  NGNFVLELDFEPF ASFP+PTL+K 
Sbjct  93   GVWEYIRLNVQALVAEELRVAEYLHFKEELVDGGCNGNFVLELDFEPFNASFPRPTLSKY  152

Query  502  IGXGVEFL  525
            IG GVEFL
Sbjct  153  IGNGVEFL  160



>gb|ADW80571.1| sucrose synthase 1 [Populus tomentosa]
Length=805

 Score =   122 bits (307),  Expect(2) = 1e-53, Method: Compositional matrix adjust.
 Identities = 58/92 (63%), Positives = 76/92 (83%), Gaps = 0/92 (0%)
 Frame = +2

Query  47   MAERVLTRVHSLRERLDATLTAHRNEILLFMSKIESHGKGILKPHQLLAEFEAICKEDQE  226
            MAER LTRVHS+RER+D TL AHRNEI+  +++IES GKGIL+ HQ++AEFEAI ++ ++
Sbjct  1    MAERALTRVHSIRERVDETLKAHRNEIVALLTRIESKGKGILQHHQIVAEFEAIPEDTRK  60

Query  227  KLNDHAFQQVLKSTQEAIVLPPWVALAIRLRP  322
             L   AF +VL+S QEAIV+PPW+ALA+R RP
Sbjct  61   TLAGGAFAEVLRSAQEAIVVPPWIALALRPRP  92


 Score =   114 bits (284),  Expect(2) = 1e-53, Method: Composition-based stats.
 Identities = 52/68 (76%), Positives = 57/68 (84%), Gaps = 0/68 (0%)
 Frame = +1

Query  322  GVWEYVTVNVHALXVEELTVPEYLQFKEELVDGPANGNFVLELDFEPFTASFPKPTLTKS  501
            GVWEY+ +NV AL VE+L V EYL FKEELVDG  NGNFVLELDFEPF ASFP+PTL+K 
Sbjct  93   GVWEYIRLNVQALVVEDLRVAEYLHFKEELVDGGCNGNFVLELDFEPFNASFPRPTLSKY  152

Query  502  IGXGVEFL  525
            IG GVEFL
Sbjct  153  IGNGVEFL  160



>gb|ADW80566.1| sucrose synthase 1 [Populus tomentosa]
Length=805

 Score =   122 bits (307),  Expect(2) = 1e-53, Method: Compositional matrix adjust.
 Identities = 58/92 (63%), Positives = 76/92 (83%), Gaps = 0/92 (0%)
 Frame = +2

Query  47   MAERVLTRVHSLRERLDATLTAHRNEILLFMSKIESHGKGILKPHQLLAEFEAICKEDQE  226
            MAER LTRVHS+RER+D TL AHRNEI+  +++IES GKGIL+ HQ++AEFEAI ++ ++
Sbjct  1    MAERALTRVHSIRERVDETLKAHRNEIVALLTRIESKGKGILQHHQIVAEFEAIPEDTRK  60

Query  227  KLNDHAFQQVLKSTQEAIVLPPWVALAIRLRP  322
             L   AF +VL+S QEAIV+PPW+ALA+R RP
Sbjct  61   TLAGGAFAEVLRSAQEAIVVPPWIALALRPRP  92


 Score =   114 bits (284),  Expect(2) = 1e-53, Method: Composition-based stats.
 Identities = 52/68 (76%), Positives = 57/68 (84%), Gaps = 0/68 (0%)
 Frame = +1

Query  322  GVWEYVTVNVHALXVEELTVPEYLQFKEELVDGPANGNFVLELDFEPFTASFPKPTLTKS  501
            GVWEY+ +NV AL VE+L V EYL FKEELVDG  NGNFVLELDFEPF ASFP+PTL+K 
Sbjct  93   GVWEYIRLNVQALVVEDLRVAEYLHFKEELVDGGCNGNFVLELDFEPFNASFPRPTLSKY  152

Query  502  IGXGVEFL  525
            IG GVEFL
Sbjct  153  IGNGVEFL  160



>ref|XP_010247458.1| PREDICTED: sucrose synthase [Nelumbo nucifera]
 ref|XP_010247459.1| PREDICTED: sucrose synthase [Nelumbo nucifera]
 ref|XP_010247460.1| PREDICTED: sucrose synthase [Nelumbo nucifera]
Length=806

 Score =   127 bits (320),  Expect(2) = 1e-53, Method: Compositional matrix adjust.
 Identities = 61/92 (66%), Positives = 73/92 (79%), Gaps = 0/92 (0%)
 Frame = +2

Query  47   MAERVLTRVHSLRERLDATLTAHRNEILLFMSKIESHGKGILKPHQLLAEFEAICKEDQE  226
            MAERVL RVHSLRERL  TL A RNE+L+ +S+IE HGKGI++PH LL E E I + D++
Sbjct  1    MAERVLARVHSLRERLGETLAAQRNELLILLSRIEGHGKGIMQPHHLLEELEKIPEGDRQ  60

Query  227  KLNDHAFQQVLKSTQEAIVLPPWVALAIRLRP  322
            KL D  F  V++STQEAIVLPPWVALA+R RP
Sbjct  61   KLVDGVFGDVIRSTQEAIVLPPWVALAVRPRP  92


 Score =   108 bits (271),  Expect(2) = 1e-53, Method: Composition-based stats.
 Identities = 50/68 (74%), Positives = 58/68 (85%), Gaps = 0/68 (0%)
 Frame = +1

Query  322  GVWEYVTVNVHALXVEELTVPEYLQFKEELVDGPANGNFVLELDFEPFTASFPKPTLTKS  501
            GVW+Y+ VN++AL VEELT  +YLQFKEELV+G +  NFVLELD EPFTASFPKPTL+K 
Sbjct  93   GVWDYIRVNINALVVEELTESQYLQFKEELVNGSSKENFVLELDLEPFTASFPKPTLSKF  152

Query  502  IGXGVEFL  525
            IG GVEFL
Sbjct  153  IGNGVEFL  160



>ref|XP_010535796.1| PREDICTED: sucrose synthase 4 [Tarenaya hassleriana]
Length=806

 Score =   126 bits (317),  Expect(2) = 2e-53, Method: Compositional matrix adjust.
 Identities = 60/92 (65%), Positives = 78/92 (85%), Gaps = 0/92 (0%)
 Frame = +2

Query  47   MAERVLTRVHSLRERLDATLTAHRNEILLFMSKIESHGKGILKPHQLLAEFEAICKEDQE  226
            MAERV+TRVHS RERLD TL+A RNE+L  +S++E+ GKGIL+ HQ++AEFEA+ +E ++
Sbjct  1    MAERVITRVHSQRERLDGTLSAQRNEVLSLLSRVEAKGKGILQHHQIIAEFEALPEETRK  60

Query  227  KLNDHAFQQVLKSTQEAIVLPPWVALAIRLRP  322
            KL   AF ++L+S+QEAIVLPPWVALAIR RP
Sbjct  61   KLEGSAFFEILRSSQEAIVLPPWVALAIRPRP  92


 Score =   109 bits (273),  Expect(2) = 2e-53, Method: Composition-based stats.
 Identities = 50/68 (74%), Positives = 56/68 (82%), Gaps = 0/68 (0%)
 Frame = +1

Query  322  GVWEYVTVNVHALXVEELTVPEYLQFKEELVDGPANGNFVLELDFEPFTASFPKPTLTKS  501
            GVWEY+ VN+HAL VEEL V EYL  KEELV+G  NG+F LELDFEPF ASFP+PTL+K 
Sbjct  93   GVWEYIRVNLHALVVEELLVSEYLHLKEELVNGSVNGSFPLELDFEPFNASFPRPTLSKY  152

Query  502  IGXGVEFL  525
            IG GVEFL
Sbjct  153  IGDGVEFL  160



>gb|ADW80562.1| sucrose synthase 1 [Populus tomentosa]
Length=805

 Score =   124 bits (312),  Expect(2) = 2e-53, Method: Compositional matrix adjust.
 Identities = 59/92 (64%), Positives = 77/92 (84%), Gaps = 0/92 (0%)
 Frame = +2

Query  47   MAERVLTRVHSLRERLDATLTAHRNEILLFMSKIESHGKGILKPHQLLAEFEAICKEDQE  226
            MAER LTRVHS+RER+D TL AHRNEI+  +++IES GKGIL+ HQ++AEFEAI ++ ++
Sbjct  1    MAERALTRVHSIRERVDETLKAHRNEIVALLTRIESKGKGILQHHQIVAEFEAIPEDTRK  60

Query  227  KLNDHAFQQVLKSTQEAIVLPPWVALAIRLRP  322
             L   AF +VL+STQEAIV+PPW+ALA+R RP
Sbjct  61   TLAGGAFAEVLRSTQEAIVVPPWIALALRPRP  92


 Score =   111 bits (278),  Expect(2) = 2e-53, Method: Composition-based stats.
 Identities = 51/68 (75%), Positives = 56/68 (82%), Gaps = 0/68 (0%)
 Frame = +1

Query  322  GVWEYVTVNVHALXVEELTVPEYLQFKEELVDGPANGNFVLELDFEPFTASFPKPTLTKS  501
            GVWEY+ +NV AL VE+L V EYL FKEELVDG  NG FVLELDFEPF ASFP+PTL+K 
Sbjct  93   GVWEYIRLNVQALVVEDLRVAEYLHFKEELVDGGCNGKFVLELDFEPFNASFPRPTLSKY  152

Query  502  IGXGVEFL  525
            IG GVEFL
Sbjct  153  IGNGVEFL  160



>gb|ADW80559.1| sucrose synthase 1 [Populus tomentosa]
Length=805

 Score =   124 bits (311),  Expect(2) = 2e-53, Method: Compositional matrix adjust.
 Identities = 59/92 (64%), Positives = 77/92 (84%), Gaps = 0/92 (0%)
 Frame = +2

Query  47   MAERVLTRVHSLRERLDATLTAHRNEILLFMSKIESHGKGILKPHQLLAEFEAICKEDQE  226
            MAER LTRVHS+RER+D TL AHRNEI+  +++IES GKGIL+ HQ++AEFEAI ++ ++
Sbjct  1    MAERALTRVHSIRERVDETLKAHRNEIVALLTRIESKGKGILQHHQIVAEFEAIPEDTRK  60

Query  227  KLNDHAFQQVLKSTQEAIVLPPWVALAIRLRP  322
             L   AF +VL+STQEAIV+PPW+ALA+R RP
Sbjct  61   TLAGGAFAEVLRSTQEAIVVPPWIALALRPRP  92


 Score =   111 bits (278),  Expect(2) = 2e-53, Method: Composition-based stats.
 Identities = 51/68 (75%), Positives = 56/68 (82%), Gaps = 0/68 (0%)
 Frame = +1

Query  322  GVWEYVTVNVHALXVEELTVPEYLQFKEELVDGPANGNFVLELDFEPFTASFPKPTLTKS  501
            GVWEY+ +NV AL VE+L V EYL FKEELVDG  NG FVLELDFEPF ASFP+PTL+K 
Sbjct  93   GVWEYIRLNVQALVVEDLRVAEYLHFKEELVDGGCNGKFVLELDFEPFNASFPRPTLSKY  152

Query  502  IGXGVEFL  525
            IG GVEFL
Sbjct  153  IGNGVEFL  160



>gb|AHA41509.1| sucrose synthase [Populus deltoides]
Length=805

 Score =   122 bits (305),  Expect(2) = 2e-53, Method: Compositional matrix adjust.
 Identities = 57/92 (62%), Positives = 75/92 (82%), Gaps = 0/92 (0%)
 Frame = +2

Query  47   MAERVLTRVHSLRERLDATLTAHRNEILLFMSKIESHGKGILKPHQLLAEFEAICKEDQE  226
            M ER LTRVHS+RER+D TL AHRNEI+  +++IE  GKGIL+ HQ++AEFEAI ++ ++
Sbjct  1    MTERALTRVHSIRERVDETLKAHRNEIVALLTRIEGKGKGILQHHQIVAEFEAIPEDTRK  60

Query  227  KLNDHAFQQVLKSTQEAIVLPPWVALAIRLRP  322
             L   AF +VL+STQEAIV+PPW+ALA+R RP
Sbjct  61   TLAGGAFAEVLRSTQEAIVVPPWIALALRPRP  92


 Score =   114 bits (284),  Expect(2) = 2e-53, Method: Composition-based stats.
 Identities = 52/68 (76%), Positives = 57/68 (84%), Gaps = 0/68 (0%)
 Frame = +1

Query  322  GVWEYVTVNVHALXVEELTVPEYLQFKEELVDGPANGNFVLELDFEPFTASFPKPTLTKS  501
            GVWEY+ +NV AL VEEL V EYL FKEELVDG +NGNFVLELDFEPF AS P+PTL+K 
Sbjct  93   GVWEYIRLNVQALVVEELRVAEYLHFKEELVDGGSNGNFVLELDFEPFNASLPRPTLSKY  152

Query  502  IGXGVEFL  525
            IG GVEFL
Sbjct  153  IGNGVEFL  160



>gb|ADW80551.1| sucrose synthase 1 [Populus tomentosa]
Length=805

 Score =   122 bits (306),  Expect(2) = 2e-53, Method: Compositional matrix adjust.
 Identities = 58/92 (63%), Positives = 76/92 (83%), Gaps = 0/92 (0%)
 Frame = +2

Query  47   MAERVLTRVHSLRERLDATLTAHRNEILLFMSKIESHGKGILKPHQLLAEFEAICKEDQE  226
            MAER LTRVHS+RER+D TL AHRNEI+  +++IES GKGIL+ HQ++AEFEAI ++ ++
Sbjct  1    MAERALTRVHSIRERVDETLKAHRNEIVALLTRIESKGKGILQHHQIVAEFEAIPEDTRK  60

Query  227  KLNDHAFQQVLKSTQEAIVLPPWVALAIRLRP  322
             L   AF +VL+S QEAIV+PPW+ALA+R RP
Sbjct  61   TLAGGAFAEVLRSAQEAIVVPPWIALALRPRP  92


 Score =   113 bits (282),  Expect(2) = 2e-53, Method: Composition-based stats.
 Identities = 52/68 (76%), Positives = 56/68 (82%), Gaps = 0/68 (0%)
 Frame = +1

Query  322  GVWEYVTVNVHALXVEELTVPEYLQFKEELVDGPANGNFVLELDFEPFTASFPKPTLTKS  501
            GVWEY+ +NV AL VEEL V EYL FKEELVDG  NG FVLELDFEPF ASFP+PTL+K 
Sbjct  93   GVWEYIRLNVQALVVEELRVAEYLHFKEELVDGGCNGKFVLELDFEPFNASFPRPTLSKY  152

Query  502  IGXGVEFL  525
            IG GVEFL
Sbjct  153  IGNGVEFL  160



>gb|AEV40464.1| sucrose synthase 5 [Gossypium arboreum]
Length=833

 Score =   130 bits (326),  Expect(2) = 3e-53, Method: Compositional matrix adjust.
 Identities = 61/92 (66%), Positives = 78/92 (85%), Gaps = 0/92 (0%)
 Frame = +2

Query  47   MAERVLTRVHSLRERLDATLTAHRNEILLFMSKIESHGKGILKPHQLLAEFEAICKEDQE  226
            MAERV+TRVHSLRERLD TL AHRNE+L  +++IE  GKGIL+ HQ++ EFEAI +E ++
Sbjct  1    MAERVITRVHSLRERLDDTLIAHRNEVLALLTRIEGKGKGILQHHQIILEFEAIPEETRK  60

Query  227  KLNDHAFQQVLKSTQEAIVLPPWVALAIRLRP  322
            KL D AF ++L+++QEAIVLPPWVALA+R RP
Sbjct  61   KLADGAFSEILRASQEAIVLPPWVALAVRPRP  92


 Score =   105 bits (261),  Expect(2) = 3e-53, Method: Compositional matrix adjust.
 Identities = 57/95 (60%), Positives = 60/95 (63%), Gaps = 27/95 (28%)
 Frame = +1

Query  322  GVWEYVTVNVHALXVEELTVPEYLQFKEELVDG---------------------------  420
            GVWEY+ VNVHAL VEELTV EYL FKEELVDG                           
Sbjct  93   GVWEYIKVNVHALVVEELTVAEYLHFKEELVDGRYLENCSFSVYFTRKCSFYHCFFDFSC  152

Query  421  PANGNFVLELDFEPFTASFPKPTLTKSIGXGVEFL  525
             ANGNFVLELDFEPF ASFP+ TL+KSIG GVEFL
Sbjct  153  SANGNFVLELDFEPFNASFPRSTLSKSIGNGVEFL  187



>gb|AAR03498.1| sucrose synthase [Populus tremuloides]
Length=805

 Score =   121 bits (304),  Expect(2) = 4e-53, Method: Compositional matrix adjust.
 Identities = 57/92 (62%), Positives = 76/92 (83%), Gaps = 0/92 (0%)
 Frame = +2

Query  47   MAERVLTRVHSLRERLDATLTAHRNEILLFMSKIESHGKGILKPHQLLAEFEAICKEDQE  226
            M ER LTRVHS+RE +D TL AHRNEI+  +++IES GKGIL+ HQ++AEFEAI +++++
Sbjct  1    MTERALTRVHSIREHVDETLKAHRNEIVALLTRIESKGKGILQHHQIVAEFEAIPEDNRK  60

Query  227  KLNDHAFQQVLKSTQEAIVLPPWVALAIRLRP  322
             L   AF +VL+STQEAIV+PPW+ALA+R RP
Sbjct  61   TLAGGAFAEVLRSTQEAIVVPPWIALALRPRP  92


 Score =   113 bits (282),  Expect(2) = 4e-53, Method: Composition-based stats.
 Identities = 51/68 (75%), Positives = 57/68 (84%), Gaps = 0/68 (0%)
 Frame = +1

Query  322  GVWEYVTVNVHALXVEELTVPEYLQFKEELVDGPANGNFVLELDFEPFTASFPKPTLTKS  501
            GVWEY+ +NV AL VE+L V EYL FKEELVDG  NGNFVLELDF+PF ASFP+PTL+K 
Sbjct  93   GVWEYIRLNVQALVVEDLRVAEYLHFKEELVDGGCNGNFVLELDFDPFNASFPRPTLSKD  152

Query  502  IGXGVEFL  525
            IG GVEFL
Sbjct  153  IGNGVEFL  160



>dbj|BAM05645.1| sucrose synthase 1, partial [Eucalyptus pilularis]
 dbj|BAM05646.1| sucrose synthase 1, partial [Eucalyptus pilularis]
 dbj|BAM05647.1| sucrose synthase 1, partial [Eucalyptus pyrocarpa]
Length=786

 Score =   117 bits (294),  Expect(2) = 4e-53, Method: Composition-based stats.
 Identities = 53/68 (78%), Positives = 59/68 (87%), Gaps = 0/68 (0%)
 Frame = +1

Query  322  GVWEYVTVNVHALXVEELTVPEYLQFKEELVDGPANGNFVLELDFEPFTASFPKPTLTKS  501
            GVWE++ VNVHAL +E+L V EYL FKEEL DG  NGNFVLELDFEPFTASFP+PTL+KS
Sbjct  83   GVWEHIRVNVHALVLEQLEVAEYLHFKEELADGSLNGNFVLELDFEPFTASFPRPTLSKS  142

Query  502  IGXGVEFL  525
            IG GVEFL
Sbjct  143  IGNGVEFL  150


 Score =   117 bits (292),  Expect(2) = 4e-53, Method: Compositional matrix adjust.
 Identities = 56/82 (68%), Positives = 69/82 (84%), Gaps = 0/82 (0%)
 Frame = +2

Query  77   SLRERLDATLTAHRNEILLFMSKIESHGKGILKPHQLLAEFEAICKEDQEKLNDHAFQQV  256
            SLRERLD TL+AHRN+I+ F+S++E+ GKGIL+ HQ+ AEFEAI +E + KL D AF +V
Sbjct  1    SLRERLDETLSAHRNDIVAFLSRVEAKGKGILQRHQIFAEFEAISEESRAKLLDGAFGEV  60

Query  257  LKSTQEAIVLPPWVALAIRLRP  322
            LKSTQEAIV PPWVALA+R RP
Sbjct  61   LKSTQEAIVSPPWVALAVRPRP  82



>gb|ADR81997.1| sucrose synthase 2 [Populus trichocarpa]
 gb|ADV71184.1| sucrose synthase 2 [Populus trichocarpa]
Length=803

 Score =   118 bits (295),  Expect(2) = 5e-53, Method: Composition-based stats.
 Identities = 55/68 (81%), Positives = 59/68 (87%), Gaps = 0/68 (0%)
 Frame = +1

Query  322  GVWEYVTVNVHALXVEELTVPEYLQFKEELVDGPANGNFVLELDFEPFTASFPKPTLTKS  501
            GVWEYV VNV AL VEEL V EYL FKEELVDG +NGNFVLELDFEPF+ASFP+PTL+K 
Sbjct  91   GVWEYVRVNVQALVVEELRVAEYLHFKEELVDGGSNGNFVLELDFEPFSASFPRPTLSKY  150

Query  502  IGXGVEFL  525
            IG GVEFL
Sbjct  151  IGNGVEFL  158


 Score =   116 bits (290),  Expect(2) = 5e-53, Method: Compositional matrix adjust.
 Identities = 57/88 (65%), Positives = 71/88 (81%), Gaps = 0/88 (0%)
 Frame = +2

Query  59   VLTRVHSLRERLDATLTAHRNEILLFMSKIESHGKGILKPHQLLAEFEAICKEDQEKLND  238
            VLTRV S+RERLD TL  HRNEI+  +++IE  GKGIL+ HQ++AEFEAI +E ++ L  
Sbjct  3    VLTRVQSIRERLDETLKTHRNEIVALLTRIEGKGKGILQHHQIIAEFEAIPEEIRKILAG  62

Query  239  HAFQQVLKSTQEAIVLPPWVALAIRLRP  322
             AF +VL+STQEAIVLPPWVALA+R RP
Sbjct  63   GAFSEVLRSTQEAIVLPPWVALAVRPRP  90



>ref|XP_011039917.1| PREDICTED: sucrose synthase [Populus euphratica]
Length=803

 Score =   117 bits (294),  Expect(2) = 7e-53, Method: Composition-based stats.
 Identities = 54/68 (79%), Positives = 59/68 (87%), Gaps = 0/68 (0%)
 Frame = +1

Query  322  GVWEYVTVNVHALXVEELTVPEYLQFKEELVDGPANGNFVLELDFEPFTASFPKPTLTKS  501
            GVWEY+ VNV AL VEEL V EYL FKEELVDG +NGNFVLELDFEPF+ASFP+PTL+K 
Sbjct  91   GVWEYIRVNVQALVVEELRVAEYLHFKEELVDGGSNGNFVLELDFEPFSASFPRPTLSKY  150

Query  502  IGXGVEFL  525
            IG GVEFL
Sbjct  151  IGNGVEFL  158


 Score =   116 bits (290),  Expect(2) = 7e-53, Method: Compositional matrix adjust.
 Identities = 57/88 (65%), Positives = 71/88 (81%), Gaps = 0/88 (0%)
 Frame = +2

Query  59   VLTRVHSLRERLDATLTAHRNEILLFMSKIESHGKGILKPHQLLAEFEAICKEDQEKLND  238
            VLTRV S+RERLD TL  HRNEI+  +++IE  GKGIL+ HQ++AEFEAI +E ++ L  
Sbjct  3    VLTRVQSIRERLDETLKTHRNEIVALLTRIEGKGKGILQHHQIIAEFEAIPEEIRKILAG  62

Query  239  HAFQQVLKSTQEAIVLPPWVALAIRLRP  322
             AF +VL+STQEAIVLPPWVALA+R RP
Sbjct  63   GAFSEVLRSTQEAIVLPPWVALAVRPRP  90



>gb|AAR19769.1| sucrose synthase [Beta vulgaris]
Length=805

 Score =   119 bits (299),  Expect(2) = 8e-53, Method: Compositional matrix adjust.
 Identities = 60/92 (65%), Positives = 73/92 (79%), Gaps = 3/92 (3%)
 Frame = +2

Query  47   MAERVLTRVHSLRERLDATLTAHRNEILLFMSKIESHGKGILKPHQLLAEFEAICKEDQE  226
            MA R LTRV SL+ERLD TLTA RNEI+ F+SKI SHGKGIL+PH++L+EFEA+   D+ 
Sbjct  1    MASR-LTRVPSLKERLDETLTAQRNEIISFLSKIASHGKGILQPHEVLSEFEAVA--DKH  57

Query  227  KLNDHAFQQVLKSTQEAIVLPPWVALAIRLRP  322
            KL D  F +VL+ TQE IVLPPW+ LA+R RP
Sbjct  58   KLADGPFGEVLRHTQETIVLPPWITLAVRPRP  89


 Score =   114 bits (285),  Expect(2) = 8e-53, Method: Composition-based stats.
 Identities = 52/68 (76%), Positives = 58/68 (85%), Gaps = 0/68 (0%)
 Frame = +1

Query  322  GVWEYVTVNVHALXVEELTVPEYLQFKEELVDGPANGNFVLELDFEPFTASFPKPTLTKS  501
            G+WEY+ VNV AL VEELT  ++L  KEELVDG  NGNFVLELDFEPFTASFP+PTL+KS
Sbjct  90   GIWEYIRVNVDALAVEELTPSQFLHVKEELVDGSTNGNFVLELDFEPFTASFPRPTLSKS  149

Query  502  IGXGVEFL  525
            IG GVEFL
Sbjct  150  IGNGVEFL  157



>gb|ADW80579.1| sucrose synthase 2 [Populus tomentosa]
Length=803

 Score =   117 bits (294),  Expect(2) = 1e-52, Method: Composition-based stats.
 Identities = 55/68 (81%), Positives = 59/68 (87%), Gaps = 0/68 (0%)
 Frame = +1

Query  322  GVWEYVTVNVHALXVEELTVPEYLQFKEELVDGPANGNFVLELDFEPFTASFPKPTLTKS  501
            GVWEYV VNV AL VEEL V EYL FKEELVDG +NGNFVLELDFEPF+ASFP+PTL+K 
Sbjct  91   GVWEYVRVNVQALVVEELRVAEYLHFKEELVDGGSNGNFVLELDFEPFSASFPRPTLSKY  150

Query  502  IGXGVEFL  525
            IG GVEFL
Sbjct  151  IGNGVEFL  158


 Score =   115 bits (289),  Expect(2) = 1e-52, Method: Compositional matrix adjust.
 Identities = 56/87 (64%), Positives = 70/87 (80%), Gaps = 0/87 (0%)
 Frame = +2

Query  62   LTRVHSLRERLDATLTAHRNEILLFMSKIESHGKGILKPHQLLAEFEAICKEDQEKLNDH  241
            LTRV S+RERLD TL  HRNEI+  +++IE  GKGIL+ HQ++AEFEAI +E ++ L   
Sbjct  4    LTRVQSIRERLDETLKTHRNEIVALLTRIEGKGKGILQHHQIIAEFEAIPEEIRKTLAGG  63

Query  242  AFQQVLKSTQEAIVLPPWVALAIRLRP  322
            AF +VL+STQEAIVLPPWVALA+R RP
Sbjct  64   AFSEVLRSTQEAIVLPPWVALAVRPRP  90



>gb|ADW80586.1| sucrose synthase 2 [Populus tomentosa]
Length=803

 Score =   118 bits (295),  Expect(2) = 1e-52, Method: Composition-based stats.
 Identities = 55/68 (81%), Positives = 59/68 (87%), Gaps = 0/68 (0%)
 Frame = +1

Query  322  GVWEYVTVNVHALXVEELTVPEYLQFKEELVDGPANGNFVLELDFEPFTASFPKPTLTKS  501
            GVWEYV VNV AL VEEL V EYL FKEELVDG +NGNFVLELDFEPF+ASFP+PTL+K 
Sbjct  91   GVWEYVRVNVQALVVEELRVAEYLHFKEELVDGGSNGNFVLELDFEPFSASFPRPTLSKY  150

Query  502  IGXGVEFL  525
            IG GVEFL
Sbjct  151  IGNGVEFL  158


 Score =   115 bits (287),  Expect(2) = 1e-52, Method: Compositional matrix adjust.
 Identities = 56/87 (64%), Positives = 70/87 (80%), Gaps = 0/87 (0%)
 Frame = +2

Query  62   LTRVHSLRERLDATLTAHRNEILLFMSKIESHGKGILKPHQLLAEFEAICKEDQEKLNDH  241
            LTRV S+RERLD TL  HRNEI+  +++IE  GKGIL+ HQ++AEFEAI +E ++ L   
Sbjct  4    LTRVQSIRERLDETLKTHRNEIVALLTRIEGKGKGILQRHQIIAEFEAIPEEIRKILAGG  63

Query  242  AFQQVLKSTQEAIVLPPWVALAIRLRP  322
            AF +VL+STQEAIVLPPWVALA+R RP
Sbjct  64   AFSEVLRSTQEAIVLPPWVALAVRPRP  90



>gb|ADW80593.1| sucrose synthase 2 [Populus tomentosa]
Length=803

 Score =   118 bits (295),  Expect(2) = 1e-52, Method: Composition-based stats.
 Identities = 55/68 (81%), Positives = 59/68 (87%), Gaps = 0/68 (0%)
 Frame = +1

Query  322  GVWEYVTVNVHALXVEELTVPEYLQFKEELVDGPANGNFVLELDFEPFTASFPKPTLTKS  501
            GVWEYV VNV AL VEEL V EYL FKEELVDG +NGNFVLELDFEPF+ASFP+PTL+K 
Sbjct  91   GVWEYVRVNVQALVVEELRVAEYLHFKEELVDGGSNGNFVLELDFEPFSASFPRPTLSKY  150

Query  502  IGXGVEFL  525
            IG GVEFL
Sbjct  151  IGNGVEFL  158


 Score =   115 bits (287),  Expect(2) = 1e-52, Method: Compositional matrix adjust.
 Identities = 56/87 (64%), Positives = 70/87 (80%), Gaps = 0/87 (0%)
 Frame = +2

Query  62   LTRVHSLRERLDATLTAHRNEILLFMSKIESHGKGILKPHQLLAEFEAICKEDQEKLNDH  241
            LTRV S+RERLD TL  HRNEI+  +++IE  GKGIL+ HQ++AEFEAI +E ++ L   
Sbjct  4    LTRVQSIRERLDETLKTHRNEIVALLTRIEGKGKGILQHHQIIAEFEAIPEEIRKILAGG  63

Query  242  AFQQVLKSTQEAIVLPPWVALAIRLRP  322
            AF +VL+STQEAIVLPPWVALA+R RP
Sbjct  64   AFSEVLRSTQEAIVLPPWVALAVRPRP  90



>gb|ADW80587.1| sucrose synthase 2 [Populus tomentosa]
Length=803

 Score =   118 bits (295),  Expect(2) = 1e-52, Method: Composition-based stats.
 Identities = 55/68 (81%), Positives = 59/68 (87%), Gaps = 0/68 (0%)
 Frame = +1

Query  322  GVWEYVTVNVHALXVEELTVPEYLQFKEELVDGPANGNFVLELDFEPFTASFPKPTLTKS  501
            GVWEYV VNV AL VEEL V EYL FKEELVDG +NGNFVLELDFEPF+ASFP+PTL+K 
Sbjct  91   GVWEYVRVNVQALVVEELRVAEYLHFKEELVDGGSNGNFVLELDFEPFSASFPRPTLSKY  150

Query  502  IGXGVEFL  525
            IG GVEFL
Sbjct  151  IGNGVEFL  158


 Score =   115 bits (287),  Expect(2) = 1e-52, Method: Compositional matrix adjust.
 Identities = 56/87 (64%), Positives = 70/87 (80%), Gaps = 0/87 (0%)
 Frame = +2

Query  62   LTRVHSLRERLDATLTAHRNEILLFMSKIESHGKGILKPHQLLAEFEAICKEDQEKLNDH  241
            LTRV S+RERLD TL  HRNEI+  +++IE  GKGIL+ HQ++AEFEAI +E ++ L   
Sbjct  4    LTRVQSIRERLDETLKTHRNEIVALLTRIEGKGKGILQRHQIIAEFEAIPEEIRKILAGG  63

Query  242  AFQQVLKSTQEAIVLPPWVALAIRLRP  322
            AF +VL+STQEAIVLPPWVALA+R RP
Sbjct  64   AFSEVLRSTQEAIVLPPWVALAVRPRP  90



>gb|ADW80601.1| sucrose synthase 2 [Populus tomentosa]
Length=803

 Score =   118 bits (295),  Expect(2) = 1e-52, Method: Composition-based stats.
 Identities = 55/68 (81%), Positives = 59/68 (87%), Gaps = 0/68 (0%)
 Frame = +1

Query  322  GVWEYVTVNVHALXVEELTVPEYLQFKEELVDGPANGNFVLELDFEPFTASFPKPTLTKS  501
            GVWEYV VNV AL VEEL V EYL FKEELVDG +NGNFVLELDFEPF+ASFP+PTL+K 
Sbjct  91   GVWEYVRVNVQALVVEELRVAEYLHFKEELVDGGSNGNFVLELDFEPFSASFPRPTLSKY  150

Query  502  IGXGVEFL  525
            IG GVEFL
Sbjct  151  IGNGVEFL  158


 Score =   114 bits (286),  Expect(2) = 1e-52, Method: Compositional matrix adjust.
 Identities = 56/87 (64%), Positives = 70/87 (80%), Gaps = 0/87 (0%)
 Frame = +2

Query  62   LTRVHSLRERLDATLTAHRNEILLFMSKIESHGKGILKPHQLLAEFEAICKEDQEKLNDH  241
            LTRV S+RERLD TL  HRNEI+  +++IE  GKGIL+ HQ++AEFEAI +E ++ L   
Sbjct  4    LTRVQSIRERLDETLKTHRNEIVALLTRIEGKGKGILQHHQIIAEFEAIPEEIRKILAGG  63

Query  242  AFQQVLKSTQEAIVLPPWVALAIRLRP  322
            AF +VL+STQEAIVLPPWVALA+R RP
Sbjct  64   AFSEVLRSTQEAIVLPPWVALAVRPRP  90



>gb|ADW80585.1| sucrose synthase 2 [Populus tomentosa]
Length=803

 Score =   118 bits (295),  Expect(2) = 1e-52, Method: Composition-based stats.
 Identities = 55/68 (81%), Positives = 59/68 (87%), Gaps = 0/68 (0%)
 Frame = +1

Query  322  GVWEYVTVNVHALXVEELTVPEYLQFKEELVDGPANGNFVLELDFEPFTASFPKPTLTKS  501
            GVWEYV VNV AL VEEL V EYL FKEELVDG +NGNFVLELDFEPF+ASFP+PTL+K 
Sbjct  91   GVWEYVRVNVQALVVEELRVAEYLHFKEELVDGGSNGNFVLELDFEPFSASFPRPTLSKY  150

Query  502  IGXGVEFL  525
            IG GVEFL
Sbjct  151  IGNGVEFL  158


 Score =   114 bits (286),  Expect(2) = 1e-52, Method: Compositional matrix adjust.
 Identities = 56/87 (64%), Positives = 70/87 (80%), Gaps = 0/87 (0%)
 Frame = +2

Query  62   LTRVHSLRERLDATLTAHRNEILLFMSKIESHGKGILKPHQLLAEFEAICKEDQEKLNDH  241
            LTRV S+RERLD TL  HRNEI+  +++IE  GKGIL+ HQ++AEFEAI +E ++ L   
Sbjct  4    LTRVQSIRERLDETLKTHRNEIVALLTRIEGKGKGILQHHQIIAEFEAIPEEIRKILAGG  63

Query  242  AFQQVLKSTQEAIVLPPWVALAIRLRP  322
            AF +VL+STQEAIVLPPWVALA+R RP
Sbjct  64   AFSEVLRSTQEAIVLPPWVALAVRPRP  90



>sp|Q41607.1|SUS2_TULGE RecName: Full=Sucrose synthase 2; AltName: Full=Sucrose-UDP glucosyltransferase 
2 [Tulipa gesneriana]
 emb|CAA65640.1| sucrose-synthase 21 [Tulipa gesneriana]
Length=820

 Score =   119 bits (299),  Expect(2) = 2e-52, Method: Composition-based stats.
 Identities = 56/93 (60%), Positives = 72/93 (77%), Gaps = 1/93 (1%)
 Frame = +2

Query  47   MAERVLTRVHSLRERLDATLTAHRNEILLFMSKIESHGKGILKPHQLLAEFEAIC-KEDQ  223
            MA+R +TRVHS+RERL  TL+AH+NE+L   S+    G+G+L+PHQLL E+EA+    D+
Sbjct  1    MADRAMTRVHSVRERLTDTLSAHKNELLALFSRFVKQGQGMLQPHQLLTEYEAVIPAADR  60

Query  224  EKLNDHAFQQVLKSTQEAIVLPPWVALAIRLRP  322
            EKL D  F+ VLK+ QEAIV+PPWVALAIR RP
Sbjct  61   EKLKDGVFEDVLKAAQEAIVIPPWVALAIRPRP  93


 Score =   113 bits (282),  Expect(2) = 2e-52, Method: Compositional matrix adjust.
 Identities = 53/68 (78%), Positives = 57/68 (84%), Gaps = 0/68 (0%)
 Frame = +1

Query  322  GVWEYVTVNVHALXVEELTVPEYLQFKEELVDGPANGNFVLELDFEPFTASFPKPTLTKS  501
            GVWEYV VNV  L VEELTVPEYLQFKEELVDG    NF LELDFEPF ASFP+P+L+KS
Sbjct  94   GVWEYVRVNVSELAVEELTVPEYLQFKEELVDGSGQSNFTLELDFEPFNASFPRPSLSKS  153

Query  502  IGXGVEFL  525
            IG GV+FL
Sbjct  154  IGNGVQFL  161



>gb|ADW80589.1| sucrose synthase 2 [Populus tomentosa]
Length=803

 Score =   118 bits (295),  Expect(2) = 2e-52, Method: Composition-based stats.
 Identities = 55/68 (81%), Positives = 59/68 (87%), Gaps = 0/68 (0%)
 Frame = +1

Query  322  GVWEYVTVNVHALXVEELTVPEYLQFKEELVDGPANGNFVLELDFEPFTASFPKPTLTKS  501
            GVWEYV VNV AL VEEL V EYL FKEELVDG +NGNFVLELDFEPF+ASFP+PTL+K 
Sbjct  91   GVWEYVRVNVQALVVEELRVAEYLHFKEELVDGGSNGNFVLELDFEPFSASFPRPTLSKY  150

Query  502  IGXGVEFL  525
            IG GVEFL
Sbjct  151  IGNGVEFL  158


 Score =   114 bits (286),  Expect(2) = 2e-52, Method: Compositional matrix adjust.
 Identities = 56/87 (64%), Positives = 70/87 (80%), Gaps = 0/87 (0%)
 Frame = +2

Query  62   LTRVHSLRERLDATLTAHRNEILLFMSKIESHGKGILKPHQLLAEFEAICKEDQEKLNDH  241
            LTRV S+RERLD TL  HRNEI+  +++IE  GKGIL+ HQ++AEFEAI +E ++ L   
Sbjct  4    LTRVQSIRERLDETLKTHRNEIVALLTRIEGKGKGILQHHQIIAEFEAIPEEIRKILAGG  63

Query  242  AFQQVLKSTQEAIVLPPWVALAIRLRP  322
            AF +VL+STQEAIVLPPWVALA+R RP
Sbjct  64   AFSEVLRSTQEAIVLPPWVALAVRPRP  90



>gb|AGM14948.1| sucrose synthase 3 [Hevea brasiliensis]
Length=810

 Score =   123 bits (309),  Expect(2) = 2e-52, Method: Compositional matrix adjust.
 Identities = 60/92 (65%), Positives = 75/92 (82%), Gaps = 0/92 (0%)
 Frame = +2

Query  47   MAERVLTRVHSLRERLDATLTAHRNEILLFMSKIESHGKGILKPHQLLAEFEAICKEDQE  226
            MAERV+TRVHS RERLD TL+AHRNEI+  +S+IE  GKGIL+ H ++AEFEAI +E+++
Sbjct  1    MAERVITRVHSFRERLDETLSAHRNEIVALLSRIEGKGKGILQHHHIIAEFEAIPEENRK  60

Query  227  KLNDHAFQQVLKSTQEAIVLPPWVALAIRLRP  322
            KL D  F +VL+S QEAIVLPP VA A+R RP
Sbjct  61   KLLDSVFGEVLRSAQEAIVLPPCVAFAVRPRP  92


 Score =   109 bits (272),  Expect(2) = 2e-52, Method: Compositional matrix adjust.
 Identities = 54/72 (75%), Positives = 58/72 (81%), Gaps = 4/72 (6%)
 Frame = +1

Query  322  GVWEYVTVNVHALXVEELTVPEYLQFKEELVDGPANGN----FVLELDFEPFTASFPKPT  489
            GVWEY+ VNVHAL VEEL V EYL FKEELV+G  NGN    FVLELDFEPF ASFP+PT
Sbjct  93   GVWEYIRVNVHALVVEELRVAEYLHFKEELVNGSVNGNVNGKFVLELDFEPFNASFPRPT  152

Query  490  LTKSIGXGVEFL  525
            L+K IG GVEFL
Sbjct  153  LSKYIGNGVEFL  164



>gb|ADW80588.1| sucrose synthase 2 [Populus tomentosa]
Length=803

 Score =   118 bits (295),  Expect(2) = 2e-52, Method: Composition-based stats.
 Identities = 55/68 (81%), Positives = 59/68 (87%), Gaps = 0/68 (0%)
 Frame = +1

Query  322  GVWEYVTVNVHALXVEELTVPEYLQFKEELVDGPANGNFVLELDFEPFTASFPKPTLTKS  501
            GVWEYV VNV AL VEEL V EYL FKEELVDG +NGNFVLELDFEPF+ASFP+PTL+K 
Sbjct  91   GVWEYVRVNVQALVVEELRVAEYLHFKEELVDGGSNGNFVLELDFEPFSASFPRPTLSKY  150

Query  502  IGXGVEFL  525
            IG GVEFL
Sbjct  151  IGNGVEFL  158


 Score =   114 bits (286),  Expect(2) = 2e-52, Method: Compositional matrix adjust.
 Identities = 56/87 (64%), Positives = 70/87 (80%), Gaps = 0/87 (0%)
 Frame = +2

Query  62   LTRVHSLRERLDATLTAHRNEILLFMSKIESHGKGILKPHQLLAEFEAICKEDQEKLNDH  241
            LTRV S+RERLD TL  HRNEI+  +++IE  GKGIL+ HQ++AEFEAI +E ++ L   
Sbjct  4    LTRVQSIRERLDETLKTHRNEIVALLTRIEGKGKGILQHHQIIAEFEAIPEEIRKILAGG  63

Query  242  AFQQVLKSTQEAIVLPPWVALAIRLRP  322
            AF +VL+STQEAIVLPPWVALA+R RP
Sbjct  64   AFSEVLRSTQEAIVLPPWVALAVRPRP  90



>gb|ADW80565.1| sucrose synthase 1 [Populus tomentosa]
Length=805

 Score =   118 bits (296),  Expect(2) = 2e-52, Method: Compositional matrix adjust.
 Identities = 58/92 (63%), Positives = 76/92 (83%), Gaps = 0/92 (0%)
 Frame = +2

Query  47   MAERVLTRVHSLRERLDATLTAHRNEILLFMSKIESHGKGILKPHQLLAEFEAICKEDQE  226
            MAER LTRVHS+RER+D TL AHRNEI+  +++IES GKGIL+ HQ++AEFEAI ++ ++
Sbjct  1    MAERALTRVHSIRERVDETLKAHRNEIVALLTRIESKGKGILQHHQIVAEFEAIPEDTRK  60

Query  227  KLNDHAFQQVLKSTQEAIVLPPWVALAIRLRP  322
             L   AF +VL+STQEAIV+PP +ALA+R RP
Sbjct  61   TLAGGAFAEVLRSTQEAIVVPPRIALALRPRP  92


 Score =   114 bits (284),  Expect(2) = 2e-52, Method: Composition-based stats.
 Identities = 52/68 (76%), Positives = 57/68 (84%), Gaps = 0/68 (0%)
 Frame = +1

Query  322  GVWEYVTVNVHALXVEELTVPEYLQFKEELVDGPANGNFVLELDFEPFTASFPKPTLTKS  501
            GVWEY+ +NV AL VE+L V EYL FKEELVDG  NGNFVLELDFEPF ASFP+PTL+K 
Sbjct  93   GVWEYIRLNVQALVVEDLRVAEYLHFKEELVDGGCNGNFVLELDFEPFNASFPRPTLSKY  152

Query  502  IGXGVEFL  525
            IG GVEFL
Sbjct  153  IGNGVEFL  160



>dbj|BAM05648.1| sucrose synthase 1, partial [Eucalyptus globulus subsp. globulus]
Length=786

 Score =   118 bits (295),  Expect(2) = 2e-52, Method: Composition-based stats.
 Identities = 53/68 (78%), Positives = 59/68 (87%), Gaps = 0/68 (0%)
 Frame = +1

Query  322  GVWEYVTVNVHALXVEELTVPEYLQFKEELVDGPANGNFVLELDFEPFTASFPKPTLTKS  501
            GVWE++ VNVHAL +E+L V EYL FKEEL DG  NGNFVLELDFEPFTASFP+PTL+KS
Sbjct  83   GVWEHIRVNVHALVLEQLEVAEYLHFKEELADGSLNGNFVLELDFEPFTASFPRPTLSKS  142

Query  502  IGXGVEFL  525
            IG GVEFL
Sbjct  143  IGNGVEFL  150


 Score =   114 bits (286),  Expect(2) = 2e-52, Method: Compositional matrix adjust.
 Identities = 55/82 (67%), Positives = 69/82 (84%), Gaps = 0/82 (0%)
 Frame = +2

Query  77   SLRERLDATLTAHRNEILLFMSKIESHGKGILKPHQLLAEFEAICKEDQEKLNDHAFQQV  256
            SLRERLD TL+A+RN+I+ F+S++E+ GKGIL+ HQ+ AEFEAI +E + KL D AF +V
Sbjct  1    SLRERLDETLSANRNDIVAFLSRVEAKGKGILQRHQIFAEFEAISEESRAKLLDGAFGEV  60

Query  257  LKSTQEAIVLPPWVALAIRLRP  322
            LKSTQEAIV PPWVALA+R RP
Sbjct  61   LKSTQEAIVSPPWVALAVRPRP  82



>gb|ADW80610.1| sucrose synthase 2 [Populus tomentosa]
Length=803

 Score =   118 bits (295),  Expect(2) = 2e-52, Method: Composition-based stats.
 Identities = 55/68 (81%), Positives = 59/68 (87%), Gaps = 0/68 (0%)
 Frame = +1

Query  322  GVWEYVTVNVHALXVEELTVPEYLQFKEELVDGPANGNFVLELDFEPFTASFPKPTLTKS  501
            GVWEYV VNV AL VEEL V EYL FKEELVDG +NGNFVLELDFEPF+ASFP+PTL+K 
Sbjct  91   GVWEYVRVNVQALVVEELRVAEYLHFKEELVDGGSNGNFVLELDFEPFSASFPRPTLSKY  150

Query  502  IGXGVEFL  525
            IG GVEFL
Sbjct  151  IGNGVEFL  158


 Score =   114 bits (286),  Expect(2) = 2e-52, Method: Compositional matrix adjust.
 Identities = 56/87 (64%), Positives = 70/87 (80%), Gaps = 0/87 (0%)
 Frame = +2

Query  62   LTRVHSLRERLDATLTAHRNEILLFMSKIESHGKGILKPHQLLAEFEAICKEDQEKLNDH  241
            LTRV S+RERLD TL  HRNEI+  +++IE  GKGIL+ HQ++AEFEAI +E ++ L   
Sbjct  4    LTRVQSIRERLDETLKTHRNEIVALLTRIEGKGKGILQHHQIIAEFEAIPEEIRKILAGG  63

Query  242  AFQQVLKSTQEAIVLPPWVALAIRLRP  322
            AF +VL+STQEAIVLPPWVALA+R RP
Sbjct  64   AFSEVLRSTQEAIVLPPWVALAVRPRP  90



>gb|ADW80595.1| sucrose synthase 2 [Populus tomentosa]
Length=803

 Score =   118 bits (295),  Expect(2) = 2e-52, Method: Composition-based stats.
 Identities = 55/68 (81%), Positives = 59/68 (87%), Gaps = 0/68 (0%)
 Frame = +1

Query  322  GVWEYVTVNVHALXVEELTVPEYLQFKEELVDGPANGNFVLELDFEPFTASFPKPTLTKS  501
            GVWEYV VNV AL VEEL V EYL FKEELVDG +NGNFVLELDFEPF+ASFP+PTL+K 
Sbjct  91   GVWEYVRVNVQALVVEELRVAEYLHFKEELVDGGSNGNFVLELDFEPFSASFPRPTLSKY  150

Query  502  IGXGVEFL  525
            IG GVEFL
Sbjct  151  IGNGVEFL  158


 Score =   114 bits (286),  Expect(2) = 2e-52, Method: Compositional matrix adjust.
 Identities = 56/87 (64%), Positives = 70/87 (80%), Gaps = 0/87 (0%)
 Frame = +2

Query  62   LTRVHSLRERLDATLTAHRNEILLFMSKIESHGKGILKPHQLLAEFEAICKEDQEKLNDH  241
            LTRV S+RERLD TL  HRNEI+  +++IE  GKGIL+ HQ++AEFEAI +E ++ L   
Sbjct  4    LTRVQSIRERLDETLKTHRNEIVALLTRIEGKGKGILQHHQIIAEFEAIPEEIRKILAGG  63

Query  242  AFQQVLKSTQEAIVLPPWVALAIRLRP  322
            AF +VL+STQEAIVLPPWVALA+R RP
Sbjct  64   AFSEVLRSTQEAIVLPPWVALAVRPRP  90



>gb|ADW80599.1| sucrose synthase 2 [Populus tomentosa]
Length=803

 Score =   117 bits (294),  Expect(2) = 2e-52, Method: Composition-based stats.
 Identities = 55/68 (81%), Positives = 59/68 (87%), Gaps = 0/68 (0%)
 Frame = +1

Query  322  GVWEYVTVNVHALXVEELTVPEYLQFKEELVDGPANGNFVLELDFEPFTASFPKPTLTKS  501
            GVWEYV VNV AL VEEL V EYL FKEELVDG +NGNFVLELDFEPF+ASFP+PTL+K 
Sbjct  91   GVWEYVRVNVQALVVEELRVAEYLHFKEELVDGGSNGNFVLELDFEPFSASFPRPTLSKY  150

Query  502  IGXGVEFL  525
            IG GVEFL
Sbjct  151  IGNGVEFL  158


 Score =   114 bits (286),  Expect(2) = 2e-52, Method: Compositional matrix adjust.
 Identities = 56/87 (64%), Positives = 70/87 (80%), Gaps = 0/87 (0%)
 Frame = +2

Query  62   LTRVHSLRERLDATLTAHRNEILLFMSKIESHGKGILKPHQLLAEFEAICKEDQEKLNDH  241
            LTRV S+RERLD TL  HRNEI+  +++IE  GKGIL+ HQ++AEFEAI +E ++ L   
Sbjct  4    LTRVQSIRERLDETLKTHRNEIVALLTRIEGKGKGILQHHQIIAEFEAIPEEIRKILAGG  63

Query  242  AFQQVLKSTQEAIVLPPWVALAIRLRP  322
            AF +VL+STQEAIVLPPWVALA+R RP
Sbjct  64   AFSEVLRSTQEAIVLPPWVALAVRPRP  90



>gb|ADW80592.1| sucrose synthase 2 [Populus tomentosa]
Length=803

 Score =   117 bits (294),  Expect(2) = 2e-52, Method: Composition-based stats.
 Identities = 55/68 (81%), Positives = 59/68 (87%), Gaps = 0/68 (0%)
 Frame = +1

Query  322  GVWEYVTVNVHALXVEELTVPEYLQFKEELVDGPANGNFVLELDFEPFTASFPKPTLTKS  501
            GVWEYV VNV AL VEEL V EYL FKEELVDG +NGNFVLELDFEPF+ASFP+PTL+K 
Sbjct  91   GVWEYVRVNVQALVVEELRVAEYLHFKEELVDGGSNGNFVLELDFEPFSASFPRPTLSKY  150

Query  502  IGXGVEFL  525
            IG GVEFL
Sbjct  151  IGNGVEFL  158


 Score =   114 bits (286),  Expect(2) = 2e-52, Method: Compositional matrix adjust.
 Identities = 56/87 (64%), Positives = 70/87 (80%), Gaps = 0/87 (0%)
 Frame = +2

Query  62   LTRVHSLRERLDATLTAHRNEILLFMSKIESHGKGILKPHQLLAEFEAICKEDQEKLNDH  241
            LTRV S+RERLD TL  HRNEI+  +++IE  GKGIL+ HQ++AEFEAI +E ++ L   
Sbjct  4    LTRVQSIRERLDETLKTHRNEIVALLTRIEGKGKGILQHHQIIAEFEAIPEEIRKILAGG  63

Query  242  AFQQVLKSTQEAIVLPPWVALAIRLRP  322
            AF +VL+STQEAIVLPPWVALA+R RP
Sbjct  64   AFSEVLRSTQEAIVLPPWVALAVRPRP  90



>gb|ADW80556.1| sucrose synthase 1 [Populus tomentosa]
Length=805

 Score =   118 bits (296),  Expect(2) = 2e-52, Method: Compositional matrix adjust.
 Identities = 58/92 (63%), Positives = 76/92 (83%), Gaps = 0/92 (0%)
 Frame = +2

Query  47   MAERVLTRVHSLRERLDATLTAHRNEILLFMSKIESHGKGILKPHQLLAEFEAICKEDQE  226
            MAER LTRVHS+RER+D TL AHRNEI+  +++IES GKGIL+ HQ++AEFEAI ++ ++
Sbjct  1    MAERALTRVHSIRERVDETLKAHRNEIVALLTRIESKGKGILQHHQIVAEFEAIPEDTRK  60

Query  227  KLNDHAFQQVLKSTQEAIVLPPWVALAIRLRP  322
             L   AF +VL+STQEAIV+PP +ALA+R RP
Sbjct  61   TLAGGAFAEVLRSTQEAIVVPPRIALALRPRP  92


 Score =   114 bits (284),  Expect(2) = 2e-52, Method: Composition-based stats.
 Identities = 52/68 (76%), Positives = 57/68 (84%), Gaps = 0/68 (0%)
 Frame = +1

Query  322  GVWEYVTVNVHALXVEELTVPEYLQFKEELVDGPANGNFVLELDFEPFTASFPKPTLTKS  501
            GVWEY+ +NV AL VE+L V EYL FKEELVDG  NGNFVLELDFEPF ASFP+PTL+K 
Sbjct  93   GVWEYIRLNVQALVVEDLRVAEYLHFKEELVDGGCNGNFVLELDFEPFNASFPRPTLSKY  152

Query  502  IGXGVEFL  525
            IG GVEFL
Sbjct  153  IGNGVEFL  160



>gb|ADV71182.1| sucrose synthase 2 [Populus tomentosa]
 gb|ADW80572.1| sucrose synthase 2 [Populus tomentosa]
 gb|ADW80573.1| sucrose synthase 2 [Populus tomentosa]
 gb|ADW80594.1| sucrose synthase 2 [Populus tomentosa]
 gb|AFZ78659.1| sucrose synthase [Populus tomentosa]
Length=803

 Score =   117 bits (294),  Expect(2) = 2e-52, Method: Composition-based stats.
 Identities = 55/68 (81%), Positives = 59/68 (87%), Gaps = 0/68 (0%)
 Frame = +1

Query  322  GVWEYVTVNVHALXVEELTVPEYLQFKEELVDGPANGNFVLELDFEPFTASFPKPTLTKS  501
            GVWEYV VNV AL VEEL V EYL FKEELVDG +NGNFVLELDFEPF+ASFP+PTL+K 
Sbjct  91   GVWEYVRVNVQALVVEELRVAEYLHFKEELVDGGSNGNFVLELDFEPFSASFPRPTLSKY  150

Query  502  IGXGVEFL  525
            IG GVEFL
Sbjct  151  IGNGVEFL  158


 Score =   114 bits (286),  Expect(2) = 2e-52, Method: Compositional matrix adjust.
 Identities = 56/87 (64%), Positives = 70/87 (80%), Gaps = 0/87 (0%)
 Frame = +2

Query  62   LTRVHSLRERLDATLTAHRNEILLFMSKIESHGKGILKPHQLLAEFEAICKEDQEKLNDH  241
            LTRV S+RERLD TL  HRNEI+  +++IE  GKGIL+ HQ++AEFEAI +E ++ L   
Sbjct  4    LTRVQSIRERLDETLKTHRNEIVALLTRIEGKGKGILQHHQIIAEFEAIPEEIRKILAGG  63

Query  242  AFQQVLKSTQEAIVLPPWVALAIRLRP  322
            AF +VL+STQEAIVLPPWVALA+R RP
Sbjct  64   AFSEVLRSTQEAIVLPPWVALAVRPRP  90



>gb|ADW80609.1| sucrose synthase 2 [Populus tomentosa]
Length=803

 Score =   117 bits (294),  Expect(2) = 2e-52, Method: Composition-based stats.
 Identities = 55/68 (81%), Positives = 59/68 (87%), Gaps = 0/68 (0%)
 Frame = +1

Query  322  GVWEYVTVNVHALXVEELTVPEYLQFKEELVDGPANGNFVLELDFEPFTASFPKPTLTKS  501
            GVWEYV VNV AL VEEL V EYL FKEELVDG +NGNFVLELDFEPF+ASFP+PTL+K 
Sbjct  91   GVWEYVRVNVQALVVEELRVAEYLHFKEELVDGGSNGNFVLELDFEPFSASFPRPTLSKY  150

Query  502  IGXGVEFL  525
            IG GVEFL
Sbjct  151  IGNGVEFL  158


 Score =   114 bits (286),  Expect(2) = 2e-52, Method: Compositional matrix adjust.
 Identities = 56/87 (64%), Positives = 70/87 (80%), Gaps = 0/87 (0%)
 Frame = +2

Query  62   LTRVHSLRERLDATLTAHRNEILLFMSKIESHGKGILKPHQLLAEFEAICKEDQEKLNDH  241
            LTRV S+RERLD TL  HRNEI+  +++IE  GKGIL+ HQ++AEFEAI +E ++ L   
Sbjct  4    LTRVQSIRERLDETLKTHRNEIVALLTRIEGKGKGILQHHQIIAEFEAIPEEIRKILAGG  63

Query  242  AFQQVLKSTQEAIVLPPWVALAIRLRP  322
            AF +VL+STQEAIVLPPWVALA+R RP
Sbjct  64   AFSEVLRSTQEAIVLPPWVALAVRPRP  90



>gb|ADW80604.1| sucrose synthase 2 [Populus tomentosa]
Length=803

 Score =   117 bits (294),  Expect(2) = 2e-52, Method: Composition-based stats.
 Identities = 55/68 (81%), Positives = 59/68 (87%), Gaps = 0/68 (0%)
 Frame = +1

Query  322  GVWEYVTVNVHALXVEELTVPEYLQFKEELVDGPANGNFVLELDFEPFTASFPKPTLTKS  501
            GVWEYV VNV AL VEEL V EYL FKEELVDG +NGNFVLELDFEPF+ASFP+PTL+K 
Sbjct  91   GVWEYVRVNVQALVVEELRVAEYLHFKEELVDGGSNGNFVLELDFEPFSASFPRPTLSKY  150

Query  502  IGXGVEFL  525
            IG GVEFL
Sbjct  151  IGNGVEFL  158


 Score =   114 bits (286),  Expect(2) = 2e-52, Method: Compositional matrix adjust.
 Identities = 56/87 (64%), Positives = 70/87 (80%), Gaps = 0/87 (0%)
 Frame = +2

Query  62   LTRVHSLRERLDATLTAHRNEILLFMSKIESHGKGILKPHQLLAEFEAICKEDQEKLNDH  241
            LTRV S+RERLD TL  HRNEI+  +++IE  GKGIL+ HQ++AEFEAI +E ++ L   
Sbjct  4    LTRVQSIRERLDETLKTHRNEIVALLTRIEGKGKGILQHHQIIAEFEAIPEEIRKILAGG  63

Query  242  AFQQVLKSTQEAIVLPPWVALAIRLRP  322
            AF +VL+STQEAIVLPPWVALA+R RP
Sbjct  64   AFSEVLRSTQEAIVLPPWVALAVRPRP  90



>gb|ADW80591.1| sucrose synthase 2 [Populus tomentosa]
Length=803

 Score =   117 bits (294),  Expect(2) = 2e-52, Method: Composition-based stats.
 Identities = 55/68 (81%), Positives = 59/68 (87%), Gaps = 0/68 (0%)
 Frame = +1

Query  322  GVWEYVTVNVHALXVEELTVPEYLQFKEELVDGPANGNFVLELDFEPFTASFPKPTLTKS  501
            GVWEYV VNV AL VEEL V EYL FKEELVDG +NGNFVLELDFEPF+ASFP+PTL+K 
Sbjct  91   GVWEYVRVNVQALVVEELRVAEYLHFKEELVDGGSNGNFVLELDFEPFSASFPRPTLSKY  150

Query  502  IGXGVEFL  525
            IG GVEFL
Sbjct  151  IGNGVEFL  158


 Score =   114 bits (286),  Expect(2) = 2e-52, Method: Compositional matrix adjust.
 Identities = 56/87 (64%), Positives = 70/87 (80%), Gaps = 0/87 (0%)
 Frame = +2

Query  62   LTRVHSLRERLDATLTAHRNEILLFMSKIESHGKGILKPHQLLAEFEAICKEDQEKLNDH  241
            LTRV S+RERLD TL  HRNEI+  +++IE  GKGIL+ HQ++AEFEAI +E ++ L   
Sbjct  4    LTRVQSIRERLDETLKTHRNEIVALLTRIEGKGKGILQHHQIIAEFEAIPEEIRKILAGG  63

Query  242  AFQQVLKSTQEAIVLPPWVALAIRLRP  322
            AF +VL+STQEAIVLPPWVALA+R RP
Sbjct  64   AFSEVLRSTQEAIVLPPWVALAVRPRP  90



>gb|ADW80606.1| sucrose synthase 2 [Populus tomentosa]
Length=803

 Score =   117 bits (294),  Expect(2) = 2e-52, Method: Composition-based stats.
 Identities = 55/68 (81%), Positives = 59/68 (87%), Gaps = 0/68 (0%)
 Frame = +1

Query  322  GVWEYVTVNVHALXVEELTVPEYLQFKEELVDGPANGNFVLELDFEPFTASFPKPTLTKS  501
            GVWEYV VNV AL VEEL V EYL FKEELVDG +NGNFVLELDFEPF+ASFP+PTL+K 
Sbjct  91   GVWEYVRVNVQALVVEELRVAEYLHFKEELVDGGSNGNFVLELDFEPFSASFPRPTLSKY  150

Query  502  IGXGVEFL  525
            IG GVEFL
Sbjct  151  IGNGVEFL  158


 Score =   114 bits (286),  Expect(2) = 2e-52, Method: Compositional matrix adjust.
 Identities = 56/87 (64%), Positives = 70/87 (80%), Gaps = 0/87 (0%)
 Frame = +2

Query  62   LTRVHSLRERLDATLTAHRNEILLFMSKIESHGKGILKPHQLLAEFEAICKEDQEKLNDH  241
            LTRV S+RERLD TL  HRNEI+  +++IE  GKGIL+ HQ++AEFEAI +E ++ L   
Sbjct  4    LTRVQSIRERLDETLKTHRNEIVALLTRIEGKGKGILQHHQIIAEFEAIPEEIRKILAGG  63

Query  242  AFQQVLKSTQEAIVLPPWVALAIRLRP  322
            AF +VL+STQEAIVLPPWVALA+R RP
Sbjct  64   AFSEVLRSTQEAIVLPPWVALAVRPRP  90



>gb|ADW80581.1| sucrose synthase 2 [Populus tomentosa]
Length=803

 Score =   117 bits (294),  Expect(2) = 2e-52, Method: Composition-based stats.
 Identities = 55/68 (81%), Positives = 59/68 (87%), Gaps = 0/68 (0%)
 Frame = +1

Query  322  GVWEYVTVNVHALXVEELTVPEYLQFKEELVDGPANGNFVLELDFEPFTASFPKPTLTKS  501
            GVWEYV VNV AL VEEL V EYL FKEELVDG +NGNFVLELDFEPF+ASFP+PTL+K 
Sbjct  91   GVWEYVRVNVQALVVEELRVAEYLHFKEELVDGGSNGNFVLELDFEPFSASFPRPTLSKY  150

Query  502  IGXGVEFL  525
            IG GVEFL
Sbjct  151  IGNGVEFL  158


 Score =   114 bits (286),  Expect(2) = 2e-52, Method: Compositional matrix adjust.
 Identities = 56/87 (64%), Positives = 70/87 (80%), Gaps = 0/87 (0%)
 Frame = +2

Query  62   LTRVHSLRERLDATLTAHRNEILLFMSKIESHGKGILKPHQLLAEFEAICKEDQEKLNDH  241
            LTRV S+RERLD TL  HRNEI+  +++IE  GKGIL+ HQ++AEFEAI +E ++ L   
Sbjct  4    LTRVQSIRERLDETLKTHRNEIVALLTRIEGKGKGILQHHQIIAEFEAIPEEIRKILAGG  63

Query  242  AFQQVLKSTQEAIVLPPWVALAIRLRP  322
            AF +VL+STQEAIVLPPWVALA+R RP
Sbjct  64   AFSEVLRSTQEAIVLPPWVALAVRPRP  90



>gb|ADW80584.1| sucrose synthase 2 [Populus tomentosa]
Length=803

 Score =   117 bits (294),  Expect(2) = 2e-52, Method: Composition-based stats.
 Identities = 55/68 (81%), Positives = 59/68 (87%), Gaps = 0/68 (0%)
 Frame = +1

Query  322  GVWEYVTVNVHALXVEELTVPEYLQFKEELVDGPANGNFVLELDFEPFTASFPKPTLTKS  501
            GVWEYV VNV AL VEEL V EYL FKEELVDG +NGNFVLELDFEPF+ASFP+PTL+K 
Sbjct  91   GVWEYVRVNVQALVVEELRVAEYLHFKEELVDGGSNGNFVLELDFEPFSASFPRPTLSKY  150

Query  502  IGXGVEFL  525
            IG GVEFL
Sbjct  151  IGNGVEFL  158


 Score =   114 bits (286),  Expect(2) = 2e-52, Method: Compositional matrix adjust.
 Identities = 56/87 (64%), Positives = 70/87 (80%), Gaps = 0/87 (0%)
 Frame = +2

Query  62   LTRVHSLRERLDATLTAHRNEILLFMSKIESHGKGILKPHQLLAEFEAICKEDQEKLNDH  241
            LTRV S+RERLD TL  HRNEI+  +++IE  GKGIL+ HQ++AEFEAI +E ++ L   
Sbjct  4    LTRVQSIRERLDETLKTHRNEIVALLTRIEGKGKGILQHHQIIAEFEAIPEEIRKILAGG  63

Query  242  AFQQVLKSTQEAIVLPPWVALAIRLRP  322
            AF +VL+STQEAIVLPPWVALA+R RP
Sbjct  64   AFSEVLRSTQEAIVLPPWVALAVRPRP  90



>gb|ADW80582.1| sucrose synthase 2 [Populus tomentosa]
Length=803

 Score =   117 bits (294),  Expect(2) = 2e-52, Method: Composition-based stats.
 Identities = 55/68 (81%), Positives = 59/68 (87%), Gaps = 0/68 (0%)
 Frame = +1

Query  322  GVWEYVTVNVHALXVEELTVPEYLQFKEELVDGPANGNFVLELDFEPFTASFPKPTLTKS  501
            GVWEYV VNV AL VEEL V EYL FKEELVDG +NGNFVLELDFEPF+ASFP+PTL+K 
Sbjct  91   GVWEYVRVNVRALVVEELRVAEYLHFKEELVDGGSNGNFVLELDFEPFSASFPRPTLSKY  150

Query  502  IGXGVEFL  525
            IG GVEFL
Sbjct  151  IGNGVEFL  158


 Score =   114 bits (286),  Expect(2) = 2e-52, Method: Compositional matrix adjust.
 Identities = 56/87 (64%), Positives = 70/87 (80%), Gaps = 0/87 (0%)
 Frame = +2

Query  62   LTRVHSLRERLDATLTAHRNEILLFMSKIESHGKGILKPHQLLAEFEAICKEDQEKLNDH  241
            LTRV S+RERLD TL  HRNEI+  +++IE  GKGIL+ HQ++AEFEAI +E ++ L   
Sbjct  4    LTRVQSIRERLDETLKTHRNEIVALLTRIEGKGKGILQHHQIIAEFEAIPEEIRKILAGG  63

Query  242  AFQQVLKSTQEAIVLPPWVALAIRLRP  322
            AF +VL+STQEAIVLPPWVALA+R RP
Sbjct  64   AFSEVLRSTQEAIVLPPWVALAVRPRP  90



>gb|ADW80576.1| sucrose synthase 2 [Populus tomentosa]
Length=803

 Score =   117 bits (294),  Expect(2) = 2e-52, Method: Composition-based stats.
 Identities = 55/68 (81%), Positives = 59/68 (87%), Gaps = 0/68 (0%)
 Frame = +1

Query  322  GVWEYVTVNVHALXVEELTVPEYLQFKEELVDGPANGNFVLELDFEPFTASFPKPTLTKS  501
            GVWEYV VNV AL VEEL V EYL FKEELVDG +NGNFVLELDFEPF+ASFP+PTL+K 
Sbjct  91   GVWEYVRVNVQALVVEELRVAEYLHFKEELVDGGSNGNFVLELDFEPFSASFPRPTLSKY  150

Query  502  IGXGVEFL  525
            IG GVEFL
Sbjct  151  IGNGVEFL  158


 Score =   114 bits (286),  Expect(2) = 2e-52, Method: Compositional matrix adjust.
 Identities = 56/87 (64%), Positives = 70/87 (80%), Gaps = 0/87 (0%)
 Frame = +2

Query  62   LTRVHSLRERLDATLTAHRNEILLFMSKIESHGKGILKPHQLLAEFEAICKEDQEKLNDH  241
            LTRV S+RERLD TL  HRNEI+  +++IE  GKGIL+ HQ++AEFEAI +E ++ L   
Sbjct  4    LTRVQSIRERLDETLKTHRNEIVALLTRIEGKGKGILQHHQIIAEFEAIPEEIRKILAGG  63

Query  242  AFQQVLKSTQEAIVLPPWVALAIRLRP  322
            AF +VL+STQEAIVLPPWVALA+R RP
Sbjct  64   AFSEVLRSTQEAIVLPPWVALAVRPRP  90



>gb|ADW80575.1| sucrose synthase 2 [Populus tomentosa]
Length=803

 Score =   118 bits (295),  Expect(2) = 3e-52, Method: Composition-based stats.
 Identities = 55/68 (81%), Positives = 59/68 (87%), Gaps = 0/68 (0%)
 Frame = +1

Query  322  GVWEYVTVNVHALXVEELTVPEYLQFKEELVDGPANGNFVLELDFEPFTASFPKPTLTKS  501
            GVWEYV VNV AL VEEL V EYL FKEELVDG +NGNFVLELDFEPF+ASFP+PTL+K 
Sbjct  91   GVWEYVRVNVQALVVEELRVAEYLHFKEELVDGGSNGNFVLELDFEPFSASFPRPTLSKY  150

Query  502  IGXGVEFL  525
            IG GVEFL
Sbjct  151  IGNGVEFL  158


 Score =   114 bits (284),  Expect(2) = 3e-52, Method: Compositional matrix adjust.
 Identities = 55/87 (63%), Positives = 70/87 (80%), Gaps = 0/87 (0%)
 Frame = +2

Query  62   LTRVHSLRERLDATLTAHRNEILLFMSKIESHGKGILKPHQLLAEFEAICKEDQEKLNDH  241
            LTRV S+RERLD TL  HRNEI+  +++IE  G+GIL+ HQ++AEFEAI +E ++ L   
Sbjct  4    LTRVQSIRERLDETLKTHRNEIVALLTRIEGKGRGILQRHQIIAEFEAIPEEIRKILAGG  63

Query  242  AFQQVLKSTQEAIVLPPWVALAIRLRP  322
            AF +VL+STQEAIVLPPWVALA+R RP
Sbjct  64   AFSEVLRSTQEAIVLPPWVALAVRPRP  90



>ref|XP_002877269.1| hypothetical protein ARALYDRAFT_484788 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH53528.1| hypothetical protein ARALYDRAFT_484788 [Arabidopsis lyrata subsp. 
lyrata]
Length=808

 Score =   120 bits (300),  Expect(2) = 3e-52, Method: Compositional matrix adjust.
 Identities = 59/93 (63%), Positives = 76/93 (82%), Gaps = 0/93 (0%)
 Frame = +2

Query  44   AMAERVLTRVHSLRERLDATLTAHRNEILLFMSKIESHGKGILKPHQLLAEFEAICKEDQ  223
            A AERV+TRVHS RERLDATL A +NE+L  +S++E+ GKGIL+ HQ++AEFEA+  E Q
Sbjct  2    ANAERVITRVHSQRERLDATLIAQKNEVLALLSRVEAKGKGILQYHQIIAEFEAMPLETQ  61

Query  224  EKLNDHAFQQVLKSTQEAIVLPPWVALAIRLRP  322
            +KL   AF ++L+S QEAIVLPP+VALA+R RP
Sbjct  62   KKLQGGAFFEILRSAQEAIVLPPFVALAVRPRP  94


 Score =   112 bits (279),  Expect(2) = 3e-52, Method: Composition-based stats.
 Identities = 51/68 (75%), Positives = 55/68 (81%), Gaps = 0/68 (0%)
 Frame = +1

Query  322  GVWEYVTVNVHALXVEELTVPEYLQFKEELVDGPANGNFVLELDFEPFTASFPKPTLTKS  501
            GVWEYV VN+H L V+EL   EYLQFKEELVDG  NGNF LELDFEPF A+FP+PTL K 
Sbjct  95   GVWEYVRVNLHDLVVDELQASEYLQFKEELVDGIRNGNFTLELDFEPFNAAFPRPTLNKY  154

Query  502  IGXGVEFL  525
            IG GVEFL
Sbjct  155  IGNGVEFL  162



>gb|AFS17277.1| sucrose synthase 1 [Amaranthus cruentus/Amaranthus hypocondriacus 
mixed library]
Length=803

 Score =   115 bits (289),  Expect(2) = 3e-52, Method: Compositional matrix adjust.
 Identities = 58/92 (63%), Positives = 72/92 (78%), Gaps = 3/92 (3%)
 Frame = +2

Query  47   MAERVLTRVHSLRERLDATLTAHRNEILLFMSKIESHGKGILKPHQLLAEFEAICKEDQE  226
            MA R LTRV SL+ERLD TL+A RNEI+ F+S+I SHGKGIL+PHQLL+E EA+   D++
Sbjct  1    MAAR-LTRVPSLKERLDETLSAQRNEIISFLSRIVSHGKGILQPHQLLSELEAVS--DKQ  57

Query  227  KLNDHAFQQVLKSTQEAIVLPPWVALAIRLRP  322
            KL D  F +V + TQE IVLPPW+ LA+R RP
Sbjct  58   KLYDGPFGEVFRHTQEVIVLPPWITLAVRPRP  89


 Score =   115 bits (289),  Expect(2) = 3e-52, Method: Composition-based stats.
 Identities = 54/68 (79%), Positives = 58/68 (85%), Gaps = 0/68 (0%)
 Frame = +1

Query  322  GVWEYVTVNVHALXVEELTVPEYLQFKEELVDGPANGNFVLELDFEPFTASFPKPTLTKS  501
            GVWEY+ VNV AL VEELT  E+L  KEELVDG  NGNFVLELDFEPFTASFP+PTL+KS
Sbjct  90   GVWEYIRVNVDALAVEELTPSEFLHVKEELVDGSVNGNFVLELDFEPFTASFPRPTLSKS  149

Query  502  IGXGVEFL  525
            IG GVEFL
Sbjct  150  IGNGVEFL  157



>ref|XP_010687574.1| PREDICTED: sucrose synthase [Beta vulgaris subsp. vulgaris]
Length=805

 Score =   116 bits (291),  Expect(2) = 4e-52, Method: Compositional matrix adjust.
 Identities = 58/92 (63%), Positives = 72/92 (78%), Gaps = 3/92 (3%)
 Frame = +2

Query  47   MAERVLTRVHSLRERLDATLTAHRNEILLFMSKIESHGKGILKPHQLLAEFEAICKEDQE  226
            MA R LTRV SL+ERLD TLTA RNEI+ F+ +I SHGKGIL+PH++L+EFEA+   D+ 
Sbjct  1    MASR-LTRVPSLKERLDETLTAQRNEIISFLKRIASHGKGILQPHEVLSEFEAVA--DKH  57

Query  227  KLNDHAFQQVLKSTQEAIVLPPWVALAIRLRP  322
            KL D  F +VL+ TQE IVLPPW+ LA+R RP
Sbjct  58   KLADGPFGEVLRHTQETIVLPPWITLAVRPRP  89


 Score =   114 bits (286),  Expect(2) = 4e-52, Method: Composition-based stats.
 Identities = 53/68 (78%), Positives = 58/68 (85%), Gaps = 0/68 (0%)
 Frame = +1

Query  322  GVWEYVTVNVHALXVEELTVPEYLQFKEELVDGPANGNFVLELDFEPFTASFPKPTLTKS  501
            GVWEY+ VNV AL VEELT  ++L  KEELVDG  NGNFVLELDFEPFTASFP+PTL+KS
Sbjct  90   GVWEYIRVNVDALAVEELTPSQFLHVKEELVDGSTNGNFVLELDFEPFTASFPRPTLSKS  149

Query  502  IGXGVEFL  525
            IG GVEFL
Sbjct  150  IGNGVEFL  157



>ref|XP_006381564.1| sucrose synthase family protein [Populus trichocarpa]
 gb|ERP59361.1| sucrose synthase family protein [Populus trichocarpa]
Length=803

 Score =   116 bits (290),  Expect(2) = 4e-52, Method: Compositional matrix adjust.
 Identities = 57/88 (65%), Positives = 71/88 (81%), Gaps = 0/88 (0%)
 Frame = +2

Query  59   VLTRVHSLRERLDATLTAHRNEILLFMSKIESHGKGILKPHQLLAEFEAICKEDQEKLND  238
            VLTRV S+RERLD TL  HRNEI+  +++IE  GKGIL+ HQ++AEFEAI +E ++ L  
Sbjct  3    VLTRVQSIRERLDETLKTHRNEIVALLTRIEGKGKGILQHHQIIAEFEAIPEEIRKILAG  62

Query  239  HAFQQVLKSTQEAIVLPPWVALAIRLRP  322
             AF +VL+STQEAIVLPPWVALA+R RP
Sbjct  63   GAFSEVLRSTQEAIVLPPWVALAVRPRP  90


 Score =   115 bits (287),  Expect(2) = 4e-52, Method: Compositional matrix adjust.
 Identities = 55/68 (81%), Positives = 59/68 (87%), Gaps = 0/68 (0%)
 Frame = +1

Query  322  GVWEYVTVNVHALXVEELTVPEYLQFKEELVDGPANGNFVLELDFEPFTASFPKPTLTKS  501
            GVWEYV VNV AL VEEL V EYL FKEELVDG +NGNFVLELDFEPF+ASFP+PTL+K 
Sbjct  91   GVWEYVRVNVQALVVEELRVAEYLHFKEELVDGGSNGNFVLELDFEPFSASFPRPTLSKY  150

Query  502  IGXGVEFL  525
            IG GVEFL
Sbjct  151  IGNGVEFL  158



>ref|NP_566865.2| sucrose synthase 4 [Arabidopsis thaliana]
 sp|Q9LXL5.1|SUS4_ARATH RecName: Full=Sucrose synthase 4; Short=AtSUS4; AltName: Full=Sucrose-UDP 
glucosyltransferase 4 [Arabidopsis thaliana]
 emb|CAB89040.1| sucrose synthase-like protein [Arabidopsis thaliana]
 gb|AEE77773.1| sucrose synthase 4 [Arabidopsis thaliana]
Length=808

 Score =   117 bits (294),  Expect(2) = 5e-52, Method: Compositional matrix adjust.
 Identities = 58/93 (62%), Positives = 74/93 (80%), Gaps = 0/93 (0%)
 Frame = +2

Query  44   AMAERVLTRVHSLRERLDATLTAHRNEILLFMSKIESHGKGILKPHQLLAEFEAICKEDQ  223
            A AERV+TRVHS RERLDATL A +NE+   +S++E+ GKGIL+ HQ++AEFEA+  E Q
Sbjct  2    ANAERVITRVHSQRERLDATLVAQKNEVFALLSRVEAKGKGILQHHQIIAEFEAMPLETQ  61

Query  224  EKLNDHAFQQVLKSTQEAIVLPPWVALAIRLRP  322
            +KL   AF + L+S QEAIVLPP+VALA+R RP
Sbjct  62   KKLKGGAFFEFLRSAQEAIVLPPFVALAVRPRP  94


 Score =   113 bits (282),  Expect(2) = 5e-52, Method: Composition-based stats.
 Identities = 52/68 (76%), Positives = 55/68 (81%), Gaps = 0/68 (0%)
 Frame = +1

Query  322  GVWEYVTVNVHALXVEELTVPEYLQFKEELVDGPANGNFVLELDFEPFTASFPKPTLTKS  501
            GVWEYV VN+H L VEEL   EYLQFKEELVDG  NGNF LELDFEPF A+FP+PTL K 
Sbjct  95   GVWEYVRVNLHDLVVEELQASEYLQFKEELVDGIKNGNFTLELDFEPFNAAFPRPTLNKY  154

Query  502  IGXGVEFL  525
            IG GVEFL
Sbjct  155  IGDGVEFL  162



>gb|ADW80580.1| sucrose synthase 2 [Populus tomentosa]
Length=803

 Score =   116 bits (290),  Expect(2) = 5e-52, Method: Composition-based stats.
 Identities = 54/68 (79%), Positives = 59/68 (87%), Gaps = 0/68 (0%)
 Frame = +1

Query  322  GVWEYVTVNVHALXVEELTVPEYLQFKEELVDGPANGNFVLELDFEPFTASFPKPTLTKS  501
            GVWEYV VNV AL VEEL V EYL FKEELV+G +NGNFVLELDFEPF+ASFP+PTL+K 
Sbjct  91   GVWEYVRVNVQALVVEELRVAEYLHFKEELVNGGSNGNFVLELDFEPFSASFPRPTLSKY  150

Query  502  IGXGVEFL  525
            IG GVEFL
Sbjct  151  IGNGVEFL  158


 Score =   114 bits (286),  Expect(2) = 5e-52, Method: Compositional matrix adjust.
 Identities = 56/87 (64%), Positives = 70/87 (80%), Gaps = 0/87 (0%)
 Frame = +2

Query  62   LTRVHSLRERLDATLTAHRNEILLFMSKIESHGKGILKPHQLLAEFEAICKEDQEKLNDH  241
            LTRV S+RERLD TL  HRNEI+  +++IE  GKGIL+ HQ++AEFEAI +E ++ L   
Sbjct  4    LTRVQSIRERLDETLKTHRNEIVALLTRIEGKGKGILQHHQIIAEFEAIPEEIRKILAGG  63

Query  242  AFQQVLKSTQEAIVLPPWVALAIRLRP  322
            AF +VL+STQEAIVLPPWVALA+R RP
Sbjct  64   AFSEVLRSTQEAIVLPPWVALAVRPRP  90



>ref|XP_004488141.1| PREDICTED: sucrose synthase-like isoform X1 [Cicer arietinum]
 ref|XP_004488142.1| PREDICTED: sucrose synthase-like isoform X2 [Cicer arietinum]
 ref|XP_004488143.1| PREDICTED: sucrose synthase-like isoform X3 [Cicer arietinum]
 ref|XP_004488144.1| PREDICTED: sucrose synthase-like isoform X4 [Cicer arietinum]
 ref|XP_004488145.1| PREDICTED: sucrose synthase-like isoform X5 [Cicer arietinum]
Length=824

 Score =   116 bits (291),  Expect(2) = 6e-52, Method: Composition-based stats.
 Identities = 56/92 (61%), Positives = 73/92 (79%), Gaps = 0/92 (0%)
 Frame = +2

Query  47   MAERVLTRVHSLRERLDATLTAHRNEILLFMSKIESHGKGILKPHQLLAEFEAICKEDQE  226
            M    LTR HS+R+R D  LT HRNEIL  +S+IE+ GKGIL+ HQ++AEFE I +E+++
Sbjct  1    MGSDRLTRSHSIRQRFDEILTGHRNEILALLSRIEAKGKGILQHHQVIAEFEEIPEENRQ  60

Query  227  KLNDHAFQQVLKSTQEAIVLPPWVALAIRLRP  322
            KL + AF +VL+STQEAIVLPP+VALA+R RP
Sbjct  61   KLVNGAFGEVLRSTQEAIVLPPFVALAVRPRP  92


 Score =   114 bits (285),  Expect(2) = 6e-52, Method: Composition-based stats.
 Identities = 51/68 (75%), Positives = 59/68 (87%), Gaps = 0/68 (0%)
 Frame = +1

Query  322  GVWEYVTVNVHALXVEELTVPEYLQFKEELVDGPANGNFVLELDFEPFTASFPKPTLTKS  501
            GVWEY+ V+VH L V+EL+  EYL+FKEELV+G +NGNFVLELDFEPF ASFP+PTL KS
Sbjct  93   GVWEYLRVDVHGLVVDELSAAEYLKFKEELVEGSSNGNFVLELDFEPFNASFPRPTLNKS  152

Query  502  IGXGVEFL  525
            IG GVEFL
Sbjct  153  IGNGVEFL  160



>ref|XP_010939862.1| PREDICTED: sucrose synthase 1 [Elaeis guineensis]
Length=815

 Score =   117 bits (292),  Expect(2) = 6e-52, Method: Compositional matrix adjust.
 Identities = 58/93 (62%), Positives = 71/93 (76%), Gaps = 1/93 (1%)
 Frame = +2

Query  47   MAERVLTRVHSLRERLDATLTAHRNEILLFMSKIESHGKGILKPHQLLAEFEAICKE-DQ  223
            MA   L+RVHS+RERL  TL+AH NE++   S+  + GKG+L PHQLLAE+EA+  E D+
Sbjct  1    MASPALSRVHSVRERLGDTLSAHPNELVALFSRFVNQGKGMLLPHQLLAEYEAVIPEADR  60

Query  224  EKLNDHAFQQVLKSTQEAIVLPPWVALAIRLRP  322
            EKL D  F+ VLK+ QEAIVLPPWVALAIR RP
Sbjct  61   EKLKDGVFEDVLKAAQEAIVLPPWVALAIRPRP  93


 Score =   114 bits (284),  Expect(2) = 6e-52, Method: Compositional matrix adjust.
 Identities = 53/68 (78%), Positives = 59/68 (87%), Gaps = 0/68 (0%)
 Frame = +1

Query  322  GVWEYVTVNVHALXVEELTVPEYLQFKEELVDGPANGNFVLELDFEPFTASFPKPTLTKS  501
            GVW+YV VNV  L VEELTVPEYLQFKEELVDG +  NFVLELDFEPF ASFP+P+L+KS
Sbjct  94   GVWQYVRVNVSELAVEELTVPEYLQFKEELVDGSSQSNFVLELDFEPFNASFPRPSLSKS  153

Query  502  IGXGVEFL  525
            IG GV+FL
Sbjct  154  IGNGVQFL  161



>gb|ADW80597.1| sucrose synthase 2 [Populus tomentosa]
Length=803

 Score =   115 bits (288),  Expect(2) = 7e-52, Method: Compositional matrix adjust.
 Identities = 57/87 (66%), Positives = 70/87 (80%), Gaps = 0/87 (0%)
 Frame = +2

Query  62   LTRVHSLRERLDATLTAHRNEILLFMSKIESHGKGILKPHQLLAEFEAICKEDQEKLNDH  241
            LTRV S+RERLD TL  HRNEI+  +++IE  GKGIL+ HQ+LAEFEAI +E ++ L   
Sbjct  4    LTRVQSIRERLDETLKTHRNEIVALLTRIEGKGKGILQHHQILAEFEAIPEEIRKILAGG  63

Query  242  AFQQVLKSTQEAIVLPPWVALAIRLRP  322
            AF +VL+STQEAIVLPPWVALA+R RP
Sbjct  64   AFSEVLRSTQEAIVLPPWVALAVRPRP  90


 Score =   115 bits (287),  Expect(2) = 7e-52, Method: Compositional matrix adjust.
 Identities = 55/68 (81%), Positives = 59/68 (87%), Gaps = 0/68 (0%)
 Frame = +1

Query  322  GVWEYVTVNVHALXVEELTVPEYLQFKEELVDGPANGNFVLELDFEPFTASFPKPTLTKS  501
            GVWEYV VNV AL VEEL V EYL FKEELVDG +NGNFVLELDFEPF+ASFP+PTL+K 
Sbjct  91   GVWEYVRVNVQALVVEELRVAEYLHFKEELVDGGSNGNFVLELDFEPFSASFPRPTLSKY  150

Query  502  IGXGVEFL  525
            IG GVEFL
Sbjct  151  IGNGVEFL  158



>gb|ABW76422.1| sucrose synthase [Populus tremuloides]
Length=803

 Score =   118 bits (295),  Expect(2) = 9e-52, Method: Composition-based stats.
 Identities = 55/68 (81%), Positives = 59/68 (87%), Gaps = 0/68 (0%)
 Frame = +1

Query  322  GVWEYVTVNVHALXVEELTVPEYLQFKEELVDGPANGNFVLELDFEPFTASFPKPTLTKS  501
            GVWEYV VNV AL VEEL V EYL FKEELVDG +NGNFVLELDFEPF+ASFP+PTL+K 
Sbjct  91   GVWEYVRVNVQALVVEELRVAEYLHFKEELVDGGSNGNFVLELDFEPFSASFPRPTLSKY  150

Query  502  IGXGVEFL  525
            IG GVEFL
Sbjct  151  IGNGVEFL  158


 Score =   112 bits (279),  Expect(2) = 9e-52, Method: Compositional matrix adjust.
 Identities = 56/87 (64%), Positives = 69/87 (79%), Gaps = 0/87 (0%)
 Frame = +2

Query  62   LTRVHSLRERLDATLTAHRNEILLFMSKIESHGKGILKPHQLLAEFEAICKEDQEKLNDH  241
            LTRV S+RERLD TL  HRNEI+  +++IE  GKGIL+ HQ++AEFEAI +E ++ L   
Sbjct  4    LTRVQSIRERLDETLKTHRNEIVALLTRIEGKGKGILQHHQIIAEFEAIPEEIRKILAGG  63

Query  242  AFQQVLKSTQEAIVLPPWVALAIRLRP  322
            AF +VL+STQEAIVLPPWVALA R RP
Sbjct  64   AFSEVLRSTQEAIVLPPWVALAERPRP  90



>gb|ADW80600.1| sucrose synthase 2 [Populus tomentosa]
Length=803

 Score =   118 bits (295),  Expect(2) = 9e-52, Method: Composition-based stats.
 Identities = 55/68 (81%), Positives = 59/68 (87%), Gaps = 0/68 (0%)
 Frame = +1

Query  322  GVWEYVTVNVHALXVEELTVPEYLQFKEELVDGPANGNFVLELDFEPFTASFPKPTLTKS  501
            GVWEYV VNV AL VEEL V EYL FKEELVDG +NGNFVLELDFEPF+ASFP+PTL+K 
Sbjct  91   GVWEYVRVNVQALVVEELRVAEYLHFKEELVDGGSNGNFVLELDFEPFSASFPRPTLSKY  150

Query  502  IGXGVEFL  525
            IG GVEFL
Sbjct  151  IGNGVEFL  158


 Score =   112 bits (279),  Expect(2) = 9e-52, Method: Compositional matrix adjust.
 Identities = 55/87 (63%), Positives = 69/87 (79%), Gaps = 0/87 (0%)
 Frame = +2

Query  62   LTRVHSLRERLDATLTAHRNEILLFMSKIESHGKGILKPHQLLAEFEAICKEDQEKLNDH  241
            LTRV S+RERLD TL  HRNEI+  +++IE  GKGIL+ HQ++AEFEAI +E ++ L   
Sbjct  4    LTRVQSIRERLDETLKTHRNEIVALLTRIEGKGKGILQHHQIIAEFEAIPEEIRKILAGG  63

Query  242  AFQQVLKSTQEAIVLPPWVALAIRLRP  322
            A  +VL+STQEAIVLPPWVALA+R RP
Sbjct  64   ALSEVLRSTQEAIVLPPWVALAVRPRP  90



>gb|AGW23638.1| sucrose synthase [Lilium davidii]
Length=846

 Score =   116 bits (290),  Expect(2) = 1e-51, Method: Compositional matrix adjust.
 Identities = 55/93 (59%), Positives = 72/93 (77%), Gaps = 1/93 (1%)
 Frame = +2

Query  47   MAERVLTRVHSLRERLDATLTAHRNEILLFMSKIESHGKGILKPHQLLAEFEAICKE-DQ  223
            MA+R LTR H+ R+RL  TL+AH+NE+L   S+    G+G+L+PHQLLAE+EA+  E ++
Sbjct  4    MADRGLTRNHTFRDRLSDTLSAHKNELLALFSRFVKQGQGMLQPHQLLAEYEAVIPEAER  63

Query  224  EKLNDHAFQQVLKSTQEAIVLPPWVALAIRLRP  322
            EKL D  F+ VLK+ QEAIV+PPWVALAIR RP
Sbjct  64   EKLKDGVFEDVLKAAQEAIVIPPWVALAIRPRP  96


 Score =   114 bits (284),  Expect(2) = 1e-51, Method: Compositional matrix adjust.
 Identities = 53/68 (78%), Positives = 58/68 (85%), Gaps = 0/68 (0%)
 Frame = +1

Query  322  GVWEYVTVNVHALXVEELTVPEYLQFKEELVDGPANGNFVLELDFEPFTASFPKPTLTKS  501
            GVWEYV VNV+ L VEELTVPEYLQFKEELVDG    NF LELDFEPF ASFP+P+L+KS
Sbjct  97   GVWEYVRVNVNELAVEELTVPEYLQFKEELVDGSGRNNFTLELDFEPFNASFPRPSLSKS  156

Query  502  IGXGVEFL  525
            IG GV+FL
Sbjct  157  IGNGVQFL  164



>gb|ADW80578.1| sucrose synthase 2 [Populus tomentosa]
Length=803

 Score =   115 bits (287),  Expect(2) = 1e-51, Method: Composition-based stats.
 Identities = 54/68 (79%), Positives = 58/68 (85%), Gaps = 0/68 (0%)
 Frame = +1

Query  322  GVWEYVTVNVHALXVEELTVPEYLQFKEELVDGPANGNFVLELDFEPFTASFPKPTLTKS  501
            GVWEYV VNV AL VEEL V EYL FKEELVDG +NGNFVLELDFEPF+ASFP+PTL+K 
Sbjct  91   GVWEYVRVNVQALVVEELRVAEYLHFKEELVDGGSNGNFVLELDFEPFSASFPRPTLSKY  150

Query  502  IGXGVEFL  525
            IG GV FL
Sbjct  151  IGNGVGFL  158


 Score =   114 bits (286),  Expect(2) = 1e-51, Method: Compositional matrix adjust.
 Identities = 56/87 (64%), Positives = 70/87 (80%), Gaps = 0/87 (0%)
 Frame = +2

Query  62   LTRVHSLRERLDATLTAHRNEILLFMSKIESHGKGILKPHQLLAEFEAICKEDQEKLNDH  241
            LTRV S+RERLD TL  HRNEI+  +++IE  GKGIL+ HQ++AEFEAI +E ++ L   
Sbjct  4    LTRVQSIRERLDETLKTHRNEIVALLTRIEGKGKGILQHHQIIAEFEAIPEEIRKILAGG  63

Query  242  AFQQVLKSTQEAIVLPPWVALAIRLRP  322
            AF +VL+STQEAIVLPPWVALA+R RP
Sbjct  64   AFSEVLRSTQEAIVLPPWVALAVRPRP  90



>gb|ADW80611.1| sucrose synthase 2 [Populus tomentosa]
Length=803

 Score =   115 bits (287),  Expect(2) = 1e-51, Method: Composition-based stats.
 Identities = 54/68 (79%), Positives = 58/68 (85%), Gaps = 0/68 (0%)
 Frame = +1

Query  322  GVWEYVTVNVHALXVEELTVPEYLQFKEELVDGPANGNFVLELDFEPFTASFPKPTLTKS  501
            GVWEYV VNV AL VEEL V EYL FKEELVDG +NGNFVLELDF PF+ASFP+PTL+K 
Sbjct  91   GVWEYVRVNVQALVVEELRVAEYLHFKEELVDGGSNGNFVLELDFGPFSASFPRPTLSKY  150

Query  502  IGXGVEFL  525
            IG GVEFL
Sbjct  151  IGNGVEFL  158


 Score =   114 bits (286),  Expect(2) = 1e-51, Method: Compositional matrix adjust.
 Identities = 56/87 (64%), Positives = 70/87 (80%), Gaps = 0/87 (0%)
 Frame = +2

Query  62   LTRVHSLRERLDATLTAHRNEILLFMSKIESHGKGILKPHQLLAEFEAICKEDQEKLNDH  241
            LTRV S+RERLD TL  HRNEI+  +++IE  GKGIL+ HQ++AEFEAI +E ++ L   
Sbjct  4    LTRVQSIRERLDETLKTHRNEIVALLTRIEGKGKGILQHHQIIAEFEAIPEEIRKILAGG  63

Query  242  AFQQVLKSTQEAIVLPPWVALAIRLRP  322
            AF +VL+STQEAIVLPPWVALA+R RP
Sbjct  64   AFSEVLRSTQEAIVLPPWVALAVRPRP  90



>gb|ADW80607.1| sucrose synthase 2 [Populus tomentosa]
Length=803

 Score =   115 bits (287),  Expect(2) = 1e-51, Method: Compositional matrix adjust.
 Identities = 55/68 (81%), Positives = 59/68 (87%), Gaps = 0/68 (0%)
 Frame = +1

Query  322  GVWEYVTVNVHALXVEELTVPEYLQFKEELVDGPANGNFVLELDFEPFTASFPKPTLTKS  501
            GVWEYV VNV AL VEEL V EYL FKEELVDG +NGNFVLELDFEPF+ASFP+PTL+K 
Sbjct  91   GVWEYVRVNVQALVVEELRVAEYLHFKEELVDGGSNGNFVLELDFEPFSASFPRPTLSKY  150

Query  502  IGXGVEFL  525
            IG GVEFL
Sbjct  151  IGNGVEFL  158


 Score =   114 bits (286),  Expect(2) = 1e-51, Method: Compositional matrix adjust.
 Identities = 56/87 (64%), Positives = 70/87 (80%), Gaps = 0/87 (0%)
 Frame = +2

Query  62   LTRVHSLRERLDATLTAHRNEILLFMSKIESHGKGILKPHQLLAEFEAICKEDQEKLNDH  241
            LTRV S+RERLD TL  HRNEI+  +++IE  GKGIL+ HQ++AEFEAI +E ++ L   
Sbjct  4    LTRVQSIRERLDETLKTHRNEIVALLTRIEGKGKGILQHHQIIAEFEAIPEEIRKILAGG  63

Query  242  AFQQVLKSTQEAIVLPPWVALAIRLRP  322
            AF +VL+STQEAIVLPPWVALA+R RP
Sbjct  64   AFSEVLRSTQEAIVLPPWVALAVRPRP  90



>gb|ADW80577.1| sucrose synthase 2 [Populus tomentosa]
Length=803

 Score =   115 bits (287),  Expect(2) = 1e-51, Method: Compositional matrix adjust.
 Identities = 55/68 (81%), Positives = 59/68 (87%), Gaps = 0/68 (0%)
 Frame = +1

Query  322  GVWEYVTVNVHALXVEELTVPEYLQFKEELVDGPANGNFVLELDFEPFTASFPKPTLTKS  501
            GVWEYV VNV AL VEEL V EYL FKEELVDG +NGNFVLELDFEPF+ASFP+PTL+K 
Sbjct  91   GVWEYVRVNVQALVVEELRVAEYLHFKEELVDGGSNGNFVLELDFEPFSASFPRPTLSKY  150

Query  502  IGXGVEFL  525
            IG GVEFL
Sbjct  151  IGNGVEFL  158


 Score =   114 bits (286),  Expect(2) = 1e-51, Method: Compositional matrix adjust.
 Identities = 56/87 (64%), Positives = 70/87 (80%), Gaps = 0/87 (0%)
 Frame = +2

Query  62   LTRVHSLRERLDATLTAHRNEILLFMSKIESHGKGILKPHQLLAEFEAICKEDQEKLNDH  241
            LTRV S+RERLD TL  HRNEI+  +++IE  GKGIL+ HQ++AEFEAI +E ++ L   
Sbjct  4    LTRVQSIRERLDETLKTHRNEIVALLTRIEGKGKGILQHHQIIAEFEAIPEEIRKILAGG  63

Query  242  AFQQVLKSTQEAIVLPPWVALAIRLRP  322
            AF +VL+STQEAIVLPPWVALA+R RP
Sbjct  64   AFSEVLRSTQEAIVLPPWVALAVRPRP  90



>gb|ADW80574.1| sucrose synthase 2 [Populus tomentosa]
Length=803

 Score =   115 bits (287),  Expect(2) = 1e-51, Method: Compositional matrix adjust.
 Identities = 55/68 (81%), Positives = 59/68 (87%), Gaps = 0/68 (0%)
 Frame = +1

Query  322  GVWEYVTVNVHALXVEELTVPEYLQFKEELVDGPANGNFVLELDFEPFTASFPKPTLTKS  501
            GVWEYV VNV AL VEEL V EYL FKEELVDG +NGNFVLELDFEPF+ASFP+PTL+K 
Sbjct  91   GVWEYVRVNVQALVVEELRVAEYLHFKEELVDGGSNGNFVLELDFEPFSASFPRPTLSKY  150

Query  502  IGXGVEFL  525
            IG GVEFL
Sbjct  151  IGNGVEFL  158


 Score =   114 bits (286),  Expect(2) = 1e-51, Method: Compositional matrix adjust.
 Identities = 56/87 (64%), Positives = 70/87 (80%), Gaps = 0/87 (0%)
 Frame = +2

Query  62   LTRVHSLRERLDATLTAHRNEILLFMSKIESHGKGILKPHQLLAEFEAICKEDQEKLNDH  241
            LTRV S+RERLD TL  HRNEI+  +++IE  GKGIL+ HQ++AEFEAI +E ++ L   
Sbjct  4    LTRVQSIRERLDETLKTHRNEIVALLTRIEGKGKGILQHHQIIAEFEAIPEEIRKILAGG  63

Query  242  AFQQVLKSTQEAIVLPPWVALAIRLRP  322
            AF +VL+STQEAIVLPPWVALA+R RP
Sbjct  64   AFSEVLRSTQEAIVLPPWVALAVRPRP  90



>gb|ADW80608.1| sucrose synthase 2 [Populus tomentosa]
Length=803

 Score =   115 bits (287),  Expect(2) = 1e-51, Method: Compositional matrix adjust.
 Identities = 55/68 (81%), Positives = 59/68 (87%), Gaps = 0/68 (0%)
 Frame = +1

Query  322  GVWEYVTVNVHALXVEELTVPEYLQFKEELVDGPANGNFVLELDFEPFTASFPKPTLTKS  501
            GVWEYV VNV AL VEEL V EYL FKEELVDG +NGNFVLELDFEPF+ASFP+PTL+K 
Sbjct  91   GVWEYVRVNVQALVVEELRVAEYLHFKEELVDGGSNGNFVLELDFEPFSASFPRPTLSKY  150

Query  502  IGXGVEFL  525
            IG GVEFL
Sbjct  151  IGNGVEFL  158


 Score =   114 bits (286),  Expect(2) = 1e-51, Method: Compositional matrix adjust.
 Identities = 56/87 (64%), Positives = 70/87 (80%), Gaps = 0/87 (0%)
 Frame = +2

Query  62   LTRVHSLRERLDATLTAHRNEILLFMSKIESHGKGILKPHQLLAEFEAICKEDQEKLNDH  241
            LTRV S+RERLD TL  HRNEI+  +++IE  GKGIL+ HQ++AEFEAI +E ++ L   
Sbjct  4    LTRVQSIRERLDETLKTHRNEIVALLTRIEGKGKGILQHHQIIAEFEAIPEEIRKILAGG  63

Query  242  AFQQVLKSTQEAIVLPPWVALAIRLRP  322
            AF +VL+STQEAIVLPPWVALA+R RP
Sbjct  64   AFSEVLRSTQEAIVLPPWVALAVRPRP  90



>gb|ADW80598.1| sucrose synthase 2 [Populus tomentosa]
Length=803

 Score =   114 bits (286),  Expect(2) = 1e-51, Method: Compositional matrix adjust.
 Identities = 56/87 (64%), Positives = 70/87 (80%), Gaps = 0/87 (0%)
 Frame = +2

Query  62   LTRVHSLRERLDATLTAHRNEILLFMSKIESHGKGILKPHQLLAEFEAICKEDQEKLNDH  241
            LTRV S+RERLD TL  HRNEI+  +++IE  GKGIL+ HQ++AEFEAI +E ++ L   
Sbjct  4    LTRVQSIRERLDETLKTHRNEIVALLTRIEGKGKGILQHHQIIAEFEAIPEEIRKILAGG  63

Query  242  AFQQVLKSTQEAIVLPPWVALAIRLRP  322
            AF +VL+STQEAIVLPPWVALA+R RP
Sbjct  64   AFSEVLRSTQEAIVLPPWVALAVRPRP  90


 Score =   114 bits (286),  Expect(2) = 1e-51, Method: Composition-based stats.
 Identities = 54/68 (79%), Positives = 58/68 (85%), Gaps = 0/68 (0%)
 Frame = +1

Query  322  GVWEYVTVNVHALXVEELTVPEYLQFKEELVDGPANGNFVLELDFEPFTASFPKPTLTKS  501
            GVWEYV VNV AL VEEL V EYL FK ELVDG +NGNFVLELDFEPF+ASFP+PTL+K 
Sbjct  91   GVWEYVRVNVQALVVEELRVAEYLHFKVELVDGGSNGNFVLELDFEPFSASFPRPTLSKY  150

Query  502  IGXGVEFL  525
            IG GVEFL
Sbjct  151  IGNGVEFL  158



>gb|ADW80603.1| sucrose synthase 2 [Populus tomentosa]
Length=803

 Score =   115 bits (287),  Expect(2) = 2e-51, Method: Compositional matrix adjust.
 Identities = 55/68 (81%), Positives = 59/68 (87%), Gaps = 0/68 (0%)
 Frame = +1

Query  322  GVWEYVTVNVHALXVEELTVPEYLQFKEELVDGPANGNFVLELDFEPFTASFPKPTLTKS  501
            GVWEYV VNV AL VEEL V EYL FKEELVDG +NGNFVLELDFEPF+ASFP+PTL+K 
Sbjct  91   GVWEYVRVNVQALVVEELRVAEYLHFKEELVDGGSNGNFVLELDFEPFSASFPRPTLSKY  150

Query  502  IGXGVEFL  525
            IG GVEFL
Sbjct  151  IGNGVEFL  158


 Score =   114 bits (286),  Expect(2) = 2e-51, Method: Compositional matrix adjust.
 Identities = 56/87 (64%), Positives = 70/87 (80%), Gaps = 0/87 (0%)
 Frame = +2

Query  62   LTRVHSLRERLDATLTAHRNEILLFMSKIESHGKGILKPHQLLAEFEAICKEDQEKLNDH  241
            LTRV S+RERLD TL  HRNEI+  +++IE  GKGIL+ HQ++AEFEAI +E ++ L   
Sbjct  4    LTRVQSIRERLDETLKTHRNEIVALLTRIEGKGKGILQHHQIIAEFEAIPEEIRKILAGG  63

Query  242  AFQQVLKSTQEAIVLPPWVALAIRLRP  322
            AF +VL+STQEAIVLPPWVALA+R RP
Sbjct  64   AFSEVLRSTQEAIVLPPWVALAVRPRP  90



>gb|ADW80583.1| sucrose synthase 2 [Populus tomentosa]
Length=803

 Score =   115 bits (287),  Expect(2) = 2e-51, Method: Compositional matrix adjust.
 Identities = 55/68 (81%), Positives = 59/68 (87%), Gaps = 0/68 (0%)
 Frame = +1

Query  322  GVWEYVTVNVHALXVEELTVPEYLQFKEELVDGPANGNFVLELDFEPFTASFPKPTLTKS  501
            GVWEYV VNV AL VEEL V EYL FKEELVDG +NGNFVLELDFEPF+ASFP+PTL+K 
Sbjct  91   GVWEYVRVNVQALVVEELRVAEYLHFKEELVDGGSNGNFVLELDFEPFSASFPRPTLSKY  150

Query  502  IGXGVEFL  525
            IG GVEFL
Sbjct  151  IGNGVEFL  158


 Score =   114 bits (285),  Expect(2) = 2e-51, Method: Compositional matrix adjust.
 Identities = 55/87 (63%), Positives = 70/87 (80%), Gaps = 0/87 (0%)
 Frame = +2

Query  62   LTRVHSLRERLDATLTAHRNEILLFMSKIESHGKGILKPHQLLAEFEAICKEDQEKLNDH  241
            LTRV S+RERLD TL  HRNEI+  ++++E  GKGIL+ HQ++AEFEAI +E ++ L   
Sbjct  4    LTRVQSIRERLDETLKTHRNEIVALLTRVEGKGKGILQHHQIIAEFEAIPEEIRKILAGG  63

Query  242  AFQQVLKSTQEAIVLPPWVALAIRLRP  322
            AF +VL+STQEAIVLPPWVALA+R RP
Sbjct  64   AFSEVLRSTQEAIVLPPWVALAVRPRP  90



>gb|ADW80602.1| sucrose synthase 2 [Populus tomentosa]
Length=803

 Score =   115 bits (287),  Expect(2) = 2e-51, Method: Compositional matrix adjust.
 Identities = 55/68 (81%), Positives = 59/68 (87%), Gaps = 0/68 (0%)
 Frame = +1

Query  322  GVWEYVTVNVHALXVEELTVPEYLQFKEELVDGPANGNFVLELDFEPFTASFPKPTLTKS  501
            GVWEYV VNV AL VEEL V EYL FKEELVDG +NGNFVLELDFEPF+ASFP+PTL+K 
Sbjct  91   GVWEYVRVNVQALVVEELRVAEYLHFKEELVDGGSNGNFVLELDFEPFSASFPRPTLSKY  150

Query  502  IGXGVEFL  525
            IG GVEFL
Sbjct  151  IGNGVEFL  158


 Score =   114 bits (285),  Expect(2) = 2e-51, Method: Compositional matrix adjust.
 Identities = 56/87 (64%), Positives = 69/87 (79%), Gaps = 0/87 (0%)
 Frame = +2

Query  62   LTRVHSLRERLDATLTAHRNEILLFMSKIESHGKGILKPHQLLAEFEAICKEDQEKLNDH  241
            LTRV S+RERLD TL  HRNEI+  +++IE  GKGIL+ HQ++AEFEAI +E  + L   
Sbjct  4    LTRVQSIRERLDETLKTHRNEIVALLTRIEGKGKGILQHHQIIAEFEAIPEEIGKILAGG  63

Query  242  AFQQVLKSTQEAIVLPPWVALAIRLRP  322
            AF +VL+STQEAIVLPPWVALA+R RP
Sbjct  64   AFSEVLRSTQEAIVLPPWVALAVRPRP  90



>ref|XP_006838088.1| hypothetical protein AMTR_s00106p00019920 [Amborella trichopoda]
 gb|ERN00657.1| hypothetical protein AMTR_s00106p00019920 [Amborella trichopoda]
Length=810

 Score =   116 bits (290),  Expect(2) = 2e-51, Method: Compositional matrix adjust.
 Identities = 58/93 (62%), Positives = 73/93 (78%), Gaps = 1/93 (1%)
 Frame = +2

Query  47   MAERVLTRVHSLRERLDATLTAHRNEILLFMSKIESHGKGILKPHQLLAEFE-AICKEDQ  223
            MA R LTRV S+RER++ TL+AHRNE++  +S+    GKGIL+PHQLL EFE  I +ED+
Sbjct  1    MATRRLTRVLSMRERVEDTLSAHRNELVCLLSRYVEQGKGILQPHQLLDEFEKVIAEEDR  60

Query  224  EKLNDHAFQQVLKSTQEAIVLPPWVALAIRLRP  322
            +KL+   F  VL+STQEAIVLPPWVALA+R RP
Sbjct  61   QKLSQGLFGDVLRSTQEAIVLPPWVALAVRPRP  93


 Score =   112 bits (281),  Expect(2) = 2e-51, Method: Composition-based stats.
 Identities = 51/68 (75%), Positives = 56/68 (82%), Gaps = 0/68 (0%)
 Frame = +1

Query  322  GVWEYVTVNVHALXVEELTVPEYLQFKEELVDGPANGNFVLELDFEPFTASFPKPTLTKS  501
            GVWEYV VNVH L VE+LTVPEYL+FKEELVDG    NFVLELDFEPF ASFP+P  + S
Sbjct  94   GVWEYVRVNVHELVVEQLTVPEYLRFKEELVDGSCQDNFVLELDFEPFNASFPRPNRSSS  153

Query  502  IGXGVEFL  525
            IG GV+FL
Sbjct  154  IGNGVQFL  161



>ref|XP_006290612.1| hypothetical protein CARUB_v10016702mg [Capsella rubella]
 gb|EOA23510.1| hypothetical protein CARUB_v10016702mg [Capsella rubella]
Length=807

 Score =   122 bits (305),  Expect(2) = 3e-51, Method: Compositional matrix adjust.
 Identities = 61/93 (66%), Positives = 76/93 (82%), Gaps = 0/93 (0%)
 Frame = +2

Query  44   AMAERVLTRVHSLRERLDATLTAHRNEILLFMSKIESHGKGILKPHQLLAEFEAICKEDQ  223
            A AERVLTRVHS RERLD TL AH+NE+L  +S++E+ GKGIL+ HQ++AEFEA+  E Q
Sbjct  2    ANAERVLTRVHSQRERLDETLVAHKNEVLALLSRVEAKGKGILQHHQIIAEFEAMPVEAQ  61

Query  224  EKLNDHAFQQVLKSTQEAIVLPPWVALAIRLRP  322
            +KL   AF ++L+STQEAIVLPP VALA+R RP
Sbjct  62   KKLQGGAFFEILRSTQEAIVLPPLVALAVRPRP  94


 Score =   106 bits (265),  Expect(2) = 3e-51, Method: Composition-based stats.
 Identities = 47/68 (69%), Positives = 54/68 (79%), Gaps = 0/68 (0%)
 Frame = +1

Query  322  GVWEYVTVNVHALXVEELTVPEYLQFKEELVDGPANGNFVLELDFEPFTASFPKPTLTKS  501
            GVWEY+ VNVH L +EEL   EYL FKE+LV+G  NG+F LELDFEPF A+FP+PTL K 
Sbjct  95   GVWEYIRVNVHDLVIEELQASEYLHFKEDLVNGIKNGSFTLELDFEPFNAAFPRPTLNKY  154

Query  502  IGXGVEFL  525
            IG GVEFL
Sbjct  155  IGNGVEFL  162



>ref|XP_003533802.1| PREDICTED: sucrose synthase-like isoform X1 [Glycine max]
 ref|XP_006587064.1| PREDICTED: sucrose synthase-like isoform X2 [Glycine max]
Length=806

 Score =   117 bits (292),  Expect(2) = 4e-51, Method: Compositional matrix adjust.
 Identities = 57/92 (62%), Positives = 71/92 (77%), Gaps = 0/92 (0%)
 Frame = +2

Query  47   MAERVLTRVHSLRERLDATLTAHRNEILLFMSKIESHGKGILKPHQLLAEFEAICKEDQE  226
            MA   LT  HS RER D TLT HRNEIL  +S++E+ GKGIL+ HQ++AEFE I +E ++
Sbjct  1    MANHPLTHSHSFRERFDETLTGHRNEILALLSRLEAKGKGILQHHQVVAEFEEIPEESRK  60

Query  227  KLNDHAFQQVLKSTQEAIVLPPWVALAIRLRP  322
            KL D  F +VL+STQEAIVLPP+VALA+R RP
Sbjct  61   KLQDGVFGEVLRSTQEAIVLPPFVALAVRPRP  92


 Score =   111 bits (277),  Expect(2) = 4e-51, Method: Compositional matrix adjust.
 Identities = 52/68 (76%), Positives = 58/68 (85%), Gaps = 0/68 (0%)
 Frame = +1

Query  322  GVWEYVTVNVHALXVEELTVPEYLQFKEELVDGPANGNFVLELDFEPFTASFPKPTLTKS  501
            GVWEY+ VNVH L V+EL   EYL+FKEELV+G +NGNFVLELDFEPF ASFP+PTL KS
Sbjct  93   GVWEYLRVNVHMLVVDELRPAEYLRFKEELVEGSSNGNFVLELDFEPFNASFPRPTLNKS  152

Query  502  IGXGVEFL  525
            IG GVEFL
Sbjct  153  IGNGVEFL  160



>gb|KHN47619.1| Sucrose synthase [Glycine soja]
Length=806

 Score =   117 bits (292),  Expect(2) = 4e-51, Method: Compositional matrix adjust.
 Identities = 57/92 (62%), Positives = 71/92 (77%), Gaps = 0/92 (0%)
 Frame = +2

Query  47   MAERVLTRVHSLRERLDATLTAHRNEILLFMSKIESHGKGILKPHQLLAEFEAICKEDQE  226
            MA   LT  HS RER D TLT HRNEIL  +S++E+ GKGIL+ HQ++AEFE I +E ++
Sbjct  1    MANHPLTHSHSFRERFDETLTGHRNEILALLSRLEAKGKGILQHHQVVAEFEEIPEESRK  60

Query  227  KLNDHAFQQVLKSTQEAIVLPPWVALAIRLRP  322
            KL D  F +VL+STQEAIVLPP+VALA+R RP
Sbjct  61   KLQDGVFGEVLRSTQEAIVLPPFVALAVRPRP  92


 Score =   111 bits (277),  Expect(2) = 4e-51, Method: Compositional matrix adjust.
 Identities = 52/68 (76%), Positives = 58/68 (85%), Gaps = 0/68 (0%)
 Frame = +1

Query  322  GVWEYVTVNVHALXVEELTVPEYLQFKEELVDGPANGNFVLELDFEPFTASFPKPTLTKS  501
            GVWEY+ VNVH L V+EL   EYL+FKEELV+G +NGNFVLELDFEPF ASFP+PTL KS
Sbjct  93   GVWEYLRVNVHMLVVDELRPAEYLRFKEELVEGSSNGNFVLELDFEPFNASFPRPTLNKS  152

Query  502  IGXGVEFL  525
            IG GVEFL
Sbjct  153  IGNGVEFL  160



>dbj|BAE99649.1| sucrose synthase like protein [Arabidopsis thaliana]
Length=395

 Score =   117 bits (293),  Expect(2) = 4e-51, Method: Compositional matrix adjust.
 Identities = 58/93 (62%), Positives = 74/93 (80%), Gaps = 0/93 (0%)
 Frame = +2

Query  44   AMAERVLTRVHSLRERLDATLTAHRNEILLFMSKIESHGKGILKPHQLLAEFEAICKEDQ  223
            A AERV+TRVHS RERLDATL A +NE+   +S++E+ GKGIL+ HQ++AEFEA+  E Q
Sbjct  2    ANAERVITRVHSQRERLDATLVAQKNEVFALLSRVEAKGKGILQHHQIIAEFEAMPLETQ  61

Query  224  EKLNDHAFQQVLKSTQEAIVLPPWVALAIRLRP  322
            +KL   AF + L+S QEAIVLPP+VALA+R RP
Sbjct  62   KKLKGGAFFEFLRSAQEAIVLPPFVALAVRPRP  94


 Score =   110 bits (275),  Expect(2) = 4e-51, Method: Compositional matrix adjust.
 Identities = 52/68 (76%), Positives = 55/68 (81%), Gaps = 0/68 (0%)
 Frame = +1

Query  322  GVWEYVTVNVHALXVEELTVPEYLQFKEELVDGPANGNFVLELDFEPFTASFPKPTLTKS  501
            GVWEYV VN+H L VEEL   EYLQFKEELVDG  NGNF LELDFEPF A+FP+PTL K 
Sbjct  95   GVWEYVRVNLHDLVVEELQASEYLQFKEELVDGIKNGNFTLELDFEPFNAAFPRPTLNKY  154

Query  502  IGXGVEFL  525
            IG GVEFL
Sbjct  155  IGDGVEFL  162



>ref|XP_010937277.1| PREDICTED: sucrose synthase 2-like [Elaeis guineensis]
Length=816

 Score =   115 bits (289),  Expect(2) = 5e-51, Method: Compositional matrix adjust.
 Identities = 57/93 (61%), Positives = 71/93 (76%), Gaps = 1/93 (1%)
 Frame = +2

Query  47   MAERVLTRVHSLRERLDATLTAHRNEILLFMSKIESHGKGILKPHQLLAEFEAICKE-DQ  223
            MA   L+R+HS+RERL  TL+AH NE++   S+  + GKG+L PHQLLAE+EA+  E D+
Sbjct  1    MATPALSRIHSVRERLGDTLSAHPNELVALFSRFVNQGKGMLLPHQLLAEYEAVIPEVDR  60

Query  224  EKLNDHAFQQVLKSTQEAIVLPPWVALAIRLRP  322
            EKL D  F+ VLK+ QEAIVLPPWVALAIR RP
Sbjct  61   EKLKDGVFEDVLKAAQEAIVLPPWVALAIRPRP  93


 Score =   112 bits (279),  Expect(2) = 5e-51, Method: Compositional matrix adjust.
 Identities = 55/69 (80%), Positives = 59/69 (86%), Gaps = 1/69 (1%)
 Frame = +1

Query  322  GVWEYVTVNVHALXVEELTVPEYLQFKEELVDGPA-NGNFVLELDFEPFTASFPKPTLTK  498
            GVWEYV VNV  L VEELTVPEYLQFKEELVDG   N NFVLELDFEPF ASFP+P+L+K
Sbjct  94   GVWEYVRVNVSELAVEELTVPEYLQFKEELVDGSGHNNNFVLELDFEPFNASFPRPSLSK  153

Query  499  SIGXGVEFL  525
            SIG GV+FL
Sbjct  154  SIGNGVQFL  162



>ref|XP_008783098.1| PREDICTED: sucrose synthase 1 [Phoenix dactylifera]
Length=816

 Score =   115 bits (287),  Expect(2) = 6e-51, Method: Compositional matrix adjust.
 Identities = 57/93 (61%), Positives = 71/93 (76%), Gaps = 1/93 (1%)
 Frame = +2

Query  47   MAERVLTRVHSLRERLDATLTAHRNEILLFMSKIESHGKGILKPHQLLAEFEAICKE-DQ  223
            MA   L+R+HS+RERL  TL+AH NE++   S+  + GKG+L PHQLLAE+EA+  E D+
Sbjct  1    MATPPLSRIHSVRERLGDTLSAHPNELVALFSRFVNQGKGMLLPHQLLAEYEAVIPEGDR  60

Query  224  EKLNDHAFQQVLKSTQEAIVLPPWVALAIRLRP  322
            EKL D  F+ VLK+ QEAIVLPPWVALAIR RP
Sbjct  61   EKLKDGVFEDVLKAAQEAIVLPPWVALAIRPRP  93


 Score =   112 bits (280),  Expect(2) = 6e-51, Method: Compositional matrix adjust.
 Identities = 55/69 (80%), Positives = 60/69 (87%), Gaps = 1/69 (1%)
 Frame = +1

Query  322  GVWEYVTVNVHALXVEELTVPEYLQFKEELVDGPA-NGNFVLELDFEPFTASFPKPTLTK  498
            GVWEYV VNV  L VEELTVPEYLQFKEELVDG + N NFVLELDFEPF ASFP+P+L+K
Sbjct  94   GVWEYVRVNVSELAVEELTVPEYLQFKEELVDGSSQNNNFVLELDFEPFNASFPRPSLSK  153

Query  499  SIGXGVEFL  525
            SIG GV+FL
Sbjct  154  SIGNGVQFL  162



>ref|XP_004488146.1| PREDICTED: sucrose synthase-like isoform X6 [Cicer arietinum]
Length=806

 Score =   115 bits (289),  Expect(2) = 6e-51, Method: Compositional matrix adjust.
 Identities = 56/92 (61%), Positives = 73/92 (79%), Gaps = 0/92 (0%)
 Frame = +2

Query  47   MAERVLTRVHSLRERLDATLTAHRNEILLFMSKIESHGKGILKPHQLLAEFEAICKEDQE  226
            M    LTR HS+R+R D  LT HRNEIL  +S+IE+ GKGIL+ HQ++AEFE I +E+++
Sbjct  1    MGSDRLTRSHSIRQRFDEILTGHRNEILALLSRIEAKGKGILQHHQVIAEFEEIPEENRQ  60

Query  227  KLNDHAFQQVLKSTQEAIVLPPWVALAIRLRP  322
            KL + AF +VL+STQEAIVLPP+VALA+R RP
Sbjct  61   KLVNGAFGEVLRSTQEAIVLPPFVALAVRPRP  92


 Score =   111 bits (278),  Expect(2) = 6e-51, Method: Compositional matrix adjust.
 Identities = 51/68 (75%), Positives = 59/68 (87%), Gaps = 0/68 (0%)
 Frame = +1

Query  322  GVWEYVTVNVHALXVEELTVPEYLQFKEELVDGPANGNFVLELDFEPFTASFPKPTLTKS  501
            GVWEY+ V+VH L V+EL+  EYL+FKEELV+G +NGNFVLELDFEPF ASFP+PTL KS
Sbjct  93   GVWEYLRVDVHGLVVDELSAAEYLKFKEELVEGSSNGNFVLELDFEPFNASFPRPTLNKS  152

Query  502  IGXGVEFL  525
            IG GVEFL
Sbjct  153  IGNGVEFL  160



>gb|ADW80590.1| sucrose synthase 2 [Populus tomentosa]
Length=803

 Score =   114 bits (286),  Expect(2) = 1e-50, Method: Compositional matrix adjust.
 Identities = 55/68 (81%), Positives = 59/68 (87%), Gaps = 0/68 (0%)
 Frame = +1

Query  322  GVWEYVTVNVHALXVEELTVPEYLQFKEELVDGPANGNFVLELDFEPFTASFPKPTLTKS  501
            GVWEYV VNV AL VEEL V EYL FKEELVDG +NGNFVLELDFEPF+ASFP+PTL+K 
Sbjct  91   GVWEYVRVNVQALVVEELRVTEYLHFKEELVDGGSNGNFVLELDFEPFSASFPRPTLSKY  150

Query  502  IGXGVEFL  525
            IG GVEFL
Sbjct  151  IGNGVEFL  158


 Score =   112 bits (279),  Expect(2) = 1e-50, Method: Compositional matrix adjust.
 Identities = 55/87 (63%), Positives = 69/87 (79%), Gaps = 0/87 (0%)
 Frame = +2

Query  62   LTRVHSLRERLDATLTAHRNEILLFMSKIESHGKGILKPHQLLAEFEAICKEDQEKLNDH  241
            LTRV S+RERL  TL  HRNEI+  +++IE  GKGIL+ HQ++AEFEAI +E ++ L   
Sbjct  4    LTRVQSIRERLGETLKTHRNEIVALLTRIEGKGKGILQHHQIIAEFEAIPEEIRKILAGG  63

Query  242  AFQQVLKSTQEAIVLPPWVALAIRLRP  322
            AF +VL+STQEAIVLPPWVALA+R RP
Sbjct  64   AFSEVLRSTQEAIVLPPWVALAVRPRP  90



>gb|ADW80605.1| sucrose synthase 2 [Populus tomentosa]
Length=803

 Score =   114 bits (286),  Expect(2) = 1e-50, Method: Compositional matrix adjust.
 Identities = 56/87 (64%), Positives = 70/87 (80%), Gaps = 0/87 (0%)
 Frame = +2

Query  62   LTRVHSLRERLDATLTAHRNEILLFMSKIESHGKGILKPHQLLAEFEAICKEDQEKLNDH  241
            LTRV S+RERLD TL  HRNEI+  +++IE  GKGIL+ HQ++AEFEAI +E ++ L   
Sbjct  4    LTRVQSIRERLDETLKTHRNEIVALLTRIEGKGKGILQHHQIIAEFEAIPEEIRKILAGG  63

Query  242  AFQQVLKSTQEAIVLPPWVALAIRLRP  322
            AF +VL+STQEAIVLPPWVALA+R RP
Sbjct  64   AFSEVLRSTQEAIVLPPWVALAVRPRP  90


 Score =   111 bits (278),  Expect(2) = 1e-50, Method: Compositional matrix adjust.
 Identities = 54/68 (79%), Positives = 58/68 (85%), Gaps = 0/68 (0%)
 Frame = +1

Query  322  GVWEYVTVNVHALXVEELTVPEYLQFKEELVDGPANGNFVLELDFEPFTASFPKPTLTKS  501
            GVWEYV VNV AL VEEL V EYL FKEE VDG +NGNFVLELDFEPF+ASFP+PTL+K 
Sbjct  91   GVWEYVRVNVQALVVEELRVAEYLHFKEEPVDGGSNGNFVLELDFEPFSASFPRPTLSKY  150

Query  502  IGXGVEFL  525
            IG GVEFL
Sbjct  151  IGNGVEFL  158



>ref|XP_009390882.1| PREDICTED: sucrose synthase 2-like [Musa acuminata subsp. malaccensis]
Length=816

 Score =   114 bits (284),  Expect(2) = 2e-50, Method: Composition-based stats.
 Identities = 53/69 (77%), Positives = 59/69 (86%), Gaps = 1/69 (1%)
 Frame = +1

Query  322  GVWEYVTVNVHALXVEELTVPEYLQFKEELVDGPA-NGNFVLELDFEPFTASFPKPTLTK  498
            GVWEYV VN+  L VEELTVPEYLQFKEEL DG + N NFVLELDFEPF ASFP+P+L+K
Sbjct  94   GVWEYVRVNISELAVEELTVPEYLQFKEELADGSSQNSNFVLELDFEPFNASFPRPSLSK  153

Query  499  SIGXGVEFL  525
            SIG GV+FL
Sbjct  154  SIGNGVQFL  162


 Score =   112 bits (280),  Expect(2) = 2e-50, Method: Composition-based stats.
 Identities = 52/93 (56%), Positives = 72/93 (77%), Gaps = 1/93 (1%)
 Frame = +2

Query  47   MAERVLTRVHSLRERLDATLTAHRNEILLFMSKIESHGKGILKPHQLLAEFEAICKE-DQ  223
            M++R LTR HS+RER+  +L++H NE++   S+    GKG+L+PHQLLAE+ A+  E D+
Sbjct  1    MSQRTLTRAHSVRERIGDSLSSHPNELVALFSRFVHQGKGMLQPHQLLAEYGAVFSEADR  60

Query  224  EKLNDHAFQQVLKSTQEAIVLPPWVALAIRLRP  322
            EKL D AF+ V+++ QEAIV+PPWVALAIR RP
Sbjct  61   EKLKDGAFEDVIQAAQEAIVIPPWVALAIRPRP  93



>ref|XP_008800466.1| PREDICTED: sucrose synthase 2 [Phoenix dactylifera]
 ref|XP_008800467.1| PREDICTED: sucrose synthase 2 [Phoenix dactylifera]
Length=815

 Score =   116 bits (291),  Expect(2) = 2e-50, Method: Compositional matrix adjust.
 Identities = 57/93 (61%), Positives = 71/93 (76%), Gaps = 1/93 (1%)
 Frame = +2

Query  47   MAERVLTRVHSLRERLDATLTAHRNEILLFMSKIESHGKGILKPHQLLAEFEAICKE-DQ  223
            MA   L+R+HS+RERL  TL+AH NE++   S+  + GKG+L PHQLLAE+EA+  E D+
Sbjct  1    MASPTLSRIHSVRERLGDTLSAHPNELVALFSRFVNQGKGMLLPHQLLAEYEAVIPEADR  60

Query  224  EKLNDHAFQQVLKSTQEAIVLPPWVALAIRLRP  322
            EKL D  F+ VLK+ QEAIVLPPWVALAIR RP
Sbjct  61   EKLKDGVFEDVLKAAQEAIVLPPWVALAIRPRP  93


 Score =   109 bits (272),  Expect(2) = 2e-50, Method: Compositional matrix adjust.
 Identities = 50/68 (74%), Positives = 57/68 (84%), Gaps = 0/68 (0%)
 Frame = +1

Query  322  GVWEYVTVNVHALXVEELTVPEYLQFKEELVDGPANGNFVLELDFEPFTASFPKPTLTKS  501
            GVW+YV VNV  L VEELTVP+YLQFKEELVDG +  NF LELD EPF ASFP+P+L+KS
Sbjct  94   GVWQYVRVNVSELAVEELTVPQYLQFKEELVDGSSQNNFALELDLEPFNASFPRPSLSKS  153

Query  502  IGXGVEFL  525
            IG GV+FL
Sbjct  154  IGNGVQFL  161



>emb|CAA57881.1| sucrose synthase [Oxybasis rubra]
Length=803

 Score =   119 bits (299),  Expect(2) = 2e-50, Method: Compositional matrix adjust.
 Identities = 61/92 (66%), Positives = 73/92 (79%), Gaps = 3/92 (3%)
 Frame = +2

Query  47   MAERVLTRVHSLRERLDATLTAHRNEILLFMSKIESHGKGILKPHQLLAEFEAICKEDQE  226
            MA R LTRV SL+ERLD TLTA RNEIL F+S+I SHGKGIL+PH+LL+EFEA+   D+ 
Sbjct  1    MAGR-LTRVPSLKERLDETLTAQRNEILSFLSRIVSHGKGILQPHELLSEFEAVS--DKH  57

Query  227  KLNDHAFQQVLKSTQEAIVLPPWVALAIRLRP  322
            KL D  F +V + TQEAIVLPPW+ LA+R RP
Sbjct  58   KLADGPFGEVFRHTQEAIVLPPWITLAVRPRP  89


 Score =   106 bits (264),  Expect(2) = 2e-50, Method: Composition-based stats.
 Identities = 51/69 (74%), Positives = 56/69 (81%), Gaps = 1/69 (1%)
 Frame = +1

Query  322  GVWEYVTVNVHALXVEELTVPEYLQFKEELVDGPANGNFVL-ELDFEPFTASFPKPTLTK  498
            GVWEY+ VNV  L VEELT  ++L  KEELVDG  NGNFVL ELDFEPF ASFP+PTL+K
Sbjct  90   GVWEYIRVNVDELAVEELTPSQFLHVKEELVDGSVNGNFVLDELDFEPFNASFPRPTLSK  149

Query  499  SIGXGVEFL  525
            SIG GVEFL
Sbjct  150  SIGNGVEFL  158



>gb|ADY02961.1| sucrose synthase [Dendrobium catenatum]
Length=807

 Score =   112 bits (281),  Expect(2) = 3e-50, Method: Compositional matrix adjust.
 Identities = 53/68 (78%), Positives = 59/68 (87%), Gaps = 0/68 (0%)
 Frame = +1

Query  322  GVWEYVTVNVHALXVEELTVPEYLQFKEELVDGPANGNFVLELDFEPFTASFPKPTLTKS  501
            GVWEYV VNV  L VEELTVPEYLQFKEELV+G +  NFVLELDFEPF ASFP+P+L+KS
Sbjct  95   GVWEYVRVNVSELAVEELTVPEYLQFKEELVEGRSESNFVLELDFEPFNASFPRPSLSKS  154

Query  502  IGXGVEFL  525
            IG GV+FL
Sbjct  155  IGNGVQFL  162


 Score =   112 bits (280),  Expect(2) = 3e-50, Method: Compositional matrix adjust.
 Identities = 54/90 (60%), Positives = 68/90 (76%), Gaps = 1/90 (1%)
 Frame = +2

Query  56   RVLTRVHSLRERLDATLTAHRNEILLFMSKIESHGKGILKPHQLLAEFEAICKE-DQEKL  232
            R LTR+HS+RERL  TL+AH NE+L   S+    GKG+L PHQ+LAE+E++  E D+EKL
Sbjct  5    RTLTRIHSIRERLGDTLSAHTNELLSLFSRFVKQGKGMLLPHQILAEYESVIPEADREKL  64

Query  233  NDHAFQQVLKSTQEAIVLPPWVALAIRLRP  322
             +  F+ VLK+ QEAIV PPWVALAIR RP
Sbjct  65   KNGGFEDVLKAAQEAIVTPPWVALAIRPRP  94



>ref|XP_003546526.1| PREDICTED: sucrose synthase-like isoform X1 [Glycine max]
 ref|XP_006597891.1| PREDICTED: sucrose synthase-like isoform X2 [Glycine max]
Length=806

 Score =   114 bits (284),  Expect(2) = 3e-50, Method: Compositional matrix adjust.
 Identities = 56/92 (61%), Positives = 70/92 (76%), Gaps = 0/92 (0%)
 Frame = +2

Query  47   MAERVLTRVHSLRERLDATLTAHRNEILLFMSKIESHGKGILKPHQLLAEFEAICKEDQE  226
            MA   LT  HS RER D TLT HRNEIL  +S++E+ GKGIL+ HQ++AEFE I +E ++
Sbjct  1    MANHPLTHSHSFRERFDETLTGHRNEILALLSRLEAKGKGILQHHQVVAEFEEIPEESRK  60

Query  227  KLNDHAFQQVLKSTQEAIVLPPWVALAIRLRP  322
            KL    F +VL+STQEAIVLPP+VALA+R RP
Sbjct  61   KLQGGVFGEVLRSTQEAIVLPPFVALAVRPRP  92


 Score =   110 bits (276),  Expect(2) = 3e-50, Method: Compositional matrix adjust.
 Identities = 52/68 (76%), Positives = 58/68 (85%), Gaps = 0/68 (0%)
 Frame = +1

Query  322  GVWEYVTVNVHALXVEELTVPEYLQFKEELVDGPANGNFVLELDFEPFTASFPKPTLTKS  501
            GVWEY+ VNVH L V+EL   EYL+FKEELV+G +NGNFVLELDFEPF ASFP+PTL KS
Sbjct  93   GVWEYLRVNVHMLVVDELLPAEYLRFKEELVEGSSNGNFVLELDFEPFNASFPRPTLNKS  152

Query  502  IGXGVEFL  525
            IG GVEFL
Sbjct  153  IGNGVEFL  160



>gb|KHN49081.1| Sucrose synthase [Glycine soja]
Length=806

 Score =   114 bits (285),  Expect(2) = 6e-50, Method: Compositional matrix adjust.
 Identities = 56/92 (61%), Positives = 70/92 (76%), Gaps = 0/92 (0%)
 Frame = +2

Query  47   MAERVLTRVHSLRERLDATLTAHRNEILLFMSKIESHGKGILKPHQLLAEFEAICKEDQE  226
            MA   LT  HS RER D TLT HRNEIL  +S++E+ GKGIL+ HQ++AEFE I +E ++
Sbjct  1    MANHPLTHSHSFRERFDETLTGHRNEILALLSRLEAKGKGILQHHQVVAEFEEIPEESRK  60

Query  227  KLNDHAFQQVLKSTQEAIVLPPWVALAIRLRP  322
            KL    F +VL+STQEAIVLPP+VALA+R RP
Sbjct  61   KLQGGVFGEVLRSTQEAIVLPPFVALAVRPRP  92


 Score =   110 bits (274),  Expect(2) = 6e-50, Method: Compositional matrix adjust.
 Identities = 51/68 (75%), Positives = 58/68 (85%), Gaps = 0/68 (0%)
 Frame = +1

Query  322  GVWEYVTVNVHALXVEELTVPEYLQFKEELVDGPANGNFVLELDFEPFTASFPKPTLTKS  501
            GVWEY+ VNVH L V++L   EYL+FKEELV+G +NGNFVLELDFEPF ASFP+PTL KS
Sbjct  93   GVWEYLRVNVHMLVVDDLRPAEYLRFKEELVEGSSNGNFVLELDFEPFNASFPRPTLNKS  152

Query  502  IGXGVEFL  525
            IG GVEFL
Sbjct  153  IGNGVEFL  160



>ref|XP_006287059.1| hypothetical protein CARUB_v10000208mg, partial [Capsella rubella]
 gb|EOA19957.1| hypothetical protein CARUB_v10000208mg, partial [Capsella rubella]
Length=850

 Score =   118 bits (295),  Expect(2) = 8e-50, Method: Compositional matrix adjust.
 Identities = 57/93 (61%), Positives = 76/93 (82%), Gaps = 0/93 (0%)
 Frame = +2

Query  44   AMAERVLTRVHSLRERLDATLTAHRNEILLFMSKIESHGKGILKPHQLLAEFEAICKEDQ  223
            A AER++TRVHS RERL+ TL + RNE+L  +S++E+ GKGIL+ +Q++AEFEA+ ++ Q
Sbjct  44   ANAERMITRVHSQRERLNETLVSERNEVLALLSRVEAKGKGILQQNQIIAEFEALPEQTQ  103

Query  224  EKLNDHAFQQVLKSTQEAIVLPPWVALAIRLRP  322
            +KL   AF  +LKSTQEAIVLPPWVALA+R RP
Sbjct  104  KKLEGGAFFDLLKSTQEAIVLPPWVALAVRPRP  136


 Score =   105 bits (263),  Expect(2) = 8e-50, Method: Compositional matrix adjust.
 Identities = 50/68 (74%), Positives = 55/68 (81%), Gaps = 0/68 (0%)
 Frame = +1

Query  322  GVWEYVTVNVHALXVEELTVPEYLQFKEELVDGPANGNFVLELDFEPFTASFPKPTLTKS  501
            GVWEY+ VN+HAL VEEL   E+L FKEELVDG  NG+F LELDFEPF ASFP+PTL K 
Sbjct  137  GVWEYLRVNLHALVVEELQPSEFLHFKEELVDGVKNGDFTLELDFEPFNASFPRPTLHKY  196

Query  502  IGXGVEFL  525
            IG GVEFL
Sbjct  197  IGDGVEFL  204



>ref|XP_009390318.1| PREDICTED: sucrose synthase 2-like [Musa acuminata subsp. malaccensis]
Length=815

 Score =   112 bits (281),  Expect(2) = 8e-50, Method: Compositional matrix adjust.
 Identities = 52/68 (76%), Positives = 58/68 (85%), Gaps = 0/68 (0%)
 Frame = +1

Query  322  GVWEYVTVNVHALXVEELTVPEYLQFKEELVDGPANGNFVLELDFEPFTASFPKPTLTKS  501
            GVWEYV VN+  L VEELTVPEYL FKEELVDG +  NFVLELDFEPF ASFP+P+L+KS
Sbjct  94   GVWEYVRVNISELAVEELTVPEYLHFKEELVDGSSQNNFVLELDFEPFNASFPRPSLSKS  153

Query  502  IGXGVEFL  525
            IG GV+FL
Sbjct  154  IGNGVQFL  161


 Score =   110 bits (276),  Expect(2) = 8e-50, Method: Compositional matrix adjust.
 Identities = 53/93 (57%), Positives = 70/93 (75%), Gaps = 1/93 (1%)
 Frame = +2

Query  47   MAERVLTRVHSLRERLDATLTAHRNEILLFMSKIESHGKGILKPHQLLAEFEAICKE-DQ  223
            M +R LTR HS+RER+  +L++H NE++   S+    GKG+L+PHQLLAE+ A   E D+
Sbjct  1    MPQRSLTRAHSVRERIGDSLSSHPNELVALFSRFIHQGKGMLQPHQLLAEYAAAFSEADK  60

Query  224  EKLNDHAFQQVLKSTQEAIVLPPWVALAIRLRP  322
            EKL D AF+ V+K+ QEAIV+PPWVALAIR RP
Sbjct  61   EKLKDGAFEDVIKAAQEAIVIPPWVALAIRPRP  93



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 561572122600