BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFF037M24

Length=585
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_002521172.1|  diphosphomevalonate decarboxylase, putative        256   5e-80   Ricinus communis
gb|KDO47061.1|  hypothetical protein CISIN_1g014714mg                   248   5e-79   Citrus sinensis [apfelsine]
ref|XP_011024216.1|  PREDICTED: diphosphomevalonate decarboxylase...    252   2e-78   Populus euphratica
gb|KJB78631.1|  hypothetical protein B456_013G012400                    247   5e-78   Gossypium raimondii
gb|KDO47060.1|  hypothetical protein CISIN_1g014714mg                   248   1e-77   Citrus sinensis [apfelsine]
ref|XP_002315441.1|  mevalonate disphosphate decarboxylase family...    250   1e-77   Populus trichocarpa [western balsam poplar]
gb|KJB78632.1|  hypothetical protein B456_013G012400                    247   2e-77   Gossypium raimondii
dbj|BAF98285.1|  diphosphomevelonate decarboxylase                      249   2e-77   Hevea brasiliensis [jebe]
gb|AAL18927.1|AF429386_1  mevalonate disphosphate decarboxylase         249   3e-77   Hevea brasiliensis [jebe]
gb|AII99848.1|  mevalonate disphosphate decarboxylase                   249   3e-77   Nicotiana tabacum [American tobacco]
ref|XP_009792788.1|  PREDICTED: diphosphomevalonate decarboxylase...    249   3e-77   Nicotiana sylvestris
ref|XP_009619582.1|  PREDICTED: diphosphomevalonate decarboxylase...    249   3e-77   Nicotiana tomentosiformis
gb|KDP35789.1|  hypothetical protein JCGZ_10425                         248   3e-77   Jatropha curcas
ref|XP_011032862.1|  PREDICTED: diphosphomevalonate decarboxylase...    248   4e-77   Populus euphratica
gb|ADR65113.1|  mevalonate 5-diphosphate decarboxylase                  248   6e-77   Catharanthus roseus [chatas]
gb|AID51442.1|  mevalonate diphosphate decarboxylase                    248   7e-77   Astragalus membranaceus
gb|KDO47059.1|  hypothetical protein CISIN_1g014714mg                   248   7e-77   Citrus sinensis [apfelsine]
gb|KHG20401.1|  Mvd                                                     248   9e-77   Gossypium arboreum [tree cotton]
ref|XP_009630346.1|  PREDICTED: diphosphomevalonate decarboxylase...    248   1e-76   Nicotiana tomentosiformis
gb|KHG20400.1|  Mvd                                                     249   1e-76   Gossypium arboreum [tree cotton]
ref|XP_002311015.1|  mevalonate disphosphate decarboxylase family...    247   1e-76   Populus trichocarpa [western balsam poplar]
gb|KJB78629.1|  hypothetical protein B456_013G012400                    247   1e-76   Gossypium raimondii
ref|XP_007142839.1|  hypothetical protein PHAVU_007G021200g             247   2e-76   Phaseolus vulgaris [French bean]
emb|CDO99902.1|  unnamed protein product                                246   4e-76   Coffea canephora [robusta coffee]
gb|KEH44325.1|  mevalonate diphosphate decarboxylase                    245   9e-76   Medicago truncatula
ref|XP_009795010.1|  PREDICTED: diphosphomevalonate decarboxylase...    244   1e-75   Nicotiana sylvestris
gb|KHN11470.1|  Diphosphomevalonate decarboxylase                       244   2e-75   Glycine soja [wild soybean]
ref|XP_007010317.1|  Mevalonate diphosphate decarboxylase 1 isofo...    240   2e-75   
ref|XP_006359351.1|  PREDICTED: diphosphomevalonate decarboxylase...    244   2e-75   
ref|XP_003555870.1|  PREDICTED: diphosphomevalonate decarboxylase...    244   3e-75   Glycine max [soybeans]
ref|XP_004497159.1|  PREDICTED: diphosphomevalonate decarboxylase...    244   3e-75   Cicer arietinum [garbanzo]
ref|XP_007010316.1|  GHMP kinase family protein isoform 3               239   6e-75   
ref|XP_006367129.1|  PREDICTED: diphosphomevalonate decarboxylase...    234   6e-75   
gb|EPS58761.1|  hypothetical protein M569_16051                         235   1e-74   Genlisea aurea
ref|XP_008232018.1|  PREDICTED: diphosphomevalonate decarboxylase...    241   2e-74   Prunus mume [ume]
ref|XP_006403598.1|  hypothetical protein EUTSA_v10010411mg             238   3e-74   
ref|XP_007211744.1|  hypothetical protein PRUPE_ppa006290mg             240   5e-74   Prunus persica
ref|XP_007010315.1|  GHMP kinase family protein isoform 2               240   7e-74   
ref|XP_011469322.1|  PREDICTED: diphosphomevalonate decarboxylase       240   7e-74   Fragaria vesca subsp. vesca
ref|XP_007010314.1|  GHMP kinase family protein isoform 1               240   7e-74   
ref|XP_006411092.1|  hypothetical protein EUTSA_v10016888mg             238   8e-74   Eutrema salsugineum [saltwater cress]
ref|XP_010032077.1|  PREDICTED: diphosphomevalonate decarboxylase...    240   8e-74   Eucalyptus grandis [rose gum]
gb|ABG24207.2|  mevalonate disphosphate decarboxylase                   239   2e-73   Arnebia euchroma
ref|XP_006403599.1|  hypothetical protein EUTSA_v10010411mg             238   4e-73   Eutrema salsugineum [saltwater cress]
ref|XP_002266399.1|  PREDICTED: diphosphomevalonate decarboxylase       238   4e-73   Vitis vinifera
gb|KFK36776.1|  hypothetical protein AALP_AA4G169000                    238   4e-73   Arabis alpina [alpine rockcress]
ref|NP_181404.1|  mevalonate diphosphate decarboxylase 1                238   6e-73   Arabidopsis thaliana [mouse-ear cress]
emb|CDY65399.1|  BnaCnng46900D                                          238   7e-73   Brassica napus [oilseed rape]
emb|CDX76157.1|  BnaA04g04210D                                          237   1e-72   
ref|XP_010676219.1|  PREDICTED: diphosphomevalonate decarboxylase...    237   1e-72   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_009139253.1|  PREDICTED: diphosphomevalonate decarboxylase...    237   1e-72   Brassica rapa
ref|XP_011084229.1|  PREDICTED: diphosphomevalonate decarboxylase...    237   1e-72   
ref|XP_006361468.1|  PREDICTED: diphosphomevalonate decarboxylase...    237   1e-72   Solanum tuberosum [potatoes]
ref|NP_001234815.1|  mevalonate disphosphate decarboxylase              237   1e-72   Solanum lycopersicum
emb|CAN82519.1|  hypothetical protein VITISV_042700                     238   1e-72   Vitis vinifera
ref|XP_010088787.1|  Diphosphomevalonate decarboxylase                  236   2e-72   
gb|AEM42974.1|  diphosphomevalonate decarboxylase                       236   2e-72   Siraitia grosvenorii [arhat fruit]
ref|XP_003536712.1|  PREDICTED: diphosphomevalonate decarboxylase...    236   2e-72   Glycine max [soybeans]
ref|XP_010515945.1|  PREDICTED: diphosphomevalonate decarboxylase...    236   3e-72   Camelina sativa [gold-of-pleasure]
ref|XP_006294305.1|  hypothetical protein CARUB_v10023314mg             236   3e-72   Capsella rubella
ref|XP_006391873.1|  hypothetical protein EUTSA_v10023484mg             235   5e-72   Eutrema salsugineum [saltwater cress]
emb|CDX73494.1|  BnaC08g25090D                                          234   1e-71   
ref|XP_010536297.1|  PREDICTED: diphosphomevalonate decarboxylase...    234   1e-71   Tarenaya hassleriana [spider flower]
ref|XP_010536296.1|  PREDICTED: diphosphomevalonate decarboxylase...    234   1e-71   Tarenaya hassleriana [spider flower]
ref|XP_010536295.1|  PREDICTED: diphosphomevalonate decarboxylase...    234   2e-71   Tarenaya hassleriana [spider flower]
gb|ACO35355.1|  mevalonate pyrophosphate decarboxylase                  227   2e-71   Elaeis oleifera
ref|NP_566995.1|  diphosphomevalonate decarboxylase                     234   2e-71   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006445714.1|  hypothetical protein CICLE_v10015368mg             231   2e-71   
gb|ADI80345.1|  mevalonate diphosphate decarboxylase                    234   3e-71   Panax ginseng [Asiatic ginseng]
emb|CAB70999.1|  DIPHOSPHOMEVALONATE DECARBOXYLASE-like protein         233   3e-71   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009116111.1|  PREDICTED: diphosphomevalonate decarboxylase       233   3e-71   Brassica rapa
gb|AEZ55675.1|  mevalonate diphosphate decarboxylase                    233   5e-71   Salvia miltiorrhiza [Chinese salvia]
gb|AGZ15316.1|  mevalonate decarboxylase                                233   6e-71   Platycodon grandiflorus [balloon-flower]
gb|AFM77982.1|  mevalonate diphosphate decarboxylase                    232   1e-70   Eleutherococcus senticosus
ref|XP_006445713.1|  hypothetical protein CICLE_v10015368mg             231   2e-70   Citrus clementina [clementine]
gb|AAM65192.1|  diphosphomevalonate decarboxylase-like protein          231   3e-70   Arabidopsis thaliana [mouse-ear cress]
gb|EYU19776.1|  hypothetical protein MIMGU_mgv1a007068mg                227   6e-70   Erythranthe guttata [common monkey flower]
ref|XP_004236810.1|  PREDICTED: diphosphomevalonate decarboxylase...    230   6e-70   Solanum lycopersicum
ref|XP_008446768.1|  PREDICTED: diphosphomevalonate decarboxylase       229   9e-70   Cucumis melo [Oriental melon]
ref|XP_010244659.1|  PREDICTED: diphosphomevalonate decarboxylase...    229   1e-69   Nelumbo nucifera [Indian lotus]
ref|XP_010907122.1|  PREDICTED: diphosphomevalonate decarboxylase...    229   1e-69   Elaeis guineensis
gb|EEC72316.1|  hypothetical protein OsI_05509                          221   2e-69   Oryza sativa Indica Group [Indian rice]
gb|AAM64988.1|  mevalonate diphosphate decarboxylase                    228   3e-69   Arabidopsis thaliana [mouse-ear cress]
gb|KHN37414.1|  Diphosphomevalonate decarboxylase                       234   3e-69   Glycine soja [wild soybean]
gb|ABV02028.1|  mevalonate diphosphate decarboxylase                    228   3e-69   Nicotiana langsdorffii x Nicotiana sanderae
gb|AEA72605.1|  mevalonate 5-diphosphate decarboxylase                  227   8e-69   Houttuynia cordata [chameleon-plant]
gb|AIK21783.1|  mevalonate diphosphate decarboxylase                    227   1e-68   Panax notoginseng [san-qi]
gb|EYU19775.1|  hypothetical protein MIMGU_mgv1a007068mg                227   1e-68   Erythranthe guttata [common monkey flower]
ref|XP_008345749.1|  PREDICTED: diphosphomevalonate decarboxylase...    227   1e-68   
ref|XP_008788072.1|  PREDICTED: diphosphomevalonate decarboxylase...    225   4e-68   Phoenix dactylifera
gb|EAZ21434.1|  hypothetical protein OsJ_05037                          226   1e-67   Oryza sativa Japonica Group [Japonica rice]
ref|XP_008364764.1|  PREDICTED: diphosphomevalonate decarboxylase...    223   2e-67   
ref|XP_009356125.1|  PREDICTED: diphosphomevalonate decarboxylase       223   3e-67   Pyrus x bretschneideri [bai li]
ref|XP_008356850.1|  PREDICTED: diphosphomevalonate decarboxylase...    223   3e-67   
gb|AFW73866.1|  hypothetical protein ZEAMMB73_421648                    215   3e-67   
gb|ACW83616.2|  mevalonate diphosphate decarboxylase                    222   6e-67   Panax ginseng [Asiatic ginseng]
gb|EEC72312.1|  hypothetical protein OsI_05503                          219   9e-67   Oryza sativa Indica Group [Indian rice]
dbj|BAD27942.1|  putative mevalonate disphosphate decarboxylase         221   2e-66   Oryza sativa Japonica Group [Japonica rice]
gb|EMT01953.1|  Diphosphomevalonate decarboxylase                       222   2e-66   
ref|XP_010427097.1|  PREDICTED: diphosphomevalonate decarboxylase...    221   2e-66   Camelina sativa [gold-of-pleasure]
ref|XP_006291202.1|  hypothetical protein CARUB_v10017330mg             220   5e-66   Capsella rubella
ref|XP_010554524.1|  PREDICTED: diphosphomevalonate decarboxylase...    219   5e-66   Tarenaya hassleriana [spider flower]
emb|CDM86983.1|  unnamed protein product                                219   6e-66   Triticum aestivum [Canadian hard winter wheat]
ref|XP_010505522.1|  PREDICTED: diphosphomevalonate decarboxylase...    219   6e-66   Camelina sativa [gold-of-pleasure]
ref|XP_010509167.1|  PREDICTED: diphosphomevalonate decarboxylase...    219   7e-66   Camelina sativa [gold-of-pleasure]
ref|XP_002877963.1|  hypothetical protein ARALYDRAFT_906831             219   9e-66   Arabidopsis lyrata subsp. lyrata
ref|XP_009404708.1|  PREDICTED: diphosphomevalonate decarboxylase...    219   1e-65   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010504223.1|  PREDICTED: diphosphomevalonate decarboxylase...    219   1e-65   Camelina sativa [gold-of-pleasure]
ref|XP_006646770.1|  PREDICTED: diphosphomevalonate decarboxylase...    218   2e-65   Oryza brachyantha
ref|XP_008665378.1|  PREDICTED: diphosphomevalonate decarboxylase...    217   6e-65   Zea mays [maize]
ref|XP_006836043.1|  hypothetical protein AMTR_s00114p00051110          217   7e-65   Amborella trichopoda
ref|XP_002881611.1|  hypothetical protein ARALYDRAFT_482881             216   7e-65   
gb|AFJ93089.1|  mevalonate diphosphate decarboxylase                    211   1e-64   Bacopa monnieri
ref|XP_002452980.1|  hypothetical protein SORBIDRAFT_04g035950          216   2e-64   Sorghum bicolor [broomcorn]
ref|XP_008665377.1|  PREDICTED: diphosphomevalonate decarboxylase...    218   2e-64   Zea mays [maize]
ref|NP_001149256.1|  LOC100282878                                       216   2e-64   Zea mays [maize]
gb|ACN41090.1|  unknown                                                 215   3e-64   Picea sitchensis
gb|KFK34679.1|  hypothetical protein AALP_AA5G177200                    215   5e-64   Arabis alpina [alpine rockcress]
ref|NP_001045633.2|  Os02g0107200                                       205   8e-64   
ref|XP_004150845.1|  PREDICTED: diphosphomevalonate decarboxylase...    212   7e-63   Cucumis sativus [cucumbers]
gb|AAV32433.1|  mevalonate disphosphate decarboxylase                   211   2e-62   Ginkgo biloba [ginkgo]
tpg|DAA51252.1|  TPA: hypothetical protein ZEAMMB73_408503              218   1e-61   
tpg|DAA51253.1|  TPA: hypothetical protein ZEAMMB73_408503              218   2e-61   
ref|XP_010067138.1|  PREDICTED: diphosphomevalonate decarboxylase...    204   1e-60   
ref|XP_008668934.1|  PREDICTED: diphosphomevalonate decarboxylase...    197   3e-60   Zea mays [maize]
ref|XP_008668933.1|  PREDICTED: diphosphomevalonate decarboxylase...    197   3e-60   Zea mays [maize]
ref|XP_003565147.1|  PREDICTED: diphosphomevalonate decarboxylase...    204   7e-60   Brachypodium distachyon [annual false brome]
ref|XP_010067136.1|  PREDICTED: diphosphomevalonate decarboxylase...    203   1e-59   Eucalyptus grandis [rose gum]
ref|XP_004954217.1|  PREDICTED: diphosphomevalonate decarboxylase...    202   2e-59   Setaria italica
ref|XP_004963234.1|  PREDICTED: diphosphomevalonate decarboxylase...    202   6e-59   Setaria italica
ref|XP_001773902.1|  predicted protein                                  201   7e-59   
gb|AGT17596.1|  mevalonate diphosphate decarboxylase                    201   7e-59   Picrorhiza kurrooa
ref|NP_001045642.2|  Os02g0109100                                       190   1e-57   
ref|XP_001774493.1|  predicted protein                                  196   1e-56   
ref|XP_002979347.1|  hypothetical protein SELMODRAFT_268244             182   1e-51   Selaginella moellendorffii
ref|XP_002992344.1|  hypothetical protein SELMODRAFT_135101             182   1e-51   Selaginella moellendorffii
gb|AFW73864.1|  hypothetical protein ZEAMMB73_421648                    150   1e-39   
ref|XP_001121619.2|  PREDICTED: diphosphomevalonate decarboxylase...    137   6e-35   Apis mellifera [bee]
ref|XP_004356734.1|  diphosphomevalonate decarboxylase                  137   1e-34   Acanthamoeba castellanii str. Neff
ref|XP_003693647.1|  PREDICTED: diphosphomevalonate decarboxylase...    136   2e-34   Apis florea [dwarf honeybee]
ref|XP_006623086.1|  PREDICTED: diphosphomevalonate decarboxylase...    136   2e-34   Apis dorsata [rock honeybee]
ref|XP_005708031.1|  diphosphomevalonate decarboxylase isoform 1        130   2e-32   Galdieria sulphuraria
ref|XP_004600545.1|  PREDICTED: diphosphomevalonate decarboxylase       130   2e-32   Sorex araneus [Eurasian shrew]
ref|XP_005708030.1|  diphosphomevalonate decarboxylase isoform 2        130   2e-32   Galdieria sulphuraria
ref|XP_006097406.1|  PREDICTED: diphosphomevalonate decarboxylase       130   2e-32   Myotis lucifugus
ref|XP_003758532.1|  PREDICTED: diphosphomevalonate decarboxylase       130   2e-32   Sarcophilus harrisii
ref|XP_002735076.1|  PREDICTED: diphosphomevalonate decarboxylase...    130   3e-32   Saccoglossus kowalevskii
gb|ELK31386.1|  Diphosphomevalonate decarboxylase                       129   4e-32   Myotis davidii
ref|NP_001133968.1|  Diphosphomevalonate decarboxylase                  130   4e-32   Salmo salar
ref|XP_011497479.1|  PREDICTED: diphosphomevalonate decarboxylase       129   4e-32   Ceratosolen solmsi marchali
ref|XP_010996754.1|  PREDICTED: diphosphomevalonate decarboxylase...    126   4e-32   Camelus dromedarius [camel]
ref|NP_001093300.1|  diphosphomevalonate decarboxylase                  129   5e-32   Bombyx mori [silk moth]
ref|XP_006762259.1|  PREDICTED: diphosphomevalonate decarboxylase...    129   6e-32   Myotis davidii
emb|CDQ87522.1|  unnamed protein product                                129   6e-32   Oncorhynchus mykiss
gb|ELU01936.1|  hypothetical protein CAPTEDRAFT_176844                  129   7e-32   Capitella teleta
ref|XP_003228605.1|  PREDICTED: diphosphomevalonate decarboxylase       129   1e-31   Anolis carolinensis [Carolina anole]
ref|XP_011315112.1|  PREDICTED: diphosphomevalonate decarboxylase...    128   1e-31   Fopius arisanus
ref|XP_006008326.1|  PREDICTED: diphosphomevalonate decarboxylase...    128   2e-31   
gb|KDR21975.1|  Diphosphomevalonate decarboxylase                       127   2e-31   Zootermopsis nevadensis
gb|ABO27200.1|  cytosolic mevalonate-5-diphosphate decarboxylase        120   2e-31   Mesostigma viride
emb|CDQ81132.1|  unnamed protein product                                128   2e-31   Oncorhynchus mykiss
ref|XP_008137975.1|  PREDICTED: diphosphomevalonate decarboxylase       128   2e-31   Eptesicus fuscus
ref|XP_006008325.1|  PREDICTED: diphosphomevalonate decarboxylase...    128   2e-31   Latimeria chalumnae
ref|XP_008553889.1|  PREDICTED: diphosphomevalonate decarboxylase       127   2e-31   Microplitis demolitor
ref|XP_003424007.1|  PREDICTED: diphosphomevalonate decarboxylase...    127   3e-31   Nasonia vitripennis
ref|XP_005862569.1|  PREDICTED: diphosphomevalonate decarboxylase...    127   3e-31   Myotis brandtii
ref|NP_001267865.1|  diphosphomevalonate decarboxylase                  126   5e-31   Bombus terrestris [large earth bumblebee]
ref|XP_001376834.1|  PREDICTED: diphosphomevalonate decarboxylase       127   5e-31   Monodelphis domestica
ref|XP_010966484.1|  PREDICTED: diphosphomevalonate decarboxylase       127   5e-31   Camelus bactrianus [camel]
ref|XP_001200662.2|  PREDICTED: diphosphomevalonate decarboxylase...    126   6e-31   
ref|XP_003484695.1|  PREDICTED: diphosphomevalonate decarboxylase...    126   9e-31   
ref|XP_004310733.1|  PREDICTED: diphosphomevalonate decarboxylase       126   9e-31   
ref|XP_009029357.1|  hypothetical protein HELRODRAFT_185177             125   1e-30   Helobdella robusta
ref|XP_002432413.1|  Diphosphomevalonate decarboxylase, putative        125   2e-30   Pediculus humanus corporis [human body lice]
ref|XP_010877776.1|  PREDICTED: diphosphomevalonate decarboxylase       125   2e-30   Esox lucius
ref|XP_007244091.1|  PREDICTED: diphosphomevalonate decarboxylase       125   2e-30   
ref|XP_002913420.1|  PREDICTED: LOW QUALITY PROTEIN: diphosphomev...    125   2e-30   
ref|XP_003702160.1|  PREDICTED: diphosphomevalonate decarboxylase...    125   2e-30   Megachile rotundata
ref|XP_006734134.1|  PREDICTED: diphosphomevalonate decarboxylase       125   3e-30   Leptonychotes weddellii
ref|NP_001007423.1|  diphosphomevalonate decarboxylase                  125   3e-30   Danio rerio [leopard danio]
ref|XP_004280113.1|  PREDICTED: diphosphomevalonate decarboxylase       124   3e-30   Orcinus orca [Orca]
ref|XP_010739786.1|  PREDICTED: diphosphomevalonate decarboxylase       124   4e-30   Larimichthys crocea [croceine croaker]
ref|XP_007468497.1|  PREDICTED: diphosphomevalonate decarboxylase       124   4e-30   Lipotes vexillifer [baiji]
gb|ELR58766.1|  Diphosphomevalonate decarboxylase                       124   4e-30   Bos mutus
ref|XP_010842266.1|  PREDICTED: diphosphomevalonate decarboxylase       124   4e-30   Bison bison bison
ref|XP_005892469.1|  PREDICTED: diphosphomevalonate decarboxylase       124   4e-30   Bos mutus
ref|XP_004437181.1|  PREDICTED: diphosphomevalonate decarboxylase       124   4e-30   Ceratotherium simum simum [southern square-lipped rhinoceros]
gb|KIY47272.1|  Diphosphomevalonate decarboxylase                       124   5e-30   Fistulina hepatica ATCC 64428
ref|XP_002592260.1|  hypothetical protein BRAFLDRAFT_277163             124   5e-30   Branchiostoma floridae
ref|XP_007125573.1|  PREDICTED: diphosphomevalonate decarboxylase...    124   5e-30   Physeter catodon
ref|NP_001068892.1|  diphosphomevalonate decarboxylase                  124   5e-30   Bos taurus [bovine]
ref|XP_007172621.1|  PREDICTED: diphosphomevalonate decarboxylase       124   5e-30   Balaenoptera acutorostrata scammoni
dbj|BAE42019.1|  unnamed protein product                                124   5e-30   Mus musculus [mouse]
ref|NP_619597.2|  diphosphomevalonate decarboxylase                     124   6e-30   Mus musculus [mouse]
pdb|3F0N|A  Chain A, Mus Musculus Mevalonate Pyrophosphate Decarb...    124   6e-30   Mus musculus [mouse]
ref|XP_004913618.1|  PREDICTED: diphosphomevalonate decarboxylase...    124   6e-30   Xenopus tropicalis [western clawed frog]
dbj|BAC40852.1|  unnamed protein product                                124   6e-30   Mus musculus [mouse]
ref|XP_011163917.1|  PREDICTED: diphosphomevalonate decarboxylase...    123   6e-30   Solenopsis invicta [imported red fire ant]
gb|AAH08526.1|  Mevalonate (diphospho) decarboxylase                    124   7e-30   Mus musculus [mouse]
emb|CAC35731.1|  diphosphomevalonate decarboxylase                      124   7e-30   Mus musculus [mouse]
ref|XP_011163916.1|  PREDICTED: diphosphomevalonate decarboxylase...    123   7e-30   Solenopsis invicta [imported red fire ant]
ref|XP_002942038.1|  PREDICTED: diphosphomevalonate decarboxylase...    123   7e-30   Xenopus tropicalis [western clawed frog]
ref|XP_005805001.1|  PREDICTED: diphosphomevalonate decarboxylase...    123   8e-30   Xiphophorus maculatus
ref|XP_005531982.1|  PREDICTED: diphosphomevalonate decarboxylase       123   8e-30   Pseudopodoces humilis [Tibetan ground-jay]
ref|XP_005769632.1|  mevalonate-5-diphosphate decarboxylase             124   8e-30   Emiliania huxleyi CCMP1516
ref|XP_546783.2|  PREDICTED: diphosphomevalonate decarboxylase          123   8e-30   Canis lupus familiaris [dogs]
gb|ACO09861.1|  Diphosphomevalonate decarboxylase                       123   8e-30   Osmerus mordax
gb|KJA27615.1|  hypothetical protein HYPSUDRAFT_130498                  123   8e-30   Hypholoma sublateritium FD-334 SS-4
ref|XP_006027907.1|  PREDICTED: diphosphomevalonate decarboxylase       123   9e-30   Alligator sinensis
ref|XP_005956369.1|  PREDICTED: diphosphomevalonate decarboxylase       123   9e-30   Pantholops hodgsonii [Tibetan antelope]
ref|XP_004392172.1|  PREDICTED: diphosphomevalonate decarboxylase       123   1e-29   Odobenus rosmarus divergens
ref|XP_006043222.1|  PREDICTED: diphosphomevalonate decarboxylase       123   1e-29   
ref|XP_011370192.1|  PREDICTED: diphosphomevalonate decarboxylase       123   1e-29   Pteropus vampyrus
ref|XP_004362385.1|  diphosphomevalonate decarboxylase                  122   2e-29   Cavenderia fasciculata
ref|XP_004666010.1|  PREDICTED: diphosphomevalonate decarboxylase       122   2e-29   Jaculus jaculus
ref|XP_004753891.1|  PREDICTED: diphosphomevalonate decarboxylase       122   2e-29   Mustela putorius furo [black ferret]
ref|XP_004067388.1|  PREDICTED: diphosphomevalonate decarboxylase       122   2e-29   
gb|AAH81784.1|  Mevalonate (diphospho) decarboxylase                    122   3e-29   Rattus norvegicus [brown rat]
ref|XP_008403677.1|  PREDICTED: diphosphomevalonate decarboxylase       122   3e-29   Poecilia reticulata
ref|XP_007549941.1|  PREDICTED: diphosphomevalonate decarboxylase       122   3e-29   Poecilia formosa
ref|XP_004377812.1|  PREDICTED: diphosphomevalonate decarboxylase       122   3e-29   Trichechus manatus latirostris
ref|XP_011058925.1|  PREDICTED: diphosphomevalonate decarboxylase       122   3e-29   Acromyrmex echinatior
gb|ELK00496.1|  Diphosphomevalonate decarboxylase                       120   3e-29   Pteropus alecto
gb|AJP70489.1|  diphosphomevalonate decarboxylase                       121   3e-29   Helicoverpa armigera [American bollworm]
gb|AAH63907.1|  mvd-prov protein                                        122   3e-29   Xenopus tropicalis [western clawed frog]
ref|XP_008838768.1|  PREDICTED: diphosphomevalonate decarboxylase       121   4e-29   Nannospalax galili
ref|NP_112324.1|  diphosphomevalonate decarboxylase                     121   4e-29   Rattus norvegicus [brown rat]
ref|XP_006926815.1|  PREDICTED: diphosphomevalonate decarboxylase       121   4e-29   Pteropus alecto
ref|XP_005691918.1|  PREDICTED: diphosphomevalonate decarboxylase       121   4e-29   
ref|XP_003998380.1|  PREDICTED: diphosphomevalonate decarboxylase       121   4e-29   
gb|ACO11575.1|  Diphosphomevalonate decarboxylase                       121   5e-29   Caligus rogercresseyi
ref|XP_009089159.1|  PREDICTED: diphosphomevalonate decarboxylase       121   5e-29   Serinus canaria [canary]
dbj|GAM24015.1|  hypothetical protein SAMD00019534_071900               121   5e-29   Acytostelium subglobosum LB1
ref|XP_007532001.1|  PREDICTED: diphosphomevalonate decarboxylase       121   5e-29   Erinaceus europaeus [common hedgehog]
ref|XP_006888835.1|  PREDICTED: diphosphomevalonate decarboxylase       121   6e-29   Elephantulus edwardii [Cape long-eared elephant shrew]
ref|XP_008308874.1|  PREDICTED: diphosphomevalonate decarboxylase       121   6e-29   Cynoglossus semilaevis [half-smooth tongue sole]
ref|XP_004058175.1|  PREDICTED: diphosphomevalonate decarboxylase       121   6e-29   
ref|XP_006780089.1|  PREDICTED: diphosphomevalonate decarboxylase...    121   7e-29   Neolamprologus brichardi [lyretail cichlid]
ref|XP_005292289.1|  PREDICTED: diphosphomevalonate decarboxylase       120   7e-29   Chrysemys picta bellii
ref|XP_005915248.1|  PREDICTED: diphosphomevalonate decarboxylase...    120   7e-29   Haplochromis burtoni
ref|XP_005753004.1|  PREDICTED: diphosphomevalonate decarboxylase...    120   8e-29   Pundamilia nyererei
ref|XP_008506971.1|  PREDICTED: diphosphomevalonate decarboxylase       120   8e-29   Equus przewalskii [Przewalski horse]
ref|XP_006860173.1|  PREDICTED: diphosphomevalonate decarboxylase       120   9e-29   Chrysochloris asiatica
ref|XP_005052358.1|  PREDICTED: diphosphomevalonate decarboxylase       120   1e-28   
gb|AAP36301.1|  Homo sapiens mevalonate (diphospho) decarboxylase       120   1e-28   synthetic construct
ref|XP_523460.3|  PREDICTED: diphosphomevalonate decarboxylase          120   1e-28   
ref|XP_003442298.1|  PREDICTED: diphosphomevalonate decarboxylase...    120   1e-28   Oreochromis niloticus
ref|NP_002452.1|  diphosphomevalonate decarboxylase                     120   1e-28   Homo sapiens [man]
ref|XP_010577890.1|  PREDICTED: diphosphomevalonate decarboxylase       120   1e-28   Haliaeetus leucocephalus
ref|XP_010792093.1|  PREDICTED: diphosphomevalonate decarboxylase       120   1e-28   Notothenia coriiceps [yellowbelly rockcod]
ref|XP_006212468.1|  PREDICTED: diphosphomevalonate decarboxylase       120   1e-28   Vicugna pacos
ref|XP_001978042.1|  GG17907                                            120   1e-28   Drosophila erecta
ref|XP_007937353.1|  PREDICTED: diphosphomevalonate decarboxylase       120   1e-28   Orycteropus afer afer
ref|XP_001488083.1|  PREDICTED: diphosphomevalonate decarboxylase       120   1e-28   Equus caballus [domestic horse]
ref|XP_008300019.1|  PREDICTED: diphosphomevalonate decarboxylase       120   1e-28   Stegastes partitus
ref|XP_004539436.1|  PREDICTED: diphosphomevalonate decarboxylase...    120   1e-28   Maylandia zebra
ref|XP_006641302.1|  PREDICTED: LOW QUALITY PROTEIN: diphosphomev...    119   2e-28   
ref|XP_010716493.1|  PREDICTED: diphosphomevalonate decarboxylase       119   2e-28   Meleagris gallopavo [common turkey]
ref|XP_002100713.1|  GE17215                                            119   2e-28   Drosophila yakuba
ref|XP_002111980.1|  hypothetical protein TRIADDRAFT_55561              119   2e-28   Trichoplax adhaerens
ref|XP_003287684.1|  hypothetical protein DICPUDRAFT_32847              119   2e-28   Dictyostelium purpureum
ref|XP_642143.1|  diphosphomevalonate decarboxylase                     119   2e-28   Dictyostelium discoideum AX4
ref|XP_004584295.1|  PREDICTED: diphosphomevalonate decarboxylase       119   3e-28   Ochotona princeps [southern American pika]
ref|XP_005345851.1|  PREDICTED: diphosphomevalonate decarboxylase       119   3e-28   Microtus ochrogaster [prairie voles]
ref|XP_004645091.1|  PREDICTED: diphosphomevalonate decarboxylase       119   3e-28   Octodon degus
ref|XP_002413928.1|  diphosphomevalonate decarboxylase, putative        118   4e-28   Ixodes scapularis [blacklegged tick]
ref|XP_003281885.1|  PREDICTED: LOW QUALITY PROTEIN: diphosphomev...    118   4e-28   
ref|XP_003805806.1|  PREDICTED: diphosphomevalonate decarboxylase       118   4e-28   Pan paniscus [bonobo]
ref|XP_423130.3|  PREDICTED: diphosphomevalonate decarboxylase is...    118   5e-28   Gallus gallus [bantam]
ref|XP_003970115.1|  PREDICTED: diphosphomevalonate decarboxylase...    118   5e-28   Takifugu rubripes [tiger puffer]
ref|XP_002044182.1|  GM22575                                            117   6e-28   Drosophila sechellia
ref|XP_007887516.1|  PREDICTED: diphosphomevalonate decarboxylase       118   7e-28   Callorhinchus milii [Australian ghost shark]
ref|XP_010353865.1|  PREDICTED: diphosphomevalonate decarboxylase...    118   7e-28   Rhinopithecus roxellana
ref|XP_004944354.1|  PREDICTED: diphosphomevalonate decarboxylase...    118   7e-28   
ref|XP_003460964.1|  PREDICTED: diphosphomevalonate decarboxylase       118   7e-28   Cavia porcellus [guinea pig]
ref|XP_004704798.1|  PREDICTED: diphosphomevalonate decarboxylase       118   7e-28   Echinops telfairi [lesser hedgehog tenrec]
ref|XP_010353864.1|  PREDICTED: diphosphomevalonate decarboxylase...    118   8e-28   Rhinopithecus roxellana
ref|XP_009066482.1|  hypothetical protein LOTGIDRAFT_211321             117   9e-28   Lottia gigantea
ref|XP_005073260.1|  PREDICTED: diphosphomevalonate decarboxylase       117   9e-28   Mesocricetus auratus [Syrian golden hamster]
ref|XP_007651118.1|  PREDICTED: diphosphomevalonate decarboxylase...    117   1e-27   
ref|XP_003495141.1|  PREDICTED: diphosphomevalonate decarboxylase...    117   1e-27   
ref|XP_005592828.1|  PREDICTED: diphosphomevalonate decarboxylase...    117   1e-27   
ref|XP_003917347.1|  PREDICTED: diphosphomevalonate decarboxylase       117   1e-27   
ref|XP_005592827.1|  PREDICTED: diphosphomevalonate decarboxylase...    117   1e-27   
ref|NP_001247472.1|  diphosphomevalonate decarboxylase                  117   1e-27   
ref|XP_004989623.1|  diphosphomevalonate decarboxylase                  117   1e-27   
gb|KIK02242.1|  hypothetical protein K443DRAFT_677763                   117   1e-27   
ref|XP_011257108.1|  PREDICTED: diphosphomevalonate decarboxylase       117   2e-27   
ref|XP_002761300.1|  PREDICTED: diphosphomevalonate decarboxylase       117   2e-27   
ref|XP_009561527.1|  PREDICTED: diphosphomevalonate decarboxylase       116   2e-27   
ref|XP_007992525.1|  PREDICTED: diphosphomevalonate decarboxylase...    116   2e-27   
ref|XP_001873551.1|  predicted protein                                  116   2e-27   
ref|XP_004015005.1|  PREDICTED: diphosphomevalonate decarboxylase       116   2e-27   
ref|XP_006987448.1|  PREDICTED: diphosphomevalonate decarboxylase       116   2e-27   
ref|XP_007266924.1|  Diphosphomevalonate decarboxylase                  116   2e-27   
ref|XP_007992523.1|  PREDICTED: diphosphomevalonate decarboxylase...    116   2e-27   
ref|XP_001880930.1|  predicted protein                                  116   3e-27   
gb|EFX83630.1|  hypothetical protein DAPPUDRAFT_301631                  116   3e-27   
gb|KIM44772.1|  hypothetical protein M413DRAFT_442732                   116   3e-27   
ref|XP_003922886.1|  PREDICTED: diphosphomevalonate decarboxylase       116   3e-27   
gb|KJE94985.1|  diphosphomevalonate decarboxylase, variant 3            115   3e-27   
gb|EUC58622.1|  diphosphomevalonate decarboxylase                       116   3e-27   
gb|EFA74532.1|  diphosphomevalonate decarboxylase                       115   4e-27   
ref|XP_970108.1|  PREDICTED: diphosphomevalonate decarboxylase is...    115   6e-27   
ref|XP_003743316.1|  PREDICTED: diphosphomevalonate decarboxylase...    115   7e-27   
ref|XP_004842741.1|  PREDICTED: diphosphomevalonate decarboxylase       115   8e-27   
ref|XP_004346191.2|  diphosphomevalonate decarboxylase                  115   9e-27   
emb|CBJ48557.1|  Diphosphomevalonate decarboxylase                      115   9e-27   
ref|XP_007371446.1|  Diphosphomevalonate decarboxylase                  115   9e-27   
gb|AEE63249.1|  unknown                                                 114   1e-26   
ref|XP_003029710.1|  hypothetical protein SCHCODRAFT_69496              114   2e-26   
ref|XP_010625831.1|  PREDICTED: diphosphomevalonate decarboxylase       114   2e-26   
ref|XP_011153018.1|  PREDICTED: diphosphomevalonate decarboxylase...    114   2e-26   
ref|XP_007334426.1|  hypothetical protein AGABI1DRAFT_116646            114   2e-26   
gb|KIM45531.1|  hypothetical protein M413DRAFT_442202                   114   2e-26   
ref|XP_001986237.1|  GH20637                                            114   2e-26   
ref|XP_006457330.1|  hypothetical protein AGABI2DRAFT_196085            113   3e-26   
gb|KIY64502.1|  Diphosphomevalonate decarboxylase                       113   3e-26   
ref|XP_001648384.1|  AAEL004050-PA                                      113   4e-26   
gb|ERL86359.1|  hypothetical protein D910_03767                         113   4e-26   
gb|KDR67556.1|  hypothetical protein GALMADRAFT_258221                  113   4e-26   
gb|ENN75638.1|  hypothetical protein YQE_07816                          113   4e-26   
gb|ELU38465.1|  diphosphomevalonate decarboxylase                       113   4e-26   
ref|NP_573068.3|  CG8239, isoform A                                     112   6e-26   
gb|KFM61632.1|  Diphosphomevalonate decarboxylase                       112   7e-26   
gb|ETN57980.1|  diphosphomevalonate decarboxylase                       112   7e-26   
emb|CDR37714.1|  CYFA0S01e15566g1_1                                     112   7e-26   
gb|EMS63646.1|  Diphosphomevalonate decarboxylase                       111   7e-26   
gb|AFI45055.1|  diphosphomevalonate decarboxylase                       112   8e-26   
ref|XP_005819249.1|  mevalonate pyrophosphate decarboxylase             112   8e-26   
gb|KIJ60024.1|  hypothetical protein HYDPIDRAFT_99556                   112   9e-26   
gb|KDN34074.1|  hypothetical protein RSAG8_12833                        112   1e-25   
gb|KDO31253.1|  diphosphomevalonate decarboxylase                       111   1e-25   
gb|KDQ21756.1|  hypothetical protein BOTBODRAFT_26181                   111   1e-25   
ref|XP_002394746.1|  hypothetical protein MPER_05313                    106   2e-25   
ref|XP_007851999.1|  diphosphomevalonate decarboxylase                  111   2e-25   
ref|XP_008613422.1|  hypothetical protein SDRG_09280                    112   2e-25   
gb|KDO47062.1|  hypothetical protein CISIN_1g014714mg                   111   2e-25   
gb|EJK65080.1|  hypothetical protein THAOC_14117                        110   2e-25   
ref|XP_002287031.1|  mevalonate disphosphate decarboxylase-like p...    110   2e-25   
gb|EIE86507.1|  diphosphomevalonate decarboxylase                       110   3e-25   
gb|KIR85269.1|  diphosphomevalonate decarboxylase                       110   3e-25   
ref|XP_003418108.1|  PREDICTED: LOW QUALITY PROTEIN: diphosphomev...    110   3e-25   
ref|XP_008190498.1|  PREDICTED: diphosphomevalonate decarboxylase...    110   3e-25   
gb|AEB00646.1|  mevalonate pyrophosphate decarboxylase                  110   3e-25   
ref|XP_008034164.1|  Diphosphomevalonate decarboxylase                  110   4e-25   
ref|XP_009547604.1|  hypothetical protein HETIRDRAFT_440521             110   5e-25   
gb|KIL66419.1|  hypothetical protein M378DRAFT_389057                   110   5e-25   
ref|XP_007317911.1|  hypothetical protein SERLADRAFT_466408             110   5e-25   
gb|EHJ66886.1|  diphosphomevalonate decarboxylase                       110   5e-25   
emb|CAF99534.1|  unnamed protein product                                109   6e-25   
emb|CEG64400.1|  Putative Diphosphomevalonate decarboxylase             109   6e-25   
emb|CEI99330.1|  Putative Diphosphomevalonate decarboxylase             109   7e-25   
ref|XP_009821609.1|  diphosphomevalonate decarboxylase, variant         109   7e-25   
dbj|BAO38704.1|  diphosphomevalonate decarboxylase                      109   7e-25   
ref|XP_007308164.1|  Diphosphomevalonate decarboxylase                  109   8e-25   
ref|XP_005105464.1|  PREDICTED: diphosphomevalonate decarboxylase...    109   8e-25   
ref|XP_001844728.1|  diphosphomevalonate decarboxylase                  109   8e-25   
ref|XP_009821608.1|  diphosphomevalonate decarboxylase                  109   9e-25   
gb|KDN43409.1|  putative MVD1-mevalonate pyrophosphate decarboxylase    109   1e-24   
ref|XP_006122792.1|  PREDICTED: LOW QUALITY PROTEIN: diphosphomev...    109   1e-24   
gb|KIR46285.1|  diphosphomevalonate decarboxylase                       108   1e-24   
ref|XP_003193399.1|  diphosphomevalonate decarboxylase                  108   1e-24   
gb|KIR53986.1|  diphosphomevalonate decarboxylase                       108   1e-24   
ref|XP_455548.1|  hypothetical protein                                  108   1e-24   
gb|KIR59630.1|  diphosphomevalonate decarboxylase                       108   1e-24   
ref|XP_002497180.1|  ZYRO0D17270p                                       108   1e-24   
gb|KIS02378.1|  diphosphomevalonate decarboxylase                       108   1e-24   
ref|XP_003383859.1|  PREDICTED: diphosphomevalonate decarboxylase...    108   1e-24   
ref|XP_321487.3|  AGAP001611-PA                                         108   2e-24   
gb|KFH65647.1|  diphosphomevalonate decarboxylase                       108   2e-24   
gb|KFK34801.1|  hypothetical protein AALP_AA5G195000                    102   2e-24   
gb|KGB78727.1|  diphosphomevalonate decarboxylase                       108   2e-24   
emb|CDO69145.1|  hypothetical protein BN946_scf185042.g47               108   2e-24   
emb|CDS06586.1|  hypothetical protein LRAMOSA09114                      108   2e-24   
gb|KII92627.1|  hypothetical protein PLICRDRAFT_102539                  108   2e-24   
gb|KIK91362.1|  hypothetical protein PAXRUDRAFT_830905                  108   2e-24   
ref|XP_008862510.1|  diphosphomevalonate decarboxylase                  107   3e-24   
gb|KIJ49692.1|  hypothetical protein M422DRAFT_205223                   107   3e-24   
ref|XP_007339537.1|  Diphosphomevalonate decarboxylase                  107   3e-24   
ref|XP_445335.1|  hypothetical protein                                  107   3e-24   
ref|XP_002050863.1|  GJ19966                                            107   3e-24   
ref|XP_011275729.1|  Diphosphomevalonate decarboxylase                  107   4e-24   
emb|CDO95793.1|  unnamed protein product                                107   4e-24   
ref|XP_003688208.1|  hypothetical protein TPHA_0M01990                  107   4e-24   
dbj|GAA95012.1|  hypothetical protein E5Q_01667                         107   4e-24   
ref|XP_002176299.1|  MPDC mevalonate diphosphate decarboxylase          107   5e-24   
ref|XP_002028521.1|  GL14496                                            107   5e-24   
ref|XP_002075379.1|  GK17667                                            107   6e-24   
ref|XP_006686867.1|  hypothetical protein CANTEDRAFT_122822             107   6e-24   
gb|KDQ27550.1|  hypothetical protein PLEOSDRAFT_1093271                 106   8e-24   
ref|XP_002551773.1|  KLTH0A07238p                                       106   8e-24   
ref|XP_001830848.1|  diphosphomevalonate decarboxylase                  106   1e-23   
gb|AFR94390.1|  diphosphomevalonate decarboxylase                       106   1e-23   
ref|XP_001386025.1|  hypothetical protein PICST_90752                   105   2e-23   
gb|AAA34506.2|  ORF                                                     102   2e-23   
ref|XP_001600914.2|  PREDICTED: diphosphomevalonate decarboxylase...    105   2e-23   
ref|XP_003956599.1|  hypothetical protein KAFR_0C04730                  105   2e-23   
ref|XP_007381587.1|  Diphosphomevalonate decarboxylase                  105   2e-23   
gb|EMG46004.1|  Diphosphomevalonate decarboxylase                       105   3e-23   
ref|XP_001646609.1|  hypothetical protein Kpol_1028p24                  105   3e-23   
emb|CCA67606.1|  probable MVD1-mevalonate pyrophosphate decarboxy...    105   3e-23   
gb|KEZ44709.1|  Diphosphomevalonate decarboxylase                       104   4e-23   
gb|KIO19559.1|  hypothetical protein M407DRAFT_16104                    104   4e-23   
gb|KJA24995.1|  hypothetical protein HYPSUDRAFT_135519                99.8    5e-23   
gb|AEY98585.1|  FAGL232Cp                                               104   6e-23   
gb|AJT16805.1|  Mvd1p                                                   104   6e-23   
ref|XP_009902760.1|  PREDICTED: LOW QUALITY PROTEIN: diphosphomev...    104   6e-23   
gb|KIM31275.1|  hypothetical protein M408DRAFT_64547                    104   6e-23   
ref|NP_986435.2|  AGL232Cp                                              103   7e-23   
gb|EDZ69577.1|  YNR043Wp-like protein                                   103   7e-23   
gb|AJT25337.1|  Mvd1p                                                   103   8e-23   
ref|XP_568247.1|  diphosphomevalonate decarboxylase                     103   9e-23   
gb|EHN00406.1|  Mvd1p                                                   103   9e-23   
gb|KIM80988.1|  hypothetical protein PILCRDRAFT_9035                  99.8    9e-23   
gb|EPB83704.1|  diphosphomevalonate decarboxylase                       103   1e-22   
dbj|GAN02670.1|  diphosphomevalonate decarboxylase                      103   1e-22   
gb|KIM69548.1|  hypothetical protein SCLCIDRAFT_1208005                 103   1e-22   
ref|XP_003800873.1|  PREDICTED: LOW QUALITY PROTEIN: diphosphomev...    103   1e-22   
gb|AJT04035.1|  Mvd1p                                                   102   2e-22   
gb|AJT30847.1|  Mvd1p                                                   102   2e-22   
dbj|GAA26136.1|  K7_Mvd1p                                               102   2e-22   
gb|EDN62849.1|  mevalonate pyrophosphate decarboxylase                  102   2e-22   
gb|AJT02547.1|  Mvd1p                                                   102   2e-22   
gb|AAF19399.1|AF203779_1  diphosphomevalonate decarboxylase MVD1        102   2e-22   
gb|AJT22350.1|  Mvd1p                                                   102   2e-22   
gb|AAT93171.1|  YNR043W                                                 102   2e-22   
gb|AJT04410.1|  Mvd1p                                                   102   2e-22   
gb|AJT07024.1|  Mvd1p                                                   102   2e-22   
ref|NP_014441.1|  diphosphomevalonate decarboxylase MVD1                102   2e-22   
ref|XP_001628780.1|  predicted protein                                  102   2e-22   
ref|XP_002005564.1|  GI19000                                            102   2e-22   
gb|EEU08298.1|  Mvd1p                                                   102   2e-22   
gb|EDV12224.1|  mevalonate pyrophosphate decarboxylase                  102   2e-22   
gb|KGQ99147.1|  diphosphomevalonate decarboxylase                       102   2e-22   
gb|EEQ43122.1|  diphosphomevalonate decarboxylase                       102   2e-22   
gb|KGU33407.1|  diphosphomevalonate decarboxylase                       102   2e-22   
gb|ESA02764.1|  hypothetical protein GLOINDRAFT_337188                  102   2e-22   
gb|KGR23081.1|  diphosphomevalonate decarboxylase                       102   2e-22   
ref|XP_773574.1|  hypothetical protein CNBI1880                         102   2e-22   
emb|CEJ91790.1|  Putative Diphosphomevalonate decarboxylase             102   3e-22   
emb|CCL99644.1|  predicted protein                                      102   3e-22   
ref|XP_002616213.1|  hypothetical protein CLUG_03454                    102   3e-22   
emb|CEP61092.1|  LALA0S02e06546g1_1                                     102   3e-22   
pdb|1FI4|A  Chain A, The X-Ray Crystal Structure Of Mevalonate 5-...    102   3e-22   
ref|XP_011105331.1|  mvd1p                                              102   4e-22   
ref|XP_007864729.1|  hypothetical protein GLOTRDRAFT_127445             102   4e-22   
ref|XP_007082922.1|  PREDICTED: diphosphomevalonate decarboxylase...  99.4    4e-22   
ref|XP_456912.2|  DEHA2A13398p                                          101   5e-22   
gb|KIK39127.1|  hypothetical protein CY34DRAFT_808602                   101   5e-22   
gb|AJT18309.1|  Mvd1p                                                   101   5e-22   
emb|CCI45990.1|  unnamed protein product                                101   5e-22   
gb|ESW97073.1|  Diphosphomevalonate decarboxylase                       101   6e-22   
ref|XP_002416688.1|  diphosphomevalonate decarboxylase, putative;...    101   6e-22   
gb|ACC62033.1|  mevalonate diphosphate decarboxylase                  95.9    7e-22   
emb|CDK26220.1|  unnamed protein product                                100   8e-22   
ref|XP_004535245.1|  PREDICTED: diphosphomevalonate decarboxylase...    100   8e-22   
ref|XP_004535244.1|  PREDICTED: diphosphomevalonate decarboxylase...    100   8e-22   
gb|AJT26802.1|  Mvd1p                                                   100   8e-22   
emb|CEP12016.1|  hypothetical protein                                   100   8e-22   
gb|EPT04682.1|  hypothetical protein FOMPIDRAFT_1140388                 100   8e-22   
gb|KGQ07524.1|  Diphosphomevalonate decarboxylase                       100   1e-21   
ref|XP_008602812.1|  diphosphomevalonate decarboxylase                  100   1e-21   
ref|XP_007670945.1|  PREDICTED: diphosphomevalonate decarboxylase       100   1e-21   
gb|EGI62780.1|  Diphosphomevalonate decarboxylase                       100   1e-21   
gb|KIM72212.1|  hypothetical protein PILCRDRAFT_829911                  100   1e-21   
ref|XP_006673782.1|  diphosphomevalonate decarboxylase                  100   1e-21   
gb|EMD33647.1|  hypothetical protein CERSUDRAFT_117755                  100   1e-21   
ref|XP_007767205.1|  Diphosphomevalonate decarboxylase                  100   2e-21   
emb|CCK69779.1|  hypothetical protein KNAG_0D00260                      100   2e-21   
ref|XP_003673492.1|  hypothetical protein NCAS_0A05510                  100   2e-21   
emb|CEI98959.1|  Putative Diphosphomevalonate decarboxylase             100   2e-21   
ref|XP_006675737.1|  hypothetical protein BATDEDRAFT_34046              101   3e-21   
emb|CCG83278.1|  Diphosphomevalonate decarboxylase                    99.4    3e-21   
ref|XP_003868196.1|  Mvd mevalonate diphosphate decarboxylase         99.0    3e-21   
ref|XP_002837299.1|  hypothetical protein                             99.0    3e-21   
gb|KDQ55805.1|  hypothetical protein JAAARDRAFT_195621                99.0    4e-21   
ref|XP_002549983.1|  diphosphomevalonate decarboxylase                98.6    4e-21   
gb|KFG78069.1|  diphosphomevalonate decarboxylase                     99.0    5e-21   
ref|XP_007372031.1|  hypothetical protein SPAPADRAFT_132255           98.6    5e-21   
gb|KID80423.1|  diphosphomevalonate decarboxylase                     98.6    5e-21   
ref|XP_002669299.1|  mevalonate decarboxylase                         98.6    5e-21   
ref|XP_006960000.1|  Diphosphomevalonate decarboxylase                98.6    5e-21   
ref|XP_009495556.1|  hypothetical protein H696_03415                  98.6    6e-21   
gb|KDN71936.1|  putative diphosphomevalonate decarboxylase            98.6    6e-21   
ref|XP_004204654.1|  Piso0_000514                                     97.8    9e-21   
gb|KIK24803.1|  hypothetical protein PISMIDRAFT_97834                 98.2    9e-21   
ref|XP_007821634.1|  Diphosphomevalonate decarboxylase                97.8    9e-21   
ref|XP_505041.1|  YALI0F05632p                                        97.8    1e-20   
gb|KIW05370.1|  diphosphomevalonate decarboxylase                     97.8    1e-20   
ref|XP_005182349.1|  PREDICTED: diphosphomevalonate decarboxylase     97.8    1e-20   
ref|XP_007059404.1|  PREDICTED: diphosphomevalonate decarboxylase     97.4    1e-20   
gb|KIO09474.1|  hypothetical protein M404DRAFT_996320                 97.8    1e-20   
emb|CCE40915.1|  hypothetical protein CPAR2_109530                    97.4    1e-20   
gb|KID99722.1|  diphosphomevalonate decarboxylase                     97.4    1e-20   
ref|XP_007878778.1|  hypothetical protein PFL1_03071                  97.8    1e-20   
ref|XP_003848249.1|  MVD1, mevalonate pyrophosphate decarboxylase     97.1    2e-20   
ref|XP_011388229.1|  putative mevalonate pyrophosphate decarboxylase  97.4    2e-20   
gb|KIM81484.1|  hypothetical protein PILCRDRAFT_821272                93.6    2e-20   
ref|XP_009234722.1|  PREDICTED: LOW QUALITY PROTEIN: diphosphomev...  95.5    2e-20   



>ref|XP_002521172.1| diphosphomevalonate decarboxylase, putative [Ricinus communis]
 gb|EEF41203.1| diphosphomevalonate decarboxylase, putative [Ricinus communis]
Length=415

 Score =   256 bits (654),  Expect = 5e-80, Method: Compositional matrix adjust.
 Identities = 132/145 (91%), Positives = 139/145 (96%), Gaps = 0/145 (0%)
 Frame = +2

Query  149  MAEKWVLMVTAQTPTNIAVIKYWGKRDETLILPINDSISVTLDPAHLCTTTTVAVSPAFD  328
            MAE+WV MVTAQTPTNIAVIKYWGKRDETLILP+NDSISVTLDPAHLCTTTTVAVSPAFD
Sbjct  1    MAERWVRMVTAQTPTNIAVIKYWGKRDETLILPVNDSISVTLDPAHLCTTTTVAVSPAFD  60

Query  329  QDRMWLNGKEMSLSGVRYQNCLKEIRARACDVEDEKKGIKITKKDWENLHVHIASYNNFP  508
            QDRMWLNGKE+SLSG RYQNCL+EIRARACDVED++KGIKI KKDWE LHVHIAS+NNFP
Sbjct  61   QDRMWLNGKEISLSGGRYQNCLREIRARACDVEDKEKGIKIAKKDWEKLHVHIASFNNFP  120

Query  509  TaaglassaagfaCLVFALGKLMNV  583
            TAAGLASSAAGFACLVFAL KLMN 
Sbjct  121  TAAGLASSAAGFACLVFALAKLMNA  145



>gb|KDO47061.1| hypothetical protein CISIN_1g014714mg [Citrus sinensis]
Length=254

 Score =   248 bits (633),  Expect = 5e-79, Method: Compositional matrix adjust.
 Identities = 127/144 (88%), Positives = 137/144 (95%), Gaps = 0/144 (0%)
 Frame = +2

Query  152  AEKWVLMVTAQTPTNIAVIKYWGKRDETLILPINDSISVTLDPAHLCTTTTVAVSPAFDQ  331
            AEKWVLMVTAQTPTNIAVIKYWGKRDETLILP+NDSISVTLDP HLCTTTTVAVSP+FDQ
Sbjct  3    AEKWVLMVTAQTPTNIAVIKYWGKRDETLILPVNDSISVTLDPDHLCTTTTVAVSPSFDQ  62

Query  332  DRMWLNGKEMSLSGVRYQNCLKEIRARACDVEDEKKGIKITKKDWENLHVHIASYNNFPT  511
            DRMWLNGKE+SL G RYQNCLKEIR+RACDVED +KGIKI KKDW+ LH+HIAS+NNFPT
Sbjct  63   DRMWLNGKEISLGGGRYQNCLKEIRSRACDVEDTEKGIKIEKKDWQKLHLHIASFNNFPT  122

Query  512  aaglassaagfaCLVFALGKLMNV  583
            AAGLASSAAGFACLVF+L KLMN+
Sbjct  123  AAGLASSAAGFACLVFSLAKLMNL  146



>ref|XP_011024216.1| PREDICTED: diphosphomevalonate decarboxylase-like [Populus euphratica]
Length=416

 Score =   252 bits (644),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 132/146 (90%), Positives = 139/146 (95%), Gaps = 1/146 (1%)
 Frame = +2

Query  149  MAEK-WVLMVTAQTPTNIAVIKYWGKRDETLILPINDSISVTLDPAHLCTTTTVAVSPAF  325
            MAEK WV MVTAQTPTNIAVIKYWGKRDETLILP+NDSISVTLDPAHLCTTTTVAVSP+F
Sbjct  1    MAEKPWVRMVTAQTPTNIAVIKYWGKRDETLILPVNDSISVTLDPAHLCTTTTVAVSPSF  60

Query  326  DQDRMWLNGKEMSLSGVRYQNCLKEIRARACDVEDEKKGIKITKKDWENLHVHIASYNNF  505
            DQDRMWLNGKE+SLSG RYQNCL+EIRA+ACDVEDE+KGIKI KKDWE LHVH+ASYNNF
Sbjct  61   DQDRMWLNGKEISLSGGRYQNCLREIRAQACDVEDEEKGIKIAKKDWEKLHVHVASYNNF  120

Query  506  PTaaglassaagfaCLVFALGKLMNV  583
            PTAAGLASSAAGFACLVFAL KLMN 
Sbjct  121  PTAAGLASSAAGFACLVFALAKLMNA  146



>gb|KJB78631.1| hypothetical protein B456_013G012400 [Gossypium raimondii]
Length=293

 Score =   247 bits (630),  Expect = 5e-78, Method: Compositional matrix adjust.
 Identities = 128/145 (88%), Positives = 136/145 (94%), Gaps = 0/145 (0%)
 Frame = +2

Query  149  MAEKWVLMVTAQTPTNIAVIKYWGKRDETLILPINDSISVTLDPAHLCTTTTVAVSPAFD  328
            M EKWVLM TAQTPTNIAVIKYWGKRDETLILP+NDSISVTLDPAHLCTTTTVAVSPAF 
Sbjct  1    MGEKWVLMKTAQTPTNIAVIKYWGKRDETLILPVNDSISVTLDPAHLCTTTTVAVSPAFQ  60

Query  329  QDRMWLNGKEMSLSGVRYQNCLKEIRARACDVEDEKKGIKITKKDWENLHVHIASYNNFP  508
            QDRMWLNGKE+SLSG RYQNCL+EIR RA +VED+++GIKI KKDWE LH+HIASYNNFP
Sbjct  61   QDRMWLNGKEISLSGGRYQNCLREIRTRAREVEDKERGIKIEKKDWEKLHLHIASYNNFP  120

Query  509  TaaglassaagfaCLVFALGKLMNV  583
            TAAGLASSAAGFACLVFAL KLMNV
Sbjct  121  TAAGLASSAAGFACLVFALAKLMNV  145



>gb|KDO47060.1| hypothetical protein CISIN_1g014714mg [Citrus sinensis]
Length=344

 Score =   248 bits (632),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 127/144 (88%), Positives = 137/144 (95%), Gaps = 0/144 (0%)
 Frame = +2

Query  152  AEKWVLMVTAQTPTNIAVIKYWGKRDETLILPINDSISVTLDPAHLCTTTTVAVSPAFDQ  331
            AEKWVLMVTAQTPTNIAVIKYWGKRDETLILP+NDSISVTLDP HLCTTTTVAVSP+FDQ
Sbjct  3    AEKWVLMVTAQTPTNIAVIKYWGKRDETLILPVNDSISVTLDPDHLCTTTTVAVSPSFDQ  62

Query  332  DRMWLNGKEMSLSGVRYQNCLKEIRARACDVEDEKKGIKITKKDWENLHVHIASYNNFPT  511
            DRMWLNGKE+SL G RYQNCLKEIR+RACDVED +KGIKI KKDW+ LH+HIAS+NNFPT
Sbjct  63   DRMWLNGKEISLGGGRYQNCLKEIRSRACDVEDTEKGIKIEKKDWQKLHLHIASFNNFPT  122

Query  512  aaglassaagfaCLVFALGKLMNV  583
            AAGLASSAAGFACLVF+L KLMN+
Sbjct  123  AAGLASSAAGFACLVFSLAKLMNL  146



>ref|XP_002315441.1| mevalonate disphosphate decarboxylase family protein [Populus 
trichocarpa]
 gb|EEF01612.1| mevalonate disphosphate decarboxylase family protein [Populus 
trichocarpa]
Length=416

 Score =   250 bits (638),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 131/146 (90%), Positives = 138/146 (95%), Gaps = 1/146 (1%)
 Frame = +2

Query  149  MAEK-WVLMVTAQTPTNIAVIKYWGKRDETLILPINDSISVTLDPAHLCTTTTVAVSPAF  325
            MA K WV MVTAQTPTNIAVIKYWGKRDETLILP+NDSISVTLDPAHLCTTTTVAVSP+F
Sbjct  1    MAGKPWVRMVTAQTPTNIAVIKYWGKRDETLILPVNDSISVTLDPAHLCTTTTVAVSPSF  60

Query  326  DQDRMWLNGKEMSLSGVRYQNCLKEIRARACDVEDEKKGIKITKKDWENLHVHIASYNNF  505
            DQDRMWLNGKE+SLSG RYQNCL+EIRA+ACD EDE+KGIKITKKDWE LHVH+ASYNNF
Sbjct  61   DQDRMWLNGKEISLSGGRYQNCLREIRAQACDAEDEEKGIKITKKDWEKLHVHVASYNNF  120

Query  506  PTaaglassaagfaCLVFALGKLMNV  583
            PTAAGLASSAAGFACLVFAL KLMN 
Sbjct  121  PTAAGLASSAAGFACLVFALAKLMNA  146



>gb|KJB78632.1| hypothetical protein B456_013G012400 [Gossypium raimondii]
Length=345

 Score =   247 bits (631),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 128/145 (88%), Positives = 136/145 (94%), Gaps = 0/145 (0%)
 Frame = +2

Query  149  MAEKWVLMVTAQTPTNIAVIKYWGKRDETLILPINDSISVTLDPAHLCTTTTVAVSPAFD  328
            M EKWVLM TAQTPTNIAVIKYWGKRDETLILP+NDSISVTLDPAHLCTTTTVAVSPAF 
Sbjct  1    MGEKWVLMKTAQTPTNIAVIKYWGKRDETLILPVNDSISVTLDPAHLCTTTTVAVSPAFQ  60

Query  329  QDRMWLNGKEMSLSGVRYQNCLKEIRARACDVEDEKKGIKITKKDWENLHVHIASYNNFP  508
            QDRMWLNGKE+SLSG RYQNCL+EIR RA +VED+++GIKI KKDWE LH+HIASYNNFP
Sbjct  61   QDRMWLNGKEISLSGGRYQNCLREIRTRAREVEDKERGIKIEKKDWEKLHLHIASYNNFP  120

Query  509  TaaglassaagfaCLVFALGKLMNV  583
            TAAGLASSAAGFACLVFAL KLMNV
Sbjct  121  TAAGLASSAAGFACLVFALAKLMNV  145



>dbj|BAF98285.1| diphosphomevelonate decarboxylase [Hevea brasiliensis]
Length=415

 Score =   249 bits (636),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 128/145 (88%), Positives = 137/145 (94%), Gaps = 0/145 (0%)
 Frame = +2

Query  149  MAEKWVLMVTAQTPTNIAVIKYWGKRDETLILPINDSISVTLDPAHLCTTTTVAVSPAFD  328
            MAE WV+MVTAQTPTNIAVIKYWGKRDE LILP+NDSISVTLDP HLCTTTTVAVSP+F 
Sbjct  1    MAESWVIMVTAQTPTNIAVIKYWGKRDEKLILPVNDSISVTLDPVHLCTTTTVAVSPSFA  60

Query  329  QDRMWLNGKEMSLSGVRYQNCLKEIRARACDVEDEKKGIKITKKDWENLHVHIASYNNFP  508
            QDRMWLNGKE+SLSG RYQNCL+EIRARACDVED+++GIKI+KKDWE LHVHIASYNNFP
Sbjct  61   QDRMWLNGKEISLSGGRYQNCLREIRARACDVEDKERGIKISKKDWEKLHVHIASYNNFP  120

Query  509  TaaglassaagfaCLVFALGKLMNV  583
            TAAGLASSAAGFACLVFAL KLMN 
Sbjct  121  TAAGLASSAAGFACLVFALAKLMNA  145



>gb|AAL18927.1|AF429386_1 mevalonate disphosphate decarboxylase [Hevea brasiliensis]
Length=415

 Score =   249 bits (635),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 128/145 (88%), Positives = 138/145 (95%), Gaps = 0/145 (0%)
 Frame = +2

Query  149  MAEKWVLMVTAQTPTNIAVIKYWGKRDETLILPINDSISVTLDPAHLCTTTTVAVSPAFD  328
            MAE WV+MVTAQTPTNIAVIKYWGKRDE LILP+NDSISVTLDPAHLCTTTTVAVSP+F 
Sbjct  1    MAESWVIMVTAQTPTNIAVIKYWGKRDEKLILPVNDSISVTLDPAHLCTTTTVAVSPSFA  60

Query  329  QDRMWLNGKEMSLSGVRYQNCLKEIRARACDVEDEKKGIKITKKDWENLHVHIASYNNFP  508
            QDRMWLNGKE+SLSG RYQNCL+EIRARACDVED+++GIKI+KKDWE L+VHIASYNNFP
Sbjct  61   QDRMWLNGKEISLSGGRYQNCLREIRARACDVEDKERGIKISKKDWEKLYVHIASYNNFP  120

Query  509  TaaglassaagfaCLVFALGKLMNV  583
            TAAGLASSAAGFACLVFAL KLMN 
Sbjct  121  TAAGLASSAAGFACLVFALAKLMNA  145



>gb|AII99848.1| mevalonate disphosphate decarboxylase [Nicotiana tabacum]
Length=418

 Score =   249 bits (635),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 130/144 (90%), Positives = 138/144 (96%), Gaps = 0/144 (0%)
 Frame = +2

Query  152  AEKWVLMVTAQTPTNIAVIKYWGKRDETLILPINDSISVTLDPAHLCTTTTVAVSPAFDQ  331
            ++KWVLMVTAQTPTNIAVIKYWGKRDE LIL INDSISVTLDPAHLCTTTTVAVSPAF+Q
Sbjct  5    SQKWVLMVTAQTPTNIAVIKYWGKRDENLILAINDSISVTLDPAHLCTTTTVAVSPAFNQ  64

Query  332  DRMWLNGKEMSLSGVRYQNCLKEIRARACDVEDEKKGIKITKKDWENLHVHIASYNNFPT  511
            DRMWLNGKE+SLSG RYQNCL+EIRARA DVEDEK+GIKI KKDWENLHVHIASYNNFPT
Sbjct  65   DRMWLNGKEISLSGGRYQNCLREIRARANDVEDEKRGIKIVKKDWENLHVHIASYNNFPT  124

Query  512  aaglassaagfaCLVFALGKLMNV  583
            AAGLASSAAGFACLV++L KLMNV
Sbjct  125  AAGLASSAAGFACLVYSLAKLMNV  148



>ref|XP_009792788.1| PREDICTED: diphosphomevalonate decarboxylase-like [Nicotiana 
sylvestris]
Length=421

 Score =   249 bits (636),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 130/144 (90%), Positives = 138/144 (96%), Gaps = 0/144 (0%)
 Frame = +2

Query  152  AEKWVLMVTAQTPTNIAVIKYWGKRDETLILPINDSISVTLDPAHLCTTTTVAVSPAFDQ  331
            ++KWVLMVTAQTPTNIAVIKYWGKRDE LIL INDSISVTLDPAHLCTTTTVAVSPAF+Q
Sbjct  5    SQKWVLMVTAQTPTNIAVIKYWGKRDENLILAINDSISVTLDPAHLCTTTTVAVSPAFNQ  64

Query  332  DRMWLNGKEMSLSGVRYQNCLKEIRARACDVEDEKKGIKITKKDWENLHVHIASYNNFPT  511
            DRMWLNGKE+SLSG RYQNCL+EIRARA DVEDEK+GIKI KKDWENLHVHIASYNNFPT
Sbjct  65   DRMWLNGKEISLSGGRYQNCLREIRARANDVEDEKRGIKIVKKDWENLHVHIASYNNFPT  124

Query  512  aaglassaagfaCLVFALGKLMNV  583
            AAGLASSAAGFACLV++L KLMNV
Sbjct  125  AAGLASSAAGFACLVYSLAKLMNV  148



>ref|XP_009619582.1| PREDICTED: diphosphomevalonate decarboxylase-like [Nicotiana 
tomentosiformis]
Length=421

 Score =   249 bits (636),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 130/144 (90%), Positives = 138/144 (96%), Gaps = 0/144 (0%)
 Frame = +2

Query  152  AEKWVLMVTAQTPTNIAVIKYWGKRDETLILPINDSISVTLDPAHLCTTTTVAVSPAFDQ  331
            ++KWVLMVTAQTPTNIAVIKYWGKRDE LIL INDSISVTLDPAHLCTTTTVAVSPAF+Q
Sbjct  5    SQKWVLMVTAQTPTNIAVIKYWGKRDENLILAINDSISVTLDPAHLCTTTTVAVSPAFNQ  64

Query  332  DRMWLNGKEMSLSGVRYQNCLKEIRARACDVEDEKKGIKITKKDWENLHVHIASYNNFPT  511
            DRMWLNGKE+SLSG RYQNCL+EIRARA DVEDEK+GIKITK DWENLHVHIASYNNFPT
Sbjct  65   DRMWLNGKEISLSGGRYQNCLREIRARANDVEDEKRGIKITKNDWENLHVHIASYNNFPT  124

Query  512  aaglassaagfaCLVFALGKLMNV  583
            AAGLASSAAGFACLV++L KLMNV
Sbjct  125  AAGLASSAAGFACLVYSLAKLMNV  148



>gb|KDP35789.1| hypothetical protein JCGZ_10425 [Jatropha curcas]
Length=415

 Score =   248 bits (634),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 128/145 (88%), Positives = 138/145 (95%), Gaps = 0/145 (0%)
 Frame = +2

Query  149  MAEKWVLMVTAQTPTNIAVIKYWGKRDETLILPINDSISVTLDPAHLCTTTTVAVSPAFD  328
            MAEKWV MVTAQTPTNIAVIKYWGKRDETLILP+NDSISVTLDP+HLCTTTTVAVSP FD
Sbjct  1    MAEKWVRMVTAQTPTNIAVIKYWGKRDETLILPVNDSISVTLDPSHLCTTTTVAVSPTFD  60

Query  329  QDRMWLNGKEMSLSGVRYQNCLKEIRARACDVEDEKKGIKITKKDWENLHVHIASYNNFP  508
            QDRMWLNGKE+SLSG R+Q+CL+EIRARACDVED++KGIKI KKDW+ LHVH+ASYNNFP
Sbjct  61   QDRMWLNGKEISLSGGRFQSCLREIRARACDVEDKEKGIKIVKKDWDKLHVHMASYNNFP  120

Query  509  TaaglassaagfaCLVFALGKLMNV  583
            TAAGLASSAAGFACLVFAL KLMN 
Sbjct  121  TAAGLASSAAGFACLVFALAKLMNA  145



>ref|XP_011032862.1| PREDICTED: diphosphomevalonate decarboxylase-like [Populus euphratica]
Length=416

 Score =   248 bits (634),  Expect = 4e-77, Method: Compositional matrix adjust.
 Identities = 130/146 (89%), Positives = 139/146 (95%), Gaps = 1/146 (1%)
 Frame = +2

Query  149  MAEK-WVLMVTAQTPTNIAVIKYWGKRDETLILPINDSISVTLDPAHLCTTTTVAVSPAF  325
            MAEK WV MVTAQTPTNIAVIKYWGKRDETLILP+NDSISVTLDPAHLCTTTTVAVSP+F
Sbjct  1    MAEKTWVRMVTAQTPTNIAVIKYWGKRDETLILPVNDSISVTLDPAHLCTTTTVAVSPSF  60

Query  326  DQDRMWLNGKEMSLSGVRYQNCLKEIRARACDVEDEKKGIKITKKDWENLHVHIASYNNF  505
            DQDRMWLNGKE+SLSG RYQNCL+EIRARAC+VED++KGIKI KKDWE LH+H+ASYNNF
Sbjct  61   DQDRMWLNGKEISLSGGRYQNCLREIRARACEVEDKEKGIKIAKKDWEKLHLHVASYNNF  120

Query  506  PTaaglassaagfaCLVFALGKLMNV  583
            PTAAGLASSAAGFACLVFAL KLMN 
Sbjct  121  PTAAGLASSAAGFACLVFALAKLMNA  146



>gb|ADR65113.1| mevalonate 5-diphosphate decarboxylase [Catharanthus roseus]
Length=421

 Score =   248 bits (633),  Expect = 6e-77, Method: Compositional matrix adjust.
 Identities = 133/148 (90%), Positives = 138/148 (93%), Gaps = 3/148 (2%)
 Frame = +2

Query  149  MAEK---WVLMVTAQTPTNIAVIKYWGKRDETLILPINDSISVTLDPAHLCTTTTVAVSP  319
            MAEK   WVLMVTAQTPTNIAVIKYWGKRDE LILPINDSISVTLDPAHLCTTTTVAVSP
Sbjct  1    MAEKNDSWVLMVTAQTPTNIAVIKYWGKRDENLILPINDSISVTLDPAHLCTTTTVAVSP  60

Query  320  AFDQDRMWLNGKEMSLSGVRYQNCLKEIRARACDVEDEKKGIKITKKDWENLHVHIASYN  499
            AF QDRMWLNGKE+SLSG RYQNCL+EIR+RA DVEDEKKGIKITKKDWE LH+HIASYN
Sbjct  61   AFTQDRMWLNGKEISLSGGRYQNCLREIRSRANDVEDEKKGIKITKKDWEKLHLHIASYN  120

Query  500  NFPTaaglassaagfaCLVFALGKLMNV  583
            NFPTAAGLASSAAGFACLVF+L KLMN 
Sbjct  121  NFPTAAGLASSAAGFACLVFSLAKLMNA  148



>gb|AID51442.1| mevalonate diphosphate decarboxylase [Astragalus membranaceus]
Length=420

 Score =   248 bits (633),  Expect = 7e-77, Method: Compositional matrix adjust.
 Identities = 127/144 (88%), Positives = 138/144 (96%), Gaps = 0/144 (0%)
 Frame = +2

Query  152  AEKWVLMVTAQTPTNIAVIKYWGKRDETLILPINDSISVTLDPAHLCTTTTVAVSPAFDQ  331
            ++ WVLMVTAQTPTNIAVIKYWGKRDETLILP+NDSISVTLDP HLCTTTTVAVSPAF+Q
Sbjct  5    SQNWVLMVTAQTPTNIAVIKYWGKRDETLILPVNDSISVTLDPNHLCTTTTVAVSPAFNQ  64

Query  332  DRMWLNGKEMSLSGVRYQNCLKEIRARACDVEDEKKGIKITKKDWENLHVHIASYNNFPT  511
            DRMWLNGKE+SLSG R+Q+CL+EIRARACDVED KKG+KITK+DW  LHVHIASYNNFPT
Sbjct  65   DRMWLNGKEISLSGGRFQSCLREIRARACDVEDTKKGVKITKEDWSKLHVHIASYNNFPT  124

Query  512  aaglassaagfaCLVFALGKLMNV  583
            AAGLASSAAGFACLV+ALGKLMNV
Sbjct  125  AAGLASSAAGFACLVYALGKLMNV  148



>gb|KDO47059.1| hypothetical protein CISIN_1g014714mg [Citrus sinensis]
Length=420

 Score =   248 bits (633),  Expect = 7e-77, Method: Compositional matrix adjust.
 Identities = 127/144 (88%), Positives = 137/144 (95%), Gaps = 0/144 (0%)
 Frame = +2

Query  152  AEKWVLMVTAQTPTNIAVIKYWGKRDETLILPINDSISVTLDPAHLCTTTTVAVSPAFDQ  331
            AEKWVLMVTAQTPTNIAVIKYWGKRDETLILP+NDSISVTLDP HLCTTTTVAVSP+FDQ
Sbjct  3    AEKWVLMVTAQTPTNIAVIKYWGKRDETLILPVNDSISVTLDPDHLCTTTTVAVSPSFDQ  62

Query  332  DRMWLNGKEMSLSGVRYQNCLKEIRARACDVEDEKKGIKITKKDWENLHVHIASYNNFPT  511
            DRMWLNGKE+SL G RYQNCLKEIR+RACDVED +KGIKI KKDW+ LH+HIAS+NNFPT
Sbjct  63   DRMWLNGKEISLGGGRYQNCLKEIRSRACDVEDTEKGIKIEKKDWQKLHLHIASFNNFPT  122

Query  512  aaglassaagfaCLVFALGKLMNV  583
            AAGLASSAAGFACLVF+L KLMN+
Sbjct  123  AAGLASSAAGFACLVFSLAKLMNL  146



>gb|KHG20401.1| Mvd [Gossypium arboreum]
Length=423

 Score =   248 bits (632),  Expect = 9e-77, Method: Compositional matrix adjust.
 Identities = 129/145 (89%), Positives = 136/145 (94%), Gaps = 0/145 (0%)
 Frame = +2

Query  149  MAEKWVLMVTAQTPTNIAVIKYWGKRDETLILPINDSISVTLDPAHLCTTTTVAVSPAFD  328
            M EKWVLM TAQTPTNIAVIKYWGKRDETLILP+NDSISVTLDPAHLCTTTTVAVSPAF 
Sbjct  1    MGEKWVLMKTAQTPTNIAVIKYWGKRDETLILPVNDSISVTLDPAHLCTTTTVAVSPAFQ  60

Query  329  QDRMWLNGKEMSLSGVRYQNCLKEIRARACDVEDEKKGIKITKKDWENLHVHIASYNNFP  508
            QDRMWLNGKEMSLSG RYQNCL+EIR RA +VED+++GIKI KKDWE LH+HIASYNNFP
Sbjct  61   QDRMWLNGKEMSLSGGRYQNCLREIRKRAREVEDKERGIKIEKKDWEKLHLHIASYNNFP  120

Query  509  TaaglassaagfaCLVFALGKLMNV  583
            TAAGLASSAAGFACLVFAL KLMNV
Sbjct  121  TAAGLASSAAGFACLVFALAKLMNV  145



>ref|XP_009630346.1| PREDICTED: diphosphomevalonate decarboxylase-like [Nicotiana 
tomentosiformis]
Length=422

 Score =   248 bits (632),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 132/149 (89%), Positives = 138/149 (93%), Gaps = 4/149 (3%)
 Frame = +2

Query  149  MAEK----WVLMVTAQTPTNIAVIKYWGKRDETLILPINDSISVTLDPAHLCTTTTVAVS  316
            MAE+    WVLMVTAQTPTNIAVIKYWGKRDE LIL INDSISVTLDPAHLCTTTTVAVS
Sbjct  1    MAEQQLQNWVLMVTAQTPTNIAVIKYWGKRDEDLILAINDSISVTLDPAHLCTTTTVAVS  60

Query  317  PAFDQDRMWLNGKEMSLSGVRYQNCLKEIRARACDVEDEKKGIKITKKDWENLHVHIASY  496
            PAFDQDRMWLNGKE+SLSG RYQNCL+EIRARA DVEDE KGIKI KKDW+NLHVH+ASY
Sbjct  61   PAFDQDRMWLNGKEISLSGGRYQNCLREIRARASDVEDENKGIKIAKKDWQNLHVHVASY  120

Query  497  NNFPTaaglassaagfaCLVFALGKLMNV  583
            NNFPTAAGLASSAAGFACLVF+L KLMNV
Sbjct  121  NNFPTAAGLASSAAGFACLVFSLAKLMNV  149



>gb|KHG20400.1| Mvd [Gossypium arboreum]
Length=459

 Score =   249 bits (635),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 129/145 (89%), Positives = 136/145 (94%), Gaps = 0/145 (0%)
 Frame = +2

Query  149  MAEKWVLMVTAQTPTNIAVIKYWGKRDETLILPINDSISVTLDPAHLCTTTTVAVSPAFD  328
            M EKWVLM TAQTPTNIAVIKYWGKRDETLILP+NDSISVTLDPAHLCTTTTVAVSPAF 
Sbjct  37   MGEKWVLMKTAQTPTNIAVIKYWGKRDETLILPVNDSISVTLDPAHLCTTTTVAVSPAFQ  96

Query  329  QDRMWLNGKEMSLSGVRYQNCLKEIRARACDVEDEKKGIKITKKDWENLHVHIASYNNFP  508
            QDRMWLNGKEMSLSG RYQNCL+EIR RA +VED+++GIKI KKDWE LH+HIASYNNFP
Sbjct  97   QDRMWLNGKEMSLSGGRYQNCLREIRKRAREVEDKERGIKIEKKDWEKLHLHIASYNNFP  156

Query  509  TaaglassaagfaCLVFALGKLMNV  583
            TAAGLASSAAGFACLVFAL KLMNV
Sbjct  157  TAAGLASSAAGFACLVFALAKLMNV  181



>ref|XP_002311015.1| mevalonate disphosphate decarboxylase family protein [Populus 
trichocarpa]
 gb|EEE88382.1| mevalonate disphosphate decarboxylase family protein [Populus 
trichocarpa]
Length=416

 Score =   247 bits (630),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 130/146 (89%), Positives = 138/146 (95%), Gaps = 1/146 (1%)
 Frame = +2

Query  149  MAEK-WVLMVTAQTPTNIAVIKYWGKRDETLILPINDSISVTLDPAHLCTTTTVAVSPAF  325
            MAEK WV MVTAQTPTNIAVIKYWGKRDETLILP+NDSISVTLDPAHLCTTTTVAVSP+F
Sbjct  1    MAEKTWVRMVTAQTPTNIAVIKYWGKRDETLILPVNDSISVTLDPAHLCTTTTVAVSPSF  60

Query  326  DQDRMWLNGKEMSLSGVRYQNCLKEIRARACDVEDEKKGIKITKKDWENLHVHIASYNNF  505
            DQDRMWLNGKE+SLSG RYQNCL+EIRARAC VED++KGIKI KKDWE LH+H+ASYNNF
Sbjct  61   DQDRMWLNGKEISLSGGRYQNCLREIRARACAVEDKEKGIKIAKKDWEKLHLHVASYNNF  120

Query  506  PTaaglassaagfaCLVFALGKLMNV  583
            PTAAGLASSAAGFACLVFAL KLMN 
Sbjct  121  PTAAGLASSAAGFACLVFALAKLMNA  146



>gb|KJB78629.1| hypothetical protein B456_013G012400 [Gossypium raimondii]
 gb|KJB78630.1| hypothetical protein B456_013G012400 [Gossypium raimondii]
Length=415

 Score =   247 bits (630),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 128/145 (88%), Positives = 136/145 (94%), Gaps = 0/145 (0%)
 Frame = +2

Query  149  MAEKWVLMVTAQTPTNIAVIKYWGKRDETLILPINDSISVTLDPAHLCTTTTVAVSPAFD  328
            M EKWVLM TAQTPTNIAVIKYWGKRDETLILP+NDSISVTLDPAHLCTTTTVAVSPAF 
Sbjct  1    MGEKWVLMKTAQTPTNIAVIKYWGKRDETLILPVNDSISVTLDPAHLCTTTTVAVSPAFQ  60

Query  329  QDRMWLNGKEMSLSGVRYQNCLKEIRARACDVEDEKKGIKITKKDWENLHVHIASYNNFP  508
            QDRMWLNGKE+SLSG RYQNCL+EIR RA +VED+++GIKI KKDWE LH+HIASYNNFP
Sbjct  61   QDRMWLNGKEISLSGGRYQNCLREIRTRAREVEDKERGIKIEKKDWEKLHLHIASYNNFP  120

Query  509  TaaglassaagfaCLVFALGKLMNV  583
            TAAGLASSAAGFACLVFAL KLMNV
Sbjct  121  TAAGLASSAAGFACLVFALAKLMNV  145



>ref|XP_007142839.1| hypothetical protein PHAVU_007G021200g [Phaseolus vulgaris]
 gb|ESW14833.1| hypothetical protein PHAVU_007G021200g [Phaseolus vulgaris]
Length=420

 Score =   247 bits (630),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 126/147 (86%), Positives = 137/147 (93%), Gaps = 0/147 (0%)
 Frame = +2

Query  143  GTMAEKWVLMVTAQTPTNIAVIKYWGKRDETLILPINDSISVTLDPAHLCTTTTVAVSPA  322
             + ++ WV+MVTAQTPTNIAVIKYWGKRDETLILP+NDSISVTLDPAHLCTTTTVAVSP 
Sbjct  2    ASESQNWVVMVTAQTPTNIAVIKYWGKRDETLILPVNDSISVTLDPAHLCTTTTVAVSPT  61

Query  323  FDQDRMWLNGKEMSLSGVRYQNCLKEIRARACDVEDEKKGIKITKKDWENLHVHIASYNN  502
            F QDRMWLNGKE+SLSG R+QNCL+EIR+RACDVEDEKKGIKI K+DW  LHVHIASYNN
Sbjct  62   FQQDRMWLNGKEISLSGGRFQNCLREIRSRACDVEDEKKGIKIRKEDWSKLHVHIASYNN  121

Query  503  FPTaaglassaagfaCLVFALGKLMNV  583
            FPTAAGLASSAAGFACL +ALGKLMNV
Sbjct  122  FPTAAGLASSAAGFACLAYALGKLMNV  148



>emb|CDO99902.1| unnamed protein product [Coffea canephora]
Length=424

 Score =   246 bits (628),  Expect = 4e-76, Method: Compositional matrix adjust.
 Identities = 130/147 (88%), Positives = 138/147 (94%), Gaps = 2/147 (1%)
 Frame = +2

Query  149  MAEK--WVLMVTAQTPTNIAVIKYWGKRDETLILPINDSISVTLDPAHLCTTTTVAVSPA  322
            MAEK  WVLMVTAQTPTNIAVIKYWGKRDE+LILPINDSISVTLDP+HLCTTTTVAVSP 
Sbjct  1    MAEKKSWVLMVTAQTPTNIAVIKYWGKRDESLILPINDSISVTLDPSHLCTTTTVAVSPG  60

Query  323  FDQDRMWLNGKEMSLSGVRYQNCLKEIRARACDVEDEKKGIKITKKDWENLHVHIASYNN  502
            F  DRMWLNGKE+SLSG RYQNCL+EIR+RA DVEDEKKGIKI KKDWENLH+HIASYNN
Sbjct  61   FTHDRMWLNGKEISLSGGRYQNCLREIRSRASDVEDEKKGIKIAKKDWENLHLHIASYNN  120

Query  503  FPTaaglassaagfaCLVFALGKLMNV  583
            FPTAAGLASSAAGFACLV++L KLMNV
Sbjct  121  FPTAAGLASSAAGFACLVYSLAKLMNV  147



>gb|KEH44325.1| mevalonate diphosphate decarboxylase [Medicago truncatula]
Length=418

 Score =   245 bits (625),  Expect = 9e-76, Method: Compositional matrix adjust.
 Identities = 125/144 (87%), Positives = 137/144 (95%), Gaps = 0/144 (0%)
 Frame = +2

Query  152  AEKWVLMVTAQTPTNIAVIKYWGKRDETLILPINDSISVTLDPAHLCTTTTVAVSPAFDQ  331
             + WVLMVTAQTPTNIAVIKYWGKRDETLILP+NDSISVTLDPAHLCTTTTV+VSP+F Q
Sbjct  3    GDSWVLMVTAQTPTNIAVIKYWGKRDETLILPVNDSISVTLDPAHLCTTTTVSVSPSFQQ  62

Query  332  DRMWLNGKEMSLSGVRYQNCLKEIRARACDVEDEKKGIKITKKDWENLHVHIASYNNFPT  511
            DRMWLNGKE+SLSG R+Q+CL+EIRARACDVED KKGIKITK+DW  L+VHIASYNNFPT
Sbjct  63   DRMWLNGKEISLSGGRFQSCLREIRARACDVEDNKKGIKITKEDWSKLYVHIASYNNFPT  122

Query  512  aaglassaagfaCLVFALGKLMNV  583
            AAGLASSAAGFACLV++LGKLMNV
Sbjct  123  AAGLASSAAGFACLVYSLGKLMNV  146



>ref|XP_009795010.1| PREDICTED: diphosphomevalonate decarboxylase-like [Nicotiana 
sylvestris]
Length=421

 Score =   244 bits (624),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 131/148 (89%), Positives = 137/148 (93%), Gaps = 3/148 (2%)
 Frame = +2

Query  149  MAEK---WVLMVTAQTPTNIAVIKYWGKRDETLILPINDSISVTLDPAHLCTTTTVAVSP  319
            MAE+   WVLMVTAQTPTNIAVIKYWGKRDE LIL INDSISVTLDPAHLCTTTTVAVSP
Sbjct  1    MAEQLQNWVLMVTAQTPTNIAVIKYWGKRDEDLILAINDSISVTLDPAHLCTTTTVAVSP  60

Query  320  AFDQDRMWLNGKEMSLSGVRYQNCLKEIRARACDVEDEKKGIKITKKDWENLHVHIASYN  499
            AF+QDRMWLNGKE+SLSG RYQNCL+EIRARA DVEDE KGIKI KKDW+NLHVHI SYN
Sbjct  61   AFNQDRMWLNGKEISLSGGRYQNCLREIRARASDVEDENKGIKIAKKDWQNLHVHIVSYN  120

Query  500  NFPTaaglassaagfaCLVFALGKLMNV  583
            NFPTAAGLASSAAGFACLVF+L KLMNV
Sbjct  121  NFPTAAGLASSAAGFACLVFSLAKLMNV  148



>gb|KHN11470.1| Diphosphomevalonate decarboxylase [Glycine soja]
Length=421

 Score =   244 bits (624),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 126/144 (88%), Positives = 135/144 (94%), Gaps = 0/144 (0%)
 Frame = +2

Query  152  AEKWVLMVTAQTPTNIAVIKYWGKRDETLILPINDSISVTLDPAHLCTTTTVAVSPAFDQ  331
            ++ WV MVTAQTPTNIAVIKYWGKRDETLILPINDSISVTLDP+HLCTTTT AVSPAF Q
Sbjct  6    SQNWVFMVTAQTPTNIAVIKYWGKRDETLILPINDSISVTLDPSHLCTTTTAAVSPAFHQ  65

Query  332  DRMWLNGKEMSLSGVRYQNCLKEIRARACDVEDEKKGIKITKKDWENLHVHIASYNNFPT  511
            DRMWLNGKE+SLSG R+Q+CL+EIRARACDVEDE KGIKITK+DW  LHVHIASYNNFPT
Sbjct  66   DRMWLNGKEISLSGGRFQSCLREIRARACDVEDETKGIKITKEDWGKLHVHIASYNNFPT  125

Query  512  aaglassaagfaCLVFALGKLMNV  583
            AAGLASSAAGFACL +ALGKLMNV
Sbjct  126  AAGLASSAAGFACLAYALGKLMNV  149



>ref|XP_007010317.1| Mevalonate diphosphate decarboxylase 1 isoform 4 [Theobroma cacao]
 gb|EOY19127.1| Mevalonate diphosphate decarboxylase 1 isoform 4 [Theobroma cacao]
Length=288

 Score =   240 bits (613),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 124/145 (86%), Positives = 134/145 (92%), Gaps = 0/145 (0%)
 Frame = +2

Query  149  MAEKWVLMVTAQTPTNIAVIKYWGKRDETLILPINDSISVTLDPAHLCTTTTVAVSPAFD  328
            M E WVLM TAQTPTNIAVIKYWGKRDE+LILP+NDSISVTLDPAHLCTTTTVAVSP F 
Sbjct  1    MGETWVLMKTAQTPTNIAVIKYWGKRDESLILPVNDSISVTLDPAHLCTTTTVAVSPVFQ  60

Query  329  QDRMWLNGKEMSLSGVRYQNCLKEIRARACDVEDEKKGIKITKKDWENLHVHIASYNNFP  508
            QDRMWLNGKE+SLSG R+Q+CL+EIR RA +VED++KG+KI KKDWE LHVHIASYNNFP
Sbjct  61   QDRMWLNGKEISLSGGRFQSCLREIRRRASEVEDKEKGVKIEKKDWEKLHVHIASYNNFP  120

Query  509  TaaglassaagfaCLVFALGKLMNV  583
            TAAGLASSAAGFACLVFAL KLMNV
Sbjct  121  TAAGLASSAAGFACLVFALAKLMNV  145



>ref|XP_006359351.1| PREDICTED: diphosphomevalonate decarboxylase-like [Solanum tuberosum]
Length=429

 Score =   244 bits (623),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 129/144 (90%), Positives = 137/144 (95%), Gaps = 0/144 (0%)
 Frame = +2

Query  152  AEKWVLMVTAQTPTNIAVIKYWGKRDETLILPINDSISVTLDPAHLCTTTTVAVSPAFDQ  331
            ++KWVLMVTAQTPTNIAVIKYWGKRDE LIL INDSISVTLDPAHLCTTTTVAVSPAF+Q
Sbjct  5    SQKWVLMVTAQTPTNIAVIKYWGKRDENLILAINDSISVTLDPAHLCTTTTVAVSPAFNQ  64

Query  332  DRMWLNGKEMSLSGVRYQNCLKEIRARACDVEDEKKGIKITKKDWENLHVHIASYNNFPT  511
            DRMWL GKE+SLSG RYQNCL+EIRARA DVEDEKKGIKITKKDWENL VH+ASYNNFPT
Sbjct  65   DRMWLLGKEISLSGGRYQNCLREIRARANDVEDEKKGIKITKKDWENLRVHVASYNNFPT  124

Query  512  aaglassaagfaCLVFALGKLMNV  583
            AAGLASSAAGFACLV++L KLMNV
Sbjct  125  AAGLASSAAGFACLVYSLAKLMNV  148



>ref|XP_003555870.1| PREDICTED: diphosphomevalonate decarboxylase-like [Glycine max]
Length=421

 Score =   244 bits (622),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 125/144 (87%), Positives = 135/144 (94%), Gaps = 0/144 (0%)
 Frame = +2

Query  152  AEKWVLMVTAQTPTNIAVIKYWGKRDETLILPINDSISVTLDPAHLCTTTTVAVSPAFDQ  331
            ++ WV MVTAQTPTNIAVIKYWGKRDETLILP+NDSISVTLDP+HLCTTTT AVSPAF Q
Sbjct  6    SQNWVFMVTAQTPTNIAVIKYWGKRDETLILPVNDSISVTLDPSHLCTTTTAAVSPAFHQ  65

Query  332  DRMWLNGKEMSLSGVRYQNCLKEIRARACDVEDEKKGIKITKKDWENLHVHIASYNNFPT  511
            DRMWLNGKE+SLSG R+Q+CL+EIRARACDVEDE KGIKITK+DW  LHVHIASYNNFPT
Sbjct  66   DRMWLNGKEISLSGGRFQSCLREIRARACDVEDETKGIKITKEDWGKLHVHIASYNNFPT  125

Query  512  aaglassaagfaCLVFALGKLMNV  583
            AAGLASSAAGFACL +ALGKLMNV
Sbjct  126  AAGLASSAAGFACLAYALGKLMNV  149



>ref|XP_004497159.1| PREDICTED: diphosphomevalonate decarboxylase-like [Cicer arietinum]
Length=421

 Score =   244 bits (622),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 125/147 (85%), Positives = 136/147 (93%), Gaps = 0/147 (0%)
 Frame = +2

Query  143  GTMAEKWVLMVTAQTPTNIAVIKYWGKRDETLILPINDSISVTLDPAHLCTTTTVAVSPA  322
            G   + WVLMVTAQTPTNIAVIKYWGKRDETLILP+NDSISVTLDP HLCTTTTVAVSP+
Sbjct  3    GDSQQNWVLMVTAQTPTNIAVIKYWGKRDETLILPVNDSISVTLDPNHLCTTTTVAVSPS  62

Query  323  FDQDRMWLNGKEMSLSGVRYQNCLKEIRARACDVEDEKKGIKITKKDWENLHVHIASYNN  502
            F QDRMWLNGKE+SLSG R+Q+CL+EIRARAC+VED KKGIKITK+DW   H+HIASYNN
Sbjct  63   FQQDRMWLNGKEISLSGGRFQSCLREIRARACEVEDNKKGIKITKEDWGKFHIHIASYNN  122

Query  503  FPTaaglassaagfaCLVFALGKLMNV  583
            FPTAAGLASSAAGFACLV+ALGKLMNV
Sbjct  123  FPTAAGLASSAAGFACLVYALGKLMNV  149



>ref|XP_007010316.1| GHMP kinase family protein isoform 3 [Theobroma cacao]
 gb|EOY19126.1| GHMP kinase family protein isoform 3 [Theobroma cacao]
Length=315

 Score =   239 bits (611),  Expect = 6e-75, Method: Compositional matrix adjust.
 Identities = 124/145 (86%), Positives = 134/145 (92%), Gaps = 0/145 (0%)
 Frame = +2

Query  149  MAEKWVLMVTAQTPTNIAVIKYWGKRDETLILPINDSISVTLDPAHLCTTTTVAVSPAFD  328
            M E WVLM TAQTPTNIAVIKYWGKRDE+LILP+NDSISVTLDPAHLCTTTTVAVSP F 
Sbjct  1    MGETWVLMKTAQTPTNIAVIKYWGKRDESLILPVNDSISVTLDPAHLCTTTTVAVSPVFQ  60

Query  329  QDRMWLNGKEMSLSGVRYQNCLKEIRARACDVEDEKKGIKITKKDWENLHVHIASYNNFP  508
            QDRMWLNGKE+SLSG R+Q+CL+EIR RA +VED++KG+KI KKDWE LHVHIASYNNFP
Sbjct  61   QDRMWLNGKEISLSGGRFQSCLREIRRRASEVEDKEKGVKIEKKDWEKLHVHIASYNNFP  120

Query  509  TaaglassaagfaCLVFALGKLMNV  583
            TAAGLASSAAGFACLVFAL KLMNV
Sbjct  121  TAAGLASSAAGFACLVFALAKLMNV  145



>ref|XP_006367129.1| PREDICTED: diphosphomevalonate decarboxylase-like [Solanum tuberosum]
Length=151

 Score =   234 bits (596),  Expect = 6e-75, Method: Compositional matrix adjust.
 Identities = 124/135 (92%), Positives = 130/135 (96%), Gaps = 0/135 (0%)
 Frame = +2

Query  152  AEKWVLMVTAQTPTNIAVIKYWGKRDETLILPINDSISVTLDPAHLCTTTTVAVSPAFDQ  331
            ++KWVLMVTAQTPTNIAVIKYWGKRDE LIL INDSISVTLDPAHLCTTTTVAVSPAF+Q
Sbjct  5    SQKWVLMVTAQTPTNIAVIKYWGKRDENLILAINDSISVTLDPAHLCTTTTVAVSPAFNQ  64

Query  332  DRMWLNGKEMSLSGVRYQNCLKEIRARACDVEDEKKGIKITKKDWENLHVHIASYNNFPT  511
            DRMWLNGKE+SLSG RYQNCL+EIRARA DVEDEKKGIKI KKDWENLHVH+ASYNNFPT
Sbjct  65   DRMWLNGKEISLSGDRYQNCLREIRARANDVEDEKKGIKIAKKDWENLHVHVASYNNFPT  124

Query  512  aaglassaagfaCLV  556
            AAGLASSAAGFACLV
Sbjct  125  AAGLASSAAGFACLV  139



>gb|EPS58761.1| hypothetical protein M569_16051, partial [Genlisea aurea]
Length=207

 Score =   235 bits (600),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 121/144 (84%), Positives = 132/144 (92%), Gaps = 0/144 (0%)
 Frame = +2

Query  152  AEKWVLMVTAQTPTNIAVIKYWGKRDETLILPINDSISVTLDPAHLCTTTTVAVSPAFDQ  331
            AEKW+L VTA+TPTNIAVIKYWGKRDE LILPINDSISVTLDP HLCTTT+VAVSPAFD+
Sbjct  3    AEKWILTVTARTPTNIAVIKYWGKRDEDLILPINDSISVTLDPDHLCTTTSVAVSPAFDR  62

Query  332  DRMWLNGKEMSLSGVRYQNCLKEIRARACDVEDEKKGIKITKKDWENLHVHIASYNNFPT  511
            DRMWLNGKE+SLSG RYQNCL+E+R+RA D EDE KGIKI+ +DW+ LHVHI SYNNFPT
Sbjct  63   DRMWLNGKEVSLSGKRYQNCLRELRSRASDYEDENKGIKISSEDWQKLHVHIVSYNNFPT  122

Query  512  aaglassaagfaCLVFALGKLMNV  583
            AAGLASSAAG ACLVFAL KLMNV
Sbjct  123  AAGLASSAAGLACLVFALAKLMNV  146



>ref|XP_008232018.1| PREDICTED: diphosphomevalonate decarboxylase-like [Prunus mume]
Length=419

 Score =   241 bits (616),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 125/144 (87%), Positives = 137/144 (95%), Gaps = 0/144 (0%)
 Frame = +2

Query  152  AEKWVLMVTAQTPTNIAVIKYWGKRDETLILPINDSISVTLDPAHLCTTTTVAVSPAFDQ  331
            ++KWVLMVTAQTPTNIAVIKYWGKRDETLILP+NDSISVTLDP HLCTTTTV+VSPAFDQ
Sbjct  5    SQKWVLMVTAQTPTNIAVIKYWGKRDETLILPVNDSISVTLDPEHLCTTTTVSVSPAFDQ  64

Query  332  DRMWLNGKEMSLSGVRYQNCLKEIRARACDVEDEKKGIKITKKDWENLHVHIASYNNFPT  511
            DRMWLNGKE+SLSG R+Q+CL+EIR+RA DV D++KGIKITKKDWE L+VHIASYNNFPT
Sbjct  65   DRMWLNGKEISLSGGRFQSCLREIRSRATDVHDKEKGIKITKKDWEKLNVHIASYNNFPT  124

Query  512  aaglassaagfaCLVFALGKLMNV  583
            AAGLASSAAGFACLVFAL KLMN 
Sbjct  125  AAGLASSAAGFACLVFALAKLMNA  148



>ref|XP_006403598.1| hypothetical protein EUTSA_v10010411mg [Eutrema salsugineum]
 gb|ESQ45051.1| hypothetical protein EUTSA_v10010411mg [Eutrema salsugineum]
Length=316

 Score =   238 bits (607),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 123/144 (85%), Positives = 133/144 (92%), Gaps = 0/144 (0%)
 Frame = +2

Query  152  AEKWVLMVTAQTPTNIAVIKYWGKRDETLILPINDSISVTLDPAHLCTTTTVAVSPAFDQ  331
            AEKWV MVTAQTPTNIAVIKYWGKRDE  ILP+NDSISVTLDP HLCT TTVAVSPAFD+
Sbjct  3    AEKWVYMVTAQTPTNIAVIKYWGKRDEVRILPVNDSISVTLDPDHLCTVTTVAVSPAFDR  62

Query  332  DRMWLNGKEMSLSGVRYQNCLKEIRARACDVEDEKKGIKITKKDWENLHVHIASYNNFPT  511
            DRMWLNGKE+SLSG RYQNCL+EIR RA DVED++KGI+I KKDWE LH+HIAS+NNFPT
Sbjct  63   DRMWLNGKEISLSGSRYQNCLREIRGRAGDVEDKEKGIRIEKKDWEKLHLHIASHNNFPT  122

Query  512  aaglassaagfaCLVFALGKLMNV  583
            AAGLASSAAGFACLVF+L KLMNV
Sbjct  123  AAGLASSAAGFACLVFSLAKLMNV  146



>ref|XP_007211744.1| hypothetical protein PRUPE_ppa006290mg [Prunus persica]
 gb|EMJ12943.1| hypothetical protein PRUPE_ppa006290mg [Prunus persica]
Length=419

 Score =   240 bits (613),  Expect = 5e-74, Method: Compositional matrix adjust.
 Identities = 124/144 (86%), Positives = 137/144 (95%), Gaps = 0/144 (0%)
 Frame = +2

Query  152  AEKWVLMVTAQTPTNIAVIKYWGKRDETLILPINDSISVTLDPAHLCTTTTVAVSPAFDQ  331
            ++KWVLMVTAQTPTNIAVIKYWGKRDETLILP+NDSISVTLDP HLCTTTTV+VSP+FDQ
Sbjct  5    SQKWVLMVTAQTPTNIAVIKYWGKRDETLILPVNDSISVTLDPEHLCTTTTVSVSPSFDQ  64

Query  332  DRMWLNGKEMSLSGVRYQNCLKEIRARACDVEDEKKGIKITKKDWENLHVHIASYNNFPT  511
            DRMWLNGKE+SLSG R+Q+CL+EIR+RA DV D++KGIKITKKDWE L+VHIASYNNFPT
Sbjct  65   DRMWLNGKEISLSGGRFQSCLREIRSRATDVHDKEKGIKITKKDWEKLNVHIASYNNFPT  124

Query  512  aaglassaagfaCLVFALGKLMNV  583
            AAGLASSAAGFACLVFAL KLMN 
Sbjct  125  AAGLASSAAGFACLVFALAKLMNA  148



>ref|XP_007010315.1| GHMP kinase family protein isoform 2 [Theobroma cacao]
 gb|EOY19125.1| GHMP kinase family protein isoform 2 [Theobroma cacao]
Length=417

 Score =   240 bits (612),  Expect = 7e-74, Method: Compositional matrix adjust.
 Identities = 124/145 (86%), Positives = 134/145 (92%), Gaps = 0/145 (0%)
 Frame = +2

Query  149  MAEKWVLMVTAQTPTNIAVIKYWGKRDETLILPINDSISVTLDPAHLCTTTTVAVSPAFD  328
            M E WVLM TAQTPTNIAVIKYWGKRDE+LILP+NDSISVTLDPAHLCTTTTVAVSP F 
Sbjct  1    MGETWVLMKTAQTPTNIAVIKYWGKRDESLILPVNDSISVTLDPAHLCTTTTVAVSPVFQ  60

Query  329  QDRMWLNGKEMSLSGVRYQNCLKEIRARACDVEDEKKGIKITKKDWENLHVHIASYNNFP  508
            QDRMWLNGKE+SLSG R+Q+CL+EIR RA +VED++KG+KI KKDWE LHVHIASYNNFP
Sbjct  61   QDRMWLNGKEISLSGGRFQSCLREIRRRASEVEDKEKGVKIEKKDWEKLHVHIASYNNFP  120

Query  509  TaaglassaagfaCLVFALGKLMNV  583
            TAAGLASSAAGFACLVFAL KLMNV
Sbjct  121  TAAGLASSAAGFACLVFALAKLMNV  145



>ref|XP_011469322.1| PREDICTED: diphosphomevalonate decarboxylase [Fragaria vesca 
subsp. vesca]
Length=418

 Score =   240 bits (612),  Expect = 7e-74, Method: Compositional matrix adjust.
 Identities = 124/143 (87%), Positives = 133/143 (93%), Gaps = 0/143 (0%)
 Frame = +2

Query  155  EKWVLMVTAQTPTNIAVIKYWGKRDETLILPINDSISVTLDPAHLCTTTTVAVSPAFDQD  334
            +KWVLMVTAQTPTNIAVIKYWGKRDE+LILP+NDSISVTLDP HLCTTTTV+VSP+F  D
Sbjct  7    QKWVLMVTAQTPTNIAVIKYWGKRDESLILPVNDSISVTLDPDHLCTTTTVSVSPSFSHD  66

Query  335  RMWLNGKEMSLSGVRYQNCLKEIRARACDVEDEKKGIKITKKDWENLHVHIASYNNFPTa  514
            RMWLNG E+SLSG R+Q CL+EIR+RACDV DE KGI ITKKDWE LHVHIASYNNFPTA
Sbjct  67   RMWLNGDEISLSGGRFQRCLREIRSRACDVHDESKGIHITKKDWEKLHVHIASYNNFPTA  126

Query  515  aglassaagfaCLVFALGKLMNV  583
            AGLASSAAGFACLVFALGKLMNV
Sbjct  127  AGLASSAAGFACLVFALGKLMNV  149



>ref|XP_007010314.1| GHMP kinase family protein isoform 1 [Theobroma cacao]
 gb|EOY19124.1| GHMP kinase family protein isoform 1 [Theobroma cacao]
Length=418

 Score =   240 bits (612),  Expect = 7e-74, Method: Compositional matrix adjust.
 Identities = 124/145 (86%), Positives = 134/145 (92%), Gaps = 0/145 (0%)
 Frame = +2

Query  149  MAEKWVLMVTAQTPTNIAVIKYWGKRDETLILPINDSISVTLDPAHLCTTTTVAVSPAFD  328
            M E WVLM TAQTPTNIAVIKYWGKRDE+LILP+NDSISVTLDPAHLCTTTTVAVSP F 
Sbjct  1    MGETWVLMKTAQTPTNIAVIKYWGKRDESLILPVNDSISVTLDPAHLCTTTTVAVSPVFQ  60

Query  329  QDRMWLNGKEMSLSGVRYQNCLKEIRARACDVEDEKKGIKITKKDWENLHVHIASYNNFP  508
            QDRMWLNGKE+SLSG R+Q+CL+EIR RA +VED++KG+KI KKDWE LHVHIASYNNFP
Sbjct  61   QDRMWLNGKEISLSGGRFQSCLREIRRRASEVEDKEKGVKIEKKDWEKLHVHIASYNNFP  120

Query  509  TaaglassaagfaCLVFALGKLMNV  583
            TAAGLASSAAGFACLVFAL KLMNV
Sbjct  121  TAAGLASSAAGFACLVFALAKLMNV  145



>ref|XP_006411092.1| hypothetical protein EUTSA_v10016888mg [Eutrema salsugineum]
 gb|ESQ52545.1| hypothetical protein EUTSA_v10016888mg [Eutrema salsugineum]
Length=341

 Score =   238 bits (606),  Expect = 8e-74, Method: Compositional matrix adjust.
 Identities = 126/143 (88%), Positives = 132/143 (92%), Gaps = 0/143 (0%)
 Frame = +2

Query  155  EKWVLMVTAQTPTNIAVIKYWGKRDETLILPINDSISVTLDPAHLCTTTTVAVSPAFDQD  334
            EKWVLMVTAQTPTNIAVIKYWGKRDE  ILPINDSISVTLDP HLCT TTVAVSP+FD+D
Sbjct  4    EKWVLMVTAQTPTNIAVIKYWGKRDEVRILPINDSISVTLDPDHLCTLTTVAVSPSFDRD  63

Query  335  RMWLNGKEMSLSGVRYQNCLKEIRARACDVEDEKKGIKITKKDWENLHVHIASYNNFPTa  514
            RMWLNGKE+SLSG RYQNCL+EIR RA DVED+ KGIKI KKDWE LH+HIASYNNFPTA
Sbjct  64   RMWLNGKEISLSGSRYQNCLREIRCRADDVEDKVKGIKIAKKDWEKLHLHIASYNNFPTA  123

Query  515  aglassaagfaCLVFALGKLMNV  583
            AGLASSAAGFACLVFAL KLMNV
Sbjct  124  AGLASSAAGFACLVFALAKLMNV  146



>ref|XP_010032077.1| PREDICTED: diphosphomevalonate decarboxylase-like [Eucalyptus 
grandis]
 gb|KCW51467.1| hypothetical protein EUGRSUZ_J00991 [Eucalyptus grandis]
Length=418

 Score =   240 bits (612),  Expect = 8e-74, Method: Compositional matrix adjust.
 Identities = 121/145 (83%), Positives = 138/145 (95%), Gaps = 0/145 (0%)
 Frame = +2

Query  149  MAEKWVLMVTAQTPTNIAVIKYWGKRDETLILPINDSISVTLDPAHLCTTTTVAVSPAFD  328
            MA +W+L +TAQTPTNIAVIKYWGKRDE+LILP+NDSISVTLDP HLCTTTTVAVSPAF+
Sbjct  1    MAGEWILTLTAQTPTNIAVIKYWGKRDESLILPVNDSISVTLDPGHLCTTTTVAVSPAFE  60

Query  329  QDRMWLNGKEMSLSGVRYQNCLKEIRARACDVEDEKKGIKITKKDWENLHVHIASYNNFP  508
            QDRMWLNGKE+SLSG R+Q+CL+EIRARA DVE+++KGIKI+KKDWE LH+HI+S+NNFP
Sbjct  61   QDRMWLNGKEISLSGDRFQSCLREIRARATDVENKEKGIKISKKDWEKLHLHISSFNNFP  120

Query  509  TaaglassaagfaCLVFALGKLMNV  583
            TAAGLASSAAG ACLVFALGKLMNV
Sbjct  121  TAAGLASSAAGLACLVFALGKLMNV  145



>gb|ABG24207.2| mevalonate disphosphate decarboxylase [Arnebia euchroma]
Length=421

 Score =   239 bits (610),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 123/147 (84%), Positives = 134/147 (91%), Gaps = 0/147 (0%)
 Frame = +2

Query  143  GTMAEKWVLMVTAQTPTNIAVIKYWGKRDETLILPINDSISVTLDPAHLCTTTTVAVSPA  322
            G   E W+LMVTAQTPTNIAVIKYWGKRDE+LILPIN SISVTLDP+HLCTTTTV+VSP+
Sbjct  2    GEQGENWILMVTAQTPTNIAVIKYWGKRDESLILPINSSISVTLDPSHLCTTTTVSVSPS  61

Query  323  FDQDRMWLNGKEMSLSGVRYQNCLKEIRARACDVEDEKKGIKITKKDWENLHVHIASYNN  502
            F QD MWLNGKE+SLSG R+Q CL+EIR+RACDVEDEKKG KI KKDWE LHVHIASYNN
Sbjct  62   FKQDCMWLNGKEISLSGGRFQRCLREIRSRACDVEDEKKGFKIAKKDWEKLHVHIASYNN  121

Query  503  FPTaaglassaagfaCLVFALGKLMNV  583
            FPTAAGLASSAAGFACLVF+L KLMN+
Sbjct  122  FPTAAGLASSAAGFACLVFSLAKLMNL  148



>ref|XP_006403599.1| hypothetical protein EUTSA_v10010411mg [Eutrema salsugineum]
 gb|ESQ45052.1| hypothetical protein EUTSA_v10010411mg [Eutrema salsugineum]
Length=419

 Score =   238 bits (608),  Expect = 4e-73, Method: Compositional matrix adjust.
 Identities = 123/144 (85%), Positives = 133/144 (92%), Gaps = 0/144 (0%)
 Frame = +2

Query  152  AEKWVLMVTAQTPTNIAVIKYWGKRDETLILPINDSISVTLDPAHLCTTTTVAVSPAFDQ  331
            AEKWV MVTAQTPTNIAVIKYWGKRDE  ILP+NDSISVTLDP HLCT TTVAVSPAFD+
Sbjct  3    AEKWVYMVTAQTPTNIAVIKYWGKRDEVRILPVNDSISVTLDPDHLCTVTTVAVSPAFDR  62

Query  332  DRMWLNGKEMSLSGVRYQNCLKEIRARACDVEDEKKGIKITKKDWENLHVHIASYNNFPT  511
            DRMWLNGKE+SLSG RYQNCL+EIR RA DVED++KGI+I KKDWE LH+HIAS+NNFPT
Sbjct  63   DRMWLNGKEISLSGSRYQNCLREIRGRAGDVEDKEKGIRIEKKDWEKLHLHIASHNNFPT  122

Query  512  aaglassaagfaCLVFALGKLMNV  583
            AAGLASSAAGFACLVF+L KLMNV
Sbjct  123  AAGLASSAAGFACLVFSLAKLMNV  146



>ref|XP_002266399.1| PREDICTED: diphosphomevalonate decarboxylase [Vitis vinifera]
 emb|CBI35263.3| unnamed protein product [Vitis vinifera]
Length=422

 Score =   238 bits (608),  Expect = 4e-73, Method: Compositional matrix adjust.
 Identities = 123/144 (85%), Positives = 132/144 (92%), Gaps = 0/144 (0%)
 Frame = +2

Query  152  AEKWVLMVTAQTPTNIAVIKYWGKRDETLILPINDSISVTLDPAHLCTTTTVAVSPAFDQ  331
            ++KW+LM TAQTPTNIAVIKYWGKRDE LIL +NDSISVTLDP HLCTTTTVAVSP F  
Sbjct  6    SQKWILMTTAQTPTNIAVIKYWGKRDEALILAVNDSISVTLDPQHLCTTTTVAVSPMFQS  65

Query  332  DRMWLNGKEMSLSGVRYQNCLKEIRARACDVEDEKKGIKITKKDWENLHVHIASYNNFPT  511
            DRMWLNGKE+SLSG RYQNCL+EIR+RA  +EDEKKGIKITKKDWE LHVHIASYNNFPT
Sbjct  66   DRMWLNGKEISLSGGRYQNCLREIRSRASKIEDEKKGIKITKKDWEKLHVHIASYNNFPT  125

Query  512  aaglassaagfaCLVFALGKLMNV  583
            AAGLASSAAGFACLVF+L KLMNV
Sbjct  126  AAGLASSAAGFACLVFSLAKLMNV  149



>gb|KFK36776.1| hypothetical protein AALP_AA4G169000 [Arabis alpina]
Length=414

 Score =   238 bits (607),  Expect = 4e-73, Method: Compositional matrix adjust.
 Identities = 127/147 (86%), Positives = 134/147 (91%), Gaps = 2/147 (1%)
 Frame = +2

Query  149  MAE--KWVLMVTAQTPTNIAVIKYWGKRDETLILPINDSISVTLDPAHLCTTTTVAVSPA  322
            MAE  KWVLMVTAQTPTNIAVIKYWGKRDE  ILPINDSISVTLDP HLCT TTVAVSP+
Sbjct  1    MAEEKKWVLMVTAQTPTNIAVIKYWGKRDEVRILPINDSISVTLDPDHLCTLTTVAVSPS  60

Query  323  FDQDRMWLNGKEMSLSGVRYQNCLKEIRARACDVEDEKKGIKITKKDWENLHVHIASYNN  502
            FD+DRMWLNGKE+SLSG RYQNCL+EIR+R  DVEDE KGIKI KKDWE LH+HIASYNN
Sbjct  61   FDRDRMWLNGKEISLSGSRYQNCLREIRSRGDDVEDEVKGIKIEKKDWETLHLHIASYNN  120

Query  503  FPTaaglassaagfaCLVFALGKLMNV  583
            FPTAAGLASSAAGFACLVF+L KLMNV
Sbjct  121  FPTAAGLASSAAGFACLVFSLAKLMNV  147



>ref|NP_181404.1| mevalonate diphosphate decarboxylase 1 [Arabidopsis thaliana]
 emb|CAA74700.1| mevalonate diphosphate decarboxylase [Arabidopsis thaliana]
 emb|CAA76803.1| mevalonate diphosphate decarboxylase [Arabidopsis thaliana]
 gb|AAC67348.1| mevalonate diphosphate decarboxylase [Arabidopsis thaliana]
 gb|AAP68208.1| At2g38700 [Arabidopsis thaliana]
 dbj|BAF00296.1| mevalonate diphosphate decarboxylase [Arabidopsis thaliana]
 gb|AEC09574.1| mevalonate diphosphate decarboxylase 1 [Arabidopsis thaliana]
Length=412

 Score =   238 bits (606),  Expect = 6e-73, Method: Compositional matrix adjust.
 Identities = 124/143 (87%), Positives = 134/143 (94%), Gaps = 0/143 (0%)
 Frame = +2

Query  155  EKWVLMVTAQTPTNIAVIKYWGKRDETLILPINDSISVTLDPAHLCTTTTVAVSPAFDQD  334
            EKWV+MVTAQTPTNIAVIKYWGKRDE  ILPINDSISVTLDP HLCT TTVAVSP+FD+D
Sbjct  4    EKWVVMVTAQTPTNIAVIKYWGKRDEVRILPINDSISVTLDPDHLCTLTTVAVSPSFDRD  63

Query  335  RMWLNGKEMSLSGVRYQNCLKEIRARACDVEDEKKGIKITKKDWENLHVHIASYNNFPTa  514
            RMWLNGKE+SLSG RYQNCL+EIR+RA DVED++KGIKI KKDWE LH+HIAS+NNFPTA
Sbjct  64   RMWLNGKEISLSGSRYQNCLREIRSRADDVEDKEKGIKIAKKDWEKLHLHIASHNNFPTA  123

Query  515  aglassaagfaCLVFALGKLMNV  583
            AGLASSAAGFACLVFAL KLMNV
Sbjct  124  AGLASSAAGFACLVFALAKLMNV  146



>emb|CDY65399.1| BnaCnng46900D [Brassica napus]
Length=419

 Score =   238 bits (606),  Expect = 7e-73, Method: Compositional matrix adjust.
 Identities = 122/144 (85%), Positives = 133/144 (92%), Gaps = 0/144 (0%)
 Frame = +2

Query  152  AEKWVLMVTAQTPTNIAVIKYWGKRDETLILPINDSISVTLDPAHLCTTTTVAVSPAFDQ  331
            AEKWV MVTAQTPTNIAVIKYWGKRDE  ILP+NDSISVTLDP HLCT TTVAVSP+FD+
Sbjct  3    AEKWVYMVTAQTPTNIAVIKYWGKRDEVRILPVNDSISVTLDPDHLCTVTTVAVSPSFDR  62

Query  332  DRMWLNGKEMSLSGVRYQNCLKEIRARACDVEDEKKGIKITKKDWENLHVHIASYNNFPT  511
            DRMWLNGKE+SLSG RYQNCL+EIR RA DVED++KG+KI KKDWE LH+HIAS+NNFPT
Sbjct  63   DRMWLNGKEISLSGSRYQNCLREIRGRAGDVEDKEKGVKIEKKDWEKLHLHIASHNNFPT  122

Query  512  aaglassaagfaCLVFALGKLMNV  583
            AAGLASSAAGFACLVF+L KLMNV
Sbjct  123  AAGLASSAAGFACLVFSLAKLMNV  146



>emb|CDX76157.1| BnaA04g04210D [Brassica napus]
Length=419

 Score =   237 bits (605),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 122/144 (85%), Positives = 133/144 (92%), Gaps = 0/144 (0%)
 Frame = +2

Query  152  AEKWVLMVTAQTPTNIAVIKYWGKRDETLILPINDSISVTLDPAHLCTTTTVAVSPAFDQ  331
            AEKWV MVTAQTPTNIAVIKYWGKRDE  ILP+NDSISVTLDP HLCT TTVAVSP+FD+
Sbjct  3    AEKWVYMVTAQTPTNIAVIKYWGKRDEVRILPVNDSISVTLDPDHLCTVTTVAVSPSFDR  62

Query  332  DRMWLNGKEMSLSGVRYQNCLKEIRARACDVEDEKKGIKITKKDWENLHVHIASYNNFPT  511
            DRMWLNGKE+SLSG RYQNCL+EIR RA DVED++KG+KI KKDWE LH+HIAS+NNFPT
Sbjct  63   DRMWLNGKEISLSGSRYQNCLREIRGRAGDVEDKEKGVKIDKKDWEKLHLHIASHNNFPT  122

Query  512  aaglassaagfaCLVFALGKLMNV  583
            AAGLASSAAGFACLVF+L KLMNV
Sbjct  123  AAGLASSAAGFACLVFSLAKLMNV  146



>ref|XP_010676219.1| PREDICTED: diphosphomevalonate decarboxylase-like [Beta vulgaris 
subsp. vulgaris]
Length=420

 Score =   237 bits (605),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 123/143 (86%), Positives = 132/143 (92%), Gaps = 0/143 (0%)
 Frame = +2

Query  155  EKWVLMVTAQTPTNIAVIKYWGKRDETLILPINDSISVTLDPAHLCTTTTVAVSPAFDQD  334
            E WV +VTA+TPTNIAVIKYWGKRDETLILPINDSISVTLDP HLCTTTTVAVSP F +D
Sbjct  5    EDWVRIVTAKTPTNIAVIKYWGKRDETLILPINDSISVTLDPNHLCTTTTVAVSPTFVED  64

Query  335  RMWLNGKEMSLSGVRYQNCLKEIRARACDVEDEKKGIKITKKDWENLHVHIASYNNFPTa  514
            RMWLNGKE+SL+G RYQNCL+EIR RA DVE+E+KGIKI KKDW+NLHVHIASYNNFPTA
Sbjct  65   RMWLNGKEISLAGERYQNCLREIRKRASDVEEEEKGIKIAKKDWQNLHVHIASYNNFPTA  124

Query  515  aglassaagfaCLVFALGKLMNV  583
            AGLASSAAG ACLVFAL KLMNV
Sbjct  125  AGLASSAAGLACLVFALAKLMNV  147



>ref|XP_009139253.1| PREDICTED: diphosphomevalonate decarboxylase-like [Brassica rapa]
Length=419

 Score =   237 bits (605),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 122/144 (85%), Positives = 133/144 (92%), Gaps = 0/144 (0%)
 Frame = +2

Query  152  AEKWVLMVTAQTPTNIAVIKYWGKRDETLILPINDSISVTLDPAHLCTTTTVAVSPAFDQ  331
            AEKWV MVTAQTPTNIAVIKYWGKRDE  ILP+NDSISVTLDP HLCT TTVAVSP+FD+
Sbjct  3    AEKWVYMVTAQTPTNIAVIKYWGKRDEVRILPVNDSISVTLDPDHLCTVTTVAVSPSFDR  62

Query  332  DRMWLNGKEMSLSGVRYQNCLKEIRARACDVEDEKKGIKITKKDWENLHVHIASYNNFPT  511
            DRMWLNGKE+SLSG RYQNCL+EIR RA DVED++KG+KI KKDWE LH+HIAS+NNFPT
Sbjct  63   DRMWLNGKEISLSGSRYQNCLREIRGRAGDVEDKEKGVKIDKKDWEKLHLHIASHNNFPT  122

Query  512  aaglassaagfaCLVFALGKLMNV  583
            AAGLASSAAGFACLVF+L KLMNV
Sbjct  123  AAGLASSAAGFACLVFSLAKLMNV  146



>ref|XP_011084229.1| PREDICTED: diphosphomevalonate decarboxylase-like [Sesamum indicum]
Length=422

 Score =   237 bits (604),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 122/144 (85%), Positives = 131/144 (91%), Gaps = 0/144 (0%)
 Frame = +2

Query  152  AEKWVLMVTAQTPTNIAVIKYWGKRDETLILPINDSISVTLDPAHLCTTTTVAVSPAFDQ  331
             + WVL VTAQTPTNIAVIKYWGKRDE LILPINDSISVTLDP HLCTTT+VAVSPAF  
Sbjct  6    GKSWVLAVTAQTPTNIAVIKYWGKRDEELILPINDSISVTLDPEHLCTTTSVAVSPAFTH  65

Query  332  DRMWLNGKEMSLSGVRYQNCLKEIRARACDVEDEKKGIKITKKDWENLHVHIASYNNFPT  511
            DRMWLNGKE+SLSG RYQNCL+E+R+RA DVEDE+KG+KITKKDWE LHVHI SYNNFPT
Sbjct  66   DRMWLNGKEVSLSGGRYQNCLRELRSRASDVEDEQKGVKITKKDWEKLHVHIVSYNNFPT  125

Query  512  aaglassaagfaCLVFALGKLMNV  583
            AAGLASSAAG ACLVF+L KLMNV
Sbjct  126  AAGLASSAAGLACLVFSLAKLMNV  149



>ref|XP_006361468.1| PREDICTED: diphosphomevalonate decarboxylase-like [Solanum tuberosum]
Length=421

 Score =   237 bits (604),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 124/144 (86%), Positives = 133/144 (92%), Gaps = 0/144 (0%)
 Frame = +2

Query  152  AEKWVLMVTAQTPTNIAVIKYWGKRDETLILPINDSISVTLDPAHLCTTTTVAVSPAFDQ  331
            ++KW+LMVTAQTPTNIAVIKYWGKRDE LIL INDSISVTLDPAHLCTTTTVAVSP+F Q
Sbjct  5    SKKWILMVTAQTPTNIAVIKYWGKRDENLILAINDSISVTLDPAHLCTTTTVAVSPSFQQ  64

Query  332  DRMWLNGKEMSLSGVRYQNCLKEIRARACDVEDEKKGIKITKKDWENLHVHIASYNNFPT  511
            DRMWLN KE+SL G RYQNCL+EIRARA D EDEKKGIKI+K DW+NLHVHI SYNNFPT
Sbjct  65   DRMWLNKKEISLDGARYQNCLREIRARANDYEDEKKGIKISKNDWQNLHVHIDSYNNFPT  124

Query  512  aaglassaagfaCLVFALGKLMNV  583
            AAGLASSAAGFACLVF+L KLMNV
Sbjct  125  AAGLASSAAGFACLVFSLAKLMNV  148



>ref|NP_001234815.1| mevalonate disphosphate decarboxylase [Solanum lycopersicum]
 gb|ABW87316.1| mevalonate disphosphate decarboxylase [Solanum lycopersicum]
Length=422

 Score =   237 bits (604),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 124/144 (86%), Positives = 133/144 (92%), Gaps = 0/144 (0%)
 Frame = +2

Query  152  AEKWVLMVTAQTPTNIAVIKYWGKRDETLILPINDSISVTLDPAHLCTTTTVAVSPAFDQ  331
            ++KW+LMVTAQTPTNIAVIKYWGKRDE LIL INDSISVTLDPAHLCTTTTVAVSP+F Q
Sbjct  6    SKKWILMVTAQTPTNIAVIKYWGKRDENLILAINDSISVTLDPAHLCTTTTVAVSPSFQQ  65

Query  332  DRMWLNGKEMSLSGVRYQNCLKEIRARACDVEDEKKGIKITKKDWENLHVHIASYNNFPT  511
            DRMWLN KE+SL G RYQNCL+EIRARA D EDEKKGIKI+K DW+NLHVHI SYNNFPT
Sbjct  66   DRMWLNKKEISLDGARYQNCLREIRARANDYEDEKKGIKISKNDWQNLHVHIDSYNNFPT  125

Query  512  aaglassaagfaCLVFALGKLMNV  583
            AAGLASSAAGFACLVF+L KLMNV
Sbjct  126  AAGLASSAAGFACLVFSLAKLMNV  149



>emb|CAN82519.1| hypothetical protein VITISV_042700 [Vitis vinifera]
Length=451

 Score =   238 bits (606),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 123/144 (85%), Positives = 132/144 (92%), Gaps = 0/144 (0%)
 Frame = +2

Query  152  AEKWVLMVTAQTPTNIAVIKYWGKRDETLILPINDSISVTLDPAHLCTTTTVAVSPAFDQ  331
            ++KW+LM TAQTPTNIAVIKYWGKRDE LIL +NDSISVTLDP HLCTTTTVAVSP F  
Sbjct  6    SQKWILMTTAQTPTNIAVIKYWGKRDEGLILAVNDSISVTLDPQHLCTTTTVAVSPMFQS  65

Query  332  DRMWLNGKEMSLSGVRYQNCLKEIRARACDVEDEKKGIKITKKDWENLHVHIASYNNFPT  511
            DRMWLNGKE+SLSG RYQNCL+EIR+RA  +EDEKKGIKITKKDWE LHVHIASYNNFPT
Sbjct  66   DRMWLNGKEISLSGGRYQNCLREIRSRASKIEDEKKGIKITKKDWEKLHVHIASYNNFPT  125

Query  512  aaglassaagfaCLVFALGKLMNV  583
            AAGLASSAAGFACLVF+L KLMNV
Sbjct  126  AAGLASSAAGFACLVFSLAKLMNV  149



>ref|XP_010088787.1| Diphosphomevalonate decarboxylase [Morus notabilis]
 gb|EXB36970.1| Diphosphomevalonate decarboxylase [Morus notabilis]
Length=400

 Score =   236 bits (602),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 120/147 (82%), Positives = 137/147 (93%), Gaps = 0/147 (0%)
 Frame = +2

Query  143  GTMAEKWVLMVTAQTPTNIAVIKYWGKRDETLILPINDSISVTLDPAHLCTTTTVAVSPA  322
             + ++ WVL+VTA+TPTNIAVIKYWGKRDE LILP+NDSISVTLDP HLCTTTTVAVSP+
Sbjct  2    ASESQNWVLVVTARTPTNIAVIKYWGKRDEKLILPVNDSISVTLDPDHLCTTTTVAVSPS  61

Query  323  FDQDRMWLNGKEMSLSGVRYQNCLKEIRARACDVEDEKKGIKITKKDWENLHVHIASYNN  502
            FDQDRMWLNGKE+SLSG R+Q+CL+EIR+RA DVED++KGIKI+K+DWE LHVHIASYNN
Sbjct  62   FDQDRMWLNGKEISLSGGRFQSCLREIRSRASDVEDKEKGIKISKEDWEKLHVHIASYNN  121

Query  503  FPTaaglassaagfaCLVFALGKLMNV  583
            FPTAAGLASSAAGFAC VF+L KLMNV
Sbjct  122  FPTAAGLASSAAGFACFVFSLAKLMNV  148



>gb|AEM42974.1| diphosphomevalonate decarboxylase [Siraitia grosvenorii]
Length=418

 Score =   236 bits (603),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 123/144 (85%), Positives = 132/144 (92%), Gaps = 0/144 (0%)
 Frame = +2

Query  152  AEKWVLMVTAQTPTNIAVIKYWGKRDETLILPINDSISVTLDPAHLCTTTTVAVSPAFDQ  331
             EKWVLM TAQTPTNIAVIKYWGKRDE LILP+NDSISVTLDP+HLCT TTVAVSPAF+Q
Sbjct  3    GEKWVLMATAQTPTNIAVIKYWGKRDEELILPVNDSISVTLDPSHLCTITTVAVSPAFEQ  62

Query  332  DRMWLNGKEMSLSGVRYQNCLKEIRARACDVEDEKKGIKITKKDWENLHVHIASYNNFPT  511
            DRMWLN KE+SLSG RYQNCL+EIR+RA DVED++KGIKI KKDWE LHV+I SYNNFPT
Sbjct  63   DRMWLNRKEISLSGARYQNCLREIRSRANDVEDKEKGIKIAKKDWEKLHVYIDSYNNFPT  122

Query  512  aaglassaagfaCLVFALGKLMNV  583
            AAGLASSAAGFACLVFAL  LMNV
Sbjct  123  AAGLASSAAGFACLVFALANLMNV  146



>ref|XP_003536712.1| PREDICTED: diphosphomevalonate decarboxylase-like [Glycine max]
Length=420

 Score =   236 bits (603),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 121/147 (82%), Positives = 135/147 (92%), Gaps = 0/147 (0%)
 Frame = +2

Query  143  GTMAEKWVLMVTAQTPTNIAVIKYWGKRDETLILPINDSISVTLDPAHLCTTTTVAVSPA  322
             + ++ WV MVTAQTPTNIAVIKYWGKRDETLILP+NDSIS+TLDP+HLCTTTTVAVS A
Sbjct  2    ASESQNWVFMVTAQTPTNIAVIKYWGKRDETLILPVNDSISLTLDPSHLCTTTTVAVSSA  61

Query  323  FDQDRMWLNGKEMSLSGVRYQNCLKEIRARACDVEDEKKGIKITKKDWENLHVHIASYNN  502
            F QDRMWLN KE+SLSG R+Q+CL+EIRARACDVEDE KGIKITK+DW  LH+HIASYNN
Sbjct  62   FHQDRMWLNAKEISLSGGRFQSCLREIRARACDVEDENKGIKITKEDWAKLHLHIASYNN  121

Query  503  FPTaaglassaagfaCLVFALGKLMNV  583
            FPTAAGLASSAAGFACL +ALGKLM+V
Sbjct  122  FPTAAGLASSAAGFACLAYALGKLMDV  148



>ref|XP_010515945.1| PREDICTED: diphosphomevalonate decarboxylase-like [Camelina sativa]
 ref|XP_010515946.1| PREDICTED: diphosphomevalonate decarboxylase-like [Camelina sativa]
 ref|XP_010515947.1| PREDICTED: diphosphomevalonate decarboxylase-like [Camelina sativa]
Length=419

 Score =   236 bits (602),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 121/143 (85%), Positives = 133/143 (93%), Gaps = 0/143 (0%)
 Frame = +2

Query  155  EKWVLMVTAQTPTNIAVIKYWGKRDETLILPINDSISVTLDPAHLCTTTTVAVSPAFDQD  334
            EKWV MVTAQTPTNIAVIKYWGKRDE  ILP+NDSISVTLDP HLCT TTVAVSPAFD+D
Sbjct  4    EKWVFMVTAQTPTNIAVIKYWGKRDEVRILPVNDSISVTLDPDHLCTVTTVAVSPAFDRD  63

Query  335  RMWLNGKEMSLSGVRYQNCLKEIRARACDVEDEKKGIKITKKDWENLHVHIASYNNFPTa  514
            RMWLNGKE+SLSG RYQNCL+EIR+RA DVED++KG+KI KKDW+ LH+HIAS+NNFPTA
Sbjct  64   RMWLNGKEISLSGSRYQNCLREIRSRAGDVEDKEKGVKIGKKDWDKLHLHIASHNNFPTA  123

Query  515  aglassaagfaCLVFALGKLMNV  583
            AGLASSAAGFACLVF+L KLMNV
Sbjct  124  AGLASSAAGFACLVFSLAKLMNV  146



>ref|XP_006294305.1| hypothetical protein CARUB_v10023314mg [Capsella rubella]
 gb|EOA27203.1| hypothetical protein CARUB_v10023314mg [Capsella rubella]
Length=412

 Score =   236 bits (601),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 123/143 (86%), Positives = 133/143 (93%), Gaps = 0/143 (0%)
 Frame = +2

Query  155  EKWVLMVTAQTPTNIAVIKYWGKRDETLILPINDSISVTLDPAHLCTTTTVAVSPAFDQD  334
            EKWV+MVTAQTPTNIAVIKYWGKRDE  ILPINDSISVTLDP HLCT TTVAVSP+FD+D
Sbjct  4    EKWVVMVTAQTPTNIAVIKYWGKRDEVRILPINDSISVTLDPEHLCTLTTVAVSPSFDRD  63

Query  335  RMWLNGKEMSLSGVRYQNCLKEIRARACDVEDEKKGIKITKKDWENLHVHIASYNNFPTa  514
            RMWLNGKE+SLSG RYQNCL+EIR+RA DVED+ KGIKI KKDWE LH+HIAS+NNFPTA
Sbjct  64   RMWLNGKEISLSGSRYQNCLREIRSRADDVEDKVKGIKIAKKDWEKLHLHIASHNNFPTA  123

Query  515  aglassaagfaCLVFALGKLMNV  583
            AGLASSAAGFACLVF+L KLMNV
Sbjct  124  AGLASSAAGFACLVFSLAKLMNV  146



>ref|XP_006391873.1| hypothetical protein EUTSA_v10023484mg [Eutrema salsugineum]
 gb|ESQ29159.1| hypothetical protein EUTSA_v10023484mg [Eutrema salsugineum]
Length=419

 Score =   235 bits (600),  Expect = 5e-72, Method: Compositional matrix adjust.
 Identities = 121/144 (84%), Positives = 133/144 (92%), Gaps = 0/144 (0%)
 Frame = +2

Query  152  AEKWVLMVTAQTPTNIAVIKYWGKRDETLILPINDSISVTLDPAHLCTTTTVAVSPAFDQ  331
            AE WV MVTAQTPTNIAVIKYWGKRDE  ILP+NDSISVTLDP HLCT TTVAVSP+FD+
Sbjct  3    AENWVYMVTAQTPTNIAVIKYWGKRDEVRILPVNDSISVTLDPDHLCTVTTVAVSPSFDR  62

Query  332  DRMWLNGKEMSLSGVRYQNCLKEIRARACDVEDEKKGIKITKKDWENLHVHIASYNNFPT  511
            DRMWLNGKE+SLSG RYQNCL+EIR+RA DVED++KG+KI KKDWE LH+HIAS+NNFPT
Sbjct  63   DRMWLNGKEISLSGSRYQNCLREIRSRAGDVEDKEKGVKIGKKDWEKLHLHIASHNNFPT  122

Query  512  aaglassaagfaCLVFALGKLMNV  583
            AAGLASSAAGFACLVF+L KLMNV
Sbjct  123  AAGLASSAAGFACLVFSLAKLMNV  146



>emb|CDX73494.1| BnaC08g25090D [Brassica napus]
Length=419

 Score =   234 bits (598),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 121/144 (84%), Positives = 133/144 (92%), Gaps = 0/144 (0%)
 Frame = +2

Query  152  AEKWVLMVTAQTPTNIAVIKYWGKRDETLILPINDSISVTLDPAHLCTTTTVAVSPAFDQ  331
            AEKWV MVTAQTPTNIAVIKYWGKRDE  ILP+NDSISVTLDP HLCT TTVAVSPAFD+
Sbjct  3    AEKWVYMVTAQTPTNIAVIKYWGKRDEVRILPVNDSISVTLDPDHLCTVTTVAVSPAFDR  62

Query  332  DRMWLNGKEMSLSGVRYQNCLKEIRARACDVEDEKKGIKITKKDWENLHVHIASYNNFPT  511
            DRMWLNGKE+SLSG RYQNCL+EIR+R  DVED++KG+KI KKDWE L++HIAS+NNFPT
Sbjct  63   DRMWLNGKEISLSGSRYQNCLREIRSRGGDVEDKEKGVKIEKKDWERLNLHIASHNNFPT  122

Query  512  aaglassaagfaCLVFALGKLMNV  583
            AAGLASSAAGFACLVF+L KLMNV
Sbjct  123  AAGLASSAAGFACLVFSLAKLMNV  146



>ref|XP_010536297.1| PREDICTED: diphosphomevalonate decarboxylase-like isoform X3 
[Tarenaya hassleriana]
 ref|XP_010536298.1| PREDICTED: diphosphomevalonate decarboxylase-like isoform X4 
[Tarenaya hassleriana]
Length=416

 Score =   234 bits (598),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 125/145 (86%), Positives = 133/145 (92%), Gaps = 1/145 (1%)
 Frame = +2

Query  152  AEK-WVLMVTAQTPTNIAVIKYWGKRDETLILPINDSISVTLDPAHLCTTTTVAVSPAFD  328
            AEK WVLMVTAQTPTNIAVIKYWGKRDE+ ILPINDSISVTLDP HLCT TT AVSPAFD
Sbjct  3    AEKPWVLMVTAQTPTNIAVIKYWGKRDESRILPINDSISVTLDPDHLCTVTTAAVSPAFD  62

Query  329  QDRMWLNGKEMSLSGVRYQNCLKEIRARACDVEDEKKGIKITKKDWENLHVHIASYNNFP  508
            +DRMWLNGKE+SLSG R+QNCL+EIR RACDVED+ K +KI KKDWE LH+HIASYNNFP
Sbjct  63   RDRMWLNGKEISLSGSRFQNCLREIRTRACDVEDKGKCVKIEKKDWEKLHLHIASYNNFP  122

Query  509  TaaglassaagfaCLVFALGKLMNV  583
            TAAGLASSAAGFACLVFAL KLMNV
Sbjct  123  TAAGLASSAAGFACLVFALSKLMNV  147



>ref|XP_010536296.1| PREDICTED: diphosphomevalonate decarboxylase-like isoform X2 
[Tarenaya hassleriana]
Length=423

 Score =   234 bits (597),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 125/145 (86%), Positives = 133/145 (92%), Gaps = 1/145 (1%)
 Frame = +2

Query  152  AEK-WVLMVTAQTPTNIAVIKYWGKRDETLILPINDSISVTLDPAHLCTTTTVAVSPAFD  328
            AEK WVLMVTAQTPTNIAVIKYWGKRDE+ ILPINDSISVTLDP HLCT TT AVSPAFD
Sbjct  3    AEKPWVLMVTAQTPTNIAVIKYWGKRDESRILPINDSISVTLDPDHLCTVTTAAVSPAFD  62

Query  329  QDRMWLNGKEMSLSGVRYQNCLKEIRARACDVEDEKKGIKITKKDWENLHVHIASYNNFP  508
            +DRMWLNGKE+SLSG R+QNCL+EIR RACDVED+ K +KI KKDWE LH+HIASYNNFP
Sbjct  63   RDRMWLNGKEISLSGSRFQNCLREIRTRACDVEDKGKCVKIEKKDWEKLHLHIASYNNFP  122

Query  509  TaaglassaagfaCLVFALGKLMNV  583
            TAAGLASSAAGFACLVFAL KLMNV
Sbjct  123  TAAGLASSAAGFACLVFALSKLMNV  147



>ref|XP_010536295.1| PREDICTED: diphosphomevalonate decarboxylase-like isoform X1 
[Tarenaya hassleriana]
Length=439

 Score =   234 bits (598),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 125/145 (86%), Positives = 133/145 (92%), Gaps = 1/145 (1%)
 Frame = +2

Query  152  AEK-WVLMVTAQTPTNIAVIKYWGKRDETLILPINDSISVTLDPAHLCTTTTVAVSPAFD  328
            AEK WVLMVTAQTPTNIAVIKYWGKRDE+ ILPINDSISVTLDP HLCT TT AVSPAFD
Sbjct  3    AEKPWVLMVTAQTPTNIAVIKYWGKRDESRILPINDSISVTLDPDHLCTVTTAAVSPAFD  62

Query  329  QDRMWLNGKEMSLSGVRYQNCLKEIRARACDVEDEKKGIKITKKDWENLHVHIASYNNFP  508
            +DRMWLNGKE+SLSG R+QNCL+EIR RACDVED+ K +KI KKDWE LH+HIASYNNFP
Sbjct  63   RDRMWLNGKEISLSGSRFQNCLREIRTRACDVEDKGKCVKIEKKDWEKLHLHIASYNNFP  122

Query  509  TaaglassaagfaCLVFALGKLMNV  583
            TAAGLASSAAGFACLVFAL KLMNV
Sbjct  123  TAAGLASSAAGFACLVFALSKLMNV  147



>gb|ACO35355.1| mevalonate pyrophosphate decarboxylase [Elaeis oleifera]
Length=206

 Score =   227 bits (578),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 118/143 (83%), Positives = 127/143 (89%), Gaps = 0/143 (0%)
 Frame = +2

Query  155  EKWVLMVTAQTPTNIAVIKYWGKRDETLILPINDSISVTLDPAHLCTTTTVAVSPAFDQD  334
            + WVLM TA+ PTNIAVIKYWGKRDE LILPINDSISVTLDP HL  TTTVAVSP+F QD
Sbjct  6    QSWVLMATARAPTNIAVIKYWGKRDEALILPINDSISVTLDPDHLSATTTVAVSPSFKQD  65

Query  335  RMWLNGKEMSLSGVRYQNCLKEIRARACDVEDEKKGIKITKKDWENLHVHIASYNNFPTa  514
            RMWLNGKE+SLSG RYQNCL+EIR RA DVEDEKKGI+I K+DWE +H+HIASYNNFPTA
Sbjct  66   RMWLNGKEISLSGGRYQNCLREIRKRAGDVEDEKKGIRIKKEDWEKMHLHIASYNNFPTA  125

Query  515  aglassaagfaCLVFALGKLMNV  583
            AGLASSAAGFACLVF   KLMNV
Sbjct  126  AGLASSAAGFACLVFTPAKLMNV  148



>ref|NP_566995.1| diphosphomevalonate decarboxylase [Arabidopsis thaliana]
 gb|AEE79204.1| diphosphomevalonate decarboxylase [Arabidopsis thaliana]
Length=419

 Score =   234 bits (596),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 122/143 (85%), Positives = 131/143 (92%), Gaps = 0/143 (0%)
 Frame = +2

Query  155  EKWVLMVTAQTPTNIAVIKYWGKRDETLILPINDSISVTLDPAHLCTTTTVAVSPAFDQD  334
            EKWV MVTAQTPTNIAVIKYWGKRDE  ILP+NDSISVTLDP HLCT TTVAVSPAFD+D
Sbjct  4    EKWVFMVTAQTPTNIAVIKYWGKRDEVRILPVNDSISVTLDPDHLCTVTTVAVSPAFDRD  63

Query  335  RMWLNGKEMSLSGVRYQNCLKEIRARACDVEDEKKGIKITKKDWENLHVHIASYNNFPTa  514
            RMWLNGKE+SLSG RYQNCL+EIR RA DVED +KGIKI KKDWE L++HIAS+NNFPTA
Sbjct  64   RMWLNGKEISLSGSRYQNCLREIRGRAGDVEDMEKGIKIRKKDWEKLNLHIASHNNFPTA  123

Query  515  aglassaagfaCLVFALGKLMNV  583
            AGLASSAAGFACLVF+L KLMNV
Sbjct  124  AGLASSAAGFACLVFSLAKLMNV  146



>ref|XP_006445714.1| hypothetical protein CICLE_v10015368mg [Citrus clementina]
 gb|ESR58954.1| hypothetical protein CICLE_v10015368mg [Citrus clementina]
Length=344

 Score =   231 bits (590),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 127/144 (88%), Positives = 138/144 (96%), Gaps = 0/144 (0%)
 Frame = +2

Query  152  AEKWVLMVTAQTPTNIAVIKYWGKRDETLILPINDSISVTLDPAHLCTTTTVAVSPAFDQ  331
            AEKWVLMVTAQTPTNIAVIKYWGKRDETLILP+NDSISVTLDP HLCTTTTVAVSP+FDQ
Sbjct  3    AEKWVLMVTAQTPTNIAVIKYWGKRDETLILPVNDSISVTLDPDHLCTTTTVAVSPSFDQ  62

Query  332  DRMWLNGKEMSLSGVRYQNCLKEIRARACDVEDEKKGIKITKKDWENLHVHIASYNNFPT  511
            DRMWLNGKE+SL G RYQNCLKEIR+RACDVED++KGIKI KKDW+ LH+HIAS+NNFPT
Sbjct  63   DRMWLNGKEISLGGGRYQNCLKEIRSRACDVEDKEKGIKIEKKDWQKLHLHIASFNNFPT  122

Query  512  aaglassaagfaCLVFALGKLMNV  583
            AAGLASSAAGFACLVF+L KLMN+
Sbjct  123  AAGLASSAAGFACLVFSLAKLMNL  146



>gb|ADI80345.1| mevalonate diphosphate decarboxylase [Panax ginseng]
Length=420

 Score =   234 bits (596),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 120/143 (84%), Positives = 133/143 (93%), Gaps = 0/143 (0%)
 Frame = +2

Query  155  EKWVLMVTAQTPTNIAVIKYWGKRDETLILPINDSISVTLDPAHLCTTTTVAVSPAFDQD  334
            +KWV+MVTAQTPTNIAVIKYWGKRDETLILPINDSISVTLDP HLCTTTTV+VSP+F+QD
Sbjct  6    QKWVVMVTAQTPTNIAVIKYWGKRDETLILPINDSISVTLDPDHLCTTTTVSVSPSFEQD  65

Query  335  RMWLNGKEMSLSGVRYQNCLKEIRARACDVEDEKKGIKITKKDWENLHVHIASYNNFPTa  514
            RMWLNGKE+SL G R+Q+CL+EIR+RACD+EDEKKGIKI K DWE L +HIASYNNFPTA
Sbjct  66   RMWLNGKEISLLGGRFQSCLREIRSRACDLEDEKKGIKIKKMDWEKLRLHIASYNNFPTA  125

Query  515  aglassaagfaCLVFALGKLMNV  583
            AGLASSAAG AC VFAL KLMN+
Sbjct  126  AGLASSAAGLACFVFALAKLMNL  148



>emb|CAB70999.1| DIPHOSPHOMEVALONATE DECARBOXYLASE-like protein [Arabidopsis thaliana]
Length=413

 Score =   233 bits (595),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 122/143 (85%), Positives = 131/143 (92%), Gaps = 0/143 (0%)
 Frame = +2

Query  155  EKWVLMVTAQTPTNIAVIKYWGKRDETLILPINDSISVTLDPAHLCTTTTVAVSPAFDQD  334
            EKWV MVTAQTPTNIAVIKYWGKRDE  ILP+NDSISVTLDP HLCT TTVAVSPAFD+D
Sbjct  4    EKWVFMVTAQTPTNIAVIKYWGKRDEVRILPVNDSISVTLDPDHLCTVTTVAVSPAFDRD  63

Query  335  RMWLNGKEMSLSGVRYQNCLKEIRARACDVEDEKKGIKITKKDWENLHVHIASYNNFPTa  514
            RMWLNGKE+SLSG RYQNCL+EIR RA DVED +KGIKI KKDWE L++HIAS+NNFPTA
Sbjct  64   RMWLNGKEISLSGSRYQNCLREIRGRAGDVEDMEKGIKIRKKDWEKLNLHIASHNNFPTA  123

Query  515  aglassaagfaCLVFALGKLMNV  583
            AGLASSAAGFACLVF+L KLMNV
Sbjct  124  AGLASSAAGFACLVFSLAKLMNV  146



>ref|XP_009116111.1| PREDICTED: diphosphomevalonate decarboxylase [Brassica rapa]
 emb|CDX78223.1| BnaA09g34180D [Brassica napus]
Length=419

 Score =   233 bits (595),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 120/144 (83%), Positives = 133/144 (92%), Gaps = 0/144 (0%)
 Frame = +2

Query  152  AEKWVLMVTAQTPTNIAVIKYWGKRDETLILPINDSISVTLDPAHLCTTTTVAVSPAFDQ  331
            AEKWV MVTAQTPTNIAVIKYWGKRDE  ILP+NDSISVTLDP HLCT TTVAVSP+FD+
Sbjct  3    AEKWVYMVTAQTPTNIAVIKYWGKRDEVRILPVNDSISVTLDPDHLCTVTTVAVSPSFDR  62

Query  332  DRMWLNGKEMSLSGVRYQNCLKEIRARACDVEDEKKGIKITKKDWENLHVHIASYNNFPT  511
            DRMWLNGKE+SLSG RYQNCL+EIR+R  DVED++KG+KI KKDWE L++HIAS+NNFPT
Sbjct  63   DRMWLNGKEISLSGSRYQNCLREIRSRGGDVEDKEKGVKIEKKDWERLNLHIASHNNFPT  122

Query  512  aaglassaagfaCLVFALGKLMNV  583
            AAGLASSAAGFACLVF+L KLMNV
Sbjct  123  AAGLASSAAGFACLVFSLAKLMNV  146



>gb|AEZ55675.1| mevalonate diphosphate decarboxylase [Salvia miltiorrhiza]
Length=422

 Score =   233 bits (594),  Expect = 5e-71, Method: Compositional matrix adjust.
 Identities = 121/144 (84%), Positives = 129/144 (90%), Gaps = 0/144 (0%)
 Frame = +2

Query  152  AEKWVLMVTAQTPTNIAVIKYWGKRDETLILPINDSISVTLDPAHLCTTTTVAVSPAFDQ  331
             EKWVL VTAQTPTNIAVIKYWGKRDE LILPINDSISVTLDP HLCTTT+VAVSPAF  
Sbjct  6    GEKWVLSVTAQTPTNIAVIKYWGKRDEELILPINDSISVTLDPGHLCTTTSVAVSPAFTH  65

Query  332  DRMWLNGKEMSLSGVRYQNCLKEIRARACDVEDEKKGIKITKKDWENLHVHIASYNNFPT  511
            DR+WLNGKE+SLSG R+QNCL+E+R+RA D EDEKKGIKI KKDWE L VHI SYNNFPT
Sbjct  66   DRIWLNGKEVSLSGGRFQNCLRELRSRATDFEDEKKGIKINKKDWEKLRVHIVSYNNFPT  125

Query  512  aaglassaagfaCLVFALGKLMNV  583
            AAGLASSAAG ACLVF+L KLMNV
Sbjct  126  AAGLASSAAGLACLVFSLAKLMNV  149



>gb|AGZ15316.1| mevalonate decarboxylase [Platycodon grandiflorus]
Length=417

 Score =   233 bits (593),  Expect = 6e-71, Method: Compositional matrix adjust.
 Identities = 120/147 (82%), Positives = 133/147 (90%), Gaps = 0/147 (0%)
 Frame = +2

Query  143  GTMAEKWVLMVTAQTPTNIAVIKYWGKRDETLILPINDSISVTLDPAHLCTTTTVAVSPA  322
            G  +EKW LMVT +TPTNIAVIKYWGKRDETLILPINDSISVTLDP HLCTTTTV+VSP+
Sbjct  2    GGESEKWALMVTGRTPTNIAVIKYWGKRDETLILPINDSISVTLDPDHLCTTTTVSVSPS  61

Query  323  FDQDRMWLNGKEMSLSGVRYQNCLKEIRARACDVEDEKKGIKITKKDWENLHVHIASYNN  502
            FDQDRMWLNGKE+SLS   +Q+CL+EIR+RA D ED+KKGIKITK DW+ LH+HIASYNN
Sbjct  62   FDQDRMWLNGKEISLSVGEFQSCLREIRSRATDFEDKKKGIKITKDDWQKLHLHIASYNN  121

Query  503  FPTaaglassaagfaCLVFALGKLMNV  583
            FPTAAGLASSAAG ACLVF+L KLMNV
Sbjct  122  FPTAAGLASSAAGLACLVFSLAKLMNV  148



>gb|AFM77982.1| mevalonate diphosphate decarboxylase [Eleutherococcus senticosus]
Length=420

 Score =   232 bits (591),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 120/143 (84%), Positives = 132/143 (92%), Gaps = 0/143 (0%)
 Frame = +2

Query  155  EKWVLMVTAQTPTNIAVIKYWGKRDETLILPINDSISVTLDPAHLCTTTTVAVSPAFDQD  334
            +KWV+MVTAQTPTNIAVIKYWGKRDETLILPINDSISVTLDP HLCTTTTVAVSP+F+QD
Sbjct  6    QKWVVMVTAQTPTNIAVIKYWGKRDETLILPINDSISVTLDPDHLCTTTTVAVSPSFEQD  65

Query  335  RMWLNGKEMSLSGVRYQNCLKEIRARACDVEDEKKGIKITKKDWENLHVHIASYNNFPTa  514
            RMWLNG E+SL G R+Q+CL+EIR+RA D+EDEKKGIKI K DWE LH+HIASYNNFPTA
Sbjct  66   RMWLNGMEISLLGGRFQSCLREIRSRARDLEDEKKGIKIKKMDWEKLHLHIASYNNFPTA  125

Query  515  aglassaagfaCLVFALGKLMNV  583
            AGLASSAAG AC VFAL KLMN+
Sbjct  126  AGLASSAAGLACFVFALAKLMNL  148



>ref|XP_006445713.1| hypothetical protein CICLE_v10015368mg [Citrus clementina]
 ref|XP_006485205.1| PREDICTED: diphosphomevalonate decarboxylase-like [Citrus sinensis]
 gb|ESR58953.1| hypothetical protein CICLE_v10015368mg [Citrus clementina]
Length=420

 Score =   231 bits (589),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 127/144 (88%), Positives = 138/144 (96%), Gaps = 0/144 (0%)
 Frame = +2

Query  152  AEKWVLMVTAQTPTNIAVIKYWGKRDETLILPINDSISVTLDPAHLCTTTTVAVSPAFDQ  331
            AEKWVLMVTAQTPTNIAVIKYWGKRDETLILP+NDSISVTLDP HLCTTTTVAVSP+FDQ
Sbjct  3    AEKWVLMVTAQTPTNIAVIKYWGKRDETLILPVNDSISVTLDPDHLCTTTTVAVSPSFDQ  62

Query  332  DRMWLNGKEMSLSGVRYQNCLKEIRARACDVEDEKKGIKITKKDWENLHVHIASYNNFPT  511
            DRMWLNGKE+SL G RYQNCLKEIR+RACDVED++KGIKI KKDW+ LH+HIAS+NNFPT
Sbjct  63   DRMWLNGKEISLGGGRYQNCLKEIRSRACDVEDKEKGIKIEKKDWQKLHLHIASFNNFPT  122

Query  512  aaglassaagfaCLVFALGKLMNV  583
            AAGLASSAAGFACLVF+L KLMN+
Sbjct  123  AAGLASSAAGFACLVFSLAKLMNL  146



>gb|AAM65192.1| diphosphomevalonate decarboxylase-like protein [Arabidopsis thaliana]
Length=419

 Score =   231 bits (588),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 121/143 (85%), Positives = 130/143 (91%), Gaps = 0/143 (0%)
 Frame = +2

Query  155  EKWVLMVTAQTPTNIAVIKYWGKRDETLILPINDSISVTLDPAHLCTTTTVAVSPAFDQD  334
            EKWV MVTAQTPTNIAVIKYWGKR E  ILP+NDSISVTLDP HLCT TTVAVSPAFD+D
Sbjct  4    EKWVFMVTAQTPTNIAVIKYWGKRHEVRILPVNDSISVTLDPDHLCTVTTVAVSPAFDRD  63

Query  335  RMWLNGKEMSLSGVRYQNCLKEIRARACDVEDEKKGIKITKKDWENLHVHIASYNNFPTa  514
            RMWLNGKE+SLSG RYQNCL+EIR RA DVED +KGIKI KKDWE L++HIAS+NNFPTA
Sbjct  64   RMWLNGKEISLSGSRYQNCLREIRGRAGDVEDMEKGIKIRKKDWEKLNLHIASHNNFPTA  123

Query  515  aglassaagfaCLVFALGKLMNV  583
            AGLASSAAGFACLVF+L KLMNV
Sbjct  124  AGLASSAAGFACLVFSLAKLMNV  146



>gb|EYU19776.1| hypothetical protein MIMGU_mgv1a007068mg [Erythranthe guttata]
Length=324

 Score =   227 bits (579),  Expect = 6e-70, Method: Compositional matrix adjust.
 Identities = 117/144 (81%), Positives = 129/144 (90%), Gaps = 0/144 (0%)
 Frame = +2

Query  152  AEKWVLMVTAQTPTNIAVIKYWGKRDETLILPINDSISVTLDPAHLCTTTTVAVSPAFDQ  331
             +KW+L VTAQTPTNIAVIKYWGKR E LILPINDSISVTLDP HLCTTT+VAVSPAF  
Sbjct  6    GDKWILTVTAQTPTNIAVIKYWGKRHEELILPINDSISVTLDPDHLCTTTSVAVSPAFTH  65

Query  332  DRMWLNGKEMSLSGVRYQNCLKEIRARACDVEDEKKGIKITKKDWENLHVHIASYNNFPT  511
            DRMWLNGKE+SLSG R+QNCL+E+R+RA DVEDEKKGIKI+KKDWE L +HI S+NNFPT
Sbjct  66   DRMWLNGKEVSLSGDRFQNCLRELRSRASDVEDEKKGIKISKKDWEKLRLHIVSFNNFPT  125

Query  512  aaglassaagfaCLVFALGKLMNV  583
            AAGLASSAAG ACLVF+L  LMNV
Sbjct  126  AAGLASSAAGLACLVFSLANLMNV  149



>ref|XP_004236810.1| PREDICTED: diphosphomevalonate decarboxylase-like [Solanum lycopersicum]
Length=421

 Score =   230 bits (587),  Expect = 6e-70, Method: Compositional matrix adjust.
 Identities = 129/144 (90%), Positives = 138/144 (96%), Gaps = 0/144 (0%)
 Frame = +2

Query  152  AEKWVLMVTAQTPTNIAVIKYWGKRDETLILPINDSISVTLDPAHLCTTTTVAVSPAFDQ  331
            ++KWVLMVTAQTPTNIAVIKYWGKRDE LIL INDSISVTLDPAHLCTTTTVAVSPAFDQ
Sbjct  5    SQKWVLMVTAQTPTNIAVIKYWGKRDENLILAINDSISVTLDPAHLCTTTTVAVSPAFDQ  64

Query  332  DRMWLNGKEMSLSGVRYQNCLKEIRARACDVEDEKKGIKITKKDWENLHVHIASYNNFPT  511
            DRMWLNGKE+SLSG RYQNCL+EIRARA DVED+KKG+KI KKDWENLHVH+ASYNNFPT
Sbjct  65   DRMWLNGKEISLSGGRYQNCLREIRARANDVEDKKKGVKIAKKDWENLHVHVASYNNFPT  124

Query  512  aaglassaagfaCLVFALGKLMNV  583
            AAGLASSAAGFACLV++L KLMNV
Sbjct  125  AAGLASSAAGFACLVYSLAKLMNV  148



>ref|XP_008446768.1| PREDICTED: diphosphomevalonate decarboxylase [Cucumis melo]
Length=424

 Score =   229 bits (585),  Expect = 9e-70, Method: Compositional matrix adjust.
 Identities = 118/144 (82%), Positives = 130/144 (90%), Gaps = 0/144 (0%)
 Frame = +2

Query  152  AEKWVLMVTAQTPTNIAVIKYWGKRDETLILPINDSISVTLDPAHLCTTTTVAVSPAFDQ  331
             +KWVL+ TAQTPTNIAVIKYWGKRDE LILP+NDSISVTLDP+HLCT TTVAVSP F++
Sbjct  9    GQKWVLLTTAQTPTNIAVIKYWGKRDEDLILPVNDSISVTLDPSHLCTITTVAVSPDFEK  68

Query  332  DRMWLNGKEMSLSGVRYQNCLKEIRARACDVEDEKKGIKITKKDWENLHVHIASYNNFPT  511
            DRMWLN KE+SLSG RYQNCL+EIR+RA DVED++KGIKI KKDWE LHV+I SYNNFPT
Sbjct  69   DRMWLNRKEISLSGARYQNCLREIRSRANDVEDKEKGIKIAKKDWEKLHVYIDSYNNFPT  128

Query  512  aaglassaagfaCLVFALGKLMNV  583
            AAGLASSAAG ACLVFAL  LMNV
Sbjct  129  AAGLASSAAGLACLVFALANLMNV  152



>ref|XP_010244659.1| PREDICTED: diphosphomevalonate decarboxylase-like [Nelumbo nucifera]
Length=421

 Score =   229 bits (584),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 119/143 (83%), Positives = 131/143 (92%), Gaps = 0/143 (0%)
 Frame = +2

Query  155  EKWVLMVTAQTPTNIAVIKYWGKRDETLILPINDSISVTLDPAHLCTTTTVAVSPAFDQD  334
            + WVLMVTAQTPTNIAVIKYWGKRDETLILP+NDSISVTLDP HLCTTTTVAVSP+F+ D
Sbjct  6    QNWVLMVTAQTPTNIAVIKYWGKRDETLILPVNDSISVTLDPEHLCTTTTVAVSPSFEND  65

Query  335  RMWLNGKEMSLSGVRYQNCLKEIRARACDVEDEKKGIKITKKDWENLHVHIASYNNFPTa  514
            RMWLNGKE+SLSG R+QNCL+EIR RA  V+DE KGI I K+DW+ LHVHIASYNNFPTA
Sbjct  66   RMWLNGKEISLSGGRFQNCLREIRCRANSVDDEDKGIHIKKEDWDRLHVHIASYNNFPTA  125

Query  515  aglassaagfaCLVFALGKLMNV  583
            AGLASSAAGFACLVF+L KLMN+
Sbjct  126  AGLASSAAGFACLVFSLAKLMNL  148



>ref|XP_010907122.1| PREDICTED: diphosphomevalonate decarboxylase-like [Elaeis guineensis]
Length=421

 Score =   229 bits (584),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 119/143 (83%), Positives = 128/143 (90%), Gaps = 0/143 (0%)
 Frame = +2

Query  155  EKWVLMVTAQTPTNIAVIKYWGKRDETLILPINDSISVTLDPAHLCTTTTVAVSPAFDQD  334
            + WVLM TA+ PTNIAVIKYWGKRDE LILPINDSISVTLDP HL  TTTVAVSP+F QD
Sbjct  6    QSWVLMATARAPTNIAVIKYWGKRDEALILPINDSISVTLDPDHLSATTTVAVSPSFKQD  65

Query  335  RMWLNGKEMSLSGVRYQNCLKEIRARACDVEDEKKGIKITKKDWENLHVHIASYNNFPTa  514
            RMWLNGKE+SLSG RYQNCL+EIR RA DVEDEKKGI+I K+DWE +H+HIASYNNFPTA
Sbjct  66   RMWLNGKEISLSGGRYQNCLREIRKRAGDVEDEKKGIRIKKEDWEKMHLHIASYNNFPTA  125

Query  515  aglassaagfaCLVFALGKLMNV  583
            AGLASSAAGFACLVF L KLMNV
Sbjct  126  AGLASSAAGFACLVFTLAKLMNV  148



>gb|EEC72316.1| hypothetical protein OsI_05509 [Oryza sativa Indica Group]
Length=188

 Score =   221 bits (563),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 111/142 (78%), Positives = 122/142 (86%), Gaps = 0/142 (0%)
 Frame = +2

Query  158  KWVLMVTAQTPTNIAVIKYWGKRDETLILPINDSISVTLDPAHLCTTTTVAVSPAFDQDR  337
            +WVLM T ++PTNIAVIKYWGKRDE LILP+NDSISVTLDP HL  TTTVAVSP+F  DR
Sbjct  8    QWVLMATGRSPTNIAVIKYWGKRDEALILPVNDSISVTLDPDHLSATTTVAVSPSFPSDR  67

Query  338  MWLNGKEMSLSGVRYQNCLKEIRARACDVEDEKKGIKITKKDWENLHVHIASYNNFPTaa  517
            MWLNGKE+SLSG R+Q+CL+EIR RA DVEDEKKGI+I K+DW  LHVHIASYNNFPTAA
Sbjct  68   MWLNGKEISLSGGRFQSCLREIRKRAQDVEDEKKGIRIKKEDWGKLHVHIASYNNFPTAA  127

Query  518  glassaagfaCLVFALGKLMNV  583
            GLASS AG  C VF LG LMNV
Sbjct  128  GLASSVAGLVCFVFTLGNLMNV  149



>gb|AAM64988.1| mevalonate diphosphate decarboxylase [Arabidopsis thaliana]
Length=404

 Score =   228 bits (580),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 120/138 (87%), Positives = 129/138 (93%), Gaps = 0/138 (0%)
 Frame = +2

Query  170  MVTAQTPTNIAVIKYWGKRDETLILPINDSISVTLDPAHLCTTTTVAVSPAFDQDRMWLN  349
            MVTAQTPTNIAVIKYWGKRDE  ILPINDSISVTLDP HLCT TTVAVSP+FD+DRMWLN
Sbjct  1    MVTAQTPTNIAVIKYWGKRDEVRILPINDSISVTLDPDHLCTLTTVAVSPSFDRDRMWLN  60

Query  350  GKEMSLSGVRYQNCLKEIRARACDVEDEKKGIKITKKDWENLHVHIASYNNFPTaaglas  529
            GKE+SLSG RYQNCL+EIR+RA DVED++KGIKI KKDWE LH+HIAS+NNFPTAAGLAS
Sbjct  61   GKEISLSGSRYQNCLREIRSRADDVEDKEKGIKIAKKDWEKLHLHIASHNNFPTAAGLAS  120

Query  530  saagfaCLVFALGKLMNV  583
            SAAGFACLVFAL KLMNV
Sbjct  121  SAAGFACLVFALAKLMNV  138



>gb|KHN37414.1| Diphosphomevalonate decarboxylase [Glycine soja]
Length=658

 Score =   234 bits (596),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 121/144 (84%), Positives = 133/144 (92%), Gaps = 0/144 (0%)
 Frame = +2

Query  152  AEKWVLMVTAQTPTNIAVIKYWGKRDETLILPINDSISVTLDPAHLCTTTTVAVSPAFDQ  331
            ++ WV MVTAQTPTNIAVIKYWGKRDETLILP+NDSIS+TLDP+HLCTTTTVAVS AF Q
Sbjct  5    SQNWVFMVTAQTPTNIAVIKYWGKRDETLILPVNDSISLTLDPSHLCTTTTVAVSSAFHQ  64

Query  332  DRMWLNGKEMSLSGVRYQNCLKEIRARACDVEDEKKGIKITKKDWENLHVHIASYNNFPT  511
            DRMWLN KE+SLSG R+ +CL+EIRARACDVEDE KGIKITK+DW  LH+HIASYNNFPT
Sbjct  65   DRMWLNAKEISLSGGRFHSCLREIRARACDVEDENKGIKITKEDWAKLHLHIASYNNFPT  124

Query  512  aaglassaagfaCLVFALGKLMNV  583
            AAGLASSAAGFACL +ALGKLMNV
Sbjct  125  AAGLASSAAGFACLAYALGKLMNV  148



>gb|ABV02028.1| mevalonate diphosphate decarboxylase [Nicotiana langsdorffii 
x Nicotiana sanderae]
Length=406

 Score =   228 bits (580),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 120/133 (90%), Positives = 125/133 (94%), Gaps = 0/133 (0%)
 Frame = +2

Query  185  TPTNIAVIKYWGKRDETLILPINDSISVTLDPAHLCTTTTVAVSPAFDQDRMWLNGKEMS  364
            TPTNIAVIKYWGKRDE LIL INDSI VTLDPAHLCTTTTVAVSPAF+QDRMWLNGKE+S
Sbjct  1    TPTNIAVIKYWGKRDEDLILAINDSIGVTLDPAHLCTTTTVAVSPAFNQDRMWLNGKEIS  60

Query  365  LSGVRYQNCLKEIRARACDVEDEKKGIKITKKDWENLHVHIASYNNFPTaaglassaagf  544
            LSG RYQNCL+EIRARA DVEDE KGIKI KKDW+NLHVHIASYNNFPTAAGLASSAAGF
Sbjct  61   LSGGRYQNCLREIRARASDVEDENKGIKIAKKDWQNLHVHIASYNNFPTAAGLASSAAGF  120

Query  545  aCLVFALGKLMNV  583
            ACLVF+L KLMNV
Sbjct  121  ACLVFSLAKLMNV  133



>gb|AEA72605.1| mevalonate 5-diphosphate decarboxylase [Houttuynia cordata]
Length=421

 Score =   227 bits (579),  Expect = 8e-69, Method: Compositional matrix adjust.
 Identities = 119/144 (83%), Positives = 132/144 (92%), Gaps = 0/144 (0%)
 Frame = +2

Query  152  AEKWVLMVTAQTPTNIAVIKYWGKRDETLILPINDSISVTLDPAHLCTTTTVAVSPAFDQ  331
            ++ W+LMVTA++PTNIAVIKYWGKRDE+LILPINDSISVTLDP HLCTTTTVAVSP+F  
Sbjct  6    SKDWILMVTAKSPTNIAVIKYWGKRDESLILPINDSISVTLDPDHLCTTTTVAVSPSFRS  65

Query  332  DRMWLNGKEMSLSGVRYQNCLKEIRARACDVEDEKKGIKITKKDWENLHVHIASYNNFPT  511
            DRMWLNGKE+SL+G RYQNCL+EIR+RA   EDEKKGI I K+DWENLH+HIASYNNFPT
Sbjct  66   DRMWLNGKEISLAGGRYQNCLREIRSRASCFEDEKKGISIRKEDWENLHLHIASYNNFPT  125

Query  512  aaglassaagfaCLVFALGKLMNV  583
            AAGLASSAAGFACLVFALG LM V
Sbjct  126  AAGLASSAAGFACLVFALGNLMCV  149



>gb|AIK21783.1| mevalonate diphosphate decarboxylase [Panax notoginseng]
Length=420

 Score =   227 bits (578),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 118/143 (83%), Positives = 131/143 (92%), Gaps = 0/143 (0%)
 Frame = +2

Query  155  EKWVLMVTAQTPTNIAVIKYWGKRDETLILPINDSISVTLDPAHLCTTTTVAVSPAFDQD  334
            +KWV+MVTAQTPTNIAVIKYWGKRDETLILPINDSISVTLDP HLCTTTTV+VSP+F+QD
Sbjct  6    QKWVVMVTAQTPTNIAVIKYWGKRDETLILPINDSISVTLDPDHLCTTTTVSVSPSFEQD  65

Query  335  RMWLNGKEMSLSGVRYQNCLKEIRARACDVEDEKKGIKITKKDWENLHVHIASYNNFPTa  514
            RMWLNGKE+SL G R+Q+CL+EIR+RA D+ED+KKGI I K DWE LH HIASYNNFPTA
Sbjct  66   RMWLNGKEISLLGGRFQSCLREIRSRARDLEDKKKGIVIKKMDWEKLHFHIASYNNFPTA  125

Query  515  aglassaagfaCLVFALGKLMNV  583
            AGLASSAAG AC VFAL KLMN+
Sbjct  126  AGLASSAAGLACFVFALAKLMNL  148



>gb|EYU19775.1| hypothetical protein MIMGU_mgv1a007068mg [Erythranthe guttata]
Length=421

 Score =   227 bits (578),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 117/144 (81%), Positives = 129/144 (90%), Gaps = 0/144 (0%)
 Frame = +2

Query  152  AEKWVLMVTAQTPTNIAVIKYWGKRDETLILPINDSISVTLDPAHLCTTTTVAVSPAFDQ  331
             +KW+L VTAQTPTNIAVIKYWGKR E LILPINDSISVTLDP HLCTTT+VAVSPAF  
Sbjct  6    GDKWILTVTAQTPTNIAVIKYWGKRHEELILPINDSISVTLDPDHLCTTTSVAVSPAFTH  65

Query  332  DRMWLNGKEMSLSGVRYQNCLKEIRARACDVEDEKKGIKITKKDWENLHVHIASYNNFPT  511
            DRMWLNGKE+SLSG R+QNCL+E+R+RA DVEDEKKGIKI+KKDWE L +HI S+NNFPT
Sbjct  66   DRMWLNGKEVSLSGDRFQNCLRELRSRASDVEDEKKGIKISKKDWEKLRLHIVSFNNFPT  125

Query  512  aaglassaagfaCLVFALGKLMNV  583
            AAGLASSAAG ACLVF+L  LMNV
Sbjct  126  AAGLASSAAGLACLVFSLANLMNV  149



>ref|XP_008345749.1| PREDICTED: diphosphomevalonate decarboxylase-like [Malus domestica]
Length=418

 Score =   227 bits (578),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 125/144 (87%), Positives = 139/144 (97%), Gaps = 0/144 (0%)
 Frame = +2

Query  152  AEKWVLMVTAQTPTNIAVIKYWGKRDETLILPINDSISVTLDPAHLCTTTTVAVSPAFDQ  331
            + KWVLMVTAQTPTNIAVIKYWGKRDE LILP+NDSISVTLDPAHLCTTTTV+VSP FDQ
Sbjct  5    SRKWVLMVTAQTPTNIAVIKYWGKRDEKLILPVNDSISVTLDPAHLCTTTTVSVSPTFDQ  64

Query  332  DRMWLNGKEMSLSGVRYQNCLKEIRARACDVEDEKKGIKITKKDWENLHVHIASYNNFPT  511
            DRMWLNG+E+S+SG R+Q+CL+EIR+RA DV+D++KGIKITKKDWENLHVHI+SYNNFPT
Sbjct  65   DRMWLNGEEISISGGRFQSCLREIRSRATDVDDKEKGIKITKKDWENLHVHISSYNNFPT  124

Query  512  aaglassaagfaCLVFALGKLMNV  583
            AAGLASSAAGFACLVFALGKLMNV
Sbjct  125  AAGLASSAAGFACLVFALGKLMNV  148



>ref|XP_008788072.1| PREDICTED: diphosphomevalonate decarboxylase-like [Phoenix dactylifera]
Length=421

 Score =   225 bits (574),  Expect = 4e-68, Method: Compositional matrix adjust.
 Identities = 116/143 (81%), Positives = 126/143 (88%), Gaps = 0/143 (0%)
 Frame = +2

Query  155  EKWVLMVTAQTPTNIAVIKYWGKRDETLILPINDSISVTLDPAHLCTTTTVAVSPAFDQD  334
            + WVLM TA+ PTNIA+IKYWGKRDE LILP NDSISVTLDP HL  TTTVAVSP+F QD
Sbjct  6    QSWVLMATARAPTNIALIKYWGKRDEALILPTNDSISVTLDPDHLSATTTVAVSPSFKQD  65

Query  335  RMWLNGKEMSLSGVRYQNCLKEIRARACDVEDEKKGIKITKKDWENLHVHIASYNNFPTa  514
            RMWLNGKE+SLSG RYQNCL+EIR RA DVEDEKKG++I K+DWE  H+HIASYNNFPTA
Sbjct  66   RMWLNGKEISLSGGRYQNCLREIRKRAGDVEDEKKGVRIKKEDWEKFHLHIASYNNFPTA  125

Query  515  aglassaagfaCLVFALGKLMNV  583
            AGLASSAAGFACLVF L KLMNV
Sbjct  126  AGLASSAAGFACLVFTLAKLMNV  148



>gb|EAZ21434.1| hypothetical protein OsJ_05037 [Oryza sativa Japonica Group]
Length=493

 Score =   226 bits (576),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 126/198 (64%), Positives = 147/198 (74%), Gaps = 9/198 (5%)
 Frame = +2

Query  5    HSADARKK--CLYNCKDLISLVHSRSLPVSINSLCSQQRLLFFSFPFPGTMAE---KWVL  169
            HS D  +K  C+Y  + L  L+H ++ P+ +  L  +   L  +  FP   A    +WVL
Sbjct  209  HSDDYARKGVCMYTWEQLHLLIHGKN-PLVLPDLHLK---LMRADRFPSMAAAEEGQWVL  264

Query  170  MVTAQTPTNIAVIKYWGKRDETLILPINDSISVTLDPAHLCTTTTVAVSPAFDQDRMWLN  349
            M T ++PTNIAVIKYWGKRDE LILP+NDSISVTLDP HL  TTTVAVSP+F  DRMWLN
Sbjct  265  MATGRSPTNIAVIKYWGKRDEALILPVNDSISVTLDPDHLSATTTVAVSPSFPSDRMWLN  324

Query  350  GKEMSLSGVRYQNCLKEIRARACDVEDEKKGIKITKKDWENLHVHIASYNNFPTaaglas  529
            GKE+SLSG R+Q+CL+EIR RA DVEDEKKGI+I K+DW  LHVHIASYNNFPTAAGLAS
Sbjct  325  GKEISLSGGRFQSCLREIRKRAQDVEDEKKGIRIKKEDWGKLHVHIASYNNFPTAAGLAS  384

Query  530  saagfaCLVFALGKLMNV  583
            S AG  C VF LG LMNV
Sbjct  385  SVAGLVCFVFTLGNLMNV  402



>ref|XP_008364764.1| PREDICTED: diphosphomevalonate decarboxylase-like [Malus domestica]
Length=418

 Score =   223 bits (569),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 123/144 (85%), Positives = 138/144 (96%), Gaps = 0/144 (0%)
 Frame = +2

Query  152  AEKWVLMVTAQTPTNIAVIKYWGKRDETLILPINDSISVTLDPAHLCTTTTVAVSPAFDQ  331
            ++KWVLMVTAQTPTNIAVIKYWGKRDE LILP+NDSISVTLDPAHLCTTTTV+VSP FDQ
Sbjct  5    SQKWVLMVTAQTPTNIAVIKYWGKRDEKLILPVNDSISVTLDPAHLCTTTTVSVSPTFDQ  64

Query  332  DRMWLNGKEMSLSGVRYQNCLKEIRARACDVEDEKKGIKITKKDWENLHVHIASYNNFPT  511
            DRMWLNG+E+S+SG R+Q+CL+EIR+RA DV+D++ GIKITKKDWE LHVHI+SYNNFPT
Sbjct  65   DRMWLNGEEISISGGRFQSCLREIRSRATDVDDKENGIKITKKDWEKLHVHISSYNNFPT  124

Query  512  aaglassaagfaCLVFALGKLMNV  583
            AAGLASSAAGFACLVFALGKLMNV
Sbjct  125  AAGLASSAAGFACLVFALGKLMNV  148



>ref|XP_009356125.1| PREDICTED: diphosphomevalonate decarboxylase [Pyrus x bretschneideri]
Length=418

 Score =   223 bits (568),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 122/144 (85%), Positives = 138/144 (96%), Gaps = 0/144 (0%)
 Frame = +2

Query  152  AEKWVLMVTAQTPTNIAVIKYWGKRDETLILPINDSISVTLDPAHLCTTTTVAVSPAFDQ  331
            ++KWVLMVTAQTPTNIAVIKYWGKRDE LILP+NDSISVTLDPAHLCTTTTV+VSP FDQ
Sbjct  5    SQKWVLMVTAQTPTNIAVIKYWGKRDEKLILPVNDSISVTLDPAHLCTTTTVSVSPTFDQ  64

Query  332  DRMWLNGKEMSLSGVRYQNCLKEIRARACDVEDEKKGIKITKKDWENLHVHIASYNNFPT  511
            DRMWLNG+E+S+SG R+Q+CL+EIR+RA D++D++KGI ITKKDWE LHVHI+SYNNFPT
Sbjct  65   DRMWLNGEEISISGGRFQSCLREIRSRATDIDDKEKGINITKKDWEKLHVHISSYNNFPT  124

Query  512  aaglassaagfaCLVFALGKLMNV  583
            AAGLASSAAGFACLVFALGKLMNV
Sbjct  125  AAGLASSAAGFACLVFALGKLMNV  148



>ref|XP_008356850.1| PREDICTED: diphosphomevalonate decarboxylase-like [Malus domestica]
Length=418

 Score =   223 bits (568),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 123/144 (85%), Positives = 138/144 (96%), Gaps = 0/144 (0%)
 Frame = +2

Query  152  AEKWVLMVTAQTPTNIAVIKYWGKRDETLILPINDSISVTLDPAHLCTTTTVAVSPAFDQ  331
            ++KWVLMVTAQTPTNIAVIKYWGKRDE LILP+NDSISVTLDPAHLCTTTTV+VSP FDQ
Sbjct  5    SQKWVLMVTAQTPTNIAVIKYWGKRDEKLILPVNDSISVTLDPAHLCTTTTVSVSPTFDQ  64

Query  332  DRMWLNGKEMSLSGVRYQNCLKEIRARACDVEDEKKGIKITKKDWENLHVHIASYNNFPT  511
            DRMWLNG+E+S+SG R+Q+CL+EIR+RA DV+D++ GIKITKKDWE LHVHI+SYNNFPT
Sbjct  65   DRMWLNGEEISISGGRFQSCLREIRSRATDVDDKEXGIKITKKDWEKLHVHISSYNNFPT  124

Query  512  aaglassaagfaCLVFALGKLMNV  583
            AAGLASSAAGFACLVFALGKLMNV
Sbjct  125  AAGLASSAAGFACLVFALGKLMNV  148



>gb|AFW73866.1| hypothetical protein ZEAMMB73_421648 [Zea mays]
Length=173

 Score =   215 bits (547),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 111/141 (79%), Positives = 123/141 (87%), Gaps = 0/141 (0%)
 Frame = +2

Query  158  KWVLMVTAQTPTNIAVIKYWGKRDETLILPINDSISVTLDPAHLCTTTTVAVSPAFDQDR  337
            +WVLM T +TPTNIAVIKYWGKRDE LILPINDSISVTLDP HL  TTTVAVSP+F  DR
Sbjct  7    QWVLMATGRTPTNIAVIKYWGKRDEALILPINDSISVTLDPDHLSATTTVAVSPSFPSDR  66

Query  338  MWLNGKEMSLSGVRYQNCLKEIRARACDVEDEKKGIKITKKDWENLHVHIASYNNFPTaa  517
            MWLNGKE+SL G R+Q+CL+EIR RA D ED++KG+KI K+DW+ LHVHIASYNNFPTAA
Sbjct  67   MWLNGKEISLLGGRFQSCLREIRKRARDFEDKEKGVKIKKEDWDKLHVHIASYNNFPTAA  126

Query  518  glassaagfaCLVFALGKLMN  580
            GLASSAAG AC VF LGKLMN
Sbjct  127  GLASSAAGLACFVFTLGKLMN  147



>gb|ACW83616.2| mevalonate diphosphate decarboxylase [Panax ginseng]
Length=417

 Score =   222 bits (566),  Expect = 6e-67, Method: Compositional matrix adjust.
 Identities = 115/145 (79%), Positives = 128/145 (88%), Gaps = 0/145 (0%)
 Frame = +2

Query  149  MAEKWVLMVTAQTPTNIAVIKYWGKRDETLILPINDSISVTLDPAHLCTTTTVAVSPAFD  328
            MAE WV+MVTAQTP NIAVIKYWGKRDETLILPINDSI V+LDP HLCTTTTV+V P+F+
Sbjct  1    MAESWVIMVTAQTPINIAVIKYWGKRDETLILPINDSIRVSLDPDHLCTTTTVSVRPSFE  60

Query  329  QDRMWLNGKEMSLSGVRYQNCLKEIRARACDVEDEKKGIKITKKDWENLHVHIASYNNFP  508
            QDRMWLNGKE+SL G R+Q+CL+EIR+RA D+EDEKKGI I K DWE LH HIASYNNFP
Sbjct  61   QDRMWLNGKEISLLGGRFQSCLREIRSRARDLEDEKKGIVIKKMDWEKLHFHIASYNNFP  120

Query  509  TaaglassaagfaCLVFALGKLMNV  583
            TAAGLASSAAG AC VFAL KL+ +
Sbjct  121  TAAGLASSAAGLACFVFALAKLLTL  145



>gb|EEC72312.1| hypothetical protein OsI_05503 [Oryza sativa Indica Group]
Length=311

 Score =   219 bits (557),  Expect = 9e-67, Method: Compositional matrix adjust.
 Identities = 111/142 (78%), Positives = 122/142 (86%), Gaps = 0/142 (0%)
 Frame = +2

Query  158  KWVLMVTAQTPTNIAVIKYWGKRDETLILPINDSISVTLDPAHLCTTTTVAVSPAFDQDR  337
            +WVLM T ++PTNIAVIKYWGKRDE LILP+NDSISVTLDP HL  TTTVAVSP+F  DR
Sbjct  8    QWVLMATGRSPTNIAVIKYWGKRDEALILPVNDSISVTLDPDHLSATTTVAVSPSFPSDR  67

Query  338  MWLNGKEMSLSGVRYQNCLKEIRARACDVEDEKKGIKITKKDWENLHVHIASYNNFPTaa  517
            MWLNGKE+SLSG R+Q+CL+EIR RA DVEDEKKGI+I K+DW  LHVHIASYNNFPTAA
Sbjct  68   MWLNGKEISLSGGRFQSCLREIRKRAQDVEDEKKGIRIKKEDWGKLHVHIASYNNFPTAA  127

Query  518  glassaagfaCLVFALGKLMNV  583
            GLASS AG  C VF LG LMNV
Sbjct  128  GLASSVAGLVCFVFTLGNLMNV  149



>dbj|BAD27942.1| putative mevalonate disphosphate decarboxylase [Oryza sativa 
Japonica Group]
 dbj|BAH01424.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEE56155.1| hypothetical protein OsJ_05052 [Oryza sativa Japonica Group]
Length=421

 Score =   221 bits (563),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 113/142 (80%), Positives = 125/142 (88%), Gaps = 0/142 (0%)
 Frame = +2

Query  158  KWVLMVTAQTPTNIAVIKYWGKRDETLILPINDSISVTLDPAHLCTTTTVAVSPAFDQDR  337
            +WVLM T ++PTNIAVIKYWGKRDE LILP+NDSISVTLDP HL  TTTVAVSP+F  DR
Sbjct  8    QWVLMATGRSPTNIAVIKYWGKRDEALILPVNDSISVTLDPDHLSATTTVAVSPSFPSDR  67

Query  338  MWLNGKEMSLSGVRYQNCLKEIRARACDVEDEKKGIKITKKDWENLHVHIASYNNFPTaa  517
            MWLNGKE+SLSG R+Q+CL+EIR RA DVEDEKKGI+I K+DW  LHVHIAS+NNFPTAA
Sbjct  68   MWLNGKEISLSGGRFQSCLREIRKRAQDVEDEKKGIRIKKEDWGKLHVHIASFNNFPTAA  127

Query  518  glassaagfaCLVFALGKLMNV  583
            GLASSAAG AC VF LGKLMNV
Sbjct  128  GLASSAAGLACFVFTLGKLMNV  149



>gb|EMT01953.1| Diphosphomevalonate decarboxylase [Aegilops tauschii]
Length=456

 Score =   222 bits (565),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 115/142 (81%), Positives = 126/142 (89%), Gaps = 0/142 (0%)
 Frame = +2

Query  158  KWVLMVTAQTPTNIAVIKYWGKRDETLILPINDSISVTLDPAHLCTTTTVAVSPAFDQDR  337
            +WVL  T ++PTNIAVIKYWGKRDE LILP+NDSISVTLDP HL  TTTVA SPAF  DR
Sbjct  8    QWVLTATGRSPTNIAVIKYWGKRDEALILPVNDSISVTLDPDHLSATTTVAASPAFPSDR  67

Query  338  MWLNGKEMSLSGVRYQNCLKEIRARACDVEDEKKGIKITKKDWENLHVHIASYNNFPTaa  517
            MWLNGKE++LSG R+Q+CL+EIR RA DVEDEK+GIKI K+DWE LHVHIASYNNFPTAA
Sbjct  68   MWLNGKEIALSGGRFQSCLREIRKRARDVEDEKRGIKIKKEDWEKLHVHIASYNNFPTAA  127

Query  518  glassaagfaCLVFALGKLMNV  583
            GLASSAAGFACLVF LGKLMNV
Sbjct  128  GLASSAAGFACLVFTLGKLMNV  149



>ref|XP_010427097.1| PREDICTED: diphosphomevalonate decarboxylase-like [Camelina sativa]
 ref|XP_010427098.1| PREDICTED: diphosphomevalonate decarboxylase-like [Camelina sativa]
Length=419

 Score =   221 bits (562),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 123/143 (86%), Positives = 133/143 (93%), Gaps = 0/143 (0%)
 Frame = +2

Query  155  EKWVLMVTAQTPTNIAVIKYWGKRDETLILPINDSISVTLDPAHLCTTTTVAVSPAFDQD  334
            EKWV MVTAQTPTNIAVIKYWGKRDE  ILP+NDSISVTLDP HLCT TTVAVSPAFD+D
Sbjct  4    EKWVFMVTAQTPTNIAVIKYWGKRDEVRILPVNDSISVTLDPDHLCTVTTVAVSPAFDRD  63

Query  335  RMWLNGKEMSLSGVRYQNCLKEIRARACDVEDEKKGIKITKKDWENLHVHIASYNNFPTa  514
            RMWLNGKE+SLSG RYQNCL+EIR+RA DVED++KGIKI KKDWE LH+HIAS+NNFPTA
Sbjct  64   RMWLNGKEISLSGSRYQNCLREIRSRAGDVEDKEKGIKIGKKDWEKLHLHIASHNNFPTA  123

Query  515  aglassaagfaCLVFALGKLMNV  583
            AGLASSAAGFACLVF+L KLMNV
Sbjct  124  AGLASSAAGFACLVFSLAKLMNV  146



>ref|XP_006291202.1| hypothetical protein CARUB_v10017330mg [Capsella rubella]
 gb|EOA24100.1| hypothetical protein CARUB_v10017330mg [Capsella rubella]
Length=419

 Score =   220 bits (560),  Expect = 5e-66, Method: Compositional matrix adjust.
 Identities = 122/144 (85%), Positives = 134/144 (93%), Gaps = 0/144 (0%)
 Frame = +2

Query  152  AEKWVLMVTAQTPTNIAVIKYWGKRDETLILPINDSISVTLDPAHLCTTTTVAVSPAFDQ  331
            +EKWV MVTAQTPTNIAVIKYWGKRDE  ILP+NDSISVTLDP HLCT TTVAVSPAFD+
Sbjct  3    SEKWVFMVTAQTPTNIAVIKYWGKRDEVRILPVNDSISVTLDPDHLCTVTTVAVSPAFDR  62

Query  332  DRMWLNGKEMSLSGVRYQNCLKEIRARACDVEDEKKGIKITKKDWENLHVHIASYNNFPT  511
            DRMWLNGKE+SLSG RYQNCL+EIR+RA DV+D++KGIKI KKDWE LH+HIAS+NNFPT
Sbjct  63   DRMWLNGKEISLSGSRYQNCLREIRSRAGDVDDKEKGIKIGKKDWEKLHLHIASHNNFPT  122

Query  512  aaglassaagfaCLVFALGKLMNV  583
            AAGLASSAAGFACLVF+L KLMNV
Sbjct  123  AAGLASSAAGFACLVFSLAKLMNV  146



>ref|XP_010554524.1| PREDICTED: diphosphomevalonate decarboxylase-like [Tarenaya hassleriana]
Length=412

 Score =   219 bits (559),  Expect = 5e-66, Method: Compositional matrix adjust.
 Identities = 127/147 (86%), Positives = 134/147 (91%), Gaps = 2/147 (1%)
 Frame = +2

Query  149  MAEK--WVLMVTAQTPTNIAVIKYWGKRDETLILPINDSISVTLDPAHLCTTTTVAVSPA  322
            MAEK  WV+MVTAQTPTNIAVIKYWGKRDE  ILPINDSISVTLDP HLCT TTVAVSPA
Sbjct  1    MAEKKQWVVMVTAQTPTNIAVIKYWGKRDEARILPINDSISVTLDPDHLCTVTTVAVSPA  60

Query  323  FDQDRMWLNGKEMSLSGVRYQNCLKEIRARACDVEDEKKGIKITKKDWENLHVHIASYNN  502
            FD D+MWLNGKE+SLSG RYQNCL+EIR RA DVED++KGIKI KKDWE LH+HIASYNN
Sbjct  61   FDHDQMWLNGKEISLSGSRYQNCLREIRNRAGDVEDKEKGIKIEKKDWEKLHLHIASYNN  120

Query  503  FPTaaglassaagfaCLVFALGKLMNV  583
            FPTAAGLASSAAGFACLVFAL KLMNV
Sbjct  121  FPTAAGLASSAAGFACLVFALSKLMNV  147



>emb|CDM86983.1| unnamed protein product [Triticum aestivum]
Length=419

 Score =   219 bits (559),  Expect = 6e-66, Method: Compositional matrix adjust.
 Identities = 114/142 (80%), Positives = 126/142 (89%), Gaps = 0/142 (0%)
 Frame = +2

Query  158  KWVLMVTAQTPTNIAVIKYWGKRDETLILPINDSISVTLDPAHLCTTTTVAVSPAFDQDR  337
            +WVL  T ++PTNIAVIKYWGKRD+ LILP+NDSISVTLDP HL  TTTVA SPAF  DR
Sbjct  6    QWVLTATGRSPTNIAVIKYWGKRDDALILPVNDSISVTLDPDHLSATTTVAASPAFPSDR  65

Query  338  MWLNGKEMSLSGVRYQNCLKEIRARACDVEDEKKGIKITKKDWENLHVHIASYNNFPTaa  517
            MWLNGKE++LSG R+Q+CL+EIR RA DVEDEK+GIKI K+DWE LHVHIASYNNFPTAA
Sbjct  66   MWLNGKEIALSGGRFQSCLREIRKRARDVEDEKRGIKIKKEDWEKLHVHIASYNNFPTAA  125

Query  518  glassaagfaCLVFALGKLMNV  583
            GLASSAAGFACLVF LGKLMNV
Sbjct  126  GLASSAAGFACLVFTLGKLMNV  147



>ref|XP_010505522.1| PREDICTED: diphosphomevalonate decarboxylase-like [Camelina sativa]
Length=412

 Score =   219 bits (559),  Expect = 6e-66, Method: Compositional matrix adjust.
 Identities = 123/143 (86%), Positives = 133/143 (93%), Gaps = 0/143 (0%)
 Frame = +2

Query  155  EKWVLMVTAQTPTNIAVIKYWGKRDETLILPINDSISVTLDPAHLCTTTTVAVSPAFDQD  334
            EKWV+MVTAQTPTNIAVIKYWGKRDE  ILPINDSISVTLDP HLCT TTVAVSP+FD+D
Sbjct  4    EKWVMMVTAQTPTNIAVIKYWGKRDEVRILPINDSISVTLDPDHLCTLTTVAVSPSFDRD  63

Query  335  RMWLNGKEMSLSGVRYQNCLKEIRARACDVEDEKKGIKITKKDWENLHVHIASYNNFPTa  514
            RMWLNGKE+SLSG RYQNCL+EIR+R  DVED++KGIKI KKDWE LH+HIAS+NNFPTA
Sbjct  64   RMWLNGKEISLSGSRYQNCLREIRSRGDDVEDKEKGIKIEKKDWEKLHLHIASHNNFPTA  123

Query  515  aglassaagfaCLVFALGKLMNV  583
            AGLASSAAGFACLVFAL KLMNV
Sbjct  124  AGLASSAAGFACLVFALAKLMNV  146



>ref|XP_010509167.1| PREDICTED: diphosphomevalonate decarboxylase-like [Camelina sativa]
Length=412

 Score =   219 bits (558),  Expect = 7e-66, Method: Compositional matrix adjust.
 Identities = 123/143 (86%), Positives = 133/143 (93%), Gaps = 0/143 (0%)
 Frame = +2

Query  155  EKWVLMVTAQTPTNIAVIKYWGKRDETLILPINDSISVTLDPAHLCTTTTVAVSPAFDQD  334
            EKWV+MVTAQTPTNIAVIKYWGKRDE  ILPINDSISVTLDP HLCT TTVAVSP+FD+D
Sbjct  4    EKWVMMVTAQTPTNIAVIKYWGKRDEVRILPINDSISVTLDPDHLCTLTTVAVSPSFDRD  63

Query  335  RMWLNGKEMSLSGVRYQNCLKEIRARACDVEDEKKGIKITKKDWENLHVHIASYNNFPTa  514
            RMWLNGKE+SLSG RYQNCL+EIR+R  DVED++KGIKI KKDWE LH+HIAS+NNFPTA
Sbjct  64   RMWLNGKEISLSGSRYQNCLREIRSRGDDVEDKEKGIKIEKKDWEKLHLHIASHNNFPTA  123

Query  515  aglassaagfaCLVFALGKLMNV  583
            AGLASSAAGFACLVFAL KLMNV
Sbjct  124  AGLASSAAGFACLVFALAKLMNV  146



>ref|XP_002877963.1| hypothetical protein ARALYDRAFT_906831 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH54222.1| hypothetical protein ARALYDRAFT_906831 [Arabidopsis lyrata subsp. 
lyrata]
Length=419

 Score =   219 bits (558),  Expect = 9e-66, Method: Compositional matrix adjust.
 Identities = 122/143 (85%), Positives = 133/143 (93%), Gaps = 0/143 (0%)
 Frame = +2

Query  155  EKWVLMVTAQTPTNIAVIKYWGKRDETLILPINDSISVTLDPAHLCTTTTVAVSPAFDQD  334
            EKWV MVTA+TPTNIAVIKYWGKRDE  ILP+NDSISVTLDP HLCT TTVAVSPAFD+D
Sbjct  4    EKWVFMVTAKTPTNIAVIKYWGKRDEVRILPVNDSISVTLDPDHLCTVTTVAVSPAFDRD  63

Query  335  RMWLNGKEMSLSGVRYQNCLKEIRARACDVEDEKKGIKITKKDWENLHVHIASYNNFPTa  514
            RMWLNGKE+SLSG RYQNCL+EIR+RA DVED++KGIKI KKDWE LH+HIAS+NNFPTA
Sbjct  64   RMWLNGKEISLSGSRYQNCLREIRSRAGDVEDKEKGIKIGKKDWEKLHLHIASHNNFPTA  123

Query  515  aglassaagfaCLVFALGKLMNV  583
            AGLASSAAGFACLVF+L KLMNV
Sbjct  124  AGLASSAAGFACLVFSLAKLMNV  146



>ref|XP_009404708.1| PREDICTED: diphosphomevalonate decarboxylase-like [Musa acuminata 
subsp. malaccensis]
Length=421

 Score =   219 bits (558),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 113/143 (79%), Positives = 123/143 (86%), Gaps = 0/143 (0%)
 Frame = +2

Query  155  EKWVLMVTAQTPTNIAVIKYWGKRDETLILPINDSISVTLDPAHLCTTTTVAVSPAFDQD  334
            E W+LM T +TPTNIAVIKYWGKRDE LILP+NDSISVTLDP HL  TTTVAVSP FD+D
Sbjct  6    ESWILMATGRTPTNIAVIKYWGKRDEALILPVNDSISVTLDPDHLSATTTVAVSPTFDRD  65

Query  335  RMWLNGKEMSLSGVRYQNCLKEIRARACDVEDEKKGIKITKKDWENLHVHIASYNNFPTa  514
            RMWLNGKE+ LSG R+Q+CL+EIR  A DVEDEKKGI+I K DW+ LHVHIASYNNFPTA
Sbjct  66   RMWLNGKEIPLSGDRFQSCLREIRKLADDVEDEKKGIRIRKDDWQKLHVHIASYNNFPTA  125

Query  515  aglassaagfaCLVFALGKLMNV  583
            AGLASSAAG AC VF L KLMNV
Sbjct  126  AGLASSAAGLACFVFTLAKLMNV  148



>ref|XP_010504223.1| PREDICTED: diphosphomevalonate decarboxylase-like [Camelina sativa]
 ref|XP_010504224.1| PREDICTED: diphosphomevalonate decarboxylase-like [Camelina sativa]
 ref|XP_010504225.1| PREDICTED: diphosphomevalonate decarboxylase-like [Camelina sativa]
Length=419

 Score =   219 bits (557),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 122/143 (85%), Positives = 133/143 (93%), Gaps = 0/143 (0%)
 Frame = +2

Query  155  EKWVLMVTAQTPTNIAVIKYWGKRDETLILPINDSISVTLDPAHLCTTTTVAVSPAFDQD  334
            EKWV MVTAQTPTNIAVIKYWGKRDE  ILP+NDSISVTLDP HLCT TTVAVSPAFD+D
Sbjct  4    EKWVFMVTAQTPTNIAVIKYWGKRDEVRILPVNDSISVTLDPDHLCTVTTVAVSPAFDRD  63

Query  335  RMWLNGKEMSLSGVRYQNCLKEIRARACDVEDEKKGIKITKKDWENLHVHIASYNNFPTa  514
            RMWLNGKE+SL+G RYQNCL+EIR+RA DVED++KGIKI KKDWE LH+HIAS+NNFPTA
Sbjct  64   RMWLNGKEISLTGSRYQNCLREIRSRADDVEDKEKGIKIGKKDWEKLHLHIASHNNFPTA  123

Query  515  aglassaagfaCLVFALGKLMNV  583
            AGLASSAAGFACLVF+L KLMNV
Sbjct  124  AGLASSAAGFACLVFSLAKLMNV  146



>ref|XP_006646770.1| PREDICTED: diphosphomevalonate decarboxylase-like [Oryza brachyantha]
Length=419

 Score =   218 bits (555),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 115/142 (81%), Positives = 127/142 (89%), Gaps = 1/142 (1%)
 Frame = +2

Query  158  KWVLMVTAQTPTNIAVIKYWGKRDETLILPINDSISVTLDPAHLCTTTTVAVSPAFDQDR  337
            +WVLM T ++PTNIAVIKYWGKRDE LILP+NDSISVTLDP HL  TTTVAVSP+F  DR
Sbjct  7    QWVLMATGRSPTNIAVIKYWGKRDEALILPVNDSISVTLDPDHLSATTTVAVSPSFPSDR  66

Query  338  MWLNGKEMSLSGVRYQNCLKEIRARACDVEDEKKGIKITKKDWENLHVHIASYNNFPTaa  517
            MWLNG+E+SLSG R+Q+CL+EIR RA DVEDE KGI+I K+DWE LHVHIASYNNFPTAA
Sbjct  67   MWLNGQEISLSGGRFQSCLREIRKRAQDVEDE-KGIRIKKEDWEKLHVHIASYNNFPTAA  125

Query  518  glassaagfaCLVFALGKLMNV  583
            GLASSAAGFACLVF LGKLMNV
Sbjct  126  GLASSAAGFACLVFTLGKLMNV  147



>ref|XP_008665378.1| PREDICTED: diphosphomevalonate decarboxylase-like isoform X2 
[Zea mays]
 gb|ACF86239.1| unknown [Zea mays]
 gb|ACN26377.1| unknown [Zea mays]
 tpg|DAA51251.1| TPA: hypothetical protein ZEAMMB73_408503 [Zea mays]
Length=420

 Score =   217 bits (553),  Expect = 6e-65, Method: Compositional matrix adjust.
 Identities = 112/142 (79%), Positives = 124/142 (87%), Gaps = 0/142 (0%)
 Frame = +2

Query  158  KWVLMVTAQTPTNIAVIKYWGKRDETLILPINDSISVTLDPAHLCTTTTVAVSPAFDQDR  337
            +WVLM T +TPTNIAVIKYWGKRDE LILPINDSISVTLDP HL  TTTVAVSP+F  DR
Sbjct  7    QWVLMATGRTPTNIAVIKYWGKRDEALILPINDSISVTLDPDHLSATTTVAVSPSFPSDR  66

Query  338  MWLNGKEMSLSGVRYQNCLKEIRARACDVEDEKKGIKITKKDWENLHVHIASYNNFPTaa  517
            MWLNGKE+SL G R+Q+CL+EIR RA D ED++KG+KI K+DW+ LHVHIASYNNFPTAA
Sbjct  67   MWLNGKEISLLGGRFQSCLREIRKRARDFEDKEKGVKIKKEDWDKLHVHIASYNNFPTAA  126

Query  518  glassaagfaCLVFALGKLMNV  583
            GLASSAAG AC VF LGKLMNV
Sbjct  127  GLASSAAGLACFVFTLGKLMNV  148



>ref|XP_006836043.1| hypothetical protein AMTR_s00114p00051110 [Amborella trichopoda]
 gb|ERM98896.1| hypothetical protein AMTR_s00114p00051110 [Amborella trichopoda]
Length=419

 Score =   217 bits (552),  Expect = 7e-65, Method: Compositional matrix adjust.
 Identities = 116/145 (80%), Positives = 129/145 (89%), Gaps = 0/145 (0%)
 Frame = +2

Query  149  MAEKWVLMVTAQTPTNIAVIKYWGKRDETLILPINDSISVTLDPAHLCTTTTVAVSPAFD  328
            ++ + +LMVTA+ PTNIAVIKYWGKRDE+LILPINDSISVTLDP HLCTTTTVAVSP F+
Sbjct  4    VSGEGMLMVTARAPTNIAVIKYWGKRDESLILPINDSISVTLDPDHLCTTTTVAVSPNFE  63

Query  329  QDRMWLNGKEMSLSGVRYQNCLKEIRARACDVEDEKKGIKITKKDWENLHVHIASYNNFP  508
             DRMWLNGKE+SLSG RYQ+CLKEIR +A DV DE KGI I  +DW+ LHVHIASYNNFP
Sbjct  64   SDRMWLNGKEISLSGGRYQSCLKEIRQQAGDVIDENKGICIKGEDWQKLHVHIASYNNFP  123

Query  509  TaaglassaagfaCLVFALGKLMNV  583
            TAAGLASSAAGFACLV+AL KLMNV
Sbjct  124  TAAGLASSAAGFACLVYALSKLMNV  148



>ref|XP_002881611.1| hypothetical protein ARALYDRAFT_482881 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH57870.1| hypothetical protein ARALYDRAFT_482881 [Arabidopsis lyrata subsp. 
lyrata]
Length=412

 Score =   216 bits (551),  Expect = 7e-65, Method: Compositional matrix adjust.
 Identities = 121/143 (85%), Positives = 134/143 (94%), Gaps = 0/143 (0%)
 Frame = +2

Query  155  EKWVLMVTAQTPTNIAVIKYWGKRDETLILPINDSISVTLDPAHLCTTTTVAVSPAFDQD  334
            EKWV+MVTAQTPTNIAVIKYWGKRDE  ILPINDSISVTLDP HLCT TTV+VSP+FD+D
Sbjct  4    EKWVMMVTAQTPTNIAVIKYWGKRDEVRILPINDSISVTLDPDHLCTLTTVSVSPSFDRD  63

Query  335  RMWLNGKEMSLSGVRYQNCLKEIRARACDVEDEKKGIKITKKDWENLHVHIASYNNFPTa  514
            RMWLNGKE+SLSG RYQNCL+EIR+RA D+ED++KGIKI KKDW+ LH+HIAS+NNFPTA
Sbjct  64   RMWLNGKEISLSGSRYQNCLREIRSRADDLEDKEKGIKIEKKDWQKLHLHIASHNNFPTA  123

Query  515  aglassaagfaCLVFALGKLMNV  583
            AGLASSAAGFACLVFAL KLMNV
Sbjct  124  AGLASSAAGFACLVFALAKLMNV  146



>gb|AFJ93089.1| mevalonate diphosphate decarboxylase, partial [Bacopa monnieri]
Length=254

 Score =   211 bits (538),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 111/130 (85%), Positives = 119/130 (92%), Gaps = 0/130 (0%)
 Frame = +2

Query  194  NIAVIKYWGKRDETLILPINDSISVTLDPAHLCTTTTVAVSPAFDQDRMWLNGKEMSLSG  373
            NIAVIKYWGKRDE LILPINDSISVTLDP HLCTTT+VAVSPAF  DRMWLNGKE+ LSG
Sbjct  1    NIAVIKYWGKRDEDLILPINDSISVTLDPDHLCTTTSVAVSPAFTHDRMWLNGKEVPLSG  60

Query  374  VRYQNCLKEIRARACDVEDEKKGIKITKKDWENLHVHIASYNNFPTaaglassaagfaCL  553
            VRYQNCLKE+R+ A DVE+E+KGIKI+KKDWE LHVHI SYNNFPTAAGLASSAAG ACL
Sbjct  61   VRYQNCLKELRSLANDVEEEEKGIKISKKDWEKLHVHIVSYNNFPTAAGLASSAAGLACL  120

Query  554  VFALGKLMNV  583
            VF+L KLMNV
Sbjct  121  VFSLAKLMNV  130



>ref|XP_002452980.1| hypothetical protein SORBIDRAFT_04g035950 [Sorghum bicolor]
 gb|EES05956.1| hypothetical protein SORBIDRAFT_04g035950 [Sorghum bicolor]
Length=420

 Score =   216 bits (550),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 111/142 (78%), Positives = 123/142 (87%), Gaps = 0/142 (0%)
 Frame = +2

Query  158  KWVLMVTAQTPTNIAVIKYWGKRDETLILPINDSISVTLDPAHLCTTTTVAVSPAFDQDR  337
            +W+LM T +TPTNIAVIKYWGKRDE LILP+NDSISVTLDP HL  TTTVAVSP+F  DR
Sbjct  7    QWLLMATGRTPTNIAVIKYWGKRDEALILPVNDSISVTLDPDHLSATTTVAVSPSFPSDR  66

Query  338  MWLNGKEMSLSGVRYQNCLKEIRARACDVEDEKKGIKITKKDWENLHVHIASYNNFPTaa  517
            MWLNGKE+SL G R+Q+CL+EIR RA D EDE+KG+KI K+DW  LHVHIASYNNFPTAA
Sbjct  67   MWLNGKEISLLGGRFQSCLREIRKRARDFEDEEKGVKIKKEDWGKLHVHIASYNNFPTAA  126

Query  518  glassaagfaCLVFALGKLMNV  583
            GLASSAAG AC VF LGKLMNV
Sbjct  127  GLASSAAGLACFVFTLGKLMNV  148



>ref|XP_008665377.1| PREDICTED: diphosphomevalonate decarboxylase-like isoform X1 
[Zea mays]
Length=497

 Score =   218 bits (555),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 115/149 (77%), Positives = 127/149 (85%), Gaps = 1/149 (1%)
 Frame = +2

Query  140  PGTMAE-KWVLMVTAQTPTNIAVIKYWGKRDETLILPINDSISVTLDPAHLCTTTTVAVS  316
            P   AE +WVLM T +TPTNIAVIKYWGKRDE LILPINDSISVTLDP HL  TTTVAVS
Sbjct  77   PMAAAEGQWVLMATGRTPTNIAVIKYWGKRDEALILPINDSISVTLDPDHLSATTTVAVS  136

Query  317  PAFDQDRMWLNGKEMSLSGVRYQNCLKEIRARACDVEDEKKGIKITKKDWENLHVHIASY  496
            P+F  DRMWLNGKE+SL G R+Q+CL+EIR RA D ED++KG+KI K+DW+ LHVHIASY
Sbjct  137  PSFPSDRMWLNGKEISLLGGRFQSCLREIRKRARDFEDKEKGVKIKKEDWDKLHVHIASY  196

Query  497  NNFPTaaglassaagfaCLVFALGKLMNV  583
            NNFPTAAGLASSAAG AC VF LGKLMNV
Sbjct  197  NNFPTAAGLASSAAGLACFVFTLGKLMNV  225



>ref|NP_001149256.1| LOC100282878 [Zea mays]
 ref|XP_008643692.1| PREDICTED: LOC100282878 isoform X1 [Zea mays]
 gb|ACG34742.1| diphosphomevalonate decarboxylase [Zea mays]
 gb|ACR36666.1| unknown [Zea mays]
 gb|AFW73865.1| diphosphomevalonate decarboxylase [Zea mays]
Length=420

 Score =   216 bits (549),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 111/142 (78%), Positives = 123/142 (87%), Gaps = 0/142 (0%)
 Frame = +2

Query  158  KWVLMVTAQTPTNIAVIKYWGKRDETLILPINDSISVTLDPAHLCTTTTVAVSPAFDQDR  337
            +WVLM T +TPTNIAVIKYWGKRDE LILPINDSISVTLDP HL  TTTVAVSP+F  DR
Sbjct  7    QWVLMATGRTPTNIAVIKYWGKRDEALILPINDSISVTLDPDHLSATTTVAVSPSFPSDR  66

Query  338  MWLNGKEMSLSGVRYQNCLKEIRARACDVEDEKKGIKITKKDWENLHVHIASYNNFPTaa  517
            MWLNGKE+SL G R+Q+CL+EIR RA D ED++KG+KI K+DW+ LHVHIASYNNFPTAA
Sbjct  67   MWLNGKEISLLGGRFQSCLREIRKRARDFEDKEKGVKIKKEDWDKLHVHIASYNNFPTAA  126

Query  518  glassaagfaCLVFALGKLMNV  583
            GLASSAAG AC VF LGKLMN 
Sbjct  127  GLASSAAGLACFVFTLGKLMNA  148



>gb|ACN41090.1| unknown [Picea sitchensis]
Length=422

 Score =   215 bits (548),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 112/147 (76%), Positives = 126/147 (86%), Gaps = 0/147 (0%)
 Frame = +2

Query  143  GTMAEKWVLMVTAQTPTNIAVIKYWGKRDETLILPINDSISVTLDPAHLCTTTTVAVSPA  322
            G   ++W+LMVTA+ PTNIAVIKYWGKRDE LILPINDSIS TLDP HL  TTTVAVSP+
Sbjct  2    GEELQRWILMVTARAPTNIAVIKYWGKRDEKLILPINDSISFTLDPDHLSATTTVAVSPS  61

Query  323  FDQDRMWLNGKEMSLSGVRYQNCLKEIRARACDVEDEKKGIKITKKDWENLHVHIASYNN  502
            F  DRMWLNGKE+SL G RYQNCL+EIR+R  DV DEK GI I K+DW+ LH+HIASYNN
Sbjct  62   FTSDRMWLNGKEVSLGGERYQNCLREIRSRGNDVVDEKNGIVIRKEDWQRLHLHIASYNN  121

Query  503  FPTaaglassaagfaCLVFALGKLMNV  583
            FPTAAGLASSAAGFACLV++L KLM+V
Sbjct  122  FPTAAGLASSAAGFACLVYSLAKLMDV  148



>gb|KFK34679.1| hypothetical protein AALP_AA5G177200 [Arabis alpina]
Length=419

 Score =   215 bits (547),  Expect = 5e-64, Method: Compositional matrix adjust.
 Identities = 120/144 (83%), Positives = 132/144 (92%), Gaps = 0/144 (0%)
 Frame = +2

Query  152  AEKWVLMVTAQTPTNIAVIKYWGKRDETLILPINDSISVTLDPAHLCTTTTVAVSPAFDQ  331
            AEKW+ MVTAQTPTNIAVIKYWGKRDE  ILP+NDSISVTLDP HLCT TTVAVSPAFD+
Sbjct  3    AEKWIFMVTAQTPTNIAVIKYWGKRDEVRILPVNDSISVTLDPDHLCTVTTVAVSPAFDR  62

Query  332  DRMWLNGKEMSLSGVRYQNCLKEIRARACDVEDEKKGIKITKKDWENLHVHIASYNNFPT  511
            DRMWLNGKE+SLSG RYQNCL+EIR+ A DVED++K IKI KKDWE L++HIAS+NNFPT
Sbjct  63   DRMWLNGKEISLSGSRYQNCLREIRSCAGDVEDKEKNIKIEKKDWEKLNLHIASHNNFPT  122

Query  512  aaglassaagfaCLVFALGKLMNV  583
            AAGLASSAAGFACLVF+L KLMNV
Sbjct  123  AAGLASSAAGFACLVFSLAKLMNV  146



>ref|NP_001045633.2| Os02g0107200 [Oryza sativa Japonica Group]
 dbj|BAF07547.2| Os02g0107200 [Oryza sativa Japonica Group]
Length=145

 Score =   205 bits (522),  Expect = 8e-64, Method: Compositional matrix adjust.
 Identities = 103/132 (78%), Positives = 114/132 (86%), Gaps = 0/132 (0%)
 Frame = +2

Query  158  KWVLMVTAQTPTNIAVIKYWGKRDETLILPINDSISVTLDPAHLCTTTTVAVSPAFDQDR  337
            +WVLM T ++PTNIAVIKYWGKRDE LILP+NDSISVTLDP HL  TTTVAVSP+F  DR
Sbjct  8    QWVLMATGRSPTNIAVIKYWGKRDEALILPVNDSISVTLDPDHLSATTTVAVSPSFPSDR  67

Query  338  MWLNGKEMSLSGVRYQNCLKEIRARACDVEDEKKGIKITKKDWENLHVHIASYNNFPTaa  517
            MWLNGKE+SLSG R+Q+CL+EIR RA DVEDEKKGI+I K+DW  LHVHIASYNNFPTAA
Sbjct  68   MWLNGKEISLSGGRFQSCLREIRKRAQDVEDEKKGIRIKKEDWGKLHVHIASYNNFPTAA  127

Query  518  glassaagfaCL  553
            GLASS AG  C 
Sbjct  128  GLASSVAGLVCF  139



>ref|XP_004150845.1| PREDICTED: diphosphomevalonate decarboxylase-like [Cucumis sativus]
 ref|XP_004165172.1| PREDICTED: diphosphomevalonate decarboxylase-like [Cucumis sativus]
 gb|KGN52198.1| hypothetical protein Csa_5G615210 [Cucumis sativus]
Length=424

 Score =   212 bits (539),  Expect = 7e-63, Method: Compositional matrix adjust.
 Identities = 118/144 (82%), Positives = 130/144 (90%), Gaps = 0/144 (0%)
 Frame = +2

Query  152  AEKWVLMVTAQTPTNIAVIKYWGKRDETLILPINDSISVTLDPAHLCTTTTVAVSPAFDQ  331
             +KWVL+ TAQTPTNIAVIKYWGKRDE LILP+NDSISVTLDP+HLCT TTVAVSP F++
Sbjct  9    GQKWVLLTTAQTPTNIAVIKYWGKRDEDLILPVNDSISVTLDPSHLCTITTVAVSPNFEK  68

Query  332  DRMWLNGKEMSLSGVRYQNCLKEIRARACDVEDEKKGIKITKKDWENLHVHIASYNNFPT  511
            DRMWLN KE+SLSG RYQNCL+EIR+RA DVED++KGIKI KKDWE LHV+I SYNNFPT
Sbjct  69   DRMWLNRKEISLSGARYQNCLREIRSRANDVEDKEKGIKIEKKDWEKLHVYIDSYNNFPT  128

Query  512  aaglassaagfaCLVFALGKLMNV  583
            AAGLASSAAG ACLVFAL  LMNV
Sbjct  129  AAGLASSAAGLACLVFALANLMNV  152



>gb|AAV32433.1| mevalonate disphosphate decarboxylase [Ginkgo biloba]
Length=430

 Score =   211 bits (536),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 110/141 (78%), Positives = 122/141 (87%), Gaps = 0/141 (0%)
 Frame = +2

Query  161  WVLMVTAQTPTNIAVIKYWGKRDETLILPINDSISVTLDPAHLCTTTTVAVSPAFDQDRM  340
            WV MVTA+ PTNIAVIKYWGKRDE LILPINDSISVTLDP HL  TTTVAVSP+F  DRM
Sbjct  11   WVFMVTARAPTNIAVIKYWGKRDEKLILPINDSISVTLDPDHLSATTTVAVSPSFSSDRM  70

Query  341  WLNGKEMSLSGVRYQNCLKEIRARACDVEDEKKGIKITKKDWENLHVHIASYNNFPTaag  520
            WLNGKE+SL G RYQNCL+EIR+R  DV DEK G  I K+DW+ LH+HIAS+NNFPTAAG
Sbjct  71   WLNGKEVSLGGERYQNCLREIRSRGRDVVDEKSGTLIKKEDWQTLHLHIASHNNFPTAAG  130

Query  521  lassaagfaCLVFALGKLMNV  583
            LASSAAGFACLV+AL KLM++
Sbjct  131  LASSAAGFACLVYALAKLMDI  151



>tpg|DAA51252.1| TPA: hypothetical protein ZEAMMB73_408503 [Zea mays]
Length=1213

 Score =   218 bits (554),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 115/149 (77%), Positives = 127/149 (85%), Gaps = 1/149 (1%)
 Frame = +2

Query  140   PGTMAE-KWVLMVTAQTPTNIAVIKYWGKRDETLILPINDSISVTLDPAHLCTTTTVAVS  316
             P   AE +WVLM T +TPTNIAVIKYWGKRDE LILPINDSISVTLDP HL  TTTVAVS
Sbjct  1040  PMAAAEGQWVLMATGRTPTNIAVIKYWGKRDEALILPINDSISVTLDPDHLSATTTVAVS  1099

Query  317   PAFDQDRMWLNGKEMSLSGVRYQNCLKEIRARACDVEDEKKGIKITKKDWENLHVHIASY  496
             P+F  DRMWLNGKE+SL G R+Q+CL+EIR RA D ED++KG+KI K+DW+ LHVHIASY
Sbjct  1100  PSFPSDRMWLNGKEISLLGGRFQSCLREIRKRARDFEDKEKGVKIKKEDWDKLHVHIASY  1159

Query  497   NNFPTaaglassaagfaCLVFALGKLMNV  583
             NNFPTAAGLASSAAG AC VF LGKLMNV
Sbjct  1160  NNFPTAAGLASSAAGLACFVFTLGKLMNV  1188



>tpg|DAA51253.1| TPA: hypothetical protein ZEAMMB73_408503 [Zea mays]
Length=1460

 Score =   218 bits (554),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 115/149 (77%), Positives = 127/149 (85%), Gaps = 1/149 (1%)
 Frame = +2

Query  140   PGTMAE-KWVLMVTAQTPTNIAVIKYWGKRDETLILPINDSISVTLDPAHLCTTTTVAVS  316
             P   AE +WVLM T +TPTNIAVIKYWGKRDE LILPINDSISVTLDP HL  TTTVAVS
Sbjct  1040  PMAAAEGQWVLMATGRTPTNIAVIKYWGKRDEALILPINDSISVTLDPDHLSATTTVAVS  1099

Query  317   PAFDQDRMWLNGKEMSLSGVRYQNCLKEIRARACDVEDEKKGIKITKKDWENLHVHIASY  496
             P+F  DRMWLNGKE+SL G R+Q+CL+EIR RA D ED++KG+KI K+DW+ LHVHIASY
Sbjct  1100  PSFPSDRMWLNGKEISLLGGRFQSCLREIRKRARDFEDKEKGVKIKKEDWDKLHVHIASY  1159

Query  497   NNFPTaaglassaagfaCLVFALGKLMNV  583
             NNFPTAAGLASSAAG AC VF LGKLMNV
Sbjct  1160  NNFPTAAGLASSAAGLACFVFTLGKLMNV  1188



>ref|XP_010067138.1| PREDICTED: diphosphomevalonate decarboxylase-like isoform X2 
[Eucalyptus grandis]
Length=354

 Score =   204 bits (519),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 105/145 (72%), Positives = 123/145 (85%), Gaps = 0/145 (0%)
 Frame = +2

Query  149  MAEKWVLMVTAQTPTNIAVIKYWGKRDETLILPINDSISVTLDPAHLCTTTTVAVSPAFD  328
            M  +WVLMVTA+ P+NI+VIKYWGKR+E LIL +N+SIS+TLD  HLC TTTVAVSP F+
Sbjct  1    MEGEWVLMVTAKAPSNISVIKYWGKRNEALILAVNESISITLDLDHLCATTTVAVSPKFE  60

Query  329  QDRMWLNGKEMSLSGVRYQNCLKEIRARACDVEDEKKGIKITKKDWENLHVHIASYNNFP  508
            +DR+WLNGKEMSLS  RYQN L+EIR+R  + ED++KGIKI K+DW  LH HIAS+NNFP
Sbjct  61   KDRLWLNGKEMSLSSDRYQNTLREIRSRGDNFEDDEKGIKIMKEDWMRLHFHIASHNNFP  120

Query  509  TaaglassaagfaCLVFALGKLMNV  583
            T  GLASSAAGFACLVFAL KLMNV
Sbjct  121  TGTGLASSAAGFACLVFALAKLMNV  145



>ref|XP_008668934.1| PREDICTED: diphosphomevalonate decarboxylase-like isoform X2 
[Zea mays]
Length=159

 Score =   197 bits (500),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 100/132 (76%), Positives = 113/132 (86%), Gaps = 0/132 (0%)
 Frame = +2

Query  158  KWVLMVTAQTPTNIAVIKYWGKRDETLILPINDSISVTLDPAHLCTTTTVAVSPAFDQDR  337
            +WVLM T +TPTNIAVIKYWGKRDE LILPINDSISVTLDP HL  TTT+AVSP+F  DR
Sbjct  7    QWVLMATGRTPTNIAVIKYWGKRDEALILPINDSISVTLDPDHLSATTTIAVSPSFPSDR  66

Query  338  MWLNGKEMSLSGVRYQNCLKEIRARACDVEDEKKGIKITKKDWENLHVHIASYNNFPTaa  517
            MWLNGKE+SL G R+Q+CLKEIR RA D+ED++K +KI K+DW  LHVHIASYNNFPT+A
Sbjct  67   MWLNGKEISLLGGRFQSCLKEIRKRARDIEDKEKDVKIKKEDWGKLHVHIASYNNFPTSA  126

Query  518  glassaagfaCL  553
            GLASSAA  AC 
Sbjct  127  GLASSAADLACF  138



>ref|XP_008668933.1| PREDICTED: diphosphomevalonate decarboxylase-like isoform X1 
[Zea mays]
Length=161

 Score =   197 bits (500),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 100/132 (76%), Positives = 113/132 (86%), Gaps = 0/132 (0%)
 Frame = +2

Query  158  KWVLMVTAQTPTNIAVIKYWGKRDETLILPINDSISVTLDPAHLCTTTTVAVSPAFDQDR  337
            +WVLM T +TPTNIAVIKYWGKRDE LILPINDSISVTLDP HL  TTT+AVSP+F  DR
Sbjct  7    QWVLMATGRTPTNIAVIKYWGKRDEALILPINDSISVTLDPDHLSATTTIAVSPSFPSDR  66

Query  338  MWLNGKEMSLSGVRYQNCLKEIRARACDVEDEKKGIKITKKDWENLHVHIASYNNFPTaa  517
            MWLNGKE+SL G R+Q+CLKEIR RA D+ED++K +KI K+DW  LHVHIASYNNFPT+A
Sbjct  67   MWLNGKEISLLGGRFQSCLKEIRKRARDIEDKEKDVKIKKEDWGKLHVHIASYNNFPTSA  126

Query  518  glassaagfaCL  553
            GLASSAA  AC 
Sbjct  127  GLASSAADLACF  138



>ref|XP_003565147.1| PREDICTED: diphosphomevalonate decarboxylase-like [Brachypodium 
distachyon]
Length=417

 Score =   204 bits (518),  Expect = 7e-60, Method: Compositional matrix adjust.
 Identities = 118/145 (81%), Positives = 129/145 (89%), Gaps = 0/145 (0%)
 Frame = +2

Query  149  MAEKWVLMVTAQTPTNIAVIKYWGKRDETLILPINDSISVTLDPAHLCTTTTVAVSPAFD  328
            MA +W+LM T +TPTNIAVIKYWGKRDE LILP+NDSISVTLDP HL  TTTVAVSP+F 
Sbjct  1    MAAEWLLMATGRTPTNIAVIKYWGKRDEALILPVNDSISVTLDPDHLSATTTVAVSPSFP  60

Query  329  QDRMWLNGKEMSLSGVRYQNCLKEIRARACDVEDEKKGIKITKKDWENLHVHIASYNNFP  508
             DRMWLNGKE++LSG R+Q+CL+EIR RA DVEDEKKGIKI K+DWE LHVHIASYNNFP
Sbjct  61   SDRMWLNGKEIALSGGRFQSCLREIRKRARDVEDEKKGIKIKKEDWEKLHVHIASYNNFP  120

Query  509  TaaglassaagfaCLVFALGKLMNV  583
            TAAGLASSAAG ACLVF LGKLMNV
Sbjct  121  TAAGLASSAAGLACLVFTLGKLMNV  145



>ref|XP_010067136.1| PREDICTED: diphosphomevalonate decarboxylase-like isoform X1 
[Eucalyptus grandis]
 ref|XP_010067137.1| PREDICTED: diphosphomevalonate decarboxylase-like isoform X1 
[Eucalyptus grandis]
 gb|KCW65201.1| hypothetical protein EUGRSUZ_G02693 [Eucalyptus grandis]
Length=419

 Score =   203 bits (517),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 105/145 (72%), Positives = 123/145 (85%), Gaps = 0/145 (0%)
 Frame = +2

Query  149  MAEKWVLMVTAQTPTNIAVIKYWGKRDETLILPINDSISVTLDPAHLCTTTTVAVSPAFD  328
            M  +WVLMVTA+ P+NI+VIKYWGKR+E LIL +N+SIS+TLD  HLC TTTVAVSP F+
Sbjct  1    MEGEWVLMVTAKAPSNISVIKYWGKRNEALILAVNESISITLDLDHLCATTTVAVSPKFE  60

Query  329  QDRMWLNGKEMSLSGVRYQNCLKEIRARACDVEDEKKGIKITKKDWENLHVHIASYNNFP  508
            +DR+WLNGKEMSLS  RYQN L+EIR+R  + ED++KGIKI K+DW  LH HIAS+NNFP
Sbjct  61   KDRLWLNGKEMSLSSDRYQNTLREIRSRGDNFEDDEKGIKIMKEDWMRLHFHIASHNNFP  120

Query  509  TaaglassaagfaCLVFALGKLMNV  583
            T  GLASSAAGFACLVFAL KLMNV
Sbjct  121  TGTGLASSAAGFACLVFALAKLMNV  145



>ref|XP_004954217.1| PREDICTED: diphosphomevalonate decarboxylase-like [Setaria italica]
Length=420

 Score =   202 bits (515),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 117/142 (82%), Positives = 128/142 (90%), Gaps = 0/142 (0%)
 Frame = +2

Query  158  KWVLMVTAQTPTNIAVIKYWGKRDETLILPINDSISVTLDPAHLCTTTTVAVSPAFDQDR  337
            +WVLM T ++PTNIAVIKYWGKRDE LILP+NDSISVTLDP HL  TTTVAVSP+F  DR
Sbjct  7    QWVLMATGRSPTNIAVIKYWGKRDEALILPVNDSISVTLDPDHLSATTTVAVSPSFPSDR  66

Query  338  MWLNGKEMSLSGVRYQNCLKEIRARACDVEDEKKGIKITKKDWENLHVHIASYNNFPTaa  517
            MWLNGKE+SLSG R+Q+CL+EIR RAC+ EDEKKGIKI K+DWE LHVHIASYNNFPTAA
Sbjct  67   MWLNGKEISLSGGRFQSCLREIRKRACEFEDEKKGIKIKKEDWEKLHVHIASYNNFPTAA  126

Query  518  glassaagfaCLVFALGKLMNV  583
            GLASSAAGFACLVF LGKLMNV
Sbjct  127  GLASSAAGFACLVFTLGKLMNV  148



>ref|XP_004963234.1| PREDICTED: diphosphomevalonate decarboxylase-like [Setaria italica]
Length=425

 Score =   202 bits (513),  Expect = 6e-59, Method: Compositional matrix adjust.
 Identities = 116/142 (82%), Positives = 127/142 (89%), Gaps = 0/142 (0%)
 Frame = +2

Query  158  KWVLMVTAQTPTNIAVIKYWGKRDETLILPINDSISVTLDPAHLCTTTTVAVSPAFDQDR  337
            +WVLM T ++PTNIAVIKYWGKRDE LILP+NDS+SVTLDP HL  TTTVAVSP+F  DR
Sbjct  10   QWVLMATGRSPTNIAVIKYWGKRDEALILPVNDSVSVTLDPDHLSATTTVAVSPSFSSDR  69

Query  338  MWLNGKEMSLSGVRYQNCLKEIRARACDVEDEKKGIKITKKDWENLHVHIASYNNFPTaa  517
            MWLNGKE+SLSG R+Q+CL+EIR RACD EDEKKGIKI K+DWE LHVHIASY NFPTAA
Sbjct  70   MWLNGKEISLSGGRFQSCLREIRKRACDFEDEKKGIKIKKEDWEKLHVHIASYKNFPTAA  129

Query  518  glassaagfaCLVFALGKLMNV  583
            GLASSAAGFACLVF LGKLMNV
Sbjct  130  GLASSAAGFACLVFTLGKLMNV  151



>ref|XP_001773902.1| predicted protein [Physcomitrella patens]
 gb|EDQ61250.1| predicted protein [Physcomitrella patens]
Length=423

 Score =   201 bits (512),  Expect = 7e-59, Method: Compositional matrix adjust.
 Identities = 106/147 (72%), Positives = 122/147 (83%), Gaps = 0/147 (0%)
 Frame = +2

Query  143  GTMAEKWVLMVTAQTPTNIAVIKYWGKRDETLILPINDSISVTLDPAHLCTTTTVAVSPA  322
            G   E WV+M TA+ P+NIAVIKYWGKRDE LILPIN SISVTLDP HL  TTTVA SPA
Sbjct  2    GNEEETWVVMKTARAPSNIAVIKYWGKRDEKLILPINSSISVTLDPEHLSATTTVAASPA  61

Query  323  FDQDRMWLNGKEMSLSGVRYQNCLKEIRARACDVEDEKKGIKITKKDWENLHVHIASYNN  502
            F++DR+WLNGKE+S+ GVRY+NCL+E+RARA DV  E  G  I K+DW +LH+HIAS NN
Sbjct  62   FEKDRLWLNGKEVSVEGVRYKNCLREMRARATDVVIESSGKVIRKEDWNSLHIHIASENN  121

Query  503  FPTaaglassaagfaCLVFALGKLMNV  583
            FPTAAGLASSAAGFACLV+AL +LM V
Sbjct  122  FPTAAGLASSAAGFACLVYALAQLMGV  148



>gb|AGT17596.1| mevalonate diphosphate decarboxylase [Picrorhiza kurrooa]
Length=421

 Score =   201 bits (512),  Expect = 7e-59, Method: Compositional matrix adjust.
 Identities = 110/144 (76%), Positives = 123/144 (85%), Gaps = 0/144 (0%)
 Frame = +2

Query  152  AEKWVLMVTAQTPTNIAVIKYWGKRDETLILPINDSISVTLDPAHLCTTTTVAVSPAFDQ  331
            AEKWVL VTAQTPTNIAVIKYWGK DE LILPINDSISVTLDP HLCTTT+VAVSPAF  
Sbjct  4    AEKWVLTVTAQTPTNIAVIKYWGKGDEDLILPINDSISVTLDPDHLCTTTSVAVSPAFTH  63

Query  332  DRMWLNGKEMSLSGVRYQNCLKEIRARACDVEDEKKGIKITKKDWENLHVHIASYNNFPT  511
            DRMWLNGKE+SLSG R+QNCL+E+R+ A DVEDEK+G+  + K   +LHVH+    +FPT
Sbjct  64   DRMWLNGKEVSLSGGRFQNCLREVRSCANDVEDEKEGVLKSLKGLGDLHVHMCPTIDFPT  123

Query  512  aaglassaagfaCLVFALGKLMNV  583
            AAGLASSAAG ACLVF+L KLMNV
Sbjct  124  AAGLASSAAGLACLVFSLAKLMNV  147



>ref|NP_001045642.2| Os02g0109100 [Oryza sativa Japonica Group]
 dbj|BAF07556.2| Os02g0109100, partial [Oryza sativa Japonica Group]
Length=147

 Score =   190 bits (482),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 87/110 (79%), Positives = 98/110 (89%), Gaps = 0/110 (0%)
 Frame = +2

Query  182  QTPTNIAVIKYWGKRDETLILPINDSISVTLDPAHLCTTTTVAVSPAFDQDRMWLNGKEM  361
            ++PTNIAVIKYWGKRDE LILP+NDSISVTLDP HL  TTTVAVSP+F  DRMWLNGKE+
Sbjct  18   RSPTNIAVIKYWGKRDEALILPVNDSISVTLDPDHLSATTTVAVSPSFPSDRMWLNGKEI  77

Query  362  SLSGVRYQNCLKEIRARACDVEDEKKGIKITKKDWENLHVHIASYNNFPT  511
            SLSG R+Q+CL+EIR RA DVEDEKKGI+I K+DW  LHVHIAS+NNFPT
Sbjct  78   SLSGGRFQSCLREIRKRAQDVEDEKKGIRIKKEDWGKLHVHIASFNNFPT  127



>ref|XP_001774493.1| predicted protein [Physcomitrella patens]
 gb|EDQ60717.1| predicted protein [Physcomitrella patens]
Length=426

 Score =   196 bits (497),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 103/143 (72%), Positives = 120/143 (84%), Gaps = 0/143 (0%)
 Frame = +2

Query  155  EKWVLMVTAQTPTNIAVIKYWGKRDETLILPINDSISVTLDPAHLCTTTTVAVSPAFDQD  334
            + WV+M TA+ P+NIAVIKYWGKRDE LILPIN SISVTLDP HL  TTTVA SPAF++D
Sbjct  7    DAWVVMKTARAPSNIAVIKYWGKRDEKLILPINSSISVTLDPEHLSATTTVAASPAFERD  66

Query  335  RMWLNGKEMSLSGVRYQNCLKEIRARACDVEDEKKGIKITKKDWENLHVHIASYNNFPTa  514
            R+WLNGKE+S+ G RY+NCL+E+RARA DV  E  G  ITK+ W  LH+HIAS NNFPTA
Sbjct  67   RLWLNGKEVSVEGERYRNCLREMRARATDVVIESSGKVITKEVWSTLHIHIASENNFPTA  126

Query  515  aglassaagfaCLVFALGKLMNV  583
            AGLASSAAGFACLV++L +LMNV
Sbjct  127  AGLASSAAGFACLVYSLAQLMNV  149



>ref|XP_002979347.1| hypothetical protein SELMODRAFT_268244 [Selaginella moellendorffii]
 gb|EFJ19755.1| hypothetical protein SELMODRAFT_268244 [Selaginella moellendorffii]
Length=403

 Score =   182 bits (462),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 99/147 (67%), Positives = 117/147 (80%), Gaps = 0/147 (0%)
 Frame = +2

Query  143  GTMAEKWVLMVTAQTPTNIAVIKYWGKRDETLILPINDSISVTLDPAHLCTTTTVAVSPA  322
            GT    W++  TA+ P+NIAVIKYWGKRDE LILP+N SISVTLDP  L  TTTV+ SP 
Sbjct  2    GTDGSAWIVSRTARAPSNIAVIKYWGKRDEDLILPLNSSISVTLDPNDLSATTTVSTSPD  61

Query  323  FDQDRMWLNGKEMSLSGVRYQNCLKEIRARACDVEDEKKGIKITKKDWENLHVHIASYNN  502
            FD DR+WLN KE+SLS  RY +CLKE+R RA DV+DEK GI ITK+DW++L +HI S NN
Sbjct  62   FDADRLWLNDKEVSLSSHRYVSCLKELRDRATDVKDEKTGIVITKEDWKHLKLHIVSKNN  121

Query  503  FPTaaglassaagfaCLVFALGKLMNV  583
            FPTAAGLASSAAGFACLVF + +LM +
Sbjct  122  FPTAAGLASSAAGFACLVFTVAQLMGI  148



>ref|XP_002992344.1| hypothetical protein SELMODRAFT_135101 [Selaginella moellendorffii]
 gb|EFJ06620.1| hypothetical protein SELMODRAFT_135101 [Selaginella moellendorffii]
Length=403

 Score =   182 bits (461),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 99/147 (67%), Positives = 117/147 (80%), Gaps = 0/147 (0%)
 Frame = +2

Query  143  GTMAEKWVLMVTAQTPTNIAVIKYWGKRDETLILPINDSISVTLDPAHLCTTTTVAVSPA  322
            GT    W++  TA+ P+NIAVIKYWGKRDE LILP+N SISVTLDP  L  TTTV+ SP 
Sbjct  2    GTDGSAWIVSRTARAPSNIAVIKYWGKRDEDLILPLNSSISVTLDPNDLSATTTVSTSPD  61

Query  323  FDQDRMWLNGKEMSLSGVRYQNCLKEIRARACDVEDEKKGIKITKKDWENLHVHIASYNN  502
            FD DR+WLN KE+SLS  RY +CLKE+R RA DV+DEK GI ITK+DW++L +HI S NN
Sbjct  62   FDADRLWLNDKEVSLSSHRYVSCLKELRDRATDVKDEKTGIVITKEDWKHLKLHIVSKNN  121

Query  503  FPTaaglassaagfaCLVFALGKLMNV  583
            FPTAAGLASSAAGFACLVF + +LM +
Sbjct  122  FPTAAGLASSAAGFACLVFTVAELMGI  148



>gb|AFW73864.1| hypothetical protein ZEAMMB73_421648 [Zea mays]
Length=390

 Score =   150 bits (378),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 87/142 (61%), Positives = 98/142 (69%), Gaps = 30/142 (21%)
 Frame = +2

Query  158  KWVLMVTAQTPTNIAVIKYWGKRDETLILPINDSISVTLDPAHLCTTTTVAVSPAFDQDR  337
            +WVLM T +TPTNIAVIKYWGKRDE LILPINDSIS                        
Sbjct  7    QWVLMATGRTPTNIAVIKYWGKRDEALILPINDSIS------------------------  42

Query  338  MWLNGKEMSLSGVRYQNCLKEIRARACDVEDEKKGIKITKKDWENLHVHIASYNNFPTaa  517
                  E+SL G R+Q+CL+EIR RA D ED++KG+KI K+DW+ LHVHIASYNNFPTAA
Sbjct  43   ------EISLLGGRFQSCLREIRKRARDFEDKEKGVKIKKEDWDKLHVHIASYNNFPTAA  96

Query  518  glassaagfaCLVFALGKLMNV  583
            GLASSAAG AC VF LGKLMN 
Sbjct  97   GLASSAAGLACFVFTLGKLMNA  118



>ref|XP_001121619.2| PREDICTED: diphosphomevalonate decarboxylase-like isoform X1 
[Apis mellifera]
Length=386

 Score =   137 bits (345),  Expect = 6e-35, Method: Compositional matrix adjust.
 Identities = 81/138 (59%), Positives = 94/138 (68%), Gaps = 11/138 (8%)
 Frame = +2

Query  170  MVTAQTPTNIAVIKYWGKRDETLILPINDSISVTLDPAHLCTTTTVAVSPAFDQDRMWLN  349
            +VT   P NIAV+KYWGKRDETLILP NDSIS TLD  HLC  TTV +SP F  DR+WLN
Sbjct  3    IVTCIAPINIAVVKYWGKRDETLILPANDSISATLDTDHLCAKTTVMISPNFKHDRIWLN  62

Query  350  GKEMSLSGVRYQNCLKEIRARACDVEDEKKGIKITKKDWENLHVHIASYNNFPTaaglas  529
            G+E  +  +R QNCL EI+ RA D     +        W+   +HI S NNFPT+AGLAS
Sbjct  63   GREEDIMNIRLQNCLTEIKKRAGDSNHMDQ--------WK---IHICSENNFPTSAGLAS  111

Query  530  saagfaCLVFALGKLMNV  583
            SAAG+ACLV AL KL  V
Sbjct  112  SAAGYACLVIALAKLYEV  129



>ref|XP_004356734.1| diphosphomevalonate decarboxylase [Acanthamoeba castellanii str. 
Neff]
 gb|ELR24834.1| diphosphomevalonate decarboxylase [Acanthamoeba castellanii str. 
Neff]
Length=412

 Score =   137 bits (344),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 81/145 (56%), Positives = 98/145 (68%), Gaps = 2/145 (1%)
 Frame = +2

Query  149  MAEKWVLMVTAQTPTNIAVIKYWGKRDETLILPINDSISVTLDPAHLCTTTTVAVSPAFD  328
            MA    L VTAQ P NIAVIKYWGK DE LILP+N S+S TL    LCTTTTV  S  F 
Sbjct  1    MATTKALCVTAQAPVNIAVIKYWGKTDEKLILPLNSSLSTTLSMTDLCTTTTVMASKEFK  60

Query  329  QDRMWLNGKEMSLSGVRYQNCLKEIRARACDVEDEKKGIKITKKDWENLHVHIASYNNFP  508
            +DR+WLNGKE S+S  R QNC+ ++ AR+  +  ++ G  + +      H HI S NNFP
Sbjct  61   EDRLWLNGKEESVSSGRMQNCIGQLVARSGLL--KRLGENVEEGKAREYHFHIVSVNNFP  118

Query  509  TaaglassaagfaCLVFALGKLMNV  583
            TAAGLASSA+GFACL + LG L+ V
Sbjct  119  TAAGLASSASGFACLTYTLGTLLEV  143



>ref|XP_003693647.1| PREDICTED: diphosphomevalonate decarboxylase-like [Apis florea]
Length=386

 Score =   136 bits (342),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 80/138 (58%), Positives = 94/138 (68%), Gaps = 11/138 (8%)
 Frame = +2

Query  170  MVTAQTPTNIAVIKYWGKRDETLILPINDSISVTLDPAHLCTTTTVAVSPAFDQDRMWLN  349
            +VT   P NIAV+KYWGKRDETLILP NDSIS TLD  HLC  TTV +SP F  DR+WLN
Sbjct  3    IVTCIAPINIAVVKYWGKRDETLILPANDSISATLDTDHLCAKTTVMISPNFKHDRIWLN  62

Query  350  GKEMSLSGVRYQNCLKEIRARACDVEDEKKGIKITKKDWENLHVHIASYNNFPTaaglas  529
            G+E  +  +R QNCL EIR R  +     +        W+   +HI S NNFPT+AGLAS
Sbjct  63   GREEDIKNIRLQNCLTEIRKRTGNSNHMDQ--------WK---IHICSENNFPTSAGLAS  111

Query  530  saagfaCLVFALGKLMNV  583
            SAAG+ACLV AL KL +V
Sbjct  112  SAAGYACLVIALAKLYDV  129



>ref|XP_006623086.1| PREDICTED: diphosphomevalonate decarboxylase-like [Apis dorsata]
Length=386

 Score =   136 bits (342),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 81/138 (59%), Positives = 93/138 (67%), Gaps = 11/138 (8%)
 Frame = +2

Query  170  MVTAQTPTNIAVIKYWGKRDETLILPINDSISVTLDPAHLCTTTTVAVSPAFDQDRMWLN  349
            +VT   P NIAV+KYWGKRDETLILP NDSIS TLD  HLC  TTV +SP F  DR+WLN
Sbjct  3    IVTCIAPINIAVVKYWGKRDETLILPANDSISATLDTDHLCAKTTVMISPNFKHDRIWLN  62

Query  350  GKEMSLSGVRYQNCLKEIRARACDVEDEKKGIKITKKDWENLHVHIASYNNFPTaaglas  529
            G+E  +  +R QNCL EI+ RA        G       W+   +HI S NNFPT+AGLAS
Sbjct  63   GREEDIKNIRLQNCLTEIKKRA--------GNSNHMNQWK---IHICSENNFPTSAGLAS  111

Query  530  saagfaCLVFALGKLMNV  583
            SAAG+ACLV AL KL  V
Sbjct  112  SAAGYACLVIALAKLYEV  129



>ref|XP_005708031.1| diphosphomevalonate decarboxylase isoform 1 [Galdieria sulphuraria]
 gb|EME31511.1| diphosphomevalonate decarboxylase isoform 1 [Galdieria sulphuraria]
Length=394

 Score =   130 bits (328),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 73/138 (53%), Positives = 99/138 (72%), Gaps = 1/138 (1%)
 Frame = +2

Query  167  LMVTAQTPTNIAVIKYWGKRDETLILPINDSISVTLDPAHLCTTTTVAVSPAFDQDRMWL  346
            L VT   P NIA+IKYWGKR+E  ILP+N S+S+TLD A L T TTV  S  FD+DR+WL
Sbjct  8    LTVTCTAPVNIALIKYWGKREEDKILPLNPSLSITLDVADLRTKTTVVASKQFDRDRLWL  67

Query  347  NGKEMSLSGVRYQNCLKEIRARACDVEDEKKGIKITKKDWENLHVHIASYNNFPTaagla  526
            NGKE  ++  R Q C++++R  A D+  + K + I K++W+N  +HI S NNFPTAAGLA
Sbjct  68   NGKEHDINNKRMQTCIRKLRQGADDLWRDGK-LMIAKEEWKNYRLHIISENNFPTAAGLA  126

Query  527  ssaagfaCLVFALGKLMN  580
            SSA+G AC V+++ +L+ 
Sbjct  127  SSASGLACFVYSIAQLLQ  144



>ref|XP_004600545.1| PREDICTED: diphosphomevalonate decarboxylase [Sorex araneus]
Length=395

 Score =   130 bits (328),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 81/145 (56%), Positives = 97/145 (67%), Gaps = 3/145 (2%)
 Frame = +2

Query  149  MAEKWVLMVTAQTPTNIAVIKYWGKRDETLILPINDSISVTLDPAHLCTTTTVAVSPAFD  328
            MA   +L VT   P NIAVIKYWGKRDE LILPIN S+SVTL    L TTTT A+S AF 
Sbjct  1    MASGQLLAVTCTAPVNIAVIKYWGKRDEELILPINSSLSVTLHQDQLKTTTTAAISKAFT  60

Query  329  QDRMWLNGKEMSLSGVRYQNCLKEIRARACDVEDEKKGIKITKKDWENLHVHIASYNNFP  508
            +DR+WLNG+E  ++  R Q CL+EIR  A        G      D++   VH+AS NNFP
Sbjct  61   KDRIWLNGREEDVTQPRLQACLREIRRLAEKRRRSSGGEDPLTHDYK---VHVASVNNFP  117

Query  509  TaaglassaagfaCLVFALGKLMNV  583
            TAAGLASSAAG+ACL +AL ++  V
Sbjct  118  TAAGLASSAAGYACLAYALARVYGV  142



>ref|XP_005708030.1| diphosphomevalonate decarboxylase isoform 2 [Galdieria sulphuraria]
 gb|EME31510.1| diphosphomevalonate decarboxylase isoform 2 [Galdieria sulphuraria]
Length=411

 Score =   130 bits (328),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 73/138 (53%), Positives = 99/138 (72%), Gaps = 1/138 (1%)
 Frame = +2

Query  167  LMVTAQTPTNIAVIKYWGKRDETLILPINDSISVTLDPAHLCTTTTVAVSPAFDQDRMWL  346
            L VT   P NIA+IKYWGKR+E  ILP+N S+S+TLD A L T TTV  S  FD+DR+WL
Sbjct  8    LTVTCTAPVNIALIKYWGKREEDKILPLNPSLSITLDVADLRTKTTVVASKQFDRDRLWL  67

Query  347  NGKEMSLSGVRYQNCLKEIRARACDVEDEKKGIKITKKDWENLHVHIASYNNFPTaagla  526
            NGKE  ++  R Q C++++R  A D+  + K + I K++W+N  +HI S NNFPTAAGLA
Sbjct  68   NGKEHDINNKRMQTCIRKLRQGADDLWRDGK-LMIAKEEWKNYRLHIISENNFPTAAGLA  126

Query  527  ssaagfaCLVFALGKLMN  580
            SSA+G AC V+++ +L+ 
Sbjct  127  SSASGLACFVYSIAQLLQ  144



>ref|XP_006097406.1| PREDICTED: diphosphomevalonate decarboxylase [Myotis lucifugus]
Length=400

 Score =   130 bits (327),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 80/146 (55%), Positives = 99/146 (68%), Gaps = 6/146 (4%)
 Frame = +2

Query  152  AEKWVLMVTAQTPTNIAVIKYWGKRDETLILPINDSISVTLDPAHLCTTTTVAVSPAFDQ  331
            +EK  L VT   P NIAVIKYWGKRDE LILPIN S+SVTL    L TTTT  +S  F +
Sbjct  3    SEKPYLAVTCTAPVNIAVIKYWGKRDEELILPINSSLSVTLHQDQLKTTTTAVISKDFTE  62

Query  332  DRMWLNGKEMSLSGVRYQNCLKEIR--ARACDVEDEKKGIKITKKDWENLHVHIASYNNF  505
            DR+WLNG+E  +   R Q CL+EIR  AR    +DE+  + ++     N  VH+AS NNF
Sbjct  63   DRIWLNGREEDIGQPRIQACLREIRRLARKRRSDDEEDPLPLSL----NYKVHVASVNNF  118

Query  506  PTaaglassaagfaCLVFALGKLMNV  583
            PTAAGLASSA+G+ACL +AL ++  V
Sbjct  119  PTAAGLASSASGYACLAYALARVYGV  144



>ref|XP_003758532.1| PREDICTED: diphosphomevalonate decarboxylase [Sarcophilus harrisii]
Length=398

 Score =   130 bits (327),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 84/146 (58%), Positives = 100/146 (68%), Gaps = 8/146 (5%)
 Frame = +2

Query  152  AEKWVLMVTAQTPTNIAVIKYWGKRDETLILPINDSISVTLDPAHLCTTTTVAVSPAFDQ  331
            AEK ++ VT   PTNIAVIKYWGKRDE LILPIN S+SVTL    L TTTT A+S  F +
Sbjct  3    AEKALVAVTCTAPTNIAVIKYWGKRDEKLILPINSSLSVTLHQNQLKTTTTAAISRDFKE  62

Query  332  DRMWLNGKEMSLSGVRYQNCLKEIR--ARACDVEDEKKGIKITKKDWENLHVHIASYNNF  505
            DR+WLNGKE  +   R Q+CL+EIR  AR      E   + ++ K      VHIAS N+F
Sbjct  63   DRIWLNGKEEDVGHPRLQSCLREIRRLARKRRSGSEGDSVPLSYK------VHIASVNDF  116

Query  506  PTaaglassaagfaCLVFALGKLMNV  583
            PTAAGLASSAAG+ACLV+ L +L  V
Sbjct  117  PTAAGLASSAAGYACLVYTLAQLYGV  142



>ref|XP_002735076.1| PREDICTED: diphosphomevalonate decarboxylase-like [Saccoglossus 
kowalevskii]
Length=405

 Score =   130 bits (327),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 80/137 (58%), Positives = 96/137 (70%), Gaps = 4/137 (3%)
 Frame = +2

Query  173  VTAQTPTNIAVIKYWGKRDETLILPINDSISVTLDPAHLCTTTTVAVSPAFDQDRMWLNG  352
            VT   P NIAVIKYWGKRDE LILP N S+S +LD  HL +TTT ++S  F +DR+WLNG
Sbjct  15   VTCTAPINIAVIKYWGKRDEQLILPTNSSLSASLDQDHLKSTTTASISKEFKRDRLWLNG  74

Query  353  KEMSLSGVRYQNCLKEIRARACDVEDEKKGIKITKKDWENLHVHIASYNNFPTaaglass  532
            KE S+   R QNCL EIR RA     ++K    +K +  N  VHI S NNFPTAAGLASS
Sbjct  75   KEESIENPRIQNCLIEIRRRA----RKRKHNDDSKSEMLNWSVHICSENNFPTAAGLASS  130

Query  533  aagfaCLVFALGKLMNV  583
            AAG+ACLV+ L KL ++
Sbjct  131  AAGYACLVYTLSKLYDI  147



>gb|ELK31386.1| Diphosphomevalonate decarboxylase [Myotis davidii]
Length=363

 Score =   129 bits (325),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 80/146 (55%), Positives = 98/146 (67%), Gaps = 6/146 (4%)
 Frame = +2

Query  152  AEKWVLMVTAQTPTNIAVIKYWGKRDETLILPINDSISVTLDPAHLCTTTTVAVSPAFDQ  331
            +EK  L VT   P NIAVIKYWGKRDE LILPIN S+SVTL    L TTTT  +S  F +
Sbjct  3    SEKPYLAVTCTAPVNIAVIKYWGKRDEELILPINSSLSVTLHQDQLKTTTTAVISKDFTE  62

Query  332  DRMWLNGKEMSLSGVRYQNCLKEIR--ARACDVEDEKKGIKITKKDWENLHVHIASYNNF  505
            DR+WLNG+E  +   R Q CL+EIR  AR     DE+  + ++     N  VH+AS NNF
Sbjct  63   DRIWLNGREEDIGQPRIQACLREIRRLARKRRSGDEEDPLPLSL----NYKVHVASVNNF  118

Query  506  PTaaglassaagfaCLVFALGKLMNV  583
            PTAAGLASSA+G+ACL +AL ++  V
Sbjct  119  PTAAGLASSASGYACLAYALARVYGV  144



>ref|NP_001133968.1| Diphosphomevalonate decarboxylase [Salmo salar]
 gb|ACI34234.1| Diphosphomevalonate decarboxylase [Salmo salar]
Length=402

 Score =   130 bits (326),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 83/149 (56%), Positives = 101/149 (68%), Gaps = 10/149 (7%)
 Frame = +2

Query  149  MAEKWVLMVTAQTPTNIAVIKYWGKRDETLILPINDSISVTLDPAHLCTTTTVAVSPAFD  328
            ++ K + MVT   P NIAVIKYWGKRDE LILPIN S+SVTL    L TTTTVA S +F 
Sbjct  4    VSGKKLTMVTCSAPVNIAVIKYWGKRDEELILPINSSLSVTLHQDQLKTTTTVACSRSFQ  63

Query  329  QDRMWLNGKEMSLSGVRYQNCLKEI----RARACDVEDEKKGIKITKKDWENLHVHIASY  496
            +DR+WLNGKE  ++  R Q+CL+EI    R R  D E +     ++ K      VHI S 
Sbjct  64   EDRIWLNGKEEDITQPRLQSCLREIRCLSRKRRSDGEADVDAAGLSHK------VHICSV  117

Query  497  NNFPTaaglassaagfaCLVFALGKLMNV  583
            NNFPTAAGLASSAAG+ACLV+ L ++M V
Sbjct  118  NNFPTAAGLASSAAGYACLVYTLSRVMGV  146



>ref|XP_011497479.1| PREDICTED: diphosphomevalonate decarboxylase [Ceratosolen solmsi 
marchali]
Length=391

 Score =   129 bits (325),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 79/138 (57%), Positives = 92/138 (67%), Gaps = 11/138 (8%)
 Frame = +2

Query  170  MVTAQTPTNIAVIKYWGKRDETLILPINDSISVTLDPAHLCTTTTVAVSPAFDQDRMWLN  349
            +VT   P NIAVIKYWGKRD+ LILP+NDSIS TLD  HLCT TT   S  F +DRMWLN
Sbjct  3    VVTCIAPINIAVIKYWGKRDDDLILPVNDSISTTLDKDHLCTKTTAMASSDFKEDRMWLN  62

Query  350  GKEMSLSGVRYQNCLKEIRARACDVEDEKKGIKITKKDWENLHVHIASYNNFPTaaglas  529
            G E S+   R QNCL+E++ RA   E           + +N  +HI S NNFPTAAGLAS
Sbjct  63   GSEQSMDNPRLQNCLRELKKRAQISE-----------EMQNWKLHICSENNFPTAAGLAS  111

Query  530  saagfaCLVFALGKLMNV  583
            SAAG+ACLV  + KL  V
Sbjct  112  SAAGYACLVTTIAKLYKV  129



>ref|XP_010996754.1| PREDICTED: diphosphomevalonate decarboxylase-like, partial [Camelus 
dromedarius]
Length=239

 Score =   126 bits (317),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 81/144 (56%), Positives = 94/144 (65%), Gaps = 2/144 (1%)
 Frame = +2

Query  152  AEKWVLMVTAQTPTNIAVIKYWGKRDETLILPINDSISVTLDPAHLCTTTTVAVSPAFDQ  331
            AEK V+ VT   P NIAVIKYWGKRDE LILPIN S+SVTL    L TTTT A+S  F +
Sbjct  3    AEKPVVAVTCTAPVNIAVIKYWGKRDEKLILPINSSLSVTLHQDQLKTTTTAAISRDFTE  62

Query  332  DRMWLNGKEMSLSGVRYQNCLKEIRARACDVEDEKKGIKITKKDWENLHVHIASYNNFPT  511
            DR+WLNG+E  +   R Q CLKEIR  AC          +      +  VHIAS NNFPT
Sbjct  63   DRIWLNGREEDIGQPRLQACLKEIRRLACKRRSGSPEDPLPLS--HSCKVHIASENNFPT  120

Query  512  aaglassaagfaCLVFALGKLMNV  583
            AAGLASSAAG+ACL + L ++  V
Sbjct  121  AAGLASSAAGYACLAYTLARVYGV  144



>ref|NP_001093300.1| diphosphomevalonate decarboxylase [Bombyx mori]
 dbj|BAF62111.1| diphosphomevalonate decarboxylase [Bombyx mori]
Length=390

 Score =   129 bits (325),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 77/138 (56%), Positives = 96/138 (70%), Gaps = 7/138 (5%)
 Frame = +2

Query  170  MVTAQTPTNIAVIKYWGKRDETLILPINDSISVTLDPAHLCTTTTVAVSPAFDQDRMWLN  349
            +VT   P NIAVIKYWGKRDE LILP+NDS+S T D + +C  T+V+  P F +D++WLN
Sbjct  4    IVTVIAPVNIAVIKYWGKRDEKLILPLNDSVSATFDTSVMCAKTSVSTHPDFVEDQIWLN  63

Query  350  GKEMSLSGVRYQNCLKEIRARACDVEDEKKGIKITKKDWENLHVHIASYNNFPTaaglas  529
            GKE S S  R QNCL+EI++RA          K   +D  +  VH++S NNFPTAAGLAS
Sbjct  64   GKEESFSNPRLQNCLREIKSRAV-------AEKTIAEDVLSWKVHVSSENNFPTAAGLAS  116

Query  530  saagfaCLVFALGKLMNV  583
            SAAG+ACLV AL KL  +
Sbjct  117  SAAGYACLVSALAKLYKI  134



>ref|XP_006762259.1| PREDICTED: diphosphomevalonate decarboxylase isoform X1 [Myotis 
davidii]
Length=400

 Score =   129 bits (325),  Expect = 6e-32, Method: Compositional matrix adjust.
 Identities = 80/146 (55%), Positives = 98/146 (67%), Gaps = 6/146 (4%)
 Frame = +2

Query  152  AEKWVLMVTAQTPTNIAVIKYWGKRDETLILPINDSISVTLDPAHLCTTTTVAVSPAFDQ  331
            +EK  L VT   P NIAVIKYWGKRDE LILPIN S+SVTL    L TTTT  +S  F +
Sbjct  3    SEKPYLAVTCTAPVNIAVIKYWGKRDEELILPINSSLSVTLHQDQLKTTTTAVISKDFTE  62

Query  332  DRMWLNGKEMSLSGVRYQNCLKEIR--ARACDVEDEKKGIKITKKDWENLHVHIASYNNF  505
            DR+WLNG+E  +   R Q CL+EIR  AR     DE+  + ++     N  VH+AS NNF
Sbjct  63   DRIWLNGREEDIGQPRIQACLREIRRLARKRRSGDEEDPLPLSL----NYKVHVASVNNF  118

Query  506  PTaaglassaagfaCLVFALGKLMNV  583
            PTAAGLASSA+G+ACL +AL ++  V
Sbjct  119  PTAAGLASSASGYACLAYALARVYGV  144



>emb|CDQ87522.1| unnamed protein product [Oncorhynchus mykiss]
Length=402

 Score =   129 bits (324),  Expect = 6e-32, Method: Compositional matrix adjust.
 Identities = 83/146 (57%), Positives = 99/146 (68%), Gaps = 10/146 (7%)
 Frame = +2

Query  158  KWVLMVTAQTPTNIAVIKYWGKRDETLILPINDSISVTLDPAHLCTTTTVAVSPAFDQDR  337
            K + MVT   P NIAVIKYWGKRDE LILPIN S+SVTL    L TTTTVA S +F +DR
Sbjct  7    KKLTMVTCSAPVNIAVIKYWGKRDEELILPINSSLSVTLHQDQLKTTTTVACSRSFQEDR  66

Query  338  MWLNGKEMSLSGVRYQNCLKEI----RARACDVEDEKKGIKITKKDWENLHVHIASYNNF  505
            +WLNGKE  ++  R Q+CL+EI    R R  D E +     ++ K      VHI S NNF
Sbjct  67   IWLNGKEEDITQPRLQSCLREIRRLARKRRSDGEADVDTAGLSHK------VHICSVNNF  120

Query  506  PTaaglassaagfaCLVFALGKLMNV  583
            PTAAGLASSAAG+ACLV+ L ++M V
Sbjct  121  PTAAGLASSAAGYACLVYTLSRVMGV  146



>gb|ELU01936.1| hypothetical protein CAPTEDRAFT_176844 [Capitella teleta]
Length=398

 Score =   129 bits (324),  Expect = 7e-32, Method: Compositional matrix adjust.
 Identities = 85/140 (61%), Positives = 92/140 (66%), Gaps = 4/140 (3%)
 Frame = +2

Query  164  VLMVTAQTPTNIAVIKYWGKRDETLILPINDSISVTLDPAHLCTTTTVAVSPAFDQDRMW  343
            ++  T   P NIAVIKYWGKRDE LILPIN S+S TLD   L   TTVA S  F +DRMW
Sbjct  5    IISKTCTGPVNIAVIKYWGKRDEKLILPINASLSGTLDQQQLRAKTTVAASAGFTKDRMW  64

Query  344  LNGKEMSLSGVRYQNCLKEIRARACDVEDEKKGIKITKKDWENLHVHIASYNNFPTaagl  523
            LNG+E SL   R QN LKEIR RA      K G +    D     VHI S NNFPTAAGL
Sbjct  65   LNGQEQSLDNPRLQNVLKEIRRRA---RKRKSGCE-DDLDMLTWRVHICSENNFPTAAGL  120

Query  524  assaagfaCLVFALGKLMNV  583
            ASSAAG ACLVF+L KL NV
Sbjct  121  ASSAAGLACLVFSLSKLFNV  140



>ref|XP_003228605.1| PREDICTED: diphosphomevalonate decarboxylase [Anolis carolinensis]
Length=406

 Score =   129 bits (323),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 88/155 (57%), Positives = 102/155 (66%), Gaps = 16/155 (10%)
 Frame = +2

Query  149  MAEKWVL-MVTAQTPTNIAVIKYWGKRDETLILPINDSISVTLDPAHLCTTTTVAVSPAF  325
            MAE   L MVT   P NIAVIKYWGKRDE LILPIN S+SVTL    L TTTT A+S  F
Sbjct  1    MAEDHPLSMVTCTAPINIAVIKYWGKRDEKLILPINSSLSVTLHQDQLKTTTTAAISRDF  60

Query  326  DQDRMWLNGKEMSLSGVRYQNCLKEIR-----ARACDVEDEKKG----IKITKKDWENLH  478
             +DR+WLNGKE  +   R Q+CL+EIR      R+ D +  + G    + +T K      
Sbjct  61   TEDRLWLNGKESDIGHPRLQSCLREIRRLARKRRSGDTKGPEGGEPSPLSLTYK------  114

Query  479  VHIASYNNFPTaaglassaagfaCLVFALGKLMNV  583
            VHIAS NNFPTAAGLASSAAG+ACLV+ L KL  V
Sbjct  115  VHIASENNFPTAAGLASSAAGYACLVYTLAKLYGV  149



>ref|XP_011315112.1| PREDICTED: diphosphomevalonate decarboxylase isoform X1 [Fopius 
arisanus]
Length=386

 Score =   128 bits (322),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 79/138 (57%), Positives = 92/138 (67%), Gaps = 11/138 (8%)
 Frame = +2

Query  170  MVTAQTPTNIAVIKYWGKRDETLILPINDSISVTLDPAHLCTTTTVAVSPAFDQDRMWLN  349
            +VT   P NIAVIKYWGKRDE LILP+NDSIS +LD   LC  TT+  S  FD DR+WLN
Sbjct  3    IVTCIAPVNIAVIKYWGKRDEQLILPVNDSISASLDTDQLCAKTTIMASADFDADRIWLN  62

Query  350  GKEMSLSGVRYQNCLKEIRARACDVEDEKKGIKITKKDWENLHVHIASYNNFPTaaglas  529
            G+E S++  R QNCL+EI+ RA               + EN  +HI S NNFPTAAGLAS
Sbjct  63   GREESINNPRLQNCLREIKKRAQ-----------LSPEMENWKLHICSKNNFPTAAGLAS  111

Query  530  saagfaCLVFALGKLMNV  583
            SAAG+ACL  AL KL  V
Sbjct  112  SAAGYACLSAALAKLYRV  129



>ref|XP_006008326.1| PREDICTED: diphosphomevalonate decarboxylase isoform X2 [Latimeria 
chalumnae]
Length=366

 Score =   128 bits (321),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 85/150 (57%), Positives = 102/150 (68%), Gaps = 11/150 (7%)
 Frame = +2

Query  149  MAEK-WVLMVTAQTPTNIAVIKYWGKRDETLILPINDSISVTLDPAHLCTTTTVAVSPAF  325
            MAEK  V  VT   P NIAVIKYWGKRD+ LILPIN S+SVTL    L TTTTV  S  F
Sbjct  1    MAEKKTVTRVTCTAPVNIAVIKYWGKRDDDLILPINSSLSVTLHQNQLKTTTTVVASREF  60

Query  326  DQDRMWLNGKEMSLSGVRYQNCLKEI----RARACDVEDEKKGIKITKKDWENLHVHIAS  493
             +DR+WLNGKE +++  R Q+CL+EI    R R  D E +   + ++ K      +HI S
Sbjct  61   KEDRIWLNGKEDNINQPRLQSCLREIQRLARKRRSDGEGDSSPLNLSYK------IHICS  114

Query  494  YNNFPTaaglassaagfaCLVFALGKLMNV  583
             NNFPTAAGLASSAAG+ACLV+AL KL +V
Sbjct  115  INNFPTAAGLASSAAGYACLVYALAKLYSV  144



>gb|KDR21975.1| Diphosphomevalonate decarboxylase [Zootermopsis nevadensis]
Length=338

 Score =   127 bits (319),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 80/139 (58%), Positives = 95/139 (68%), Gaps = 8/139 (6%)
 Frame = +2

Query  170  MVTAQTPTNIAVIKYWGKRDETLILPINDSISVTLDPAHLCTTTTVAVSPAFDQDRMWLN  349
            +VT   P NIAVIKYWGKRDE LILP+NDS+S TL    +   T+V  SP F +D++WLN
Sbjct  3    IVTCIAPVNIAVIKYWGKRDENLILPLNDSVSATLSIKQMNAKTSVMASPNFTEDKIWLN  62

Query  350  GKEMSLSGVRYQNCLKEIRARACDVEDEK-KGIKITKKDWENLHVHIASYNNFPTaagla  526
            G+E +    R QNCL+EIR RA    D K  G+     DW    VH+ S NNFPTAAGLA
Sbjct  63   GREETFHSQRLQNCLQEIRRRAKQRADGKDDGV----SDWC---VHVCSENNFPTAAGLA  115

Query  527  ssaagfaCLVFALGKLMNV  583
            SSAAG+ACLVFAL +L NV
Sbjct  116  SSAAGYACLVFALAQLYNV  134



>gb|ABO27200.1| cytosolic mevalonate-5-diphosphate decarboxylase [Mesostigma 
viride]
Length=93

 Score =   120 bits (302),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 57/92 (62%), Positives = 72/92 (78%), Gaps = 1/92 (1%)
 Frame = +2

Query  221  KRDETLILPINDSISVTLDPAHLCTTTTVAVSPAFDQDRMWLNGKEMSLSGVRYQNCLKE  400
            KRDE LILPIN SISVT+DP  LC TTTVAVSP+F++DR+WLNGKE+ +  VRYQNCL+ 
Sbjct  1    KRDEELILPINSSISVTIDPTALCATTTVAVSPSFERDRLWLNGKEVPMDNVRYQNCLRI  60

Query  401  IRARACDVEDEKKGI-KITKKDWENLHVHIAS  493
            +R RA DV  + +G   +++ DW+ L VHIAS
Sbjct  61   MRERARDVAADGQGSPAVSRSDWQALKVHIAS  92



>emb|CDQ81132.1| unnamed protein product [Oncorhynchus mykiss]
Length=402

 Score =   128 bits (321),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 83/146 (57%), Positives = 98/146 (67%), Gaps = 10/146 (7%)
 Frame = +2

Query  158  KWVLMVTAQTPTNIAVIKYWGKRDETLILPINDSISVTLDPAHLCTTTTVAVSPAFDQDR  337
            K + MVT   P NIAVIKYWGKRDE LILPIN S+SVTL    L TTTTVA S  F +DR
Sbjct  7    KELTMVTCSAPVNIAVIKYWGKRDEELILPINSSLSVTLHQDQLKTTTTVACSRLFQEDR  66

Query  338  MWLNGKEMSLSGVRYQNCLKEI----RARACDVEDEKKGIKITKKDWENLHVHIASYNNF  505
            +WLNGKE  ++  R Q+CL+EI    R R  D E +     ++ K      VHI S NNF
Sbjct  67   IWLNGKEEDITQPRLQSCLREIRRLARKRRSDGEADVDTAGLSHK------VHICSVNNF  120

Query  506  PTaaglassaagfaCLVFALGKLMNV  583
            PTAAGLASSAAG+ACLV+ L ++M V
Sbjct  121  PTAAGLASSAAGYACLVYTLSRVMGV  146



>ref|XP_008137975.1| PREDICTED: diphosphomevalonate decarboxylase [Eptesicus fuscus]
Length=400

 Score =   128 bits (321),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 81/146 (55%), Positives = 98/146 (67%), Gaps = 6/146 (4%)
 Frame = +2

Query  152  AEKWVLMVTAQTPTNIAVIKYWGKRDETLILPINDSISVTLDPAHLCTTTTVAVSPAFDQ  331
            +EK  L VT   P NIAVIKYWGKRDE LILPIN S+SVTL    L TTTT  +S  F +
Sbjct  3    SEKPHLAVTCTAPVNIAVIKYWGKRDEELILPINSSLSVTLHQDQLKTTTTAVISKDFTE  62

Query  332  DRMWLNGKEMSLSGVRYQNCLKEIR--ARACDVEDEKKGIKITKKDWENLHVHIASYNNF  505
            DR+WLNG+E  +   R Q CL+EIR  AR     DE+  + ++     N  VHIAS NNF
Sbjct  63   DRIWLNGREEDIGQPRIQACLREIRRLARKRRSGDEEDLLPLSL----NYKVHIASVNNF  118

Query  506  PTaaglassaagfaCLVFALGKLMNV  583
            PTAAGLASSA+G+ACL +AL ++  V
Sbjct  119  PTAAGLASSASGYACLAYALAQVYGV  144



>ref|XP_006008325.1| PREDICTED: diphosphomevalonate decarboxylase isoform X1 [Latimeria 
chalumnae]
Length=400

 Score =   128 bits (321),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 85/150 (57%), Positives = 102/150 (68%), Gaps = 11/150 (7%)
 Frame = +2

Query  149  MAEK-WVLMVTAQTPTNIAVIKYWGKRDETLILPINDSISVTLDPAHLCTTTTVAVSPAF  325
            MAEK  V  VT   P NIAVIKYWGKRD+ LILPIN S+SVTL    L TTTTV  S  F
Sbjct  1    MAEKKTVTRVTCTAPVNIAVIKYWGKRDDDLILPINSSLSVTLHQNQLKTTTTVVASREF  60

Query  326  DQDRMWLNGKEMSLSGVRYQNCLKEI----RARACDVEDEKKGIKITKKDWENLHVHIAS  493
             +DR+WLNGKE +++  R Q+CL+EI    R R  D E +   + ++ K      +HI S
Sbjct  61   KEDRIWLNGKEDNINQPRLQSCLREIQRLARKRRSDGEGDSSPLNLSYK------IHICS  114

Query  494  YNNFPTaaglassaagfaCLVFALGKLMNV  583
             NNFPTAAGLASSAAG+ACLV+AL KL +V
Sbjct  115  INNFPTAAGLASSAAGYACLVYALAKLYSV  144



>ref|XP_008553889.1| PREDICTED: diphosphomevalonate decarboxylase [Microplitis demolitor]
 gb|EZA44851.1| diphosphomevalonate decarboxylase [Microplitis demolitor]
Length=386

 Score =   127 bits (320),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 78/137 (57%), Positives = 95/137 (69%), Gaps = 11/137 (8%)
 Frame = +2

Query  170  MVTAQTPTNIAVIKYWGKRDETLILPINDSISVTLDPAHLCTTTTVAVSPAFDQDRMWLN  349
            +VT   P NIAVIKYWGKRDE LILPINDSIS++LD   LCT TTV  SP F ++++WLN
Sbjct  3    IVTCIAPVNIAVIKYWGKRDEDLILPINDSISLSLDTKQLCTKTTVMASPNFKENKIWLN  62

Query  350  GKEMSLSGVRYQNCLKEIRARACDVEDEKKGIKITKKDWENLHVHIASYNNFPTaaglas  529
            G+E S++  R QNCL++I+++A               + E   VHI S NNFPTAAGLAS
Sbjct  63   GREESMNNKRLQNCLEKIKSKAT-----------LTNEMEMWKVHICSNNNFPTAAGLAS  111

Query  530  saagfaCLVFALGKLMN  580
            SAAG+ACL  AL KL N
Sbjct  112  SAAGYACLTAALAKLYN  128



>ref|XP_003424007.1| PREDICTED: diphosphomevalonate decarboxylase isoform X2 [Nasonia 
vitripennis]
Length=379

 Score =   127 bits (319),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 63/115 (55%), Positives = 75/115 (65%), Gaps = 11/115 (10%)
 Frame = +2

Query  167  LMVTAQTPTNIAVIKYWGKRDETLILPINDSISVTLDPAHLCTTTTVAVSPAFDQDRMWL  346
            + VT   P NIAVIKYWGKRDE LILPINDS+S TLD  HLC  TTV  SP F ++++WL
Sbjct  3    ITVTCVAPVNIAVIKYWGKRDEDLILPINDSLSATLDTEHLCAKTTVRASPEFKENKIWL  62

Query  347  NGKEMSLSGVRYQNCLKEIRARACDVEDEKKGIKITKKDWENLHVHIASYNNFPT  511
            NG+E S+   R QNCLKEI+ R+              KD E+  +HI S NNFPT
Sbjct  63   NGREESMDNPRLQNCLKEIKKRSQ-----------LSKDMESWKIHICSENNFPT  106



>ref|XP_005862569.1| PREDICTED: diphosphomevalonate decarboxylase isoform X2 [Myotis 
brandtii]
Length=400

 Score =   127 bits (320),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 78/146 (53%), Positives = 99/146 (68%), Gaps = 6/146 (4%)
 Frame = +2

Query  152  AEKWVLMVTAQTPTNIAVIKYWGKRDETLILPINDSISVTLDPAHLCTTTTVAVSPAFDQ  331
            +EK  L +T   P NIAVIKYWGKRDE LILPIN S+SVTL    L TTTT  +S  F +
Sbjct  3    SEKPYLAMTCTAPVNIAVIKYWGKRDEELILPINSSLSVTLHQDQLKTTTTAVISKDFTE  62

Query  332  DRMWLNGKEMSLSGVRYQNCLKEIR--ARACDVEDEKKGIKITKKDWENLHVHIASYNNF  505
            DR+WLNG+E  +   R Q CL+EIR  AR    ++E+  + ++     N  VH+AS NNF
Sbjct  63   DRIWLNGREEDIGQPRIQACLREIRRLARKRRSDEEEDPLPLSL----NYKVHVASVNNF  118

Query  506  PTaaglassaagfaCLVFALGKLMNV  583
            PTAAGLASSA+G+ACL +AL ++  V
Sbjct  119  PTAAGLASSASGYACLAYALARVYGV  144



>ref|NP_001267865.1| diphosphomevalonate decarboxylase [Bombus terrestris]
 gb|AFI55102.1| diphosphomevalonate decarboxylase [Bombus terrestris]
Length=384

 Score =   126 bits (317),  Expect = 5e-31, Method: Compositional matrix adjust.
 Identities = 81/137 (59%), Positives = 93/137 (68%), Gaps = 11/137 (8%)
 Frame = +2

Query  173  VTAQTPTNIAVIKYWGKRDETLILPINDSISVTLDPAHLCTTTTVAVSPAFDQDRMWLNG  352
            VT     NIAVIKYWGKRDETLILP+NDSIS TLD  HL T TTV +SP F +D++WLNG
Sbjct  4    VTCIASVNIAVIKYWGKRDETLILPVNDSISATLDTDHLHTKTTVMISPTFKEDQIWLNG  63

Query  353  KEMSLSGVRYQNCLKEIRARACDVEDEKKGIKITKKDWENLHVHIASYNNFPTaaglass  532
            +E  +   R QNCL +IR RA +     +        W+   VHI S NNFPTAAGLASS
Sbjct  64   QEEDIKNPRLQNCLTQIRKRARNSNHIDQ--------WK---VHICSENNFPTAAGLASS  112

Query  533  aagfaCLVFALGKLMNV  583
            AAG+ACLV AL KL  V
Sbjct  113  AAGYACLVAALAKLYQV  129



>ref|XP_001376834.1| PREDICTED: diphosphomevalonate decarboxylase [Monodelphis domestica]
Length=398

 Score =   127 bits (318),  Expect = 5e-31, Method: Compositional matrix adjust.
 Identities = 83/146 (57%), Positives = 99/146 (68%), Gaps = 8/146 (5%)
 Frame = +2

Query  152  AEKWVLMVTAQTPTNIAVIKYWGKRDETLILPINDSISVTLDPAHLCTTTTVAVSPAFDQ  331
            AEK ++ VT   PTNIAVIKYWGKRDE LILPIN S+SVTL    L TTTT A+S  F +
Sbjct  3    AEKPLVSVTCTAPTNIAVIKYWGKRDEKLILPINSSLSVTLHQNQLKTTTTAAISRDFKE  62

Query  332  DRMWLNGKEMSLSGVRYQNCLKEIRARACDVEDEKKG--IKITKKDWENLHVHIASYNNF  505
            DR+WLNGKE  +   R Q+CL+EIR  A        G  + ++ K      VHIAS N+F
Sbjct  63   DRIWLNGKEEDVGHHRLQSCLREIRRLARKRRSGSDGDLVPLSYK------VHIASVNDF  116

Query  506  PTaaglassaagfaCLVFALGKLMNV  583
            PTAAGLASSAAG+ACLV+ L +L  V
Sbjct  117  PTAAGLASSAAGYACLVYTLAQLYGV  142



>ref|XP_010966484.1| PREDICTED: diphosphomevalonate decarboxylase [Camelus bactrianus]
Length=400

 Score =   127 bits (318),  Expect = 5e-31, Method: Compositional matrix adjust.
 Identities = 81/144 (56%), Positives = 94/144 (65%), Gaps = 2/144 (1%)
 Frame = +2

Query  152  AEKWVLMVTAQTPTNIAVIKYWGKRDETLILPINDSISVTLDPAHLCTTTTVAVSPAFDQ  331
            AEK V+ VT   P NIAVIKYWGKRDE LILPIN S+SVTL    L TTTT A+S  F +
Sbjct  3    AEKPVVAVTCTAPVNIAVIKYWGKRDEKLILPINSSLSVTLHQDQLKTTTTAAISRDFTE  62

Query  332  DRMWLNGKEMSLSGVRYQNCLKEIRARACDVEDEKKGIKITKKDWENLHVHIASYNNFPT  511
            DR+WLNG+E  +   R Q CLKEIR  AC          +      +  VHIAS NNFPT
Sbjct  63   DRIWLNGREEDIGQPRLQACLKEIRRLACKRRSGSPEDPLPLS--HSCKVHIASENNFPT  120

Query  512  aaglassaagfaCLVFALGKLMNV  583
            AAGLASSAAG+ACL + L ++  V
Sbjct  121  AAGLASSAAGYACLAYTLARVYGV  144



>ref|XP_001200662.2| PREDICTED: diphosphomevalonate decarboxylase-like [Strongylocentrotus 
purpuratus]
Length=410

 Score =   126 bits (317),  Expect = 6e-31, Method: Compositional matrix adjust.
 Identities = 78/137 (57%), Positives = 95/137 (69%), Gaps = 5/137 (4%)
 Frame = +2

Query  173  VTAQTPTNIAVIKYWGKRDETLILPINDSISVTLDPAHLCTTTTVAVSPAFDQDRMWLNG  352
            VT + P NIAVIKYWGKRDE LILP+N S+S TL    LCTTT++A S  F +DR+WLNG
Sbjct  7    VTCKAPINIAVIKYWGKRDEKLILPVNSSLSATLHIDQLCTTTSIAGSKHFPEDRLWLNG  66

Query  353  KEMSLSGVRYQNCLKEIRARACDVEDEKKGIKITKKDWENLHVHIASYNNFPTaaglass  532
            KE SL   R + CL+EIR RA      K+ I   + + E+  +HI S NNFPTAAGLASS
Sbjct  67   KEESLENPRVKTCLQEIRKRA-----RKRKISDDESNPEDWKLHICSENNFPTAAGLASS  121

Query  533  aagfaCLVFALGKLMNV  583
            AAG+ACLV  L ++  V
Sbjct  122  AAGYACLVATLAQVYGV  138



>ref|XP_003484695.1| PREDICTED: diphosphomevalonate decarboxylase-like [Bombus impatiens]
Length=446

 Score =   126 bits (317),  Expect = 9e-31, Method: Compositional matrix adjust.
 Identities = 80/137 (58%), Positives = 94/137 (69%), Gaps = 11/137 (8%)
 Frame = +2

Query  173  VTAQTPTNIAVIKYWGKRDETLILPINDSISVTLDPAHLCTTTTVAVSPAFDQDRMWLNG  352
            VT  T  NIAVIKYWGKRDETLILP+NDSIS TLD  HL T TTV +SP F +D++WLNG
Sbjct  66   VTCITSVNIAVIKYWGKRDETLILPVNDSISATLDTNHLHTKTTVMISPTFKEDQIWLNG  125

Query  353  KEMSLSGVRYQNCLKEIRARACDVEDEKKGIKITKKDWENLHVHIASYNNFPTaaglass  532
            ++  +   R QNCL +IR RA +     +        W+   VHI S NNFPTAAGLASS
Sbjct  126  QKEDIKNPRLQNCLTQIRKRARNSNHIDQ--------WK---VHICSENNFPTAAGLASS  174

Query  533  aagfaCLVFALGKLMNV  583
            AAG+ACLV AL KL  +
Sbjct  175  AAGYACLVAALAKLYQI  191



>ref|XP_004310733.1| PREDICTED: diphosphomevalonate decarboxylase [Tursiops truncatus]
Length=400

 Score =   126 bits (316),  Expect = 9e-31, Method: Compositional matrix adjust.
 Identities = 80/148 (54%), Positives = 99/148 (67%), Gaps = 10/148 (7%)
 Frame = +2

Query  152  AEKWVLMVTAQTPTNIAVIKYWGKRDETLILPINDSISVTLDPAHLCTTTTVAVSPAFDQ  331
            +EK + +VT   P NIAVIKYWGKRDE LILPIN S+SVTL    L TTTT A+S  F +
Sbjct  3    SEKRLEVVTCTAPVNIAVIKYWGKRDEELILPINSSLSVTLHQDQLKTTTTAAISRDFTE  62

Query  332  DRMWLNGKEMSLSGVRYQNCLKEI----RARACDVEDEKKGIKITKKDWENLHVHIASYN  499
            DR+WLNG+E  +   R Q CL+EI    R R  D  +E   + ++ K      VH+AS N
Sbjct  63   DRIWLNGREEDVGQPRLQACLREIRRLARKRRSDGHEEPLPLSLSYK------VHVASVN  116

Query  500  NFPTaaglassaagfaCLVFALGKLMNV  583
            NFPTAAGLASSAAG+ACL +AL ++  V
Sbjct  117  NFPTAAGLASSAAGYACLAYALARVYGV  144



>ref|XP_009029357.1| hypothetical protein HELRODRAFT_185177 [Helobdella robusta]
 gb|ESN93109.1| hypothetical protein HELRODRAFT_185177 [Helobdella robusta]
Length=406

 Score =   125 bits (315),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 79/140 (56%), Positives = 97/140 (69%), Gaps = 8/140 (6%)
 Frame = +2

Query  164  VLMVTAQTPTNIAVIKYWGKRDETLILPINDSISVTLDPAHLCTTTTVAVSPAFDQDRMW  343
            +L VT + P NIAV+KYWGK+DE LILP+N SIS TLD  H+C TTTVA+S +F +D+ W
Sbjct  3    ILSVTGRAPINIAVVKYWGKKDERLILPLNGSISGTLDLTHMCATTTVAISESFSEDQFW  62

Query  344  LNGKEMSLSGVRYQNCLKEIRARACDVEDEKKGIKITKKDWENLHVHIASYNNFPTaagl  523
            LNG E SLS  R+   L+ I+ RA     E + I   K  W+   +HI S NNFPTAAGL
Sbjct  63   LNGLECSLSA-RFSIVLEAIKKRAL----ENETIDREKLSWK---IHICSKNNFPTAAGL  114

Query  524  assaagfaCLVFALGKLMNV  583
            ASSAAG ACLVF L +L N+
Sbjct  115  ASSAAGLACLVFCLARLYNI  134



>ref|XP_002432413.1| Diphosphomevalonate decarboxylase, putative [Pediculus humanus 
corporis]
 gb|EEB19675.1| Diphosphomevalonate decarboxylase, putative [Pediculus humanus 
corporis]
Length=401

 Score =   125 bits (314),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 74/138 (54%), Positives = 93/138 (67%), Gaps = 0/138 (0%)
 Frame = +2

Query  170  MVTAQTPTNIAVIKYWGKRDETLILPINDSISVTLDPAHLCTTTTVAVSPAFDQDRMWLN  349
            +VT + P NIA IKYWGKRDETLILP+NDSISVT++   +   TT+A SP F  DR+WLN
Sbjct  3    IVTCKAPVNIAAIKYWGKRDETLILPLNDSISVTINTNFMRAKTTIAASPHFKNDRIWLN  62

Query  350  GKEMSLSGVRYQNCLKEIRARACDVEDEKKGIKITKKDWENLHVHIASYNNFPTaaglas  529
            G+E   +  R   C+ E + R        +G  I  +   N  +HIAS NNFPTAAGLAS
Sbjct  63   GREEDFTNPRLMACVNESKYRQHSNIKSMQGNAIIIEKAANWKIHIASENNFPTAAGLAS  122

Query  530  saagfaCLVFALGKLMNV  583
            SAAG+ACLV+AL +LM +
Sbjct  123  SAAGYACLVYALSRLMGI  140



>ref|XP_010877776.1| PREDICTED: diphosphomevalonate decarboxylase [Esox lucius]
Length=402

 Score =   125 bits (314),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 80/139 (58%), Positives = 96/139 (69%), Gaps = 4/139 (3%)
 Frame = +2

Query  170  MVTAQTPTNIAVIKYWGKRDETLILPINDSISVTLDPAHLCTTTTVAVSPAFDQDRMWLN  349
            MVT   P NIAVIKYWGKRDE  ILPIN S+SVTL    L TTTTVA S +F +DR+WLN
Sbjct  11   MVTCNAPVNIAVIKYWGKRDEECILPINSSLSVTLHQDQLKTTTTVACSRSFQEDRIWLN  70

Query  350  GKEMSLSGVRYQNCLKEIRARACDVE-DEKKGIKITKKDWENLHVHIASYNNFPTaagla  526
            GKE  ++  R Q+CL+EIR  A     D + G+ +     +   VHI S NNFPTAAGLA
Sbjct  71   GKEEDINQPRLQSCLREIRRLARKRRSDGEGGVDLAGLSHK---VHICSVNNFPTAAGLA  127

Query  527  ssaagfaCLVFALGKLMNV  583
            SSAAG+ACLV+ L ++M V
Sbjct  128  SSAAGYACLVYTLARVMGV  146



>ref|XP_007244091.1| PREDICTED: diphosphomevalonate decarboxylase [Astyanax mexicanus]
Length=404

 Score =   125 bits (314),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 81/155 (52%), Positives = 103/155 (66%), Gaps = 11/155 (7%)
 Frame = +2

Query  131  FPFPGTMAEKWVLMVTAQTPTNIAVIKYWGKRDETLILPINDSISVTLDPAHLCTTTTVA  310
             P   + + + + ++T   P NIAVIKYWGKRDE LILPIN S+SVTL    L TTTTVA
Sbjct  1    MPENSSSSSQRLTVITCTAPVNIAVIKYWGKRDEELILPINSSLSVTLHQDQLKTTTTVA  60

Query  311  VSPAFDQDRMWLNGKEMSLSGVRYQNCLKEI----RARACDVEDEKKGIKITKKDWENLH  478
             S +F +DR+WLNGKE  ++  R Q+CL+EI    R R  D +D    I ++ +      
Sbjct  61   CSRSFQEDRIWLNGKEEDINQPRLQSCLREIRRLARKRRSD-DDPSNDISLSHR------  113

Query  479  VHIASYNNFPTaaglassaagfaCLVFALGKLMNV  583
            VHI S NNFPTAAGLASSAAG+ACLV++L +L  V
Sbjct  114  VHICSVNNFPTAAGLASSAAGYACLVYSLSRLFGV  148



>ref|XP_002913420.1| PREDICTED: LOW QUALITY PROTEIN: diphosphomevalonate decarboxylase 
[Ailuropoda melanoleuca]
Length=400

 Score =   125 bits (313),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 79/146 (54%), Positives = 99/146 (68%), Gaps = 6/146 (4%)
 Frame = +2

Query  152  AEKWVLMVTAQTPTNIAVIKYWGKRDETLILPINDSISVTLDPAHLCTTTTVAVSPAFDQ  331
            +EK ++ VT   P NIAVIKYWGKRDE L+LPIN S+SVTL    L TTTT A+S  F +
Sbjct  3    SEKSLVAVTCTAPVNIAVIKYWGKRDEDLVLPINSSLSVTLHQDQLKTTTTAAISKDFTE  62

Query  332  DRMWLNGKEMSLSGVRYQNCLKEIR--ARACDVEDEKKGIKITKKDWENLHVHIASYNNF  505
            DR+WLNG+E  +   R Q CL+EIR  AR      E+  + ++     +  VHIAS NNF
Sbjct  63   DRIWLNGREEDVGQPRLQACLREIRRLARKRSSAGEEXPLPLSL----SYKVHIASVNNF  118

Query  506  PTaaglassaagfaCLVFALGKLMNV  583
            PTAAGLASSAAG+ACL +AL ++  V
Sbjct  119  PTAAGLASSAAGYACLAYALARVYGV  144



>ref|XP_003702160.1| PREDICTED: diphosphomevalonate decarboxylase-like [Megachile 
rotundata]
Length=387

 Score =   125 bits (313),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 81/137 (59%), Positives = 89/137 (65%), Gaps = 11/137 (8%)
 Frame = +2

Query  173  VTAQTPTNIAVIKYWGKRDETLILPINDSISVTLDPAHLCTTTTVAVSPAFDQDRMWLNG  352
            VT   P NIAVIKYWGKRD+ LILP+NDSIS TLD   LC  TTV +SP F  D +WLNG
Sbjct  4    VTCIAPINIAVIKYWGKRDDKLILPLNDSISATLDTEQLCAKTTVMISPNFKNDCIWLNG  63

Query  353  KEMSLSGVRYQNCLKEIRARACDVEDEKKGIKITKKDWENLHVHIASYNNFPTaaglass  532
            KE  +   R QNCL EIR RA        G       W+   +HI S NNFPTAAGLASS
Sbjct  64   KEEDIKNPRLQNCLTEIRKRA--------GHSKHLNQWK---IHICSENNFPTAAGLASS  112

Query  533  aagfaCLVFALGKLMNV  583
            AAG+ACLV AL KL  V
Sbjct  113  AAGYACLVTALAKLYEV  129



>ref|XP_006734134.1| PREDICTED: diphosphomevalonate decarboxylase [Leptonychotes weddellii]
Length=400

 Score =   125 bits (313),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 80/146 (55%), Positives = 99/146 (68%), Gaps = 6/146 (4%)
 Frame = +2

Query  152  AEKWVLMVTAQTPTNIAVIKYWGKRDETLILPINDSISVTLDPAHLCTTTTVAVSPAFDQ  331
            +EK ++ VT   P NIAVIKYWGKRDE LILPIN S+SVTL    L TTTT A+S  F +
Sbjct  3    SEKPLVAVTCTAPVNIAVIKYWGKRDEDLILPINSSLSVTLHQDQLKTTTTAAISKDFTE  62

Query  332  DRMWLNGKEMSLSGVRYQNCLKEIR--ARACDVEDEKKGIKITKKDWENLHVHIASYNNF  505
            DR+WLNG+E  +   R Q CL+EIR  AR      ++  + ++     +  VHIAS NNF
Sbjct  63   DRIWLNGREEDVGQPRLQACLREIRRLARKRRSAGDEDPLPLSL----SYKVHIASVNNF  118

Query  506  PTaaglassaagfaCLVFALGKLMNV  583
            PTAAGLASSAAG+ACL +AL +L  V
Sbjct  119  PTAAGLASSAAGYACLAYALARLYGV  144



>ref|NP_001007423.1| diphosphomevalonate decarboxylase [Danio rerio]
 sp|Q5U403.1|MVD1_DANRE RecName: Full=Diphosphomevalonate decarboxylase; AltName: Full=Mevalonate 
(diphospho)decarboxylase; Short=MDDase; AltName: 
Full=Mevalonate pyrophosphate decarboxylase [Danio rerio]
 gb|AAH85325.1| Zgc:100824 [Danio rerio]
Length=400

 Score =   125 bits (313),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 82/138 (59%), Positives = 94/138 (68%), Gaps = 5/138 (4%)
 Frame = +2

Query  170  MVTAQTPTNIAVIKYWGKRDETLILPINDSISVTLDPAHLCTTTTVAVSPAFDQDRMWLN  349
            MVT   P NIAVIKYWGKRDE LILP+N S+SVTL   HL TTTT+A S +F +D +WLN
Sbjct  11   MVTCTAPVNIAVIKYWGKRDEDLILPVNASLSVTLHQDHLRTTTTIACSRSFHKDCIWLN  70

Query  350  GKEMSLSGVRYQNCLKEIRARACDVEDEKKGIKITKKDWENLHVHIASYNNFPTaaglas  529
            GKE  +S  R Q+CL EIR  A      +K       D  N  VHI S NNFPTAAGLAS
Sbjct  71   GKEQDISHPRLQSCLLEIRRLA----QRRKNTGDPASDVSN-KVHICSVNNFPTAAGLAS  125

Query  530  saagfaCLVFALGKLMNV  583
            SAAG+ACLV+ L +L NV
Sbjct  126  SAAGYACLVYTLSQLFNV  143



>ref|XP_004280113.1| PREDICTED: diphosphomevalonate decarboxylase [Orcinus orca]
Length=400

 Score =   124 bits (312),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 79/148 (53%), Positives = 99/148 (67%), Gaps = 10/148 (7%)
 Frame = +2

Query  152  AEKWVLMVTAQTPTNIAVIKYWGKRDETLILPINDSISVTLDPAHLCTTTTVAVSPAFDQ  331
            +EK + +VT   P NIAVIKYWGKRDE LILPIN S+SVTL    L TTTT A+S  F +
Sbjct  3    SEKRLEVVTCTAPVNIAVIKYWGKRDEELILPINSSLSVTLHQDQLKTTTTAAISRDFTE  62

Query  332  DRMWLNGKEMSLSGVRYQNCLKEI----RARACDVEDEKKGIKITKKDWENLHVHIASYN  499
            DR+WLNG+E  +   R Q CL+EI    R R  D  ++   + ++ K      VH+AS N
Sbjct  63   DRIWLNGREEDVGQPRLQACLREIRRLARKRRSDGHEDPLPLSLSYK------VHVASVN  116

Query  500  NFPTaaglassaagfaCLVFALGKLMNV  583
            NFPTAAGLASSAAG+ACL +AL ++  V
Sbjct  117  NFPTAAGLASSAAGYACLAYALARVYGV  144



>ref|XP_010739786.1| PREDICTED: diphosphomevalonate decarboxylase [Larimichthys crocea]
Length=397

 Score =   124 bits (312),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 81/140 (58%), Positives = 96/140 (69%), Gaps = 6/140 (4%)
 Frame = +2

Query  170  MVTAQTPTNIAVIKYWGKRDETLILPINDSISVTLDPAHLCTTTTVAVSPAFDQDRMWLN  349
            +VT   P NIAVIKYWGKRDE LILPIN S+SVTL    L TTTTVA S +F +DR+WLN
Sbjct  6    IVTCTAPVNIAVIKYWGKRDEELILPINSSLSVTLHQEQLKTTTTVATSRSFQEDRIWLN  65

Query  350  GKEMSLSGVRYQNCLKEIRARACDVEDEKKGIKITKKDWENL--HVHIASYNNFPTaagl  523
            GKE  ++  R Q+CL+EIR  A     +++G      D   L   VHI S NNFPTAAGL
Sbjct  66   GKEEDITHPRLQSCLREIRRLA----RKRRGDGDPSVDSTGLSHKVHICSVNNFPTAAGL  121

Query  524  assaagfaCLVFALGKLMNV  583
            ASSAAGFACLV+ L ++  V
Sbjct  122  ASSAAGFACLVYTLARVFGV  141



>ref|XP_007468497.1| PREDICTED: diphosphomevalonate decarboxylase [Lipotes vexillifer]
Length=400

 Score =   124 bits (311),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 77/148 (52%), Positives = 98/148 (66%), Gaps = 10/148 (7%)
 Frame = +2

Query  152  AEKWVLMVTAQTPTNIAVIKYWGKRDETLILPINDSISVTLDPAHLCTTTTVAVSPAFDQ  331
            +EK + +VT   P NIAVIKYWGKRDE LILPIN S+SVTL    L TTTT A++  F +
Sbjct  3    SEKRLEVVTCTAPVNIAVIKYWGKRDEELILPINSSLSVTLHQDQLKTTTTAAINRDFTE  62

Query  332  DRMWLNGKEMSLSGVRYQNCLKEI----RARACDVEDEKKGIKITKKDWENLHVHIASYN  499
            DR+WLNG+E  +   R Q CL+EI    R R  D  ++   + ++ K      VH+AS N
Sbjct  63   DRIWLNGREEDVGQPRLQACLREIRRLARKRRSDGHEDPLPLSLSYK------VHVASVN  116

Query  500  NFPTaaglassaagfaCLVFALGKLMNV  583
            NFPT AGLASSAAG+ACL +AL ++  V
Sbjct  117  NFPTGAGLASSAAGYACLAYALAQVYGV  144



>gb|ELR58766.1| Diphosphomevalonate decarboxylase, partial [Bos mutus]
Length=411

 Score =   124 bits (312),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 77/148 (52%), Positives = 99/148 (67%), Gaps = 10/148 (7%)
 Frame = +2

Query  152  AEKWVLMVTAQTPTNIAVIKYWGKRDETLILPINDSISVTLDPAHLCTTTTVAVSPAFDQ  331
            +EK +++VT   P NIAV+KYWGKRDE LILPIN S+SVTL    L TTTT A+S  F +
Sbjct  5    SEKPIVVVTCTAPVNIAVVKYWGKRDEELILPINSSLSVTLHQDQLKTTTTAAISRDFTE  64

Query  332  DRMWLNGKEMSLSGVRYQNCLKEI----RARACDVEDEKKGIKITKKDWENLHVHIASYN  499
            DR+WLNG+E  +   R Q CL+EI    R R  D  ++   + ++ K      VH+AS N
Sbjct  65   DRIWLNGREEDMGHPRLQACLREIRRLARKRRSDGHEDPLPLSLSYK------VHVASEN  118

Query  500  NFPTaaglassaagfaCLVFALGKLMNV  583
            NFPTAAGLASSAAG+ACL + L ++  V
Sbjct  119  NFPTAAGLASSAAGYACLAYTLARVYGV  146



>ref|XP_010842266.1| PREDICTED: diphosphomevalonate decarboxylase [Bison bison bison]
Length=400

 Score =   124 bits (311),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 77/148 (52%), Positives = 99/148 (67%), Gaps = 10/148 (7%)
 Frame = +2

Query  152  AEKWVLMVTAQTPTNIAVIKYWGKRDETLILPINDSISVTLDPAHLCTTTTVAVSPAFDQ  331
            +EK +++VT   P NIAV+KYWGKRDE LILPIN S+SVTL    L TTTT A+S  F +
Sbjct  3    SEKPIVVVTCTAPVNIAVVKYWGKRDEELILPINSSLSVTLHQDQLKTTTTAAISRDFTE  62

Query  332  DRMWLNGKEMSLSGVRYQNCLKEI----RARACDVEDEKKGIKITKKDWENLHVHIASYN  499
            DR+WLNG+E  +   R Q CL+EI    R R  D  ++   + ++ K      VH+AS N
Sbjct  63   DRIWLNGREEDMGHPRLQACLREIRRLARKRRSDGHEDPLPLSLSYK------VHVASEN  116

Query  500  NFPTaaglassaagfaCLVFALGKLMNV  583
            NFPTAAGLASSAAG+ACL + L ++  V
Sbjct  117  NFPTAAGLASSAAGYACLAYTLARVYGV  144



>ref|XP_005892469.1| PREDICTED: diphosphomevalonate decarboxylase [Bos mutus]
Length=400

 Score =   124 bits (311),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 77/148 (52%), Positives = 99/148 (67%), Gaps = 10/148 (7%)
 Frame = +2

Query  152  AEKWVLMVTAQTPTNIAVIKYWGKRDETLILPINDSISVTLDPAHLCTTTTVAVSPAFDQ  331
            +EK +++VT   P NIAV+KYWGKRDE LILPIN S+SVTL    L TTTT A+S  F +
Sbjct  3    SEKPIVVVTCTAPVNIAVVKYWGKRDEELILPINSSLSVTLHQDQLKTTTTAAISRDFTE  62

Query  332  DRMWLNGKEMSLSGVRYQNCLKEI----RARACDVEDEKKGIKITKKDWENLHVHIASYN  499
            DR+WLNG+E  +   R Q CL+EI    R R  D  ++   + ++ K      VH+AS N
Sbjct  63   DRIWLNGREEDMGHPRLQACLREIRRLARKRRSDGHEDPLPLSLSYK------VHVASEN  116

Query  500  NFPTaaglassaagfaCLVFALGKLMNV  583
            NFPTAAGLASSAAG+ACL + L ++  V
Sbjct  117  NFPTAAGLASSAAGYACLAYTLARVYGV  144



>ref|XP_004437181.1| PREDICTED: diphosphomevalonate decarboxylase [Ceratotherium simum 
simum]
Length=400

 Score =   124 bits (311),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 78/148 (53%), Positives = 99/148 (67%), Gaps = 10/148 (7%)
 Frame = +2

Query  152  AEKWVLMVTAQTPTNIAVIKYWGKRDETLILPINDSISVTLDPAHLCTTTTVAVSPAFDQ  331
            +EK ++ VT   P NIAVIKYWGKRDE LILPIN S+SVTL    L TTTT A+S  F +
Sbjct  3    SEKPIVAVTCTAPVNIAVIKYWGKRDEELILPINSSLSVTLHQDQLKTTTTAAISKDFAE  62

Query  332  DRMWLNGKEMSLSGVRYQNCLKEI----RARACDVEDEKKGIKITKKDWENLHVHIASYN  499
            DR+WLNG+E  +   R Q CL+EI    R R    +++   + ++ K      VH+AS N
Sbjct  63   DRIWLNGQEEDVGQPRLQACLREIRRLARKRRSSGDEDPLPLSVSYK------VHVASVN  116

Query  500  NFPTaaglassaagfaCLVFALGKLMNV  583
            NFPTAAGLASSAAG+ACL +AL ++  V
Sbjct  117  NFPTAAGLASSAAGYACLAYALARVYGV  144



>gb|KIY47272.1| Diphosphomevalonate decarboxylase [Fistulina hepatica ATCC 64428]
Length=406

 Score =   124 bits (311),  Expect = 5e-30, Method: Compositional matrix adjust.
 Identities = 79/139 (57%), Positives = 94/139 (68%), Gaps = 6/139 (4%)
 Frame = +2

Query  164  VLMVTAQTPTNIAVIKYWGKRDETLILPINDSISVTLDPAHLCTTTTVAVSPAFDQDRMW  343
            +   TA  P NIAVIKYWGKRD  LILP N S+SVTLD  HL +TTT    P+F++DR+W
Sbjct  4    IFQATASAPVNIAVIKYWGKRDTKLILPTNSSLSVTLDQDHLKSTTTSRADPSFEKDRLW  63

Query  344  LNGKEMSL-SGVRYQNCLKEI-RARACDVEDEKKGIKITKKDWENLHVHIASYNNFPTaa  517
            LNGKE  + +G R   C+KE+ R R  +VED+        K      VHI+SYNNFPTAA
Sbjct  64   LNGKEEEIKAGGRTATCIKEMKRLRKVEVEDKDPSAPTISK----YPVHISSYNNFPTAA  119

Query  518  glassaagfaCLVFALGKL  574
            GLASSAAGFA LV +LG L
Sbjct  120  GLASSAAGFAALVSSLGAL  138



>ref|XP_002592260.1| hypothetical protein BRAFLDRAFT_277163 [Branchiostoma floridae]
 gb|EEN48271.1| hypothetical protein BRAFLDRAFT_277163 [Branchiostoma floridae]
Length=409

 Score =   124 bits (311),  Expect = 5e-30, Method: Compositional matrix adjust.
 Identities = 80/142 (56%), Positives = 94/142 (66%), Gaps = 8/142 (6%)
 Frame = +2

Query  164  VLMVTAQTPTNIAVIKYWGKRDETLILPINDSISVTLDPAHLCTTTTVAVSPAFDQDRMW  343
            +  VT   P NIAVIKYWGKRDE L+LPIN S+SVTL    LC  TTVA S  F +DR+W
Sbjct  14   ISQVTCTAPVNIAVIKYWGKRDEQLVLPINPSLSVTLSQDQLCARTTVAASADFKRDRVW  73

Query  344  LNGKEMSLSGVRYQNCLKEIR--ARACDVEDEKKGIKITKKDWENLHVHIASYNNFPTaa  517
            LNG+E S+   R Q CL EIR  AR    +DE+ G      D     VH+ S NNFPTAA
Sbjct  74   LNGQEQSVDAPRLQKCLGEIRRLARKRKHKDERAG------DLLGSCVHVCSENNFPTAA  127

Query  518  glassaagfaCLVFALGKLMNV  583
            GLASSAAG+ACLV +L KL ++
Sbjct  128  GLASSAAGYACLVQSLAKLFHI  149



>ref|XP_007125573.1| PREDICTED: diphosphomevalonate decarboxylase isoform X2 [Physeter 
catodon]
Length=400

 Score =   124 bits (311),  Expect = 5e-30, Method: Compositional matrix adjust.
 Identities = 79/148 (53%), Positives = 98/148 (66%), Gaps = 10/148 (7%)
 Frame = +2

Query  152  AEKWVLMVTAQTPTNIAVIKYWGKRDETLILPINDSISVTLDPAHLCTTTTVAVSPAFDQ  331
            +EK + +VT   P NIAVIKYWGKRDE LILPIN S+SVTL    L TTTT A+S  F +
Sbjct  3    SEKRLEVVTCTAPVNIAVIKYWGKRDEELILPINSSLSVTLHQDQLKTTTTAAISRDFTE  62

Query  332  DRMWLNGKEMSLSGVRYQNCLKEI----RARACDVEDEKKGIKITKKDWENLHVHIASYN  499
            DR+WLNG+E      R Q CL+EI    R R  D  ++   + ++ K      VH+AS N
Sbjct  63   DRIWLNGREEDAGQPRLQACLREIRRLARKRRSDGHEDPLPLSLSYK------VHVASVN  116

Query  500  NFPTaaglassaagfaCLVFALGKLMNV  583
            NFPTAAGLASSAAG+ACL +AL ++  V
Sbjct  117  NFPTAAGLASSAAGYACLAYALARVYGV  144



>ref|NP_001068892.1| diphosphomevalonate decarboxylase [Bos taurus]
 sp|Q0P570.1|MVD1_BOVIN RecName: Full=Diphosphomevalonate decarboxylase; AltName: Full=Mevalonate 
(diphospho)decarboxylase; Short=MDDase; AltName: 
Full=Mevalonate pyrophosphate decarboxylase [Bos taurus]
 gb|AAI20433.1| Mevalonate (diphospho) decarboxylase [Bos taurus]
 tpg|DAA20052.1| TPA: diphosphomevalonate decarboxylase [Bos taurus]
Length=400

 Score =   124 bits (311),  Expect = 5e-30, Method: Compositional matrix adjust.
 Identities = 77/148 (52%), Positives = 99/148 (67%), Gaps = 10/148 (7%)
 Frame = +2

Query  152  AEKWVLMVTAQTPTNIAVIKYWGKRDETLILPINDSISVTLDPAHLCTTTTVAVSPAFDQ  331
            +EK +++VT   P NIAV+KYWGKRDE LILPIN S+SVTL    L TTTT A+S  F +
Sbjct  3    SEKPIVVVTCTAPVNIAVVKYWGKRDEELILPINSSLSVTLHQDQLKTTTTAAISRDFTE  62

Query  332  DRMWLNGKEMSLSGVRYQNCLKEI----RARACDVEDEKKGIKITKKDWENLHVHIASYN  499
            DR+WLNG+E  +   R Q CL+EI    R R  D  ++   + ++ K      VH+AS N
Sbjct  63   DRIWLNGREEDMGHPRLQACLREIRRLARKRRSDGHEDPLPLSLSYK------VHVASEN  116

Query  500  NFPTaaglassaagfaCLVFALGKLMNV  583
            NFPTAAGLASSAAG+ACL + L ++  V
Sbjct  117  NFPTAAGLASSAAGYACLAYTLARVYGV  144



>ref|XP_007172621.1| PREDICTED: diphosphomevalonate decarboxylase [Balaenoptera acutorostrata 
scammoni]
Length=400

 Score =   124 bits (311),  Expect = 5e-30, Method: Compositional matrix adjust.
 Identities = 79/148 (53%), Positives = 98/148 (66%), Gaps = 10/148 (7%)
 Frame = +2

Query  152  AEKWVLMVTAQTPTNIAVIKYWGKRDETLILPINDSISVTLDPAHLCTTTTVAVSPAFDQ  331
            +E+ V +VT   P NIAVIKYWGKRDE LILPIN S+SVTL    L TTTT A+S  F +
Sbjct  3    SEEPVEVVTCTAPVNIAVIKYWGKRDEELILPINSSLSVTLHQDQLKTTTTAAISRDFTE  62

Query  332  DRMWLNGKEMSLSGVRYQNCLKEI----RARACDVEDEKKGIKITKKDWENLHVHIASYN  499
            DR+WLNG+E  +   R Q CL+EI    R R  D  +E   + ++ K      VH+AS N
Sbjct  63   DRIWLNGREEDVGQPRLQACLREIRRLARKRRSDGHEEPLPLSLSYK------VHVASVN  116

Query  500  NFPTaaglassaagfaCLVFALGKLMNV  583
            NFPTAAGLASSAAG+ACL + L ++  V
Sbjct  117  NFPTAAGLASSAAGYACLAYTLARVYGV  144



>dbj|BAE42019.1| unnamed protein product [Mus musculus]
Length=401

 Score =   124 bits (310),  Expect = 5e-30, Method: Compositional matrix adjust.
 Identities = 78/139 (56%), Positives = 93/139 (67%), Gaps = 2/139 (1%)
 Frame = +2

Query  167  LMVTAQTPTNIAVIKYWGKRDETLILPINDSISVTLDPAHLCTTTTVAVSPAFDQDRMWL  346
            LMVT   P NIAVIKYWGKRDE LILPIN S+SVTL    L TTTTVA+S  F +DR+WL
Sbjct  9    LMVTCTAPVNIAVIKYWGKRDEALILPINSSLSVTLHQDQLKTTTTVAISKDFTEDRIWL  68

Query  347  NGKEMSLSGVRYQNCLKEIRARACDVEDEKKGIKITKKDWENLHVHIASYNNFPTaagla  526
            NG+E  +   R Q CL+EIR  A      + G  +      +  VH+AS NNFPTAAGLA
Sbjct  69   NGREEDVGQPRLQACLREIRRLARKRRSTEDGDTLPLS--LSYKVHVASVNNFPTAAGLA  126

Query  527  ssaagfaCLVFALGKLMNV  583
            SSAAG+ACL + L ++  V
Sbjct  127  SSAAGYACLAYTLAQVYGV  145



>ref|NP_619597.2| diphosphomevalonate decarboxylase [Mus musculus]
 sp|Q99JF5.2|MVD1_MOUSE RecName: Full=Diphosphomevalonate decarboxylase; AltName: Full=Mevalonate 
(diphospho)decarboxylase; Short=MDDase; AltName: 
Full=Mevalonate pyrophosphate decarboxylase [Mus musculus]
 dbj|BAE22291.1| unnamed protein product [Mus musculus]
 gb|EDL11681.1| mevalonate (diphospho) decarboxylase [Mus musculus]
Length=401

 Score =   124 bits (310),  Expect = 6e-30, Method: Compositional matrix adjust.
 Identities = 78/139 (56%), Positives = 93/139 (67%), Gaps = 2/139 (1%)
 Frame = +2

Query  167  LMVTAQTPTNIAVIKYWGKRDETLILPINDSISVTLDPAHLCTTTTVAVSPAFDQDRMWL  346
            LMVT   P NIAVIKYWGKRDE LILPIN S+SVTL    L TTTTVA+S  F +DR+WL
Sbjct  9    LMVTCTAPVNIAVIKYWGKRDEALILPINSSLSVTLHQDQLKTTTTVAISKDFTEDRIWL  68

Query  347  NGKEMSLSGVRYQNCLKEIRARACDVEDEKKGIKITKKDWENLHVHIASYNNFPTaagla  526
            NG+E  +   R Q CL+EIR  A      + G  +      +  VH+AS NNFPTAAGLA
Sbjct  69   NGREEDVGQPRLQACLREIRRLARKRRSTEDGDTLPLS--LSYKVHVASVNNFPTAAGLA  126

Query  527  ssaagfaCLVFALGKLMNV  583
            SSAAG+ACL + L ++  V
Sbjct  127  SSAAGYACLAYTLAQVYGV  145



>pdb|3F0N|A Chain A, Mus Musculus Mevalonate Pyrophosphate Decarboxylase
 pdb|3F0N|B Chain B, Mus Musculus Mevalonate Pyrophosphate Decarboxylase
Length=414

 Score =   124 bits (310),  Expect = 6e-30, Method: Compositional matrix adjust.
 Identities = 78/139 (56%), Positives = 93/139 (67%), Gaps = 2/139 (1%)
 Frame = +2

Query  167  LMVTAQTPTNIAVIKYWGKRDETLILPINDSISVTLDPAHLCTTTTVAVSPAFDQDRMWL  346
            LMVT   P NIAVIKYWGKRDE LILPIN S+SVTL    L TTTTVA+S  F +DR+WL
Sbjct  22   LMVTCTAPVNIAVIKYWGKRDEALILPINSSLSVTLHQDQLKTTTTVAISKDFTEDRIWL  81

Query  347  NGKEMSLSGVRYQNCLKEIRARACDVEDEKKGIKITKKDWENLHVHIASYNNFPTaagla  526
            NG+E  +   R Q CL+EIR  A      + G  +      +  VH+AS NNFPTAAGLA
Sbjct  82   NGREEDVGQPRLQACLREIRRLARKRRSTEDGDTLPLS--LSYKVHVASVNNFPTAAGLA  139

Query  527  ssaagfaCLVFALGKLMNV  583
            SSAAG+ACL + L ++  V
Sbjct  140  SSAAGYACLAYTLAQVYGV  158



>ref|XP_004913618.1| PREDICTED: diphosphomevalonate decarboxylase isoform X2 [Xenopus 
(Silurana) tropicalis]
Length=417

 Score =   124 bits (310),  Expect = 6e-30, Method: Compositional matrix adjust.
 Identities = 79/137 (58%), Positives = 95/137 (69%), Gaps = 2/137 (1%)
 Frame = +2

Query  173  VTAQTPTNIAVIKYWGKRDETLILPINDSISVTLDPAHLCTTTTVAVSPAFDQDRMWLNG  352
            VT   P NIAVIKYWGKR+E LILPIN S+SVTL    L TTT+ A S  F +DR+WLNG
Sbjct  27   VTCTAPVNIAVIKYWGKRNEELILPINSSLSVTLHQDQLKTTTSAAASREFTEDRIWLNG  86

Query  353  KEMSLSGVRYQNCLKEIRARACDVEDEKKGIKITKKDWENLHVHIASYNNFPTaaglass  532
            KE ++S  R Q+CL+EIR  A    +E+    +++    N  VHI S NNFPTAAGLASS
Sbjct  87   KEENISHPRLQSCLREIRRLARKRRNEEGDENVSR--ILNDKVHICSVNNFPTAAGLASS  144

Query  533  aagfaCLVFALGKLMNV  583
            AAG+ACLV+ L KL  V
Sbjct  145  AAGYACLVYTLAKLYGV  161



>dbj|BAC40852.1| unnamed protein product [Mus musculus]
 dbj|BAE32901.1| unnamed protein product [Mus musculus]
Length=401

 Score =   124 bits (310),  Expect = 6e-30, Method: Compositional matrix adjust.
 Identities = 78/139 (56%), Positives = 93/139 (67%), Gaps = 2/139 (1%)
 Frame = +2

Query  167  LMVTAQTPTNIAVIKYWGKRDETLILPINDSISVTLDPAHLCTTTTVAVSPAFDQDRMWL  346
            LMVT   P NIAVIKYWGKRDE LILPIN S+SVTL    L TTTTVA+S  F +DR+WL
Sbjct  9    LMVTCTAPVNIAVIKYWGKRDEALILPINSSLSVTLHQDQLKTTTTVAISKDFTEDRIWL  68

Query  347  NGKEMSLSGVRYQNCLKEIRARACDVEDEKKGIKITKKDWENLHVHIASYNNFPTaagla  526
            NG+E  +   R Q CL+EIR  A      + G  +      +  VH+AS NNFPTAAGLA
Sbjct  69   NGREEDVGQPRLQACLREIRRLARKRRSTEDGDTLPLS--LSYKVHVASVNNFPTAAGLA  126

Query  527  ssaagfaCLVFALGKLMNV  583
            SSAAG+ACL + L ++  V
Sbjct  127  SSAAGYACLAYTLAQVYGV  145



>ref|XP_011163917.1| PREDICTED: diphosphomevalonate decarboxylase isoform X2 [Solenopsis 
invicta]
Length=381

 Score =   123 bits (309),  Expect = 6e-30, Method: Compositional matrix adjust.
 Identities = 78/137 (57%), Positives = 91/137 (66%), Gaps = 11/137 (8%)
 Frame = +2

Query  173  VTAQTPTNIAVIKYWGKRDETLILPINDSISVTLDPAHLCTTTTVAVSPAFDQDRMWLNG  352
            VT   P NIAVIKYWGKRDE+LILP NDSIS TLD   L   TTV +SP F +D +WLNG
Sbjct  4    VTCIAPVNIAVIKYWGKRDESLILPTNDSISATLDTDQLHAKTTVMISPDFKEDCIWLNG  63

Query  353  KEMSLSGVRYQNCLKEIRARACDVEDEKKGIKITKKDWENLHVHIASYNNFPTaaglass  532
            +E  +  +R QNCLKEIR R+         +     DW+   +HI S NNFPTAAGLASS
Sbjct  64   REEDIKNIRLQNCLKEIRKRS--------QLSDYINDWK---IHICSKNNFPTAAGLASS  112

Query  533  aagfaCLVFALGKLMNV  583
            AAG+ACL  AL KL  +
Sbjct  113  AAGYACLTAALAKLYKI  129



>gb|AAH08526.1| Mevalonate (diphospho) decarboxylase [Mus musculus]
Length=401

 Score =   124 bits (310),  Expect = 7e-30, Method: Compositional matrix adjust.
 Identities = 78/139 (56%), Positives = 93/139 (67%), Gaps = 2/139 (1%)
 Frame = +2

Query  167  LMVTAQTPTNIAVIKYWGKRDETLILPINDSISVTLDPAHLCTTTTVAVSPAFDQDRMWL  346
            LMVT   P NIAVIKYWGKRDE LILPIN S+SVTL    L TTTTVA+S  F +DR+WL
Sbjct  9    LMVTCTAPVNIAVIKYWGKRDEALILPINSSLSVTLHQDQLKTTTTVAISKDFTEDRIWL  68

Query  347  NGKEMSLSGVRYQNCLKEIRARACDVEDEKKGIKITKKDWENLHVHIASYNNFPTaagla  526
            NG+E  +   R Q CL+EIR  A      + G  +      +  VH+AS NNFPTAAGLA
Sbjct  69   NGREEDVGQPRLQACLREIRRLARKRRSTEDGDTLPLS--LSYKVHVASVNNFPTAAGLA  126

Query  527  ssaagfaCLVFALGKLMNV  583
            SSAAG+ACL + L ++  V
Sbjct  127  SSAAGYACLAYTLAQVYGV  145



>emb|CAC35731.1| diphosphomevalonate decarboxylase [Mus musculus]
Length=401

 Score =   124 bits (310),  Expect = 7e-30, Method: Compositional matrix adjust.
 Identities = 78/139 (56%), Positives = 93/139 (67%), Gaps = 2/139 (1%)
 Frame = +2

Query  167  LMVTAQTPTNIAVIKYWGKRDETLILPINDSISVTLDPAHLCTTTTVAVSPAFDQDRMWL  346
            LMVT   P NIAVIKYWGKRDE LILPIN S+SVTL    L TTTTVA+S  F +DR+WL
Sbjct  9    LMVTCTAPVNIAVIKYWGKRDEALILPINSSLSVTLHQDQLKTTTTVAISKDFTEDRIWL  68

Query  347  NGKEMSLSGVRYQNCLKEIRARACDVEDEKKGIKITKKDWENLHVHIASYNNFPTaagla  526
            NG+E  +   R Q CL+EIR  A      + G  +      +  VH+AS NNFPTAAGLA
Sbjct  69   NGREEDVGQPRLQACLREIRRLARKRRSTEDGDTLPLS--LSYKVHVASVNNFPTAAGLA  126

Query  527  ssaagfaCLVFALGKLMNV  583
            SSAAG+ACL + L ++  V
Sbjct  127  SSAAGYACLAYTLAQVYGV  145



>ref|XP_011163916.1| PREDICTED: diphosphomevalonate decarboxylase isoform X1 [Solenopsis 
invicta]
Length=387

 Score =   123 bits (309),  Expect = 7e-30, Method: Compositional matrix adjust.
 Identities = 78/137 (57%), Positives = 91/137 (66%), Gaps = 11/137 (8%)
 Frame = +2

Query  173  VTAQTPTNIAVIKYWGKRDETLILPINDSISVTLDPAHLCTTTTVAVSPAFDQDRMWLNG  352
            VT   P NIAVIKYWGKRDE+LILP NDSIS TLD   L   TTV +SP F +D +WLNG
Sbjct  4    VTCIAPVNIAVIKYWGKRDESLILPTNDSISATLDTDQLHAKTTVMISPDFKEDCIWLNG  63

Query  353  KEMSLSGVRYQNCLKEIRARACDVEDEKKGIKITKKDWENLHVHIASYNNFPTaaglass  532
            +E  +  +R QNCLKEIR R+         +     DW+   +HI S NNFPTAAGLASS
Sbjct  64   REEDIKNIRLQNCLKEIRKRS--------QLSDYINDWK---IHICSKNNFPTAAGLASS  112

Query  533  aagfaCLVFALGKLMNV  583
            AAG+ACL  AL KL  +
Sbjct  113  AAGYACLTAALAKLYKI  129



>ref|XP_002942038.1| PREDICTED: diphosphomevalonate decarboxylase isoform X1 [Xenopus 
(Silurana) tropicalis]
 ref|XP_004913619.1| PREDICTED: diphosphomevalonate decarboxylase isoform X3 [Xenopus 
(Silurana) tropicalis]
 ref|XP_004913620.1| PREDICTED: diphosphomevalonate decarboxylase isoform X4 [Xenopus 
(Silurana) tropicalis]
 ref|XP_004913621.1| PREDICTED: diphosphomevalonate decarboxylase isoform X5 [Xenopus 
(Silurana) tropicalis]
 ref|XP_004913622.1| PREDICTED: diphosphomevalonate decarboxylase isoform X6 [Xenopus 
(Silurana) tropicalis]
Length=394

 Score =   123 bits (309),  Expect = 7e-30, Method: Compositional matrix adjust.
 Identities = 79/137 (58%), Positives = 95/137 (69%), Gaps = 2/137 (1%)
 Frame = +2

Query  173  VTAQTPTNIAVIKYWGKRDETLILPINDSISVTLDPAHLCTTTTVAVSPAFDQDRMWLNG  352
            VT   P NIAVIKYWGKR+E LILPIN S+SVTL    L TTT+ A S  F +DR+WLNG
Sbjct  4    VTCTAPVNIAVIKYWGKRNEELILPINSSLSVTLHQDQLKTTTSAAASREFTEDRIWLNG  63

Query  353  KEMSLSGVRYQNCLKEIRARACDVEDEKKGIKITKKDWENLHVHIASYNNFPTaaglass  532
            KE ++S  R Q+CL+EIR  A    +E+    +++    N  VHI S NNFPTAAGLASS
Sbjct  64   KEENISHPRLQSCLREIRRLARKRRNEEGDENVSR--ILNDKVHICSVNNFPTAAGLASS  121

Query  533  aagfaCLVFALGKLMNV  583
            AAG+ACLV+ L KL  V
Sbjct  122  AAGYACLVYTLAKLYGV  138



>ref|XP_005805001.1| PREDICTED: diphosphomevalonate decarboxylase-like [Xiphophorus 
maculatus]
Length=403

 Score =   123 bits (309),  Expect = 8e-30, Method: Compositional matrix adjust.
 Identities = 79/138 (57%), Positives = 95/138 (69%), Gaps = 1/138 (1%)
 Frame = +2

Query  170  MVTAQTPTNIAVIKYWGKRDETLILPINDSISVTLDPAHLCTTTTVAVSPAFDQDRMWLN  349
            +VT   P NIAVIKYWGKRDE LILPIN S+SVTL    L TTTTVA+S +F +DR+WLN
Sbjct  11   IVTCTAPVNIAVIKYWGKRDEDLILPINSSMSVTLHQDQLKTTTTVAISRSFQEDRLWLN  70

Query  350  GKEMSLSGVRYQNCLKEIRARACDVEDEKKGIKITKKDWENLHVHIASYNNFPTaaglas  529
            GKE  ++  R Q+CL+EIR  A    ++    + T     +  VHI S NNFPTAAGLAS
Sbjct  71   GKEEDITHQRLQSCLREIRRLARKRRNDGDA-RATDSVGLSHKVHICSVNNFPTAAGLAS  129

Query  530  saagfaCLVFALGKLMNV  583
            SAAGFACLV+ L +   V
Sbjct  130  SAAGFACLVYTLAQAFGV  147



>ref|XP_005531982.1| PREDICTED: diphosphomevalonate decarboxylase [Pseudopodoces humilis]
Length=399

 Score =   123 bits (309),  Expect = 8e-30, Method: Compositional matrix adjust.
 Identities = 79/144 (55%), Positives = 94/144 (65%), Gaps = 3/144 (2%)
 Frame = +2

Query  152  AEKWVLMVTAQTPTNIAVIKYWGKRDETLILPINDSISVTLDPAHLCTTTTVAVSPAFDQ  331
            AE+ + M T   P NIAVIKYWGKRD  LILPIN S+SVTL    L TTTT A S  F +
Sbjct  3    AERGLAMATCTAPVNIAVIKYWGKRDTDLILPINSSLSVTLHQDQLKTTTTAAASRDFTE  62

Query  332  DRMWLNGKEMSLSGVRYQNCLKEIRARACDVEDEKKGIKITKKDWENLHVHIASYNNFPT  511
            DR+WLNGKE  +   R Q CL+E+R  A      + G + T     +  +HIAS NNFPT
Sbjct  63   DRLWLNGKEADVGHPRVQACLREVRRLA---RKRRGGCEDTATLSLSYKIHIASENNFPT  119

Query  512  aaglassaagfaCLVFALGKLMNV  583
            AAGLASSAAG+ACLV AL +L  +
Sbjct  120  AAGLASSAAGYACLVSALARLYGL  143



>ref|XP_005769632.1| mevalonate-5-diphosphate decarboxylase [Emiliania huxleyi CCMP1516]
 gb|EOD17203.1| mevalonate-5-diphosphate decarboxylase [Emiliania huxleyi CCMP1516]
Length=439

 Score =   124 bits (310),  Expect = 8e-30, Method: Compositional matrix adjust.
 Identities = 76/145 (52%), Positives = 100/145 (69%), Gaps = 2/145 (1%)
 Frame = +2

Query  155  EKWVLMVTAQTPTNIAVIKYWGKRDETLILPINDSISVTLDPAHLCTTTTVAVSPAFDQD  334
            ++ V  +T  +PTNIA+IKYWGKRD  + LPIN S+SVTL+   L T TTV+ S +F +D
Sbjct  2    QQPVFSLTISSPTNIALIKYWGKRDAKINLPINSSVSVTLNQRDLRTVTTVSASRSFSRD  61

Query  335  RMWLNGKEMSLSGV-RYQNCLKEIRARACDVEDEKKGIKITKKD-WENLHVHIASYNNFP  508
            R+WLNG+E  ++   R     +E+RARA D+ D K G  + +KD W+ L V + S NNFP
Sbjct  62   RLWLNGEEEDVNASRRVLAVFREVRARAGDLRDPKTGQVLVRKDEWDGLRVWVVSENNFP  121

Query  509  TaaglassaagfaCLVFALGKLMNV  583
            TAAGLASSAAG+A L FAL KL  +
Sbjct  122  TAAGLASSAAGYAALTFALSKLYGL  146



>ref|XP_546783.2| PREDICTED: diphosphomevalonate decarboxylase [Canis lupus familiaris]
Length=400

 Score =   123 bits (309),  Expect = 8e-30, Method: Compositional matrix adjust.
 Identities = 80/148 (54%), Positives = 98/148 (66%), Gaps = 10/148 (7%)
 Frame = +2

Query  152  AEKWVLMVTAQTPTNIAVIKYWGKRDETLILPINDSISVTLDPAHLCTTTTVAVSPAFDQ  331
            +EK +L VT   P NIAVIKYWGKRDE L+LPIN S+SVTL    L TTTT AVS  F +
Sbjct  3    SEKPLLAVTCTAPVNIAVIKYWGKRDEDLVLPINSSLSVTLHQDQLKTTTTAAVSKDFTE  62

Query  332  DRMWLNGKEMSLSGVRYQNCLKEI----RARACDVEDEKKGIKITKKDWENLHVHIASYN  499
            DR+WLNG+E  +   R Q CL+EI    R R    +++   + +T K      VHIAS N
Sbjct  63   DRIWLNGREEDVEQPRLQACLREIRRLARKRRSTGDEDPLPLSLTYK------VHIASVN  116

Query  500  NFPTaaglassaagfaCLVFALGKLMNV  583
            NFPTAAGLASSAAG+ACL + L ++  V
Sbjct  117  NFPTAAGLASSAAGYACLAYTLAQVYGV  144



>gb|ACO09861.1| Diphosphomevalonate decarboxylase [Osmerus mordax]
Length=398

 Score =   123 bits (309),  Expect = 8e-30, Method: Compositional matrix adjust.
 Identities = 76/138 (55%), Positives = 96/138 (70%), Gaps = 6/138 (4%)
 Frame = +2

Query  170  MVTAQTPTNIAVIKYWGKRDETLILPINDSISVTLDPAHLCTTTTVAVSPAFDQDRMWLN  349
            MVT   P NIAVIKYWGKRDE LILPIN S+SVTL    L TTTTVA S +F++DR+WLN
Sbjct  11   MVTCSAPVNIAVIKYWGKRDEELILPINSSLSVTLHQDQLRTTTTVACSRSFEEDRIWLN  70

Query  350  GKEMSLSGVRYQNCLKEIRARACDVEDEKKGIKITKKDWENLHVHIASYNNFPTaaglas  529
            G+E  ++  R Q+CL+E+R  A     +     ++ K       HI S NNFPTAAGLAS
Sbjct  71   GREEDITLPRLQSCLREVRRLARKRHSDGDPAGLSHK------FHICSVNNFPTAAGLAS  124

Query  530  saagfaCLVFALGKLMNV  583
            SAAG+ACLV++L +++ V
Sbjct  125  SAAGYACLVYSLARVLGV  142



>gb|KJA27615.1| hypothetical protein HYPSUDRAFT_130498 [Hypholoma sublateritium 
FD-334 SS-4]
Length=411

 Score =   123 bits (309),  Expect = 8e-30, Method: Compositional matrix adjust.
 Identities = 78/144 (54%), Positives = 94/144 (65%), Gaps = 6/144 (4%)
 Frame = +2

Query  149  MAEKWVLMVTAQTPTNIAVIKYWGKRDETLILPINDSISVTLDPAHLCTTTTVAVSPAFD  328
            M+   +   TA  P NIAVIKYWGKRD  LILP N S+SVTLD  HL +TTT    P+F+
Sbjct  1    MSSAPIYEATASAPVNIAVIKYWGKRDTKLILPTNSSLSVTLDQDHLRSTTTSRADPSFE  60

Query  329  QDRMWLNGKEMSL-SGVRYQNCLKEI-RARACDVEDEKKGIKITKKDWENLHVHIASYNN  502
             DR+WLNGKE  + +G R + C+KE+ R R   VED    +  +        VHIASYNN
Sbjct  61   ADRLWLNGKEDQITAGSRLETCIKEMKRLRKETVED----VDASAPKLSTYKVHIASYNN  116

Query  503  FPTaaglassaagfaCLVFALGKL  574
            FPTAAGLASSA+GFA LV +L  L
Sbjct  117  FPTAAGLASSASGFAALVASLAHL  140



>ref|XP_006027907.1| PREDICTED: diphosphomevalonate decarboxylase [Alligator sinensis]
Length=409

 Score =   123 bits (309),  Expect = 9e-30, Method: Compositional matrix adjust.
 Identities = 78/145 (54%), Positives = 96/145 (66%), Gaps = 10/145 (7%)
 Frame = +2

Query  152  AEKWVLMVTAQTPTNIAVIKYWGKRDETLILPINDSISVTLDPAHLCTTTTVAVSPAFDQ  331
             E+    VT   P NIAVIKYWGKRD  LILPIN S+SVTL+   L TTTT A+S  F +
Sbjct  3    GEQGCCRVTCTAPVNIAVIKYWGKRDSELILPINSSLSVTLNQDQLKTTTTAAISRDFKE  62

Query  332  DRMWLNGKEMSLSGVRYQNCLKEI----RARACDVEDEKKGIKITKKDWENLHVHIASYN  499
            DR+WLNG+E  ++  R QNCL+E+    R R    E +   + +T K      +HIAS N
Sbjct  63   DRLWLNGEEADITHPRLQNCLREMRRLARKRRSGSEGDTAPLNLTHK------LHIASVN  116

Query  500  NFPTaaglassaagfaCLVFALGKL  574
            NFPTAAGLASSAAG+ACLV+ L +L
Sbjct  117  NFPTAAGLASSAAGYACLVYTLARL  141



>ref|XP_005956369.1| PREDICTED: diphosphomevalonate decarboxylase [Pantholops hodgsonii]
Length=403

 Score =   123 bits (309),  Expect = 9e-30, Method: Compositional matrix adjust.
 Identities = 77/148 (52%), Positives = 100/148 (68%), Gaps = 10/148 (7%)
 Frame = +2

Query  152  AEKWVLMVTAQTPTNIAVIKYWGKRDETLILPINDSISVTLDPAHLCTTTTVAVSPAFDQ  331
            +EK +++VT   P NIAV+KYWGKRDE LILPIN S+SVTL    L TTTT A+S  F +
Sbjct  3    SEKPIVVVTCTAPVNIAVVKYWGKRDEELILPINSSLSVTLHQDQLKTTTTAAISRDFTE  62

Query  332  DRMWLNGKEMSLSGVRYQNCLKEI----RARACDVEDEKKGIKITKKDWENLHVHIASYN  499
            DR+WLNG+E  +   R Q CL+EI    R R  +  ++   + ++ K      VH+AS N
Sbjct  63   DRIWLNGQEEDVGQPRLQACLREIRRLARKRRSNGHEDPLPLSLSYK------VHVASEN  116

Query  500  NFPTaaglassaagfaCLVFALGKLMNV  583
            NFPTAAGLASSAAG+ACL +AL ++  V
Sbjct  117  NFPTAAGLASSAAGYACLAYALARVYGV  144



>ref|XP_004392172.1| PREDICTED: diphosphomevalonate decarboxylase [Odobenus rosmarus 
divergens]
Length=400

 Score =   123 bits (308),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 79/145 (54%), Positives = 98/145 (68%), Gaps = 6/145 (4%)
 Frame = +2

Query  155  EKWVLMVTAQTPTNIAVIKYWGKRDETLILPINDSISVTLDPAHLCTTTTVAVSPAFDQD  334
            EK ++ VT   P NIAVIKYWGKRDE LILPIN S+SVTL    L TTTT A+S  F +D
Sbjct  4    EKPLVAVTCTAPVNIAVIKYWGKRDEDLILPINSSLSVTLHQDQLKTTTTAAISKDFTED  63

Query  335  RMWLNGKEMSLSGVRYQNCLKEIR--ARACDVEDEKKGIKITKKDWENLHVHIASYNNFP  508
            R+WLNG+E  +   R Q CL+EIR  AR      ++  + ++     +  VHIAS NNFP
Sbjct  64   RIWLNGREEDVGQPRLQACLREIRRLARKRRSAGDEDPLPLSL----SYKVHIASVNNFP  119

Query  509  TaaglassaagfaCLVFALGKLMNV  583
            TAAGLASSAAG+ACL +AL ++  V
Sbjct  120  TAAGLASSAAGYACLAYALARVYGV  144



>ref|XP_006043222.1| PREDICTED: diphosphomevalonate decarboxylase [Bubalus bubalis]
Length=400

 Score =   123 bits (308),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 77/148 (52%), Positives = 98/148 (66%), Gaps = 10/148 (7%)
 Frame = +2

Query  152  AEKWVLMVTAQTPTNIAVIKYWGKRDETLILPINDSISVTLDPAHLCTTTTVAVSPAFDQ  331
            +EK +++VT   P NIAV+KYWGKRDE LILPIN S+SVTL    L TTTT A+S  F +
Sbjct  3    SEKPIVVVTCTAPVNIAVVKYWGKRDEELILPINSSLSVTLHQDQLKTTTTAAISRDFTE  62

Query  332  DRMWLNGKEMSLSGVRYQNCLKEI----RARACDVEDEKKGIKITKKDWENLHVHIASYN  499
            DR+WLNG+E  +   R Q CL EI    R R  D  ++   + ++ K      VH+AS N
Sbjct  63   DRIWLNGREEDMGHPRLQACLTEIRRLARKRRSDGHEDPLPLSLSYK------VHVASEN  116

Query  500  NFPTaaglassaagfaCLVFALGKLMNV  583
            NFPTAAGLASSAAG+ACL + L ++  V
Sbjct  117  NFPTAAGLASSAAGYACLAYTLARVYGV  144



>ref|XP_011370192.1| PREDICTED: diphosphomevalonate decarboxylase [Pteropus vampyrus]
Length=400

 Score =   123 bits (308),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 79/146 (54%), Positives = 99/146 (68%), Gaps = 6/146 (4%)
 Frame = +2

Query  152  AEKWVLMVTAQTPTNIAVIKYWGKRDETLILPINDSISVTLDPAHLCTTTTVAVSPAFDQ  331
            +EK V+ VT   P NIAVIKYWGKRDE LILPIN S+SVTL    L TTTT  +S  F +
Sbjct  3    SEKPVVTVTCTAPVNIAVIKYWGKRDEDLILPINSSLSVTLHQDQLKTTTTAVISKDFTE  62

Query  332  DRMWLNGKEMSLSGVRYQNCLKEIR--ARACDVEDEKKGIKITKKDWENLHVHIASYNNF  505
            D++WLNG+++ +   R Q CL+EIR  AR     D+K  + ++     +  VHIAS NNF
Sbjct  63   DQIWLNGQKVDVGQPRIQACLREIRRLARKRRSADDKDPLPLSL----SYKVHIASVNNF  118

Query  506  PTaaglassaagfaCLVFALGKLMNV  583
            PTAAGLASSAAG+ACL F L ++  V
Sbjct  119  PTAAGLASSAAGYACLAFTLAQVYGV  144



>ref|XP_004362385.1| diphosphomevalonate decarboxylase [Dictyostelium fasciculatum]
 gb|EGG24534.1| diphosphomevalonate decarboxylase [Dictyostelium fasciculatum]
Length=415

 Score =   122 bits (307),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 75/137 (55%), Positives = 91/137 (66%), Gaps = 12/137 (9%)
 Frame = +2

Query  173  VTAQTPTNIAVIKYWGKRDETLILPINDSISVTLDPAHLCTTTTVAVSPAFDQDRMWLNG  352
            VT   P NIA IKYWGKRDE LILP+N S+S TL    L TTTT   S +F++D +WLNG
Sbjct  28   VTCTAPVNIATIKYWGKRDENLILPLNSSLSGTLHQDDLKTTTTAVASESFEEDALWLNG  87

Query  353  KEMSLSGVRYQNCLKEIRARACDVEDEKKGIKITKKDWENLHVHIASYNNFPTaaglass  532
            K+  ++ VRYQN LK IR+RA  + D+K              VHI S NNFPTAAGLASS
Sbjct  88   KKEDVNSVRYQNVLKTIRSRATKLMDKKH------------FVHICSINNFPTAAGLASS  135

Query  533  aagfaCLVFALGKLMNV  583
            A+G+ACLV+ L +L  V
Sbjct  136  ASGYACLVYVLAQLYGV  152



>ref|XP_004666010.1| PREDICTED: diphosphomevalonate decarboxylase [Jaculus jaculus]
Length=400

 Score =   122 bits (307),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 78/144 (54%), Positives = 94/144 (65%), Gaps = 2/144 (1%)
 Frame = +2

Query  152  AEKWVLMVTAQTPTNIAVIKYWGKRDETLILPINDSISVTLDPAHLCTTTTVAVSPAFDQ  331
            +EK  +MVT   P NIAVIKYWGKRDE LILPIN S+SVTL    L TTTT A+S  F +
Sbjct  3    SEKPQVMVTCTAPVNIAVIKYWGKRDEALILPINSSLSVTLHQDQLKTTTTAAISKDFTE  62

Query  332  DRMWLNGKEMSLSGVRYQNCLKEIRARACDVEDEKKGIKITKKDWENLHVHIASYNNFPT  511
            DR+WLNG+E  +   R Q CL+EIR  A        G  +      +  VH+AS NNFPT
Sbjct  63   DRIWLNGREEDVRQPRLQACLREIRRLAQKQRTAGDGDALPLS--LSYKVHVASVNNFPT  120

Query  512  aaglassaagfaCLVFALGKLMNV  583
            AAGLASSAAG+ACL + L ++  V
Sbjct  121  AAGLASSAAGYACLAYTLAQVYGV  144



>ref|XP_004753891.1| PREDICTED: diphosphomevalonate decarboxylase [Mustela putorius 
furo]
 ref|XP_004814744.1| PREDICTED: diphosphomevalonate decarboxylase [Mustela putorius 
furo]
Length=400

 Score =   122 bits (306),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 77/147 (52%), Positives = 97/147 (66%), Gaps = 10/147 (7%)
 Frame = +2

Query  155  EKWVLMVTAQTPTNIAVIKYWGKRDETLILPINDSISVTLDPAHLCTTTTVAVSPAFDQD  334
            EK V+ VT   P NIAVIKYWGKRDE L+LPIN S+SVTL    L TTTT A+S  F +D
Sbjct  4    EKPVVAVTCTAPVNIAVIKYWGKRDEDLVLPINSSLSVTLHQDQLKTTTTAAISKDFTED  63

Query  335  RMWLNGKEMSLSGVRYQNCLKEI----RARACDVEDEKKGIKITKKDWENLHVHIASYNN  502
            R+WLNG+E  +   R Q CL+EI    R R    +++   + ++ K      VH+AS NN
Sbjct  64   RIWLNGREEDVEQPRLQACLREIRRLARKRRSAGDEDPAALGLSYK------VHVASVNN  117

Query  503  FPTaaglassaagfaCLVFALGKLMNV  583
            FPTAAGLASSAAG+ACL + L ++  V
Sbjct  118  FPTAAGLASSAAGYACLAYTLAQVYGV  144



>ref|XP_004067388.1| PREDICTED: diphosphomevalonate decarboxylase [Oryzias latipes]
Length=364

 Score =   122 bits (305),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 79/140 (56%), Positives = 97/140 (69%), Gaps = 5/140 (4%)
 Frame = +2

Query  170  MVTAQTPTNIAVIKYWGKRDETLILPINDSISVTLDPAHLCTTTTVAVSPAFDQDRMWLN  349
            +VT   P NIAVIKYWGKR+E LILPIN S+SVTL    L TTTTVA S +F +DR+WLN
Sbjct  6    LVTCTAPVNIAVIKYWGKRNEELILPINSSLSVTLHQDQLKTTTTVATSRSFKEDRIWLN  65

Query  350  GKEMSLSGVRYQNCLKEIR--ARACDVEDEKKGIKITKKDWENLHVHIASYNNFPTaagl  523
            GKE  ++  R Q+CL+EIR  AR    + +    ++T    +   VHI S NNFPTAAGL
Sbjct  66   GKEEDITHPRLQSCLREIRRLARKRHNDGDATSTELTGLSQK---VHICSVNNFPTAAGL  122

Query  524  assaagfaCLVFALGKLMNV  583
            ASSAAGFACLV++L +   V
Sbjct  123  ASSAAGFACLVYSLAQAFGV  142



>gb|AAH81784.1| Mevalonate (diphospho) decarboxylase [Rattus norvegicus]
 gb|EDL92747.1| mevalonate (diphospho) decarboxylase [Rattus norvegicus]
Length=401

 Score =   122 bits (306),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 77/139 (55%), Positives = 90/139 (65%), Gaps = 2/139 (1%)
 Frame = +2

Query  167  LMVTAQTPTNIAVIKYWGKRDETLILPINDSISVTLDPAHLCTTTTVAVSPAFDQDRMWL  346
            LMVT   P NIAVIKYWGKRDE LILPIN S+SVTL    L TTTT A+S  F +DR+WL
Sbjct  9    LMVTCTAPVNIAVIKYWGKRDEALILPINSSLSVTLHQDQLKTTTTAAISKDFTEDRIWL  68

Query  347  NGKEMSLSGVRYQNCLKEIRARACDVEDEKKGIKITKKDWENLHVHIASYNNFPTaagla  526
            NG+E  +   R Q CL+EIR  A        G  +         VH+AS NNFPTAAGLA
Sbjct  69   NGREEDVGQPRLQACLREIRRLARKRRSTGDGDALPLS--LGYKVHVASVNNFPTAAGLA  126

Query  527  ssaagfaCLVFALGKLMNV  583
            SSAAG+ACL + L ++  V
Sbjct  127  SSAAGYACLAYTLARVYGV  145



>ref|XP_008403677.1| PREDICTED: diphosphomevalonate decarboxylase [Poecilia reticulata]
Length=403

 Score =   122 bits (306),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 79/138 (57%), Positives = 93/138 (67%), Gaps = 1/138 (1%)
 Frame = +2

Query  170  MVTAQTPTNIAVIKYWGKRDETLILPINDSISVTLDPAHLCTTTTVAVSPAFDQDRMWLN  349
            +VT   P NIAVIKYWGKRDE LILPIN S+SVTL    L TTTTVA+S +F +DR+WLN
Sbjct  11   IVTCTAPVNIAVIKYWGKRDEDLILPINSSLSVTLHQDQLKTTTTVAISRSFQEDRLWLN  70

Query  350  GKEMSLSGVRYQNCLKEIRARACDVEDEKKGIKITKKDWENLHVHIASYNNFPTaaglas  529
            GKE  ++  R Q+CL+EIR R           + T     +  VHI S NNFPTAAGLAS
Sbjct  71   GKEEDITHQRLQSCLREIR-RLTRKRRTDGDARSTDSVGLSHKVHICSVNNFPTAAGLAS  129

Query  530  saagfaCLVFALGKLMNV  583
            SAAGFACLV+ L +   V
Sbjct  130  SAAGFACLVYTLAQAFGV  147



>ref|XP_007549941.1| PREDICTED: diphosphomevalonate decarboxylase [Poecilia formosa]
Length=404

 Score =   122 bits (305),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 80/140 (57%), Positives = 95/140 (68%), Gaps = 5/140 (4%)
 Frame = +2

Query  170  MVTAQTPTNIAVIKYWGKRDETLILPINDSISVTLDPAHLCTTTTVAVSPAFDQDRMWLN  349
            +VT   P NIAVIKYWGKRDE LILPIN S+SVTL    L TTTTVA+S +F +DR+WLN
Sbjct  11   IVTCTAPVNIAVIKYWGKRDEDLILPINSSLSVTLHQDQLKTTTTVAISRSFQEDRLWLN  70

Query  350  GKEMSLSGVRYQNCLKEIRARACDVEDEKKGIKITKKDWENL--HVHIASYNNFPTaagl  523
            GKE  ++  R Q+CL+EIR  A    ++        +D   L   VHI S NNFPTAAGL
Sbjct  71   GKEEDITHQRLQSCLREIRRLARKRRNDGDA---RSEDSVGLSHKVHICSVNNFPTAAGL  127

Query  524  assaagfaCLVFALGKLMNV  583
            ASSAAGFACLV+ L +   V
Sbjct  128  ASSAAGFACLVYTLAQAFGV  147



>ref|XP_004377812.1| PREDICTED: diphosphomevalonate decarboxylase [Trichechus manatus 
latirostris]
Length=400

 Score =   122 bits (305),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 76/146 (52%), Positives = 100/146 (68%), Gaps = 6/146 (4%)
 Frame = +2

Query  152  AEKWVLMVTAQTPTNIAVIKYWGKRDETLILPINDSISVTLDPAHLCTTTTVAVSPAFDQ  331
            +E+ +++VT+  P NIAVIKYWGKRDE L+LP+N S+SVTL    L TTTT A+S  F +
Sbjct  3    SEEPLVIVTSTAPVNIAVIKYWGKRDEELVLPLNSSLSVTLHQDQLKTTTTAAISKDFTE  62

Query  332  DRMWLNGKEMSLSGVRYQNCLKEIR--ARACDVEDEKKGIKITKKDWENLHVHIASYNNF  505
            DR+WLNG E+ +   R Q+CL+EIR  AR     D+     ++     +  VHIAS NNF
Sbjct  63   DRIWLNGTEVDVGQPRLQSCLREIRRLARKRRSTDDGDAPPLSL----SYKVHIASENNF  118

Query  506  PTaaglassaagfaCLVFALGKLMNV  583
            PTAAGLASSAAG+ACL + L ++  V
Sbjct  119  PTAAGLASSAAGYACLAYTLARVYGV  144



>ref|XP_011058925.1| PREDICTED: diphosphomevalonate decarboxylase [Acromyrmex echinatior]
Length=386

 Score =   122 bits (305),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 78/137 (57%), Positives = 91/137 (66%), Gaps = 11/137 (8%)
 Frame = +2

Query  173  VTAQTPTNIAVIKYWGKRDETLILPINDSISVTLDPAHLCTTTTVAVSPAFDQDRMWLNG  352
            VT   P NIAVIKYWGKR+E+LILP NDSIS TLD A L   TTV +S  F +DR+WLNG
Sbjct  5    VTCIAPVNIAVIKYWGKRNESLILPTNDSISATLDTAQLHAKTTVMLSSDFKEDRIWLNG  64

Query  353  KEMSLSGVRYQNCLKEIRARACDVEDEKKGIKITKKDWENLHVHIASYNNFPTaaglass  532
            KE  ++  R QNCLKEIR R+         +     DW+   + I S NNFPTAAGLASS
Sbjct  65   KEEDINNTRLQNCLKEIRKRS--------QLSGYTNDWK---IRICSKNNFPTAAGLASS  113

Query  533  aagfaCLVFALGKLMNV  583
            AAG+ACL  AL KL  +
Sbjct  114  AAGYACLTAALAKLYKI  130



>gb|ELK00496.1| Diphosphomevalonate decarboxylase [Pteropus alecto]
Length=310

 Score =   120 bits (302),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 78/146 (53%), Positives = 99/146 (68%), Gaps = 6/146 (4%)
 Frame = +2

Query  152  AEKWVLMVTAQTPTNIAVIKYWGKRDETLILPINDSISVTLDPAHLCTTTTVAVSPAFDQ  331
            +EK ++ VT   P NIAVIKYWGKRDE LILPIN S+SVTL    L TTTT  +S  F +
Sbjct  3    SEKPLVTVTCTAPVNIAVIKYWGKRDEDLILPINSSLSVTLHQDQLKTTTTAVISKDFTE  62

Query  332  DRMWLNGKEMSLSGVRYQNCLKEIR--ARACDVEDEKKGIKITKKDWENLHVHIASYNNF  505
            D++WLNG+++ +   R Q CL+EIR  AR     D+K  + ++     +  VHIAS NNF
Sbjct  63   DQIWLNGQKVDVGQPRIQACLREIRRLARKRRSADDKDPLPLSL----SYKVHIASVNNF  118

Query  506  PTaaglassaagfaCLVFALGKLMNV  583
            PTAAGLASSAAG+ACL F L ++  V
Sbjct  119  PTAAGLASSAAGYACLAFTLAQVYGV  144



>gb|AJP70489.1| diphosphomevalonate decarboxylase [Helicoverpa armigera]
Length=386

 Score =   121 bits (304),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 75/138 (54%), Positives = 90/138 (65%), Gaps = 7/138 (5%)
 Frame = +2

Query  170  MVTAQTPTNIAVIKYWGKRDETLILPINDSISVTLDPAHLCTTTTVAVSPAFDQDRMWLN  349
            ++T   P NIAVIKYWGKRDE LILP+NDS+S TLD + +C  T+V     F +D +WLN
Sbjct  4    IITVIAPVNIAVIKYWGKRDEDLILPLNDSVSATLDTSIMCAKTSVCARADFKEDAIWLN  63

Query  350  GKEMSLSGVRYQNCLKEIRARACDVEDEKKGIKITKKDWENLHVHIASYNNFPTaaglas  529
            GK+ S    R QNCL EI+ RA          K   +D+    VH+ S NNFPTAAGLAS
Sbjct  64   GKKESFDSPRLQNCLGEIKLRAA-------AEKSVSEDFLQRKVHVCSENNFPTAAGLAS  116

Query  530  saagfaCLVFALGKLMNV  583
            SAAG+ACLV AL KL  V
Sbjct  117  SAAGYACLVTALAKLYKV  134



>gb|AAH63907.1| mvd-prov protein, partial [Xenopus (Silurana) tropicalis]
Length=402

 Score =   122 bits (305),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 79/147 (54%), Positives = 98/147 (67%), Gaps = 2/147 (1%)
 Frame = +2

Query  143  GTMAEKWVLMVTAQTPTNIAVIKYWGKRDETLILPINDSISVTLDPAHLCTTTTVAVSPA  322
            G    + +  VT   P NIAVIKYWGK++E LILPIN S+SVTL    L TTT+ A S  
Sbjct  2    GNFRGQEMKKVTCTAPVNIAVIKYWGKQNEELILPINSSLSVTLHQDQLKTTTSAAASRE  61

Query  323  FDQDRMWLNGKEMSLSGVRYQNCLKEIRARACDVEDEKKGIKITKKDWENLHVHIASYNN  502
            F +DR+WLNGKE ++S  R Q+CL+EIR  A    +E+    +++    N  VHI S NN
Sbjct  62   FTEDRIWLNGKEENISHPRLQSCLREIRRLARKRRNEEGDENVSR--ILNDKVHICSVNN  119

Query  503  FPTaaglassaagfaCLVFALGKLMNV  583
            FPTAAGLASSAAG+ACLV+ L KL  V
Sbjct  120  FPTAAGLASSAAGYACLVYTLAKLYGV  146



>ref|XP_008838768.1| PREDICTED: diphosphomevalonate decarboxylase [Nannospalax galili]
Length=406

 Score =   121 bits (304),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 77/146 (53%), Positives = 99/146 (68%), Gaps = 6/146 (4%)
 Frame = +2

Query  152  AEKWVLMVTAQTPTNIAVIKYWGKRDETLILPINDSISVTLDPAHLCTTTTVAVSPAFDQ  331
            +EK  ++VT   P NIAVIKYWGKRDE LILPIN S+SVTL    L TTTT A+S  F +
Sbjct  9    SEKLQVVVTCTAPVNIAVIKYWGKRDEALILPINSSLSVTLHQDQLRTTTTAAISKDFTE  68

Query  332  DRMWLNGKEMSLSGVRYQNCLKEIR--ARACDVEDEKKGIKITKKDWENLHVHIASYNNF  505
            DR+WLNG+E ++   R Q CL+EIR  AR     + +  + ++     +  VH+AS NNF
Sbjct  69   DRIWLNGREEAVGQPRLQACLREIRRLARKRRSMEGEGALPLSL----SYKVHVASVNNF  124

Query  506  PTaaglassaagfaCLVFALGKLMNV  583
            PTAAGLASSAAG+ACL + L ++  V
Sbjct  125  PTAAGLASSAAGYACLAYTLAQVYGV  150



>ref|NP_112324.1| diphosphomevalonate decarboxylase [Rattus norvegicus]
 sp|Q62967.1|MVD1_RAT RecName: Full=Diphosphomevalonate decarboxylase; AltName: Full=Mevalonate 
(diphospho)decarboxylase; Short=MDDase; AltName: 
Full=Mevalonate pyrophosphate decarboxylase [Rattus norvegicus]
 gb|AAB00192.1| mevalonate pyrophosphate decarboxylase [Rattus norvegicus]
Length=401

 Score =   121 bits (304),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 77/139 (55%), Positives = 90/139 (65%), Gaps = 2/139 (1%)
 Frame = +2

Query  167  LMVTAQTPTNIAVIKYWGKRDETLILPINDSISVTLDPAHLCTTTTVAVSPAFDQDRMWL  346
            LMVT   P NIAVIKYWGKRDE LILPIN S+SVTL    L TTTT A+S  F +DR+WL
Sbjct  9    LMVTCTAPVNIAVIKYWGKRDEALILPINPSLSVTLHQDQLKTTTTAAISKDFTEDRIWL  68

Query  347  NGKEMSLSGVRYQNCLKEIRARACDVEDEKKGIKITKKDWENLHVHIASYNNFPTaagla  526
            NG+E  +   R Q CL+EIR  A        G  +         VH+AS NNFPTAAGLA
Sbjct  69   NGREEDVGQPRLQACLREIRRLARKRRSTGDGDALPLS--LGYKVHVASVNNFPTAAGLA  126

Query  527  ssaagfaCLVFALGKLMNV  583
            SSAAG+ACL + L ++  V
Sbjct  127  SSAAGYACLAYTLARVYGV  145



>ref|XP_006926815.1| PREDICTED: diphosphomevalonate decarboxylase [Pteropus alecto]
Length=400

 Score =   121 bits (304),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 78/146 (53%), Positives = 99/146 (68%), Gaps = 6/146 (4%)
 Frame = +2

Query  152  AEKWVLMVTAQTPTNIAVIKYWGKRDETLILPINDSISVTLDPAHLCTTTTVAVSPAFDQ  331
            +EK ++ VT   P NIAVIKYWGKRDE LILPIN S+SVTL    L TTTT  +S  F +
Sbjct  3    SEKPLVTVTCTAPVNIAVIKYWGKRDEDLILPINSSLSVTLHQDQLKTTTTAVISKDFTE  62

Query  332  DRMWLNGKEMSLSGVRYQNCLKEIR--ARACDVEDEKKGIKITKKDWENLHVHIASYNNF  505
            D++WLNG+++ +   R Q CL+EIR  AR     D+K  + ++     +  VHIAS NNF
Sbjct  63   DQIWLNGQKVDVGQPRIQACLREIRRLARKRRSADDKDPLPLSL----SYKVHIASVNNF  118

Query  506  PTaaglassaagfaCLVFALGKLMNV  583
            PTAAGLASSAAG+ACL F L ++  V
Sbjct  119  PTAAGLASSAAGYACLAFTLAQVYGV  144



>ref|XP_005691918.1| PREDICTED: diphosphomevalonate decarboxylase [Capra hircus]
Length=396

 Score =   121 bits (304),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 76/148 (51%), Positives = 99/148 (67%), Gaps = 10/148 (7%)
 Frame = +2

Query  152  AEKWVLMVTAQTPTNIAVIKYWGKRDETLILPINDSISVTLDPAHLCTTTTVAVSPAFDQ  331
            +EK +++VT   P NIAV+KYWGKRDE LILPIN S+SVTL    L TTTT A+S  F +
Sbjct  3    SEKPIVVVTCTAPVNIAVVKYWGKRDEELILPINSSLSVTLHQDQLKTTTTAAISRDFTE  62

Query  332  DRMWLNGKEMSLSGVRYQNCLKEI----RARACDVEDEKKGIKITKKDWENLHVHIASYN  499
            DR+WLNG+E  +   R Q CL+EI    R R  +  ++   + ++ K      VH+AS N
Sbjct  63   DRIWLNGQEEDVGQPRLQACLREIRRLARKRRSNGHEDPLPLSLSYK------VHVASEN  116

Query  500  NFPTaaglassaagfaCLVFALGKLMNV  583
            NFPTAAGLASSAAG+ACL + L ++  V
Sbjct  117  NFPTAAGLASSAAGYACLAYTLARVYGV  144



>ref|XP_003998380.1| PREDICTED: diphosphomevalonate decarboxylase [Felis catus]
Length=398

 Score =   121 bits (304),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 77/147 (52%), Positives = 98/147 (67%), Gaps = 10/147 (7%)
 Frame = +2

Query  155  EKWVLMVTAQTPTNIAVIKYWGKRDETLILPINDSISVTLDPAHLCTTTTVAVSPAFDQD  334
            EK +++VT   P NIAVIKYWGKRDE L+LPIN S+SVTL    L TTTT A+S  F +D
Sbjct  5    EKPLVVVTCTAPVNIAVIKYWGKRDEDLVLPINSSLSVTLHQDQLKTTTTAAISKDFTED  64

Query  335  RMWLNGKEMSLSGVRYQNCLKEI----RARACDVEDEKKGIKITKKDWENLHVHIASYNN  502
            R+WLNG+E  +   R Q CL+EI    R R    +++   + ++ K      VHIAS NN
Sbjct  65   RIWLNGREEDVGQPRLQACLREIRRLARKRRSTGDEDPPPLSLSYK------VHIASVNN  118

Query  503  FPTaaglassaagfaCLVFALGKLMNV  583
            FPTAAGLASSAAG+ACL + L ++  V
Sbjct  119  FPTAAGLASSAAGYACLAYTLARVYGV  145



>gb|ACO11575.1| Diphosphomevalonate decarboxylase [Caligus rogercresseyi]
Length=390

 Score =   121 bits (303),  Expect = 5e-29, Method: Compositional matrix adjust.
 Identities = 74/138 (54%), Positives = 93/138 (67%), Gaps = 13/138 (9%)
 Frame = +2

Query  170  MVTAQTPTNIAVIKYWGKRDETLILPINDSISVTLDPAHLCTTTTVAVSPAFDQDRMWLN  349
            +VT   P NIAVIKYWGKRDE LILPINDS S+TLD   +   TT+  SP F++D++WLN
Sbjct  5    IVTCIAPVNIAVIKYWGKRDEELILPINDSFSLTLDTKEMRAKTTIMTSPEFEKDQIWLN  64

Query  350  GKEMSLSGVRYQNCLKEIRARACDVEDEKKGIKITKKDWENLHVHIASYNNFPTaaglas  529
             KE S+   R Q CL EIR R+          + + K+W+   + I S NNFPTAAGLAS
Sbjct  65   DKEESMENPRLQRCLGEIRKRS----------QASHKNWK---IRICSENNFPTAAGLAS  111

Query  530  saagfaCLVFALGKLMNV  583
            SAAG+ACLV+AL K+  +
Sbjct  112  SAAGYACLVYALSKIFEI  129



>ref|XP_009089159.1| PREDICTED: diphosphomevalonate decarboxylase [Serinus canaria]
Length=399

 Score =   121 bits (303),  Expect = 5e-29, Method: Compositional matrix adjust.
 Identities = 78/144 (54%), Positives = 93/144 (65%), Gaps = 3/144 (2%)
 Frame = +2

Query  152  AEKWVLMVTAQTPTNIAVIKYWGKRDETLILPINDSISVTLDPAHLCTTTTVAVSPAFDQ  331
            AE+ + M T   P NIAVIKYWGKRD  LILPIN S+SVTL    L TTTT A S  F +
Sbjct  3    AERALAMATCTAPVNIAVIKYWGKRDTDLILPINSSLSVTLHQDQLKTTTTAAASRDFTE  62

Query  332  DRMWLNGKEMSLSGVRYQNCLKEIRARACDVEDEKKGIKITKKDWENLHVHIASYNNFPT  511
            DR+WLNGKE  +   R Q CL+E+R  A      + G +       +  +HIAS NNFPT
Sbjct  63   DRLWLNGKEADVGHPRVQACLREVRRLA---RKRRGGGEDAAALSLSYKIHIASENNFPT  119

Query  512  aaglassaagfaCLVFALGKLMNV  583
            AAGLASSAAG+ACLV AL +L  +
Sbjct  120  AAGLASSAAGYACLVSALARLYGL  143



>dbj|GAM24015.1| hypothetical protein SAMD00019534_071900 [Acytostelium subglobosum 
LB1]
Length=402

 Score =   121 bits (303),  Expect = 5e-29, Method: Compositional matrix adjust.
 Identities = 75/138 (54%), Positives = 91/138 (66%), Gaps = 12/138 (9%)
 Frame = +2

Query  170  MVTAQTPTNIAVIKYWGKRDETLILPINDSISVTLDPAHLCTTTTVAVSPAFDQDRMWLN  349
            +VT   P NIA IKYWGKRDE LILP+NDS+S TL    L TTTT   S +F +D +WLN
Sbjct  4    LVTCTAPVNIATIKYWGKRDEKLILPLNDSLSGTLHQDDLKTTTTAMASESFTEDALWLN  63

Query  350  GKEMSLSGVRYQNCLKEIRARACDVEDEKKGIKITKKDWENLHVHIASYNNFPTaaglas  529
            GK+  ++  RYQN LK IR+RA  + D+K              VHI S NNFPTAAGLAS
Sbjct  64   GKKEDINTTRYQNVLKTIRSRATKLMDKKHC------------VHICSVNNFPTAAGLAS  111

Query  530  saagfaCLVFALGKLMNV  583
            SA+G+ACLV+ L +L  V
Sbjct  112  SASGYACLVYVLAQLYGV  129



>ref|XP_007532001.1| PREDICTED: diphosphomevalonate decarboxylase [Erinaceus europaeus]
Length=400

 Score =   121 bits (303),  Expect = 5e-29, Method: Compositional matrix adjust.
 Identities = 77/146 (53%), Positives = 97/146 (66%), Gaps = 10/146 (7%)
 Frame = +2

Query  158  KWVLMVTAQTPTNIAVIKYWGKRDETLILPINDSISVTLDPAHLCTTTTVAVSPAFDQDR  337
            K ++ VT   P NIAVIKYWGKRDE LILPIN S+SVTL    L TTTT A+S  F +DR
Sbjct  5    KQLVTVTCTAPVNIAVIKYWGKRDEELILPINSSLSVTLHQDQLKTTTTAAISKDFTEDR  64

Query  338  MWLNGKEMSLSGVRYQNCLKEI----RARACDVEDEKKGIKITKKDWENLHVHIASYNNF  505
            +WLNG+E  +   R Q CL+EI    R R    +++   + ++ K      VH+AS NNF
Sbjct  65   IWLNGQEEHVGQPRLQACLREIRRLARKRRSTGDEDPPPLSLSYK------VHVASVNNF  118

Query  506  PTaaglassaagfaCLVFALGKLMNV  583
            PTAAGLASSAAG+ACL +AL ++  V
Sbjct  119  PTAAGLASSAAGYACLAYALSQVYGV  144



>ref|XP_006888835.1| PREDICTED: diphosphomevalonate decarboxylase [Elephantulus edwardii]
Length=400

 Score =   121 bits (303),  Expect = 6e-29, Method: Compositional matrix adjust.
 Identities = 76/148 (51%), Positives = 98/148 (66%), Gaps = 10/148 (7%)
 Frame = +2

Query  152  AEKWVLMVTAQTPTNIAVIKYWGKRDETLILPINDSISVTLDPAHLCTTTTVAVSPAFDQ  331
            ++K  +MVT   P NIAVIKYWGKRDE LILP+N S+SVTL    L TTTT  +S  F +
Sbjct  3    SDKSRVMVTCTAPVNIAVIKYWGKRDEELILPLNSSLSVTLHQDQLKTTTTATISKDFTE  62

Query  332  DRMWLNGKEMSLSGVRYQNCLKEI----RARACDVEDEKKGIKITKKDWENLHVHIASYN  499
            DR+WLNG E+ +   R Q+CL+EI    R R    + +  G+ ++ K      VH+AS N
Sbjct  63   DRVWLNGVEVDVRQPRLQSCLREIHRLARKRRSTEDKDAPGLSLSHK------VHVASEN  116

Query  500  NFPTaaglassaagfaCLVFALGKLMNV  583
            NFPTAAGLASSAAG+ACL + L ++  V
Sbjct  117  NFPTAAGLASSAAGYACLAYTLARVYGV  144



>ref|XP_008308874.1| PREDICTED: diphosphomevalonate decarboxylase [Cynoglossus semilaevis]
 ref|XP_008308875.1| PREDICTED: diphosphomevalonate decarboxylase [Cynoglossus semilaevis]
Length=403

 Score =   121 bits (303),  Expect = 6e-29, Method: Compositional matrix adjust.
 Identities = 81/138 (59%), Positives = 93/138 (67%), Gaps = 4/138 (3%)
 Frame = +2

Query  173  VTAQTPTNIAVIKYWGKRDETLILPINDSISVTLDPAHLCTTTTVAVSPAFDQDRMWLNG  352
            VT   P NIAVIKYWGKRDE LILPIN S+SVTL    L TTTTVA S +F +DR+WLNG
Sbjct  13   VTCTAPVNIAVIKYWGKRDEDLILPINSSLSVTLHQDQLKTTTTVATSRSFLEDRLWLNG  72

Query  353  KEMSLSGVRYQNCLKEIRARACDVE-DEKKGIKITKKDWENLHVHIASYNNFPTaaglas  529
            KE  ++  R Q+CL+EIR  A     D   G+ +T        VHI S NNFPTAAGLAS
Sbjct  73   KEEDINHSRLQSCLREIRRLARKRRSDGDAGLNLTGLSQR---VHICSVNNFPTAAGLAS  129

Query  530  saagfaCLVFALGKLMNV  583
            SAAGFACLV+ L +   V
Sbjct  130  SAAGFACLVYTLAQAFGV  147



>ref|XP_004058175.1| PREDICTED: diphosphomevalonate decarboxylase [Gorilla gorilla 
gorilla]
Length=400

 Score =   121 bits (303),  Expect = 6e-29, Method: Compositional matrix adjust.
 Identities = 76/144 (53%), Positives = 93/144 (65%), Gaps = 2/144 (1%)
 Frame = +2

Query  152  AEKWVLMVTAQTPTNIAVIKYWGKRDETLILPINDSISVTLDPAHLCTTTTVAVSPAFDQ  331
            +EK    VT   P NIAVIKYWGKRDE L+LPIN S+SVTL    L TTTT  +S  F +
Sbjct  3    SEKPQAAVTCTAPVNIAVIKYWGKRDEELVLPINSSLSVTLHQDQLKTTTTAVISKHFTK  62

Query  332  DRMWLNGKEMSLSGVRYQNCLKEIRARACDVEDEKKGIKITKKDWENLHVHIASYNNFPT  511
            DR+WLNG+E  +   R Q CL+EIR  A    D + G  +      +  VH+AS NNFPT
Sbjct  63   DRIWLNGREEDVGQPRLQACLREIRCLARKRRDSRDGDPLPSS--LSCKVHVASVNNFPT  120

Query  512  aaglassaagfaCLVFALGKLMNV  583
            AAGLASSAAG+ACL + L ++  V
Sbjct  121  AAGLASSAAGYACLAYTLARVYGV  144



>ref|XP_006780089.1| PREDICTED: diphosphomevalonate decarboxylase-like [Neolamprologus 
brichardi]
Length=402

 Score =   121 bits (303),  Expect = 7e-29, Method: Compositional matrix adjust.
 Identities = 79/142 (56%), Positives = 96/142 (68%), Gaps = 10/142 (7%)
 Frame = +2

Query  170  MVTAQTPTNIAVIKYWGKRDETLILPINDSISVTLDPAHLCTTTTVAVSPAFDQDRMWLN  349
            +VT   P NIAVIKYWGKR+E LILPIN S+SVTL    L TTTTVA S +F +DR+WLN
Sbjct  11   IVTCTAPVNIAVIKYWGKRNEDLILPINSSLSVTLHQDQLKTTTTVATSRSFQEDRIWLN  70

Query  350  GKEMSLSGVRYQNCLKEI----RARACDVEDEKKGIKITKKDWENLHVHIASYNNFPTaa  517
            GKE  ++  R Q+CL+EI    R R  D +       ++ K      VHI S NNFPTAA
Sbjct  71   GKEEDITHPRLQSCLREIRRLARKRRNDGDSGVDSASLSHK------VHICSVNNFPTAA  124

Query  518  glassaagfaCLVFALGKLMNV  583
            GLASSAAGFACLV++L ++  V
Sbjct  125  GLASSAAGFACLVYSLARVFGV  146



>ref|XP_005292289.1| PREDICTED: diphosphomevalonate decarboxylase [Chrysemys picta 
bellii]
Length=400

 Score =   120 bits (302),  Expect = 7e-29, Method: Compositional matrix adjust.
 Identities = 79/145 (54%), Positives = 97/145 (67%), Gaps = 6/145 (4%)
 Frame = +2

Query  155  EKWVLMVTAQTPTNIAVIKYWGKRDETLILPINDSISVTLDPAHLCTTTTVAVSPAFDQD  334
            EK + +VT   P NIAVIKYWGKRDE LILPIN S+SVTL    L TTTT A+S  F +D
Sbjct  4    EKPLTVVTCTAPVNIAVIKYWGKRDEELILPINSSLSVTLHQDQLKTTTTAAISRDFKED  63

Query  335  RMWLNGKEMSLSGVRYQNCLKEIRARACDVEDEKKGIKITKKDWENL--HVHIASYNNFP  508
            R+WLNG+E  +   R Q+CL+E+R  A     +++G         +L   VH+AS NNFP
Sbjct  64   RLWLNGEEADVGHPRLQSCLREMRRLA----RKRRGGSAGAAAPLSLAYKVHVASVNNFP  119

Query  509  TaaglassaagfaCLVFALGKLMNV  583
            TAAGLASSAAG+ACLV  L +L  V
Sbjct  120  TAAGLASSAAGYACLVHTLARLYGV  144



>ref|XP_005915248.1| PREDICTED: diphosphomevalonate decarboxylase-like [Haplochromis 
burtoni]
Length=402

 Score =   120 bits (302),  Expect = 7e-29, Method: Compositional matrix adjust.
 Identities = 79/142 (56%), Positives = 96/142 (68%), Gaps = 10/142 (7%)
 Frame = +2

Query  170  MVTAQTPTNIAVIKYWGKRDETLILPINDSISVTLDPAHLCTTTTVAVSPAFDQDRMWLN  349
            +VT   P NIAVIKYWGKR+E LILPIN S+SVTL    L TTTTVA S +F +DR+WLN
Sbjct  11   IVTCTAPVNIAVIKYWGKRNEDLILPINSSLSVTLHQDQLKTTTTVATSRSFQEDRIWLN  70

Query  350  GKEMSLSGVRYQNCLKEI----RARACDVEDEKKGIKITKKDWENLHVHIASYNNFPTaa  517
            GKE  ++  R Q+CL+EI    R R  D +       ++ K      VHI S NNFPTAA
Sbjct  71   GKEEDITHPRLQSCLREIRRLARKRRNDGDSGVDSASLSHK------VHICSVNNFPTAA  124

Query  518  glassaagfaCLVFALGKLMNV  583
            GLASSAAGFACLV++L ++  V
Sbjct  125  GLASSAAGFACLVYSLARVFGV  146



>ref|XP_005753004.1| PREDICTED: diphosphomevalonate decarboxylase-like [Pundamilia 
nyererei]
Length=402

 Score =   120 bits (302),  Expect = 8e-29, Method: Compositional matrix adjust.
 Identities = 79/142 (56%), Positives = 96/142 (68%), Gaps = 10/142 (7%)
 Frame = +2

Query  170  MVTAQTPTNIAVIKYWGKRDETLILPINDSISVTLDPAHLCTTTTVAVSPAFDQDRMWLN  349
            +VT   P NIAVIKYWGKR+E LILPIN S+SVTL    L TTTTVA S +F +DR+WLN
Sbjct  11   IVTCTAPVNIAVIKYWGKRNEDLILPINSSLSVTLHQDQLKTTTTVATSRSFQEDRIWLN  70

Query  350  GKEMSLSGVRYQNCLKEI----RARACDVEDEKKGIKITKKDWENLHVHIASYNNFPTaa  517
            GKE  ++  R Q+CL+EI    R R  D +       ++ K      VHI S NNFPTAA
Sbjct  71   GKEEDITHPRLQSCLREIRRLARKRRNDGDSGVDSASLSHK------VHICSVNNFPTAA  124

Query  518  glassaagfaCLVFALGKLMNV  583
            GLASSAAGFACLV++L ++  V
Sbjct  125  GLASSAAGFACLVYSLARVFGV  146



>ref|XP_008506971.1| PREDICTED: diphosphomevalonate decarboxylase [Equus przewalskii]
Length=400

 Score =   120 bits (302),  Expect = 8e-29, Method: Compositional matrix adjust.
 Identities = 77/146 (53%), Positives = 98/146 (67%), Gaps = 6/146 (4%)
 Frame = +2

Query  152  AEKWVLMVTAQTPTNIAVIKYWGKRDETLILPINDSISVTLDPAHLCTTTTVAVSPAFDQ  331
            +EK ++ VT   P NIAVIKYWGKRDE LILPIN S+SVTL    L TTTT A+S  F +
Sbjct  3    SEKPLVAVTCTAPVNIAVIKYWGKRDEELILPINSSLSVTLHQDQLKTTTTAAISKDFTE  62

Query  332  DRMWLNGKEMSLSGVRYQNCLKEIR--ARACDVEDEKKGIKITKKDWENLHVHIASYNNF  505
            DR+WLNG+E  +   R Q CL+EIR  AR      ++  + ++     +  VH+AS NNF
Sbjct  63   DRIWLNGREEDVGQPRLQACLREIRRLARKRRSAGDEDPLPLSL----SYKVHVASVNNF  118

Query  506  PTaaglassaagfaCLVFALGKLMNV  583
            PTAAGLASSAAG+ACL + L ++  V
Sbjct  119  PTAAGLASSAAGYACLAYTLAQVYGV  144



>ref|XP_006860173.1| PREDICTED: diphosphomevalonate decarboxylase [Chrysochloris asiatica]
Length=400

 Score =   120 bits (301),  Expect = 9e-29, Method: Compositional matrix adjust.
 Identities = 77/146 (53%), Positives = 97/146 (66%), Gaps = 6/146 (4%)
 Frame = +2

Query  152  AEKWVLMVTAQTPTNIAVIKYWGKRDETLILPINDSISVTLDPAHLCTTTTVAVSPAFDQ  331
            +EK + +VT   P NIAVIKYWGKRDE LILP+N S+SVTL    L TTTT A+S  F +
Sbjct  3    SEKQLTVVTCTAPVNIAVIKYWGKRDEELILPLNSSLSVTLHQDQLKTTTTAAISKDFTE  62

Query  332  DRMWLNGKEMSLSGVRYQNCLKEIR--ARACDVEDEKKGIKITKKDWENLHVHIASYNNF  505
            DR+WLNG E+ +   R Q+CL+EI   AR     D++     +     +  VH+AS NNF
Sbjct  63   DRIWLNGVEVDMGQPRLQSCLREIHRLARKRRSSDDRNAPPPSL----SYKVHVASENNF  118

Query  506  PTaaglassaagfaCLVFALGKLMNV  583
            PTAAGLASSAAG+ACL + L K+  V
Sbjct  119  PTAAGLASSAAGYACLAYTLAKVYGV  144



>ref|XP_005052358.1| PREDICTED: diphosphomevalonate decarboxylase [Ficedula albicollis]
Length=401

 Score =   120 bits (301),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 78/144 (54%), Positives = 92/144 (64%), Gaps = 3/144 (2%)
 Frame = +2

Query  152  AEKWVLMVTAQTPTNIAVIKYWGKRDETLILPINDSISVTLDPAHLCTTTTVAVSPAFDQ  331
            AE+   M T   P NIAVIKYWGKRD  LILPIN S+SVTL    L TTTT A S  F +
Sbjct  3    AERGPAMATCTAPVNIAVIKYWGKRDTDLILPINSSLSVTLHQDQLKTTTTAAASRDFTE  62

Query  332  DRMWLNGKEMSLSGVRYQNCLKEIRARACDVEDEKKGIKITKKDWENLHVHIASYNNFPT  511
            DR+WLNGKE  +   R Q CL+E+R  A      + G +       +  +HIAS NNFPT
Sbjct  63   DRLWLNGKEADVGHPRVQACLREVRRLA---RKRRGGGEDAAALSLSYKIHIASENNFPT  119

Query  512  aaglassaagfaCLVFALGKLMNV  583
            AAGLASSAAG+ACLV AL +L  +
Sbjct  120  AAGLASSAAGYACLVSALARLYGL  143



>gb|AAP36301.1| Homo sapiens mevalonate (diphospho) decarboxylase [synthetic 
construct]
 gb|AAX43880.1| mevalonate (diphospho) decarboxylase, partial [synthetic construct]
Length=401

 Score =   120 bits (301),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 75/144 (52%), Positives = 94/144 (65%), Gaps = 2/144 (1%)
 Frame = +2

Query  152  AEKWVLMVTAQTPTNIAVIKYWGKRDETLILPINDSISVTLDPAHLCTTTTVAVSPAFDQ  331
            +EK +  VT   P NIAVIKYWGKRDE L+LPIN S+SVTL    L TTTT  +S  F +
Sbjct  3    SEKPLAAVTCTAPVNIAVIKYWGKRDEELVLPINSSLSVTLHQDQLKTTTTAVISKDFTE  62

Query  332  DRMWLNGKEMSLSGVRYQNCLKEIRARACDVEDEKKGIKITKKDWENLHVHIASYNNFPT  511
            DR+WLNG+E  +   R Q CL+EIR  A    + + G  +      +  VH+AS NNFPT
Sbjct  63   DRIWLNGREEDVGQPRLQACLREIRCLARKRRNSRDGDPLPSS--LSCKVHVASVNNFPT  120

Query  512  aaglassaagfaCLVFALGKLMNV  583
            AAGLASSAAG+ACL + L ++  V
Sbjct  121  AAGLASSAAGYACLAYTLARVYGV  144



>ref|XP_523460.3| PREDICTED: diphosphomevalonate decarboxylase [Pan troglodytes]
Length=400

 Score =   120 bits (301),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 75/144 (52%), Positives = 94/144 (65%), Gaps = 2/144 (1%)
 Frame = +2

Query  152  AEKWVLMVTAQTPTNIAVIKYWGKRDETLILPINDSISVTLDPAHLCTTTTVAVSPAFDQ  331
            +EK +  VT   P NIAVIKYWGKRDE L+LPIN S+SVTL    L TTTT  +S  F +
Sbjct  3    SEKPLAAVTCTAPVNIAVIKYWGKRDEELVLPINSSLSVTLHQDQLKTTTTAVISKDFTE  62

Query  332  DRMWLNGKEMSLSGVRYQNCLKEIRARACDVEDEKKGIKITKKDWENLHVHIASYNNFPT  511
            DR+WLNG+E  +   R Q CL+EIR  A    + + G  +      +  VH+AS NNFPT
Sbjct  63   DRIWLNGREEDVGQPRLQACLREIRCLARKRRNSRDGDPLPSS--LSCKVHVASVNNFPT  120

Query  512  aaglassaagfaCLVFALGKLMNV  583
            AAGLASSAAG+ACL + L ++  V
Sbjct  121  AAGLASSAAGYACLAYTLARVYGV  144



>ref|XP_003442298.1| PREDICTED: diphosphomevalonate decarboxylase-like [Oreochromis 
niloticus]
Length=402

 Score =   120 bits (301),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 79/142 (56%), Positives = 95/142 (67%), Gaps = 10/142 (7%)
 Frame = +2

Query  170  MVTAQTPTNIAVIKYWGKRDETLILPINDSISVTLDPAHLCTTTTVAVSPAFDQDRMWLN  349
            +VT   P NIAVIKYWGKR+E LILPIN S+SVTL    L TTTTVA S +F +DR+WLN
Sbjct  11   IVTCTAPVNIAVIKYWGKRNEDLILPINSSLSVTLHQDQLKTTTTVATSRSFQEDRIWLN  70

Query  350  GKEMSLSGVRYQNCLKEI----RARACDVEDEKKGIKITKKDWENLHVHIASYNNFPTaa  517
            GKE  ++  R Q+CL+EI    R R  D +       ++ K      VHI S NNFPTAA
Sbjct  71   GKEEDITHPRLQSCLREIRRLARKRRNDGDSGVDSASLSHK------VHICSVNNFPTAA  124

Query  518  glassaagfaCLVFALGKLMNV  583
            GLASSAAGFACLV+ L ++  V
Sbjct  125  GLASSAAGFACLVYTLARVFGV  146



>ref|NP_002452.1| diphosphomevalonate decarboxylase [Homo sapiens]
 sp|P53602.1|MVD1_HUMAN RecName: Full=Diphosphomevalonate decarboxylase; AltName: Full=Mevalonate 
(diphospho)decarboxylase; Short=MDDase; AltName: 
Full=Mevalonate pyrophosphate decarboxylase [Homo sapiens]
 pdb|3D4J|A Chain A, Crystal Structure Of Human Mevalonate Diphosphate Decarboxylase
 pdb|3D4J|B Chain B, Crystal Structure Of Human Mevalonate Diphosphate Decarboxylase
 gb|AAC50440.1| mevalonate pyrophosphate decarboxylase [Homo sapiens]
 gb|AAH00011.1| Mevalonate (diphospho) decarboxylase [Homo sapiens]
 gb|AAP35576.1| mevalonate (diphospho) decarboxylase [Homo sapiens]
 gb|AAX32278.1| mevalonate (diphospho) decarboxylase [synthetic construct]
 gb|EAW66792.1| mevalonate (diphospho) decarboxylase, isoform CRA_c [Homo sapiens]
 gb|ABM84650.1| mevalonate (diphospho) decarboxylase [synthetic construct]
 gb|ABM92179.1| mevalonate (diphospho) decarboxylase [synthetic construct]
 dbj|BAI45751.1| mevalonate (diphospho) decarboxylase [synthetic construct]
Length=400

 Score =   120 bits (301),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 75/144 (52%), Positives = 94/144 (65%), Gaps = 2/144 (1%)
 Frame = +2

Query  152  AEKWVLMVTAQTPTNIAVIKYWGKRDETLILPINDSISVTLDPAHLCTTTTVAVSPAFDQ  331
            +EK +  VT   P NIAVIKYWGKRDE L+LPIN S+SVTL    L TTTT  +S  F +
Sbjct  3    SEKPLAAVTCTAPVNIAVIKYWGKRDEELVLPINSSLSVTLHQDQLKTTTTAVISKDFTE  62

Query  332  DRMWLNGKEMSLSGVRYQNCLKEIRARACDVEDEKKGIKITKKDWENLHVHIASYNNFPT  511
            DR+WLNG+E  +   R Q CL+EIR  A    + + G  +      +  VH+AS NNFPT
Sbjct  63   DRIWLNGREEDVGQPRLQACLREIRCLARKRRNSRDGDPLPSS--LSCKVHVASVNNFPT  120

Query  512  aaglassaagfaCLVFALGKLMNV  583
            AAGLASSAAG+ACL + L ++  V
Sbjct  121  AAGLASSAAGYACLAYTLARVYGV  144



>ref|XP_010577890.1| PREDICTED: diphosphomevalonate decarboxylase [Haliaeetus leucocephalus]
Length=400

 Score =   120 bits (301),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 76/147 (52%), Positives = 96/147 (65%), Gaps = 10/147 (7%)
 Frame = +2

Query  155  EKWVLMVTAQTPTNIAVIKYWGKRDETLILPINDSISVTLDPAHLCTTTTVAVSPAFDQD  334
            E+ + MVT   P NIAVIKYWGKRD  LILPIN S+SVTL    L TTTT A S  F +D
Sbjct  4    ERGLAMVTCTAPVNIAVIKYWGKRDNDLILPINSSLSVTLHQDQLKTTTTAAASRDFAED  63

Query  335  RMWLNGKEMSLSGVRYQNCLKEI----RARACDVEDEKKGIKITKKDWENLHVHIASYNN  502
            R+WLNG+E  +   R Q CL+E+    R R    +++   + ++ K      +H+A+ NN
Sbjct  64   RLWLNGEEADVGHPRLQACLREVRRLARKRRGGSDEDAAPLSLSYK------IHVATENN  117

Query  503  FPTaaglassaagfaCLVFALGKLMNV  583
            FPTAAGLASSAAG+ACLV AL +L  V
Sbjct  118  FPTAAGLASSAAGYACLVSALARLYGV  144



>ref|XP_010792093.1| PREDICTED: diphosphomevalonate decarboxylase [Notothenia coriiceps]
Length=402

 Score =   120 bits (301),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 77/137 (56%), Positives = 94/137 (69%), Gaps = 2/137 (1%)
 Frame = +2

Query  170  MVTAQTPTNIAVIKYWGKRDETLILPINDSISVTLDPAHLCTTTTVAVSPAFDQDRMWLN  349
            +VT   P NIAVIKYWGKR+E LILPIN S+SVTL    L TTTT+A S +F +DR+WLN
Sbjct  11   IVTCTAPVNIAVIKYWGKRNEELILPINSSLSVTLHQDQLKTTTTIATSRSFKEDRIWLN  70

Query  350  GKEMSLSGVRYQNCLKEIRARACDVEDEKKGIKITKKDWENLHVHIASYNNFPTaaglas  529
            GKE  ++  R Q+CL+EIR  A    ++  G         +L VHI S NNFPTAAGLAS
Sbjct  71   GKEEDITHPRLQSCLREIRRLARKRRND--GDPALDPSVLSLKVHICSVNNFPTAAGLAS  128

Query  530  saagfaCLVFALGKLMN  580
            SAAGFACLV+ L ++  
Sbjct  129  SAAGFACLVYTLARVFG  145



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 737611932690