BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFF037P11

Length=496
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009610601.1|  PREDICTED: glucan endo-1,3-beta-glucosidase        160   2e-47   Nicotiana tomentosiformis
ref|XP_009791207.1|  PREDICTED: glucan endo-1,3-beta-glucosidase-...    158   1e-46   Nicotiana sylvestris
ref|XP_006345964.1|  PREDICTED: glucan endo-1,3-beta-glucosidase-...    154   7e-46   Solanum tuberosum [potatoes]
ref|XP_011091523.1|  PREDICTED: glucan endo-1,3-beta-glucosidase-...    162   2e-45   Sesamum indicum [beniseed]
ref|XP_004239793.1|  PREDICTED: glucan endo-1,3-beta-glucosidase        153   2e-45   Solanum lycopersicum
ref|NP_001234416.1|  beta-glucosidase 08 precursor                      153   2e-43   Solanum lycopersicum
ref|NP_001275174.1|  glucan endo-1,3-beta-glucosidase-like precursor    151   5e-43   Solanum tuberosum [potatoes]
gb|AHL24654.1|  Fra e 9.01 allergen                                     153   9e-43   Fraxinus excelsior
ref|XP_009593199.1|  PREDICTED: glucan endo-1,3-beta-glucosidase-...    153   2e-42   Nicotiana tomentosiformis
gb|AHL24655.1|  Fra e 9.02 allergen                                     152   2e-42   Fraxinus excelsior
ref|XP_009789910.1|  PREDICTED: glucan endo-1,3-beta-glucosidase-...    151   8e-42   Nicotiana sylvestris
gb|EYU33213.1|  hypothetical protein MIMGU_mgv1a006294mg                151   8e-41   Erythranthe guttata [common monkey flower]
emb|CDP00093.1|  unnamed protein product                                145   2e-40   Coffea canephora [robusta coffee]
gb|EPS63364.1|  glycoside hydrolase                                     148   3e-40   Genlisea aurea
ref|XP_011101632.1|  PREDICTED: glucan endo-1,3-beta-glucosidase-...    137   7e-38   
gb|EPS69142.1|  hypothetical protein M569_05624                         142   2e-37   Genlisea aurea
ref|XP_010091462.1|  putative glucan endo-1,3-beta-glucosidase A6       133   1e-35   
ref|XP_003552703.1|  PREDICTED: glucan endo-1,3-beta-glucosidase        138   2e-35   Glycine max [soybeans]
emb|CBI31680.3|  unnamed protein product                                137   4e-35   Vitis vinifera
ref|XP_002283647.1|  PREDICTED: glucan endo-1,3-beta-glucosidase        137   7e-35   Vitis vinifera
ref|XP_004516968.1|  PREDICTED: glucan endo-1,3-beta-glucosidase-...    135   3e-34   Cicer arietinum [garbanzo]
gb|KCW85568.1|  hypothetical protein EUGRSUZ_B02365                     133   6e-34   Eucalyptus grandis [rose gum]
ref|XP_010043554.1|  PREDICTED: glucan endo-1,3-beta-glucosidase-...    132   8e-34   Eucalyptus grandis [rose gum]
ref|XP_003622030.1|  Glucan endo-1,3-beta-glucosidase                   133   1e-33   Medicago truncatula
ref|XP_010043553.1|  PREDICTED: glucan endo-1,3-beta-glucosidase-...    132   1e-33   Eucalyptus grandis [rose gum]
ref|XP_004167482.1|  PREDICTED: glucan endo-1,3-beta-glucosidase-...    133   2e-33   
ref|XP_004147695.1|  PREDICTED: glucan endo-1,3-beta-glucosidase-...    132   2e-33   
ref|XP_010043555.1|  PREDICTED: glucan endo-1,3-beta-glucosidase-...    133   2e-33   Eucalyptus grandis [rose gum]
gb|KCW85570.1|  hypothetical protein EUGRSUZ_B02367                     132   2e-33   Eucalyptus grandis [rose gum]
ref|XP_008461659.1|  PREDICTED: glucan endo-1,3-beta-glucosidase        132   3e-33   Cucumis melo [Oriental melon]
gb|KJB73920.1|  hypothetical protein B456_011G261000                    131   3e-33   Gossypium raimondii
ref|XP_007139210.1|  hypothetical protein PHAVU_008G010600g             132   3e-33   Phaseolus vulgaris [French bean]
ref|XP_002530863.1|  Glucan endo-1,3-beta-glucosidase precursor, ...    132   5e-33   Ricinus communis
ref|XP_010922329.1|  PREDICTED: glucan endo-1,3-beta-glucosidase-...    131   7e-33   Elaeis guineensis
gb|EYU19897.1|  hypothetical protein MIMGU_mgv1a006105mg                131   7e-33   Erythranthe guttata [common monkey flower]
ref|XP_002530862.1|  Glucan endo-1,3-beta-glucosidase precursor, ...    131   7e-33   
emb|CAB85903.1|  beta-1,3 glucanase                                     131   9e-33   Pisum sativum [garden pea]
ref|XP_011029669.1|  PREDICTED: glucan endo-1,3-beta-glucosidase-...    131   9e-33   Populus euphratica
emb|CDY41232.1|  BnaC08g26260D                                          130   1e-32   Brassica napus [oilseed rape]
ref|XP_009405069.1|  PREDICTED: glucan endo-1,3-beta-glucosidase-...    130   1e-32   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_011470609.1|  PREDICTED: glucan endo-1,3-beta-glucosidase-...    132   3e-32   Fragaria vesca subsp. vesca
gb|ABK95730.1|  unknown                                                 129   3e-32   Populus trichocarpa [western balsam poplar]
ref|XP_002312097.1|  hypothetical protein POPTR_0008s05600g             129   3e-32   Populus trichocarpa [western balsam poplar]
ref|XP_008802734.1|  PREDICTED: glucan endo-1,3-beta-glucosidase        129   3e-32   Phoenix dactylifera
emb|CDY62387.1|  BnaCnng40170D                                          129   3e-32   Brassica napus [oilseed rape]
emb|CDY53692.1|  BnaA07g37860D                                          129   4e-32   Brassica napus [oilseed rape]
gb|KDP44958.1|  hypothetical protein JCGZ_01458                         129   5e-32   Jatropha curcas
ref|XP_010534498.1|  PREDICTED: glucan endo-1,3-beta-glucosidase        129   5e-32   Tarenaya hassleriana [spider flower]
ref|XP_010256938.1|  PREDICTED: glucan endo-1,3-beta-glucosidase-...    129   5e-32   Nelumbo nucifera [Indian lotus]
ref|XP_009116238.1|  PREDICTED: glucan endo-1,3-beta-glucosidase-...    128   1e-31   
ref|XP_010106478.1|  Glucan endo-1,3-beta-glucosidase                   128   1e-31   
emb|CDY41234.1|  BnaC08g26240D                                          127   2e-31   Brassica napus [oilseed rape]
ref|XP_009103956.1|  PREDICTED: glucan endo-1,3-beta-glucosidase-...    127   2e-31   Brassica rapa
ref|XP_002878033.1|  hypothetical protein ARALYDRAFT_485970             127   2e-31   
emb|CDY40219.1|  BnaA09g35010D                                          127   2e-31   Brassica napus [oilseed rape]
ref|XP_006403459.1|  hypothetical protein EUTSA_v10010363mg             127   3e-31   Eutrema salsugineum [saltwater cress]
gb|KJB37375.1|  hypothetical protein B456_006G202300                    127   3e-31   Gossypium raimondii
ref|XP_009345986.1|  PREDICTED: glucan endo-1,3-beta-glucosidase-...    127   3e-31   Pyrus x bretschneideri [bai li]
ref|XP_009353665.1|  PREDICTED: glucan endo-1,3-beta-glucosidase-...    127   3e-31   Pyrus x bretschneideri [bai li]
ref|XP_009345982.1|  PREDICTED: glucan endo-1,3-beta-glucosidase-...    127   3e-31   Pyrus x bretschneideri [bai li]
gb|AAM66982.1|  beta-1,3-glucanase-like protein                         125   6e-31   Arabidopsis thaliana [mouse-ear cress]
emb|CDY40218.1|  BnaA09g35000D                                          125   6e-31   Brassica napus [oilseed rape]
gb|AAK76666.1|  putative beta-1,3-glucanase                             125   6e-31   Arabidopsis thaliana [mouse-ear cress]
ref|NP_191103.1|  O-Glycosyl hydrolases family 17 protein               125   6e-31   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010034118.1|  PREDICTED: glucan endo-1,3-beta-glucosidase        125   6e-31   Eucalyptus grandis [rose gum]
ref|XP_010043552.1|  PREDICTED: glucan endo-1,3-beta-glucosidase-...    125   7e-31   
gb|KHF99783.1|  Glucan endo-1,3-beta-glucosidase                        126   7e-31   Gossypium arboreum [tree cotton]
ref|XP_009116237.1|  PREDICTED: glucan endo-1,3-beta-glucosidase-...    125   7e-31   Brassica rapa
ref|XP_004307514.1|  PREDICTED: glucan endo-1,3-beta-glucosidase-...    125   8e-31   Fragaria vesca subsp. vesca
gb|KCW85567.1|  hypothetical protein EUGRSUZ_B02364                     125   8e-31   Eucalyptus grandis [rose gum]
ref|XP_003561280.1|  PREDICTED: glucan endo-1,3-beta-glucosidase-...    125   9e-31   Brachypodium distachyon [annual false brome]
ref|XP_010937626.1|  PREDICTED: glucan endo-1,3-beta-glucosidase-...    125   1e-30   Elaeis guineensis
ref|XP_010690542.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    117   1e-30   
ref|XP_011035318.1|  PREDICTED: glucan endo-1,3-beta-glucosidase-...    125   1e-30   Populus euphratica
ref|XP_008343598.1|  PREDICTED: glucan endo-1,3-beta-glucosidase-...    124   1e-30   
ref|XP_010690550.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    117   2e-30   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_008457482.1|  PREDICTED: glucan endo-1,3-beta-glucosidase        125   2e-30   
ref|XP_010516112.1|  PREDICTED: glucan endo-1,3-beta-glucosidase-...    123   2e-30   Camelina sativa [gold-of-pleasure]
ref|XP_007220314.1|  hypothetical protein PRUPE_ppa005160m1g            123   2e-30   
ref|XP_010504397.1|  PREDICTED: glucan endo-1,3-beta-glucosidase-...    123   2e-30   Camelina sativa [gold-of-pleasure]
ref|XP_007205054.1|  hypothetical protein PRUPE_ppa004320mg             124   2e-30   Prunus persica
ref|XP_004151673.1|  PREDICTED: glucan endo-1,3-beta-glucosidase-...    124   3e-30   
ref|XP_006291113.1|  hypothetical protein CARUB_v10017225mg             122   4e-30   Capsella rubella
emb|CDY02936.1|  BnaC04g25500D                                          123   4e-30   
ref|XP_011027355.1|  PREDICTED: glucan endo-1,3-beta-glucosidase        123   5e-30   Populus euphratica
ref|XP_002315222.2|  hypothetical protein POPTR_0010s21130g             123   5e-30   Populus trichocarpa [western balsam poplar]
gb|KDP34495.1|  hypothetical protein JCGZ_11045                         123   7e-30   Jatropha curcas
ref|XP_009357726.1|  PREDICTED: glucan endo-1,3-beta-glucosidase        123   8e-30   
gb|KHG22731.1|  Glucan endo-1,3-beta-glucosidase                        122   9e-30   Gossypium arboreum [tree cotton]
ref|XP_008233624.1|  PREDICTED: glucan endo-1,3-beta-glucosidase-...    122   1e-29   Prunus mume [ume]
emb|CDP05033.1|  unnamed protein product                                122   1e-29   Coffea canephora [robusta coffee]
gb|KJB83778.1|  hypothetical protein B456_013G263800                    122   1e-29   Gossypium raimondii
ref|XP_002312098.1|  glucan endo-1 family protein                       122   1e-29   Populus trichocarpa [western balsam poplar]
ref|XP_006394688.1|  hypothetical protein EUTSA_v10004182mg             122   1e-29   
ref|XP_010427314.1|  PREDICTED: glucan endo-1,3-beta-glucosidase-...    121   2e-29   Camelina sativa [gold-of-pleasure]
gb|KFK34786.1|  hypothetical protein AALP_AA5G193500                    119   2e-29   Arabis alpina [alpine rockcress]
ref|XP_011029787.1|  PREDICTED: glucan endo-1,3-beta-glucosidase-...    121   2e-29   Populus euphratica
emb|CDX76097.1|  BnaA04g03610D                                          121   2e-29   
ref|XP_004295910.1|  PREDICTED: glucan endo-1,3-beta-glucosidase-...    121   3e-29   Fragaria vesca subsp. vesca
gb|ACM45718.1|  endo-1,3-beta-glucanase                                 121   3e-29   Pyrus x bretschneideri x Pyrus pyrifolia
ref|XP_008223598.1|  PREDICTED: glucan endo-1,3-beta-glucosidase-...    121   3e-29   Prunus mume [ume]
ref|XP_002298356.1|  glycosyl hydrolase family 17 family protein        121   3e-29   
ref|XP_008342287.1|  PREDICTED: glucan endo-1,3-beta-glucosidase-...    120   3e-29   
ref|XP_006350772.1|  PREDICTED: glucan endo-1,3-beta-glucosidase-...    120   5e-29   Solanum tuberosum [potatoes]
ref|NP_001151227.1|  glucan endo-1,3-beta-glucosidase precursor         120   5e-29   Zea mays [maize]
ref|XP_008810606.1|  PREDICTED: glucan endo-1,3-beta-glucosidase        119   5e-29   
ref|XP_002318439.2|  hypothetical protein POPTR_0012s02490g             120   5e-29   Populus trichocarpa [western balsam poplar]
ref|XP_004959111.1|  PREDICTED: uncharacterized protein LOC101782084    123   5e-29   
ref|XP_010048931.1|  PREDICTED: glucan endo-1,3-beta-glucosidase        120   6e-29   Eucalyptus grandis [rose gum]
ref|XP_006441150.1|  hypothetical protein CICLE_v10020075mg             120   7e-29   Citrus clementina [clementine]
ref|XP_008437641.1|  PREDICTED: glucan endo-1,3-beta-glucosidase        120   7e-29   Cucumis melo [Oriental melon]
ref|XP_008371690.1|  PREDICTED: glucan endo-1,3-beta-glucosidase-...    120   8e-29   Malus domestica [apple tree]
ref|XP_007016412.1|  O-Glycosyl hydrolases family 17 protein isof...    119   9e-29   
gb|KGN49838.1|  hypothetical protein Csa_5G139170                       120   9e-29   Cucumis sativus [cucumbers]
ref|XP_004145947.1|  PREDICTED: glucan endo-1,3-beta-glucosidase-...    120   9e-29   
dbj|BAB40807.1|  endo-1,3-beta-glucanase-like protein                   119   9e-29   Pyrus pyrifolia [sha li]
ref|XP_009357727.1|  PREDICTED: glucan endo-1,3-beta-glucosidase-...    119   9e-29   
ref|XP_006491986.1|  PREDICTED: glucan endo-1,3-beta-glucosidase-...    119   9e-29   Citrus sinensis [apfelsine]
ref|XP_008382814.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    119   1e-28   Malus domestica [apple tree]
ref|XP_007016411.1|  O-Glycosyl hydrolases family 17 protein isof...    120   1e-28   
ref|XP_011015294.1|  PREDICTED: glucan endo-1,3-beta-glucosidase-...    119   1e-28   Populus euphratica
ref|XP_009796709.1|  PREDICTED: LOW QUALITY PROTEIN: glucan endo-...    119   1e-28   Nicotiana sylvestris
ref|XP_009357725.1|  PREDICTED: glucan endo-1,3-beta-glucosidase-...    119   1e-28   
ref|XP_006846179.1|  hypothetical protein AMTR_s00012p00207210          119   1e-28   Amborella trichopoda
ref|XP_009139167.1|  PREDICTED: glucan endo-1,3-beta-glucosidase-...    119   1e-28   Brassica rapa
ref|XP_002532848.1|  Glucan endo-1,3-beta-glucosidase precursor, ...    119   1e-28   Ricinus communis
ref|XP_007039107.1|  O-Glycosyl hydrolases family 17 protein            119   1e-28   
ref|XP_002890613.1|  predicted protein                                  113   2e-28   
ref|XP_008382813.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    119   2e-28   
emb|CDY53600.1|  BnaA05g34730D                                          119   2e-28   Brassica napus [oilseed rape]
ref|XP_008362701.1|  PREDICTED: LOW QUALITY PROTEIN: glucan endo-...    119   2e-28   Malus domestica [apple tree]
ref|XP_007157802.1|  hypothetical protein PHAVU_002G099500g             119   2e-28   Phaseolus vulgaris [French bean]
ref|XP_011025078.1|  PREDICTED: glucan endo-1,3-beta-glucosidase-...    119   3e-28   Populus euphratica
ref|XP_009143300.1|  PREDICTED: glucan endo-1,3-beta-glucosidase        118   3e-28   Brassica rapa
ref|XP_010264453.1|  PREDICTED: glucan endo-1,3-beta-glucosidase        118   3e-28   Nelumbo nucifera [Indian lotus]
gb|KJB19861.1|  hypothetical protein B456_003G121900                    117   3e-28   Gossypium raimondii
emb|CDY20461.1|  BnaC04g05830D                                          118   4e-28   Brassica napus [oilseed rape]
ref|XP_009384878.1|  PREDICTED: glucan endo-1,3-beta-glucosidase-...    118   4e-28   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_007009341.1|  O-Glycosyl hydrolases family 17 protein, put...    117   5e-28   
ref|XP_009419749.1|  PREDICTED: glucan endo-1,3-beta-glucosidase-...    117   5e-28   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_002459582.1|  hypothetical protein SORBIDRAFT_02g007050          118   6e-28   
ref|XP_004241225.1|  PREDICTED: glucan endo-1,3-beta-glucosidase-...    117   6e-28   Solanum lycopersicum
dbj|BAK07810.1|  predicted protein                                      117   7e-28   Hordeum vulgare subsp. vulgare [two-rowed barley]
emb|CDP21469.1|  unnamed protein product                                117   1e-27   Coffea canephora [robusta coffee]
ref|XP_007137073.1|  hypothetical protein PHAVU_009G097400g             116   1e-27   Phaseolus vulgaris [French bean]
emb|CBI16129.3|  unnamed protein product                                116   1e-27   Vitis vinifera
ref|XP_004498531.1|  PREDICTED: glucan endo-1,3-beta-glucosidase-...    116   1e-27   
ref|XP_002281025.1|  PREDICTED: glucan endo-1,3-beta-glucosidase-...    116   2e-27   Vitis vinifera
emb|CAN72975.1|  hypothetical protein VITISV_019488                     115   2e-27   Vitis vinifera
gb|KHN16491.1|  Glucan endo-1,3-beta-glucosidase                        115   3e-27   Glycine soja [wild soybean]
ref|XP_007220925.1|  hypothetical protein PRUPE_ppa023079mg             115   4e-27   Prunus persica
gb|KHG05533.1|  Glucan endo-1,3-beta-glucosidase                        115   4e-27   Gossypium arboreum [tree cotton]
ref|XP_008234701.1|  PREDICTED: glucan endo-1,3-beta-glucosidase        115   4e-27   Prunus mume [ume]
ref|XP_009343476.1|  PREDICTED: glucan endo-1,3-beta-glucosidase        115   4e-27   Pyrus x bretschneideri [bai li]
ref|XP_007013797.1|  O-Glycosyl hydrolases family 17 protein, put...    113   5e-27   
ref|XP_007013798.1|  O-Glycosyl hydrolases family 17 protein, put...    113   5e-27   
gb|KJB23726.1|  hypothetical protein B456_004G111800                    114   8e-27   Gossypium raimondii
ref|XP_008376760.1|  PREDICTED: glucan endo-1,3-beta-glucosidase        114   9e-27   Malus domestica [apple tree]
ref|XP_010109237.1|  Glucan endo-1,3-beta-glucosidase                   114   9e-27   
ref|XP_011044676.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    114   1e-26   Populus euphratica
ref|XP_006435532.1|  hypothetical protein CICLE_v10033472mg             114   1e-26   Citrus clementina [clementine]
ref|XP_006486487.1|  PREDICTED: glucan endo-1,3-beta-glucosidase-...    114   1e-26   Citrus sinensis [apfelsine]
ref|XP_010318035.1|  PREDICTED: glucan endo-1,3-beta-glucosidase        113   1e-26   Solanum lycopersicum
ref|XP_011044679.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    113   1e-26   Populus euphratica
ref|XP_002526252.1|  Glucan endo-1,3-beta-glucosidase precursor, ...    114   1e-26   
gb|KJB53907.1|  hypothetical protein B456_009G010800                    113   1e-26   Gossypium raimondii
ref|XP_006411190.1|  hypothetical protein EUTSA_v10017897mg             114   2e-26   Eutrema salsugineum [saltwater cress]
ref|XP_004505325.1|  PREDICTED: glucan endo-1,3-beta-glucosidase-...    114   2e-26   Cicer arietinum [garbanzo]
ref|XP_004505326.1|  PREDICTED: glucan endo-1,3-beta-glucosidase-...    114   2e-26   
gb|EMT11580.1|  Glucan endo-1,3-beta-glucosidase                        114   2e-26   
gb|KDP35193.1|  hypothetical protein JCGZ_09352                         113   2e-26   Jatropha curcas
ref|XP_010267530.1|  PREDICTED: glucan endo-1,3-beta-glucosidase        112   3e-26   Nelumbo nucifera [Indian lotus]
ref|NP_001119271.1|  O-Glycosyl hydrolases family 17 protein            112   4e-26   Arabidopsis thaliana [mouse-ear cress]
ref|NP_001031936.1|  O-Glycosyl hydrolases family 17 protein            112   4e-26   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009620579.1|  PREDICTED: LOW QUALITY PROTEIN: glucan endo-...    111   5e-26   
ref|XP_010662898.1|  PREDICTED: glucan endo-1,3-beta-glucosidase        112   5e-26   Vitis vinifera
ref|XP_011046747.1|  PREDICTED: glucan endo-1,3-beta-glucosidase-...    111   6e-26   Populus euphratica
ref|XP_011046750.1|  PREDICTED: glucan endo-1,3-beta-glucosidase-...    111   7e-26   Populus euphratica
ref|XP_009799239.1|  PREDICTED: glucan endo-1,3-beta-glucosidase-...    111   9e-26   Nicotiana sylvestris
ref|XP_010421258.1|  PREDICTED: glucan endo-1,3-beta-glucosidase-...    111   1e-25   Camelina sativa [gold-of-pleasure]
ref|XP_002874188.1|  hydrolase, hydrolyzing O-glycosyl compounds        111   1e-25   
ref|XP_010519454.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    111   1e-25   Tarenaya hassleriana [spider flower]
gb|KFK27709.1|  hypothetical protein AALP_AA8G419000                    110   2e-25   Arabis alpina [alpine rockcress]
ref|XP_010535497.1|  PREDICTED: glucan endo-1,3-beta-glucosidase        110   2e-25   
ref|XP_006350517.1|  PREDICTED: glucan endo-1,3-beta-glucosidase-...    109   2e-25   Solanum tuberosum [potatoes]
ref|XP_010685761.1|  PREDICTED: glucan endo-1,3-beta-glucosidase-...    110   3e-25   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_010421259.1|  PREDICTED: glucan endo-1,3-beta-glucosidase-...    109   3e-25   
ref|XP_010493578.1|  PREDICTED: glucan endo-1,3-beta-glucosidase        109   3e-25   Camelina sativa [gold-of-pleasure]
ref|XP_006295997.1|  hypothetical protein CARUB_v10025141mg             110   5e-25   Capsella rubella
ref|XP_008377317.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    108   9e-25   Malus domestica [apple tree]
ref|XP_010519453.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    108   1e-24   Tarenaya hassleriana [spider flower]
ref|XP_004309121.2|  PREDICTED: glucan endo-1,3-beta-glucosidase        108   2e-24   Fragaria vesca subsp. vesca
emb|CDX87130.1|  BnaC09g04450D                                          107   2e-24   
ref|XP_002321390.2|  hypothetical protein POPTR_0015s01240g             107   2e-24   
gb|AES90042.2|  O-glycosyl hydrolase family 17 protein                  108   2e-24   Medicago truncatula
ref|XP_003607845.1|  Glucan endo-1,3-beta-glucosidase                   108   2e-24   
ref|XP_009374190.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    107   3e-24   Pyrus x bretschneideri [bai li]
ref|XP_006287713.1|  hypothetical protein CARUB_v10000922mg             107   4e-24   
ref|XP_006292633.1|  hypothetical protein CARUB_v10018875mg             106   4e-24   
gb|EAZ03332.1|  hypothetical protein OsI_25474                          107   4e-24   Oryza sativa Indica Group [Indian rice]
ref|XP_009586622.1|  PREDICTED: glucan endo-1,3-beta-glucosidase-...    106   5e-24   
ref|NP_001059262.1|  Os07g0240200                                       107   5e-24   
ref|XP_009374179.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 7      106   7e-24   Pyrus x bretschneideri [bai li]
ref|NP_190241.1|  Glycosyl hydrolase superfamily protein                105   1e-23   Arabidopsis thaliana [mouse-ear cress]
ref|XP_003588492.1|  Glucan endo-1,3-beta-glucosidase                   104   1e-23   
emb|CDY19838.1|  BnaA09g04910D                                          105   2e-23   Brassica napus [oilseed rape]
ref|XP_009111627.1|  PREDICTED: glucan endo-1,3-beta-glucosidase        105   2e-23   Brassica rapa
gb|KDO72847.1|  hypothetical protein CISIN_1g0375832mg                  104   2e-23   Citrus sinensis [apfelsine]
ref|XP_006651673.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    103   3e-23   
ref|NP_001050864.2|  Os03g0669300                                       101   3e-23   
ref|XP_006424832.1|  hypothetical protein CICLE_v10028241mg             105   3e-23   Citrus clementina [clementine]
ref|XP_006488330.1|  PREDICTED: glucan endo-1,3-beta-glucosidase-...    104   3e-23   Citrus sinensis [apfelsine]
ref|XP_006658422.1|  PREDICTED: glucan endo-1,3-beta-glucosidase-...    104   3e-23   
ref|XP_011075984.1|  PREDICTED: glucan endo-1,3-beta-glucosidase        103   4e-23   
ref|NP_181494.1|  glycosyl hydrolase-17                                 104   6e-23   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006307574.1|  hypothetical protein CARUB_v10009196mg             103   8e-23   Capsella rubella
ref|XP_007201010.1|  hypothetical protein PRUPE_ppa005375mg             103   8e-23   Prunus persica
gb|EMS59735.1|  Glucan endo-1,3-beta-glucosidase 11                     102   1e-22   Triticum urartu
ref|XP_010925707.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    102   1e-22   
ref|XP_010925705.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    102   1e-22   
ref|XP_010063141.1|  PREDICTED: glucan endo-1,3-beta-D-glucosidas...    102   2e-22   Eucalyptus grandis [rose gum]
ref|NP_001130652.1|  uncharacterized protein LOC100191753 precursor     102   2e-22   Zea mays [maize]
ref|XP_006827757.1|  hypothetical protein AMTR_s00009p00263650          102   2e-22   
ref|XP_002877494.1|  predicted protein                                  101   2e-22   
ref|XP_010507244.1|  PREDICTED: LOW QUALITY PROTEIN: glucan endo-...    100   3e-22   
ref|XP_008783886.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    100   3e-22   
ref|XP_008783885.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    100   4e-22   
ref|XP_010671896.1|  PREDICTED: glucan endo-1,3-beta-glucosidase        100   5e-22   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_002881667.1|  glycosyl hydrolase family 17 protein               102   6e-22   Arabidopsis lyrata subsp. lyrata
gb|ABK24695.1|  unknown                                                 100   8e-22   Picea sitchensis
emb|CBI30910.3|  unnamed protein product                              99.8    8e-22   Vitis vinifera
ref|XP_006855691.1|  hypothetical protein AMTR_s00044p00136160        98.6    1e-21   
ref|XP_002270153.2|  PREDICTED: glucan endo-1,3-beta-glucosidase 11   99.8    1e-21   Vitis vinifera
ref|XP_009406752.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...    100   1e-21   
gb|EAY91326.1|  hypothetical protein OsI_12942                          100   1e-21   Oryza sativa Indica Group [Indian rice]
gb|AAP44659.1|  putative beta 1,3-glucanase                             100   1e-21   Oryza sativa Japonica Group [Japonica rice]
ref|XP_008236880.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 7    99.4    2e-21   Prunus mume [ume]
ref|XP_010227646.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...  98.6    2e-21   Brachypodium distachyon [annual false brome]
emb|CAB80165.1|  putative protein (fragment)                          98.2    2e-21   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010478704.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...  98.6    3e-21   Camelina sativa [gold-of-pleasure]
ref|XP_002448791.1|  hypothetical protein SORBIDRAFT_06g033250        99.0    3e-21   Sorghum bicolor [broomcorn]
ref|XP_010505644.1|  PREDICTED: glucan endo-1,3-beta-glucosidase-...    100   4e-21   
gb|EPS68882.1|  hypothetical protein M569_05882                       95.9    6e-21   Genlisea aurea
ref|XP_008783477.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 7    98.2    6e-21   Phoenix dactylifera
ref|NP_195174.6|  glucan endo-1,3-beta-glucosidase 7                  98.6    6e-21   Arabidopsis thaliana [mouse-ear cress]
emb|CDY45313.1|  BnaA03g52860D                                          100   6e-21   Brassica napus [oilseed rape]
ref|XP_010512954.1|  PREDICTED: glucan endo-1,3-beta-glucosidase-...  99.8    6e-21   
ref|XP_010461089.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 11   97.8    7e-21   Camelina sativa [gold-of-pleasure]
tpg|DAA35302.1|  TPA: putative O-glycosyl hydrolase family 17 pro...  97.8    7e-21   
ref|XP_010499813.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...  97.8    7e-21   Camelina sativa [gold-of-pleasure]
ref|NP_001151529.1|  LOC100285163 precursor                           97.8    8e-21   Zea mays [maize]
ref|XP_008778544.1|  PREDICTED: glucan endo-1,3-beta-glucosidase-...  97.8    9e-21   Phoenix dactylifera
ref|XP_002976327.1|  hypothetical protein SELMODRAFT_105037           95.9    1e-20   
ref|XP_010412950.1|  PREDICTED: glucan endo-1,3-beta-glucosidase-...  97.4    1e-20   
gb|KGN49400.1|  hypothetical protein Csa_6G523410                     96.3    2e-20   Cucumis sativus [cucumbers]
ref|XP_008383474.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...  96.3    2e-20   
ref|XP_002272900.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 12   97.1    2e-20   Vitis vinifera
ref|XP_004301627.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...  97.1    2e-20   Fragaria vesca subsp. vesca
emb|CBI40742.3|  unnamed protein product                              97.4    2e-20   Vitis vinifera
ref|XP_008358612.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...  96.3    2e-20   
gb|AAM96962.1|  putative beta-1,3-glucanase precursor                 96.3    2e-20   Arabidopsis thaliana [mouse-ear cress]
gb|KFK33989.1|  hypothetical protein AALP_AA5G087500                  96.7    2e-20   Arabis alpina [alpine rockcress]
ref|XP_009421254.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...  95.9    2e-20   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_008439628.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...  95.1    2e-20   Cucumis melo [Oriental melon]
ref|XP_008225490.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...  95.9    2e-20   
ref|XP_010478378.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...  95.9    3e-20   Camelina sativa [gold-of-pleasure]
ref|XP_002987317.1|  hypothetical protein SELMODRAFT_125909           95.1    3e-20   
emb|CDY26296.1|  BnaA09g26470D                                        95.9    3e-20   Brassica napus [oilseed rape]
ref|XP_008238068.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...  96.7    3e-20   Prunus mume [ume]
ref|XP_010940752.1|  PREDICTED: glucan endo-1,3-beta-glucosidase-...  96.3    3e-20   Elaeis guineensis
ref|XP_009115194.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 11   95.5    3e-20   Brassica rapa
gb|EYU43261.1|  hypothetical protein MIMGU_mgv1a008785mg              95.1    3e-20   Erythranthe guttata [common monkey flower]
ref|XP_010913393.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...  96.7    3e-20   Elaeis guineensis
ref|XP_010094541.1|  Glucan endo-1,3-beta-glucosidase 12              96.7    3e-20   Morus notabilis
ref|XP_010915632.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...  95.1    3e-20   
ref|XP_010096392.1|  Glucan endo-1,3-beta-glucosidase 7               96.3    3e-20   Morus notabilis
ref|XP_010110962.1|  Glucan endo-1,3-beta-glucosidase 11              95.1    3e-20   
gb|AFS50099.1|  glucan endo-1,3-beta-glucosidase                      96.7    4e-20   Elaeis guineensis
ref|XP_007211424.1|  hypothetical protein PRUPE_ppa007088mg           95.1    4e-20   
ref|XP_009138297.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...  96.7    4e-20   
ref|XP_008225491.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...  95.5    4e-20   
ref|XP_010499522.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...  95.5    4e-20   
ref|XP_008439627.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...  95.1    4e-20   
ref|XP_009138298.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...  96.3    4e-20   
ref|XP_008373395.1|  PREDICTED: glucan endo-1,3-beta-D-glucosidas...  96.3    4e-20   
ref|XP_010279618.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...  95.1    4e-20   
ref|XP_006657020.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...  95.1    5e-20   
ref|XP_010279617.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...  95.1    5e-20   
ref|XP_009360891.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 11   95.1    6e-20   
ref|XP_008466580.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 7    95.9    6e-20   
ref|XP_008781529.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...  94.7    6e-20   
emb|CDX99881.1|  BnaC05g23030D                                        94.4    6e-20   
emb|CDX72483.1|  BnaC07g45050D                                        97.1    6e-20   
ref|XP_004147788.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...  95.5    7e-20   
ref|XP_009380510.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...  95.1    7e-20   
ref|XP_006663687.1|  PREDICTED: glucan endo-1,3-beta-glucosidase-...  95.1    7e-20   
ref|XP_009372602.1|  PREDICTED: glucan endo-1,3-beta-D-glucosidas...  95.5    8e-20   
ref|XP_004169494.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...  95.5    8e-20   
ref|XP_010942826.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 7    95.1    8e-20   
ref|XP_009380509.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...  94.7    9e-20   
ref|XP_009380508.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...  94.7    1e-19   
ref|XP_006304941.1|  hypothetical protein CARUB_v10011427mg           94.4    1e-19   
ref|XP_009114852.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 11   94.4    1e-19   
emb|CDO97058.1|  unnamed protein product                              94.7    1e-19   
emb|CDX93815.1|  BnaA09g24150D                                        94.4    1e-19   
ref|XP_004960035.1|  PREDICTED: glucan endo-1,3-beta-glucosidase-...  95.1    1e-19   
ref|XP_010460784.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...  94.0    1e-19   
ref|XP_001780679.1|  predicted protein                                93.2    1e-19   
ref|XP_006415516.1|  hypothetical protein EUTSA_v10007753mg           94.0    1e-19   
ref|XP_004982218.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...  94.7    1e-19   
ref|XP_009626249.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...  94.4    1e-19   
emb|CAJ86292.1|  H0124B04.9                                           96.3    2e-19   
ref|XP_011096566.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...  93.6    2e-19   
ref|XP_004299094.1|  PREDICTED: glucan endo-1,3-beta-D-glucosidase    94.7    2e-19   
gb|AFS50098.1|  glucan endo-1,3-beta-glucosidase                      94.4    2e-19   
gb|EEC78268.1|  hypothetical protein OsI_17962                        95.9    2e-19   
ref|XP_010432409.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...  94.7    2e-19   
ref|XP_007025069.1|  Glycosyl hydrolase superfamily protein           93.6    2e-19   
ref|XP_011096565.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...  93.6    2e-19   
ref|XP_004982217.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...  94.4    2e-19   
ref|XP_002437077.1|  hypothetical protein SORBIDRAFT_10g020900        93.6    2e-19   
ref|XP_009109623.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...  93.6    2e-19   
emb|CDX90225.1|  BnaA08g17590D                                        93.6    2e-19   
ref|XP_009414127.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...  94.4    2e-19   
gb|AAG52058.1|AC022455_12  beta-1,3-glucanase precursor, putative...  93.2    2e-19   
ref|XP_007018100.1|  Glucan endo-1,3-beta-glucosidase, putative       94.0    2e-19   
gb|EMS56219.1|  Glucan endo-1,3-beta-glucosidase                      94.0    2e-19   
gb|KDP36766.1|  hypothetical protein JCGZ_08057                       94.0    2e-19   
ref|NP_174300.2|  glycosyl hydrolases family protein                  93.2    2e-19   
ref|XP_004162616.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...  92.8    2e-19   
sp|P52409.1|E13B_WHEAT  RecName: Full=Glucan endo-1,3-beta-glucos...  94.0    3e-19   
ref|XP_011085243.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...  92.8    3e-19   
gb|EMT31321.1|  Glucan endo-1,3-beta-glucosidase                      94.4    3e-19   
dbj|BAD54223.1|  putative beta-1,3-glucanase precursor                92.8    3e-19   
gb|KDP38495.1|  hypothetical protein JCGZ_04420                       93.2    3e-19   
ref|XP_007209985.1|  hypothetical protein PRUPE_ppa005142mg           93.6    3e-19   
gb|KJB10702.1|  hypothetical protein B456_001G216900                  93.6    3e-19   
ref|XP_002893598.1|  predicted protein                                92.4    3e-19   
ref|XP_002306003.2|  hypothetical protein POPTR_0004s13980g           92.4    3e-19   
ref|XP_010447074.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...  94.0    4e-19   
gb|KJB10701.1|  hypothetical protein B456_001G216900                  93.6    4e-19   
ref|XP_003561438.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...  93.6    4e-19   
gb|KFK44831.1|  hypothetical protein AALP_AA1G308300                  92.4    4e-19   
ref|XP_009407686.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...  93.2    4e-19   
ref|XP_010423738.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...  93.6    5e-19   
ref|XP_002519678.1|  Glucan endo-1,3-beta-glucosidase precursor, ...  92.0    5e-19   
ref|XP_009785958.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...  92.4    5e-19   
emb|CDX69064.1|  BnaC01g03890D                                        92.4    6e-19   
gb|EEE65821.1|  hypothetical protein OsJ_21560                        92.4    6e-19   
ref|XP_006467461.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...  92.0    6e-19   
ref|XP_006449699.1|  hypothetical protein CICLE_v10015646mg           91.7    6e-19   
gb|KDO78187.1|  hypothetical protein CISIN_1g016045mg                 91.7    6e-19   
ref|XP_008788767.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...  93.2    7e-19   
ref|NP_001057782.1|  Os06g0531000                                     92.4    7e-19   
ref|XP_011048644.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...  92.4    7e-19   
gb|EEE61922.1|  hypothetical protein OsJ_16662                        94.0    7e-19   
gb|EEC80746.1|  hypothetical protein OsI_23229                        92.4    8e-19   
ref|XP_010549489.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 11   91.7    8e-19   
ref|XP_002306099.1|  hypothetical protein POPTR_0004s16120g           91.3    9e-19   
ref|XP_006409465.1|  hypothetical protein EUTSA_v10022641mg           92.8    9e-19   
gb|EPS58986.1|  hypothetical protein M569_15824                       92.0    1e-18   
gb|EMS57155.1|  Glucan endo-1,3-beta-glucosidase                      92.4    1e-18   
ref|XP_002867117.1|  hypothetical protein ARALYDRAFT_491210           90.9    1e-18   
gb|KJB57237.1|  hypothetical protein B456_009G154800                  90.9    1e-18   
ref|XP_008392643.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...  90.9    1e-18   
gb|KJB57236.1|  hypothetical protein B456_009G154800                  90.9    1e-18   
ref|XP_004309523.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...  91.3    1e-18   
ref|XP_011470886.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...  91.3    1e-18   
ref|XP_010444969.1|  PREDICTED: LOW QUALITY PROTEIN: glucan endo-...  92.4    1e-18   
emb|CAA18827.1|  putative protein (fragment)                          90.5    1e-18   
ref|XP_010928243.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...  92.0    1e-18   
ref|XP_008392644.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...  90.9    1e-18   
gb|KJB14206.1|  hypothetical protein B456_002G114200                  91.7    2e-18   
ref|XP_002510704.1|  Glucan endo-1,3-beta-glucosidase precursor, ...  91.7    2e-18   
ref|XP_008392645.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...  90.9    2e-18   
ref|XP_004293577.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 11   90.9    2e-18   
gb|EYU33370.1|  hypothetical protein MIMGU_mgv1a018482mg              90.5    2e-18   
ref|XP_010274875.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...  90.9    2e-18   
gb|AAX95269.1|  glucan endo-1,3-beta-glucosidase precursor (ec 3....  91.3    2e-18   
ref|XP_009801195.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...  91.7    2e-18   
emb|CDX75437.1|  BnaA01g02650D                                        92.0    2e-18   
ref|XP_004965529.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...  90.9    2e-18   
ref|XP_006386924.1|  hypothetical protein POPTR_0002s26290g           91.7    2e-18   
ref|XP_010668075.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 11   90.5    2e-18   
ref|XP_011037536.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...  91.3    2e-18   
ref|XP_006384505.1|  hypothetical protein POPTR_0004s16120g           91.3    2e-18   
ref|XP_010489192.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...  90.5    2e-18   
ref|XP_003577202.1|  PREDICTED: glucan endo-1,3-beta-glucosidase-...  91.3    2e-18   
gb|KHG05496.1|  hypothetical protein F383_30989                       91.3    2e-18   
ref|XP_010107844.1|  Glucan endo-1,3-beta-glucosidase 7               90.1    2e-18   
gb|EEC68648.1|  hypothetical protein OsI_37085                        91.3    2e-18   
ref|XP_011034841.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...  91.3    2e-18   
ref|XP_004134912.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...  90.9    2e-18   
ref|NP_001068545.2|  Os11g0704600                                     91.3    2e-18   
ref|XP_004149679.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...  90.1    3e-18   
ref|XP_002275642.2|  PREDICTED: glucan endo-1,3-beta-glucosidase 14   90.5    3e-18   
ref|XP_010530842.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 7    91.3    3e-18   
gb|AAX95357.1|  glucan endo-1,3-beta-glucosidase precursor (ec 3....  91.3    3e-18   
gb|ABR16583.1|  unknown                                               90.1    3e-18   
ref|XP_002282736.1|  PREDICTED: glucan endo-1,3-beta-D-glucosidas...  90.9    3e-18   
ref|XP_004252276.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...  90.9    3e-18   
ref|XP_008374135.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...  88.2    3e-18   
ref|XP_010489191.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...  90.5    3e-18   
ref|XP_006377609.1|  glycosyl hydrolase family 17 family protein      89.7    3e-18   
ref|XP_008352157.1|  PREDICTED: LOW QUALITY PROTEIN: glucan endo-...  88.2    3e-18   
ref|XP_010664681.1|  PREDICTED: glucan endo-1,3-beta-D-glucosidas...  90.9    3e-18   
gb|KGN65539.1|  hypothetical protein Csa_1G436330                     90.1    3e-18   
gb|KJB32497.1|  hypothetical protein B456_005G243100                  89.4    4e-18   
ref|XP_008444326.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...  90.1    4e-18   
gb|KDP30806.1|  hypothetical protein JCGZ_13749                       90.9    4e-18   
ref|XP_006473828.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...  90.9    4e-18   
gb|KDO85165.1|  hypothetical protein CISIN_1g011390mg                 90.9    4e-18   
gb|KFK30062.1|  hypothetical protein AALP_AA7G211800                  90.9    4e-18   
ref|XP_002300634.2|  hypothetical protein POPTR_0002s00860g           90.5    4e-18   
ref|XP_011009938.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...  89.7    4e-18   
ref|XP_010263687.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...  90.5    4e-18   
ref|XP_010065396.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...  90.5    4e-18   
dbj|BAJ85927.1|  predicted protein                                    89.7    5e-18   
ref|NP_001148381.1|  glucan endo-1,3-beta-glucosidase 7 precursor     90.5    5e-18   
gb|EYU45144.1|  hypothetical protein MIMGU_mgv1a006001mg              90.1    5e-18   
ref|XP_010097796.1|  Glucan endo-1,3-beta-glucosidase, basic vacu...  89.0    5e-18   
gb|KHG00665.1|  hypothetical protein F383_20417                       90.1    5e-18   
ref|XP_004293211.1|  PREDICTED: glucan endo-1,3-beta-D-glucosidase    90.5    5e-18   
ref|XP_011009939.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...  89.4    5e-18   
gb|KCW75916.1|  hypothetical protein EUGRSUZ_D00293                   89.0    5e-18   
ref|XP_010052055.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 11   89.0    5e-18   
ref|XP_002886212.1|  glycosyl hydrolase family 17 protein             90.1    5e-18   
ref|XP_009112198.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 7    90.5    5e-18   
ref|XP_007042210.1|  O-Glycosyl hydrolases family 17 protein isof...  90.1    5e-18   
tpg|DAA41054.1|  TPA: putative O-glycosyl hydrolase family 17 pro...  88.2    5e-18   
gb|KJB13749.1|  hypothetical protein B456_002G092600                  90.1    5e-18   
emb|CDP18512.1|  unnamed protein product                              89.4    5e-18   
ref|XP_010036769.1|  PREDICTED: probable glucan endo-1,3-beta-glu...  90.1    5e-18   
gb|KHG21190.1|  hypothetical protein F383_01641                       90.1    5e-18   
ref|XP_009108359.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...  89.4    5e-18   
ref|XP_009592800.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...  87.0    5e-18   
ref|XP_002510373.1|  Glucan endo-1,3-beta-glucosidase precursor, ...  90.1    6e-18   
ref|XP_011024410.1|  PREDICTED: glucan endo-1,3-beta-D-glucosidas...  90.5    6e-18   
emb|CDX76528.1|  BnaA08g08720D                                        89.4    6e-18   
gb|EEE52578.1|  hypothetical protein OsJ_34867                        91.3    6e-18   
gb|KHG21189.1|  hypothetical protein F383_01641                       90.1    6e-18   
ref|XP_010467346.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 7    90.1    7e-18   
ref|XP_009595793.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...  89.0    7e-18   
ref|XP_006299612.1|  hypothetical protein CARUB_v10015799mg           90.1    8e-18   
gb|KJB69825.1|  hypothetical protein B456_011G044700                  89.4    8e-18   
ref|XP_009772777.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...  86.3    8e-18   
ref|XP_006845039.1|  hypothetical protein AMTR_s00058p00220600        89.0    8e-18   
gb|KJB69824.1|  hypothetical protein B456_011G044700                  89.0    8e-18   
emb|CDY34065.1|  BnaC03g62670D                                        89.0    8e-18   
gb|AFK46350.1|  unknown                                               87.8    8e-18   
ref|XP_002509479.1|  Glucan endo-1,3-beta-glucosidase precursor, ...  89.7    9e-18   
ref|XP_002466692.1|  hypothetical protein SORBIDRAFT_01g012380        89.7    9e-18   
ref|XP_007042209.1|  O-Glycosyl hydrolases family 17 protein isof...  89.7    9e-18   
ref|XP_011015994.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...  89.4    9e-18   
ref|XP_006360726.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...  89.0    9e-18   
emb|CDY69080.1|  BnaCnng61800D                                        89.0    9e-18   
ref|XP_006412222.1|  hypothetical protein EUTSA_v10024968mg           89.7    1e-17   
gb|KHG11479.1|  hypothetical protein F383_06303                       89.4    1e-17   
ref|XP_011015993.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...  89.4    1e-17   
emb|CAA16806.1|  beta-1, 3-glucanase-like protein                     88.6    1e-17   
gb|KJB32496.1|  hypothetical protein B456_005G243100                  89.4    1e-17   
gb|KDP37980.1|  hypothetical protein JCGZ_04623                       88.2    1e-17   
ref|XP_004233126.2|  PREDICTED: glucan endo-1,3-beta-glucosidase 14   88.6    1e-17   
ref|NP_193568.2|  glycosyl hydrolase family protein                   88.6    1e-17   
ref|XP_008805608.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...  89.4    1e-17   
gb|KJB32499.1|  hypothetical protein B456_005G243100                  89.4    1e-17   
gb|KHG28308.1|  hypothetical protein F383_11467                       88.6    1e-17   
gb|KHN44765.1|  Glucan endo-1,3-beta-glucosidase 11                   88.6    1e-17   
ref|XP_006396136.1|  hypothetical protein EUTSA_v10002515mg           89.4    1e-17   
ref|XP_002893744.1|  glycosyl hydrolase family 17 protein             88.6    1e-17   
ref|XP_006282645.1|  hypothetical protein CARUB_v10004986mg           88.2    1e-17   
ref|XP_010559242.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...  88.2    1e-17   
ref|XP_010254870.1|  PREDICTED: glucan endo-1,3-beta-D-glucosidase    89.4    1e-17   
ref|XP_002961999.1|  hypothetical protein SELMODRAFT_76182            87.4    1e-17   
ref|XP_010538537.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...  88.2    1e-17   
ref|XP_010252096.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 11   88.2    2e-17   
ref|XP_010540580.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...  88.2    2e-17   
dbj|BAO09557.1|  beta-1,3-glucanase                                   87.4    2e-17   
ref|XP_004252615.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...  88.2    2e-17   
ref|NP_001150602.1|  LOC100284235                                     88.6    2e-17   
ref|XP_010538536.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...  88.2    2e-17   
gb|ACF88366.1|  unknown                                               88.6    2e-17   
gb|ACF85320.1|  unknown                                               88.6    2e-17   
emb|CDP07273.1|  unnamed protein product                              89.0    2e-17   
ref|XP_010412737.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...  88.6    2e-17   
ref|XP_010542063.1|  PREDICTED: glucan endo-1,3-beta-glucosidase 11   88.2    2e-17   
ref|XP_010488778.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...  88.6    2e-17   
gb|KCW72602.1|  hypothetical protein EUGRSUZ_E01067                   87.8    2e-17   
gb|KCW72601.1|  hypothetical protein EUGRSUZ_E01067                   87.8    2e-17   
ref|XP_008670470.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...  89.4    2e-17   
ref|XP_010467085.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...  88.6    2e-17   
gb|AFK44108.1|  unknown                                               85.1    2e-17   
emb|CDY18049.1|  BnaC07g04210D                                        88.2    2e-17   
ref|XP_003606895.1|  Glucan endo-1,3-beta-glucosidase                 88.2    2e-17   
emb|CAE54080.1|  beta 1-3 glucanase                                   85.1    3e-17   
emb|CBI28320.3|  unnamed protein product                              87.8    3e-17   
ref|XP_010056028.1|  PREDICTED: glucan endo-1,3-beta-glucosidase ...  87.8    3e-17   
dbj|BAJ87172.1|  predicted protein                                    88.2    3e-17   
ref|XP_008371763.1|  PREDICTED: LOW QUALITY PROTEIN: glucan endo-...  87.4    3e-17   
ref|XP_004298364.2|  PREDICTED: glucan endo-1,3-beta-glucosidase ...  88.2    3e-17   



>ref|XP_009610601.1| PREDICTED: glucan endo-1,3-beta-glucosidase [Nicotiana tomentosiformis]
Length=494

 Score =   160 bits (406),  Expect(2) = 2e-47, Method: Compositional matrix adjust.
 Identities = 83/124 (67%), Positives = 98/124 (79%), Gaps = 3/124 (2%)
 Frame = +3

Query  42   MEMSLRPSPIFLFFLVSAFLFIHG---VRSIGVNYGTLGDNLPPPTEVARFLKEKTVIDR  212
            MEMS + +  FL FL  + +FI     V SIGVNYGTLG+NLPPP++VA+FLK+KT+ID+
Sbjct  1    MEMSNKKTSPFLSFLFISAIFIQCFPYVSSIGVNYGTLGNNLPPPSQVAQFLKDKTIIDK  60

Query  213  IKIFDVNPDILRAFAGTGILVTVTVPNGEIIPLKDAGYAAQWVAANIKPFYPATKINIIA  392
            IKIFDVNPDILRAFA TGI VTVTVPNGEI  L D GYA  +V ANIKPFYP TKI++IA
Sbjct  61   IKIFDVNPDILRAFANTGISVTVTVPNGEIPKLLDIGYAKSYVEANIKPFYPQTKIDVIA  120

Query  393  VGQR  404
            +G  
Sbjct  121  IGNE  124


 Score = 55.1 bits (131),  Expect(2) = 2e-47, Method: Compositional matrix adjust.
 Identities = 22/32 (69%), Positives = 27/32 (84%), Gaps = 0/32 (0%)
 Frame = +1

Query  397  GNEVLHWGTPEMQNGLVAAMRSLYNALVKSGI  492
            GNE+LHW TPE+QN LV AMR+ Y AL++SGI
Sbjct  122  GNEILHWETPEVQNKLVPAMRTFYQALIQSGI  153



>ref|XP_009791207.1| PREDICTED: glucan endo-1,3-beta-glucosidase-like [Nicotiana sylvestris]
Length=490

 Score =   158 bits (399),  Expect(2) = 1e-46, Method: Compositional matrix adjust.
 Identities = 82/124 (66%), Positives = 97/124 (78%), Gaps = 3/124 (2%)
 Frame = +3

Query  42   MEMSLRPSPIFLFFLVSAFLFIHG---VRSIGVNYGTLGDNLPPPTEVARFLKEKTVIDR  212
            MEMS + +  FL  L  + +FI     V SIGVNYGTLG+NLPPP++VA+FLK+KT+ID+
Sbjct  1    MEMSNKKTSPFLSILFISAIFIQCFPYVSSIGVNYGTLGNNLPPPSQVAQFLKDKTIIDK  60

Query  213  IKIFDVNPDILRAFAGTGILVTVTVPNGEIIPLKDAGYAAQWVAANIKPFYPATKINIIA  392
            IKIFDVNPDILRAFA TGI VTVTVPNGEI  L D GYA  +V ANIKPFYP TKI++IA
Sbjct  61   IKIFDVNPDILRAFANTGISVTVTVPNGEIHKLLDIGYAKSYVEANIKPFYPQTKIDVIA  120

Query  393  VGQR  404
            +G  
Sbjct  121  IGNE  124


 Score = 55.1 bits (131),  Expect(2) = 1e-46, Method: Compositional matrix adjust.
 Identities = 22/32 (69%), Positives = 27/32 (84%), Gaps = 0/32 (0%)
 Frame = +1

Query  397  GNEVLHWGTPEMQNGLVAAMRSLYNALVKSGI  492
            GNE+LHW TPE+QN LV AMR+ Y AL++SGI
Sbjct  122  GNEILHWETPEVQNKLVPAMRTFYQALIQSGI  153



>ref|XP_006345964.1| PREDICTED: glucan endo-1,3-beta-glucosidase-like [Solanum tuberosum]
Length=504

 Score =   154 bits (390),  Expect(2) = 7e-46, Method: Compositional matrix adjust.
 Identities = 81/126 (64%), Positives = 99/126 (79%), Gaps = 6/126 (5%)
 Frame = +3

Query  42   MEMSLRP--SPIFLFFLVSAFLFIHG---VRSIGVNYGTLGDNLPPPTEVARFLKEKTVI  206
            ME+S +   SP+F F  +S+ +FI     V S+GVNYGTLG+NLPPP++VA+FLK+KT+I
Sbjct  1    MEVSYKKITSPLFTFLFISS-IFIQCLPYVSSLGVNYGTLGNNLPPPSQVAQFLKDKTII  59

Query  207  DRIKIFDVNPDILRAFAGTGILVTVTVPNGEIIPLKDAGYAAQWVAANIKPFYPATKINI  386
            D+IKIFDVNPDIL+AFA T I VTVTVPNGEI  L D GYA  +V ANIKPFYP TKI++
Sbjct  60   DKIKIFDVNPDILKAFANTNISVTVTVPNGEIPKLLDIGYAKSYVEANIKPFYPQTKIDV  119

Query  387  IAVGQR  404
            IAVG  
Sbjct  120  IAVGNE  125


 Score = 55.8 bits (133),  Expect(2) = 7e-46, Method: Composition-based stats.
 Identities = 23/32 (72%), Positives = 27/32 (84%), Gaps = 0/32 (0%)
 Frame = +1

Query  397  GNEVLHWGTPEMQNGLVAAMRSLYNALVKSGI  492
            GNE+LHW TPE+QN LV AMR+LY AL +SGI
Sbjct  123  GNEILHWETPEVQNKLVGAMRTLYQALTQSGI  154



>ref|XP_011091523.1| PREDICTED: glucan endo-1,3-beta-glucosidase-like [Sesamum indicum]
Length=457

 Score =   162 bits (411),  Expect(2) = 2e-45, Method: Compositional matrix adjust.
 Identities = 79/101 (78%), Positives = 87/101 (86%), Gaps = 0/101 (0%)
 Frame = +3

Query  102  FIHGVRSIGVNYGTLGDNLPPPTEVARFLKEKTVIDRIKIFDVNPDILRAFAGTGILVTV  281
            F+  V+SIGVNYGTLGDNLPPP +VA+FLKEKT IDRIKIFDVNPDILRAFA TGILV V
Sbjct  21   FLAAVQSIGVNYGTLGDNLPPPAQVAQFLKEKTTIDRIKIFDVNPDILRAFANTGILVAV  80

Query  282  TVPNGEIIPLKDAGYAAQWVAANIKPFYPATKINIIAVGQR  404
            T+PNGEI  L DAGYA +W+AANI+PFYPATKIN I VG  
Sbjct  81   TIPNGEIPGLTDAGYARRWLAANIQPFYPATKINYILVGNE  121


 Score = 46.6 bits (109),  Expect(2) = 2e-45, Method: Compositional matrix adjust.
 Identities = 20/33 (61%), Positives = 27/33 (82%), Gaps = 0/33 (0%)
 Frame = +1

Query  397  GNEVLHWGTPEMQNGLVAAMRSLYNALVKSGIK  495
            GNE+LHWG   +++ LVAAMRS++ AL+ SGIK
Sbjct  119  GNEILHWGPQNLRDNLVAAMRSVHQALLLSGIK  151



>ref|XP_004239793.1| PREDICTED: glucan endo-1,3-beta-glucosidase [Solanum lycopersicum]
Length=526

 Score =   153 bits (386),  Expect(2) = 2e-45, Method: Compositional matrix adjust.
 Identities = 79/125 (63%), Positives = 96/125 (77%), Gaps = 4/125 (3%)
 Frame = +3

Query  42   MEMSLRP--SPIFLFFLVSAFL--FIHGVRSIGVNYGTLGDNLPPPTEVARFLKEKTVID  209
            ME+S +   SP+F F  +S+    F   V  IGVNYGTLG+NLPPP++VA+FLK+KT+ID
Sbjct  1    MEVSNKKITSPLFTFLFISSIFIQFFPYVSCIGVNYGTLGNNLPPPSQVAQFLKDKTIID  60

Query  210  RIKIFDVNPDILRAFAGTGILVTVTVPNGEIIPLKDAGYAAQWVAANIKPFYPATKINII  389
            +IKIFDVNPDIL+AFA T I VTVTVPN EI  L+D GYA  +V ANIKPFYP TKI++I
Sbjct  61   KIKIFDVNPDILKAFANTNISVTVTVPNSEIPKLQDIGYAKSYVEANIKPFYPQTKIDVI  120

Query  390  AVGQR  404
            AVG  
Sbjct  121  AVGNE  125


 Score = 55.8 bits (133),  Expect(2) = 2e-45, Method: Composition-based stats.
 Identities = 23/32 (72%), Positives = 27/32 (84%), Gaps = 0/32 (0%)
 Frame = +1

Query  397  GNEVLHWGTPEMQNGLVAAMRSLYNALVKSGI  492
            GNE+LHW TPE+QN LV AMR+LY AL +SGI
Sbjct  123  GNEILHWETPEVQNKLVGAMRTLYQALTQSGI  154



>ref|NP_001234416.1| beta-glucosidase 08 precursor [Solanum lycopersicum]
 gb|ACH56716.1| beta-glucosidase 08 [Solanum lycopersicum]
Length=459

 Score =   153 bits (386),  Expect(2) = 2e-43, Method: Compositional matrix adjust.
 Identities = 73/111 (66%), Positives = 90/111 (81%), Gaps = 0/111 (0%)
 Frame = +3

Query  72   FLFFLVSAFLFIHGVRSIGVNYGTLGDNLPPPTEVARFLKEKTVIDRIKIFDVNPDILRA  251
            F+ FL++  LF+H V SIGVNYGTLG+NLPPP +VA+F+K+KTVIDR+KIFD+NPDILRA
Sbjct  7    FVLFLIAIALFLHDVTSIGVNYGTLGNNLPPPAQVAQFIKDKTVIDRVKIFDINPDILRA  66

Query  252  FAGTGILVTVTVPNGEIIPLKDAGYAAQWVAANIKPFYPATKINIIAVGQR  404
            FA TGI +TVTVPNGEI  L D  YA ++V  NIKP YP TK+++I VG  
Sbjct  67   FANTGISLTVTVPNGEIPNLLDLAYARRYVEQNIKPHYPQTKMDVILVGNE  117


 Score = 49.3 bits (116),  Expect(2) = 2e-43, Method: Compositional matrix adjust.
 Identities = 22/33 (67%), Positives = 25/33 (76%), Gaps = 0/33 (0%)
 Frame = +1

Query  397  GNEVLHWGTPEMQNGLVAAMRSLYNALVKSGIK  495
            GNEVLHW TPE+QN LV AM+  Y AL  SG+K
Sbjct  115  GNEVLHWDTPEVQNKLVPAMKVFYQALGLSGLK  147



>ref|NP_001275174.1| glucan endo-1,3-beta-glucosidase-like precursor [Solanum tuberosum]
 gb|AFU52649.1| beta-1,3-glucanase 14 [Solanum tuberosum]
Length=462

 Score =   151 bits (382),  Expect(2) = 5e-43, Method: Compositional matrix adjust.
 Identities = 75/119 (63%), Positives = 94/119 (79%), Gaps = 2/119 (2%)
 Frame = +3

Query  48   MSLRPSPIFLFFLVSAFLFIHGVRSIGVNYGTLGDNLPPPTEVARFLKEKTVIDRIKIFD  227
            +S + S I  FF+++  LF+H V SIGVNYGTLG+NLPPP +VA+F+K+KTVIDR+KIFD
Sbjct  4    ISSKTSFILFFFVIA--LFLHDVTSIGVNYGTLGNNLPPPAQVAQFIKDKTVIDRVKIFD  61

Query  228  VNPDILRAFAGTGILVTVTVPNGEIIPLKDAGYAAQWVAANIKPFYPATKINIIAVGQR  404
            +NPDILRAFA TGI +TVTVPNGEI  L D  YA ++V  NIKP YP TKI+++ VG  
Sbjct  62   INPDILRAFANTGISLTVTVPNGEIPNLLDLAYARRYVEQNIKPHYPQTKIDVVLVGNE  120


 Score = 49.3 bits (116),  Expect(2) = 5e-43, Method: Compositional matrix adjust.
 Identities = 22/33 (67%), Positives = 25/33 (76%), Gaps = 0/33 (0%)
 Frame = +1

Query  397  GNEVLHWGTPEMQNGLVAAMRSLYNALVKSGIK  495
            GNEVLHW TPE+QN LV AM+  Y AL  SG+K
Sbjct  118  GNEVLHWDTPEVQNKLVPAMKVFYQALGLSGLK  150



>gb|AHL24654.1| Fra e 9.01 allergen [Fraxinus excelsior]
Length=462

 Score =   153 bits (387),  Expect(2) = 9e-43, Method: Compositional matrix adjust.
 Identities = 80/123 (65%), Positives = 88/123 (72%), Gaps = 2/123 (2%)
 Frame = +3

Query  42   MEMSLRPSPIFLFFLVSAFLFIH--GVRSIGVNYGTLGDNLPPPTEVARFLKEKTVIDRI  215
            ME S R S  F+   V   L  H   V SIGVNYGTLG+NLPPP +VA+FLKEKT IDR+
Sbjct  1    MEFSKRHSLFFVLLFVYTILVQHFAAVNSIGVNYGTLGNNLPPPAQVAQFLKEKTTIDRV  60

Query  216  KIFDVNPDILRAFAGTGILVTVTVPNGEIIPLKDAGYAAQWVAANIKPFYPATKINIIAV  395
            K+FDVNPDILRAFAGTGI V VTVPNGEI  L +   A +WV  NIKPFYP TKIN I V
Sbjct  61   KLFDVNPDILRAFAGTGIFVAVTVPNGEIPNLVNMKNARRWVGDNIKPFYPQTKINYILV  120

Query  396  GQR  404
            G  
Sbjct  121  GNE  123


 Score = 47.0 bits (110),  Expect(2) = 9e-43, Method: Compositional matrix adjust.
 Identities = 20/33 (61%), Positives = 27/33 (82%), Gaps = 0/33 (0%)
 Frame = +1

Query  397  GNEVLHWGTPEMQNGLVAAMRSLYNALVKSGIK  495
            GNEVLHWG   + + LV AMR+L+NAL++SGI+
Sbjct  121  GNEVLHWGPQNVIDNLVGAMRALHNALIRSGIQ  153



>ref|XP_009593199.1| PREDICTED: glucan endo-1,3-beta-glucosidase-like [Nicotiana tomentosiformis]
Length=464

 Score =   153 bits (387),  Expect(2) = 2e-42, Method: Compositional matrix adjust.
 Identities = 78/116 (67%), Positives = 90/116 (78%), Gaps = 0/116 (0%)
 Frame = +3

Query  57   RPSPIFLFFLVSAFLFIHGVRSIGVNYGTLGDNLPPPTEVARFLKEKTVIDRIKIFDVNP  236
            RPS + +     A LF   V SIGVNYGTLG+NLPPP +VA+FLK+KTVIDRIKIFD+NP
Sbjct  5    RPSMLLVLIFFVAPLFFPAVNSIGVNYGTLGNNLPPPAQVAQFLKDKTVIDRIKIFDINP  64

Query  237  DILRAFAGTGILVTVTVPNGEIIPLKDAGYAAQWVAANIKPFYPATKINIIAVGQR  404
            DILRAFA TGI VTVTVPNGEI  L D  YA +++ ANIKPFYP TKI++I VG  
Sbjct  65   DILRAFANTGISVTVTVPNGEIPNLLDISYARRYIDANIKPFYPQTKIDVILVGNE  120


 Score = 45.4 bits (106),  Expect(2) = 2e-42, Method: Compositional matrix adjust.
 Identities = 19/33 (58%), Positives = 25/33 (76%), Gaps = 0/33 (0%)
 Frame = +1

Query  397  GNEVLHWGTPEMQNGLVAAMRSLYNALVKSGIK  495
            GNEVLHW  P++Q  LV AM++ Y AL +SG+K
Sbjct  118  GNEVLHWDGPDIQMKLVPAMKTFYQALGQSGLK  150



>gb|AHL24655.1| Fra e 9.02 allergen [Fraxinus excelsior]
Length=468

 Score =   152 bits (383),  Expect(2) = 2e-42, Method: Compositional matrix adjust.
 Identities = 79/123 (64%), Positives = 87/123 (71%), Gaps = 2/123 (2%)
 Frame = +3

Query  42   MEMSLRPSPIFLFFLVSAFLFIH--GVRSIGVNYGTLGDNLPPPTEVARFLKEKTVIDRI  215
            ME S R S  F+   V   L  H   V SIGVNYGTLG+NLPPP +VA+FLKEKT IDR+
Sbjct  1    MEFSKRHSLFFVLLFVYTILVQHFAAVNSIGVNYGTLGNNLPPPAQVAQFLKEKTTIDRV  60

Query  216  KIFDVNPDILRAFAGTGILVTVTVPNGEIIPLKDAGYAAQWVAANIKPFYPATKINIIAV  395
            K+FDVNPDILR FAGTGI V VTVPNGEI  L +   A +WV  NIKPFYP TKIN I V
Sbjct  61   KLFDVNPDILRTFAGTGIFVAVTVPNGEIPNLVNMKNARRWVGDNIKPFYPQTKINYILV  120

Query  396  GQR  404
            G  
Sbjct  121  GNE  123


 Score = 47.0 bits (110),  Expect(2) = 2e-42, Method: Compositional matrix adjust.
 Identities = 20/33 (61%), Positives = 27/33 (82%), Gaps = 0/33 (0%)
 Frame = +1

Query  397  GNEVLHWGTPEMQNGLVAAMRSLYNALVKSGIK  495
            GNEVLHWG   + + LV AMR+L+NAL++SGI+
Sbjct  121  GNEVLHWGAQNVIDNLVGAMRALHNALIRSGIQ  153



>ref|XP_009789910.1| PREDICTED: glucan endo-1,3-beta-glucosidase-like [Nicotiana sylvestris]
Length=463

 Score =   151 bits (382),  Expect(2) = 8e-42, Method: Compositional matrix adjust.
 Identities = 79/116 (68%), Positives = 90/116 (78%), Gaps = 1/116 (1%)
 Frame = +3

Query  57   RPSPIFLFFLVSAFLFIHGVRSIGVNYGTLGDNLPPPTEVARFLKEKTVIDRIKIFDVNP  236
            RPS + L   V   LF   V SIGVNYGTLG+NLPPP +VA+FLK+KTVIDRIKIFD+NP
Sbjct  5    RPSLLLLILFVVP-LFFPAVNSIGVNYGTLGNNLPPPAQVAQFLKDKTVIDRIKIFDINP  63

Query  237  DILRAFAGTGILVTVTVPNGEIIPLKDAGYAAQWVAANIKPFYPATKINIIAVGQR  404
            DILRAFA TGI VTVTVPNGEI  L D  YA +++ ANIKPFYP TKI++I VG  
Sbjct  64   DILRAFANTGISVTVTVPNGEIPNLLDISYARRYIDANIKPFYPQTKIDVILVGNE  119


 Score = 45.4 bits (106),  Expect(2) = 8e-42, Method: Compositional matrix adjust.
 Identities = 19/33 (58%), Positives = 25/33 (76%), Gaps = 0/33 (0%)
 Frame = +1

Query  397  GNEVLHWGTPEMQNGLVAAMRSLYNALVKSGIK  495
            GNEVLHW  P++Q  LV AM++ Y AL +SG+K
Sbjct  117  GNEVLHWDGPDIQMKLVPAMKTFYQALGQSGLK  149



>gb|EYU33213.1| hypothetical protein MIMGU_mgv1a006294mg [Erythranthe guttata]
Length=449

 Score =   151 bits (382),  Expect(2) = 8e-41, Method: Compositional matrix adjust.
 Identities = 73/97 (75%), Positives = 81/97 (84%), Gaps = 0/97 (0%)
 Frame = +3

Query  114  VRSIGVNYGTLGDNLPPPTEVARFLKEKTVIDRIKIFDVNPDILRAFAGTGILVTVTVPN  293
            V SIGVNYGT+GDNLPPP +VA+FLK+KT IDRIKIFD NPDILRAF+GTGILV VTVPN
Sbjct  20   VESIGVNYGTMGDNLPPPAQVAQFLKDKTTIDRIKIFDANPDILRAFSGTGILVAVTVPN  79

Query  294  GEIIPLKDAGYAAQWVAANIKPFYPATKINIIAVGQR  404
            GEI  L D G A +WVAANI+PF+P TKIN I VG  
Sbjct  80   GEIPSLTDPGNARRWVAANIQPFHPQTKINYILVGNE  116


 Score = 42.0 bits (97),  Expect(2) = 8e-41, Method: Compositional matrix adjust.
 Identities = 19/32 (59%), Positives = 24/32 (75%), Gaps = 0/32 (0%)
 Frame = +1

Query  397  GNEVLHWGTPEMQNGLVAAMRSLYNALVKSGI  492
            GNE+LHWG   + + LV+AMRSL+ AL  SGI
Sbjct  114  GNEILHWGPQNLVDNLVSAMRSLHTALSLSGI  145



>emb|CDP00093.1| unnamed protein product [Coffea canephora]
Length=452

 Score =   145 bits (367),  Expect(2) = 2e-40, Method: Compositional matrix adjust.
 Identities = 77/122 (63%), Positives = 89/122 (73%), Gaps = 3/122 (2%)
 Frame = +3

Query  48   MSLR-PSPIFLFFLVSAFLFIH--GVRSIGVNYGTLGDNLPPPTEVARFLKEKTVIDRIK  218
            MS R  S     FLV A    H   V+SIGVNYGT+ DNLPPP +V +F+K+KT IDR+K
Sbjct  1    MSKRTQSSAMAIFLVFALFIQHFSAVQSIGVNYGTVADNLPPPAQVVQFIKDKTFIDRVK  60

Query  219  IFDVNPDILRAFAGTGILVTVTVPNGEIIPLKDAGYAAQWVAANIKPFYPATKINIIAVG  398
            IFDVNPDI+RAFA TGIL+TVTVPNGEI  L +  YA +WV  +IKPFYP TKIN IAVG
Sbjct  61   IFDVNPDIIRAFANTGILLTVTVPNGEIPNLTNIRYARRWVNEHIKPFYPQTKINYIAVG  120

Query  399  QR  404
              
Sbjct  121  NE  122


 Score = 46.6 bits (109),  Expect(2) = 2e-40, Method: Compositional matrix adjust.
 Identities = 21/32 (66%), Positives = 26/32 (81%), Gaps = 0/32 (0%)
 Frame = +1

Query  397  GNEVLHWGTPEMQNGLVAAMRSLYNALVKSGI  492
            GNEVLHWG   + + LVAAMR+L+ ALVK+GI
Sbjct  120  GNEVLHWGPQNLIDNLVAAMRTLHQALVKNGI  151



>gb|EPS63364.1| glycoside hydrolase, partial [Genlisea aurea]
Length=435

 Score =   148 bits (373),  Expect(2) = 3e-40, Method: Compositional matrix adjust.
 Identities = 72/107 (67%), Positives = 84/107 (79%), Gaps = 0/107 (0%)
 Frame = +3

Query  84   LVSAFLFIHGVRSIGVNYGTLGDNLPPPTEVARFLKEKTVIDRIKIFDVNPDILRAFAGT  263
            ++ + L    V SIGVNYGTL DNLPPP EVA FL+++T IDR+KIFD+NPDILRAFAGT
Sbjct  2    VILSVLLFPAVDSIGVNYGTLADNLPPPLEVAHFLRDRTTIDRVKIFDINPDILRAFAGT  61

Query  264  GILVTVTVPNGEIIPLKDAGYAAQWVAANIKPFYPATKINIIAVGQR  404
            GI V VTVPNG+I  L DAG A +WVAANI+PFYP TKI+ I VG  
Sbjct  62   GISVAVTVPNGDIPSLTDAGNAQRWVAANIQPFYPQTKIDSILVGNE  108


 Score = 43.5 bits (101),  Expect(2) = 3e-40, Method: Compositional matrix adjust.
 Identities = 18/32 (56%), Positives = 25/32 (78%), Gaps = 0/32 (0%)
 Frame = +1

Query  397  GNEVLHWGTPEMQNGLVAAMRSLYNALVKSGI  492
            GNE+LHWG   +++ LVAAMR+L  ALV +G+
Sbjct  106  GNEILHWGPQNLRDSLVAAMRTLQRALVAAGV  137



>ref|XP_011101632.1| PREDICTED: glucan endo-1,3-beta-glucosidase-like [Sesamum indicum]
Length=456

 Score =   137 bits (346),  Expect(2) = 7e-38, Method: Compositional matrix adjust.
 Identities = 72/117 (62%), Positives = 86/117 (74%), Gaps = 4/117 (3%)
 Frame = +3

Query  54   LRPSPIFLFFLVSAFLFIHGVRSIGVNYGTLGDNLPPPTEVARFLKEKTVIDRIKIFDVN  233
            +R +   LF L      I  V+SIGVNYGTLG+NLPPP +VA+FLKEKT++D +KIFDVN
Sbjct  8    IRVAATTLFLLA----IITTVQSIGVNYGTLGNNLPPPAQVAQFLKEKTIVDGVKIFDVN  63

Query  234  PDILRAFAGTGILVTVTVPNGEIIPLKDAGYAAQWVAANIKPFYPATKINIIAVGQR  404
            PDILRAFA TGI VT+TVPN +I  L     A +WVAANIKPFYP TKI+ + VG  
Sbjct  64   PDILRAFANTGIHVTITVPNDQIPNLTVVRNARRWVAANIKPFYPQTKIHYVLVGNE  120


 Score = 46.2 bits (108),  Expect(2) = 7e-38, Method: Compositional matrix adjust.
 Identities = 20/33 (61%), Positives = 25/33 (76%), Gaps = 0/33 (0%)
 Frame = +1

Query  397  GNEVLHWGTPEMQNGLVAAMRSLYNALVKSGIK  495
            GNE+LHWG   +++ LVAAMR+LY AL   GIK
Sbjct  118  GNEILHWGPQNLRDNLVAAMRTLYKALRMEGIK  150



>gb|EPS69142.1| hypothetical protein M569_05624, partial [Genlisea aurea]
Length=349

 Score =   142 bits (358),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 68/100 (68%), Positives = 81/100 (81%), Gaps = 0/100 (0%)
 Frame = +3

Query  105  IHGVRSIGVNYGTLGDNLPPPTEVARFLKEKTVIDRIKIFDVNPDILRAFAGTGILVTVT  284
            I  V SIGVNYGT+ +NLPPP +VA+F+K+KT IDR+KIFDVNPDILRAFA TGILV+VT
Sbjct  18   ISAVHSIGVNYGTIANNLPPPAQVAQFIKQKTFIDRVKIFDVNPDILRAFANTGILVSVT  77

Query  285  VPNGEIIPLKDAGYAAQWVAANIKPFYPATKINIIAVGQR  404
            VPNGEI  L +  YA +WV+ NIKPF+P T+IN I VG  
Sbjct  78   VPNGEIPNLTNIRYARRWVSVNIKPFHPQTRINYILVGNE  117



>ref|XP_010091462.1| putative glucan endo-1,3-beta-glucosidase A6 [Morus notabilis]
 gb|EXC36948.1| putative glucan endo-1,3-beta-glucosidase A6 [Morus notabilis]
Length=186

 Score =   133 bits (334),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 67/103 (65%), Positives = 77/103 (75%), Gaps = 3/103 (3%)
 Frame = +3

Query  123  IGVNYGTLGDNLPPPTEVARFLKEKTVIDRIKIFDVNPDILRAFAGTGILVTVTVPNGEI  302
            IG NYGTLG+NLPPP +V  FLK +T +DRIKIFD NPDILRAFA +GI VTVTV NGEI
Sbjct  55   IGFNYGTLGNNLPPPLQVVNFLKTQTTVDRIKIFDANPDILRAFADSGIAVTVTVGNGEI  114

Query  303  IPLKDAGYAAQWVAANIKPFYPATKINIIAVGQRGSPLGHAGD  431
            + L D   A +WV+ NIKPFYP T+IN IAVG     + H GD
Sbjct  115  VGLTDPKAARRWVSTNIKPFYPRTRINYIAVGNE---VIHWGD  154



>ref|XP_003552703.1| PREDICTED: glucan endo-1,3-beta-glucosidase [Glycine max]
Length=454

 Score =   138 bits (348),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 71/111 (64%), Positives = 79/111 (71%), Gaps = 3/111 (3%)
 Frame = +3

Query  114  VRSIGVNYGTLGDNLPPPTEVARFLKEKTVIDRIKIFDVNPDILRAFAGTGILVTVTVPN  293
               IG+NYGTLGDNLPPP  VA FLK KT IDR+KI+DVNPDILRAFAG+GI VTVT PN
Sbjct  22   AHGIGINYGTLGDNLPPPAAVANFLKTKTTIDRVKIYDVNPDILRAFAGSGISVTVTAPN  81

Query  294  GEIIPLKDAGYAAQWVAANIKPFYPATKINIIAVGQRGSPLGHAGDAERPR  446
            G+I  L     A QWVA +IKPF+P TKIN I V   GS + H GD    R
Sbjct  82   GDIAALTKIDSARQWVATHIKPFHPQTKINYILV---GSEVLHWGDTNMIR  129



>emb|CBI31680.3| unnamed protein product [Vitis vinifera]
Length=406

 Score =   137 bits (344),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 70/111 (63%), Positives = 80/111 (72%), Gaps = 0/111 (0%)
 Frame = +3

Query  72   FLFFLVSAFLFIHGVRSIGVNYGTLGDNLPPPTEVARFLKEKTVIDRIKIFDVNPDILRA  251
            F+ F VSA LF     SIGVNYGTL DNLPPP +VA FLK +T ID+IKIFD NPDILRA
Sbjct  11   FVIFGVSALLFSATAYSIGVNYGTLADNLPPPAQVANFLKTRTTIDQIKIFDSNPDILRA  70

Query  252  FAGTGILVTVTVPNGEIIPLKDAGYAAQWVAANIKPFYPATKINIIAVGQR  404
            FA TGI VT+TV NG+I  +     A  WVA +I PFYP+TKIN +AVG  
Sbjct  71   FASTGIGVTITVGNGDIPAITKLPAARDWVATHILPFYPSTKINYVAVGNE  121



>ref|XP_002283647.1| PREDICTED: glucan endo-1,3-beta-glucosidase [Vitis vinifera]
Length=447

 Score =   137 bits (344),  Expect = 7e-35, Method: Compositional matrix adjust.
 Identities = 70/111 (63%), Positives = 80/111 (72%), Gaps = 0/111 (0%)
 Frame = +3

Query  72   FLFFLVSAFLFIHGVRSIGVNYGTLGDNLPPPTEVARFLKEKTVIDRIKIFDVNPDILRA  251
            F+ F VSA LF     SIGVNYGTL DNLPPP +VA FLK +T ID+IKIFD NPDILRA
Sbjct  11   FVIFGVSALLFSATAYSIGVNYGTLADNLPPPAQVANFLKTRTTIDQIKIFDSNPDILRA  70

Query  252  FAGTGILVTVTVPNGEIIPLKDAGYAAQWVAANIKPFYPATKINIIAVGQR  404
            FA TGI VT+TV NG+I  +     A  WVA +I PFYP+TKIN +AVG  
Sbjct  71   FASTGIGVTITVGNGDIPAITKLPAARDWVATHILPFYPSTKINYVAVGNE  121



>ref|XP_004516968.1| PREDICTED: glucan endo-1,3-beta-glucosidase-like [Cicer arietinum]
Length=450

 Score =   135 bits (340),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 70/106 (66%), Positives = 79/106 (75%), Gaps = 3/106 (3%)
 Frame = +3

Query  114  VRSIGVNYGTLGDNLPPPTEVARFLKEKTVIDRIKIFDVNPDILRAFAGTGILVTVTVPN  293
            V SIGVNYGTLGDNLPPPT VA FLK  T+IDR+KI+DV+P IL+AFA TGI VTVT PN
Sbjct  21   VNSIGVNYGTLGDNLPPPTTVANFLKTNTIIDRVKIYDVSPQILQAFANTGIAVTVTAPN  80

Query  294  GEIIPLKDAGYAAQWVAANIKPFYPATKINIIAVGQRGSPLGHAGD  431
            G+I  L +   A QWV  NIKPF+P TKIN I V   GS + H GD
Sbjct  81   GDIATLTNIDSARQWVVRNIKPFHPMTKINYILV---GSEVLHWGD  123



>gb|KCW85568.1| hypothetical protein EUGRSUZ_B02365, partial [Eucalyptus grandis]
Length=346

 Score =   133 bits (334),  Expect = 6e-34, Method: Compositional matrix adjust.
 Identities = 71/119 (60%), Positives = 83/119 (70%), Gaps = 1/119 (1%)
 Frame = +3

Query  51   SLRPSPIFLFFL-VSAFLFIHGVRSIGVNYGTLGDNLPPPTEVARFLKEKTVIDRIKIFD  227
            +L P    +FFL V+         +IGVNYGT+ DNLPPP++VA FLK KT IDR+K+FD
Sbjct  3    NLFPLATAVFFLSVACPHLSRAAYTIGVNYGTVADNLPPPSQVATFLKTKTAIDRVKLFD  62

Query  228  VNPDILRAFAGTGILVTVTVPNGEIIPLKDAGYAAQWVAANIKPFYPATKINIIAVGQR  404
             NPDILRAFAGTGI VTVTV NG+II L     A  WV+ANI PF+P T IN IAVG  
Sbjct  63   ANPDILRAFAGTGIAVTVTVGNGDIISLSKLPSAQAWVSANILPFHPKTLINRIAVGNE  121



>ref|XP_010043554.1| PREDICTED: glucan endo-1,3-beta-glucosidase-like isoform X2 [Eucalyptus 
grandis]
Length=354

 Score =   132 bits (333),  Expect = 8e-34, Method: Compositional matrix adjust.
 Identities = 71/119 (60%), Positives = 83/119 (70%), Gaps = 1/119 (1%)
 Frame = +3

Query  51   SLRPSPIFLFFL-VSAFLFIHGVRSIGVNYGTLGDNLPPPTEVARFLKEKTVIDRIKIFD  227
            +L P    +FFL V+         +IGVNYGT+ DNLPPP++VA FLK KT IDR+K+FD
Sbjct  3    NLFPLATAVFFLSVACPHLSRAAYTIGVNYGTVADNLPPPSQVATFLKTKTAIDRVKLFD  62

Query  228  VNPDILRAFAGTGILVTVTVPNGEIIPLKDAGYAAQWVAANIKPFYPATKINIIAVGQR  404
             NPDILRAFAGTGI VTVTV NG+II L     A  WV+ANI PF+P T IN IAVG  
Sbjct  63   ANPDILRAFAGTGIAVTVTVGNGDIISLSKLPSAQAWVSANILPFHPKTLINRIAVGNE  121



>ref|XP_003622030.1| Glucan endo-1,3-beta-glucosidase [Medicago truncatula]
 gb|AES78248.1| glucan endo-1,3-beta-glucosidase-like protein [Medicago truncatula]
Length=448

 Score =   133 bits (335),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 69/108 (64%), Positives = 77/108 (71%), Gaps = 3/108 (3%)
 Frame = +3

Query  114  VRSIGVNYGTLGDNLPPPTEVARFLKEKTVIDRIKIFDVNPDILRAFAGTGILVTVTVPN  293
            V SIGVNYGTL DNLPPP  VA FLK  T++DR+KIFDV+P IL+AFA TGI VTVT PN
Sbjct  20   VNSIGVNYGTLADNLPPPATVANFLKTNTIVDRVKIFDVSPQILQAFANTGISVTVTAPN  79

Query  294  GEIIPLKDAGYAAQWVAANIKPFYPATKINIIAVGQRGSPLGHAGDAE  437
            G+I  L +   A QWV   IKPFYPATKIN I V   GS + H GD  
Sbjct  80   GDIAALGNINSARQWVQQKIKPFYPATKINYILV---GSEVLHWGDGN  124



>ref|XP_010043553.1| PREDICTED: glucan endo-1,3-beta-glucosidase-like isoform X1 [Eucalyptus 
grandis]
Length=410

 Score =   132 bits (333),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 71/119 (60%), Positives = 83/119 (70%), Gaps = 1/119 (1%)
 Frame = +3

Query  51   SLRPSPIFLFFL-VSAFLFIHGVRSIGVNYGTLGDNLPPPTEVARFLKEKTVIDRIKIFD  227
            +L P    +FFL V+         +IGVNYGT+ DNLPPP++VA FLK KT IDR+K+FD
Sbjct  3    NLFPLATAVFFLSVACPHLSRAAYTIGVNYGTVADNLPPPSQVATFLKTKTAIDRVKLFD  62

Query  228  VNPDILRAFAGTGILVTVTVPNGEIIPLKDAGYAAQWVAANIKPFYPATKINIIAVGQR  404
             NPDILRAFAGTGI VTVTV NG+II L     A  WV+ANI PF+P T IN IAVG  
Sbjct  63   ANPDILRAFAGTGIAVTVTVGNGDIISLSKLPSAQAWVSANILPFHPKTLINRIAVGNE  121



>ref|XP_004167482.1| PREDICTED: glucan endo-1,3-beta-glucosidase-like [Cucumis sativus]
Length=447

 Score =   133 bits (334),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 67/98 (68%), Positives = 77/98 (79%), Gaps = 0/98 (0%)
 Frame = +3

Query  111  GVRSIGVNYGTLGDNLPPPTEVARFLKEKTVIDRIKIFDVNPDILRAFAGTGILVTVTVP  290
             V +IGVNYGTLG+NL PP EVA FLK KT IDR+KIFD NPDILRAFAG+GILVTVTV 
Sbjct  23   AVFAIGVNYGTLGNNLRPPAEVANFLKTKTKIDRVKIFDTNPDILRAFAGSGILVTVTVG  82

Query  291  NGEIIPLKDAGYAAQWVAANIKPFYPATKINIIAVGQR  404
            NG I  L D  +A +WVAA+I PF+P T+I+ IAVG  
Sbjct  83   NGLIPNLADLAFAREWVAAHIAPFHPQTRIHYIAVGNE  120



>ref|XP_004147695.1| PREDICTED: glucan endo-1,3-beta-glucosidase-like [Cucumis sativus]
 gb|KGN50541.1| hypothetical protein Csa_5G181480 [Cucumis sativus]
Length=441

 Score =   132 bits (333),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 67/98 (68%), Positives = 77/98 (79%), Gaps = 0/98 (0%)
 Frame = +3

Query  111  GVRSIGVNYGTLGDNLPPPTEVARFLKEKTVIDRIKIFDVNPDILRAFAGTGILVTVTVP  290
             V +IGVNYGTLG+NL PP EVA FLK KT IDR+KIFD NPDILRAFAG+GILVTVTV 
Sbjct  23   AVFAIGVNYGTLGNNLRPPAEVANFLKTKTKIDRVKIFDTNPDILRAFAGSGILVTVTVG  82

Query  291  NGEIIPLKDAGYAAQWVAANIKPFYPATKINIIAVGQR  404
            NG I  L D  +A +WVAA+I PF+P T+I+ IAVG  
Sbjct  83   NGLIPNLADLAFAREWVAAHIAPFHPQTRIHYIAVGNE  120



>ref|XP_010043555.1| PREDICTED: glucan endo-1,3-beta-glucosidase-like [Eucalyptus 
grandis]
 gb|KCW85569.1| hypothetical protein EUGRSUZ_B02367 [Eucalyptus grandis]
Length=501

 Score =   133 bits (334),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 71/119 (60%), Positives = 83/119 (70%), Gaps = 1/119 (1%)
 Frame = +3

Query  51   SLRPSPIFLFFL-VSAFLFIHGVRSIGVNYGTLGDNLPPPTEVARFLKEKTVIDRIKIFD  227
            +L P    +FFL V+         +IGVNYGT+ DNLPPP++VA FLK KT IDR+K+FD
Sbjct  3    NLFPLATAVFFLSVACPHLSRAAYTIGVNYGTVADNLPPPSQVATFLKTKTAIDRVKLFD  62

Query  228  VNPDILRAFAGTGILVTVTVPNGEIIPLKDAGYAAQWVAANIKPFYPATKINIIAVGQR  404
             NPDILRAFAGTGI VTVTV NG+II L     A  WV+ANI PF+P T IN IAVG  
Sbjct  63   ANPDILRAFAGTGIAVTVTVGNGDIISLSKLPAAQAWVSANILPFHPKTLINRIAVGNE  121



>gb|KCW85570.1| hypothetical protein EUGRSUZ_B02367 [Eucalyptus grandis]
Length=460

 Score =   132 bits (333),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 70/118 (59%), Positives = 81/118 (69%), Gaps = 8/118 (7%)
 Frame = +3

Query  75   LFFLVSAFLFI--------HGVRSIGVNYGTLGDNLPPPTEVARFLKEKTVIDRIKIFDV  230
            LF L +A  F+            +IGVNYGT+ DNLPPP++VA FLK KT IDR+K+FD 
Sbjct  4    LFPLATAVFFLSVACPHLSRAAYTIGVNYGTVADNLPPPSQVATFLKTKTAIDRVKLFDA  63

Query  231  NPDILRAFAGTGILVTVTVPNGEIIPLKDAGYAAQWVAANIKPFYPATKINIIAVGQR  404
            NPDILRAFAGTGI VTVTV NG+II L     A  WV+ANI PF+P T IN IAVG  
Sbjct  64   NPDILRAFAGTGIAVTVTVGNGDIISLSKLPAAQAWVSANILPFHPKTLINRIAVGNE  121



>ref|XP_008461659.1| PREDICTED: glucan endo-1,3-beta-glucosidase [Cucumis melo]
Length=449

 Score =   132 bits (332),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 69/112 (62%), Positives = 81/112 (72%), Gaps = 5/112 (4%)
 Frame = +3

Query  69   IFLFFLVSAFLFIHGVRSIGVNYGTLGDNLPPPTEVARFLKEKTVIDRIKIFDVNPDILR  248
            IFL   +S  +F     +IGVNYGTLG+NL PP EV  FLK KT IDR+KIFD NPDILR
Sbjct  13   IFLLLQISTTVF-----AIGVNYGTLGNNLRPPAEVVNFLKTKTKIDRVKIFDTNPDILR  67

Query  249  AFAGTGILVTVTVPNGEIIPLKDAGYAAQWVAANIKPFYPATKINIIAVGQR  404
            AFAG+GILVTVTV NGEI  L +  +A  WVA +I PF+P T+I+ IAVG  
Sbjct  68   AFAGSGILVTVTVGNGEIPALGNLAFARAWVAEHIAPFHPQTRIHYIAVGNE  119



>gb|KJB73920.1| hypothetical protein B456_011G261000 [Gossypium raimondii]
Length=366

 Score =   131 bits (329),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 62/118 (53%), Positives = 80/118 (68%), Gaps = 0/118 (0%)
 Frame = +3

Query  51   SLRPSPIFLFFLVSAFLFIHGVRSIGVNYGTLGDNLPPPTEVARFLKEKTVIDRIKIFDV  230
            SL    +FLF   + F       +IGVNYG + DNLP PTEVA F+K KT+ D +KIFD 
Sbjct  3    SLTSLQLFLFLSTTVFNLFSSTAAIGVNYGMVADNLPSPTEVANFIKTKTIFDSVKIFDT  62

Query  231  NPDILRAFAGTGILVTVTVPNGEIIPLKDAGYAAQWVAANIKPFYPATKINIIAVGQR  404
            NP++LRAF  TGI +TVT+PNGEI  L + G A+ WV ANI+PF+P T+I  I++G  
Sbjct  63   NPNVLRAFTNTGITMTVTIPNGEIPNLANEGAASAWVNANIQPFHPQTRIKYISIGNE  120



>ref|XP_007139210.1| hypothetical protein PHAVU_008G010600g [Phaseolus vulgaris]
 gb|ESW11204.1| hypothetical protein PHAVU_008G010600g [Phaseolus vulgaris]
Length=443

 Score =   132 bits (332),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 67/111 (60%), Positives = 80/111 (72%), Gaps = 3/111 (3%)
 Frame = +3

Query  114  VRSIGVNYGTLGDNLPPPTEVARFLKEKTVIDRIKIFDVNPDILRAFAGTGILVTVTVPN  293
              SIG+NYGTLGDNLPPP  VA FLK +T IDR+KI+DVNP IL+AFA +GI +TVT PN
Sbjct  22   AHSIGINYGTLGDNLPPPATVANFLKTRTTIDRVKIYDVNPQILQAFANSGISMTVTAPN  81

Query  294  GEIIPLKDAGYAAQWVAANIKPFYPATKINIIAVGQRGSPLGHAGDAERPR  446
            G+I  LK    A QWV ++IKPF+P TKI  I V   GS + H GDA+  R
Sbjct  82   GDIAVLKQIDTARQWVVSHIKPFHPQTKIEYILV---GSEVLHWGDADMIR  129



>ref|XP_002530863.1| Glucan endo-1,3-beta-glucosidase precursor, putative [Ricinus 
communis]
 gb|EEF31537.1| Glucan endo-1,3-beta-glucosidase precursor, putative [Ricinus 
communis]
Length=457

 Score =   132 bits (331),  Expect = 5e-33, Method: Compositional matrix adjust.
 Identities = 67/120 (56%), Positives = 85/120 (71%), Gaps = 1/120 (1%)
 Frame = +3

Query  48   MSLRPSPIFLFFLVSAFLFIHG-VRSIGVNYGTLGDNLPPPTEVARFLKEKTVIDRIKIF  224
            M+ +     L  L+S F  +   + +IGVNYGTLG+NLPPP++VA+F+K +T+ID IKIF
Sbjct  1    MTTKTHHRHLLLLISTFFHLSTTIFAIGVNYGTLGNNLPPPSQVAKFIKTQTIIDSIKIF  60

Query  225  DVNPDILRAFAGTGILVTVTVPNGEIIPLKDAGYAAQWVAANIKPFYPATKINIIAVGQR  404
            D NPD+LRAFA TGI VTVTV NG+I  L +   A +WV ANI PFYP T+IN I VG  
Sbjct  61   DTNPDVLRAFANTGISVTVTVGNGDIPALANINNARRWVVANIAPFYPRTRINRIVVGNE  120



>ref|XP_010922329.1| PREDICTED: glucan endo-1,3-beta-glucosidase-like [Elaeis guineensis]
Length=447

 Score =   131 bits (330),  Expect = 7e-33, Method: Compositional matrix adjust.
 Identities = 62/94 (66%), Positives = 74/94 (79%), Gaps = 0/94 (0%)
 Frame = +3

Query  123  IGVNYGTLGDNLPPPTEVARFLKEKTVIDRIKIFDVNPDILRAFAGTGILVTVTVPNGEI  302
            IGVNYGTL DNLPPPT+VA FLKE+T IDR+K+FD NPD++RAFAGTGI V +T PNG+I
Sbjct  26   IGVNYGTLADNLPPPTQVAAFLKERTFIDRVKLFDSNPDLIRAFAGTGISVMITAPNGDI  85

Query  303  IPLKDAGYAAQWVAANIKPFYPATKINIIAVGQR  404
              L     A  WVAA++ PFYPAT I++IAVG  
Sbjct  86   PSLAKLPGAQAWVAAHVAPFYPATNISLIAVGNE  119



>gb|EYU19897.1| hypothetical protein MIMGU_mgv1a006105mg [Erythranthe guttata]
Length=457

 Score =   131 bits (330),  Expect = 7e-33, Method: Compositional matrix adjust.
 Identities = 64/94 (68%), Positives = 76/94 (81%), Gaps = 0/94 (0%)
 Frame = +3

Query  123  IGVNYGTLGDNLPPPTEVARFLKEKTVIDRIKIFDVNPDILRAFAGTGILVTVTVPNGEI  302
            IGVNYG LGDNLPPP +VA+FLK+KT IDR+KIF VN DIL+AFAGTGILV+VT+PNGEI
Sbjct  25   IGVNYGILGDNLPPPAQVAQFLKDKTTIDRVKIFGVNADILQAFAGTGILVSVTIPNGEI  84

Query  303  IPLKDAGYAAQWVAANIKPFYPATKINIIAVGQR  404
              L +  YA +++AANIKPF+P TK   I VG  
Sbjct  85   PNLANIHYARRYIAANIKPFHPQTKFQYILVGNE  118



>ref|XP_002530862.1| Glucan endo-1,3-beta-glucosidase precursor, putative [Ricinus 
communis]
 gb|EEF31536.1| Glucan endo-1,3-beta-glucosidase precursor, putative [Ricinus 
communis]
Length=447

 Score =   131 bits (329),  Expect = 7e-33, Method: Compositional matrix adjust.
 Identities = 64/95 (67%), Positives = 75/95 (79%), Gaps = 0/95 (0%)
 Frame = +3

Query  120  SIGVNYGTLGDNLPPPTEVARFLKEKTVIDRIKIFDVNPDILRAFAGTGILVTVTVPNGE  299
            ++GVNYGTL +NLPPP++VA FLK +T+ID IKIFD NPDILRAFA TGI VTVTV NG+
Sbjct  27   ALGVNYGTLANNLPPPSQVANFLKTQTIIDSIKIFDTNPDILRAFANTGITVTVTVGNGD  86

Query  300  IIPLKDAGYAAQWVAANIKPFYPATKINIIAVGQR  404
            I  L +A  A +WV  NIKP+YP TKIN IAVG  
Sbjct  87   IPALSEAHAARRWVNNNIKPYYPQTKINRIAVGNE  121



>emb|CAB85903.1| beta-1,3 glucanase [Pisum sativum]
Length=453

 Score =   131 bits (329),  Expect = 9e-33, Method: Compositional matrix adjust.
 Identities = 69/113 (61%), Positives = 79/113 (70%), Gaps = 3/113 (3%)
 Frame = +3

Query  96   FLFIHGVRSIGVNYGTLGDNLPPPTEVARFLKEKTVIDRIKIFDVNPDILRAFAGTGILV  275
            F  +  V SIGVNYGTLGDNLPPP  VA FLK  T+ID +KIFDV+P IL+AFA TGI V
Sbjct  18   FHLVATVTSIGVNYGTLGDNLPPPATVANFLKTNTIIDSVKIFDVSPQILQAFANTGISV  77

Query  276  TVTVPNGEIIPLKDAGYAAQWVAANIKPFYPATKINIIAVGQRGSPLGHAGDA  434
            TVT PNG+I  L     A QWV  +IKPF+P TKIN I V   GS + H GD+
Sbjct  78   TVTAPNGDIEALAKIDSARQWVVTHIKPFHPQTKINYILV---GSEVFHWGDS  127



>ref|XP_011029669.1| PREDICTED: glucan endo-1,3-beta-glucosidase-like [Populus euphratica]
Length=448

 Score =   131 bits (329),  Expect = 9e-33, Method: Compositional matrix adjust.
 Identities = 67/111 (60%), Positives = 78/111 (70%), Gaps = 7/111 (6%)
 Frame = +3

Query  72   FLFFLVSAFLFIHGVRSIGVNYGTLGDNLPPPTEVARFLKEKTVIDRIKIFDVNPDILRA  251
             L F  +AF       +IGVNYGTL +NLP P+EVA FLK +T ID IKIFD NPDILRA
Sbjct  19   LLHFSTTAF-------AIGVNYGTLANNLPSPSEVASFLKTQTTIDSIKIFDTNPDILRA  71

Query  252  FAGTGILVTVTVPNGEIIPLKDAGYAAQWVAANIKPFYPATKINIIAVGQR  404
            FA + I VTVTV NG+I  L D   A+QWVA NIKP+YP T+I +IAVG  
Sbjct  72   FANSNITVTVTVGNGDIPALVDVNTASQWVANNIKPYYPQTRIKLIAVGNE  122



>emb|CDY41232.1| BnaC08g26260D [Brassica napus]
Length=451

 Score =   130 bits (328),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 73/121 (60%), Positives = 88/121 (73%), Gaps = 3/121 (2%)
 Frame = +3

Query  48   MSLRPSPIFLFFLVSA-FLFIHG-VRSIGVNYGTLGDNLPPPTEVARFLKEKTVIDRIKI  221
            M+  P  I L  L +A FL +   + SIGVNYGTLG NLPPPT+VA FLK +T ID +KI
Sbjct  1    MAKAPPSISLLLLSAAVFLTLPATISSIGVNYGTLG-NLPPPTQVANFLKTQTSIDSVKI  59

Query  222  FDVNPDILRAFAGTGILVTVTVPNGEIIPLKDAGYAAQWVAANIKPFYPATKINIIAVGQ  401
            F+VNPDI+RAFAGTGI V VTVPNG+I  L +   A +WVAANI+PF+P TKI  I+VG 
Sbjct  60   FNVNPDIIRAFAGTGISVVVTVPNGDIPALANGVQARRWVAANIQPFHPQTKIKYISVGN  119

Query  402  R  404
             
Sbjct  120  E  120



>ref|XP_009405069.1| PREDICTED: glucan endo-1,3-beta-glucosidase-like [Musa acuminata 
subsp. malaccensis]
Length=471

 Score =   130 bits (328),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 69/125 (55%), Positives = 87/125 (70%), Gaps = 2/125 (2%)
 Frame = +3

Query  69   IFLFFLVSAFLFIHGVRSIGVNYGTLGDNLPPPTEVARFLKEKTVIDRIKIFDVNPDILR  248
            +F+  L S+   + G+ SIGVNYGT+ DNLPPP +VA FLK+ T+IDRIK++D NPDI+R
Sbjct  18   LFVLILFSSASAVSGL-SIGVNYGTIADNLPPPPQVAAFLKDHTIIDRIKLYDANPDIIR  76

Query  249  AFAGTGILVTVTVPNGEIIPLKDAGYAAQ-WVAANIKPFYPATKINIIAVGQRGSPLGHA  425
            AFAGT I VT+T PNGEI     +  AA  WVAAN+ PF PAT+I ++ VG      G A
Sbjct  77   AFAGTPISVTITAPNGEIPSFASSREAADAWVAANVAPFVPATRITLVLVGNEILNTGDA  136

Query  426  GDAER  440
            G  ER
Sbjct  137  GLMER  141



>ref|XP_011470609.1| PREDICTED: glucan endo-1,3-beta-glucosidase-like [Fragaria vesca 
subsp. vesca]
Length=702

 Score =   132 bits (331),  Expect = 3e-32, Method: Composition-based stats.
 Identities = 63/104 (61%), Positives = 80/104 (77%), Gaps = 3/104 (3%)
 Frame = +3

Query  120  SIGVNYGTLGDNLPPPTEVARFLKEKTVIDRIKIFDVNPDILRAFAGTGILVTVTVPNGE  299
            SIGVNYGTLGDNLPPP++VA FLK +T+ID +KIFD+NPDI+RAFA +GI +T+T+PNG+
Sbjct  20   SIGVNYGTLGDNLPPPSQVANFLKTQTIIDSLKIFDMNPDIIRAFANSGISLTITLPNGD  79

Query  300  IIPLKDAGYAAQWVAANIKPFYPATKINIIAVGQRGSPLGHAGD  431
            I  L +   A +W+  NIKPFYPAT I  I V   G+ + H GD
Sbjct  80   IPTLTNPRAARRWIQQNIKPFYPATLIRYICV---GTEVLHWGD  120



>gb|ABK95730.1| unknown [Populus trichocarpa]
Length=448

 Score =   129 bits (325),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 66/111 (59%), Positives = 78/111 (70%), Gaps = 7/111 (6%)
 Frame = +3

Query  72   FLFFLVSAFLFIHGVRSIGVNYGTLGDNLPPPTEVARFLKEKTVIDRIKIFDVNPDILRA  251
             L F  +AF       +IGVNYGTL +NLP P++VA FLK +T ID IKIFD NPDILRA
Sbjct  19   LLHFSTTAF-------AIGVNYGTLANNLPSPSQVASFLKTQTTIDSIKIFDTNPDILRA  71

Query  252  FAGTGILVTVTVPNGEIIPLKDAGYAAQWVAANIKPFYPATKINIIAVGQR  404
            FA + I VTVTV NG+I  L D   A+QWVA NIKP+YP T+I +IAVG  
Sbjct  72   FANSNITVTVTVGNGDIPALVDVNAASQWVANNIKPYYPQTRIKLIAVGNE  122



>ref|XP_002312097.1| hypothetical protein POPTR_0008s05600g [Populus trichocarpa]
 gb|EEE89464.1| hypothetical protein POPTR_0008s05600g [Populus trichocarpa]
Length=448

 Score =   129 bits (325),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 66/111 (59%), Positives = 78/111 (70%), Gaps = 7/111 (6%)
 Frame = +3

Query  72   FLFFLVSAFLFIHGVRSIGVNYGTLGDNLPPPTEVARFLKEKTVIDRIKIFDVNPDILRA  251
             L F  +AF       +IGVNYGTL +NLP P++VA FLK +T ID IKIFD NPDILRA
Sbjct  19   LLHFSTTAF-------AIGVNYGTLANNLPSPSQVASFLKTQTTIDSIKIFDTNPDILRA  71

Query  252  FAGTGILVTVTVPNGEIIPLKDAGYAAQWVAANIKPFYPATKINIIAVGQR  404
            FA + I VTVTV NG+I  L D   A+QWVA NIKP+YP T+I +IAVG  
Sbjct  72   FANSNITVTVTVGNGDIPALVDVNAASQWVANNIKPYYPQTRIKLIAVGNE  122



>ref|XP_008802734.1| PREDICTED: glucan endo-1,3-beta-glucosidase [Phoenix dactylifera]
Length=451

 Score =   129 bits (325),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 62/95 (65%), Positives = 72/95 (76%), Gaps = 0/95 (0%)
 Frame = +3

Query  120  SIGVNYGTLGDNLPPPTEVARFLKEKTVIDRIKIFDVNPDILRAFAGTGILVTVTVPNGE  299
            SIGVNYGTL DNLPPP +VA FLKE T IDR+K+FD NPD++RAFAGTGI V +T PNG+
Sbjct  26   SIGVNYGTLADNLPPPAQVAAFLKESTFIDRVKLFDSNPDLIRAFAGTGISVMITAPNGD  85

Query  300  IIPLKDAGYAAQWVAANIKPFYPATKINIIAVGQR  404
            I  L     A  WVAAN+ P YPAT I++IAVG  
Sbjct  86   IPSLAKLPGARAWVAANVAPLYPATNISLIAVGNE  120



>emb|CDY62387.1| BnaCnng40170D [Brassica napus]
Length=449

 Score =   129 bits (325),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 70/116 (60%), Positives = 83/116 (72%), Gaps = 4/116 (3%)
 Frame = +3

Query  66   PIFLFFLVSA---FLFIHGVRSIGVNYGTLGDNLPPPTEVARFLKEKTVIDRIKIFDVNP  236
            P   F L SA   F F   + SIGVNYGTLG NLPPPT+VA FLK +T ID +KIF+V+P
Sbjct  6    PFISFLLFSAAVLFTFPAAISSIGVNYGTLG-NLPPPTQVANFLKTQTSIDSVKIFNVDP  64

Query  237  DILRAFAGTGILVTVTVPNGEIIPLKDAGYAAQWVAANIKPFYPATKINIIAVGQR  404
            +ILRAFAGTGI V VTVPNG+I  L +   A +WV+ANI PF+P TKI  I+VG  
Sbjct  65   NILRAFAGTGISVVVTVPNGDIPALANGMQARRWVSANILPFHPQTKIKYISVGNE  120



>emb|CDY53692.1| BnaA07g37860D [Brassica napus]
Length=449

 Score =   129 bits (324),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 69/116 (59%), Positives = 84/116 (72%), Gaps = 4/116 (3%)
 Frame = +3

Query  66   PIFLFFLVSA---FLFIHGVRSIGVNYGTLGDNLPPPTEVARFLKEKTVIDRIKIFDVNP  236
            P+  F L+SA     F   + SIGVNYGTLG NLPPPT+VA FLK +T ID +KIF+V+P
Sbjct  6    PLISFLLISAAVLLTFPAAISSIGVNYGTLG-NLPPPTQVANFLKTQTSIDSVKIFNVDP  64

Query  237  DILRAFAGTGILVTVTVPNGEIIPLKDAGYAAQWVAANIKPFYPATKINIIAVGQR  404
            +ILRAFAGTGI V VTVPNG+I  L +   A +WV+ANI PF+P TKI  I+VG  
Sbjct  65   NILRAFAGTGISVVVTVPNGDIPALANGMQARRWVSANILPFHPQTKIKYISVGNE  120



>gb|KDP44958.1| hypothetical protein JCGZ_01458 [Jatropha curcas]
Length=446

 Score =   129 bits (323),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 64/107 (60%), Positives = 80/107 (75%), Gaps = 1/107 (1%)
 Frame = +3

Query  87   VSAFLFIHGVRS-IGVNYGTLGDNLPPPTEVARFLKEKTVIDRIKIFDVNPDILRAFAGT  263
            +S FL +    + +GVNYGTL +NLPPP +VA FLK +T+ID IKIFD NP+IL+AFA T
Sbjct  12   ISTFLHLFTTSAALGVNYGTLANNLPPPAQVANFLKTETIIDSIKIFDTNPEILKAFANT  71

Query  264  GILVTVTVPNGEIIPLKDAGYAAQWVAANIKPFYPATKINIIAVGQR  404
             I VTVTV NG+I  L +A  A +WVA NIKP+YP TKIN+IA+G  
Sbjct  72   NITVTVTVGNGDIPSLSNARAARRWVANNIKPYYPQTKINLIAIGNE  118



>ref|XP_010534498.1| PREDICTED: glucan endo-1,3-beta-glucosidase [Tarenaya hassleriana]
Length=449

 Score =   129 bits (323),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 66/114 (58%), Positives = 83/114 (73%), Gaps = 4/114 (4%)
 Frame = +3

Query  72   FLFFLVSAFLFIH---GVRSIGVNYGTLGDNLPPPTEVARFLKEKTVIDRIKIFDVNPDI  242
             L  + +A LF+H   G+ ++GVNYGTLG NLP P +VA F++ +T ID +KIFDVNPDI
Sbjct  11   LLLVISAAVLFLHLPDGISAVGVNYGTLG-NLPSPADVANFIRTRTTIDSVKIFDVNPDI  69

Query  243  LRAFAGTGILVTVTVPNGEIIPLKDAGYAAQWVAANIKPFYPATKINIIAVGQR  404
            LRAFAG+GI V VTVPNGEI  L +   A +W AANIKPF+P T+I  I+VG  
Sbjct  70   LRAFAGSGISVVVTVPNGEIPALVNTRQARRWGAANIKPFHPQTRIKYISVGNE  123



>ref|XP_010256938.1| PREDICTED: glucan endo-1,3-beta-glucosidase-like [Nelumbo nucifera]
Length=455

 Score =   129 bits (323),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 63/98 (64%), Positives = 74/98 (76%), Gaps = 0/98 (0%)
 Frame = +3

Query  111  GVRSIGVNYGTLGDNLPPPTEVARFLKEKTVIDRIKIFDVNPDILRAFAGTGILVTVTVP  290
             V SI VNYGTLG+NLPPP +VA F+K++T+ID++KIFD NPDILRAFA TGI +TVTV 
Sbjct  29   AVYSIDVNYGTLGNNLPPPAQVATFIKQRTIIDKVKIFDTNPDILRAFANTGIAITVTVG  88

Query  291  NGEIIPLKDAGYAAQWVAANIKPFYPATKINIIAVGQR  404
            NG+I  L +   A  WVA  I PFYP TKIN IAVG  
Sbjct  89   NGDIPQLANLPAARNWVATKITPFYPQTKINRIAVGNE  126



>ref|XP_009116238.1| PREDICTED: glucan endo-1,3-beta-glucosidase-like [Brassica rapa]
Length=450

 Score =   128 bits (321),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 65/103 (63%), Positives = 78/103 (76%), Gaps = 1/103 (1%)
 Frame = +3

Query  96   FLFIHGVRSIGVNYGTLGDNLPPPTEVARFLKEKTVIDRIKIFDVNPDILRAFAGTGILV  275
            F     + SIGVNYGTLG NLPPPT+VA FLK +T ID +KIF+VNPDI+RAFAGTGI +
Sbjct  19   FTLPAAISSIGVNYGTLG-NLPPPTQVANFLKTQTSIDSVKIFNVNPDIIRAFAGTGISL  77

Query  276  TVTVPNGEIIPLKDAGYAAQWVAANIKPFYPATKINIIAVGQR  404
             VTVPNG+I  L +   A +WVAANI+PF+P TKI  I+VG  
Sbjct  78   VVTVPNGDIPALANGVQARRWVAANIQPFHPQTKIKYISVGNE  120



>ref|XP_010106478.1| Glucan endo-1,3-beta-glucosidase [Morus notabilis]
 gb|EXC10654.1| Glucan endo-1,3-beta-glucosidase [Morus notabilis]
Length=489

 Score =   128 bits (321),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 63/95 (66%), Positives = 72/95 (76%), Gaps = 0/95 (0%)
 Frame = +3

Query  120  SIGVNYGTLGDNLPPPTEVARFLKEKTVIDRIKIFDVNPDILRAFAGTGILVTVTVPNGE  299
            S+GVNYGT+ DNLPPP++VA FLK +T IDR+KIFD NPDILRAFAGTGI VTVTV NG+
Sbjct  26   SVGVNYGTVADNLPPPSQVATFLKTRTTIDRVKIFDANPDILRAFAGTGIAVTVTVGNGD  85

Query  300  IIPLKDAGYAAQWVAANIKPFYPATKINIIAVGQR  404
            +  L     A  WVA NI PF+P T IN IAVG  
Sbjct  86   VPSLAKLPAAQSWVANNILPFHPKTIINSIAVGNE  120



>emb|CDY41234.1| BnaC08g26240D [Brassica napus]
Length=455

 Score =   127 bits (320),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 64/97 (66%), Positives = 77/97 (79%), Gaps = 1/97 (1%)
 Frame = +3

Query  114  VRSIGVNYGTLGDNLPPPTEVARFLKEKTVIDRIKIFDVNPDILRAFAGTGILVTVTVPN  293
            + SIGVNYGTLG NLPPPT+VA FLK +T ID +KIF+VNPDI+RAFAGTGI V VTVPN
Sbjct  27   ISSIGVNYGTLG-NLPPPTQVANFLKTQTSIDSVKIFNVNPDIIRAFAGTGISVVVTVPN  85

Query  294  GEIIPLKDAGYAAQWVAANIKPFYPATKINIIAVGQR  404
            G+I  L +   A +WV+ANI+PF+P TKI  I+VG  
Sbjct  86   GDIPALANGVQARRWVSANIQPFHPQTKIKYISVGNE  122



>ref|XP_009103956.1| PREDICTED: glucan endo-1,3-beta-glucosidase-like [Brassica rapa]
Length=449

 Score =   127 bits (319),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 68/116 (59%), Positives = 83/116 (72%), Gaps = 4/116 (3%)
 Frame = +3

Query  66   PIFLFFLVSA---FLFIHGVRSIGVNYGTLGDNLPPPTEVARFLKEKTVIDRIKIFDVNP  236
            P+  F L+SA     F   + SIGVNYGTLG NLPPPT+VA FLK +  ID +KIF+V+P
Sbjct  6    PLISFLLISAAVLLTFPAAISSIGVNYGTLG-NLPPPTQVANFLKTQASIDSVKIFNVDP  64

Query  237  DILRAFAGTGILVTVTVPNGEIIPLKDAGYAAQWVAANIKPFYPATKINIIAVGQR  404
            +ILRAFAGTGI V VTVPNG+I  L +   A +WV+ANI PF+P TKI  I+VG  
Sbjct  65   NILRAFAGTGISVVVTVPNGDIPALANGMQARRWVSANILPFHPQTKIKYISVGNE  120



>ref|XP_002878033.1| hypothetical protein ARALYDRAFT_485970 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH54292.1| hypothetical protein ARALYDRAFT_485970 [Arabidopsis lyrata subsp. 
lyrata]
Length=449

 Score =   127 bits (318),  Expect(2) = 2e-31, Method: Compositional matrix adjust.
 Identities = 64/97 (66%), Positives = 76/97 (78%), Gaps = 1/97 (1%)
 Frame = +3

Query  114  VRSIGVNYGTLGDNLPPPTEVARFLKEKTVIDRIKIFDVNPDILRAFAGTGILVTVTVPN  293
            + +IGVNYGTLG NLPPPT+VA F+K +T ID +KIFDVNPDILRAFAGTGI V VTVPN
Sbjct  26   ISAIGVNYGTLG-NLPPPTQVANFIKTQTSIDSVKIFDVNPDILRAFAGTGISVVVTVPN  84

Query  294  GEIIPLKDAGYAAQWVAANIKPFYPATKINIIAVGQR  404
            G+I  L +   A +WV+ANI PF+P TKI  I+VG  
Sbjct  85   GDIPALANGRQARRWVSANILPFHPQTKIKYISVGNE  121


 Score = 35.4 bits (80),  Expect(2) = 2e-31, Method: Compositional matrix adjust.
 Identities = 17/33 (52%), Positives = 24/33 (73%), Gaps = 0/33 (0%)
 Frame = +1

Query  397  GNEVLHWGTPEMQNGLVAAMRSLYNALVKSGIK  495
            GNE+L  G   M N L+ AMR+L NALV++G++
Sbjct  119  GNEILLTGDNNMINNLLPAMRNLNNALVRAGVR  151



>emb|CDY40219.1| BnaA09g35010D [Brassica napus]
Length=450

 Score =   127 bits (319),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 64/97 (66%), Positives = 77/97 (79%), Gaps = 1/97 (1%)
 Frame = +3

Query  114  VRSIGVNYGTLGDNLPPPTEVARFLKEKTVIDRIKIFDVNPDILRAFAGTGILVTVTVPN  293
            + SIGVNYGTLG NLPPPT+VA FLK +T ID +KIF+VNPDI+RAFAGTGI + VTVPN
Sbjct  25   ISSIGVNYGTLG-NLPPPTQVANFLKTQTSIDSVKIFNVNPDIIRAFAGTGISLVVTVPN  83

Query  294  GEIIPLKDAGYAAQWVAANIKPFYPATKINIIAVGQR  404
            G+I  L +   A +WVAANI+PF+P TKI  I+VG  
Sbjct  84   GDIPALANGVQARRWVAANIQPFHPQTKIKYISVGNE  120



>ref|XP_006403459.1| hypothetical protein EUTSA_v10010363mg [Eutrema salsugineum]
 gb|ESQ44912.1| hypothetical protein EUTSA_v10010363mg [Eutrema salsugineum]
Length=456

 Score =   127 bits (318),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 67/108 (62%), Positives = 81/108 (75%), Gaps = 4/108 (4%)
 Frame = +3

Query  90   SAFLFI---HGVRSIGVNYGTLGDNLPPPTEVARFLKEKTVIDRIKIFDVNPDILRAFAG  260
            SA +FI     + +IGVNYGTLG NLPPPT+VA F+K +T ID +KIFDVNPDILRAFAG
Sbjct  16   SAVVFITFPAAISAIGVNYGTLG-NLPPPTQVANFIKTQTSIDSVKIFDVNPDILRAFAG  74

Query  261  TGILVTVTVPNGEIIPLKDAGYAAQWVAANIKPFYPATKINIIAVGQR  404
            TGI V VTVPNG+I  L +   A +WV+ANI P++P TKI  I+VG  
Sbjct  75   TGISVVVTVPNGDIPALANGRQARRWVSANILPYHPQTKIKYISVGNE  122



>gb|KJB37375.1| hypothetical protein B456_006G202300 [Gossypium raimondii]
Length=509

 Score =   127 bits (318),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 70/140 (50%), Positives = 94/140 (67%), Gaps = 6/140 (4%)
 Frame = +3

Query  3    LNYRNKSNLILKIMEMSLRPSPI---FLFFLVSAFL---FIHGVRSIGVNYGTLGDNLPP  164
            L+ R+ S+L  + + M+ +  P+    L  ++S FL   F+ GV SIGVNYGT+ +NLPP
Sbjct  30   LHQRSPSSLTHQKLAMAKQFIPLSSSILVAVISLFLVSTFVPGVGSIGVNYGTVANNLPP  89

Query  165  PTEVARFLKEKTVIDRIKIFDVNPDILRAFAGTGILVTVTVPNGEIIPLKDAGYAAQWVA  344
            P +VA FL E TVI+R+K++D NPDIL+AFA TGI VTVTVPN +I  L    +A QWV 
Sbjct  90   PPQVAHFLLESTVINRVKLYDANPDILKAFAHTGIAVTVTVPNDQIPRLTKLNFARQWVE  149

Query  345  ANIKPFYPATKINIIAVGQR  404
             N++P+ PAT I  I VG  
Sbjct  150  DNVQPYTPATNIVRILVGNE  169



>ref|XP_009345986.1| PREDICTED: glucan endo-1,3-beta-glucosidase-like [Pyrus x bretschneideri]
Length=513

 Score =   127 bits (318),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 64/108 (59%), Positives = 73/108 (68%), Gaps = 0/108 (0%)
 Frame = +3

Query  81   FLVSAFLFIHGVRSIGVNYGTLGDNLPPPTEVARFLKEKTVIDRIKIFDVNPDILRAFAG  260
            F     + +    SIGVNYGT+ DNLPPP++VA FLK KT IDR+KIFD NPDILR FAG
Sbjct  15   FSACHVILLTTAYSIGVNYGTIADNLPPPSKVATFLKTKTTIDRVKIFDANPDILRVFAG  74

Query  261  TGILVTVTVPNGEIIPLKDAGYAAQWVAANIKPFYPATKINIIAVGQR  404
            T I VTVTV NG++  L     A  WVA NI PF+P T IN IAVG  
Sbjct  75   TNIAVTVTVGNGDVPALAKLSAAQSWVADNILPFHPRTTINRIAVGNE  122



>ref|XP_009353665.1| PREDICTED: glucan endo-1,3-beta-glucosidase-like [Pyrus x bretschneideri]
Length=513

 Score =   127 bits (318),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 64/108 (59%), Positives = 73/108 (68%), Gaps = 0/108 (0%)
 Frame = +3

Query  81   FLVSAFLFIHGVRSIGVNYGTLGDNLPPPTEVARFLKEKTVIDRIKIFDVNPDILRAFAG  260
            F     + +    SIGVNYGT+ DNLPPP++VA FLK KT IDR+KIFD NPDILR FAG
Sbjct  15   FSACHVILLTTAYSIGVNYGTIADNLPPPSKVATFLKTKTTIDRVKIFDANPDILRVFAG  74

Query  261  TGILVTVTVPNGEIIPLKDAGYAAQWVAANIKPFYPATKINIIAVGQR  404
            T I VTVTV NG++  L     A  WVA NI PF+P T IN IAVG  
Sbjct  75   TNIAVTVTVGNGDVPALAKLSAAQSWVADNILPFHPRTTINRIAVGNE  122



>ref|XP_009345982.1| PREDICTED: glucan endo-1,3-beta-glucosidase-like [Pyrus x bretschneideri]
Length=513

 Score =   127 bits (318),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 64/108 (59%), Positives = 73/108 (68%), Gaps = 0/108 (0%)
 Frame = +3

Query  81   FLVSAFLFIHGVRSIGVNYGTLGDNLPPPTEVARFLKEKTVIDRIKIFDVNPDILRAFAG  260
            F     + +    SIGVNYGT+ DNLPPP++VA FLK KT IDR+KIFD NPDILR FAG
Sbjct  15   FSACHVILLTTAYSIGVNYGTIADNLPPPSKVATFLKTKTTIDRVKIFDANPDILRVFAG  74

Query  261  TGILVTVTVPNGEIIPLKDAGYAAQWVAANIKPFYPATKINIIAVGQR  404
            T I VTVTV NG++  L     A  WVA NI PF+P T IN IAVG  
Sbjct  75   TNIAVTVTVGNGDVPALAKLSAAQSWVADNILPFHPRTTINRIAVGNE  122



>gb|AAM66982.1| beta-1,3-glucanase-like protein [Arabidopsis thaliana]
Length=449

 Score =   125 bits (313),  Expect(2) = 6e-31, Method: Compositional matrix adjust.
 Identities = 67/108 (62%), Positives = 79/108 (73%), Gaps = 2/108 (2%)
 Frame = +3

Query  84   LVSAFLFIHGV-RSIGVNYGTLGDNLPPPTEVARFLKEKTVIDRIKIFDVNPDILRAFAG  260
              + FL I  V  +IGVNYGTLG NLPPPT+VA F+K +T ID +KIFDVNPDILRAFAG
Sbjct  15   CAAVFLTIPAVISAIGVNYGTLG-NLPPPTQVANFIKTQTSIDNVKIFDVNPDILRAFAG  73

Query  261  TGILVTVTVPNGEIIPLKDAGYAAQWVAANIKPFYPATKINIIAVGQR  404
            TGI V VTVPNG+I  L +   A +WV+ NI PF+P TKI  I+VG  
Sbjct  74   TGISVVVTVPNGDIPALANGRQARRWVSVNILPFHPQTKIKYISVGNE  121


 Score = 35.4 bits (80),  Expect(2) = 6e-31, Method: Compositional matrix adjust.
 Identities = 17/33 (52%), Positives = 24/33 (73%), Gaps = 0/33 (0%)
 Frame = +1

Query  397  GNEVLHWGTPEMQNGLVAAMRSLYNALVKSGIK  495
            GNE+L  G   M N L+ AMR+L NALV++G++
Sbjct  119  GNEILLTGDNNMINNLLPAMRNLNNALVRAGVR  151



>emb|CDY40218.1| BnaA09g35000D [Brassica napus]
Length=453

 Score =   125 bits (315),  Expect = 6e-31, Method: Compositional matrix adjust.
 Identities = 64/97 (66%), Positives = 76/97 (78%), Gaps = 1/97 (1%)
 Frame = +3

Query  114  VRSIGVNYGTLGDNLPPPTEVARFLKEKTVIDRIKIFDVNPDILRAFAGTGILVTVTVPN  293
            + SIGVNYGTLG NLPPPT+VA FLK +T ID +KIF+VNPDI+RAFAGTGI V VTVPN
Sbjct  26   ISSIGVNYGTLG-NLPPPTQVANFLKTQTSIDSVKIFNVNPDIIRAFAGTGISVVVTVPN  84

Query  294  GEIIPLKDAGYAAQWVAANIKPFYPATKINIIAVGQR  404
            G+I  L +   A +WV+ANI PF+P TKI  I+VG  
Sbjct  85   GDIPALANGVQARRWVSANILPFHPQTKIKYISVGNE  121



>gb|AAK76666.1| putative beta-1,3-glucanase [Arabidopsis thaliana]
Length=449

 Score =   125 bits (313),  Expect(2) = 6e-31, Method: Compositional matrix adjust.
 Identities = 67/108 (62%), Positives = 79/108 (73%), Gaps = 2/108 (2%)
 Frame = +3

Query  84   LVSAFLFIHGV-RSIGVNYGTLGDNLPPPTEVARFLKEKTVIDRIKIFDVNPDILRAFAG  260
              + FL I  V  +IGVNYGTLG NLPPPT+VA F+K +T ID +KIFDVNPDILRAFAG
Sbjct  15   CAAVFLTIPAVISAIGVNYGTLG-NLPPPTQVANFIKTQTSIDSVKIFDVNPDILRAFAG  73

Query  261  TGILVTVTVPNGEIIPLKDAGYAAQWVAANIKPFYPATKINIIAVGQR  404
            TGI V VTVPNG+I  L +   A +WV+ NI PF+P TKI  I+VG  
Sbjct  74   TGISVVVTVPNGDIPALANGRQARRWVSVNILPFHPQTKIKYISVGNE  121


 Score = 35.4 bits (80),  Expect(2) = 6e-31, Method: Compositional matrix adjust.
 Identities = 17/33 (52%), Positives = 24/33 (73%), Gaps = 0/33 (0%)
 Frame = +1

Query  397  GNEVLHWGTPEMQNGLVAAMRSLYNALVKSGIK  495
            GNE+L  G   M N L+ AMR+L NALV++G++
Sbjct  119  GNEILLTGDNNMINNLLPAMRNLNNALVRAGVR  151



>ref|NP_191103.1| O-Glycosyl hydrolases family 17 protein [Arabidopsis thaliana]
 emb|CAB75901.1| beta-1, 3-glucanase-like protein [Arabidopsis thaliana]
 gb|AAN12934.1| putative beta-1,3-glucanase [Arabidopsis thaliana]
 gb|AEE79383.1| O-Glycosyl hydrolases family 17 protein [Arabidopsis thaliana]
Length=449

 Score =   125 bits (313),  Expect(2) = 6e-31, Method: Compositional matrix adjust.
 Identities = 67/108 (62%), Positives = 79/108 (73%), Gaps = 2/108 (2%)
 Frame = +3

Query  84   LVSAFLFIHGV-RSIGVNYGTLGDNLPPPTEVARFLKEKTVIDRIKIFDVNPDILRAFAG  260
              + FL I  V  +IGVNYGTLG NLPPPT+VA F+K +T ID +KIFDVNPDILRAFAG
Sbjct  15   CAAVFLTIPAVISAIGVNYGTLG-NLPPPTQVANFIKTQTSIDSVKIFDVNPDILRAFAG  73

Query  261  TGILVTVTVPNGEIIPLKDAGYAAQWVAANIKPFYPATKINIIAVGQR  404
            TGI V VTVPNG+I  L +   A +WV+ NI PF+P TKI  I+VG  
Sbjct  74   TGISVVVTVPNGDIPALANGRQARRWVSVNILPFHPQTKIKYISVGNE  121


 Score = 35.4 bits (80),  Expect(2) = 6e-31, Method: Compositional matrix adjust.
 Identities = 17/33 (52%), Positives = 24/33 (73%), Gaps = 0/33 (0%)
 Frame = +1

Query  397  GNEVLHWGTPEMQNGLVAAMRSLYNALVKSGIK  495
            GNE+L  G   M N L+ AMR+L NALV++G++
Sbjct  119  GNEILLTGDNNMINNLLPAMRNLNNALVRAGVR  151



>ref|XP_010034118.1| PREDICTED: glucan endo-1,3-beta-glucosidase [Eucalyptus grandis]
 gb|KCW50205.1| hypothetical protein EUGRSUZ_J00013 [Eucalyptus grandis]
Length=451

 Score =   125 bits (315),  Expect = 6e-31, Method: Compositional matrix adjust.
 Identities = 61/93 (66%), Positives = 71/93 (76%), Gaps = 0/93 (0%)
 Frame = +3

Query  123  IGVNYGTLGDNLPPPTEVARFLKEKTVIDRIKIFDVNPDILRAFAGTGILVTVTVPNGEI  302
            IGVNYGTLGDNLPPP +VA F+K +T+I+R+KIFD NPDILRAFA TGI +TVT  NG+I
Sbjct  24   IGVNYGTLGDNLPPPAQVANFIKSQTIINRVKIFDTNPDILRAFADTGIAMTVTAGNGDI  83

Query  303  IPLKDAGYAAQWVAANIKPFYPATKINIIAVGQ  401
              L    YA QWVA NI PFYP T+I  + VG 
Sbjct  84   PALTRLAYARQWVAINIAPFYPRTRIVRVLVGN  116



>ref|XP_010043552.1| PREDICTED: glucan endo-1,3-beta-glucosidase-like [Eucalyptus 
grandis]
Length=462

 Score =   125 bits (315),  Expect = 7e-31, Method: Compositional matrix adjust.
 Identities = 67/119 (56%), Positives = 81/119 (68%), Gaps = 1/119 (1%)
 Frame = +3

Query  51   SLRPSPIFLFFL-VSAFLFIHGVRSIGVNYGTLGDNLPPPTEVARFLKEKTVIDRIKIFD  227
            SL P    +FFL V+         +IG+NYGT+ DNLPPP++VA FLK KT IDR+KIF 
Sbjct  3    SLFPLTAAVFFLSVACPHLSRAAYTIGINYGTIADNLPPPSKVATFLKTKTTIDRVKIFH  62

Query  228  VNPDILRAFAGTGILVTVTVPNGEIIPLKDAGYAAQWVAANIKPFYPATKINIIAVGQR  404
             +PDILRAFAGTGI VTV+V N +I+ L     A  WV+ANI PFYP T IN IA+G  
Sbjct  63   ASPDILRAFAGTGIAVTVSVGNEDIVSLSKLPAAKSWVSANILPFYPKTLINRIAMGNE  121



>gb|KHF99783.1| Glucan endo-1,3-beta-glucosidase [Gossypium arboreum]
Length=510

 Score =   126 bits (316),  Expect = 7e-31, Method: Compositional matrix adjust.
 Identities = 68/122 (56%), Positives = 80/122 (66%), Gaps = 5/122 (4%)
 Frame = +3

Query  54   LRPSPIFLFFLVSAFLFIH-----GVRSIGVNYGTLGDNLPPPTEVARFLKEKTVIDRIK  218
            L  + + +FF  S  L I       V +IGVNYGT+ DNLP PT+VA+FLK KT IDRIK
Sbjct  4    LSATKLLIFFFFSCHLSIFSSTATAVYTIGVNYGTVADNLPTPTQVAKFLKSKTNIDRIK  63

Query  219  IFDVNPDILRAFAGTGILVTVTVPNGEIIPLKDAGYAAQWVAANIKPFYPATKINIIAVG  398
            IFD NPDIL+AFAGTGI VTVTV NG+I  L     A  W+  NI P++P T I  IAVG
Sbjct  64   IFDTNPDILKAFAGTGISVTVTVGNGDIPSLAKLPGAKAWIEKNILPYHPKTIIRYIAVG  123

Query  399  QR  404
              
Sbjct  124  NE  125



>ref|XP_009116237.1| PREDICTED: glucan endo-1,3-beta-glucosidase-like [Brassica rapa]
Length=453

 Score =   125 bits (315),  Expect = 7e-31, Method: Compositional matrix adjust.
 Identities = 64/97 (66%), Positives = 76/97 (78%), Gaps = 1/97 (1%)
 Frame = +3

Query  114  VRSIGVNYGTLGDNLPPPTEVARFLKEKTVIDRIKIFDVNPDILRAFAGTGILVTVTVPN  293
            + SIGVNYGTLG NLPPPT+VA FLK +T ID +KIF+VNPDI+RAFAGTGI V VTVPN
Sbjct  26   ISSIGVNYGTLG-NLPPPTQVANFLKTQTSIDSVKIFNVNPDIIRAFAGTGISVVVTVPN  84

Query  294  GEIIPLKDAGYAAQWVAANIKPFYPATKINIIAVGQR  404
            G+I  L +   A +WV+ANI PF+P TKI  I+VG  
Sbjct  85   GDIPALANGVQARRWVSANILPFHPQTKIKYISVGNE  121



>ref|XP_004307514.1| PREDICTED: glucan endo-1,3-beta-glucosidase-like [Fragaria vesca 
subsp. vesca]
Length=477

 Score =   125 bits (315),  Expect = 8e-31, Method: Compositional matrix adjust.
 Identities = 66/123 (54%), Positives = 85/123 (69%), Gaps = 8/123 (7%)
 Frame = +3

Query  72   FLFFLVSAFLFIHGVRSIGVNYGTLGDNLPPPTEVARFLKEKTVIDRIKIFDVNPDILRA  251
             LFF ++   +     SIGVNYGTL DNLPPP +VA F+K +T+ID +KIFDVNPDI+RA
Sbjct  11   LLFFQLATTAY-----SIGVNYGTLADNLPPPAQVANFIKTQTIIDAVKIFDVNPDIIRA  65

Query  252  FAGTGILVTVTVPNGEIIPLKDAGYAAQWVAANIKPFYPATKINIIAVGQRGSPLGHAGD  431
            FA TGI +T+T+PNGEI  L     A ++VA +I+PFYPATK   I +G     + H GD
Sbjct  66   FANTGISLTITIPNGEIPGLTTLDGAKRYVAQHIQPFYPATKFKYILMGNE---ILHWGD  122

Query  432  AER  440
            A +
Sbjct  123  AAQ  125


 Score = 48.1 bits (113),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 20/33 (61%), Positives = 26/33 (79%), Gaps = 0/33 (0%)
 Frame = +1

Query  397  GNEVLHWGTPEMQNGLVAAMRSLYNALVKSGIK  495
            GNE+LHWG    +NGLV AM+ LY AL+++GIK
Sbjct  114  GNEILHWGDAAQKNGLVPAMKMLYAALIQAGIK  146



>gb|KCW85567.1| hypothetical protein EUGRSUZ_B02364 [Eucalyptus grandis]
Length=489

 Score =   125 bits (315),  Expect = 8e-31, Method: Compositional matrix adjust.
 Identities = 67/119 (56%), Positives = 81/119 (68%), Gaps = 1/119 (1%)
 Frame = +3

Query  51   SLRPSPIFLFFL-VSAFLFIHGVRSIGVNYGTLGDNLPPPTEVARFLKEKTVIDRIKIFD  227
            SL P    +FFL V+         +IG+NYGT+ DNLPPP++VA FLK KT IDR+KIF 
Sbjct  3    SLFPLTAAVFFLSVACPHLSRAAYTIGINYGTIADNLPPPSKVATFLKTKTTIDRVKIFH  62

Query  228  VNPDILRAFAGTGILVTVTVPNGEIIPLKDAGYAAQWVAANIKPFYPATKINIIAVGQR  404
             +PDILRAFAGTGI VTV+V N +I+ L     A  WV+ANI PFYP T IN IA+G  
Sbjct  63   ASPDILRAFAGTGIAVTVSVGNEDIVSLSKLPAAKSWVSANILPFYPKTLINRIAMGNE  121



>ref|XP_003561280.1| PREDICTED: glucan endo-1,3-beta-glucosidase-like [Brachypodium 
distachyon]
Length=475

 Score =   125 bits (314),  Expect = 9e-31, Method: Compositional matrix adjust.
 Identities = 63/112 (56%), Positives = 79/112 (71%), Gaps = 1/112 (1%)
 Frame = +3

Query  69   IFLFFLVSAFLFIHGVRSIGVNYGTLGDNLPPPTEVARFLKEKTVIDRIKIFDVNPDILR  248
            I++F  + A  F     +IGVNYGT GDNL PP+ VA FL  +T IDR+K+FD NPD+LR
Sbjct  18   IYVFLAIVAQPFTT-TTAIGVNYGTKGDNLAPPSTVAAFLANRTRIDRVKLFDTNPDMLR  76

Query  249  AFAGTGILVTVTVPNGEIIPLKDAGYAAQWVAANIKPFYPATKINIIAVGQR  404
            AFAGTGI V VT  NG+I  L     AA WVA+N+ PFYPAT+I+++AVG  
Sbjct  77   AFAGTGISVMVTAANGDIPILATTQGAAAWVASNVAPFYPATEISLVAVGNE  128



>ref|XP_010937626.1| PREDICTED: glucan endo-1,3-beta-glucosidase-like [Elaeis guineensis]
Length=450

 Score =   125 bits (314),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 58/95 (61%), Positives = 73/95 (77%), Gaps = 0/95 (0%)
 Frame = +3

Query  120  SIGVNYGTLGDNLPPPTEVARFLKEKTVIDRIKIFDVNPDILRAFAGTGILVTVTVPNGE  299
            SIGVNYGTL DNLPPP++VA FLK  T IDR+K+FD NPD++RAFAGTGI + +TVPNG+
Sbjct  24   SIGVNYGTLADNLPPPSQVAAFLKANTFIDRVKLFDSNPDLIRAFAGTGISLMITVPNGD  83

Query  300  IIPLKDAGYAAQWVAANIKPFYPATKINIIAVGQR  404
            +  L     A  WVA N+ PF+PAT I+++AVG  
Sbjct  84   VPSLAKLPAARTWVANNVAPFHPATNISLLAVGNE  118



>ref|XP_010690542.1| PREDICTED: glucan endo-1,3-beta-glucosidase isoform X1 [Beta 
vulgaris subsp. vulgaris]
Length=488

 Score =   117 bits (293),  Expect(2) = 1e-30, Method: Compositional matrix adjust.
 Identities = 61/112 (54%), Positives = 75/112 (67%), Gaps = 4/112 (4%)
 Frame = +3

Query  69   IFLFFLVSAFLFIHGVRSIGVNYGTLGDNLPPPTEVARFLKEKTVIDRIKIFDVNPDILR  248
            IF FF     L +    SIGVNYGT+ DNLPPP +VA FLK KT I++IK+FD NPDI+R
Sbjct  12   IFSFF----HLNLGSAWSIGVNYGTVADNLPPPAQVAEFLKTKTTINKIKLFDTNPDIVR  67

Query  249  AFAGTGILVTVTVPNGEIIPLKDAGYAAQWVAANIKPFYPATKINIIAVGQR  404
            AFA +GI V++T+PNGEI  L     A QWVA +I PF P + I  + VG  
Sbjct  68   AFANSGIAVSITLPNGEIPNLVQLSAAKQWVATHITPFVPQSNIIRVLVGNE  119


 Score = 42.4 bits (98),  Expect(2) = 1e-30, Method: Compositional matrix adjust.
 Identities = 19/33 (58%), Positives = 24/33 (73%), Gaps = 0/33 (0%)
 Frame = +1

Query  397  GNEVLHWGTPEMQNGLVAAMRSLYNALVKSGIK  495
            GNEVLHWG   + + LV AMR+LY AL ++G K
Sbjct  117  GNEVLHWGPQNLIDNLVPAMRTLYQALQQAGHK  149



>ref|XP_011035318.1| PREDICTED: glucan endo-1,3-beta-glucosidase-like [Populus euphratica]
Length=504

 Score =   125 bits (314),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 66/130 (51%), Positives = 81/130 (62%), Gaps = 4/130 (3%)
 Frame = +3

Query  27   LILKIMEMSLRPSPIFLFFLVSAFLFIHGVRS----IGVNYGTLGDNLPPPTEVARFLKE  194
            ++L  +       P  LF L+  F +     S    +GVNYGT+ +NLP P++VA FLK 
Sbjct  1    MLLHFLSSEKMAKPRTLFLLLFTFYYHFSSSSAAYTVGVNYGTVANNLPSPSQVASFLKT  60

Query  195  KTVIDRIKIFDVNPDILRAFAGTGILVTVTVPNGEIIPLKDAGYAAQWVAANIKPFYPAT  374
            +T IDR+KIFD NPDILRAFA TGI VTVTV NG+I  L     A  W+AANI PF+P T
Sbjct  61   QTTIDRVKIFDTNPDILRAFANTGISVTVTVGNGDIPSLAKLPAAQSWIAANILPFHPQT  120

Query  375  KINIIAVGQR  404
             I  IAVG  
Sbjct  121  SIKYIAVGNE  130



>ref|XP_008343598.1| PREDICTED: glucan endo-1,3-beta-glucosidase-like [Malus domestica]
Length=343

 Score =   124 bits (310),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 60/104 (58%), Positives = 77/104 (74%), Gaps = 3/104 (3%)
 Frame = +3

Query  120  SIGVNYGTLGDNLPPPTEVARFLKEKTVIDRIKIFDVNPDILRAFAGTGILVTVTVPNGE  299
            SIGVNYGTL DNLPPP +VA F+K +T ID +K+FD NPDI++AFA T I +T+TVPNGE
Sbjct  22   SIGVNYGTLADNLPPPAKVADFIKTQTKIDAVKLFDANPDIIKAFANTNISLTITVPNGE  81

Query  300  IIPLKDAGYAAQWVAANIKPFYPATKINIIAVGQRGSPLGHAGD  431
            I  LK+   A +W+  ++KPFYPA+KI  IA+G     + H GD
Sbjct  82   IPSLKNLQTARRWITDHVKPFYPASKIKYIALGNE---VLHWGD  122



>ref|XP_010690550.1| PREDICTED: glucan endo-1,3-beta-glucosidase isoform X2 [Beta 
vulgaris subsp. vulgaris]
Length=465

 Score =   117 bits (292),  Expect(2) = 2e-30, Method: Compositional matrix adjust.
 Identities = 61/112 (54%), Positives = 75/112 (67%), Gaps = 4/112 (4%)
 Frame = +3

Query  69   IFLFFLVSAFLFIHGVRSIGVNYGTLGDNLPPPTEVARFLKEKTVIDRIKIFDVNPDILR  248
            IF FF     L +    SIGVNYGT+ DNLPPP +VA FLK KT I++IK+FD NPDI+R
Sbjct  12   IFSFF----HLNLGSAWSIGVNYGTVADNLPPPAQVAEFLKTKTTINKIKLFDTNPDIVR  67

Query  249  AFAGTGILVTVTVPNGEIIPLKDAGYAAQWVAANIKPFYPATKINIIAVGQR  404
            AFA +GI V++T+PNGEI  L     A QWVA +I PF P + I  + VG  
Sbjct  68   AFANSGIAVSITLPNGEIPNLVQLSAAKQWVATHITPFVPQSNIIRVLVGNE  119


 Score = 42.0 bits (97),  Expect(2) = 2e-30, Method: Compositional matrix adjust.
 Identities = 19/33 (58%), Positives = 24/33 (73%), Gaps = 0/33 (0%)
 Frame = +1

Query  397  GNEVLHWGTPEMQNGLVAAMRSLYNALVKSGIK  495
            GNEVLHWG   + + LV AMR+LY AL ++G K
Sbjct  117  GNEVLHWGPQNLIDNLVPAMRTLYQALQQAGHK  149



>ref|XP_008457482.1| PREDICTED: glucan endo-1,3-beta-glucosidase [Cucumis melo]
Length=573

 Score =   125 bits (314),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 62/95 (65%), Positives = 72/95 (76%), Gaps = 0/95 (0%)
 Frame = +3

Query  120  SIGVNYGTLGDNLPPPTEVARFLKEKTVIDRIKIFDVNPDILRAFAGTGILVTVTVPNGE  299
            SIGVNYGT+ +NLPPPT+VA FLK +T IDR+KIFD NPDILRAFAGTGI +TV++ NG+
Sbjct  103  SIGVNYGTVANNLPPPTQVAAFLKSRTSIDRVKIFDANPDILRAFAGTGIALTVSIANGD  162

Query  300  IIPLKDAGYAAQWVAANIKPFYPATKINIIAVGQR  404
            I  L     A  WVA NI PF+P T IN IAVG  
Sbjct  163  IPALAKLPAAQSWVANNILPFHPTTLINHIAVGNE  197



>ref|XP_010516112.1| PREDICTED: glucan endo-1,3-beta-glucosidase-like [Camelina sativa]
Length=453

 Score =   123 bits (309),  Expect(2) = 2e-30, Method: Compositional matrix adjust.
 Identities = 63/97 (65%), Positives = 75/97 (77%), Gaps = 1/97 (1%)
 Frame = +3

Query  114  VRSIGVNYGTLGDNLPPPTEVARFLKEKTVIDRIKIFDVNPDILRAFAGTGILVTVTVPN  293
            + +IGVNYGTLG NLPPPT+VA F+K +T ID +KIFDVNPDILRAFAGTGI V VTVPN
Sbjct  29   ISAIGVNYGTLG-NLPPPTQVANFIKTQTSIDSVKIFDVNPDILRAFAGTGISVVVTVPN  87

Query  294  GEIIPLKDAGYAAQWVAANIKPFYPATKINIIAVGQR  404
            G+I  L +   A +WV+ANI PF+P T I  I+VG  
Sbjct  88   GDIPALANGLQARRWVSANILPFHPQTMIKYISVGNE  124


 Score = 35.4 bits (80),  Expect(2) = 2e-30, Method: Compositional matrix adjust.
 Identities = 17/33 (52%), Positives = 24/33 (73%), Gaps = 0/33 (0%)
 Frame = +1

Query  397  GNEVLHWGTPEMQNGLVAAMRSLYNALVKSGIK  495
            GNE+L  G   M N L+ AMR+L NALV++G++
Sbjct  122  GNEILLSGDNNMINNLLPAMRNLNNALVRAGVR  154



>ref|XP_007220314.1| hypothetical protein PRUPE_ppa005160m1g, partial [Prunus persica]
 gb|EMJ21513.1| hypothetical protein PRUPE_ppa005160m1g, partial [Prunus persica]
Length=330

 Score =   123 bits (309),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 60/104 (58%), Positives = 76/104 (73%), Gaps = 3/104 (3%)
 Frame = +3

Query  120  SIGVNYGTLGDNLPPPTEVARFLKEKTVIDRIKIFDVNPDILRAFAGTGILVTVTVPNGE  299
            +IGVNYGTL DNLPPP +VA FLK +T ID++KIFD NPDI++AFA T I +T+T+PNG+
Sbjct  22   AIGVNYGTLADNLPPPAQVANFLKTQTNIDKVKIFDANPDIIKAFANTNISLTITIPNGD  81

Query  300  IIPLKDAGYAAQWVAANIKPFYPATKINIIAVGQRGSPLGHAGD  431
            I  L     A +WV  ++KPFYP TKIN IA+G     + H GD
Sbjct  82   IPSLTKLRTARRWVVDHVKPFYPQTKINYIAMGNE---VLHWGD  122


 Score = 50.1 bits (118),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 21/33 (64%), Positives = 26/33 (79%), Gaps = 0/33 (0%)
 Frame = +1

Query  397  GNEVLHWGTPEMQNGLVAAMRSLYNALVKSGIK  495
            GNEVLHWG   ++N LV AMR+ +NALV+ GIK
Sbjct  114  GNEVLHWGDDNLKNSLVPAMRTFHNALVREGIK  146



>ref|XP_010504397.1| PREDICTED: glucan endo-1,3-beta-glucosidase-like [Camelina sativa]
Length=453

 Score =   123 bits (309),  Expect(2) = 2e-30, Method: Compositional matrix adjust.
 Identities = 63/97 (65%), Positives = 75/97 (77%), Gaps = 1/97 (1%)
 Frame = +3

Query  114  VRSIGVNYGTLGDNLPPPTEVARFLKEKTVIDRIKIFDVNPDILRAFAGTGILVTVTVPN  293
            + +IGVNYGTLG NLPPPT+VA F+K +T ID +KIFDVNPDILRAFAGTGI V VTVPN
Sbjct  29   ISAIGVNYGTLG-NLPPPTQVANFIKTQTSIDSVKIFDVNPDILRAFAGTGISVVVTVPN  87

Query  294  GEIIPLKDAGYAAQWVAANIKPFYPATKINIIAVGQR  404
            G+I  L +   A +WV+ANI PF+P T I  I+VG  
Sbjct  88   GDIPALANGLQARRWVSANILPFHPQTMIKYISVGNE  124


 Score = 35.4 bits (80),  Expect(2) = 2e-30, Method: Compositional matrix adjust.
 Identities = 17/33 (52%), Positives = 24/33 (73%), Gaps = 0/33 (0%)
 Frame = +1

Query  397  GNEVLHWGTPEMQNGLVAAMRSLYNALVKSGIK  495
            GNE+L  G   M N L+ AMR+L NALV++G++
Sbjct  122  GNEILLSGDNNMINNLLPAMRNLNNALVRAGVR  154



>ref|XP_007205054.1| hypothetical protein PRUPE_ppa004320mg [Prunus persica]
 gb|EMJ06253.1| hypothetical protein PRUPE_ppa004320mg [Prunus persica]
Length=516

 Score =   124 bits (312),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 62/95 (65%), Positives = 71/95 (75%), Gaps = 0/95 (0%)
 Frame = +3

Query  120  SIGVNYGTLGDNLPPPTEVARFLKEKTVIDRIKIFDVNPDILRAFAGTGILVTVTVPNGE  299
            SIGVNYGT+ DNLPPP++VA FLK KT IDR+KIFD NPD+LRAFA T I VTVTV NG+
Sbjct  32   SIGVNYGTIADNLPPPSQVATFLKTKTTIDRVKIFDANPDMLRAFADTKIAVTVTVGNGD  91

Query  300  IIPLKDAGYAAQWVAANIKPFYPATKINIIAVGQR  404
            +  L     A  WV+ANI PF+P T IN IAVG  
Sbjct  92   VPALAKLSAAQAWVSANILPFHPRTIINRIAVGNE  126



>ref|XP_004151673.1| PREDICTED: glucan endo-1,3-beta-glucosidase-like [Cucumis sativus]
 ref|XP_004168987.1| PREDICTED: glucan endo-1,3-beta-glucosidase-like [Cucumis sativus]
 gb|KGN65723.1| Glucan endo-1,3-beta-glucosidase [Cucumis sativus]
Length=489

 Score =   124 bits (310),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 62/95 (65%), Positives = 71/95 (75%), Gaps = 0/95 (0%)
 Frame = +3

Query  120  SIGVNYGTLGDNLPPPTEVARFLKEKTVIDRIKIFDVNPDILRAFAGTGILVTVTVPNGE  299
            SIGVNYGT+ +NLPPP++VA FLK  T IDR+KIFD NPDILRAFAGTGI +TV+V NG+
Sbjct  23   SIGVNYGTVANNLPPPSQVAAFLKSHTSIDRVKIFDANPDILRAFAGTGIALTVSVANGD  82

Query  300  IIPLKDAGYAAQWVAANIKPFYPATKINIIAVGQR  404
            I  L     A  WVA NI PF+P T IN IAVG  
Sbjct  83   IPALAKLPAAQSWVANNILPFHPTTLINHIAVGNE  117



>ref|XP_006291113.1| hypothetical protein CARUB_v10017225mg [Capsella rubella]
 gb|EOA24011.1| hypothetical protein CARUB_v10017225mg [Capsella rubella]
Length=454

 Score =   122 bits (307),  Expect(2) = 4e-30, Method: Compositional matrix adjust.
 Identities = 63/97 (65%), Positives = 75/97 (77%), Gaps = 1/97 (1%)
 Frame = +3

Query  114  VRSIGVNYGTLGDNLPPPTEVARFLKEKTVIDRIKIFDVNPDILRAFAGTGILVTVTVPN  293
            + +IGVNYGTLG NLPPPT+VA F+K +T ID +KIFDVNPDILRAFAGTGI V VTVPN
Sbjct  30   ISAIGVNYGTLG-NLPPPTQVANFIKTQTSIDSVKIFDVNPDILRAFAGTGISVVVTVPN  88

Query  294  GEIIPLKDAGYAAQWVAANIKPFYPATKINIIAVGQR  404
             +I  L +   A +WV+ANI PF+P TKI  I+VG  
Sbjct  89   VDIPALANGVQARRWVSANILPFHPQTKIKYISVGNE  125


 Score = 35.4 bits (80),  Expect(2) = 4e-30, Method: Compositional matrix adjust.
 Identities = 17/33 (52%), Positives = 24/33 (73%), Gaps = 0/33 (0%)
 Frame = +1

Query  397  GNEVLHWGTPEMQNGLVAAMRSLYNALVKSGIK  495
            GNE+L  G   M N L+ AMR+L NALV++G++
Sbjct  123  GNEILLTGDNNMINNLLPAMRNLNNALVRAGVR  155



>emb|CDY02936.1| BnaC04g25500D [Brassica napus]
Length=452

 Score =   123 bits (309),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 63/97 (65%), Positives = 76/97 (78%), Gaps = 1/97 (1%)
 Frame = +3

Query  114  VRSIGVNYGTLGDNLPPPTEVARFLKEKTVIDRIKIFDVNPDILRAFAGTGILVTVTVPN  293
            + +IGVNYGTLG NLPPPTEVA FLK +T ID +KIF+V+P+ILRAFAGTGI V VTVPN
Sbjct  26   ISAIGVNYGTLG-NLPPPTEVANFLKTQTSIDSVKIFNVDPNILRAFAGTGISVVVTVPN  84

Query  294  GEIIPLKDAGYAAQWVAANIKPFYPATKINIIAVGQR  404
            G+I  L +   A +WV+ANI PF+P TKI  I+VG  
Sbjct  85   GDIPALANGRQARRWVSANILPFHPQTKIKYISVGNE  121



>ref|XP_011027355.1| PREDICTED: glucan endo-1,3-beta-glucosidase [Populus euphratica]
Length=457

 Score =   123 bits (309),  Expect = 5e-30, Method: Compositional matrix adjust.
 Identities = 61/95 (64%), Positives = 72/95 (76%), Gaps = 0/95 (0%)
 Frame = +3

Query  120  SIGVNYGTLGDNLPPPTEVARFLKEKTVIDRIKIFDVNPDILRAFAGTGILVTVTVPNGE  299
            SIGVNYGTL ++LP P++VA FLK +T+ID IKIFD NPDILR FA T I VTVTV NG+
Sbjct  28   SIGVNYGTLANDLPSPSQVASFLKTQTIIDSIKIFDTNPDILRGFANTNITVTVTVGNGD  87

Query  300  IIPLKDAGYAAQWVAANIKPFYPATKINIIAVGQR  404
            I  L DA  A +WVA NI+ FYP T+I +IAVG  
Sbjct  88   IPALVDANAAGRWVANNIEQFYPQTRIKLIAVGNE  122



>ref|XP_002315222.2| hypothetical protein POPTR_0010s21130g [Populus trichocarpa]
 gb|EEF01393.2| hypothetical protein POPTR_0010s21130g [Populus trichocarpa]
Length=477

 Score =   123 bits (309),  Expect = 5e-30, Method: Compositional matrix adjust.
 Identities = 61/95 (64%), Positives = 73/95 (77%), Gaps = 0/95 (0%)
 Frame = +3

Query  120  SIGVNYGTLGDNLPPPTEVARFLKEKTVIDRIKIFDVNPDILRAFAGTGILVTVTVPNGE  299
            SIGVNYGTL ++LP P++VA FLK +T+ID IKIFD NPDILR FA T I VTVTV NG+
Sbjct  28   SIGVNYGTLANDLPSPSQVANFLKTQTIIDSIKIFDTNPDILRGFANTNITVTVTVGNGD  87

Query  300  IIPLKDAGYAAQWVAANIKPFYPATKINIIAVGQR  404
            I  L DA  A++WVA NI+ FYP T+I +IAVG  
Sbjct  88   IPALVDANAASRWVANNIEQFYPQTRIKLIAVGNE  122



>gb|KDP34495.1| hypothetical protein JCGZ_11045 [Jatropha curcas]
Length=494

 Score =   123 bits (308),  Expect = 7e-30, Method: Compositional matrix adjust.
 Identities = 63/95 (66%), Positives = 70/95 (74%), Gaps = 0/95 (0%)
 Frame = +3

Query  120  SIGVNYGTLGDNLPPPTEVARFLKEKTVIDRIKIFDVNPDILRAFAGTGILVTVTVPNGE  299
            SIGVNYGT+ DNLP P++VA FLK KT IDRIKIFD NPDILRAFA TGI VTVTV NG+
Sbjct  26   SIGVNYGTVADNLPTPSQVANFLKTKTTIDRIKIFDANPDILRAFANTGISVTVTVGNGD  85

Query  300  IIPLKDAGYAAQWVAANIKPFYPATKINIIAVGQR  404
            I  L     A  W+AANI P++P T I  IAVG  
Sbjct  86   IPSLAKLPAAKAWIAANILPYHPKTIIKYIAVGNE  120



>ref|XP_009357726.1| PREDICTED: glucan endo-1,3-beta-glucosidase [Pyrus x bretschneideri]
Length=492

 Score =   123 bits (308),  Expect = 8e-30, Method: Compositional matrix adjust.
 Identities = 60/104 (58%), Positives = 77/104 (74%), Gaps = 3/104 (3%)
 Frame = +3

Query  120  SIGVNYGTLGDNLPPPTEVARFLKEKTVIDRIKIFDVNPDILRAFAGTGILVTVTVPNGE  299
            SIGVNYGTL DNLPPP +VA F+K +T ID +K+FD NPDI++AFA T I +T+TVPNGE
Sbjct  22   SIGVNYGTLADNLPPPAKVADFIKTQTNIDAVKLFDANPDIIKAFANTNISLTITVPNGE  81

Query  300  IIPLKDAGYAAQWVAANIKPFYPATKINIIAVGQRGSPLGHAGD  431
            I  LK+   A +W+  ++KPFYPA+KI  IA+G     + H GD
Sbjct  82   IPSLKNLQTARRWITDHVKPFYPASKIKYIALGNE---VLHWGD  122



>gb|KHG22731.1| Glucan endo-1,3-beta-glucosidase [Gossypium arboreum]
Length=465

 Score =   122 bits (307),  Expect = 9e-30, Method: Compositional matrix adjust.
 Identities = 63/112 (56%), Positives = 78/112 (70%), Gaps = 2/112 (2%)
 Frame = +3

Query  69   IFLFFLVSAFLFIHGVRSIGVNYGTLGDNLPPPTEVARFLKEKTVIDRIKIFDVNPDILR  248
            +   FLVS    + GV SIGVNYGT+ +NLPPP +VA FL E TVI+R+K++D NPDIL+
Sbjct  16   VISLFLVSTL--VPGVGSIGVNYGTVANNLPPPPQVAHFLLESTVINRVKLYDANPDILK  73

Query  249  AFAGTGILVTVTVPNGEIIPLKDAGYAAQWVAANIKPFYPATKINIIAVGQR  404
            AFA TGI VTVTVPN +I  L    +A QWV  N++P+ PAT I  I VG  
Sbjct  74   AFAHTGIAVTVTVPNDQIPRLTKLNFARQWVEDNVQPYTPATNIVRILVGNE  125



>ref|XP_008233624.1| PREDICTED: glucan endo-1,3-beta-glucosidase-like [Prunus mume]
Length=478

 Score =   122 bits (307),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 60/104 (58%), Positives = 76/104 (73%), Gaps = 3/104 (3%)
 Frame = +3

Query  120  SIGVNYGTLGDNLPPPTEVARFLKEKTVIDRIKIFDVNPDILRAFAGTGILVTVTVPNGE  299
            +IGVNYGTL DNLPPP +VA FLK +T ID++KIFD NPDI++AFA T I +T+T+PNG+
Sbjct  22   AIGVNYGTLADNLPPPAQVANFLKTQTNIDKVKIFDANPDIIKAFANTNISLTITIPNGD  81

Query  300  IIPLKDAGYAAQWVAANIKPFYPATKINIIAVGQRGSPLGHAGD  431
            I  L     A +WV  ++KPFYP TKIN IA+G     + H GD
Sbjct  82   IPSLTKLRAARRWVVDHVKPFYPQTKINYIAMGNE---VLHWGD  122


 Score = 50.1 bits (118),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 21/33 (64%), Positives = 26/33 (79%), Gaps = 0/33 (0%)
 Frame = +1

Query  397  GNEVLHWGTPEMQNGLVAAMRSLYNALVKSGIK  495
            GNEVLHWG   ++N LV AMR+ +NALV+ GIK
Sbjct  114  GNEVLHWGDDNLKNSLVPAMRTFHNALVREGIK  146



>emb|CDP05033.1| unnamed protein product [Coffea canephora]
Length=459

 Score =   122 bits (306),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 61/116 (53%), Positives = 78/116 (67%), Gaps = 6/116 (5%)
 Frame = +3

Query  75   LFFLVSAFLFIHGVR------SIGVNYGTLGDNLPPPTEVARFLKEKTVIDRIKIFDVNP  236
            L  ++SA L +  V       ++GVNYGT+ DNLPPP EVA FL E T+I+R+++FD NP
Sbjct  5    LVHVISALLLVASVNIQGIEGTVGVNYGTVADNLPPPAEVAHFLLENTIINRVRLFDANP  64

Query  237  DILRAFAGTGILVTVTVPNGEIIPLKDAGYAAQWVAANIKPFYPATKINIIAVGQR  404
            +IL AFA TGI +T+TVPN EI  L +  +A QWV ANI P +PAT I  I VG  
Sbjct  65   EILEAFAHTGIAITLTVPNNEIPQLTNLSFAQQWVTANITPHFPATNIVRILVGNE  120



>gb|KJB83778.1| hypothetical protein B456_013G263800 [Gossypium raimondii]
Length=510

 Score =   122 bits (307),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 67/122 (55%), Positives = 78/122 (64%), Gaps = 5/122 (4%)
 Frame = +3

Query  54   LRPSPIFLFFLVSAFLFIH-----GVRSIGVNYGTLGDNLPPPTEVARFLKEKTVIDRIK  218
            L  + + +FF  S  L I       V +IGVNYGT+ DNLP P +VA FLK KT IDRIK
Sbjct  4    LSATKLLIFFFFSCHLSIFSSTATAVYTIGVNYGTIADNLPTPAQVANFLKTKTNIDRIK  63

Query  219  IFDVNPDILRAFAGTGILVTVTVPNGEIIPLKDAGYAAQWVAANIKPFYPATKINIIAVG  398
            IFD NPDIL+AFAGTGI VTVTV NG+I  L     A  W+  NI P++P T I  IAVG
Sbjct  64   IFDTNPDILKAFAGTGISVTVTVGNGDIPSLAKLPGAKAWIEKNILPYHPKTIIRYIAVG  123

Query  399  QR  404
              
Sbjct  124  NE  125



>ref|XP_002312098.1| glucan endo-1 family protein [Populus trichocarpa]
 gb|EEE89465.1| glucan endo-1 family protein [Populus trichocarpa]
Length=454

 Score =   122 bits (305),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 61/95 (64%), Positives = 72/95 (76%), Gaps = 0/95 (0%)
 Frame = +3

Query  120  SIGVNYGTLGDNLPPPTEVARFLKEKTVIDRIKIFDVNPDILRAFAGTGILVTVTVPNGE  299
            +IGVNYGTLG+NLPPP++VA F+K +T+ID IKIFD N DIL AFA TGI VTVTV NG+
Sbjct  29   AIGVNYGTLGNNLPPPSQVANFIKTQTIIDSIKIFDTNHDILNAFANTGITVTVTVGNGD  88

Query  300  IIPLKDAGYAAQWVAANIKPFYPATKINIIAVGQR  404
            I  L +   A  WVAANI PF+P T+IN I VG  
Sbjct  89   IPSLANLNSARGWVAANIAPFHPQTRINRIVVGNE  123



>ref|XP_006394688.1| hypothetical protein EUTSA_v10004182mg [Eutrema salsugineum]
 gb|ESQ31974.1| hypothetical protein EUTSA_v10004182mg [Eutrema salsugineum]
Length=458

 Score =   122 bits (305),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 66/129 (51%), Positives = 85/129 (66%), Gaps = 2/129 (2%)
 Frame = +3

Query  24   NLILKIMEMSLRPSPIFLFFLVSAFL-FIHGVR-SIGVNYGTLGDNLPPPTEVARFLKEK  197
            N +L     S   SPI +F +V A + F  G   SIGVNYGTL +NLPPP +VA FL   
Sbjct  2    NYMLLFFSCSWVISPISMFTMVVALIIFSTGANASIGVNYGTLANNLPPPRQVAEFLLHS  61

Query  198  TVIDRIKIFDVNPDILRAFAGTGILVTVTVPNGEIIPLKDAGYAAQWVAANIKPFYPATK  377
            TVI+RI++FD +P ILRAFA TGI VTVTVPN +I  L +  +A QW++ +I+P +P+T 
Sbjct  62   TVINRIRLFDADPQILRAFAHTGIAVTVTVPNHQITHLTNLSFAEQWISDHIQPHFPSTN  121

Query  378  INIIAVGQR  404
            I  I VG  
Sbjct  122  IIRILVGNE  130



>ref|XP_010427314.1| PREDICTED: glucan endo-1,3-beta-glucosidase-like [Camelina sativa]
Length=452

 Score =   121 bits (304),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 63/97 (65%), Positives = 74/97 (76%), Gaps = 1/97 (1%)
 Frame = +3

Query  114  VRSIGVNYGTLGDNLPPPTEVARFLKEKTVIDRIKIFDVNPDILRAFAGTGILVTVTVPN  293
            + +IGVNYGTLG NLPPPT+VA F+K +T ID +KIFDVNPDILRAFAGTGI V VTVPN
Sbjct  28   ISAIGVNYGTLG-NLPPPTQVANFIKTQTTIDSVKIFDVNPDILRAFAGTGISVVVTVPN  86

Query  294  GEIIPLKDAGYAAQWVAANIKPFYPATKINIIAVGQR  404
            G+I  L +   A +WV+ANI PF P T I  I+VG  
Sbjct  87   GDIPALANGLQARRWVSANILPFNPQTIIKYISVGNE  123



>gb|KFK34786.1| hypothetical protein AALP_AA5G193500 [Arabis alpina]
Length=447

 Score =   119 bits (298),  Expect(2) = 2e-29, Method: Compositional matrix adjust.
 Identities = 59/97 (61%), Positives = 76/97 (78%), Gaps = 1/97 (1%)
 Frame = +3

Query  114  VRSIGVNYGTLGDNLPPPTEVARFLKEKTVIDRIKIFDVNPDILRAFAGTGILVTVTVPN  293
            + +IGVNYGTLG NLPPP++VA F+K +T ID +KIF+V+P+ILRAFAG+GI V VTVPN
Sbjct  22   ISAIGVNYGTLG-NLPPPSQVANFIKTRTSIDSVKIFNVDPNILRAFAGSGISVVVTVPN  80

Query  294  GEIIPLKDAGYAAQWVAANIKPFYPATKINIIAVGQR  404
            G+I  L +   A +WVAANI P++P TKI  I+VG  
Sbjct  81   GDIPALANGRQARRWVAANILPYHPQTKIKYISVGNE  117


 Score = 36.2 bits (82),  Expect(2) = 2e-29, Method: Compositional matrix adjust.
 Identities = 18/33 (55%), Positives = 24/33 (73%), Gaps = 0/33 (0%)
 Frame = +1

Query  397  GNEVLHWGTPEMQNGLVAAMRSLYNALVKSGIK  495
            GNE+L  G   M N L+ AMR+L NALV++G+K
Sbjct  115  GNEILLTGDNNMINNLLPAMRNLNNALVRAGVK  147



>ref|XP_011029787.1| PREDICTED: glucan endo-1,3-beta-glucosidase-like [Populus euphratica]
Length=451

 Score =   121 bits (304),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 61/95 (64%), Positives = 72/95 (76%), Gaps = 0/95 (0%)
 Frame = +3

Query  120  SIGVNYGTLGDNLPPPTEVARFLKEKTVIDRIKIFDVNPDILRAFAGTGILVTVTVPNGE  299
            +IGVNYGTLG+NLPPP++VA F+K +T+ID IKIFD N DIL AFA TGI VTVTV NG+
Sbjct  26   AIGVNYGTLGNNLPPPSQVANFIKTQTIIDSIKIFDTNHDILNAFANTGITVTVTVGNGD  85

Query  300  IIPLKDAGYAAQWVAANIKPFYPATKINIIAVGQR  404
            I  L +   A  WVAANI PF+P T+IN I VG  
Sbjct  86   IPSLANLNSARGWVAANIAPFHPRTRINRIVVGNE  120



>emb|CDX76097.1| BnaA04g03610D [Brassica napus]
Length=451

 Score =   121 bits (304),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 62/97 (64%), Positives = 75/97 (77%), Gaps = 1/97 (1%)
 Frame = +3

Query  114  VRSIGVNYGTLGDNLPPPTEVARFLKEKTVIDRIKIFDVNPDILRAFAGTGILVTVTVPN  293
            + +IGVNYGTLG NLPPP EVA FLK +T ID +KIF+V+P+ILRAFAGTGI V VTVPN
Sbjct  26   ISAIGVNYGTLG-NLPPPNEVANFLKTQTSIDSVKIFNVDPNILRAFAGTGISVVVTVPN  84

Query  294  GEIIPLKDAGYAAQWVAANIKPFYPATKINIIAVGQR  404
            G+I  L +   A +WV+ANI PF+P TKI  I+VG  
Sbjct  85   GDIPALANGRQARRWVSANILPFHPQTKIKYISVGNE  121



>ref|XP_004295910.1| PREDICTED: glucan endo-1,3-beta-glucosidase-like [Fragaria vesca 
subsp. vesca]
Length=515

 Score =   121 bits (304),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 64/105 (61%), Positives = 74/105 (70%), Gaps = 1/105 (1%)
 Frame = +3

Query  90   SAFLFIHGVRSIGVNYGTLGDNLPPPTEVARFLKEKTVIDRIKIFDVNPDILRAFAGTGI  269
            SAF  I    +IGVNYGT+ +NLPPP++VA FLK KT IDR+KIF+ +P +LRAFA TGI
Sbjct  14   SAFHVIL-TSAIGVNYGTVANNLPPPSQVATFLKTKTTIDRVKIFNTDPAVLRAFANTGI  72

Query  270  LVTVTVPNGEIIPLKDAGYAAQWVAANIKPFYPATKINIIAVGQR  404
             VTVTV NG + PL     A  WVA NI PFYP T IN IAVG  
Sbjct  73   AVTVTVGNGNVPPLAKLPAAQSWVADNILPFYPRTNINRIAVGNE  117



>gb|ACM45718.1| endo-1,3-beta-glucanase [Pyrus pyrifolia]
Length=454

 Score =   121 bits (303),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 59/104 (57%), Positives = 76/104 (73%), Gaps = 3/104 (3%)
 Frame = +3

Query  120  SIGVNYGTLGDNLPPPTEVARFLKEKTVIDRIKIFDVNPDILRAFAGTGILVTVTVPNGE  299
            SIGVNYGTL DNLPPP +VA F+K +T ID +K+FD NPDI++AFA T I +T+T+PNG+
Sbjct  22   SIGVNYGTLADNLPPPAQVANFIKTQTTIDAVKLFDANPDIIKAFANTNISLTITIPNGD  81

Query  300  IIPLKDAGYAAQWVAANIKPFYPATKINIIAVGQRGSPLGHAGD  431
            I  L +   A  W+  ++KPFYPATKI  IA+   GS + H GD
Sbjct  82   IQSLINLRTARHWIIDHVKPFYPATKIKYIAM---GSEVLHWGD  122



>ref|XP_008223598.1| PREDICTED: glucan endo-1,3-beta-glucosidase-like [Prunus mume]
Length=517

 Score =   121 bits (304),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 61/95 (64%), Positives = 70/95 (74%), Gaps = 0/95 (0%)
 Frame = +3

Query  120  SIGVNYGTLGDNLPPPTEVARFLKEKTVIDRIKIFDVNPDILRAFAGTGILVTVTVPNGE  299
            SIGVNYGT+ DNLPPP++VA FLK KT IDR+KIFD N D+LRAFA T I VTVTV NG+
Sbjct  32   SIGVNYGTIADNLPPPSQVATFLKTKTTIDRVKIFDANADMLRAFADTKIAVTVTVGNGD  91

Query  300  IIPLKDAGYAAQWVAANIKPFYPATKINIIAVGQR  404
            +  L     A  WV+ANI PF+P T IN IAVG  
Sbjct  92   VPALAKLSAAQAWVSANILPFHPRTIINRIAVGNE  126



>ref|XP_002298356.1| glycosyl hydrolase family 17 family protein [Populus trichocarpa]
 gb|EEE83161.1| glycosyl hydrolase family 17 family protein [Populus trichocarpa]
Length=457

 Score =   121 bits (303),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 59/95 (62%), Positives = 70/95 (74%), Gaps = 0/95 (0%)
 Frame = +3

Query  120  SIGVNYGTLGDNLPPPTEVARFLKEKTVIDRIKIFDVNPDILRAFAGTGILVTVTVPNGE  299
            ++GVNYGT+ +NLP P++VA FLK +T IDR+KIFD NPDILRAFA TGI VTVTV NG+
Sbjct  26   TVGVNYGTVANNLPSPSQVASFLKTQTTIDRVKIFDTNPDILRAFANTGISVTVTVGNGD  85

Query  300  IIPLKDAGYAAQWVAANIKPFYPATKINIIAVGQR  404
            I  L     A  W+AANI PF+P T I  IAVG  
Sbjct  86   IPSLAKLPAAQSWIAANILPFHPQTSIKYIAVGNE  120



>ref|XP_008342287.1| PREDICTED: glucan endo-1,3-beta-glucosidase-like [Malus domestica]
Length=343

 Score =   120 bits (300),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 60/104 (58%), Positives = 76/104 (73%), Gaps = 3/104 (3%)
 Frame = +3

Query  120  SIGVNYGTLGDNLPPPTEVARFLKEKTVIDRIKIFDVNPDILRAFAGTGILVTVTVPNGE  299
            SIGVNYGTLGDNLPPP +VA F+K +T ID +KIFD NPDI++AFA T I +T+T+PNG+
Sbjct  22   SIGVNYGTLGDNLPPPAKVADFIKTQTNIDAVKIFDTNPDIIKAFANTNISLTITIPNGD  81

Query  300  IIPLKDAGYAAQWVAANIKPFYPATKINIIAVGQRGSPLGHAGD  431
            I  L     A +WV  ++KPFYPA+KI  IA+G     + H GD
Sbjct  82   IPKLIKLRIARRWVVDHVKPFYPASKIKYIAMGNE---VLHWGD  122



>ref|XP_006350772.1| PREDICTED: glucan endo-1,3-beta-glucosidase-like [Solanum tuberosum]
Length=448

 Score =   120 bits (301),  Expect = 5e-29, Method: Compositional matrix adjust.
 Identities = 58/116 (50%), Positives = 80/116 (69%), Gaps = 5/116 (4%)
 Frame = +3

Query  66   PIFLFFLVSAFLFIHGVRS---IGVNYGTLGDNLPPPTEVARFLKEKTVIDRIKIFDVNP  236
            PIF  F+    L  +GV S   +G+NYGT+ DNLPPP++VA F+++ T +++IKIFD NP
Sbjct  9    PIFSSFIF--LLLCNGVSSDYLLGINYGTVADNLPPPSQVAAFIRDHTTLNKIKIFDANP  66

Query  237  DILRAFAGTGILVTVTVPNGEIIPLKDAGYAAQWVAANIKPFYPATKINIIAVGQR  404
            +I+RAFA TG+ VTVTVPNG+I  +     A  WV  N+ PFYP T+I+ I +G  
Sbjct  67   EIIRAFADTGVWVTVTVPNGDIWSVSKPTAAQWWVEQNVVPFYPRTRIDRICIGNE  122



>ref|NP_001151227.1| glucan endo-1,3-beta-glucosidase precursor [Zea mays]
 gb|ACG42046.1| glucan endo-1,3-beta-glucosidase precursor [Zea mays]
Length=498

 Score =   120 bits (302),  Expect = 5e-29, Method: Compositional matrix adjust.
 Identities = 56/95 (59%), Positives = 70/95 (74%), Gaps = 0/95 (0%)
 Frame = +3

Query  120  SIGVNYGTLGDNLPPPTEVARFLKEKTVIDRIKIFDVNPDILRAFAGTGILVTVTVPNGE  299
            +IGVNYGT GDNLPPP  VA FL  +T IDR+K+FD NPD++RAFAGTGI V VT  NG+
Sbjct  29   AIGVNYGTKGDNLPPPATVASFLANRTRIDRVKLFDTNPDMVRAFAGTGIAVMVTAGNGD  88

Query  300  IIPLKDAGYAAQWVAANIKPFYPATKINIIAVGQR  404
            I  L     A  WVAAN+ P+YP+T I++++VG  
Sbjct  89   IPKLATKDGAGAWVAANVAPYYPSTDISLVSVGNE  123



>ref|XP_008810606.1| PREDICTED: glucan endo-1,3-beta-glucosidase [Phoenix dactylifera]
Length=351

 Score =   119 bits (299),  Expect = 5e-29, Method: Compositional matrix adjust.
 Identities = 55/95 (58%), Positives = 70/95 (74%), Gaps = 0/95 (0%)
 Frame = +3

Query  120  SIGVNYGTLGDNLPPPTEVARFLKEKTVIDRIKIFDVNPDILRAFAGTGILVTVTVPNGE  299
            SIGVNYG + DNLPPP +VA FLK  T IDR+K+FD NPD +RAFAGTGI + +TVPNG+
Sbjct  22   SIGVNYGAVADNLPPPPQVAAFLKANTFIDRVKLFDSNPDFIRAFAGTGISLMITVPNGD  81

Query  300  IIPLKDAGYAAQWVAANIKPFYPATKINIIAVGQR  404
            +  L     A  W+A N+ PF+PAT I+++AVG  
Sbjct  82   VPSLAKVPAARAWIANNVAPFHPATNISLLAVGNE  116



>ref|XP_002318439.2| hypothetical protein POPTR_0012s02490g [Populus trichocarpa]
 gb|EEE96659.2| hypothetical protein POPTR_0012s02490g [Populus trichocarpa]
Length=460

 Score =   120 bits (301),  Expect = 5e-29, Method: Compositional matrix adjust.
 Identities = 56/110 (51%), Positives = 78/110 (71%), Gaps = 0/110 (0%)
 Frame = +3

Query  75   LFFLVSAFLFIHGVRSIGVNYGTLGDNLPPPTEVARFLKEKTVIDRIKIFDVNPDILRAF  254
            +  L SAF  +    SIGVNYGT+ DNLPPP +VA FL E T+I+R+++FD N +I++AF
Sbjct  16   ILLLASAFNILGAEGSIGVNYGTVADNLPPPAQVAHFLLESTIINRVRLFDTNTEIIQAF  75

Query  255  AGTGILVTVTVPNGEIIPLKDAGYAAQWVAANIKPFYPATKINIIAVGQR  404
            A TGI +T+TVPN +I  L + G+A +WV +N++P+ PAT I  I VG  
Sbjct  76   AHTGIAITITVPNDQIPHLTNLGFAQEWVKSNVQPYVPATNIVRILVGNE  125



>ref|XP_004959111.1| PREDICTED: uncharacterized protein LOC101782084 [Setaria italica]
Length=1022

 Score =   123 bits (309),  Expect = 5e-29, Method: Composition-based stats.
 Identities = 61/107 (57%), Positives = 79/107 (74%), Gaps = 2/107 (2%)
 Frame = +3

Query  84   LVSAFLFIHG--VRSIGVNYGTLGDNLPPPTEVARFLKEKTVIDRIKIFDVNPDILRAFA  257
            ++SAFL +      +IGVNYGT GDNLPPP +VA FL  +T IDR+K+FD N D++RAFA
Sbjct  14   VLSAFLLVIAPYAAAIGVNYGTKGDNLPPPAKVASFLANRTRIDRVKLFDTNADMVRAFA  73

Query  258  GTGILVTVTVPNGEIIPLKDAGYAAQWVAANIKPFYPATKINIIAVG  398
            GTGI +TVT  NG+I  L     AA WV+AN+ P+YPAT I+++AVG
Sbjct  74   GTGIALTVTAANGDIPKLATKDGAAAWVSANVAPYYPATDISLVAVG  120



>ref|XP_010048931.1| PREDICTED: glucan endo-1,3-beta-glucosidase [Eucalyptus grandis]
 gb|KCW89128.1| hypothetical protein EUGRSUZ_A01445 [Eucalyptus grandis]
Length=476

 Score =   120 bits (301),  Expect = 6e-29, Method: Compositional matrix adjust.
 Identities = 60/111 (54%), Positives = 75/111 (68%), Gaps = 1/111 (1%)
 Frame = +3

Query  75   LFFLVSAFLFIHGVRS-IGVNYGTLGDNLPPPTEVARFLKEKTVIDRIKIFDVNPDILRA  251
            +F L+ +  F+ G R+ IGVNYGT+ DNLPPP +VA FL E T IDRI++FD +PDIL+A
Sbjct  21   VFLLLCSSFFMEGARAGIGVNYGTVADNLPPPAQVAHFLLESTTIDRIRLFDADPDILKA  80

Query  252  FAGTGILVTVTVPNGEIIPLKDAGYAAQWVAANIKPFYPATKINIIAVGQR  404
            FA TGI +TVTVPN  I  L     A  WV  N++P+ PAT I  I VG  
Sbjct  81   FANTGIAITVTVPNDLIPQLAKLSNAQDWVRTNVEPYVPATDIVRILVGNE  131



>ref|XP_006441150.1| hypothetical protein CICLE_v10020075mg [Citrus clementina]
 gb|ESR54390.1| hypothetical protein CICLE_v10020075mg [Citrus clementina]
Length=460

 Score =   120 bits (300),  Expect = 7e-29, Method: Compositional matrix adjust.
 Identities = 63/124 (51%), Positives = 82/124 (66%), Gaps = 3/124 (2%)
 Frame = +3

Query  42   MEMSLRPSPIF--LFFLVSAFLFIHGVR-SIGVNYGTLGDNLPPPTEVARFLKEKTVIDR  212
            M+ +  P P F  L  +V +   IHG   SIGVNYGT+ +NLPPPT VA FL E T+I+R
Sbjct  1    MDKAQIPLPTFTILLLVVVSISLIHGSEGSIGVNYGTVANNLPPPTHVAHFLLESTIINR  60

Query  213  IKIFDVNPDILRAFAGTGILVTVTVPNGEIIPLKDAGYAAQWVAANIKPFYPATKINIIA  392
            +++FD +P ++RAFA TGI VTVTVPN +I  L    +A QW+  NI+P+ PAT I  I 
Sbjct  61   VRLFDADPKMIRAFAHTGIAVTVTVPNDQIPYLTKLNFAEQWLKNNIQPYTPATNIVRIL  120

Query  393  VGQR  404
            VG  
Sbjct  121  VGNE  124



>ref|XP_008437641.1| PREDICTED: glucan endo-1,3-beta-glucosidase [Cucumis melo]
Length=499

 Score =   120 bits (301),  Expect = 7e-29, Method: Compositional matrix adjust.
 Identities = 58/115 (50%), Positives = 80/115 (70%), Gaps = 2/115 (2%)
 Frame = +3

Query  66   PIFLFFLVSAFLFIHGVR--SIGVNYGTLGDNLPPPTEVARFLKEKTVIDRIKIFDVNPD  239
            P FL  ++   + I GV   SIGVNYGT+ DNLPPP++VA FL + T+IDR+++FD +PD
Sbjct  40   PTFLLLILPTLIQIQGVNGGSIGVNYGTVADNLPPPSKVAAFLLDNTIIDRVRLFDADPD  99

Query  240  ILRAFAGTGILVTVTVPNGEIIPLKDAGYAAQWVAANIKPFYPATKINIIAVGQR  404
            ILRAFA TGI V++T+PN +I  L    +A +W+  NI+P+ PAT I  + VG  
Sbjct  100  ILRAFAHTGISVSITIPNDQIPRLVKPNFAEEWIKFNIQPYIPATNIIRVLVGNE  154



>ref|XP_008371690.1| PREDICTED: glucan endo-1,3-beta-glucosidase-like [Malus domestica]
Length=454

 Score =   120 bits (300),  Expect = 8e-29, Method: Compositional matrix adjust.
 Identities = 59/104 (57%), Positives = 76/104 (73%), Gaps = 3/104 (3%)
 Frame = +3

Query  120  SIGVNYGTLGDNLPPPTEVARFLKEKTVIDRIKIFDVNPDILRAFAGTGILVTVTVPNGE  299
            SIGVNYGTL DNLPPP +VA F+K +T ID +K+FD NPDI++AFA T I +T+T+PNG+
Sbjct  22   SIGVNYGTLADNLPPPAQVADFIKTQTNIDAVKLFDANPDIIKAFANTNISLTITIPNGD  81

Query  300  IIPLKDAGYAAQWVAANIKPFYPATKINIIAVGQRGSPLGHAGD  431
            I  L +   A  W+  ++KPFYPATKI  IA+   GS + H GD
Sbjct  82   IQSLINLRTARHWIIDHVKPFYPATKIKYIAM---GSEVLHWGD  122



>ref|XP_007016412.1| O-Glycosyl hydrolases family 17 protein isoform 2 [Theobroma 
cacao]
 gb|EOY34031.1| O-Glycosyl hydrolases family 17 protein isoform 2 [Theobroma 
cacao]
Length=428

 Score =   119 bits (299),  Expect = 9e-29, Method: Compositional matrix adjust.
 Identities = 65/121 (54%), Positives = 76/121 (63%), Gaps = 3/121 (2%)
 Frame = +3

Query  51   SLRPSPIFLFFLVSAFLF---IHGVRSIGVNYGTLGDNLPPPTEVARFLKEKTVIDRIKI  221
            +L  + +F  F     +F        SIGVNYGT+ DNLPPP +VA FLK KT IDR+KI
Sbjct  3    TLSATKLFFLFTFHVTIFSSTTTAAYSIGVNYGTVADNLPPPPQVANFLKTKTNIDRVKI  62

Query  222  FDVNPDILRAFAGTGILVTVTVPNGEIIPLKDAGYAAQWVAANIKPFYPATKINIIAVGQ  401
            FD NPDIL+AFA TGI VTVTV NG+I  L     A  W+A NI P +P T I  IAVG 
Sbjct  63   FDANPDILKAFANTGISVTVTVGNGDIPSLAKLPGAQSWIADNILPHHPQTIIRYIAVGN  122

Query  402  R  404
             
Sbjct  123  E  123



>gb|KGN49838.1| hypothetical protein Csa_5G139170 [Cucumis sativus]
Length=493

 Score =   120 bits (300),  Expect = 9e-29, Method: Compositional matrix adjust.
 Identities = 58/115 (50%), Positives = 79/115 (69%), Gaps = 2/115 (2%)
 Frame = +3

Query  66   PIFLFFLVSAFLFIHGVR--SIGVNYGTLGDNLPPPTEVARFLKEKTVIDRIKIFDVNPD  239
            P FL  ++     I GV   SIGVNYGT+ DNLPPP++VA FL + T+IDR+++FD +PD
Sbjct  41   PTFLLLILPTLFQIQGVNGGSIGVNYGTVADNLPPPSKVAAFLLDNTIIDRVRLFDADPD  100

Query  240  ILRAFAGTGILVTVTVPNGEIIPLKDAGYAAQWVAANIKPFYPATKINIIAVGQR  404
            ILRAFA TGI V++T+PN +I  L    +A +W+  NI+P+ PAT I  + VG  
Sbjct  101  ILRAFAHTGISVSITIPNDQIPRLVKPNFAEEWIKFNIQPYIPATNIIRVLVGNE  155



>ref|XP_004145947.1| PREDICTED: glucan endo-1,3-beta-glucosidase-like [Cucumis sativus]
 ref|XP_004160391.1| PREDICTED: glucan endo-1,3-beta-glucosidase-like [Cucumis sativus]
Length=497

 Score =   120 bits (300),  Expect = 9e-29, Method: Compositional matrix adjust.
 Identities = 58/115 (50%), Positives = 79/115 (69%), Gaps = 2/115 (2%)
 Frame = +3

Query  66   PIFLFFLVSAFLFIHGVR--SIGVNYGTLGDNLPPPTEVARFLKEKTVIDRIKIFDVNPD  239
            P FL  ++     I GV   SIGVNYGT+ DNLPPP++VA FL + T+IDR+++FD +PD
Sbjct  41   PTFLLLILPTLFQIQGVNGGSIGVNYGTVADNLPPPSKVAAFLLDNTIIDRVRLFDADPD  100

Query  240  ILRAFAGTGILVTVTVPNGEIIPLKDAGYAAQWVAANIKPFYPATKINIIAVGQR  404
            ILRAFA TGI V++T+PN +I  L    +A +W+  NI+P+ PAT I  + VG  
Sbjct  101  ILRAFAHTGISVSITIPNDQIPRLVKPNFAEEWIKFNIQPYIPATNIIRVLVGNE  155



>dbj|BAB40807.1| endo-1,3-beta-glucanase-like protein [Pyrus pyrifolia]
Length=397

 Score =   119 bits (299),  Expect = 9e-29, Method: Compositional matrix adjust.
 Identities = 60/104 (58%), Positives = 76/104 (73%), Gaps = 3/104 (3%)
 Frame = +3

Query  120  SIGVNYGTLGDNLPPPTEVARFLKEKTVIDRIKIFDVNPDILRAFAGTGILVTVTVPNGE  299
            SIGVNYGTLGDNLPPP +VA F+K +T ID +KIFD NPDI++AFA T I +T+T+PNG+
Sbjct  22   SIGVNYGTLGDNLPPPAKVADFIKTQTNIDAVKIFDTNPDIIKAFANTNISLTITIPNGD  81

Query  300  IIPLKDAGYAAQWVAANIKPFYPATKINIIAVGQRGSPLGHAGD  431
            I  L     A +WV  ++KPFYPA+KI  IA+G     + H GD
Sbjct  82   IPKLIKLRTAPRWVVDHVKPFYPASKIKYIAMGNE---VLHWGD  122



>ref|XP_009357727.1| PREDICTED: glucan endo-1,3-beta-glucosidase-like [Pyrus x bretschneideri]
Length=454

 Score =   119 bits (299),  Expect = 9e-29, Method: Compositional matrix adjust.
 Identities = 58/104 (56%), Positives = 76/104 (73%), Gaps = 3/104 (3%)
 Frame = +3

Query  120  SIGVNYGTLGDNLPPPTEVARFLKEKTVIDRIKIFDVNPDILRAFAGTGILVTVTVPNGE  299
            SIGVNYGTL DNLPPP +VA F+K +T ID +K+FD NPDI++AFA T I +T+T+PNG+
Sbjct  22   SIGVNYGTLADNLPPPAQVANFIKTETTIDAVKLFDANPDIIKAFANTNISLTITIPNGD  81

Query  300  IIPLKDAGYAAQWVAANIKPFYPATKINIIAVGQRGSPLGHAGD  431
            I  L +   A  W+  ++KPFYPA+KI  IA+   GS + H GD
Sbjct  82   IQSLINLRTARHWIIDHVKPFYPASKIKYIAM---GSEVLHWGD  122



>ref|XP_006491986.1| PREDICTED: glucan endo-1,3-beta-glucosidase-like [Citrus sinensis]
 gb|KDO59627.1| hypothetical protein CISIN_1g043079mg [Citrus sinensis]
Length=460

 Score =   119 bits (299),  Expect = 9e-29, Method: Compositional matrix adjust.
 Identities = 63/124 (51%), Positives = 82/124 (66%), Gaps = 3/124 (2%)
 Frame = +3

Query  42   MEMSLRPSPIF--LFFLVSAFLFIHGVR-SIGVNYGTLGDNLPPPTEVARFLKEKTVIDR  212
            M+ +  P P F  L  +V +   IHG   SIGVNYGT+ +NLPPPT VA FL E T+I+R
Sbjct  1    MDKAQIPLPTFTILLLVVVSISLIHGSEGSIGVNYGTVANNLPPPTHVAHFLLESTIINR  60

Query  213  IKIFDVNPDILRAFAGTGILVTVTVPNGEIIPLKDAGYAAQWVAANIKPFYPATKINIIA  392
            +++FD +P ++RAFA TGI VTVTVPN +I  L    +A QW+  NI+P+ PAT I  I 
Sbjct  61   VRLFDADPKMIRAFAHTGIAVTVTVPNDQIPYLTKLNFAEQWLKNNIQPYTPATNIVRIF  120

Query  393  VGQR  404
            VG  
Sbjct  121  VGNE  124



>ref|XP_008382814.1| PREDICTED: glucan endo-1,3-beta-glucosidase isoform X2 [Malus 
domestica]
Length=396

 Score =   119 bits (298),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 60/104 (58%), Positives = 76/104 (73%), Gaps = 3/104 (3%)
 Frame = +3

Query  120  SIGVNYGTLGDNLPPPTEVARFLKEKTVIDRIKIFDVNPDILRAFAGTGILVTVTVPNGE  299
            SIGVNYGTLGDNLPPP +VA F+K +T ID +KIFD NPDI++AFA T I +T+T+PNG+
Sbjct  22   SIGVNYGTLGDNLPPPAKVADFIKTQTNIDAVKIFDTNPDIIKAFANTNISLTITIPNGD  81

Query  300  IIPLKDAGYAAQWVAANIKPFYPATKINIIAVGQRGSPLGHAGD  431
            I  L     A +WV  ++KPFYPA+KI  IA+G     + H GD
Sbjct  82   IPKLIKLRIARRWVVDHVKPFYPASKIKYIAMGNE---VLHWGD  122



>ref|XP_007016411.1| O-Glycosyl hydrolases family 17 protein isoform 1 [Theobroma 
cacao]
 gb|EOY34030.1| O-Glycosyl hydrolases family 17 protein isoform 1 [Theobroma 
cacao]
Length=497

 Score =   120 bits (300),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 65/121 (54%), Positives = 76/121 (63%), Gaps = 3/121 (2%)
 Frame = +3

Query  51   SLRPSPIFLFFLVSAFLF---IHGVRSIGVNYGTLGDNLPPPTEVARFLKEKTVIDRIKI  221
            +L  + +F  F     +F        SIGVNYGT+ DNLPPP +VA FLK KT IDR+KI
Sbjct  3    TLSATKLFFLFTFHVTIFSSTTTAAYSIGVNYGTVADNLPPPPQVANFLKTKTNIDRVKI  62

Query  222  FDVNPDILRAFAGTGILVTVTVPNGEIIPLKDAGYAAQWVAANIKPFYPATKINIIAVGQ  401
            FD NPDIL+AFA TGI VTVTV NG+I  L     A  W+A NI P +P T I  IAVG 
Sbjct  63   FDANPDILKAFANTGISVTVTVGNGDIPSLAKLPGAQSWIADNILPHHPQTIIRYIAVGN  122

Query  402  R  404
             
Sbjct  123  E  123



>ref|XP_011015294.1| PREDICTED: glucan endo-1,3-beta-glucosidase-like [Populus euphratica]
Length=496

 Score =   119 bits (299),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 62/120 (52%), Positives = 76/120 (63%), Gaps = 4/120 (3%)
 Frame = +3

Query  57   RPSPIFLFFLVSAFLFIH----GVRSIGVNYGTLGDNLPPPTEVARFLKEKTVIDRIKIF  224
            +P  +FL      + F         ++GVNYGT+ +NLP P++VA FLK +T IDR+KIF
Sbjct  3    KPRTLFLLLFTFYYHFSSSSSSAAYTVGVNYGTVANNLPSPSQVASFLKTQTTIDRVKIF  62

Query  225  DVNPDILRAFAGTGILVTVTVPNGEIIPLKDAGYAAQWVAANIKPFYPATKINIIAVGQR  404
            D N DILRAFA TGI VTVTV NG+I  L     A  W+AANI PF+P T I  IAVG  
Sbjct  63   DTNQDILRAFANTGISVTVTVGNGDIPSLAKLPAAQSWIAANILPFHPQTSIKYIAVGNE  122



>ref|XP_009796709.1| PREDICTED: LOW QUALITY PROTEIN: glucan endo-1,3-beta-glucosidase-like 
[Nicotiana sylvestris]
Length=436

 Score =   119 bits (299),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 58/125 (46%), Positives = 83/125 (66%), Gaps = 4/125 (3%)
 Frame = +3

Query  30   ILKIMEMSLRPSPIFLFFLVSAFLFIHGVRSIGVNYGTLGDNLPPPTEVARFLKEKTVID  209
            + K+  + +  S IF FF   +     G   IGVNYGT+ DNLPPPT+VA F++++T ++
Sbjct  1    MAKLCFIHILCSFIFFFFCNGSL----GGYLIGVNYGTVADNLPPPTQVAAFIRDQTTVN  56

Query  210  RIKIFDVNPDILRAFAGTGILVTVTVPNGEIIPLKDAGYAAQWVAANIKPFYPATKINII  389
            +IKI D NP+I+RAF+ TG+ VT+TVPNG+I+ +     A  WV  N+ P+YP TKI+ I
Sbjct  57   KIKIVDANPEIIRAFSNTGVWVTITVPNGDILTVSKPAGAQSWVDENVVPYYPHTKIDRI  116

Query  390  AVGQR  404
             VG  
Sbjct  117  CVGNE  121



>ref|XP_009357725.1| PREDICTED: glucan endo-1,3-beta-glucosidase-like [Pyrus x bretschneideri]
Length=397

 Score =   119 bits (298),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 60/104 (58%), Positives = 76/104 (73%), Gaps = 3/104 (3%)
 Frame = +3

Query  120  SIGVNYGTLGDNLPPPTEVARFLKEKTVIDRIKIFDVNPDILRAFAGTGILVTVTVPNGE  299
            SIGVNYGTLGDNLPPP +VA F+K +T ID +KIFD NPDI++AFA T I +T+T+PNG+
Sbjct  22   SIGVNYGTLGDNLPPPAKVADFIKTQTNIDAVKIFDTNPDIIKAFANTNISLTITIPNGD  81

Query  300  IIPLKDAGYAAQWVAANIKPFYPATKINIIAVGQRGSPLGHAGD  431
            I  L     A +WV  ++KPFYPA+KI  IA+G     + H GD
Sbjct  82   IPKLIKLRTARRWVVDHVKPFYPASKIKYIAMGNE---VLHWGD  122



>ref|XP_006846179.1| hypothetical protein AMTR_s00012p00207210 [Amborella trichopoda]
 gb|ERN07854.1| hypothetical protein AMTR_s00012p00207210 [Amborella trichopoda]
Length=481

 Score =   119 bits (299),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 64/114 (56%), Positives = 77/114 (68%), Gaps = 4/114 (4%)
 Frame = +3

Query  75   LFFLVSAFLFIHGV----RSIGVNYGTLGDNLPPPTEVARFLKEKTVIDRIKIFDVNPDI  242
            L  L+S F  I  +     SIGVNYGTL DNLPPP +VA FLK +T IDRIK+F  +P I
Sbjct  10   LTSLISYFCIILSLGLKASSIGVNYGTLADNLPPPAQVATFLKTQTYIDRIKLFGADPAI  69

Query  243  LRAFAGTGILVTVTVPNGEIIPLKDAGYAAQWVAANIKPFYPATKINIIAVGQR  404
            L+AFA TGI V ++  N EI+PL  A  AAQWVA ++ PF PATKI  I+VG  
Sbjct  70   LQAFANTGISVVISAANDEIVPLSKAPAAAQWVADHVLPFVPATKIIAISVGNE  123



>ref|XP_009139167.1| PREDICTED: glucan endo-1,3-beta-glucosidase-like [Brassica rapa]
Length=451

 Score =   119 bits (298),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 61/97 (63%), Positives = 74/97 (76%), Gaps = 1/97 (1%)
 Frame = +3

Query  114  VRSIGVNYGTLGDNLPPPTEVARFLKEKTVIDRIKIFDVNPDILRAFAGTGILVTVTVPN  293
            + +IGVNYGTLG NLPPP EVA FLK +T ID +KIF+V+P+ILRAFAG GI V VTVPN
Sbjct  26   ISAIGVNYGTLG-NLPPPNEVANFLKTQTSIDSVKIFNVDPNILRAFAGPGISVVVTVPN  84

Query  294  GEIIPLKDAGYAAQWVAANIKPFYPATKINIIAVGQR  404
            G+I  L +   A +WV+ANI PF+P TKI  I+VG  
Sbjct  85   GDIPALANGRQARRWVSANILPFHPQTKIKYISVGNE  121



>ref|XP_002532848.1| Glucan endo-1,3-beta-glucosidase precursor, putative [Ricinus 
communis]
 gb|EEF29526.1| Glucan endo-1,3-beta-glucosidase precursor, putative [Ricinus 
communis]
Length=488

 Score =   119 bits (299),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 58/95 (61%), Positives = 70/95 (74%), Gaps = 0/95 (0%)
 Frame = +3

Query  120  SIGVNYGTLGDNLPPPTEVARFLKEKTVIDRIKIFDVNPDILRAFAGTGILVTVTVPNGE  299
            ++GVNYGT+ +NLPPP++VA FLK +T I+ IKIFD NPDILRAFA TGI VTVTV NG+
Sbjct  24   TVGVNYGTVANNLPPPSQVAAFLKSQTTINSIKIFDANPDILRAFANTGISVTVTVGNGD  83

Query  300  IIPLKDAGYAAQWVAANIKPFYPATKINIIAVGQR  404
            I  L     A  W+++NI PFYP T I  IAVG  
Sbjct  84   IPSLSKLDAAKSWISSNILPFYPQTLIKYIAVGNE  118



>ref|XP_007039107.1| O-Glycosyl hydrolases family 17 protein [Theobroma cacao]
 gb|EOY23608.1| O-Glycosyl hydrolases family 17 protein [Theobroma cacao]
Length=482

 Score =   119 bits (298),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 63/119 (53%), Positives = 80/119 (67%), Gaps = 7/119 (6%)
 Frame = +3

Query  69   IFLFFLVSAFLF------IHGVR-SIGVNYGTLGDNLPPPTEVARFLKEKTVIDRIKIFD  227
            +F   LV+A LF      + GV  +IG+NYGT+ +NLPPP +VA FL E TVI+R+++FD
Sbjct  25   VFSSVLVAAILFFLASTPVRGVEGTIGINYGTVANNLPPPAQVAHFLLESTVINRVRLFD  84

Query  228  VNPDILRAFAGTGILVTVTVPNGEIIPLKDAGYAAQWVAANIKPFYPATKINIIAVGQR  404
             NPDIL+AFA TGI +TVTVPN +I  L     A QWV  NI+P+ PAT I  I VG  
Sbjct  85   ANPDILKAFAHTGIAITVTVPNDQIPRLTKLNLAQQWVEDNIQPYTPATNIVRILVGNE  143



>ref|XP_002890613.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH66872.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
Length=116

 Score =   113 bits (282),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 55/84 (65%), Positives = 65/84 (77%), Gaps = 0/84 (0%)
 Frame = +3

Query  153  NLPPPTEVARFLKEKTVIDRIKIFDVNPDILRAFAGTGILVTVTVPNGEIIPLKDAGYAA  332
            NLPPPT+VA F+K +T ID +KIFDVNPDILRAFAGTGI V VTVPNG+I  L +   A 
Sbjct  1    NLPPPTQVANFIKTQTSIDSVKIFDVNPDILRAFAGTGISVVVTVPNGDIPALTNGRQAR  60

Query  333  QWVAANIKPFYPATKINIIAVGQR  404
            +WV+ANI PF+P TKI  I+VG  
Sbjct  61   RWVSANILPFHPQTKIKYISVGNE  84



>ref|XP_008382813.1| PREDICTED: glucan endo-1,3-beta-glucosidase isoform X1 [Malus 
domestica]
Length=486

 Score =   119 bits (298),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 60/104 (58%), Positives = 76/104 (73%), Gaps = 3/104 (3%)
 Frame = +3

Query  120  SIGVNYGTLGDNLPPPTEVARFLKEKTVIDRIKIFDVNPDILRAFAGTGILVTVTVPNGE  299
            SIGVNYGTLGDNLPPP +VA F+K +T ID +KIFD NPDI++AFA T I +T+T+PNG+
Sbjct  22   SIGVNYGTLGDNLPPPAKVADFIKTQTNIDAVKIFDTNPDIIKAFANTNISLTITIPNGD  81

Query  300  IIPLKDAGYAAQWVAANIKPFYPATKINIIAVGQRGSPLGHAGD  431
            I  L     A +WV  ++KPFYPA+KI  IA+G     + H GD
Sbjct  82   IPKLIKLRIARRWVVDHVKPFYPASKIKYIAMGNE---VLHWGD  122



>emb|CDY53600.1| BnaA05g34730D [Brassica napus]
Length=450

 Score =   119 bits (297),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 60/113 (53%), Positives = 72/113 (64%), Gaps = 1/113 (1%)
 Frame = +3

Query  66   PIFLFFLVSAFLFIHGVRSIGVNYGTLGDNLPPPTEVARFLKEKTVIDRIKIFDVNPDIL  245
            P  L   V  FL      +IG+NYGT G NLPPP +V  F+K KT+ID +KI+D NPDIL
Sbjct  11   PSLLLASVMIFLLSSKTSAIGINYGTQG-NLPPPQQVVEFIKTKTIIDSVKIYDANPDIL  69

Query  246  RAFAGTGILVTVTVPNGEIIPLKDAGYAAQWVAANIKPFYPATKINIIAVGQR  404
            RA +GTGI VT+ VPNG I  L +   A QWV AN+ PF+  TKI  I VG  
Sbjct  70   RALSGTGIDVTIMVPNGNIPALANVENARQWVGANVLPFHQQTKIKYICVGNE  122



>ref|XP_008362701.1| PREDICTED: LOW QUALITY PROTEIN: glucan endo-1,3-beta-glucosidase-like 
[Malus domestica]
Length=473

 Score =   119 bits (297),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 59/104 (57%), Positives = 74/104 (71%), Gaps = 3/104 (3%)
 Frame = +3

Query  120  SIGVNYGTLGDNLPPPTEVARFLKEKTVIDRIKIFDVNPDILRAFAGTGILVTVTVPNGE  299
            SIGVNYGTL DNLPPP +VA FLK +T ID +KIFD NPDI++AFA + I +T+TVPNGE
Sbjct  22   SIGVNYGTLADNLPPPAQVANFLKTQTNIDAVKIFDANPDIIKAFANSNISLTITVPNGE  81

Query  300  IIPLKDAGYAAQWVAANIKPFYPATKINIIAVGQRGSPLGHAGD  431
            I  L     A +W+  ++KPFYPA+KI  I +G     + H GD
Sbjct  82   IPSLTKLRTARRWIIDHVKPFYPASKIKYIGMGNE---VLHWGD  122



>ref|XP_007157802.1| hypothetical protein PHAVU_002G099500g [Phaseolus vulgaris]
 gb|ESW29796.1| hypothetical protein PHAVU_002G099500g [Phaseolus vulgaris]
Length=507

 Score =   119 bits (297),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 57/102 (56%), Positives = 69/102 (68%), Gaps = 0/102 (0%)
 Frame = +3

Query  99   LFIHGVRSIGVNYGTLGDNLPPPTEVARFLKEKTVIDRIKIFDVNPDILRAFAGTGILVT  278
            L+      IGVNYGT+ DNLPPP+ VA F+K +T IDR+K+FD NPD+LRAFAGTGI +T
Sbjct  24   LYASYTTKIGVNYGTVADNLPPPSTVAAFIKSQTTIDRVKLFDANPDMLRAFAGTGISIT  83

Query  279  VTVPNGEIIPLKDAGYAAQWVAANIKPFYPATKINIIAVGQR  404
            VTVPN  I  L     A  W++ NI PF P T +  IAVG  
Sbjct  84   VTVPNAAIPSLSTLPAAQAWLSENILPFLPQTAVTRIAVGNE  125



>ref|XP_011025078.1| PREDICTED: glucan endo-1,3-beta-glucosidase-like [Populus euphratica]
Length=491

 Score =   119 bits (297),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 57/110 (52%), Positives = 77/110 (70%), Gaps = 0/110 (0%)
 Frame = +3

Query  75   LFFLVSAFLFIHGVRSIGVNYGTLGDNLPPPTEVARFLKEKTVIDRIKIFDVNPDILRAF  254
            +  L SAF  +    SIGVNYGT+ DNLPPP +VA FL E T+I+R+++FD N +I++AF
Sbjct  47   ILLLASAFNILGVEGSIGVNYGTVADNLPPPAQVAHFLLESTIINRVRLFDTNTEIIQAF  106

Query  255  AGTGILVTVTVPNGEIIPLKDAGYAAQWVAANIKPFYPATKINIIAVGQR  404
            A TGI +TVTVPN +I  L   G+A +WV +N++P+ PAT I  I VG  
Sbjct  107  AHTGIAITVTVPNDQIPHLTKLGFAQEWVRSNVQPYVPATNIVRILVGNE  156



>ref|XP_009143300.1| PREDICTED: glucan endo-1,3-beta-glucosidase [Brassica rapa]
Length=448

 Score =   118 bits (296),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 60/113 (53%), Positives = 72/113 (64%), Gaps = 1/113 (1%)
 Frame = +3

Query  66   PIFLFFLVSAFLFIHGVRSIGVNYGTLGDNLPPPTEVARFLKEKTVIDRIKIFDVNPDIL  245
            P  L   V  FL      +IG+NYGT G NLPPP +V  F+K KT+ID +KI+D NPDIL
Sbjct  11   PSLLLASVVIFLLSSKTSAIGINYGTQG-NLPPPQQVVEFIKTKTIIDSVKIYDANPDIL  69

Query  246  RAFAGTGILVTVTVPNGEIIPLKDAGYAAQWVAANIKPFYPATKINIIAVGQR  404
            RA +GTGI VT+ VPNG I  L +   A QWV AN+ PF+  TKI  I VG  
Sbjct  70   RALSGTGIDVTIMVPNGNIPALANVENARQWVGANVLPFHQQTKIKYICVGNE  122



>ref|XP_010264453.1| PREDICTED: glucan endo-1,3-beta-glucosidase [Nelumbo nucifera]
Length=454

 Score =   118 bits (295),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 57/95 (60%), Positives = 71/95 (75%), Gaps = 0/95 (0%)
 Frame = +3

Query  120  SIGVNYGTLGDNLPPPTEVARFLKEKTVIDRIKIFDVNPDILRAFAGTGILVTVTVPNGE  299
            SIGVNYGTL ++LP P++VA FLK+ T ID++KIFD NPD+L+AFA TGI +TV+V NG+
Sbjct  33   SIGVNYGTLANDLPLPSQVAAFLKQSTTIDKVKIFDTNPDVLQAFANTGIAITVSVGNGD  92

Query  300  IIPLKDAGYAAQWVAANIKPFYPATKINIIAVGQR  404
            I  L     A  WVA +I PF+P TKIN IAVG  
Sbjct  93   IPALSKLPAAQDWVATHISPFHPQTKINRIAVGNE  127



>gb|KJB19861.1| hypothetical protein B456_003G121900 [Gossypium raimondii]
Length=367

 Score =   117 bits (294),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 63/125 (50%), Positives = 79/125 (63%), Gaps = 6/125 (5%)
 Frame = +3

Query  48   MSLRPSPIFL-----FFLVSAFLFIHGVR-SIGVNYGTLGDNLPPPTEVARFLKEKTVID  209
            M   PS  +L     FFL S FL   GV  +IGVNYGT+  NLPPP +VA FL E T+I 
Sbjct  1    MHHSPSTSYLVMLISFFLASKFLLFPGVEGTIGVNYGTVASNLPPPAQVAHFLVESTIIS  60

Query  210  RIKIFDVNPDILRAFAGTGILVTVTVPNGEIIPLKDAGYAAQWVAANIKPFYPATKINII  389
            R+++FD + +IL+AFA TGI ++VTVPN EI  L    +A QWV  NI+P+ P T I  I
Sbjct  61   RVRLFDADSNILKAFAHTGIAISVTVPNDEIPRLTKLNFAQQWVENNIQPYTPNTNIVRI  120

Query  390  AVGQR  404
             VG  
Sbjct  121  LVGNE  125



>emb|CDY20461.1| BnaC04g05830D [Brassica napus]
Length=450

 Score =   118 bits (295),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 60/113 (53%), Positives = 72/113 (64%), Gaps = 1/113 (1%)
 Frame = +3

Query  66   PIFLFFLVSAFLFIHGVRSIGVNYGTLGDNLPPPTEVARFLKEKTVIDRIKIFDVNPDIL  245
            P  L   V  FL      +IG+NYGT G NLPPP +V  F+K KT+ID +KI+D NPDIL
Sbjct  11   PSLLLASVVIFLLSSKTSAIGINYGTQG-NLPPPQQVVDFIKTKTIIDSVKIYDANPDIL  69

Query  246  RAFAGTGILVTVTVPNGEIIPLKDAGYAAQWVAANIKPFYPATKINIIAVGQR  404
            RA +GTGI VT+ VPNG I  L +   A QWV AN+ PF+  TKI  I VG  
Sbjct  70   RALSGTGIDVTIMVPNGNIPALANVENARQWVGANVLPFHQQTKIKYICVGNE  122



>ref|XP_009384878.1| PREDICTED: glucan endo-1,3-beta-glucosidase-like [Musa acuminata 
subsp. malaccensis]
Length=453

 Score =   118 bits (295),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 57/100 (57%), Positives = 73/100 (73%), Gaps = 6/100 (6%)
 Frame = +3

Query  123  IGVNYGTLGDNLPPPTEVARFLKEKTVIDRIKIFDVNPDILRAFAGTGILVTVTVPNGEI  302
            +GVNYG   DNLPPP +VA FLK++T +DR+K+FD NPDI+RAFAGTGI + +TVPNG+I
Sbjct  29   VGVNYGAFADNLPPPAQVAAFLKDRTFVDRVKLFDANPDIIRAFAGTGISLMITVPNGDI  88

Query  303  IPL------KDAGYAAQWVAANIKPFYPATKINIIAVGQR  404
              L        +  A+ WVA N+ PFYPAT I++IAVG  
Sbjct  89   PSLASRRSSAPSPAASAWVAINVAPFYPATNISLIAVGNE  128



>ref|XP_007009341.1| O-Glycosyl hydrolases family 17 protein, putative [Theobroma 
cacao]
 gb|EOY18151.1| O-Glycosyl hydrolases family 17 protein, putative [Theobroma 
cacao]
Length=440

 Score =   117 bits (292),  Expect(2) = 5e-28, Method: Compositional matrix adjust.
 Identities = 58/109 (53%), Positives = 74/109 (68%), Gaps = 1/109 (1%)
 Frame = +3

Query  81   FLVSAFL-FIHGVRSIGVNYGTLGDNLPPPTEVARFLKEKTVIDRIKIFDVNPDILRAFA  257
             L++ FL  +    ++GVNYG + DNLP P EVA F+K KT+ D +KIFD NPD+LRAFA
Sbjct  4    LLLATFLHLVTSATALGVNYGMIADNLPSPYEVANFIKTKTIFDSVKIFDTNPDVLRAFA  63

Query  258  GTGILVTVTVPNGEIIPLKDAGYAAQWVAANIKPFYPATKINIIAVGQR  404
             T I VTVTV NG+I  L +   A +WV  +I+PFYP TKI  I+VG  
Sbjct  64   NTDISVTVTVANGQIPSLTNVRAARRWVNNHIRPFYPQTKIKYISVGNE  112


 Score = 33.9 bits (76),  Expect(2) = 5e-28, Method: Compositional matrix adjust.
 Identities = 16/33 (48%), Positives = 23/33 (70%), Gaps = 0/33 (0%)
 Frame = +1

Query  397  GNEVLHWGTPEMQNGLVAAMRSLYNALVKSGIK  495
            GNE+L +   +  N LV AM+SL+ AL K+GI+
Sbjct  110  GNEILLFNVQDQINNLVPAMKSLHLALAKAGIR  142



>ref|XP_009419749.1| PREDICTED: glucan endo-1,3-beta-glucosidase-like [Musa acuminata 
subsp. malaccensis]
Length=462

 Score =   117 bits (294),  Expect = 5e-28, Method: Compositional matrix adjust.
 Identities = 56/100 (56%), Positives = 75/100 (75%), Gaps = 5/100 (5%)
 Frame = +3

Query  120  SIGVNYGTLGDNLPPPTEVARFLKEKTVIDRIKIFDVNPDILRAFAGTGILVTVTVPNGE  299
            SIGVNYG   +NLPPP +VA FLK++T IDR+K+FD NPD++RAFAGTGI + +TVPNG+
Sbjct  40   SIGVNYGAYANNLPPPAQVAAFLKDRTFIDRVKLFDANPDMIRAFAGTGISLMITVPNGD  99

Query  300  IIPL-----KDAGYAAQWVAANIKPFYPATKINIIAVGQR  404
            I  L       +  A+ WVA+++ PFYPAT I+++AVG  
Sbjct  100  IASLASRSSAPSPAASAWVASHVAPFYPATNISLVAVGNE  139



>ref|XP_002459582.1| hypothetical protein SORBIDRAFT_02g007050 [Sorghum bicolor]
 gb|EER96103.1| hypothetical protein SORBIDRAFT_02g007050 [Sorghum bicolor]
Length=545

 Score =   118 bits (295),  Expect = 6e-28, Method: Compositional matrix adjust.
 Identities = 55/95 (58%), Positives = 69/95 (73%), Gaps = 0/95 (0%)
 Frame = +3

Query  120  SIGVNYGTLGDNLPPPTEVARFLKEKTVIDRIKIFDVNPDILRAFAGTGILVTVTVPNGE  299
            +IGVNYGT GDNLPPP  VA FL  +T IDR+K+FD NPD++RAFAGTGI + VT  NG+
Sbjct  33   AIGVNYGTKGDNLPPPATVASFLANRTRIDRVKLFDTNPDMVRAFAGTGIALMVTAGNGD  92

Query  300  IIPLKDAGYAAQWVAANIKPFYPATKINIIAVGQR  404
            I  L     AA WV+AN+ P+YP T I+++ VG  
Sbjct  93   IPKLATKDGAAAWVSANVAPYYPKTDISLVLVGNE  127



>ref|XP_004241225.1| PREDICTED: glucan endo-1,3-beta-glucosidase-like [Solanum lycopersicum]
Length=449

 Score =   117 bits (293),  Expect = 6e-28, Method: Compositional matrix adjust.
 Identities = 57/118 (48%), Positives = 78/118 (66%), Gaps = 6/118 (5%)
 Frame = +3

Query  69   IFLFFLVSAFLF------IHGVRSIGVNYGTLGDNLPPPTEVARFLKEKTVIDRIKIFDV  230
             F   + S+F+F      + G   +G+NYGT+ DNLPPPT+VA F+++ T +++IKIFD 
Sbjct  5    CFFLPIFSSFVFLLLCNGVSGDYLLGINYGTVADNLPPPTQVAAFIRDHTTLNKIKIFDA  64

Query  231  NPDILRAFAGTGILVTVTVPNGEIIPLKDAGYAAQWVAANIKPFYPATKINIIAVGQR  404
            NP+I+RAFA TGI VTVTV NG+I  +     A  WV  N+ PFYP T+I+ I VG  
Sbjct  65   NPEIIRAFADTGIWVTVTVSNGDIWSVSKPTAAQWWVEQNVVPFYPRTRIDRICVGNE  122



>dbj|BAK07810.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=487

 Score =   117 bits (293),  Expect = 7e-28, Method: Compositional matrix adjust.
 Identities = 61/112 (54%), Positives = 74/112 (66%), Gaps = 5/112 (4%)
 Frame = +3

Query  69   IFLFFLVSAFLFIHGVRSIGVNYGTLGDNLPPPTEVARFLKEKTVIDRIKIFDVNPDILR  248
            I +F  V+ F        IGVNYGT GDNLP P +VA FL  +T IDR+K+FD NPD++R
Sbjct  18   ICIFLAVAPF-----STPIGVNYGTKGDNLPSPAKVAAFLVTRTNIDRVKLFDTNPDVVR  72

Query  249  AFAGTGILVTVTVPNGEIIPLKDAGYAAQWVAANIKPFYPATKINIIAVGQR  404
            AFAGTGI V VT  NG+I  L     A  WVA NI P+YPAT I+++AVG  
Sbjct  73   AFAGTGISVMVTAGNGDIPGLATQNGADAWVATNIAPYYPATDISLVAVGNE  124



>emb|CDP21469.1| unnamed protein product [Coffea canephora]
Length=458

 Score =   117 bits (292),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 59/126 (47%), Positives = 83/126 (66%), Gaps = 8/126 (6%)
 Frame = +3

Query  51   SLRPSPIFLF---FLVSAFLFIH-----GVRSIGVNYGTLGDNLPPPTEVARFLKEKTVI  206
            S  P+  FLF   F++    F+H        +IGVNYGT+ DNLPPP +VA F+K++T I
Sbjct  5    SSSPAKPFLFSISFVIFLHHFLHHWAVAAGYAIGVNYGTVADNLPPPAQVASFIKDQTSI  64

Query  207  DRIKIFDVNPDILRAFAGTGILVTVTVPNGEIIPLKDAGYAAQWVAANIKPFYPATKINI  386
            D+IKIFD NPDI+RAFA + + +T+TV NG+++ +     A  WV+ N+ P+YP TKI+ 
Sbjct  65   DKIKIFDANPDIIRAFANSNVSLTITVGNGDVLAVSKLPAAQSWVSTNVLPYYPQTKIHR  124

Query  387  IAVGQR  404
            I VG  
Sbjct  125  IDVGNE  130



>ref|XP_007137073.1| hypothetical protein PHAVU_009G097400g [Phaseolus vulgaris]
 gb|ESW09067.1| hypothetical protein PHAVU_009G097400g [Phaseolus vulgaris]
Length=380

 Score =   116 bits (291),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 53/99 (54%), Positives = 70/99 (71%), Gaps = 0/99 (0%)
 Frame = +3

Query  108  HGVRSIGVNYGTLGDNLPPPTEVARFLKEKTVIDRIKIFDVNPDILRAFAGTGILVTVTV  287
                 IGVNYGT+  NLPPP++VA+FL + T I+R++IFD NP+IL AFA TGI VT+TV
Sbjct  27   EATAKIGVNYGTVASNLPPPSKVAKFLSKSTTINRVRIFDANPEILHAFANTGIEVTITV  86

Query  288  PNGEIIPLKDAGYAAQWVAANIKPFYPATKINIIAVGQR  404
            PN +I  + +  +A QWV  N++PF PATK+  I VG  
Sbjct  87   PNDQIPQITNLTFAQQWVKTNVQPFLPATKLIRILVGNE  125



>emb|CBI16129.3| unnamed protein product [Vitis vinifera]
Length=360

 Score =   116 bits (290),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 59/97 (61%), Positives = 68/97 (70%), Gaps = 0/97 (0%)
 Frame = +3

Query  114  VRSIGVNYGTLGDNLPPPTEVARFLKEKTVIDRIKIFDVNPDILRAFAGTGILVTVTVPN  293
            V SIGVNYGT+ DNL  P+EVA F+K+KT+ DR+KIFD NPDI+ AFA TGI +TVTV N
Sbjct  21   VYSIGVNYGTVADNLASPSEVAAFIKDKTIFDRVKIFDTNPDIINAFANTGIGLTVTVVN  80

Query  294  GEIIPLKDAGYAAQWVAANIKPFYPATKINIIAVGQR  404
             +I  L     A  WVA NI PFY  TKIN I VG  
Sbjct  81   LDIPKLVHPNEATNWVATNIVPFYQKTKINYICVGNE  117



>ref|XP_004498531.1| PREDICTED: glucan endo-1,3-beta-glucosidase-like, partial [Cicer 
arietinum]
Length=360

 Score =   116 bits (290),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 54/108 (50%), Positives = 76/108 (70%), Gaps = 3/108 (3%)
 Frame = +3

Query  81   FLVSAFLFIHGVRSIGVNYGTLGDNLPPPTEVARFLKEKTVIDRIKIFDVNPDILRAFAG  260
            FL+ +F  + G   IGVNYGTLG+NLPPP++VA+FL   T I++++IFD NP+IL AFA 
Sbjct  3    FLLKSFAEVQG---IGVNYGTLGNNLPPPSQVAKFLLHSTTINQVRIFDANPEILHAFAN  59

Query  261  TGILVTVTVPNGEIIPLKDAGYAAQWVAANIKPFYPATKINIIAVGQR  404
            TGI +T+T+PN +I  + +   A QW+  N++PF P+T I  I VG  
Sbjct  60   TGIEITITIPNDQIPNITNLTLAQQWIKTNVQPFIPSTNIIRILVGNE  107



>ref|XP_002281025.1| PREDICTED: glucan endo-1,3-beta-glucosidase-like [Vitis vinifera]
Length=444

 Score =   116 bits (290),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 59/97 (61%), Positives = 68/97 (70%), Gaps = 0/97 (0%)
 Frame = +3

Query  114  VRSIGVNYGTLGDNLPPPTEVARFLKEKTVIDRIKIFDVNPDILRAFAGTGILVTVTVPN  293
            V SIGVNYGT+ DNL  P+EVA F+K+KT+ DR+KIFD NPDI+ AFA TGI +TVTV N
Sbjct  21   VYSIGVNYGTVADNLASPSEVAAFIKDKTIFDRVKIFDTNPDIINAFANTGIGLTVTVVN  80

Query  294  GEIIPLKDAGYAAQWVAANIKPFYPATKINIIAVGQR  404
             +I  L     A  WVA NI PFY  TKIN I VG  
Sbjct  81   LDIPKLVHPNEATNWVATNIVPFYQKTKINYICVGNE  117



>emb|CAN72975.1| hypothetical protein VITISV_019488 [Vitis vinifera]
Length=443

 Score =   115 bits (289),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 59/98 (60%), Positives = 68/98 (69%), Gaps = 0/98 (0%)
 Frame = +3

Query  111  GVRSIGVNYGTLGDNLPPPTEVARFLKEKTVIDRIKIFDVNPDILRAFAGTGILVTVTVP  290
             V SIGVNYGT+ DNL  P+EVA F+K+KT+ DR+KIFD NPDI+ AFA TGI +TVTV 
Sbjct  20   AVYSIGVNYGTVADNLASPSEVAAFIKDKTIFDRVKIFDTNPDIINAFANTGIGLTVTVV  79

Query  291  NGEIIPLKDAGYAAQWVAANIKPFYPATKINIIAVGQR  404
            N +I  L     A  WVA NI PFY  TKIN I VG  
Sbjct  80   NLDIPKLVHPNEATNWVATNIVPFYQKTKINYICVGNE  117



>gb|KHN16491.1| Glucan endo-1,3-beta-glucosidase [Glycine soja]
Length=360

 Score =   115 bits (287),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 54/99 (55%), Positives = 71/99 (72%), Gaps = 1/99 (1%)
 Frame = +3

Query  108  HGVRSIGVNYGTLGDNLPPPTEVARFLKEKTVIDRIKIFDVNPDILRAFAGTGILVTVTV  287
            HG+  IGVNYGT+ +NLPPP  VA+FL + T I ++++FD NP+ILRAF  TGI VT+TV
Sbjct  28   HGI-GIGVNYGTVANNLPPPAMVAKFLSKSTTIKKVRLFDANPEILRAFGNTGIEVTITV  86

Query  288  PNGEIIPLKDAGYAAQWVAANIKPFYPATKINIIAVGQR  404
            PN +I  + +  YA QWV  N++PF PATK+  I VG  
Sbjct  87   PNDQIPDITNLTYAQQWVKTNVQPFIPATKLIRILVGNE  125



>ref|XP_007220925.1| hypothetical protein PRUPE_ppa023079mg [Prunus persica]
 gb|EMJ22124.1| hypothetical protein PRUPE_ppa023079mg [Prunus persica]
Length=470

 Score =   115 bits (288),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 57/110 (52%), Positives = 76/110 (69%), Gaps = 0/110 (0%)
 Frame = +3

Query  75   LFFLVSAFLFIHGVRSIGVNYGTLGDNLPPPTEVARFLKEKTVIDRIKIFDVNPDILRAF  254
            L  LVS F+      SIGVNYGT+ ++LPPPT VA FL E T+I+R+++FD NPDIL+AF
Sbjct  16   LLLLVSIFIQGGVQGSIGVNYGTVANDLPPPTHVAHFLLESTIINRVRLFDANPDILQAF  75

Query  255  AGTGILVTVTVPNGEIIPLKDAGYAAQWVAANIKPFYPATKINIIAVGQR  404
            A TGI VT+TVPN +I  L    +A QW+ +N++P+  AT I  I +G  
Sbjct  76   AHTGIAVTITVPNDQIPHLTKLSFAQQWLKSNVQPYVQATNIVRILIGNE  125



>gb|KHG05533.1| Glucan endo-1,3-beta-glucosidase [Gossypium arboreum]
Length=443

 Score =   115 bits (287),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 58/111 (52%), Positives = 73/111 (66%), Gaps = 1/111 (1%)
 Frame = +3

Query  75   LFFLVSAFL-FIHGVRSIGVNYGTLGDNLPPPTEVARFLKEKTVIDRIKIFDVNPDILRA  251
            +F L+   L       SIGVNYG   DNLPPP+ VA FL+ +T+ D +K+FD NPD+LRA
Sbjct  4    VFILIGVLLQLFTATTSIGVNYGMTADNLPPPSVVANFLRTQTIFDSVKLFDANPDVLRA  63

Query  252  FAGTGILVTVTVPNGEIIPLKDAGYAAQWVAANIKPFYPATKINIIAVGQR  404
            FA TGI V+VTV NG+I  L +   A +WVA +I PF+P TKI  I VG  
Sbjct  64   FANTGISVSVTVGNGDIPGLTNTVTARRWVADHISPFHPQTKIKYICVGTE  114



>ref|XP_008234701.1| PREDICTED: glucan endo-1,3-beta-glucosidase [Prunus mume]
Length=468

 Score =   115 bits (288),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 57/110 (52%), Positives = 76/110 (69%), Gaps = 0/110 (0%)
 Frame = +3

Query  75   LFFLVSAFLFIHGVRSIGVNYGTLGDNLPPPTEVARFLKEKTVIDRIKIFDVNPDILRAF  254
            L  LVS F+      SIGVNYGT+ ++LPPPT VA FL E T+I+R+++FD NPDIL+AF
Sbjct  16   LLLLVSIFIQGGVQGSIGVNYGTVANDLPPPTHVAHFLLESTIINRVRLFDANPDILQAF  75

Query  255  AGTGILVTVTVPNGEIIPLKDAGYAAQWVAANIKPFYPATKINIIAVGQR  404
            A TGI VT+TVPN +I  L    +A QW+ +N++P+  AT I  I +G  
Sbjct  76   AHTGIAVTITVPNDQIPHLTKLSFAQQWLKSNVQPYVQATNIVRILIGNE  125



>ref|XP_009343476.1| PREDICTED: glucan endo-1,3-beta-glucosidase [Pyrus x bretschneideri]
Length=479

 Score =   115 bits (288),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 58/104 (56%), Positives = 72/104 (69%), Gaps = 3/104 (3%)
 Frame = +3

Query  120  SIGVNYGTLGDNLPPPTEVARFLKEKTVIDRIKIFDVNPDILRAFAGTGILVTVTVPNGE  299
            SIGVNYGTL DNLPPP +VA FLK +T ID +KIFD NPDI++AFA + I +T+TVPN E
Sbjct  28   SIGVNYGTLADNLPPPAQVANFLKTQTNIDAVKIFDANPDIIKAFANSNISLTITVPNSE  87

Query  300  IIPLKDAGYAAQWVAANIKPFYPATKINIIAVGQRGSPLGHAGD  431
            I  L     A  W+  ++KPFYPA+KI  I +G     + H GD
Sbjct  88   IPSLTKLRTARLWIIDHVKPFYPASKIKYIGMGNE---VLHWGD  128



>ref|XP_007013797.1| O-Glycosyl hydrolases family 17 protein, putative isoform 1 [Theobroma 
cacao]
 gb|EOY31416.1| O-Glycosyl hydrolases family 17 protein, putative isoform 1 [Theobroma 
cacao]
Length=483

 Score =   113 bits (283),  Expect(2) = 5e-27, Method: Compositional matrix adjust.
 Identities = 56/111 (50%), Positives = 74/111 (67%), Gaps = 1/111 (1%)
 Frame = +3

Query  75   LFFLVSAFLFIHGVRS-IGVNYGTLGDNLPPPTEVARFLKEKTVIDRIKIFDVNPDILRA  251
            +F L++ FL +    + +GVNYG   DNLP P+ VA F+K +T+ D +K+FD NP++LRA
Sbjct  41   IFLLLAIFLHLFTTTTALGVNYGMAADNLPSPSVVANFIKTQTIFDSVKMFDANPEVLRA  100

Query  252  FAGTGILVTVTVPNGEIIPLKDAGYAAQWVAANIKPFYPATKINIIAVGQR  404
            FA TGI VTVTV NG+I  L +   A +WVA +I PFYP TKI  I  G  
Sbjct  101  FANTGISVTVTVGNGDIPALTNTVVARRWVAQHISPFYPQTKIKYICAGSE  151


 Score = 34.3 bits (77),  Expect(2) = 5e-27, Method: Compositional matrix adjust.
 Identities = 18/33 (55%), Positives = 23/33 (70%), Gaps = 0/33 (0%)
 Frame = +1

Query  397  GNEVLHWGTPEMQNGLVAAMRSLYNALVKSGIK  495
            G+EVL     +  N LV AMRSL+ ALVK+GI+
Sbjct  149  GSEVLFSNITDWINNLVPAMRSLHYALVKAGIQ  181



>ref|XP_007013798.1| O-Glycosyl hydrolases family 17 protein, putative isoform 2, 
partial [Theobroma cacao]
 gb|EOY31417.1| O-Glycosyl hydrolases family 17 protein, putative isoform 2, 
partial [Theobroma cacao]
Length=459

 Score =   113 bits (283),  Expect(2) = 5e-27, Method: Compositional matrix adjust.
 Identities = 56/111 (50%), Positives = 74/111 (67%), Gaps = 1/111 (1%)
 Frame = +3

Query  75   LFFLVSAFLFIHGVRS-IGVNYGTLGDNLPPPTEVARFLKEKTVIDRIKIFDVNPDILRA  251
            +F L++ FL +    + +GVNYG   DNLP P+ VA F+K +T+ D +K+FD NP++LRA
Sbjct  41   IFLLLAIFLHLFTTTTALGVNYGMAADNLPSPSVVANFIKTQTIFDSVKMFDANPEVLRA  100

Query  252  FAGTGILVTVTVPNGEIIPLKDAGYAAQWVAANIKPFYPATKINIIAVGQR  404
            FA TGI VTVTV NG+I  L +   A +WVA +I PFYP TKI  I  G  
Sbjct  101  FANTGISVTVTVGNGDIPALTNTVVARRWVAQHISPFYPQTKIKYICAGSE  151


 Score = 33.9 bits (76),  Expect(2) = 5e-27, Method: Compositional matrix adjust.
 Identities = 18/33 (55%), Positives = 23/33 (70%), Gaps = 0/33 (0%)
 Frame = +1

Query  397  GNEVLHWGTPEMQNGLVAAMRSLYNALVKSGIK  495
            G+EVL     +  N LV AMRSL+ ALVK+GI+
Sbjct  149  GSEVLFSNITDWINNLVPAMRSLHYALVKAGIQ  181



>gb|KJB23726.1| hypothetical protein B456_004G111800 [Gossypium raimondii]
Length=380

 Score =   114 bits (284),  Expect = 8e-27, Method: Compositional matrix adjust.
 Identities = 61/123 (50%), Positives = 79/123 (64%), Gaps = 3/123 (2%)
 Frame = +3

Query  39   IMEMSLRPSPIFLFFLVSAFLFIHGVR-SIGVNYGTLGDNLPPPTEVARFLKEKTVIDRI  215
            I  +S R   +  FFL  A   + G   +IGVNYGT+ +NLPPP +VA FL E TVI+R+
Sbjct  6    ISMLSSRLVAVISFFL--ALTLVKGFEGTIGVNYGTVANNLPPPAQVAHFLLESTVINRV  63

Query  216  KIFDVNPDILRAFAGTGILVTVTVPNGEIIPLKDAGYAAQWVAANIKPFYPATKINIIAV  395
            ++FD NP+ILRAFA TG+ VT++VPN +I  L    +A QWV   I+P  PAT I  I V
Sbjct  64   RLFDANPEILRAFAHTGVAVTISVPNDQIPDLTKLNFAQQWVEDYIQPHTPATNIVRILV  123

Query  396  GQR  404
            G  
Sbjct  124  GNE  126



>ref|XP_008376760.1| PREDICTED: glucan endo-1,3-beta-glucosidase [Malus domestica]
Length=465

 Score =   114 bits (285),  Expect = 9e-27, Method: Compositional matrix adjust.
 Identities = 59/112 (53%), Positives = 74/112 (66%), Gaps = 1/112 (1%)
 Frame = +3

Query  69   IFLFFLVSAFLFIHGVRSIGVNYGTLGDNLPPPTEVARFLKEKTVIDRIKIFDVNPDILR  248
              L  LVS F+   G  SIGVNYGT+  +LPPP +VA FL E T+I+R+++FD NPDILR
Sbjct  14   CILLLLVSIFV-QGGEGSIGVNYGTMASDLPPPAKVAHFLLESTIINRVRLFDTNPDILR  72

Query  249  AFAGTGILVTVTVPNGEIIPLKDAGYAAQWVAANIKPFYPATKINIIAVGQR  404
            AFA TGI VT+T+PN +I  L     A QW+  N++P  PAT I  I VG  
Sbjct  73   AFAHTGIAVTITIPNDQIPHLTKIRSAQQWLKTNVQPHIPATNIVRILVGNE  124



>ref|XP_010109237.1| Glucan endo-1,3-beta-glucosidase [Morus notabilis]
 gb|EXC21417.1| Glucan endo-1,3-beta-glucosidase [Morus notabilis]
Length=478

 Score =   114 bits (285),  Expect = 9e-27, Method: Compositional matrix adjust.
 Identities = 59/110 (54%), Positives = 73/110 (66%), Gaps = 0/110 (0%)
 Frame = +3

Query  75   LFFLVSAFLFIHGVRSIGVNYGTLGDNLPPPTEVARFLKEKTVIDRIKIFDVNPDILRAF  254
            L  LV +     G  +IGVNYGT+ DNLPPP+EVA FL E T I+R+++FD +PDILRAF
Sbjct  20   LSLLVISTFLQGGHGAIGVNYGTVADNLPPPSEVAHFLVESTTINRVRLFDADPDILRAF  79

Query  255  AGTGILVTVTVPNGEIIPLKDAGYAAQWVAANIKPFYPATKINIIAVGQR  404
            A TGI VTVTVPN +I  L     A +W+  N++P  PAT I  I VG  
Sbjct  80   AHTGITVTVTVPNDQIPRLTKLPAAHEWLKTNVQPHVPATNIVRILVGNE  129



>ref|XP_011044676.1| PREDICTED: glucan endo-1,3-beta-glucosidase isoform X1 [Populus 
euphratica]
 ref|XP_011044677.1| PREDICTED: glucan endo-1,3-beta-glucosidase isoform X1 [Populus 
euphratica]
 ref|XP_011044678.1| PREDICTED: glucan endo-1,3-beta-glucosidase isoform X1 [Populus 
euphratica]
Length=398

 Score =   114 bits (284),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 56/109 (51%), Positives = 77/109 (71%), Gaps = 1/109 (1%)
 Frame = +3

Query  81   FLVSAFLFIHGVR-SIGVNYGTLGDNLPPPTEVARFLKEKTVIDRIKIFDVNPDILRAFA  257
             L+++ L+I GV  SIGVNYGTL +NLPPP +VA FL E T+I+R+++FD + +ILRAFA
Sbjct  31   LLLASTLYIQGVEGSIGVNYGTLANNLPPPAQVAHFLLESTIINRVRLFDASTEILRAFA  90

Query  258  GTGILVTVTVPNGEIIPLKDAGYAAQWVAANIKPFYPATKINIIAVGQR  404
             TGI VTVTV N +I  L + G+A +W+ +N++P    T I  I VG  
Sbjct  91   HTGIEVTVTVTNDQIPHLTNIGFAQEWLKSNVQPHVRTTNIVRILVGNE  139



>ref|XP_006435532.1| hypothetical protein CICLE_v10033472mg [Citrus clementina]
 gb|ESR48772.1| hypothetical protein CICLE_v10033472mg [Citrus clementina]
Length=449

 Score =   114 bits (284),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 59/97 (61%), Positives = 68/97 (70%), Gaps = 0/97 (0%)
 Frame = +3

Query  114  VRSIGVNYGTLGDNLPPPTEVARFLKEKTVIDRIKIFDVNPDILRAFAGTGILVTVTVPN  293
              +IGVNYGT+ +NLP P EVA FLK KT ID IK+FD NP+ILRAFA T I VTV+V N
Sbjct  26   TSAIGVNYGTIANNLPKPAEVANFLKTKTTIDAIKLFDANPEILRAFANTNISVTVSVGN  85

Query  294  GEIIPLKDAGYAAQWVAANIKPFYPATKINIIAVGQR  404
            G+I  L     A  WVAANI PFYP+TKI  + VG  
Sbjct  86   GDIPALVQLPAAKNWVAANIVPFYPSTKIIRVVVGNE  122



>ref|XP_006486487.1| PREDICTED: glucan endo-1,3-beta-glucosidase-like [Citrus sinensis]
Length=449

 Score =   114 bits (284),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 59/97 (61%), Positives = 68/97 (70%), Gaps = 0/97 (0%)
 Frame = +3

Query  114  VRSIGVNYGTLGDNLPPPTEVARFLKEKTVIDRIKIFDVNPDILRAFAGTGILVTVTVPN  293
              +IGVNYGT+ +NLP P EVA FLK KT ID IK+FD NP+ILRAFA T I VTV+V N
Sbjct  26   TSAIGVNYGTIANNLPKPAEVANFLKTKTTIDAIKLFDANPEILRAFANTNISVTVSVGN  85

Query  294  GEIIPLKDAGYAAQWVAANIKPFYPATKINIIAVGQR  404
            G+I  L     A  WVAANI PFYP+TKI  + VG  
Sbjct  86   GDIPALVQLPAAKNWVAANIVPFYPSTKIIRVVVGNE  122



>ref|XP_010318035.1| PREDICTED: glucan endo-1,3-beta-glucosidase [Solanum lycopersicum]
Length=378

 Score =   113 bits (283),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 57/103 (55%), Positives = 71/103 (69%), Gaps = 1/103 (1%)
 Frame = +3

Query  99   LFIHGVR-SIGVNYGTLGDNLPPPTEVARFLKEKTVIDRIKIFDVNPDILRAFAGTGILV  275
            +F+ GV  +IGVNYGT+ DNLPPP +VA FL+E T I R+++FD NP+IL+AFA TGI V
Sbjct  23   IFLQGVEGTIGVNYGTVADNLPPPVQVASFLRESTFIRRVRLFDANPEILKAFANTGISV  82

Query  276  TVTVPNGEIIPLKDAGYAAQWVAANIKPFYPATKINIIAVGQR  404
            TV VPN  I  L    +A QWV  N+ P+ PAT I  I VG  
Sbjct  83   TVNVPNDLIPQLTMLSFAQQWVEINVLPYVPATNIVRILVGNE  125



>ref|XP_011044679.1| PREDICTED: glucan endo-1,3-beta-glucosidase isoform X2 [Populus 
euphratica]
Length=393

 Score =   113 bits (283),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 56/109 (51%), Positives = 77/109 (71%), Gaps = 1/109 (1%)
 Frame = +3

Query  81   FLVSAFLFIHGVR-SIGVNYGTLGDNLPPPTEVARFLKEKTVIDRIKIFDVNPDILRAFA  257
             L+++ L+I GV  SIGVNYGTL +NLPPP +VA FL E T+I+R+++FD + +ILRAFA
Sbjct  31   LLLASTLYIQGVEGSIGVNYGTLANNLPPPAQVAHFLLESTIINRVRLFDASTEILRAFA  90

Query  258  GTGILVTVTVPNGEIIPLKDAGYAAQWVAANIKPFYPATKINIIAVGQR  404
             TGI VTVTV N +I  L + G+A +W+ +N++P    T I  I VG  
Sbjct  91   HTGIEVTVTVTNDQIPHLTNIGFAQEWLKSNVQPHVRTTNIVRILVGNE  139



>ref|XP_002526252.1| Glucan endo-1,3-beta-glucosidase precursor, putative [Ricinus 
communis]
 gb|EEF36121.1| Glucan endo-1,3-beta-glucosidase precursor, putative [Ricinus 
communis]
Length=476

 Score =   114 bits (284),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 59/122 (48%), Positives = 79/122 (65%), Gaps = 6/122 (5%)
 Frame = +3

Query  57   RPSPIFLFFLVSAFLFIHGV------RSIGVNYGTLGDNLPPPTEVARFLKEKTVIDRIK  218
            R S      +V+A LF+          ++GVNYGT+ +NLPPP +VA FL E T+I+R++
Sbjct  3    RESAALYASMVTAILFLQSTIIPGAEGTLGVNYGTVANNLPPPAQVANFLVESTIINRVR  62

Query  219  IFDVNPDILRAFAGTGILVTVTVPNGEIIPLKDAGYAAQWVAANIKPFYPATKINIIAVG  398
            +FD N +IL+AFA TGI VTVTVPN +I  L    +A QWV +NI+P+ PAT I  I VG
Sbjct  63   LFDTNREILQAFAHTGIEVTVTVPNDQIPRLTKLNFAQQWVKSNIQPYVPATNIIRILVG  122

Query  399  QR  404
              
Sbjct  123  NE  124



>gb|KJB53907.1| hypothetical protein B456_009G010800 [Gossypium raimondii]
Length=443

 Score =   113 bits (283),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 57/111 (51%), Positives = 72/111 (65%), Gaps = 1/111 (1%)
 Frame = +3

Query  75   LFFLVSAFL-FIHGVRSIGVNYGTLGDNLPPPTEVARFLKEKTVIDRIKIFDVNPDILRA  251
            +F L+   L        IGVNYG   DNLPPP+ VA FLK +T+ D +K+FD NPD+LRA
Sbjct  4    VFILIGVLLQLFTATTGIGVNYGMTADNLPPPSVVANFLKTQTIFDSVKLFDANPDVLRA  63

Query  252  FAGTGILVTVTVPNGEIIPLKDAGYAAQWVAANIKPFYPATKINIIAVGQR  404
            FA TGI V+VT+ NG+I  L +   A +WVA +I PF+P TKI  I VG  
Sbjct  64   FANTGISVSVTIGNGDIPGLTNTVTARRWVADHISPFHPQTKIKYICVGTE  114



>ref|XP_006411190.1| hypothetical protein EUTSA_v10017897mg [Eutrema salsugineum]
 gb|ESQ52643.1| hypothetical protein EUTSA_v10017897mg [Eutrema salsugineum]
Length=553

 Score =   114 bits (286),  Expect = 2e-26, Method: Composition-based stats.
 Identities = 63/109 (58%), Positives = 76/109 (70%), Gaps = 4/109 (4%)
 Frame = +3

Query  78   FFLVSAFLF-IHGVRS-IGVNYGTLGDNLPPPTEVARFLKEKTVIDRIKIFDVNPDILRA  251
              LVSA +F +  V S +G+NYGTLG NLPPP +V  F+K KT+ D +KIFD NPDILRA
Sbjct  13   LLLVSAVIFQLSAVTSAVGINYGTLG-NLPPPQQVVDFIKTKTIFDSVKIFDANPDILRA  71

Query  252  FAGTGILVTVTVPNGEIIPLKDAGYAAQWVAANIKPFYPATKINIIAVG  398
             AG+GI VT+TVPNG I  L +   A QWVAAN+ PF+  T I  I VG
Sbjct  72   LAGSGIHVTITVPNGNIPALANLENARQWVAANVLPFHQTT-IKYICVG  119



>ref|XP_004505325.1| PREDICTED: glucan endo-1,3-beta-glucosidase-like isoform X1 [Cicer 
arietinum]
Length=492

 Score =   114 bits (284),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 55/97 (57%), Positives = 66/97 (68%), Gaps = 0/97 (0%)
 Frame = +3

Query  114  VRSIGVNYGTLGDNLPPPTEVARFLKEKTVIDRIKIFDVNPDILRAFAGTGILVTVTVPN  293
              +IGVNYGT+ DNLPPP+ VA FLK +T I+ IK++D NPDILRAFA TGI VTVT  N
Sbjct  21   TNTIGVNYGTVADNLPPPSTVATFLKSQTTINHIKLYDANPDILRAFANTGISVTVTAAN  80

Query  294  GEIIPLKDAGYAAQWVAANIKPFYPATKINIIAVGQR  404
            G+I  L     A  W+  NI P++P T  N IAVG  
Sbjct  81   GDIPSLSKLPSAKSWITTNILPYHPKTIFNRIAVGNE  117



>ref|XP_004505326.1| PREDICTED: glucan endo-1,3-beta-glucosidase-like isoform X2 [Cicer 
arietinum]
Length=495

 Score =   114 bits (284),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 55/97 (57%), Positives = 66/97 (68%), Gaps = 0/97 (0%)
 Frame = +3

Query  114  VRSIGVNYGTLGDNLPPPTEVARFLKEKTVIDRIKIFDVNPDILRAFAGTGILVTVTVPN  293
              +IGVNYGT+ DNLPPP+ VA FLK +T I+ IK++D NPDILRAFA TGI VTVT  N
Sbjct  21   TNTIGVNYGTVADNLPPPSTVATFLKSQTTINHIKLYDANPDILRAFANTGISVTVTAAN  80

Query  294  GEIIPLKDAGYAAQWVAANIKPFYPATKINIIAVGQR  404
            G+I  L     A  W+  NI P++P T  N IAVG  
Sbjct  81   GDIPSLSKLPSAKSWITTNILPYHPKTIFNRIAVGNE  117



>gb|EMT11580.1| Glucan endo-1,3-beta-glucosidase [Aegilops tauschii]
Length=552

 Score =   114 bits (285),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 63/112 (56%), Positives = 75/112 (67%), Gaps = 5/112 (4%)
 Frame = +3

Query  69   IFLFFLVSAFLFIHGVRSIGVNYGTLGDNLPPPTEVARFLKEKTVIDRIKIFDVNPDILR  248
            +   FLV A L      +IGVNYGT GDNLP P +VA FL  +T IDR+K+FD NPDI+R
Sbjct  16   VMCIFLVIAPLST----AIGVNYGTKGDNLPSPAKVA-FLVTRTNIDRVKLFDTNPDIVR  70

Query  249  AFAGTGILVTVTVPNGEIIPLKDAGYAAQWVAANIKPFYPATKINIIAVGQR  404
            AFAGTGI V VT  NG+I  L     A  WVA NI P+YPAT I+++AVG  
Sbjct  71   AFAGTGISVMVTAGNGDIPGLATQTGADSWVATNIAPYYPATDISLVAVGNE  122



>gb|KDP35193.1| hypothetical protein JCGZ_09352 [Jatropha curcas]
Length=478

 Score =   113 bits (283),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 55/110 (50%), Positives = 77/110 (70%), Gaps = 0/110 (0%)
 Frame = +3

Query  75   LFFLVSAFLFIHGVRSIGVNYGTLGDNLPPPTEVARFLKEKTVIDRIKIFDVNPDILRAF  254
            ++FL S  LF     ++GVNYGTL +NLPPP +VA FL + T+I+R+K+FD N +IL+AF
Sbjct  17   IWFLESTLLFQGVEATLGVNYGTLANNLPPPAKVADFLVQSTIINRVKLFDTNTEILQAF  76

Query  255  AGTGILVTVTVPNGEIIPLKDAGYAAQWVAANIKPFYPATKINIIAVGQR  404
            A TGI VTVTVP+ +I  L    ++ +W+ +NI+P+ PAT I  I VG  
Sbjct  77   AHTGIAVTVTVPDDQIPHLTKLNFSQEWLKSNIQPYIPATNIIRILVGNE  126



>ref|XP_010267530.1| PREDICTED: glucan endo-1,3-beta-glucosidase [Nelumbo nucifera]
Length=455

 Score =   112 bits (281),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 58/111 (52%), Positives = 78/111 (70%), Gaps = 2/111 (2%)
 Frame = +3

Query  75   LFFLVSAFLFIHGVR-SIGVNYGTLGDNLPPPTEVARFLKEKTVIDRIKIFDVNPDILRA  251
            L  L++A L + GV+ +IGVNYGT+ +NLPPP EVA FL E+T I+R+++FD NP IL+A
Sbjct  16   LLLLIAATL-VGGVQGTIGVNYGTIANNLPPPAEVAHFLLEETTINRVRLFDANPAILQA  74

Query  252  FAGTGILVTVTVPNGEIIPLKDAGYAAQWVAANIKPFYPATKINIIAVGQR  404
            FA TGI VT+TVPN +I  L    +A  WV +N+ P+ P+T I  I VG  
Sbjct  75   FAHTGIAVTITVPNQQIPDLTKLSFAQHWVKSNVLPYTPSTNIIRILVGNE  125



>ref|NP_001119271.1| O-Glycosyl hydrolases family 17 protein [Arabidopsis thaliana]
 gb|AED93291.1| O-Glycosyl hydrolases family 17 protein [Arabidopsis thaliana]
Length=452

 Score =   112 bits (280),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 54/95 (57%), Positives = 69/95 (73%), Gaps = 0/95 (0%)
 Frame = +3

Query  120  SIGVNYGTLGDNLPPPTEVARFLKEKTVIDRIKIFDVNPDILRAFAGTGILVTVTVPNGE  299
            SIGVNYGTL +NLPPP +VA FL   TVI+RI++FD +P IL+AFA TGI VTVTVPN +
Sbjct  29   SIGVNYGTLANNLPPPQQVAEFLLHSTVINRIRLFDTDPQILQAFANTGIAVTVTVPNDQ  88

Query  300  IIPLKDAGYAAQWVAANIKPFYPATKINIIAVGQR  404
            I  L +   A QW++ +I+P +P+T I  I VG  
Sbjct  89   IPHLTNLSSAKQWISDHIQPHFPSTNIIRILVGNE  123



>ref|NP_001031936.1| O-Glycosyl hydrolases family 17 protein [Arabidopsis thaliana]
 gb|AED93290.1| O-Glycosyl hydrolases family 17 protein [Arabidopsis thaliana]
Length=458

 Score =   112 bits (280),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 54/95 (57%), Positives = 69/95 (73%), Gaps = 0/95 (0%)
 Frame = +3

Query  120  SIGVNYGTLGDNLPPPTEVARFLKEKTVIDRIKIFDVNPDILRAFAGTGILVTVTVPNGE  299
            SIGVNYGTL +NLPPP +VA FL   TVI+RI++FD +P IL+AFA TGI VTVTVPN +
Sbjct  29   SIGVNYGTLANNLPPPQQVAEFLLHSTVINRIRLFDTDPQILQAFANTGIAVTVTVPNDQ  88

Query  300  IIPLKDAGYAAQWVAANIKPFYPATKINIIAVGQR  404
            I  L +   A QW++ +I+P +P+T I  I VG  
Sbjct  89   IPHLTNLSSAKQWISDHIQPHFPSTNIIRILVGNE  123



>ref|XP_009620579.1| PREDICTED: LOW QUALITY PROTEIN: glucan endo-1,3-beta-glucosidase 
[Nicotiana tomentosiformis]
Length=365

 Score =   111 bits (278),  Expect = 5e-26, Method: Compositional matrix adjust.
 Identities = 50/94 (53%), Positives = 68/94 (72%), Gaps = 0/94 (0%)
 Frame = +3

Query  123  IGVNYGTLGDNLPPPTEVARFLKEKTVIDRIKIFDVNPDILRAFAGTGILVTVTVPNGEI  302
            IGVNYG + DNL PPT+V  F++++T I++IKIFD NP+I+ AFA TGI +T+TVPNG I
Sbjct  28   IGVNYGXVTDNLLPPTQVTAFIRDQTTINKIKIFDANPEIIHAFANTGIWLTITVPNGNI  87

Query  303  IPLKDAGYAAQWVAANIKPFYPATKINIIAVGQR  404
            + +  +  A  WV  N+ P+YP TKI+ I VG  
Sbjct  88   LSVSKSAGATTWVNENVVPYYPHTKIDRICVGNE  121



>ref|XP_010662898.1| PREDICTED: glucan endo-1,3-beta-glucosidase [Vitis vinifera]
 emb|CBI23036.3| unnamed protein product [Vitis vinifera]
Length=461

 Score =   112 bits (279),  Expect = 5e-26, Method: Compositional matrix adjust.
 Identities = 58/110 (53%), Positives = 80/110 (73%), Gaps = 4/110 (4%)
 Frame = +3

Query  84   LVSAFLFIHGV--RSIGVNYGTLGDNLPPPTEVARFLKEKTVIDRIKIFDVNPDILRAFA  257
            L+ A +F  GV   +IGVNYGT+ ++LPPP+EVARFL E T I+R+++FD +P++++AFA
Sbjct  9    LLLASVFFQGVVEGNIGVNYGTVANDLPPPSEVARFLLESTTINRVRMFDADPEMIQAFA  68

Query  258  GTGILVTVTVPNGEIIP-LKDAGYAAQWVAANIKPFYPATKINIIAVGQR  404
             TGI VTVTVPN E+IP L    +A QWV  N++P+ PAT +  I VG  
Sbjct  69   HTGIAVTVTVPN-ELIPRLTKLSFAQQWVKTNVQPYVPATNLIRILVGNE  117



>ref|XP_011046747.1| PREDICTED: glucan endo-1,3-beta-glucosidase-like isoform X1 [Populus 
euphratica]
 ref|XP_011046748.1| PREDICTED: glucan endo-1,3-beta-glucosidase-like isoform X1 [Populus 
euphratica]
Length=398

 Score =   111 bits (278),  Expect = 6e-26, Method: Compositional matrix adjust.
 Identities = 55/109 (50%), Positives = 76/109 (70%), Gaps = 1/109 (1%)
 Frame = +3

Query  81   FLVSAFLFIHGVR-SIGVNYGTLGDNLPPPTEVARFLKEKTVIDRIKIFDVNPDILRAFA  257
             L+++ L+I GV  SIGVNYGTL +NLPPP +VA FL E T+I+R+++FD + +ILRAFA
Sbjct  31   LLLASTLYIQGVEGSIGVNYGTLANNLPPPAQVAHFLLESTIINRVRLFDASTEILRAFA  90

Query  258  GTGILVTVTVPNGEIIPLKDAGYAAQWVAANIKPFYPATKINIIAVGQR  404
              GI VTVTV N +I  L + G+A +W+ +N++P    T I  I VG  
Sbjct  91   HKGIEVTVTVTNDQIPHLTNIGFAQEWLKSNVQPHVRTTNIVRILVGNE  139



>ref|XP_011046750.1| PREDICTED: glucan endo-1,3-beta-glucosidase-like isoform X2 [Populus 
euphratica]
Length=393

 Score =   111 bits (278),  Expect = 7e-26, Method: Compositional matrix adjust.
 Identities = 55/109 (50%), Positives = 76/109 (70%), Gaps = 1/109 (1%)
 Frame = +3

Query  81   FLVSAFLFIHGVR-SIGVNYGTLGDNLPPPTEVARFLKEKTVIDRIKIFDVNPDILRAFA  257
             L+++ L+I GV  SIGVNYGTL +NLPPP +VA FL E T+I+R+++FD + +ILRAFA
Sbjct  31   LLLASTLYIQGVEGSIGVNYGTLANNLPPPAQVAHFLLESTIINRVRLFDASTEILRAFA  90

Query  258  GTGILVTVTVPNGEIIPLKDAGYAAQWVAANIKPFYPATKINIIAVGQR  404
              GI VTVTV N +I  L + G+A +W+ +N++P    T I  I VG  
Sbjct  91   HKGIEVTVTVTNDQIPHLTNIGFAQEWLKSNVQPHVRTTNIVRILVGNE  139



>ref|XP_009799239.1| PREDICTED: glucan endo-1,3-beta-glucosidase-like [Nicotiana sylvestris]
Length=386

 Score =   111 bits (277),  Expect = 9e-26, Method: Compositional matrix adjust.
 Identities = 61/117 (52%), Positives = 74/117 (63%), Gaps = 7/117 (6%)
 Frame = +3

Query  75   LFFLVSAFLFI------HGVR-SIGVNYGTLGDNLPPPTEVARFLKEKTVIDRIKIFDVN  233
            L  L+ A LF+       GV  +IG+NYGT+ DNLPPP +VARFL E T I R+++FD N
Sbjct  9    LVHLLGALLFVLTPILTQGVEGTIGINYGTVADNLPPPVQVARFLLESTFISRVRLFDAN  68

Query  234  PDILRAFAGTGILVTVTVPNGEIIPLKDAGYAAQWVAANIKPFYPATKINIIAVGQR  404
            P+IL+AFA TGI VTV VPN  I  L    +A QWV  N+ P  PAT I  I VG  
Sbjct  69   PEILKAFARTGIAVTVNVPNDLIPHLLKLSFARQWVEYNVLPHVPATNIVRILVGNE  125



>ref|XP_010421258.1| PREDICTED: glucan endo-1,3-beta-glucosidase-like isoform X1 [Camelina 
sativa]
Length=453

 Score =   111 bits (277),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 59/130 (45%), Positives = 80/130 (62%), Gaps = 3/130 (2%)
 Frame = +3

Query  24   NLILKIMEMSLRPSPIFLFFLVSAFLFI---HGVRSIGVNYGTLGDNLPPPTEVARFLKE  194
            N +L  +  S   S + +F LV   +         SIGVNYGTL +NLPPP +VA FL  
Sbjct  2    NYVLPFLYFSSFTSSVSMFNLVGLLIICLTGGAEASIGVNYGTLANNLPPPHQVAEFLLH  61

Query  195  KTVIDRIKIFDVNPDILRAFAGTGILVTVTVPNGEIIPLKDAGYAAQWVAANIKPFYPAT  374
             TVI+R+++FD +P IL+AFA TGI VTVTVPN ++  L +   A +W++  I+P YP+T
Sbjct  62   STVINRVRLFDADPQILQAFANTGIAVTVTVPNDQVPHLTNLTSAQKWISDQIQPHYPST  121

Query  375  KINIIAVGQR  404
             I  I VG  
Sbjct  122  NIIRILVGNE  131



>ref|XP_002874188.1| hydrolase, hydrolyzing O-glycosyl compounds [Arabidopsis lyrata 
subsp. lyrata]
 gb|EFH50447.1| hydrolase, hydrolyzing O-glycosyl compounds [Arabidopsis lyrata 
subsp. lyrata]
Length=443

 Score =   111 bits (277),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 53/95 (56%), Positives = 68/95 (72%), Gaps = 0/95 (0%)
 Frame = +3

Query  120  SIGVNYGTLGDNLPPPTEVARFLKEKTVIDRIKIFDVNPDILRAFAGTGILVTVTVPNGE  299
            SIGVNYGTL +NLPPP +VA FL   TVI+RI++FD +P IL+AFA TGI +TVTVPN +
Sbjct  15   SIGVNYGTLANNLPPPQQVAEFLLHSTVINRIRLFDTDPHILQAFANTGIAITVTVPNDQ  74

Query  300  IIPLKDAGYAAQWVAANIKPFYPATKINIIAVGQR  404
            I  L +   A QW++  I+P +P+T I  I VG  
Sbjct  75   IPHLTNLSSAKQWISDQIQPHFPSTNIIRILVGNE  109



>ref|XP_010519454.1| PREDICTED: glucan endo-1,3-beta-glucosidase isoform X2 [Tarenaya 
hassleriana]
Length=486

 Score =   111 bits (277),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 54/102 (53%), Positives = 73/102 (72%), Gaps = 1/102 (1%)
 Frame = +3

Query  102  FIHGVR-SIGVNYGTLGDNLPPPTEVARFLKEKTVIDRIKIFDVNPDILRAFAGTGILVT  278
            F+ GV  SIGVNYGTL +NL PP +VA FL   TVI+R+++FD +P ILR+F+GTGI  +
Sbjct  29   FVSGVEASIGVNYGTLANNLQPPRQVAEFLLRSTVINRVRLFDTDPQILRSFSGTGIATS  88

Query  279  VTVPNGEIIPLKDAGYAAQWVAANIKPFYPATKINIIAVGQR  404
            VTVPN  I  L +  +A QW++ +I+PF+P+T I  I VG  
Sbjct  89   VTVPNDLIPNLTNLSFAQQWLSLSIQPFFPSTNIVRILVGNE  130



>gb|KFK27709.1| hypothetical protein AALP_AA8G419000, partial [Arabis alpina]
Length=441

 Score =   110 bits (275),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 52/95 (55%), Positives = 69/95 (73%), Gaps = 0/95 (0%)
 Frame = +3

Query  120  SIGVNYGTLGDNLPPPTEVARFLKEKTVIDRIKIFDVNPDILRAFAGTGILVTVTVPNGE  299
            SIGVNYGTL +NLPPP +VA FL   TVI+RI++FD NP IL++FA TGI VTVT+PN +
Sbjct  11   SIGVNYGTLANNLPPPHQVAEFLLHSTVINRIRLFDANPQILQSFANTGIAVTVTIPNNQ  70

Query  300  IIPLKDAGYAAQWVAANIKPFYPATKINIIAVGQR  404
            I  L +  ++ QW++ +I P +P+T I  I VG  
Sbjct  71   IPLLTNLTFSQQWISHHINPHFPSTNIIRILVGNE  105



>ref|XP_010535497.1| PREDICTED: glucan endo-1,3-beta-glucosidase [Tarenaya hassleriana]
Length=372

 Score =   110 bits (274),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 53/94 (56%), Positives = 68/94 (72%), Gaps = 0/94 (0%)
 Frame = +3

Query  123  IGVNYGTLGDNLPPPTEVARFLKEKTVIDRIKIFDVNPDILRAFAGTGILVTVTVPNGEI  302
            +GVNYGT+ DNLPPP +VA FLK KT I+ +KIFD +P+ILRAFAGTGI VTVTV N +I
Sbjct  29   VGVNYGTVADNLPPPQQVAGFLKTKTNINHVKIFDADPNILRAFAGTGISVTVTVANSDI  88

Query  303  IPLKDAGYAAQWVAANIKPFYPATKINIIAVGQR  404
              L     AA+W++ ++ PF P+  +  IAVG  
Sbjct  89   PSLCKLSAAARWLSDHVLPFLPSVSLRYIAVGNE  122



>ref|XP_006350517.1| PREDICTED: glucan endo-1,3-beta-glucosidase-like [Solanum tuberosum]
Length=382

 Score =   109 bits (273),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 55/103 (53%), Positives = 71/103 (69%), Gaps = 1/103 (1%)
 Frame = +3

Query  99   LFIHGVR-SIGVNYGTLGDNLPPPTEVARFLKEKTVIDRIKIFDVNPDILRAFAGTGILV  275
            +F+ GV  +IGVNYGT+ D+LPPP +VA FL++ T I R+++FD NP+IL+AFA TGI V
Sbjct  23   IFLQGVEGTIGVNYGTVADDLPPPVQVASFLRDSTFIRRVRLFDANPEILKAFARTGISV  82

Query  276  TVTVPNGEIIPLKDAGYAAQWVAANIKPFYPATKINIIAVGQR  404
            TV VPN  I  L    +A QWV  N+ P+ PAT I  I VG  
Sbjct  83   TVNVPNDLIPQLTMLSFAQQWVEINVLPYVPATNIVRILVGNE  125



>ref|XP_010685761.1| PREDICTED: glucan endo-1,3-beta-glucosidase-like [Beta vulgaris 
subsp. vulgaris]
Length=454

 Score =   110 bits (274),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 49/94 (52%), Positives = 65/94 (69%), Gaps = 0/94 (0%)
 Frame = +3

Query  123  IGVNYGTLGDNLPPPTEVARFLKEKTVIDRIKIFDVNPDILRAFAGTGILVTVTVPNGEI  302
            IG NYG + DNLPPP+ VA+FL  +T +  +K+FD +P IL+AFA TGI +TV +PN ++
Sbjct  29   IGANYGRVADNLPPPSSVAKFLTSQTTLTSVKLFDCDPQILQAFANTGISLTVNIPNSDV  88

Query  303  IPLKDAGYAAQWVAANIKPFYPATKINIIAVGQR  404
            IPL D   A  WVA +I P++P T I  IAVG  
Sbjct  89   IPLSDPTNAQSWVATHILPYHPQTIIRYIAVGNE  122



>ref|XP_010421259.1| PREDICTED: glucan endo-1,3-beta-glucosidase-like isoform X2 [Camelina 
sativa]
Length=435

 Score =   109 bits (273),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 52/95 (55%), Positives = 68/95 (72%), Gaps = 0/95 (0%)
 Frame = +3

Query  120  SIGVNYGTLGDNLPPPTEVARFLKEKTVIDRIKIFDVNPDILRAFAGTGILVTVTVPNGE  299
            SIGVNYGTL +NLPPP +VA FL   TVI+R+++FD +P IL+AFA TGI VTVTVPN +
Sbjct  19   SIGVNYGTLANNLPPPHQVAEFLLHSTVINRVRLFDADPQILQAFANTGIAVTVTVPNDQ  78

Query  300  IIPLKDAGYAAQWVAANIKPFYPATKINIIAVGQR  404
            +  L +   A +W++  I+P YP+T I  I VG  
Sbjct  79   VPHLTNLTSAQKWISDQIQPHYPSTNIIRILVGNE  113



>ref|XP_010493578.1| PREDICTED: glucan endo-1,3-beta-glucosidase [Camelina sativa]
Length=457

 Score =   109 bits (273),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 59/130 (45%), Positives = 80/130 (62%), Gaps = 3/130 (2%)
 Frame = +3

Query  24   NLILKIMEMSLRPSPIFLFFLVSAFLFI---HGVRSIGVNYGTLGDNLPPPTEVARFLKE  194
            N +L  +  S   S + +F LV   +         SIGVNYGTL +NLPPP +VA FL  
Sbjct  2    NYVLPFLYFSSFTSSVSMFNLVGLLIICLTGGADASIGVNYGTLANNLPPPHQVAEFLLH  61

Query  195  KTVIDRIKIFDVNPDILRAFAGTGILVTVTVPNGEIIPLKDAGYAAQWVAANIKPFYPAT  374
             TVI+R+++FD +P IL+AFA TGI VTVTVPN +I  L +   A +W++  I+P +P+T
Sbjct  62   STVINRVRLFDADPQILQAFANTGIAVTVTVPNDQIPHLTNLTSAQKWISDQIQPHFPST  121

Query  375  KINIIAVGQR  404
             I  I VG  
Sbjct  122  NIIRILVGNE  131



>ref|XP_006295997.1| hypothetical protein CARUB_v10025141mg [Capsella rubella]
 gb|EOA28895.1| hypothetical protein CARUB_v10025141mg [Capsella rubella]
Length=540

 Score =   110 bits (274),  Expect = 5e-25, Method: Composition-based stats.
 Identities = 60/121 (50%), Positives = 76/121 (63%), Gaps = 3/121 (2%)
 Frame = +3

Query  42   MEMSLRPSPIFLFFLVSAFLF-IHGVRS-IGVNYGTLGDNLPPPTEVARFLKEKTVIDRI  215
            M  + R S +    +V+A +F +  V S IG+NYGTLG NL PP +V  F+K KT +D +
Sbjct  1    MAKTTRCSTLPFLPIVAAMIFQLSAVTSAIGINYGTLG-NLQPPQQVVDFIKTKTKLDSV  59

Query  216  KIFDVNPDILRAFAGTGILVTVTVPNGEIIPLKDAGYAAQWVAANIKPFYPATKINIIAV  395
            KIFD NPDILR  AGT I VT+ VPNG I  + D   A QWVAAN+ PF+   K   + V
Sbjct  60   KIFDANPDILRGLAGTEISVTIMVPNGNIPAMVDVANARQWVAANVLPFHQQIKFKYLCV  119

Query  396  G  398
            G
Sbjct  120  G  120



>ref|XP_008377317.1| PREDICTED: glucan endo-1,3-beta-glucosidase 7-like [Malus domestica]
Length=459

 Score =   108 bits (270),  Expect = 9e-25, Method: Compositional matrix adjust.
 Identities = 57/123 (46%), Positives = 78/123 (63%), Gaps = 3/123 (2%)
 Frame = +3

Query  42   MEMSLRPSPIFLFFLV-SAFLFIHGVRSIGVNYGTLGDNLPPPTEVARFLKEKTVIDRIK  218
            M  SL   PI L FL  +AFL       IGVNYG + DNLPPP+E A+ L + T I R++
Sbjct  1    MASSLSHFPILLLFLSFTAFLSADSQSFIGVNYGQVADNLPPPSETAKLL-QSTAIKRVR  59

Query  219  IFDVNPDILRAFAGTGILVTVTVPNGEIIPL-KDAGYAAQWVAANIKPFYPATKINIIAV  395
            ++  +P I++A AG+GI + +   NG+I  L  D   AAQWV +N+ PFYPA+KI++I V
Sbjct  60   LYGADPAIIKALAGSGIAIAIGASNGDIPALASDPNAAAQWVNSNVLPFYPASKIDLINV  119

Query  396  GQR  404
            G  
Sbjct  120  GNE  122



>ref|XP_010519453.1| PREDICTED: glucan endo-1,3-beta-glucosidase isoform X1 [Tarenaya 
hassleriana]
Length=532

 Score =   108 bits (271),  Expect = 1e-24, Method: Composition-based stats.
 Identities = 51/93 (55%), Positives = 69/93 (74%), Gaps = 0/93 (0%)
 Frame = +3

Query  120  SIGVNYGTLGDNLPPPTEVARFLKEKTVIDRIKIFDVNPDILRAFAGTGILVTVTVPNGE  299
            SIGVNYGTL +NL PP +VA FL   TVI+R+++FD +P ILR+F+GTGI  +VTVPN  
Sbjct  82   SIGVNYGTLANNLQPPRQVAEFLLRSTVINRVRLFDTDPQILRSFSGTGIATSVTVPNDL  141

Query  300  IIPLKDAGYAAQWVAANIKPFYPATKINIIAVG  398
            I  L +  +A QW++ +I+PF+P+T I  I VG
Sbjct  142  IPNLTNLSFAQQWLSLSIQPFFPSTNIVRILVG  174



>ref|XP_004309121.2| PREDICTED: glucan endo-1,3-beta-glucosidase [Fragaria vesca subsp. 
vesca]
Length=508

 Score =   108 bits (270),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 56/117 (48%), Positives = 79/117 (68%), Gaps = 2/117 (2%)
 Frame = +3

Query  57   RPSPIFLFFLVSAFLFIHGVR-SIGVNYGTLGDNLPPPTEVARFLKEKTVIDRIKIFDVN  233
            R S I L FL S F  + GV+ SIGVNYGT+ ++LPPP++VA FL + T+I+R+++FD N
Sbjct  57   RGSTIVLLFLASIF-NVQGVQGSIGVNYGTVANDLPPPSQVAHFLLQSTIINRVRLFDTN  115

Query  234  PDILRAFAGTGILVTVTVPNGEIIPLKDAGYAAQWVAANIKPFYPATKINIIAVGQR  404
            P IL+AFA +GI +T+TVPN +I       +A  W+  N+ P+ PAT I  I +G  
Sbjct  116  PQILQAFAHSGIPLTITVPNDQIPHFTKLRFAQNWLNTNVIPYTPATNIVRILLGNE  172



>emb|CDX87130.1| BnaC09g04450D [Brassica napus]
Length=465

 Score =   107 bits (268),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 51/95 (54%), Positives = 69/95 (73%), Gaps = 0/95 (0%)
 Frame = +3

Query  120  SIGVNYGTLGDNLPPPTEVARFLKEKTVIDRIKIFDVNPDILRAFAGTGILVTVTVPNGE  299
            SIGVNYGTL +NLPPP +VA FL   TVI+RI++FD +P IL+AFA TG+ VTVTV N +
Sbjct  33   SIGVNYGTLANNLPPPRQVAEFLLHSTVINRIRLFDADPQILQAFAHTGVAVTVTVSNDQ  92

Query  300  IIPLKDAGYAAQWVAANIKPFYPATKINIIAVGQR  404
            I  L +  +A +W++ +I+P +P+T I  I VG  
Sbjct  93   IPHLTNLSFAQRWISDHIQPHFPSTNIIRILVGNE  127



>ref|XP_002321390.2| hypothetical protein POPTR_0015s01240g [Populus trichocarpa]
 gb|EEF05517.2| hypothetical protein POPTR_0015s01240g [Populus trichocarpa]
Length=355

 Score =   107 bits (266),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 50/99 (51%), Positives = 70/99 (71%), Gaps = 0/99 (0%)
 Frame = +3

Query  108  HGVRSIGVNYGTLGDNLPPPTEVARFLKEKTVIDRIKIFDVNPDILRAFAGTGILVTVTV  287
            + + +IGVNYGTL +NLPPP +VA FL E T+I+R+++FD + +ILRAFA TGI VTVTV
Sbjct  3    NALATIGVNYGTLANNLPPPAQVAHFLLESTIINRVRLFDASTEILRAFAHTGIAVTVTV  62

Query  288  PNGEIIPLKDAGYAAQWVAANIKPFYPATKINIIAVGQR  404
             N +I  L + G+A +W+ +N++P    T I  I VG  
Sbjct  63   TNDQIPHLTNIGFAQEWLKSNVQPHVRTTNIVRILVGNE  101



>gb|AES90042.2| O-glycosyl hydrolase family 17 protein [Medicago truncatula]
Length=531

 Score =   108 bits (270),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 56/101 (55%), Positives = 64/101 (63%), Gaps = 0/101 (0%)
 Frame = +3

Query  102  FIHGVRSIGVNYGTLGDNLPPPTEVARFLKEKTVIDRIKIFDVNPDILRAFAGTGILVTV  281
            F     +IGVNYGT+ +NLPPPT VA FLK +T I  IKIFD N  ILRAFA T I VTV
Sbjct  37   FSSATYNIGVNYGTIANNLPPPTTVATFLKTQTTITHIKIFDTNSSILRAFANTNISVTV  96

Query  282  TVPNGEIIPLKDAGYAAQWVAANIKPFYPATKINIIAVGQR  404
            TV N +I  L     A +W+  NI PF+P T  N IAVG  
Sbjct  97   TVSNADIPSLTKLPSAQKWITTNILPFHPKTIFNRIAVGNE  137



>ref|XP_003607845.1| Glucan endo-1,3-beta-glucosidase [Medicago truncatula]
Length=512

 Score =   108 bits (269),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 56/101 (55%), Positives = 64/101 (63%), Gaps = 0/101 (0%)
 Frame = +3

Query  102  FIHGVRSIGVNYGTLGDNLPPPTEVARFLKEKTVIDRIKIFDVNPDILRAFAGTGILVTV  281
            F     +IGVNYGT+ +NLPPPT VA FLK +T I  IKIFD N  ILRAFA T I VTV
Sbjct  18   FSSATYNIGVNYGTIANNLPPPTTVATFLKTQTTITHIKIFDTNSSILRAFANTNISVTV  77

Query  282  TVPNGEIIPLKDAGYAAQWVAANIKPFYPATKINIIAVGQR  404
            TV N +I  L     A +W+  NI PF+P T  N IAVG  
Sbjct  78   TVSNADIPSLTKLPSAQKWITTNILPFHPKTIFNRIAVGNE  118



>ref|XP_009374190.1| PREDICTED: glucan endo-1,3-beta-glucosidase 7-like [Pyrus x bretschneideri]
Length=459

 Score =   107 bits (267),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 57/123 (46%), Positives = 79/123 (64%), Gaps = 3/123 (2%)
 Frame = +3

Query  42   MEMSLRPSPIFLFFLV-SAFLFIHGVRSIGVNYGTLGDNLPPPTEVARFLKEKTVIDRIK  218
            M  SL   PI L FL+ +AFL       IGVNYG + DNLPPP++ A+ L + T I RI+
Sbjct  1    MASSLSHLPILLVFLLFTAFLSADSQSFIGVNYGQVADNLPPPSDTAKLL-QSTAIKRIR  59

Query  219  IFDVNPDILRAFAGTGILVTVTVPNGEIIPL-KDAGYAAQWVAANIKPFYPATKINIIAV  395
            +F  +P I++A AG+GI + +   NG++  L  D   AAQWV +N+ PFYPA+KI++I V
Sbjct  60   LFGSDPAIIKALAGSGIAIAIGAANGDLPALASDPNAAAQWVNSNVLPFYPASKIDLINV  119

Query  396  GQR  404
            G  
Sbjct  120  GNE  122



>ref|XP_006287713.1| hypothetical protein CARUB_v10000922mg [Capsella rubella]
 gb|EOA20611.1| hypothetical protein CARUB_v10000922mg [Capsella rubella]
Length=459

 Score =   107 bits (266),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 52/95 (55%), Positives = 69/95 (73%), Gaps = 0/95 (0%)
 Frame = +3

Query  120  SIGVNYGTLGDNLPPPTEVARFLKEKTVIDRIKIFDVNPDILRAFAGTGILVTVTVPNGE  299
            SIGVNYGTL +NLPPP +VA FL   T+I+RI++FD +P IL+AFA TGI VTVTVPN +
Sbjct  9    SIGVNYGTLANNLPPPQQVAEFLLRSTLINRIRLFDADPLILKAFANTGITVTVTVPNDQ  68

Query  300  IIPLKDAGYAAQWVAANIKPFYPATKINIIAVGQR  404
            I  L +   A +W++ +I+P +P+T I  I VG  
Sbjct  69   IPHLTNLTSAQKWISDHIQPHFPSTNIIRILVGNE  103



>ref|XP_006292633.1| hypothetical protein CARUB_v10018875mg [Capsella rubella]
 gb|EOA25531.1| hypothetical protein CARUB_v10018875mg [Capsella rubella]
Length=348

 Score =   106 bits (264),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 52/95 (55%), Positives = 67/95 (71%), Gaps = 1/95 (1%)
 Frame = +3

Query  123  IGVNYGTLGDNLPPPTEVARFLKEKTVIDRIKIFDVNPDILRAFAG-TGILVTVTVPNGE  299
            IGVNYGT+ +NLPPP +V  F+K KT I+ +KIFD NPDIL AF+G TGI +TVT+PN +
Sbjct  28   IGVNYGTVANNLPPPHQVVNFIKTKTNINHVKIFDANPDILAAFSGITGISLTVTIPNSD  87

Query  300  IIPLKDAGYAAQWVAANIKPFYPATKINIIAVGQR  404
            I+ L     A  W++ ++ PF PAT I  IAVG  
Sbjct  88   IVSLSKLPNARSWLSNHLLPFLPATSIRYIAVGNE  122



>gb|EAZ03332.1| hypothetical protein OsI_25474 [Oryza sativa Indica Group]
Length=501

 Score =   107 bits (267),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 60/102 (59%), Positives = 74/102 (73%), Gaps = 0/102 (0%)
 Frame = +3

Query  99   LFIHGVRSIGVNYGTLGDNLPPPTEVARFLKEKTVIDRIKIFDVNPDILRAFAGTGILVT  278
            + +    +IGVNYGT GDNLPPP  VA+FL  +T IDR+K+FD NPDI++AFAGTGI V 
Sbjct  21   ILLPSAAAIGVNYGTKGDNLPPPATVAKFLANRTRIDRVKLFDTNPDIVKAFAGTGITVM  80

Query  279  VTVPNGEIIPLKDAGYAAQWVAANIKPFYPATKINIIAVGQR  404
            VT  NG+I  L     AA WVAANI P+YPAT I+++AVG  
Sbjct  81   VTAGNGDIPTLGTKDGAAAWVAANIAPYYPATDISLVAVGNE  122



>ref|XP_009586622.1| PREDICTED: glucan endo-1,3-beta-glucosidase-like [Nicotiana tomentosiformis]
Length=385

 Score =   106 bits (264),  Expect = 5e-24, Method: Compositional matrix adjust.
 Identities = 60/135 (44%), Positives = 75/135 (56%), Gaps = 16/135 (12%)
 Frame = +3

Query  99   LFIHGVR-SIGVNYGTLGDNLPPPTEVARFLKEKTVIDRIKIFDVNPDILRAFAGTGILV  275
            + I GV  +IG++YGT+ D+LPPP +VARFL E T I R+++FD NP+IL+AFA TGI V
Sbjct  23   ILIQGVEGTIGIDYGTVADDLPPPVQVARFLLESTFIRRVRLFDANPEILKAFAHTGIAV  82

Query  276  TVTVPNGEIIPLKDAGYAAQWVAANIKPFYPATKINIIAVGQR---------------GS  410
            TV  PN  I  L    +A QWV  N+ P  PAT I  I VG                  +
Sbjct  83   TVNFPNDLIPHLTKLSFARQWVEINVLPHIPATNIVRILVGNEVISTANKLLIGNLVPAT  142

Query  411  PLGHAGDAERPRRRH  455
               HA   ER   RH
Sbjct  143  ETLHAALVERSLDRH  157



>ref|NP_001059262.1| Os07g0240200 [Oryza sativa Japonica Group]
 dbj|BAC83528.1| putative glucan endo-1,3-beta-glucosidase precursor [Oryza sativa 
Japonica Group]
 dbj|BAF21176.1| Os07g0240200 [Oryza sativa Japonica Group]
 gb|EAZ39236.1| hypothetical protein OsJ_23659 [Oryza sativa Japonica Group]
 dbj|BAG91193.1| unnamed protein product [Oryza sativa Japonica Group]
Length=501

 Score =   107 bits (266),  Expect = 5e-24, Method: Compositional matrix adjust.
 Identities = 60/102 (59%), Positives = 74/102 (73%), Gaps = 0/102 (0%)
 Frame = +3

Query  99   LFIHGVRSIGVNYGTLGDNLPPPTEVARFLKEKTVIDRIKIFDVNPDILRAFAGTGILVT  278
            + +    +IGVNYGT GDNLPPP  VA+FL  +T IDR+K+FD NPDI++AFAGTGI V 
Sbjct  21   ILLPSAAAIGVNYGTKGDNLPPPATVAKFLANRTRIDRVKLFDTNPDIVKAFAGTGITVM  80

Query  279  VTVPNGEIIPLKDAGYAAQWVAANIKPFYPATKINIIAVGQR  404
            VT  NG+I  L     AA WVAANI P+YPAT I+++AVG  
Sbjct  81   VTAGNGDIPTLGTKDGAAAWVAANIAPYYPATDISLVAVGNE  122



>ref|XP_009374179.1| PREDICTED: glucan endo-1,3-beta-glucosidase 7 [Pyrus x bretschneideri]
Length=459

 Score =   106 bits (264),  Expect = 7e-24, Method: Compositional matrix adjust.
 Identities = 55/123 (45%), Positives = 79/123 (64%), Gaps = 3/123 (2%)
 Frame = +3

Query  42   MEMSLRPSPIFLFFLV-SAFLFIHGVRSIGVNYGTLGDNLPPPTEVARFLKEKTVIDRIK  218
            M  SL   PI L FL+ +AFL       IGVNYG + DNLPPP++ A+ L + T I R++
Sbjct  1    MASSLSHFPILLVFLLFTAFLSADSQSFIGVNYGQVADNLPPPSDTAKLL-QSTAIKRVR  59

Query  219  IFDVNPDILRAFAGTGILVTVTVPNGEIIPL-KDAGYAAQWVAANIKPFYPATKINIIAV  395
            ++  +P I++A AG+GI + +   NG++  L  D   AAQWV +N+ PFYPA+KI++I V
Sbjct  60   LYGADPAIIKALAGSGIAIAIGAANGDLPALASDPNAAAQWVNSNVLPFYPASKIDLINV  119

Query  396  GQR  404
            G  
Sbjct  120  GNE  122



>ref|NP_190241.1| Glycosyl hydrolase superfamily protein [Arabidopsis thaliana]
 emb|CAB62327.1| glucosidase-like protein [Arabidopsis thaliana]
 gb|AEE78173.1| Glycosyl hydrolase superfamily protein [Arabidopsis thaliana]
Length=356

 Score =   105 bits (261),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 54/112 (48%), Positives = 71/112 (63%), Gaps = 2/112 (2%)
 Frame = +3

Query  75   LFFLVSAFLF-IHGVRSIGVNYGTLGDNLPPPTEVARFLKEKTVIDRIKIFDVNPDILRA  251
            L+FL+   +        +GVNYGT+ +NLPPP +V  F+K KT+I+ +KIFD N DIL A
Sbjct  10   LYFLILTLILPFSAAYQVGVNYGTVANNLPPPHQVVNFIKTKTIINHVKIFDTNHDILAA  69

Query  252  FAG-TGILVTVTVPNGEIIPLKDAGYAAQWVAANIKPFYPATKINIIAVGQR  404
            F+G TGI +TVTVPN +II L     A  W++ N+ PF   T I  IAVG  
Sbjct  70   FSGITGISLTVTVPNSDIISLSKLSNARSWLSDNLLPFLLTTSIRYIAVGNE  121



>ref|XP_003588492.1| Glucan endo-1,3-beta-glucosidase [Medicago truncatula]
 gb|AES58743.1| glycoside hydrolase family 17 protein [Medicago truncatula]
Length=363

 Score =   104 bits (260),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 49/108 (45%), Positives = 73/108 (68%), Gaps = 3/108 (3%)
 Frame = +3

Query  81   FLVSAFLFIHGVRSIGVNYGTLGDNLPPPTEVARFLKEKTVIDRIKIFDVNPDILRAFAG  260
            FL+ +F  + G   IGVNYGT+ +NLPPP++VA+FL   T+I++++IFD N +IL+AF  
Sbjct  5    FLLQSFTEVQG---IGVNYGTIANNLPPPSQVAKFLLHSTIINKVRIFDANQEILQAFEN  61

Query  261  TGILVTVTVPNGEIIPLKDAGYAAQWVAANIKPFYPATKINIIAVGQR  404
            T I +T+T+PN +I  + +   A QWV  N++PF P+  I  I VG  
Sbjct  62   TRIEITITIPNDQIPNITNLTLAQQWVKTNVQPFIPSINIIRILVGNE  109



>emb|CDY19838.1| BnaA09g04910D [Brassica napus]
Length=467

 Score =   105 bits (262),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 49/95 (52%), Positives = 69/95 (73%), Gaps = 0/95 (0%)
 Frame = +3

Query  120  SIGVNYGTLGDNLPPPTEVARFLKEKTVIDRIKIFDVNPDILRAFAGTGILVTVTVPNGE  299
            SIGVNYGTL +NLPPP +VA FL   TVI+RI++F+ +P IL+AFA TG+ VTVT+ N +
Sbjct  35   SIGVNYGTLANNLPPPRQVAEFLLHSTVINRIRLFNADPQILQAFAHTGVAVTVTISNDQ  94

Query  300  IIPLKDAGYAAQWVAANIKPFYPATKINIIAVGQR  404
            I  L +  +A +W++ +I+P +P+T I  I VG  
Sbjct  95   IPHLTNLSFAQRWISDHIQPHFPSTNIIRILVGNE  129



>ref|XP_009111627.1| PREDICTED: glucan endo-1,3-beta-glucosidase [Brassica rapa]
Length=470

 Score =   105 bits (262),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 49/95 (52%), Positives = 69/95 (73%), Gaps = 0/95 (0%)
 Frame = +3

Query  120  SIGVNYGTLGDNLPPPTEVARFLKEKTVIDRIKIFDVNPDILRAFAGTGILVTVTVPNGE  299
            SIGVNYGTL +NLPPP +VA FL   TVI+RI++F+ +P IL+AFA TG+ VTVT+ N +
Sbjct  38   SIGVNYGTLANNLPPPRQVAEFLLHSTVINRIRLFNADPQILQAFAHTGVAVTVTISNDQ  97

Query  300  IIPLKDAGYAAQWVAANIKPFYPATKINIIAVGQR  404
            I  L +  +A +W++ +I+P +P+T I  I VG  
Sbjct  98   IPHLTNLSFAQRWISDHIQPHFPSTNIIRILVGNE  132



>gb|KDO72847.1| hypothetical protein CISIN_1g0375832mg, partial [Citrus sinensis]
Length=458

 Score =   104 bits (260),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 53/95 (56%), Positives = 63/95 (66%), Gaps = 0/95 (0%)
 Frame = +3

Query  120  SIGVNYGTLGDNLPPPTEVARFLKEKTVIDRIKIFDVNPDILRAFAGTGILVTVTVPNGE  299
            SIGVNYG + +NLPPP +VA FLK +T IDR+K+FD NP+ LRAFA T I VTVTV NG+
Sbjct  31   SIGVNYGAIANNLPPPQQVANFLKTQTTIDRVKLFDANPEFLRAFAHTNIPVTVTVGNGD  90

Query  300  IIPLKDAGYAAQWVAANIKPFYPATKINIIAVGQR  404
            I  L     A  WVA NI P +P T    I +G  
Sbjct  91   IPALAKLPAAQSWVANNILPHHPQTIFRYIVLGNE  125



>ref|XP_006651673.1| PREDICTED: glucan endo-1,3-beta-glucosidase 7-like [Oryza brachyantha]
Length=343

 Score =   103 bits (258),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 55/123 (45%), Positives = 78/123 (63%), Gaps = 3/123 (2%)
 Frame = +3

Query  42   MEMSLRPSPIFLFFLVSAFLFIHGVRS-IGVNYGTLGDNLPPPTEVARFLKEKTVIDRIK  218
            ME   R   + L FL+  F+ +   +S IGVNYG + DNLP P E  + LK  T I +++
Sbjct  1    MEAEARKPLLVLAFLLCCFVGVSTAQSYIGVNYGEVADNLPAPEETVKLLK-STTISKVR  59

Query  219  IFDVNPDILRAFAGTGILVTVTVPNGEIIPL-KDAGYAAQWVAANIKPFYPATKINIIAV  395
            ++ V+P I+RA AGTGI + V V NGEI  L  D   A++W+AAN+ PF PA+ I+++AV
Sbjct  60   LYGVDPAIMRALAGTGISIVVGVANGEIPSLAADPAAASRWLAANVLPFVPASTISVVAV  119

Query  396  GQR  404
            G  
Sbjct  120  GNE  122



>ref|NP_001050864.2| Os03g0669300 [Oryza sativa Japonica Group]
 dbj|BAF12778.2| Os03g0669300 [Oryza sativa Japonica Group]
Length=202

 Score =   101 bits (252),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 53/123 (43%), Positives = 75/123 (61%), Gaps = 5/123 (4%)
 Frame = +3

Query  48   MSLRPSPIFLFFLVSAFLFIHGVRS---IGVNYGTLGDNLPPPTEVARFLKEKTVIDRIK  218
            M      + L   VS   F+   R+   IGVNYG + DNLP P E A+ LK  T I +++
Sbjct  1    MEAESRKLLLALAVSLCCFVAASRAQSYIGVNYGEVADNLPAPEETAKLLK-STTISKVR  59

Query  219  IFDVNPDILRAFAGTGILVTVTVPNGEIIPL-KDAGYAAQWVAANIKPFYPATKINIIAV  395
            ++ V+P I+RA AGTGI + V V NG+I  L  D   A++W+AAN+ PF PA+ I+++AV
Sbjct  60   LYGVDPGIMRALAGTGISLVVGVANGDIPSLAADPAAASRWLAANVLPFVPASTISVVAV  119

Query  396  GQR  404
            G  
Sbjct  120  GNE  122



>ref|XP_006424832.1| hypothetical protein CICLE_v10028241mg [Citrus clementina]
 ref|XP_006488329.1| PREDICTED: glucan endo-1,3-beta-glucosidase-like isoform X1 [Citrus 
sinensis]
 gb|ESR38072.1| hypothetical protein CICLE_v10028241mg [Citrus clementina]
Length=504

 Score =   105 bits (261),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 53/95 (56%), Positives = 63/95 (66%), Gaps = 0/95 (0%)
 Frame = +3

Query  120  SIGVNYGTLGDNLPPPTEVARFLKEKTVIDRIKIFDVNPDILRAFAGTGILVTVTVPNGE  299
            SIGVNYG + +NLPPP +VA FLK +T IDR+K+FD NP+ LRAFA T I VTVTV NG+
Sbjct  31   SIGVNYGAIANNLPPPQQVANFLKTQTTIDRVKLFDANPEFLRAFAHTNIPVTVTVGNGD  90

Query  300  IIPLKDAGYAAQWVAANIKPFYPATKINIIAVGQR  404
            I  L     A  WVA NI P +P T    I +G  
Sbjct  91   IPALAKLPAAQSWVANNILPHHPQTIFRYIVLGNE  125



>ref|XP_006488330.1| PREDICTED: glucan endo-1,3-beta-glucosidase-like isoform X2 [Citrus 
sinensis]
Length=502

 Score =   104 bits (260),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 53/95 (56%), Positives = 63/95 (66%), Gaps = 0/95 (0%)
 Frame = +3

Query  120  SIGVNYGTLGDNLPPPTEVARFLKEKTVIDRIKIFDVNPDILRAFAGTGILVTVTVPNGE  299
            SIGVNYG + +NLPPP +VA FLK +T IDR+K+FD NP+ LRAFA T I VTVTV NG+
Sbjct  31   SIGVNYGAIANNLPPPQQVANFLKTQTTIDRVKLFDANPEFLRAFAHTNIPVTVTVGNGD  90

Query  300  IIPLKDAGYAAQWVAANIKPFYPATKINIIAVGQR  404
            I  L     A  WVA NI P +P T    I +G  
Sbjct  91   IPALAKLPAAQSWVANNILPHHPQTIFRYIVLGNE  125



>ref|XP_006658422.1| PREDICTED: glucan endo-1,3-beta-glucosidase-like [Oryza brachyantha]
Length=471

 Score =   104 bits (259),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 60/94 (64%), Positives = 70/94 (74%), Gaps = 0/94 (0%)
 Frame = +3

Query  123  IGVNYGTLGDNLPPPTEVARFLKEKTVIDRIKIFDVNPDILRAFAGTGILVTVTVPNGEI  302
            IGVNYGT GDNLPPP  VA FL  +T IDR+K+FD NPDI++AFAGTGI V VT  NG+I
Sbjct  34   IGVNYGTKGDNLPPPATVAAFLANRTRIDRVKLFDTNPDIVKAFAGTGITVMVTAGNGDI  93

Query  303  IPLKDAGYAAQWVAANIKPFYPATKINIIAVGQR  404
              L     AA WVAANI P+YPAT I+++AVG  
Sbjct  94   PTLGTKDGAAAWVAANIAPYYPATDISLVAVGNE  127



>ref|XP_011075984.1| PREDICTED: glucan endo-1,3-beta-glucosidase [Sesamum indicum]
Length=396

 Score =   103 bits (257),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 53/103 (51%), Positives = 71/103 (69%), Gaps = 1/103 (1%)
 Frame = +3

Query  99   LFIHGVR-SIGVNYGTLGDNLPPPTEVARFLKEKTVIDRIKIFDVNPDILRAFAGTGILV  275
             F+ GV+ SIGVNYGT  DNLPPP++VARFL + TVI R+++FD + + LRAFAGTGI +
Sbjct  31   FFLFGVKGSIGVNYGTEADNLPPPSKVARFLLDSTVIRRVRVFDADREKLRAFAGTGIAI  90

Query  276  TVTVPNGEIIPLKDAGYAAQWVAANIKPFYPATKINIIAVGQR  404
            T+T+PN +I  L +  +A +WV   + P   AT I  I VG  
Sbjct  91   TITIPNDQIPHLTNLTFAQEWVKDILLPHTRATNIVRILVGNE  133



>ref|NP_181494.1| glycosyl hydrolase-17 [Arabidopsis thaliana]
 gb|AAB97119.1| putative beta-1,3-glucanase [Arabidopsis thaliana]
 gb|AAM14919.1| putative beta-1,3-glucanase [Arabidopsis thaliana]
 gb|AEC09701.1| glycosyl hydrolase-17 [Arabidopsis thaliana]
Length=549

 Score =   104 bits (260),  Expect = 6e-23, Method: Composition-based stats.
 Identities = 54/110 (49%), Positives = 68/110 (62%), Gaps = 2/110 (2%)
 Frame = +3

Query  72   FLFFLVSAFLFIHGVRS-IGVNYGTLGDNLPPPTEVARFLKEKTVIDRIKIFDVNPDILR  248
            FL  +      +  V S IG+NYGTLG NL PP +V  F+K KT  D +KI+D NPDILR
Sbjct  12   FLLIVAGVIFQLSAVTSAIGINYGTLG-NLQPPQQVVDFIKTKTTFDSVKIYDANPDILR  70

Query  249  AFAGTGILVTVTVPNGEIIPLKDAGYAAQWVAANIKPFYPATKINIIAVG  398
            AFAG+ I +T+ VPNG I  + +   A QWVAAN+ PF    K   + VG
Sbjct  71   AFAGSEINITIMVPNGNIPAMVNVANARQWVAANVLPFQQQIKFKYVCVG  120



>ref|XP_006307574.1| hypothetical protein CARUB_v10009196mg [Capsella rubella]
 gb|EOA40472.1| hypothetical protein CARUB_v10009196mg [Capsella rubella]
Length=431

 Score =   103 bits (256),  Expect = 8e-23, Method: Compositional matrix adjust.
 Identities = 53/123 (43%), Positives = 72/123 (59%), Gaps = 3/123 (2%)
 Frame = +3

Query  42   MEMSL--RPSPIFLFFLVSAFLFIHGVRSIGVNYGTLGDNLPPPTEVARFLKEKTVIDRI  215
            ME+++  R SPI    L   F+F   + SIGVNYG +GDNLPPP+EV   +K      ++
Sbjct  1    MELNIFHRSSPILFLLLSVTFIFPTAITSIGVNYGQIGDNLPPPSEVIPLIKSIGAT-KV  59

Query  216  KIFDVNPDILRAFAGTGILVTVTVPNGEIIPLKDAGYAAQWVAANIKPFYPATKINIIAV  395
            K++D NP IL+AFA TGI   V + N  +  +KD   A  W+  N+ PF PAT I  I +
Sbjct  60   KLYDANPQILKAFANTGIEFIVGLGNEYLSKMKDPSKALTWIKQNVTPFLPATNITCITI  119

Query  396  GQR  404
            G  
Sbjct  120  GNE  122



>ref|XP_007201010.1| hypothetical protein PRUPE_ppa005375mg [Prunus persica]
 gb|EMJ02209.1| hypothetical protein PRUPE_ppa005375mg [Prunus persica]
Length=464

 Score =   103 bits (257),  Expect = 8e-23, Method: Compositional matrix adjust.
 Identities = 54/119 (45%), Positives = 73/119 (61%), Gaps = 2/119 (2%)
 Frame = +3

Query  51   SLRPSPIFLFFLVSAFLFIHGVRSIGVNYGTLGDNLPPPTEVARFLKEKTVIDRIKIFDV  230
            SL   PIFLF L +AF        IGVNYG + DNLPPP   A+ L + T I R++++  
Sbjct  3    SLSHLPIFLFLLFTAFYSAASQSFIGVNYGQVADNLPPPAATAKLL-QSTSIKRVRLYGA  61

Query  231  NPDILRAFAGTGILVTVTVPNGEIIPL-KDAGYAAQWVAANIKPFYPATKINIIAVGQR  404
            +P I++A AGTGI + +   NG+I  L  D   AAQWV +N+  FYPA+ I++I VG  
Sbjct  62   DPAIIKALAGTGIAIAIGASNGDIPALASDPNAAAQWVNSNVLAFYPASNIDLINVGNE  120



>gb|EMS59735.1| Glucan endo-1,3-beta-glucosidase 11 [Triticum urartu]
Length=419

 Score =   102 bits (255),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 53/119 (45%), Positives = 73/119 (61%), Gaps = 2/119 (2%)
 Frame = +3

Query  51   SLRPSPIFLFFLVSAFLFIHGVRSIGVNYGTLGDNLPPPTEVARFLKEKTVIDRIKIFDV  230
            SL+ S +    L S    +    +IG+NYG +G+NLP P +V   L    V  +++I+DV
Sbjct  12   SLQLSALLCVLLFSEVWVLQCSAAIGINYGQVGNNLPTPAQVVSLLSSLRV-GKVRIYDV  70

Query  231  NPDILRAFAGTGILVTVTVPNGEIIPL-KDAGYAAQWVAANIKPFYPATKINIIAVGQR  404
             P +L AFAGTGI + VTVPN  + P+   AG A QW  ANIKP++PAT++  IAVG  
Sbjct  71   TPQVLAAFAGTGIELIVTVPNDLVQPMAASAGQAMQWATANIKPYFPATRVTGIAVGNE  129



>ref|XP_010925707.1| PREDICTED: glucan endo-1,3-beta-glucosidase 11-like isoform X2 
[Elaeis guineensis]
Length=385

 Score =   102 bits (253),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 55/115 (48%), Positives = 72/115 (63%), Gaps = 3/115 (3%)
 Frame = +3

Query  66   PIFLFF--LVSAFLFIHGVRSIGVNYGTLGDNLPPPTEVARFLKEKTVIDRIKIFDVNPD  239
            PIFL F  L S F FI    ++G+NYG + +NLP P +V   L     I +I+I+D NP 
Sbjct  13   PIFLLFNLLSSEFGFIQLGSTLGINYGQVANNLPSPEQVLTLLTSLR-ISKIRIYDTNPQ  71

Query  240  ILRAFAGTGILVTVTVPNGEIIPLKDAGYAAQWVAANIKPFYPATKINIIAVGQR  404
            +L AFA +GI + VTVPN  +  + D   A QWV  NIKP++PATKI+ IAVG  
Sbjct  72   VLTAFANSGIDLMVTVPNEVVAQVTDPRQALQWVMTNIKPYFPATKISGIAVGNE  126



>ref|XP_010925705.1| PREDICTED: glucan endo-1,3-beta-glucosidase 11-like isoform X1 
[Elaeis guineensis]
Length=398

 Score =   102 bits (253),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 55/115 (48%), Positives = 72/115 (63%), Gaps = 3/115 (3%)
 Frame = +3

Query  66   PIFLFF--LVSAFLFIHGVRSIGVNYGTLGDNLPPPTEVARFLKEKTVIDRIKIFDVNPD  239
            PIFL F  L S F FI    ++G+NYG + +NLP P +V   L     I +I+I+D NP 
Sbjct  13   PIFLLFNLLSSEFGFIQLGSTLGINYGQVANNLPSPEQVLTLLTSLR-ISKIRIYDTNPQ  71

Query  240  ILRAFAGTGILVTVTVPNGEIIPLKDAGYAAQWVAANIKPFYPATKINIIAVGQR  404
            +L AFA +GI + VTVPN  +  + D   A QWV  NIKP++PATKI+ IAVG  
Sbjct  72   VLTAFANSGIDLMVTVPNEVVAQVTDPRQALQWVMTNIKPYFPATKISGIAVGNE  126



>ref|XP_010063141.1| PREDICTED: glucan endo-1,3-beta-D-glucosidase-like [Eucalyptus 
grandis]
 gb|KCW70332.1| hypothetical protein EUGRSUZ_F03575 [Eucalyptus grandis]
Length=465

 Score =   102 bits (254),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 52/100 (52%), Positives = 71/100 (71%), Gaps = 2/100 (2%)
 Frame = +3

Query  108  HGVRSIGVNYGTLGDNLPPPTEVARFLKEKTVIDRIKIFDVNPDILRAFAGTGILVTVTV  287
            HGV ++GVNYGT+G+NL PP +VA+ L + T+IDR+KI+D NPDIL AF+ TGI + V V
Sbjct  22   HGVSAVGVNYGTIGNNLLPPKKVAQLL-QSTLIDRVKIYDSNPDILDAFSNTGIDLVVAV  80

Query  288  PNGEIIPL-KDAGYAAQWVAANIKPFYPATKINIIAVGQR  404
             N  +  L KD   AA+W+A+ + PF PAT +  +AVG  
Sbjct  81   ENPLVANLSKDPSAAAEWLASRVAPFLPATSVVSVAVGNE  120



>ref|NP_001130652.1| uncharacterized protein LOC100191753 precursor [Zea mays]
 gb|ACF78958.1| unknown [Zea mays]
 gb|ACN34183.1| unknown [Zea mays]
 gb|AFW86789.1| putative O-glycosyl hydrolase family 17 protein [Zea mays]
Length=407

 Score =   102 bits (253),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 51/125 (41%), Positives = 81/125 (65%), Gaps = 9/125 (7%)
 Frame = +3

Query  51   SLRPSPIFLFFLVSAFL-----FIHGVRSIGVNYGTLGDNLPPPTEVARFLKEKTVIDRI  215
            SL P+ + +  L+  FL     F+    ++G+NYG + +NLPPP +V + L     I ++
Sbjct  7    SLGPTALLICALLCTFLSSEVGFVRQATALGINYGQVANNLPPPAQVVQLLSSLR-IGKV  65

Query  216  KIFDVNPDILRAFAGTGILVTVTVPNGEIIP--LKDAGYAAQWVAANIKPFYPATKINII  389
            +I+DVNP +L AFAGTGI + VTVP+ +++P     A  A QWV+A+++P++PAT++  I
Sbjct  66   RIYDVNPQVLTAFAGTGIELVVTVPD-DLVPGMASSASQALQWVSASLRPYFPATRVTGI  124

Query  390  AVGQR  404
            AVG  
Sbjct  125  AVGNE  129



>ref|XP_006827757.1| hypothetical protein AMTR_s00009p00263650 [Amborella trichopoda]
 gb|ERM95173.1| hypothetical protein AMTR_s00009p00263650 [Amborella trichopoda]
Length=468

 Score =   102 bits (254),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 52/114 (46%), Positives = 75/114 (66%), Gaps = 1/114 (1%)
 Frame = +3

Query  63   SPIFLFFLVSAFLFIHGVRSIGVNYGTLGDNLPPPTEVARFLKEKTVIDRIKIFDVNPDI  242
            S + L F V+  +    + +IGVNYGT+ +NLPPPT+VA+FLKE T+I+ +K+F ++  I
Sbjct  14   SSLLLLFSVNCIMDTEAI-NIGVNYGTVANNLPPPTQVAKFLKENTLINHVKLFGIDHAI  72

Query  243  LRAFAGTGILVTVTVPNGEIIPLKDAGYAAQWVAANIKPFYPATKINIIAVGQR  404
            ++AFA TGI +TV +PN +I  L+    A QW+  NI P+   TKI  I VG  
Sbjct  73   IQAFANTGIALTVAIPNDQIPSLRRLAIARQWIQINILPYVYTTKIIRILVGNE  126



>ref|XP_002877494.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH53753.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
Length=350

 Score =   101 bits (251),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 49/95 (52%), Positives = 66/95 (69%), Gaps = 1/95 (1%)
 Frame = +3

Query  123  IGVNYGTLGDNLPPPTEVARFLKEKTVIDRIKIFDVNPDILRAFAG-TGILVTVTVPNGE  299
            +GVNYGT+ +NLPPP +V  F+K KT I+ +KIFD NPDIL AF+G T I +TVT+PN +
Sbjct  27   VGVNYGTVANNLPPPHQVVNFIKTKTNINHVKIFDTNPDILAAFSGSTEISLTVTIPNSD  86

Query  300  IIPLKDAGYAAQWVAANIKPFYPATKINIIAVGQR  404
            I+ L     A  W++ ++ PF P T I+ IAVG  
Sbjct  87   ILSLSKLPNARSWLSNHLLPFLPTTSISYIAVGNE  121



>ref|XP_010507244.1| PREDICTED: LOW QUALITY PROTEIN: glucan endo-1,3-beta-glucosidase-like 
[Camelina sativa]
Length=347

 Score =   100 bits (250),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 50/95 (53%), Positives = 65/95 (68%), Gaps = 1/95 (1%)
 Frame = +3

Query  123  IGVNYGTLGDNLPPPTEVARFLKEKTVIDRIKIFDVNPDILRAFAG-TGILVTVTVPNGE  299
            +GVNYGT+ +NLP P +V  F+K KT I+ +KIFD N DIL AF+G TGI +TVT+PN +
Sbjct  27   VGVNYGTVANNLPSPHQVVNFIKTKTNINHVKIFDANADILAAFSGITGISLTVTIPNSD  86

Query  300  IIPLKDAGYAAQWVAANIKPFYPATKINIIAVGQR  404
            I+ L     A  W++ N+ PF PAT I  IAVG  
Sbjct  87   IVSLSKLPNARSWLSYNLLPFLPATSIRYIAVGNE  121



>ref|XP_008783886.1| PREDICTED: glucan endo-1,3-beta-glucosidase 11-like isoform X2 
[Phoenix dactylifera]
Length=384

 Score =   100 bits (250),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 54/116 (47%), Positives = 75/116 (65%), Gaps = 5/116 (4%)
 Frame = +3

Query  66   PIFLFF--LVSAFLFIHGVRSIGVNYGTLGDNLPPPTEVARFLKEKTVIDRIKIFDVNPD  239
            PIFL F    S F F+    ++G+NYG + +NLPPP +V   L   + I + +I+D NP 
Sbjct  13   PIFLLFNLFYSEFGFLQLGSTLGINYGQVANNLPPPEQVVTLLNSLS-ITKTRIYDTNPQ  71

Query  240  ILRAFAGTGILVTVTVPNGEIIP-LKDAGYAAQWVAANIKPFYPATKINIIAVGQR  404
            +L AFA +GI + VTVPN E++P + D   A QWV  NIKP++PAT+I+ IAVG  
Sbjct  72   VLTAFANSGIDLVVTVPN-EVVPQVTDPQQALQWVMTNIKPYFPATRISGIAVGNE  126



>ref|XP_008783885.1| PREDICTED: glucan endo-1,3-beta-glucosidase 11-like isoform X1 
[Phoenix dactylifera]
Length=397

 Score =   100 bits (249),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 52/115 (45%), Positives = 72/115 (63%), Gaps = 3/115 (3%)
 Frame = +3

Query  66   PIFLFF--LVSAFLFIHGVRSIGVNYGTLGDNLPPPTEVARFLKEKTVIDRIKIFDVNPD  239
            PIFL F    S F F+    ++G+NYG + +NLPPP +V   L   + I + +I+D NP 
Sbjct  13   PIFLLFNLFYSEFGFLQLGSTLGINYGQVANNLPPPEQVVTLLNSLS-ITKTRIYDTNPQ  71

Query  240  ILRAFAGTGILVTVTVPNGEIIPLKDAGYAAQWVAANIKPFYPATKINIIAVGQR  404
            +L AFA +GI + VTVPN  +  + D   A QWV  NIKP++PAT+I+ IAVG  
Sbjct  72   VLTAFANSGIDLVVTVPNEVVPQVTDPQQALQWVMTNIKPYFPATRISGIAVGNE  126



>ref|XP_010671896.1| PREDICTED: glucan endo-1,3-beta-glucosidase [Beta vulgaris subsp. 
vulgaris]
Length=359

 Score =   100 bits (249),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 49/101 (49%), Positives = 65/101 (64%), Gaps = 1/101 (1%)
 Frame = +3

Query  105  IHGVRS-IGVNYGTLGDNLPPPTEVARFLKEKTVIDRIKIFDVNPDILRAFAGTGILVTV  281
            + G+ S IGVNYG   DNLPPP EVA+FL + T+I+ I++FD NPD L+AFA TGI +TV
Sbjct  5    VKGIESNIGVNYGMQADNLPPPNEVAKFLLDSTIINHIRLFDANPDTLQAFAHTGIAITV  64

Query  282  TVPNGEIIPLKDAGYAAQWVAANIKPFYPATKINIIAVGQR  404
            T+PN  I    +  +A +W+  NI     +T I  I VG  
Sbjct  65   TIPNDLIPQFTNFTFAQEWIKTNISSHVHSTNIKRILVGNE  105



>ref|XP_002881667.1| glycosyl hydrolase family 17 protein [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH57926.1| glycosyl hydrolase family 17 protein [Arabidopsis lyrata subsp. 
lyrata]
Length=549

 Score =   102 bits (253),  Expect = 6e-22, Method: Composition-based stats.
 Identities = 53/115 (46%), Positives = 70/115 (61%), Gaps = 9/115 (8%)
 Frame = +3

Query  78   FFLVSAFLFIHGV--------RSIGVNYGTLGDNLPPPTEVARFLKEKTVIDRIKIFDVN  233
            FF +   L + GV         +IG+NYGTLG NL PP +V  F+K+ T    +KI+D N
Sbjct  7    FFTLPFLLIVAGVIFQLSAVTSAIGINYGTLG-NLQPPQQVVDFIKKNTTFASVKIYDAN  65

Query  234  PDILRAFAGTGILVTVTVPNGEIIPLKDAGYAAQWVAANIKPFYPATKINIIAVG  398
            PDILR+FAG+ I VT+ VPNG I  + +   A QWVAAN+ PF+   K   + VG
Sbjct  66   PDILRSFAGSEINVTIMVPNGNIPAMVNVANARQWVAANVLPFHQQIKFKYLCVG  120



>gb|ABK24695.1| unknown [Picea sitchensis]
Length=485

 Score =   100 bits (250),  Expect = 8e-22, Method: Compositional matrix adjust.
 Identities = 52/107 (49%), Positives = 66/107 (62%), Gaps = 1/107 (1%)
 Frame = +3

Query  84   LVSAFLFIHGVRSIGVNYGTLGDNLPPPTEVARFLKEKTVIDRIKIFDVNPDILRAFAGT  263
            LV          +IGVNYG +GDNLPPP+EVA+FL + T ID++K+FD +P +L+AFA T
Sbjct  14   LVLVLCIFFTAEAIGVNYGRMGDNLPPPSEVAKFL-QTTNIDKVKLFDADPSVLQAFADT  72

Query  264  GILVTVTVPNGEIIPLKDAGYAAQWVAANIKPFYPATKINIIAVGQR  404
             I V V V N EI  L     A  WV  N+ P+ PAT I  I+VG  
Sbjct  73   NITVVVAVANDEIPALNKLPAAQDWVKKNVAPYVPATNIIAISVGNE  119



>emb|CBI30910.3| unnamed protein product [Vitis vinifera]
Length=375

 Score = 99.8 bits (247),  Expect = 8e-22, Method: Compositional matrix adjust.
 Identities = 54/117 (46%), Positives = 72/117 (62%), Gaps = 6/117 (5%)
 Frame = +3

Query  69   IFLFFLVSAFLF-----IHGVRSIGVNYGTLGDNLPPPTEVARFLKEKTVIDRIKIFDVN  233
            +F  F++SA  F     + GV S G+NYG +G+NLP P +V   L     I + KI+D N
Sbjct  11   MFHAFILSALFFSDCGFLRGVASFGINYGQIGNNLPQPEKVLDLLSSLK-ITKTKIYDTN  69

Query  234  PDILRAFAGTGILVTVTVPNGEIIPLKDAGYAAQWVAANIKPFYPATKINIIAVGQR  404
            P IL AFA +GI + VTV N ++  L D   A QWV++ IKP++PATKI  IAVG  
Sbjct  70   PQILTAFANSGIELIVTVENDKLSDLTDPQQALQWVSSRIKPYFPATKITGIAVGNE  126



>ref|XP_006855691.1| hypothetical protein AMTR_s00044p00136160 [Amborella trichopoda]
 gb|ERN17158.1| hypothetical protein AMTR_s00044p00136160 [Amborella trichopoda]
Length=251

 Score = 98.6 bits (244),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 56/117 (48%), Positives = 71/117 (61%), Gaps = 5/117 (4%)
 Frame = +3

Query  60   PSPIFLFFLVSAFLFIHGVRSIGVNYGTLGDNLPPPTEVARFLKEKTVIDRIKIFDVNPD  239
            PS    FFL+  FL +     IG+NYGT+G NLP P   A  L+  T+ID++KI+D NP 
Sbjct  4    PSLAASFFLL--FLTLQRASGIGMNYGTMGTNLPSPKHAAAVLQH-TLIDKVKIYDTNPT  60

Query  240  ILRAFAGTGILVTVTVPNGEIIPLKDAG--YAAQWVAANIKPFYPATKINIIAVGQR  404
            IL+AFA TGI V VTV N  I  L   G   AA W ++ + PF PAT I +I+VG  
Sbjct  61   ILQAFANTGISVAVTVENALIQNLSTGGPPAAADWFSSQVAPFLPATPITLISVGNE  117



>ref|XP_002270153.2| PREDICTED: glucan endo-1,3-beta-glucosidase 11 [Vitis vinifera]
Length=403

 Score = 99.8 bits (247),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 54/117 (46%), Positives = 72/117 (62%), Gaps = 6/117 (5%)
 Frame = +3

Query  69   IFLFFLVSAFLF-----IHGVRSIGVNYGTLGDNLPPPTEVARFLKEKTVIDRIKIFDVN  233
            +F  F++SA  F     + GV S G+NYG +G+NLP P +V   L     I + KI+D N
Sbjct  11   MFHAFILSALFFSDCGFLRGVASFGINYGQIGNNLPQPEKVLDLLSSLK-ITKTKIYDTN  69

Query  234  PDILRAFAGTGILVTVTVPNGEIIPLKDAGYAAQWVAANIKPFYPATKINIIAVGQR  404
            P IL AFA +GI + VTV N ++  L D   A QWV++ IKP++PATKI  IAVG  
Sbjct  70   PQILTAFANSGIELIVTVENDKLSDLTDPQQALQWVSSRIKPYFPATKITGIAVGNE  126



>ref|XP_009406752.1| PREDICTED: glucan endo-1,3-beta-glucosidase 7-like [Musa acuminata 
subsp. malaccensis]
Length=462

 Score =   100 bits (248),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 58/130 (45%), Positives = 76/130 (58%), Gaps = 5/130 (4%)
 Frame = +3

Query  48   MSLRPSPIFLFFLVSAFLFIHGVRS---IGVNYGTLGDNLPPPTEVARFLKEKTVIDRIK  218
            M+LR S   +    S FL +   +S   IGVNYG + DNLPPP E AR LK  T I +++
Sbjct  1    MALRNSLSIVIAAWSLFLAVPFAKSQSFIGVNYGQVADNLPPPEETARLLK-STTISKVR  59

Query  219  IFDVNPDILRAFAGTGILVTVTVPNGEIIPL-KDAGYAAQWVAANIKPFYPATKINIIAV  395
            ++  +P ILRA AGT I V +   NG+I  L  D   A  WV+AN+ PF PAT I+++AV
Sbjct  60   LYGADPAILRALAGTDISVVIGAANGDIASLASDPSAATNWVSANVLPFVPATSISVVAV  119

Query  396  GQRGSPLGHA  425
            G      G A
Sbjct  120  GNEALTSGDA  129



>gb|EAY91326.1| hypothetical protein OsI_12942 [Oryza sativa Indica Group]
Length=464

 Score =   100 bits (248),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 53/123 (43%), Positives = 75/123 (61%), Gaps = 5/123 (4%)
 Frame = +3

Query  48   MSLRPSPIFLFFLVSAFLFIHGVRS---IGVNYGTLGDNLPPPTEVARFLKEKTVIDRIK  218
            M      + L   VS   F+   R+   IGVNYG + DNLP P E A+ LK  T I +++
Sbjct  1    MEAESRKLLLALAVSLCCFVAASRAQSYIGVNYGEVADNLPAPEETAKLLK-STTISKVR  59

Query  219  IFDVNPDILRAFAGTGILVTVTVPNGEIIPL-KDAGYAAQWVAANIKPFYPATKINIIAV  395
            ++ V+P I+RA AGTGI + V V NG+I  L  D   A++W+AAN+ PF PA+ I+++AV
Sbjct  60   LYGVDPGIMRALAGTGISLVVGVANGDIPSLAADPAAASRWLAANVLPFVPASTISVVAV  119

Query  396  GQR  404
            G  
Sbjct  120  GNE  122



>gb|AAP44659.1| putative beta 1,3-glucanase [Oryza sativa Japonica Group]
 gb|ABF98103.1| Glucan endo-1,3-beta-glucosidase 7 precursor, putative, expressed 
[Oryza sativa Japonica Group]
 gb|EEE63416.1| hypothetical protein OsJ_18228 [Oryza sativa Japonica Group]
Length=464

 Score =   100 bits (248),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 53/123 (43%), Positives = 75/123 (61%), Gaps = 5/123 (4%)
 Frame = +3

Query  48   MSLRPSPIFLFFLVSAFLFIHGVRS---IGVNYGTLGDNLPPPTEVARFLKEKTVIDRIK  218
            M      + L   VS   F+   R+   IGVNYG + DNLP P E A+ LK  T I +++
Sbjct  1    MEAESRKLLLALAVSLCCFVAASRAQSYIGVNYGEVADNLPAPEETAKLLK-STTISKVR  59

Query  219  IFDVNPDILRAFAGTGILVTVTVPNGEIIPL-KDAGYAAQWVAANIKPFYPATKINIIAV  395
            ++ V+P I+RA AGTGI + V V NG+I  L  D   A++W+AAN+ PF PA+ I+++AV
Sbjct  60   LYGVDPGIMRALAGTGISLVVGVANGDIPSLAADPAAASRWLAANVLPFVPASTISVVAV  119

Query  396  GQR  404
            G  
Sbjct  120  GNE  122



>ref|XP_008236880.1| PREDICTED: glucan endo-1,3-beta-glucosidase 7 [Prunus mume]
Length=463

 Score = 99.4 bits (246),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 52/119 (44%), Positives = 71/119 (60%), Gaps = 2/119 (2%)
 Frame = +3

Query  51   SLRPSPIFLFFLVSAFLFIHGVRSIGVNYGTLGDNLPPPTEVARFLKEKTVIDRIKIFDV  230
            SL   PIFL  L +AF        IGVNYG + DNLPPP   A+ L + T I R++++  
Sbjct  3    SLSHLPIFLSLLFTAFYSAASQSFIGVNYGQVADNLPPPAATAKLL-QSTAIKRVRLYGA  61

Query  231  NPDILRAFAGTGILVTVTVPNGEIIPL-KDAGYAAQWVAANIKPFYPATKINIIAVGQR  404
            +P I++A AGTGI + +   NG+I  L  D   AAQWV +N+  FYP + I++I VG  
Sbjct  62   DPAIIKALAGTGIAIAIGASNGDIPALASDPNAAAQWVNSNVLAFYPTSNIDLINVGNE  120



>ref|XP_010227646.1| PREDICTED: glucan endo-1,3-beta-glucosidase 14-like [Brachypodium 
distachyon]
Length=407

 Score = 98.6 bits (244),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 48/96 (50%), Positives = 66/96 (69%), Gaps = 2/96 (2%)
 Frame = +3

Query  120  SIGVNYGTLGDNLPPPTEVARFLKEKTVIDRIKIFDVNPDILRAFAGTGILVTVTVPNGE  299
            +IG+NYG +G+NLP PT+V   L    V  +++I+DVNP +L AF+GTGI + VTVPN  
Sbjct  35   AIGINYGQVGNNLPTPTQVVSLLSSLRV-GKVRIYDVNPQVLSAFSGTGIELIVTVPNDL  93

Query  300  IIPL-KDAGYAAQWVAANIKPFYPATKINIIAVGQR  404
            + P+    G A QWV ANIKP++PAT+   +AVG  
Sbjct  94   VQPMAASTGQALQWVTANIKPYFPATRFTGVAVGNE  129



>emb|CAB80165.1| putative protein (fragment) [Arabidopsis thaliana]
Length=356

 Score = 98.2 bits (243),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 49/120 (41%), Positives = 73/120 (61%), Gaps = 2/120 (2%)
 Frame = +3

Query  48   MSLRPSPIFLFFLVSAFLFIHGVRSIGVNYGTLGDNLPPPTEVARFLKEKTVIDRIKIFD  227
            M+L  S  FL   +S F   H    IGVNYG + DNLPPP+E  + L + T I +++++ 
Sbjct  1    MALSISIYFLLIFLSHFPSSHAEPFIGVNYGQVADNLPPPSETVKLL-QSTSIQKVRLYG  59

Query  228  VNPDILRAFAGTGILVTVTVPNGEIIPL-KDAGYAAQWVAANIKPFYPATKINIIAVGQR  404
             +P I++A AGTG+ + +   NG++  L  D   A QW+ +N+ PFYPA+KI +I VG  
Sbjct  60   ADPAIIKALAGTGVGIVIGAANGDVPSLASDPNAATQWINSNVLPFYPASKIMLITVGNE  119



>ref|XP_010478704.1| PREDICTED: glucan endo-1,3-beta-glucosidase 11-like [Camelina 
sativa]
Length=419

 Score = 98.6 bits (244),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 53/122 (43%), Positives = 70/122 (57%), Gaps = 2/122 (2%)
 Frame = +3

Query  42   MEM-SLRPSPIFLFFLVSAFLFIHGVRSIGVNYGTLGDNLPPPTEVARFLKEKTVIDRIK  218
            ME+ S R S  FLF L   F+    + SIGVNYG +GDNLP P+EV   +K      ++K
Sbjct  1    MELKSFRRSSSFLFLLSVMFIIPTAIASIGVNYGQIGDNLPSPSEVIPLIKSIGAT-KVK  59

Query  219  IFDVNPDILRAFAGTGILVTVTVPNGEIIPLKDAGYAAQWVAANIKPFYPATKINIIAVG  398
            ++D NP IL+AFA TGI   V + N  +  +KD   A  W+  N+ PF PAT I  I +G
Sbjct  60   LYDANPQILKAFANTGIEFIVGLGNEYLSKMKDPSKALTWIKQNVTPFLPATNITCITIG  119

Query  399  QR  404
              
Sbjct  120  NE  121



>ref|XP_002448791.1| hypothetical protein SORBIDRAFT_06g033250 [Sorghum bicolor]
 gb|EES13119.1| hypothetical protein SORBIDRAFT_06g033250 [Sorghum bicolor]
Length=464

 Score = 99.0 bits (245),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 51/107 (48%), Positives = 68/107 (64%), Gaps = 1/107 (1%)
 Frame = +3

Query  87   VSAFLFIHG-VRSIGVNYGTLGDNLPPPTEVARFLKEKTVIDRIKIFDVNPDILRAFAGT  263
            VSA  F       IGVNYGT G  LP PT+VARFL   T++DR+++ D +P +L+AFAGT
Sbjct  18   VSAITFTGADAGGIGVNYGTRGTTLPAPTDVARFLARDTIVDRVRLLDADPVLLQAFAGT  77

Query  264  GILVTVTVPNGEIIPLKDAGYAAQWVAANIKPFYPATKINIIAVGQR  404
            G+ V VTVPNG +  L    +A +WV  N+ P+  AT I+ + VG  
Sbjct  78   GLAVDVTVPNGVVPRLVSLAFARRWVRDNVAPYAGATNISRLLVGDE  124



>ref|XP_010505644.1| PREDICTED: glucan endo-1,3-beta-glucosidase-like [Camelina sativa]
Length=639

 Score =   100 bits (248),  Expect = 4e-21, Method: Composition-based stats.
 Identities = 49/111 (44%), Positives = 65/111 (59%), Gaps = 1/111 (1%)
 Frame = +3

Query  66   PIFLFFLVSAFLFIHGVRSIGVNYGTLGDNLPPPTEVARFLKEKTVIDRIKIFDVNPDIL  245
            P  L F    F  +    +IG+NYGTLG  L PP +V  F++  T  D +KI+D NP+IL
Sbjct  11   PFLLIFAPVIFQLLAVTSAIGINYGTLG-KLQPPQQVVDFIRTNTNFDSVKIYDANPNIL  69

Query  246  RAFAGTGILVTVTVPNGEIIPLKDAGYAAQWVAANIKPFYPATKINIIAVG  398
            R  AG+ I VT+ VPNG I  + +   A QWVAAN+ PF+   K   + VG
Sbjct  70   RPLAGSNINVTIMVPNGNIPAMVNVANARQWVAANVLPFHKQIKFKYLCVG  120



>gb|EPS68882.1| hypothetical protein M569_05882 [Genlisea aurea]
Length=377

 Score = 95.9 bits (237),  Expect(2) = 6e-21, Method: Compositional matrix adjust.
 Identities = 51/111 (46%), Positives = 69/111 (62%), Gaps = 4/111 (4%)
 Frame = +3

Query  72   FLFFLVSAFLFIHGVRSIGVNYGTLGDNLPPPTEVARFLKEKTVIDRIKIFDVNPDILRA  251
            FLFF     LF  G   +G+NYG +G+NLP P EV + L+    I + +I+D NP IL+A
Sbjct  4    FLFFSGYGGLFAEG---LGINYGQVGNNLPAPEEVLQLLR-SLKISKARIYDTNPQILKA  59

Query  252  FAGTGILVTVTVPNGEIIPLKDAGYAAQWVAANIKPFYPATKINIIAVGQR  404
            FA +G+ +TVTVPN  +  L D   A QWV  N+  ++PAT+I  IAVG  
Sbjct  60   FADSGVEITVTVPNELLYALVDPVQALQWVKTNVGAYFPATRIAGIAVGNE  110


 Score = 31.6 bits (70),  Expect(2) = 6e-21, Method: Compositional matrix adjust.
 Identities = 16/33 (48%), Positives = 22/33 (67%), Gaps = 0/33 (0%)
 Frame = +1

Query  397  GNEVLHWGTPEMQNGLVAAMRSLYNALVKSGIK  495
            GNEV   G  E+ + LV AM S++ ALV+SG+ 
Sbjct  108  GNEVFSGGGTELLSHLVPAMMSIHGALVESGLD  140



>ref|XP_008783477.1| PREDICTED: glucan endo-1,3-beta-glucosidase 7 [Phoenix dactylifera]
Length=464

 Score = 98.2 bits (243),  Expect = 6e-21, Method: Compositional matrix adjust.
 Identities = 56/116 (48%), Positives = 72/116 (62%), Gaps = 7/116 (6%)
 Frame = +3

Query  75   LFFLVSAFL--FIHGVRS---IGVNYGTLGDNLPPPTEVARFLKEKTVIDRIKIFDVNPD  239
            LF  +SA L  F    RS   IGVNYG + DNLPPP   A+ LK  T I +++++  +P 
Sbjct  7    LFLTISALLLAFFSFARSQTFIGVNYGEVADNLPPPEATAKLLK-STTISKVRLYGADPA  65

Query  240  ILRAFAGTGILVTVTVPNGEIIPL-KDAGYAAQWVAANIKPFYPATKINIIAVGQR  404
            ILRA AGT I V +   NG+I  L  D   A++WVAAN+ PF PAT I++IAVG  
Sbjct  66   ILRALAGTNISVIIGAANGDIPSLASDPAAASRWVAANVLPFIPATTISVIAVGNE  121



>ref|NP_195174.6| glucan endo-1,3-beta-glucosidase 7 [Arabidopsis thaliana]
 sp|Q9M069.2|E137_ARATH RecName: Full=Glucan endo-1,3-beta-glucosidase 7; AltName: Full=(1->3)-beta-glucan 
endohydrolase 7; Short=(1->3)-beta-glucanase 
7; AltName: Full=Beta-1,3-endoglucanase 7; Short=Beta-1,3-glucanase 
7; Flags: Precursor [Arabidopsis thaliana]
 gb|AEE86384.1| glucan endo-1,3-beta-glucosidase 7 [Arabidopsis thaliana]
Length=504

 Score = 98.6 bits (244),  Expect = 6e-21, Method: Composition-based stats.
 Identities = 49/118 (42%), Positives = 73/118 (62%), Gaps = 2/118 (2%)
 Frame = +3

Query  48   MSLRPSPIFLFFLVSAFLFIHGVRSIGVNYGTLGDNLPPPTEVARFLKEKTVIDRIKIFD  227
            M+L  S  FL   +S F   H    IGVNYG + DNLPPP+E  + L + T I +++++ 
Sbjct  1    MALSISIYFLLIFLSHFPSSHAEPFIGVNYGQVADNLPPPSETVKLL-QSTSIQKVRLYG  59

Query  228  VNPDILRAFAGTGILVTVTVPNGEIIPL-KDAGYAAQWVAANIKPFYPATKINIIAVG  398
             +P I++A AGTG+ + +   NG++  L  D   A QW+ +N+ PFYPA+KI +I VG
Sbjct  60   ADPAIIKALAGTGVGIVIGAANGDVPSLASDPNAATQWINSNVLPFYPASKIMLITVG  117



>emb|CDY45313.1| BnaA03g52860D [Brassica napus]
Length=892

 Score =   100 bits (248),  Expect = 6e-21, Method: Composition-based stats.
 Identities = 45/110 (41%), Positives = 72/110 (65%), Gaps = 2/110 (2%)
 Frame = +3

Query  72   FLFFLVSAFLFIHGVRSIGVNYGTLGDNLPPPTEVARFLKEKTVIDRIKIFDVNPDILRA  251
             L  ++S F   H    IGVNYG + DNLPPP+E A+ + + T I +++++  +P I++A
Sbjct  9    LLLIVLSQFPSSHAEPFIGVNYGQVADNLPPPSETAKLI-QSTSIQKVRLYGADPAIIKA  67

Query  252  FAGTGILVTVTVPNGEIIPL-KDAGYAAQWVAANIKPFYPATKINIIAVG  398
             AGTG+ + +   NG++  L  D   A+QW+++N+ PFYPA+KI +I VG
Sbjct  68   LAGTGVGIVIGTANGDLPSLAADPNAASQWISSNVLPFYPASKIILITVG  117



>ref|XP_010512954.1| PREDICTED: glucan endo-1,3-beta-glucosidase-like [Camelina sativa]
Length=774

 Score = 99.8 bits (247),  Expect = 6e-21, Method: Composition-based stats.
 Identities = 52/121 (43%), Positives = 73/121 (60%), Gaps = 3/121 (2%)
 Frame = +3

Query  42   MEMSLRPSPIFLFFLVSAFLF--IHGVRSIGVNYGTLGDNLPPPTEVARFLKEKTVIDRI  215
            M  + R S +    +V+  +F  +    +IG+NYGTLG  L PP +V  F++ KT  D +
Sbjct  1    MAKTTRCSTLPFLLIVAPVIFQLLAVTSAIGINYGTLG-KLQPPQKVVDFIRTKTNFDSV  59

Query  216  KIFDVNPDILRAFAGTGILVTVTVPNGEIIPLKDAGYAAQWVAANIKPFYPATKINIIAV  395
            KI+D NP+ILRA AG+ I VT+ VPNG I  + +   A QWVAAN+ PF+   K   + V
Sbjct  60   KIYDANPNILRALAGSEINVTIMVPNGNIPAMVNVANARQWVAANVLPFHKQIKFKYLCV  119

Query  396  G  398
            G
Sbjct  120  G  120



>ref|XP_010461089.1| PREDICTED: glucan endo-1,3-beta-glucosidase 11 [Camelina sativa]
Length=428

 Score = 97.8 bits (242),  Expect = 7e-21, Method: Compositional matrix adjust.
 Identities = 52/122 (43%), Positives = 70/122 (57%), Gaps = 2/122 (2%)
 Frame = +3

Query  42   MEM-SLRPSPIFLFFLVSAFLFIHGVRSIGVNYGTLGDNLPPPTEVARFLKEKTVIDRIK  218
            ME+ S R S  F+F L   F+    + SIGVNYG +GDNLP P+EV   +K      ++K
Sbjct  1    MELKSFRRSSSFIFLLSVTFIIPTAIASIGVNYGQIGDNLPSPSEVIPLIKSIGAT-KVK  59

Query  219  IFDVNPDILRAFAGTGILVTVTVPNGEIIPLKDAGYAAQWVAANIKPFYPATKINIIAVG  398
            ++D NP IL+AFA TGI   V + N  +  +KD   A  W+  N+ PF PAT I  I +G
Sbjct  60   LYDANPQILKAFANTGIEFIVGLGNEYLSKMKDPSKALTWIKQNVTPFLPATNITCITIG  119

Query  399  QR  404
              
Sbjct  120  NE  121



>tpg|DAA35302.1| TPA: putative O-glycosyl hydrolase family 17 protein [Zea mays]
Length=450

 Score = 97.8 bits (242),  Expect = 7e-21, Method: Compositional matrix adjust.
 Identities = 47/94 (50%), Positives = 63/94 (67%), Gaps = 0/94 (0%)
 Frame = +3

Query  123  IGVNYGTLGDNLPPPTEVARFLKEKTVIDRIKIFDVNPDILRAFAGTGILVTVTVPNGEI  302
            IGVNYGT G  LP P +VARFL   T+ DR+++ D +P +LRAFAGTG+ V VTVPNG +
Sbjct  29   IGVNYGTRGTTLPAPADVARFLARDTIFDRVRLLDADPVLLRAFAGTGLAVDVTVPNGVV  88

Query  303  IPLKDAGYAAQWVAANIKPFYPATKINIIAVGQR  404
              L +  +A +WV  N+ P+  AT I+ + VG  
Sbjct  89   PHLLNLTFARRWVRDNVTPYAGATNISRLLVGDE  122



>ref|XP_010499813.1| PREDICTED: glucan endo-1,3-beta-glucosidase 11-like [Camelina 
sativa]
Length=430

 Score = 97.8 bits (242),  Expect = 7e-21, Method: Compositional matrix adjust.
 Identities = 52/122 (43%), Positives = 70/122 (57%), Gaps = 2/122 (2%)
 Frame = +3

Query  42   MEM-SLRPSPIFLFFLVSAFLFIHGVRSIGVNYGTLGDNLPPPTEVARFLKEKTVIDRIK  218
            ME+ S R S  F+F L   F+    + SIGVNYG +GDNLP P+EV   +K      ++K
Sbjct  1    MELKSFRRSSSFIFLLSVTFIIPTAIASIGVNYGQIGDNLPSPSEVIPLIKSIGAT-KVK  59

Query  219  IFDVNPDILRAFAGTGILVTVTVPNGEIIPLKDAGYAAQWVAANIKPFYPATKINIIAVG  398
            ++D NP IL+AFA TGI   V + N  +  +KD   A  W+  N+ PF PAT I  I +G
Sbjct  60   LYDANPQILKAFANTGIEFIVGLGNEYLSKMKDPSKALTWIKQNVTPFLPATNITCITIG  119

Query  399  QR  404
              
Sbjct  120  NE  121



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 552737873190