BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFF037K11

Length=618
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009800816.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    209   2e-61   Nicotiana sylvestris
ref|XP_004248083.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    207   8e-61   Solanum lycopersicum
ref|XP_006339720.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    206   6e-60   Solanum tuberosum [potatoes]
ref|XP_009600181.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    205   1e-59   
ref|XP_006362137.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    203   4e-59   Solanum tuberosum [potatoes]
ref|XP_009613969.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    204   9e-59   Nicotiana tomentosiformis
ref|XP_011093028.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    198   4e-57   Sesamum indicum [beniseed]
ref|XP_004229990.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    197   3e-56   Solanum lycopersicum
gb|EYU40714.1|  hypothetical protein MIMGU_mgv1a019320mg                196   3e-56   Erythranthe guttata [common monkey flower]
ref|XP_009775618.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    196   3e-56   Nicotiana sylvestris
gb|EYU38885.1|  hypothetical protein MIMGU_mgv1a026932mg                194   2e-55   Erythranthe guttata [common monkey flower]
ref|XP_011093892.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    193   3e-55   Sesamum indicum [beniseed]
gb|EYU32252.1|  hypothetical protein MIMGU_mgv1a005685mg                192   7e-55   Erythranthe guttata [common monkey flower]
ref|XP_006444833.1|  hypothetical protein CICLE_v10019938mg             190   8e-54   Citrus clementina [clementine]
ref|XP_006491285.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    189   1e-53   Citrus sinensis [apfelsine]
gb|KDP28482.1|  hypothetical protein JCGZ_14253                         188   4e-53   Jatropha curcas
ref|XP_004494825.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    186   3e-52   
gb|KEH24641.1|  eukaryotic aspartyl protease family protein             185   6e-52   Medicago truncatula
ref|XP_010053832.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    184   1e-51   Eucalyptus grandis [rose gum]
ref|XP_007217966.1|  hypothetical protein PRUPE_ppa005289mg             183   3e-51   
emb|CDP08669.1|  unnamed protein product                                182   7e-51   Coffea canephora [robusta coffee]
ref|XP_011038277.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    182   1e-50   Populus euphratica
ref|XP_004139658.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    180   3e-50   Cucumis sativus [cucumbers]
ref|XP_010266550.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    181   3e-50   Nelumbo nucifera [Indian lotus]
emb|CDY15187.1|  BnaC05g00660D                                          180   3e-50   Brassica napus [oilseed rape]
ref|XP_006418409.1|  hypothetical protein EUTSA_v10009389mg             181   3e-50   Eutrema salsugineum [saltwater cress]
ref|XP_011023172.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    180   6e-50   Populus euphratica
ref|XP_008351846.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    179   7e-50   
ref|XP_008343434.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    179   7e-50   
ref|XP_008461984.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    179   2e-49   
ref|XP_002892074.1|  aspartyl protease family protein                   179   2e-49   
ref|XP_010095748.1|  Aspartic proteinase nepenthesin-1                  178   2e-49   Morus notabilis
ref|XP_002523337.1|  Aspartic proteinase nepenthesin-1 precursor,...    177   3e-49   Ricinus communis
gb|EPS66029.1|  hypothetical protein M569_08742                         177   4e-49   Genlisea aurea
ref|XP_008376086.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    177   5e-49   Malus domestica [apple tree]
emb|CBI40559.3|  unnamed protein product                                176   7e-49   Vitis vinifera
gb|KJB49569.1|  hypothetical protein B456_008G125700                    177   8e-49   Gossypium raimondii
ref|XP_002320868.1|  aspartyl protease family protein                   177   8e-49   Populus trichocarpa [western balsam poplar]
ref|XP_002263964.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    176   2e-48   Vitis vinifera
ref|XP_009336767.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    174   5e-48   Pyrus x bretschneideri [bai li]
ref|XP_010474721.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    174   6e-48   Camelina sativa [gold-of-pleasure]
ref|XP_007147317.1|  hypothetical protein PHAVU_006G113700g             175   7e-48   Phaseolus vulgaris [French bean]
ref|XP_002302634.2|  aspartyl protease family protein                   172   4e-47   Populus trichocarpa [western balsam poplar]
emb|CDX90023.1|  BnaA10g00590D                                          171   9e-47   
gb|AAM66061.1|  chloroplast nucleoid DNA binding protein, putative      171   9e-47   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009119684.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    171   1e-46   Brassica rapa
ref|XP_010457141.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    171   2e-46   Camelina sativa [gold-of-pleasure]
ref|NP_171637.1|  aspartyl protease family protein                      170   2e-46   Arabidopsis thaliana [mouse-ear cress]
gb|KFK42512.1|  hypothetical protein AALP_AA1G003500                    169   5e-46   Arabis alpina [alpine rockcress]
ref|XP_010556596.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    167   2e-45   Tarenaya hassleriana [spider flower]
ref|XP_007135265.1|  hypothetical protein PHAVU_010G114700g             165   2e-44   Phaseolus vulgaris [French bean]
gb|AGV54495.1|  aspartic proteinase nepenthesin-1-like protein          165   2e-44   Phaseolus vulgaris [French bean]
ref|XP_006307379.1|  hypothetical protein CARUB_v10009005mg             163   7e-44   Capsella rubella
gb|AGV54447.1|  aspartic proteinase nepenthesin-1 precursor             163   8e-44   Phaseolus vulgaris [French bean]
ref|XP_003554768.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    163   1e-43   Glycine max [soybeans]
ref|XP_007051537.1|  Eukaryotic aspartyl protease family protein ...    162   1e-43   
ref|XP_007051536.1|  Eukaryotic aspartyl protease family protein ...    162   5e-43   
gb|KJB09628.1|  hypothetical protein B456_001G154400                    159   1e-42   Gossypium raimondii
ref|XP_010918360.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    160   1e-42   Elaeis guineensis
gb|KJB09626.1|  hypothetical protein B456_001G154400                    160   2e-42   Gossypium raimondii
ref|XP_003529886.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    159   2e-42   Glycine max [soybeans]
ref|XP_008437888.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    159   3e-42   Cucumis melo [Oriental melon]
ref|XP_008799615.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    159   3e-42   Phoenix dactylifera
gb|KGN56421.1|  Aspartic proteinase nepenthesin-1                       158   9e-42   Cucumis sativus [cucumbers]
ref|XP_004133810.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    157   9e-42   Cucumis sativus [cucumbers]
emb|CDY43952.1|  BnaC04g21580D                                          157   2e-41   Brassica napus [oilseed rape]
ref|XP_010665756.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    156   2e-41   Beta vulgaris subsp. vulgaris [field beet]
emb|CDX89133.1|  BnaA04g00530D                                          156   2e-41   
gb|KFK35370.1|  hypothetical protein AALP_AA5G276300                    156   3e-41   Arabis alpina [alpine rockcress]
ref|XP_009138753.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    155   5e-41   Brassica rapa
ref|XP_010480432.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    155   6e-41   Camelina sativa [gold-of-pleasure]
ref|XP_004306664.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    155   8e-41   Fragaria vesca subsp. vesca
ref|XP_010469025.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    154   1e-40   Camelina sativa [gold-of-pleasure]
ref|XP_010512555.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    154   1e-40   Camelina sativa [gold-of-pleasure]
ref|XP_010413342.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    153   4e-40   Camelina sativa [gold-of-pleasure]
ref|XP_010544842.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    152   9e-40   Tarenaya hassleriana [spider flower]
ref|XP_009394177.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    152   1e-39   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_002878415.1|  aspartyl protease family protein                   151   2e-39   
ref|XP_004171805.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    149   3e-39   
gb|ABK24467.1|  unknown                                                 151   3e-39   Picea sitchensis
ref|XP_010924503.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    150   7e-39   Elaeis guineensis
emb|CDY25081.1|  BnaC06g18230D                                          150   8e-39   Brassica napus [oilseed rape]
gb|KJB41527.1|  hypothetical protein B456_007G108800                    149   8e-39   Gossypium raimondii
gb|AAK64003.1|  AT3g61820/F15G16_210                                    147   2e-38   Arabidopsis thaliana [mouse-ear cress]
emb|CDX67868.1|  BnaA07g19080D                                          147   7e-38   
ref|NP_191741.1|  aspartyl protease                                     147   8e-38   Arabidopsis thaliana [mouse-ear cress]
ref|XP_004969076.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    146   1e-37   Setaria italica
ref|XP_009104352.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    146   2e-37   Brassica rapa
ref|XP_003520873.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    144   9e-37   Glycine max [soybeans]
gb|KHN16429.1|  Aspartic proteinase nepenthesin-1                       135   1e-36   Glycine soja [wild soybean]
ref|XP_003569303.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    139   3e-35   Brachypodium distachyon [annual false brome]
tpg|DAA58835.1|  TPA: hypothetical protein ZEAMMB73_701358              139   5e-35   
ref|XP_011007544.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    139   8e-35   Populus euphratica
ref|NP_001043485.1|  Os01g0598600                                       139   8e-35   
ref|XP_011031192.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    138   9e-35   Populus euphratica
ref|XP_011461997.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    134   1e-34   Fragaria vesca subsp. vesca
gb|EAZ12575.1|  hypothetical protein OsJ_02481                          137   2e-34   Oryza sativa Japonica Group [Japonica rice]
ref|XP_002306246.2|  hypothetical protein POPTR_0005s06390g             137   2e-34   Populus trichocarpa [western balsam poplar]
ref|XP_006402438.1|  hypothetical protein EUTSA_v10005923mg             137   2e-34   Eutrema salsugineum [saltwater cress]
ref|XP_009629151.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    136   4e-34   Nicotiana tomentosiformis
ref|XP_006345303.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    136   6e-34   Solanum tuberosum [potatoes]
ref|XP_002455897.1|  hypothetical protein SORBIDRAFT_03g026970          135   9e-34   
gb|KJB49971.1|  hypothetical protein B456_008G147500                    135   1e-33   Gossypium raimondii
gb|KDP40474.1|  hypothetical protein JCGZ_24473                         135   2e-33   Jatropha curcas
gb|KEH44446.1|  aspartic protease in GUARD CELL-like protein            135   2e-33   Medicago truncatula
gb|KJB79793.1|  hypothetical protein B456_013G067200                    134   2e-33   Gossypium raimondii
ref|NP_001056485.1|  Os05g0590000                                       134   2e-33   
gb|EAY99240.1|  hypothetical protein OsI_21202                          134   3e-33   Oryza sativa Indica Group [Indian rice]
gb|AAT38006.1|  unknow protein                                          134   3e-33   Oryza sativa Japonica Group [Japonica rice]
ref|XP_011022942.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    134   5e-33   Populus euphratica
ref|XP_002309912.2|  hypothetical protein POPTR_0007s04120g             133   7e-33   Populus trichocarpa [western balsam poplar]
ref|XP_004147103.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    133   7e-33   Cucumis sativus [cucumbers]
ref|XP_006406427.1|  hypothetical protein EUTSA_v10020671mg             133   7e-33   Eutrema salsugineum [saltwater cress]
gb|KJB77420.1|  hypothetical protein B456_012G135900                    132   1e-32   Gossypium raimondii
ref|XP_006847790.1|  hypothetical protein AMTR_s00029p00016750          132   2e-32   Amborella trichopoda
ref|XP_010279486.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    132   2e-32   Nelumbo nucifera [Indian lotus]
ref|XP_009760593.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    132   2e-32   Nicotiana sylvestris
ref|XP_004497254.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    131   2e-32   Cicer arietinum [garbanzo]
gb|EYU40681.1|  hypothetical protein MIMGU_mgv1a005122mg                131   4e-32   Erythranthe guttata [common monkey flower]
ref|XP_002513132.1|  Aspartic proteinase nepenthesin-1 precursor,...    131   4e-32   Ricinus communis
gb|KDO69941.1|  hypothetical protein CISIN_1g011042mg                   131   4e-32   Citrus sinensis [apfelsine]
ref|XP_004236867.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    130   4e-32   Solanum lycopersicum
ref|XP_004961034.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    130   6e-32   Setaria italica
ref|XP_006484478.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    130   6e-32   Citrus sinensis [apfelsine]
ref|XP_006437655.1|  hypothetical protein CICLE_v10031332mg             130   6e-32   
ref|XP_009351765.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    130   6e-32   
ref|XP_010248951.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    130   7e-32   Nelumbo nucifera [Indian lotus]
ref|XP_009607692.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    130   1e-31   Nicotiana tomentosiformis
dbj|BAJ86414.1|  predicted protein                                      129   2e-31   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_008465249.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    129   2e-31   Cucumis melo [Oriental melon]
ref|XP_010487964.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    129   2e-31   Camelina sativa [gold-of-pleasure]
ref|XP_002267930.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    129   2e-31   Vitis vinifera
gb|ABK25248.1|  unknown                                                 127   3e-31   Picea sitchensis
ref|XP_008445900.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    128   3e-31   Cucumis melo [Oriental melon]
ref|XP_002885351.1|  pepsin A                                           128   3e-31   Arabidopsis lyrata subsp. lyrata
gb|ABK24480.1|  unknown                                                 128   3e-31   Picea sitchensis
ref|XP_007142740.1|  hypothetical protein PHAVU_007G013000g             128   3e-31   Phaseolus vulgaris [French bean]
emb|CBI35367.3|  unnamed protein product                                128   4e-31   Vitis vinifera
ref|XP_006360843.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    128   4e-31   Solanum tuberosum [potatoes]
ref|XP_004253208.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    128   5e-31   Solanum lycopersicum
gb|KFK39328.1|  hypothetical protein AALP_AA3G230300                    127   5e-31   Arabis alpina [alpine rockcress]
ref|XP_003555824.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    128   5e-31   Glycine max [soybeans]
ref|XP_009145693.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    127   5e-31   Brassica rapa
ref|XP_007043208.1|  Aspartic proteinase nepenthesin-1, putative        127   6e-31   
ref|XP_010508355.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    127   7e-31   Camelina sativa [gold-of-pleasure]
ref|XP_010466176.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    127   7e-31   Camelina sativa [gold-of-pleasure]
ref|XP_004150193.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    127   7e-31   Cucumis sativus [cucumbers]
ref|NP_188636.2|  protein ASPARTIC PROTEASE IN GUARD CELL 2             127   8e-31   Arabidopsis thaliana [mouse-ear cress]
gb|ABR17085.1|  unknown                                                 127   9e-31   Picea sitchensis
ref|XP_008340423.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    127   1e-30   Malus domestica [apple tree]
ref|XP_003536757.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    127   1e-30   Glycine max [soybeans]
emb|CDP04865.1|  unnamed protein product                                127   1e-30   Coffea canephora [robusta coffee]
ref|XP_006297584.1|  hypothetical protein CARUB_v10013606mg             126   2e-30   Capsella rubella
ref|XP_010031370.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    126   2e-30   Eucalyptus grandis [rose gum]
ref|XP_009337150.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    125   4e-30   Pyrus x bretschneideri [bai li]
ref|XP_010541885.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    120   4e-30   
ref|XP_010935575.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    125   4e-30   Elaeis guineensis
ref|XP_007209939.1|  hypothetical protein PRUPE_ppa004726mg             125   5e-30   Prunus persica
ref|XP_009145889.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    125   5e-30   Brassica rapa
ref|XP_008244017.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    125   5e-30   Prunus mume [ume]
emb|CDX92240.1|  BnaA05g21670D                                          125   6e-30   
dbj|BAK07248.1|  predicted protein                                      125   6e-30   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_008802841.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    124   6e-30   Phoenix dactylifera
ref|XP_004137465.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    124   8e-30   Cucumis sativus [cucumbers]
ref|XP_004157423.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    124   8e-30   
ref|XP_006485768.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    124   1e-29   Citrus sinensis [apfelsine]
ref|XP_006440937.1|  hypothetical protein CICLE_v10019848mg             124   1e-29   Citrus clementina [clementine]
ref|XP_007152794.1|  hypothetical protein PHAVU_004G160200g             124   1e-29   Phaseolus vulgaris [French bean]
gb|KDO64536.1|  hypothetical protein CISIN_1g011045mg                   124   1e-29   Citrus sinensis [apfelsine]
ref|XP_007153018.1|  hypothetical protein PHAVU_003G000900g             124   1e-29   Phaseolus vulgaris [French bean]
ref|XP_006653026.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    124   1e-29   Oryza brachyantha
ref|XP_003565317.2|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    124   1e-29   Brachypodium distachyon [annual false brome]
emb|CDY24483.1|  BnaC05g34710D                                          124   1e-29   Brassica napus [oilseed rape]
ref|XP_008457107.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    124   1e-29   
ref|XP_009770623.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    124   1e-29   Nicotiana sylvestris
ref|XP_004498097.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    124   1e-29   Cicer arietinum [garbanzo]
emb|CDM80984.1|  unnamed protein product                                124   1e-29   Triticum aestivum [Canadian hard winter wheat]
ref|XP_004498098.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    124   1e-29   
ref|XP_004297710.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    123   2e-29   Fragaria vesca subsp. vesca
ref|XP_009112699.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    123   2e-29   Brassica rapa
ref|XP_008799310.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    123   2e-29   Phoenix dactylifera
ref|XP_010916474.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    123   2e-29   Elaeis guineensis
gb|ABR16474.1|  unknown                                                 123   3e-29   Picea sitchensis
ref|XP_003637421.1|  Aspartic proteinase nepenthesin-1                  120   3e-29   
emb|CDM83204.1|  unnamed protein product                                123   3e-29   Triticum aestivum [Canadian hard winter wheat]
emb|CDY69364.1|  BnaCnng63170D                                          122   3e-29   Brassica napus [oilseed rape]
gb|KFK39179.1|  hypothetical protein AALP_AA3G210500                    122   3e-29   Arabis alpina [alpine rockcress]
ref|XP_006852628.1|  hypothetical protein AMTR_s00021p00234660          122   4e-29   Amborella trichopoda
ref|XP_009337317.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    122   4e-29   Pyrus x bretschneideri [bai li]
emb|CDY24395.1|  BnaCnng04620D                                          122   5e-29   Brassica napus [oilseed rape]
ref|XP_002457394.1|  hypothetical protein SORBIDRAFT_03g006630          122   5e-29   Sorghum bicolor [broomcorn]
ref|XP_010103590.1|  Aspartic proteinase nepenthesin-2                  122   5e-29   Morus notabilis
ref|XP_004960076.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    122   5e-29   Setaria italica
ref|XP_008782298.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    122   5e-29   Phoenix dactylifera
ref|XP_003589787.1|  Aspartic proteinase nepenthesin-2                  122   6e-29   
ref|XP_009385987.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    121   7e-29   Musa acuminata subsp. malaccensis [pisang utan]
gb|AES60038.2|  aspartic protease in GUARD CELL-like protein            121   7e-29   Medicago truncatula
ref|XP_010908909.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    121   8e-29   
ref|XP_010036867.1|  PREDICTED: LOW QUALITY PROTEIN: protein ASPA...    121   8e-29   
ref|XP_008374731.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    121   9e-29   
ref|XP_004968151.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    121   1e-28   Setaria italica
tpg|DAA53545.1|  TPA: hypothetical protein ZEAMMB73_483039              121   1e-28   
ref|XP_002440367.1|  hypothetical protein SORBIDRAFT_09g030430          120   2e-28   
ref|XP_010506935.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    120   2e-28   Camelina sativa [gold-of-pleasure]
gb|KJB37242.1|  hypothetical protein B456_006G195400                    120   2e-28   Gossypium raimondii
ref|XP_006298983.1|  hypothetical protein CARUB_v10015108mg             120   3e-28   Capsella rubella
ref|XP_009346910.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    120   3e-28   Pyrus x bretschneideri [bai li]
gb|KEH44258.1|  aspartic protease in GUARD CELL-like protein            120   3e-28   Medicago truncatula
ref|XP_009398943.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    120   3e-28   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_006406598.1|  hypothetical protein EUTSA_v10020568mg             120   3e-28   Eutrema salsugineum [saltwater cress]
ref|XP_008351878.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    120   3e-28   
ref|XP_011459743.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    116   3e-28   Fragaria vesca subsp. vesca
ref|XP_007227097.1|  hypothetical protein PRUPE_ppa025647mg             120   3e-28   
ref|XP_002970504.1|  hypothetical protein SELMODRAFT_93504              120   3e-28   
ref|XP_008221090.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    120   3e-28   Prunus mume [ume]
gb|EAY72467.1|  hypothetical protein OsI_00323                          119   5e-28   Oryza sativa Indica Group [Indian rice]
ref|XP_010465949.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    119   5e-28   Camelina sativa [gold-of-pleasure]
ref|XP_008367576.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    119   5e-28   
ref|XP_009109887.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    119   6e-28   Brassica rapa
ref|XP_009409187.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    119   6e-28   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_004135107.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    119   7e-28   Cucumis sativus [cucumbers]
ref|XP_008446567.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    118   1e-27   Cucumis melo [Oriental melon]
ref|XP_006354732.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    118   1e-27   
ref|XP_002275164.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    118   1e-27   Vitis vinifera
ref|XP_010487776.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    118   1e-27   Camelina sativa [gold-of-pleasure]
ref|XP_004241622.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    118   1e-27   Solanum lycopersicum
gb|ABR17396.1|  unknown                                                 117   2e-27   Picea sitchensis
ref|NP_188478.1|  protein ASPARTIC PROTEASE IN GUARD CELL 1             118   2e-27   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009380958.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    118   2e-27   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_002885261.1|  aspartyl protease family protein                   117   2e-27   Arabidopsis lyrata subsp. lyrata
gb|ABK24255.1|  unknown                                                 117   2e-27   Picea sitchensis
ref|XP_004172253.1|  PREDICTED: LOW QUALITY PROTEIN: protein ASPA...    117   2e-27   
gb|AAL87345.1|  putative chloroplast nucleoid DNA-binding protein       117   3e-27   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008791252.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    117   3e-27   
ref|XP_003520035.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    117   4e-27   Glycine max [soybeans]
ref|XP_002448772.1|  hypothetical protein SORBIDRAFT_06g032900          116   5e-27   Sorghum bicolor [broomcorn]
ref|XP_003517994.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    116   5e-27   Glycine max [soybeans]
gb|EAY72465.1|  hypothetical protein OsI_00321                          115   5e-27   Oryza sativa Indica Group [Indian rice]
ref|XP_002990366.1|  hypothetical protein SELMODRAFT_43971              116   5e-27   
emb|CDX75968.1|  BnaC03g40510D                                          116   7e-27   
ref|XP_007153356.1|  hypothetical protein PHAVU_003G028600g             115   8e-27   Phaseolus vulgaris [French bean]
ref|XP_009135580.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    115   9e-27   Brassica rapa
ref|XP_010477900.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    115   9e-27   Camelina sativa [gold-of-pleasure]
emb|CDX82342.1|  BnaA03g34790D                                          115   1e-26   
ref|NP_001041979.1|  Os01g0140100                                       115   1e-26   
ref|XP_008668690.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    115   1e-26   
ref|XP_006843768.1|  hypothetical protein AMTR_s00007p00241440          115   1e-26   Amborella trichopoda
dbj|BAJ97639.1|  predicted protein                                      115   1e-26   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|KCW86348.1|  hypothetical protein EUGRSUZ_B03036                     115   2e-26   Eucalyptus grandis [rose gum]
ref|XP_006374138.1|  hypothetical protein POPTR_0015s02540g             115   2e-26   Populus trichocarpa [western balsam poplar]
ref|XP_010044282.1|  PREDICTED: LOW QUALITY PROTEIN: protein ASPA...    115   2e-26   Eucalyptus grandis [rose gum]
ref|XP_002315953.1|  aspartyl protease family protein                   114   2e-26   Populus trichocarpa [western balsam poplar]
gb|EMS50115.1|  Aspartic proteinase nepenthesin-2                       112   2e-26   Triticum urartu
emb|CAE05761.2|  OSJNBa0064G10.12                                       114   2e-26   Oryza sativa Japonica Group [Japonica rice]
gb|EAZ32412.1|  hypothetical protein OsJ_16623                          114   2e-26   Oryza sativa Japonica Group [Japonica rice]
ref|NP_001054261.2|  Os04g0677100                                       114   2e-26   
emb|CAJ86229.1|  H0402C08.5                                             114   2e-26   Oryza sativa [red rice]
emb|CDY25371.1|  BnaA05g19130D                                          114   3e-26   Brassica napus [oilseed rape]
ref|XP_006362549.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    114   3e-26   Solanum tuberosum [potatoes]
ref|XP_006415880.1|  hypothetical protein EUTSA_v10009899mg             114   3e-26   Eutrema salsugineum [saltwater cress]
emb|CDY24567.1|  BnaC05g32510D                                          114   3e-26   Brassica napus [oilseed rape]
ref|XP_002965292.1|  hypothetical protein SELMODRAFT_83230              114   4e-26   
ref|XP_002986620.1|  hypothetical protein SELMODRAFT_124369             114   4e-26   
ref|XP_010926497.1|  PREDICTED: LOW QUALITY PROTEIN: protein ASPA...    114   4e-26   Elaeis guineensis
ref|XP_004497116.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    114   4e-26   Cicer arietinum [garbanzo]
emb|CBI27051.3|  unnamed protein product                                111   4e-26   Vitis vinifera
ref|XP_008351877.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    114   4e-26   
ref|XP_002979394.1|  hypothetical protein SELMODRAFT_53966              113   4e-26   
gb|KFK44545.1|  hypothetical protein AALP_AA1G270600                    114   4e-26   Arabis alpina [alpine rockcress]
ref|XP_002978584.1|  hypothetical protein SELMODRAFT_54048              113   5e-26   
ref|XP_009608744.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    114   5e-26   Nicotiana tomentosiformis
gb|KDO70057.1|  hypothetical protein CISIN_1g0117491mg                  110   5e-26   Citrus sinensis [apfelsine]
ref|XP_003534178.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    114   5e-26   Glycine max [soybeans]
ref|XP_010527532.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    114   5e-26   Tarenaya hassleriana [spider flower]
ref|XP_010499100.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    113   7e-26   Camelina sativa [gold-of-pleasure]
ref|XP_010460347.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    113   8e-26   Camelina sativa [gold-of-pleasure]
ref|XP_004238952.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    113   8e-26   Solanum lycopersicum
ref|XP_001759252.1|  predicted protein                                  112   9e-26   
gb|KDP29378.1|  hypothetical protein JCGZ_18299                         113   9e-26   Jatropha curcas
ref|XP_011004863.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    112   1e-25   
ref|XP_010695864.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    112   1e-25   
ref|XP_009762361.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    112   1e-25   
gb|KDP20100.1|  hypothetical protein JCGZ_05869                         112   2e-25   
emb|CDY51131.1|  BnaA07g37140D                                          111   2e-25   
ref|XP_004299230.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    112   2e-25   
ref|XP_006437718.1|  hypothetical protein CICLE_v10031364mg             111   3e-25   
ref|XP_002511962.1|  Aspartic proteinase nepenthesin-1 precursor,...    112   3e-25   
ref|XP_006484425.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    111   3e-25   
gb|KJB52970.1|  hypothetical protein B456_008G285900                    111   3e-25   
ref|XP_009616228.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    111   3e-25   
gb|EPS61272.1|  hypothetical protein M569_13524                         111   3e-25   
ref|XP_004298296.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    111   3e-25   
ref|NP_173922.1|  aspartyl protease family protein                      111   3e-25   
ref|XP_002281973.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    111   4e-25   
ref|XP_002964789.1|  hypothetical protein SELMODRAFT_82470              110   4e-25   
ref|XP_011089579.1|  PREDICTED: LOW QUALITY PROTEIN: protein ASPA...    111   4e-25   
ref|XP_008359997.1|  PREDICTED: LOW QUALITY PROTEIN: protein ASPA...    112   4e-25   
ref|XP_002529147.1|  Aspartic proteinase nepenthesin-1 precursor,...    111   4e-25   
ref|XP_009356391.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    110   6e-25   
emb|CDP20336.1|  unnamed protein product                                110   6e-25   
ref|XP_010533981.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    110   8e-25   
ref|XP_004512945.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    110   1e-24   
ref|XP_007036465.1|  Eukaryotic aspartyl protease family protein        110   1e-24   
emb|CDP20730.1|  unnamed protein product                                110   1e-24   
ref|XP_008243190.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    110   1e-24   
ref|XP_002966033.1|  hypothetical protein SELMODRAFT_64135              108   1e-24   
ref|XP_002890686.1|  aspartyl protease family protein                   109   1e-24   
ref|XP_002971459.1|  hypothetical protein SELMODRAFT_64134              108   1e-24   
ref|XP_008389306.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    109   2e-24   
ref|XP_009336599.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    109   2e-24   
ref|XP_009103072.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    109   2e-24   
ref|XP_009800603.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    109   2e-24   
ref|XP_011008360.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    108   3e-24   
ref|XP_001757102.1|  predicted protein                                  108   3e-24   
ref|XP_008668689.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    108   3e-24   
ref|XP_010551158.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    108   6e-24   
ref|XP_006306517.1|  hypothetical protein CARUB_v10012516mg             107   7e-24   
tpg|DAA35351.1|  TPA: hypothetical protein ZEAMMB73_696016              108   7e-24   
ref|XP_010551288.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    107   1e-23   
ref|XP_009609715.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    106   2e-23   
gb|EYU40867.1|  hypothetical protein MIMGU_mgv1a023461mg                107   2e-23   
ref|XP_008791253.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    106   2e-23   
ref|XP_010092769.1|  Aspartic proteinase nepenthesin-1                  106   2e-23   
ref|XP_002961719.1|  hypothetical protein SELMODRAFT_64161              105   3e-23   
ref|XP_010688619.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    106   3e-23   
ref|XP_002442591.1|  hypothetical protein SORBIDRAFT_08g022580          105   4e-23   
ref|XP_001784204.1|  predicted protein                                  104   4e-23   
ref|XP_009798772.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    105   4e-23   
ref|XP_010549135.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    105   5e-23   
ref|XP_010265215.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    105   6e-23   
ref|XP_011072934.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    104   1e-22   
gb|KJB50738.1|  hypothetical protein B456_008G185200                    104   1e-22   
gb|KEH27070.1|  aspartic protease in GUARD CELL-like protein            103   2e-22   
gb|EAY75637.1|  hypothetical protein OsI_03542                          103   3e-22   
dbj|BAB84414.1|  chloroplast nucleoid DNA-binding protein cnd41-like    103   3e-22   
gb|EAZ13356.1|  hypothetical protein OsJ_03278                          103   3e-22   
emb|CDY03848.1|  BnaC07g10730D                                          103   4e-22   
ref|XP_002442590.1|  hypothetical protein SORBIDRAFT_08g022570          103   5e-22   
ref|XP_007046283.1|  Eukaryotic aspartyl protease family protein        102   6e-22   
ref|XP_010911344.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    100   8e-22   
ref|XP_006646269.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...    101   9e-22   
ref|XP_010105777.1|  Aspartic proteinase nepenthesin-1                  100   3e-21   
ref|XP_007225636.1|  hypothetical protein PRUPE_ppa003917mg             100   5e-21   
gb|EYU19035.1|  hypothetical protein MIMGU_mgv1a021892mg              99.8    6e-21   
ref|XP_008393394.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...  95.9    7e-21   
ref|XP_006341626.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...  99.4    9e-21   
ref|XP_002443631.1|  hypothetical protein SORBIDRAFT_08g022620        99.4    1e-20   
ref|XP_002468182.1|  hypothetical protein SORBIDRAFT_01g041210        99.4    1e-20   
ref|XP_008795461.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...  97.4    2e-20   
ref|XP_004235788.2|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...  98.6    2e-20   
ref|XP_011077177.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...  97.8    3e-20   
ref|XP_004972145.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...  97.1    5e-20   
ref|XP_003580821.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...  97.1    5e-20   
ref|XP_004503002.1|  PREDICTED: aspartic proteinase nepenthesin-1...  96.3    1e-19   
ref|XP_008675097.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...  95.9    1e-19   
ref|XP_003567056.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...  95.5    1e-19   
ref|XP_010677970.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...  95.9    2e-19   
gb|EAZ09523.1|  hypothetical protein OsI_31798                        95.5    2e-19   
ref|NP_001063501.1|  Os09g0482200                                     95.5    2e-19   
ref|XP_004957153.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...  94.7    3e-19   
ref|XP_009625615.1|  PREDICTED: aspartic proteinase nepenthesin-1     94.0    5e-19   
ref|NP_001183392.1|  uncharacterized protein LOC100501808             92.8    6e-19   
ref|XP_010913225.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...  94.0    6e-19   
gb|EYU25643.1|  hypothetical protein MIMGU_mgv1a027134mg              93.6    6e-19   
ref|XP_006345762.1|  PREDICTED: aspartic proteinase nepenthesin-1...  92.8    1e-18   
ref|XP_008356685.1|  PREDICTED: LOW QUALITY PROTEIN: aspartic pro...  91.3    2e-18   
ref|XP_004239252.1|  PREDICTED: aspartic proteinase nepenthesin-1...  93.2    2e-18   
ref|XP_010674342.1|  PREDICTED: aspartic proteinase nepenthesin-1     92.4    2e-18   
ref|XP_009801916.1|  PREDICTED: aspartic proteinase nepenthesin-1     92.0    2e-18   
ref|XP_002986201.1|  hypothetical protein SELMODRAFT_234982           92.0    2e-18   
ref|XP_004168776.1|  PREDICTED: aspartic proteinase nepenthesin-1...  91.7    4e-18   
ref|XP_003614103.1|  Aspartic proteinase nepenthesin-1                91.7    4e-18   
gb|KGN54860.1|  hypothetical protein Csa_4G554680                     91.7    4e-18   
ref|XP_006354419.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...  92.4    4e-18   
ref|XP_002985015.1|  hypothetical protein SELMODRAFT_121417           92.0    5e-18   
dbj|BAJ99659.1|  predicted protein                                    91.7    5e-18   
ref|XP_003627786.1|  Aspartic proteinase nepenthesin-1                91.3    5e-18   
ref|XP_010099762.1|  Aspartic proteinase nepenthesin-1                91.3    5e-18   
gb|EYU29201.1|  hypothetical protein MIMGU_mgv1a005225mg              91.7    5e-18   
ref|XP_004500468.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...  91.7    6e-18   
ref|XP_003617399.1|  60S ribosomal protein L18a                       92.4    6e-18   
ref|XP_006373545.1|  hypothetical protein POPTR_0016s00260g           91.3    6e-18   
ref|XP_008380197.1|  PREDICTED: aspartic proteinase nepenthesin-2     91.7    7e-18   
ref|XP_009377195.1|  PREDICTED: aspartic proteinase nepenthesin-2...  91.7    7e-18   
ref|XP_009363121.1|  PREDICTED: aspartic proteinase nepenthesin-1     90.9    7e-18   
ref|XP_007146932.1|  hypothetical protein PHAVU_006G083000g           91.7    7e-18   
ref|XP_008381436.1|  PREDICTED: aspartic proteinase nepenthesin-1     90.9    8e-18   
ref|XP_006660750.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...  90.9    9e-18   
ref|XP_008229704.1|  PREDICTED: uncharacterized protein LOC103329046  92.0    9e-18   
gb|AHA84134.1|  aspartic proteinase nepenthesin-1                     90.9    9e-18   
ref|XP_008776818.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...  89.4    1e-17   
ref|XP_004144695.1|  PREDICTED: LOW QUALITY PROTEIN: aspartic pro...  91.7    1e-17   
ref|XP_004491319.1|  PREDICTED: LOW QUALITY PROTEIN: probable asp...  91.7    1e-17   
ref|XP_008453384.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...  90.9    1e-17   
ref|XP_008220626.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...  90.5    1e-17   
ref|XP_010499694.1|  PREDICTED: probable aspartic protease At2g35615  90.1    1e-17   
ref|XP_004239638.1|  PREDICTED: aspartic proteinase nepenthesin-1     90.1    1e-17   
ref|XP_007146522.1|  hypothetical protein PHAVU_006G048000g           90.5    1e-17   
ref|XP_010035929.1|  PREDICTED: aspartic proteinase nepenthesin-2...  91.3    1e-17   
ref|NP_174430.1|  aspartyl protease-like protein                      90.1    1e-17   
emb|CDO98452.1|  unnamed protein product                              90.1    1e-17   
gb|AET00358.2|  eukaryotic aspartyl protease family protein           90.9    1e-17   
ref|XP_007215315.1|  hypothetical protein PRUPE_ppa003547mg           90.9    1e-17   
gb|KJB51470.1|  hypothetical protein B456_008G217800                  89.7    2e-17   
ref|XP_002458414.1|  hypothetical protein SORBIDRAFT_03g033075        89.7    2e-17   
ref|XP_002271145.2|  PREDICTED: aspartic proteinase CDR1-like         89.0    2e-17   
ref|XP_002520371.1|  basic 7S globulin 2 precursor small subunit,...  90.5    2e-17   
ref|XP_011100548.1|  PREDICTED: aspartic proteinase nepenthesin-2...  90.5    2e-17   
ref|XP_008442220.1|  PREDICTED: aspartic proteinase nepenthesin-1     89.7    2e-17   
gb|KGN63809.1|  hypothetical protein Csa_1G022480                     89.7    2e-17   
ref|XP_004170576.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...  90.1    2e-17   
ref|XP_004138237.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...  90.1    2e-17   
gb|KHN11976.1|  Aspartic proteinase nepenthesin-1                     90.1    2e-17   
ref|XP_011044763.1|  PREDICTED: aspartic proteinase nepenthesin-2...  90.1    2e-17   
emb|CAN61225.1|  hypothetical protein VITISV_006732                   89.4    3e-17   
ref|XP_003570481.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...  89.4    3e-17   
ref|XP_010480892.1|  PREDICTED: probable aspartic protease At2g35615  89.4    3e-17   
ref|XP_007146226.1|  hypothetical protein PHAVU_006G022800g           90.1    3e-17   
ref|XP_003620775.1|  Aspartic proteinase nepenthesin-1                89.4    3e-17   
gb|KEH35638.1|  aspartic proteinase nepenthesin                       89.4    3e-17   
ref|XP_004506716.1|  PREDICTED: aspartic proteinase CDR1-like         89.0    3e-17   
ref|XP_006828037.1|  hypothetical protein AMTR_s00008p00256490        89.0    3e-17   
ref|XP_007221482.1|  hypothetical protein PRUPE_ppa005446mg           89.4    3e-17   
ref|XP_009142895.1|  PREDICTED: aspartic proteinase nepenthesin-2     89.7    3e-17   
ref|XP_007157022.1|  hypothetical protein PHAVU_002G037000g           89.0    3e-17   
emb|CDX79836.1|  BnaA05g03200D                                        89.7    3e-17   
ref|XP_003553140.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...  89.7    3e-17   
gb|KJB08584.1|  hypothetical protein B456_001G092100                  89.7    3e-17   
ref|XP_003552901.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...  89.7    3e-17   
dbj|BAJ53226.1|  JHL06P13.6                                           89.0    3e-17   
gb|KDO51883.1|  hypothetical protein CISIN_1g041228mg                 89.7    3e-17   
gb|KDP37099.1|  hypothetical protein JCGZ_06155                       88.6    3e-17   
ref|XP_002307559.2|  hypothetical protein POPTR_0005s22630g           89.7    3e-17   
ref|XP_004151699.1|  PREDICTED: probable aspartic protease At2g35...  86.7    3e-17   
ref|XP_007157024.1|  hypothetical protein PHAVU_002G037200g           88.6    3e-17   
ref|XP_008353635.1|  PREDICTED: aspartic proteinase nepenthesin-2...  89.7    4e-17   
emb|CDY53652.1|  BnaC04g52860D                                        89.4    4e-17   
ref|XP_007048981.1|  Eukaryotic aspartyl protease family protein ...  89.7    4e-17   
gb|EMT14793.1|  Aspartic proteinase nepenthesin-2                     88.6    4e-17   
dbj|BAJ91382.1|  predicted protein                                    89.0    4e-17   
ref|XP_006437136.1|  hypothetical protein CICLE_v10031104mg           89.4    4e-17   
gb|KJB71343.1|  hypothetical protein B456_011G117400                  88.6    4e-17   
emb|CDP15730.1|  unnamed protein product                              89.4    4e-17   
ref|XP_007048982.1|  Eukaryotic aspartyl protease family protein ...  89.0    4e-17   
gb|EMS52672.1|  Aspartic proteinase nepenthesin-2                     88.6    4e-17   
ref|XP_004513307.1|  PREDICTED: aspartic proteinase CDR1-like         88.6    5e-17   
emb|CDM84701.1|  unnamed protein product                              88.6    5e-17   
ref|XP_008452152.1|  PREDICTED: probable aspartic protease At2g35615  88.2    5e-17   
ref|XP_008784432.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...  89.4    5e-17   
ref|XP_003610885.1|  Aspartic proteinase nepenthesin-1                88.2    5e-17   
gb|ABP93697.1|  unknown protein isoform 2                             87.4    5e-17   
ref|XP_010524109.1|  PREDICTED: aspartic proteinase nepenthesin-1...  89.0    5e-17   
ref|XP_006484924.1|  PREDICTED: uncharacterized protein LOC102625748  89.7    5e-17   
ref|XP_007133780.1|  hypothetical protein PHAVU_011G208400g           88.2    5e-17   
ref|XP_001779661.1|  predicted protein                                88.2    5e-17   
ref|XP_006415326.1|  hypothetical protein EUTSA_v10009809mg           88.2    5e-17   
ref|XP_006595492.1|  PREDICTED: uncharacterized protein LOC100305...  89.7    5e-17   
ref|XP_011467594.1|  PREDICTED: aspartic proteinase nepenthesin-2     89.0    5e-17   
ref|XP_006357686.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...  89.0    6e-17   
ref|XP_009390623.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...  88.6    6e-17   
ref|NP_001046662.1|  Os02g0314600                                     88.6    6e-17   
ref|XP_007141420.1|  hypothetical protein PHAVU_008G193900g           89.0    6e-17   
ref|XP_010525594.1|  PREDICTED: aspartic proteinase nepenthesin-2     89.0    6e-17   
gb|KGN55408.1|  hypothetical protein Csa_4G651750                     87.4    6e-17   
ref|XP_004489816.1|  PREDICTED: aspartic proteinase CDR1-like         88.2    6e-17   
gb|EAY85563.1|  hypothetical protein OsI_06935                        88.6    6e-17   
gb|KHN37639.1|  Putative aspartic protease                            87.8    7e-17   
ref|XP_010087862.1|  Aspartic proteinase nepenthesin-1                89.0    7e-17   
ref|XP_010508488.1|  PREDICTED: aspartic proteinase CDR1-like         88.6    7e-17   
gb|KHN35116.1|  Putative aspartic protease                            87.0    7e-17   
ref|XP_010091139.1|  Aspartic proteinase nepenthesin-2                84.3    7e-17   
ref|XP_010065986.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...  88.2    7e-17   
ref|XP_002460431.1|  hypothetical protein SORBIDRAFT_02g028000        88.2    7e-17   
ref|XP_009114173.1|  PREDICTED: aspartic proteinase nepenthesin-1     88.2    7e-17   
emb|CBI39998.3|  unnamed protein product                              86.7    7e-17   
ref|XP_002272802.1|  PREDICTED: aspartic proteinase nepenthesin-1     87.8    8e-17   
gb|AFB33417.1|  hypothetical protein 2_5996_01                        84.3    8e-17   
gb|KDP26966.1|  hypothetical protein JCGZ_22200                       88.6    8e-17   
ref|XP_011080092.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...  88.2    8e-17   
ref|XP_006648575.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...  88.2    8e-17   
ref|XP_009417820.1|  PREDICTED: aspartic proteinase nepenthesin-1...  87.4    8e-17   
ref|XP_011085418.1|  PREDICTED: aspartic proteinase nepenthesin-2...  88.6    8e-17   
gb|KGN53444.1|  hypothetical protein Csa_4G055390                     87.4    8e-17   
ref|XP_008670374.1|  PREDICTED: aspartic proteinase nepenthesin-2...  88.2    9e-17   
ref|XP_004243605.1|  PREDICTED: aspartic proteinase nepenthesin-2...  88.6    9e-17   
ref|XP_009421481.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...  88.6    9e-17   
ref|XP_008778737.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...  88.6    9e-17   
ref|XP_003541603.1|  PREDICTED: aspartic proteinase CDR1-like         87.4    9e-17   
ref|XP_008227834.1|  PREDICTED: aspartic proteinase nepenthesin-1     87.8    1e-16   
ref|XP_004164554.1|  PREDICTED: probable aspartic protease At2g35...  87.4    1e-16   
ref|XP_007157023.1|  hypothetical protein PHAVU_002G037100g           87.4    1e-16   
ref|XP_006574359.1|  PREDICTED: uncharacterized protein LOC100527...  89.0    1e-16   
gb|KHN29184.1|  Putative aspartic protease                            87.4    1e-16   
ref|XP_003538663.2|  PREDICTED: aspartic proteinase CDR1-like         87.4    1e-16   
ref|XP_004150866.1|  PREDICTED: protein ASPARTIC PROTEASE IN GUAR...  87.8    1e-16   
ref|XP_010241281.1|  PREDICTED: aspartic proteinase nepenthesin-1...  88.2    1e-16   
ref|XP_002881883.1|  hypothetical protein ARALYDRAFT_903676           88.2    1e-16   
ref|XP_010517850.1|  PREDICTED: aspartic proteinase CDR1-like         88.2    1e-16   
gb|KHN38336.1|  Aspartic proteinase nepenthesin-2                     88.2    1e-16   
emb|CDY17408.1|  BnaC09g21290D                                        87.4    1e-16   



>ref|XP_009800816.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 2-like [Nicotiana 
sylvestris]
Length=474

 Score =   209 bits (533),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 119/176 (68%), Positives = 137/176 (78%), Gaps = 6/176 (3%)
 Frame = +3

Query  96   ETXSLRPLPTAQHYSLSSKPQYSQTLVQPDDSENTLSLDLHHIDLIS--SAAVNATPKAL  269
            +T +LR LP  Q  SLS   Q S    QP +SENTL++ LHH+DLI+  ++  N TP AL
Sbjct  29   QTLTLRSLPEPQ--SLSWATQDSNDF-QPLNSENTLAVQLHHVDLITPYTSLSNTTPHAL  85

Query  270  FVKRLQRDaarakalsllaaaaPPHNATRGRDFSSSVISGLAQGSGEYFTRLGVGTPPKY  449
            F  RLQRDA RAK LS LA A    NAT  +DFSSSVISGLAQGSGEYFTR+G+GTPPKY
Sbjct  86   FKLRLQRDAVRAKLLSNLAEAVANANATV-KDFSSSVISGLAQGSGEYFTRIGIGTPPKY  144

Query  450  AFMVLDTGSDVVWLQCSPCRKCYAQTDPVFDPSKSSSFVGVKCDSPLCRRLDSSGC  617
            A+MVLDTGSDVVW+QC PCR+CY Q+DPVFDP+KSSSF G+ CDSPLCRRLDS GC
Sbjct  145  AYMVLDTGSDVVWIQCLPCRQCYNQSDPVFDPTKSSSFTGLSCDSPLCRRLDSPGC  200



>ref|XP_004248083.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 1 [Solanum 
lycopersicum]
Length=458

 Score =   207 bits (528),  Expect = 8e-61, Method: Compositional matrix adjust.
 Identities = 117/174 (67%), Positives = 139/174 (80%), Gaps = 14/174 (8%)
 Frame = +3

Query  96   ETXSLRPLPTAQHYSLSSKPQYSQTLVQPDDSENTLSLDLHHIDLISSAAVNATPKALFV  275
            +T +L PLP  Q  SLS +PQ S       D+ENTLS+ LHH+DL+S ++ NATP ALF 
Sbjct  24   QTLTLNPLPQLQ--SLSWEPQLSS------DNENTLSVQLHHVDLLSPSSFNATPHALFK  75

Query  276  KRLQRDaarakalsllaaaaPPHNATRGRDFSSSVISGLAQGSGEYFTRLGVGTPPKYAF  455
             RLQRDA RAK+LSLL+A     N+T G+DFSSSVISGL+QGSGEYFTR+G+GTP KY +
Sbjct  76   LRLQRDAIRAKSLSLLSA-----NST-GKDFSSSVISGLSQGSGEYFTRIGIGTPVKYVY  129

Query  456  MVLDTGSDVVWLQCSPCRKCYAQTDPVFDPSKSSSFVGVKCDSPLCRRLDSSGC  617
            +VLDTGSD+VW+QC PC KCY+Q+DPVFDPSKSSSF  V CDSPLCRRLDSSGC
Sbjct  130  LVLDTGSDIVWIQCLPCSKCYSQSDPVFDPSKSSSFSTVTCDSPLCRRLDSSGC  183



>ref|XP_006339720.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 2-like [Solanum 
tuberosum]
Length=480

 Score =   206 bits (524),  Expect = 6e-60, Method: Compositional matrix adjust.
 Identities = 110/182 (60%), Positives = 127/182 (70%), Gaps = 10/182 (5%)
 Frame = +3

Query  96   ETXSLRPLPTAQHYSLSSKPQYSQTLVQPDDSENTLSLDLHHIDLISSAAVNATPKALFV  275
            +T  L  LP  Q  SL    Q         D +NTLSL LHH+DL+S ++ NATP ALF 
Sbjct  28   QTLLLHSLPLTQLQSLDFDAQLLSGDGSDLDPDNTLSLQLHHVDLVSPSSFNATPHALFK  87

Query  276  KRLQRDa--------arakalsllaaaaPPHNATRGRDFSSSVISGLAQGSGEYFTRLGV  431
             RLQRDA          A   ++   A  PH    GRDFSSSV+SGL+QGSGEYFTR+GV
Sbjct  88   LRLQRDAYRAKAISDLAAANATVGRRAGKPHAG--GRDFSSSVVSGLSQGSGEYFTRIGV  145

Query  432  GTPPKYAFMVLDTGSDVVWLQCSPCRKCYAQTDPVFDPSKSSSFVGVKCDSPLCRRLDSS  611
            GTPPKY +MVLDTGSDVVW+QCSPC+KCY Q+DPVFDPSKSSSF+GV C SPLCRRLDS+
Sbjct  146  GTPPKYVYMVLDTGSDVVWIQCSPCKKCYTQSDPVFDPSKSSSFLGVACGSPLCRRLDSA  205

Query  612  GC  617
             C
Sbjct  206  SC  207



>ref|XP_009600181.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 2-like [Nicotiana 
tomentosiformis]
Length=474

 Score =   205 bits (522),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 115/176 (65%), Positives = 138/176 (78%), Gaps = 6/176 (3%)
 Frame = +3

Query  96   ETXSLRPLPTAQHYSLSSKPQYSQTLVQPDDSENTLSLDLHHIDLIS--SAAVNATPKAL  269
            +T +LR LP  Q  S +++  Y     QP +S+NTL++ LHH+DLI+  ++  N TP AL
Sbjct  29   QTLTLRSLPEPQSLSWATQDSYD---FQPLNSQNTLAVQLHHVDLITPYTSLFNTTPHAL  85

Query  270  FVKRLQRDaarakalsllaaaaPPHNATRGRDFSSSVISGLAQGSGEYFTRLGVGTPPKY  449
            F  RLQRDA RA+ LS LA AA   NAT  +DFSSSVISGLAQGSGEYFTR+G+GTPPKY
Sbjct  86   FKLRLQRDAVRAELLSKLAEAAANANATV-KDFSSSVISGLAQGSGEYFTRIGIGTPPKY  144

Query  450  AFMVLDTGSDVVWLQCSPCRKCYAQTDPVFDPSKSSSFVGVKCDSPLCRRLDSSGC  617
            A++VLDTGSDVVW+QC PCR+CY Q+DPVFDPSKSSSF G+ CDSPLCRRLDS GC
Sbjct  145  AYLVLDTGSDVVWIQCLPCRQCYNQSDPVFDPSKSSSFTGLSCDSPLCRRLDSPGC  200



>ref|XP_006362137.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 2-like [Solanum 
tuberosum]
Length=461

 Score =   203 bits (517),  Expect = 4e-59, Method: Compositional matrix adjust.
 Identities = 117/174 (67%), Positives = 140/174 (80%), Gaps = 11/174 (6%)
 Frame = +3

Query  96   ETXSLRPLPTAQHYSLSSKPQYSQTLVQPDDSENTLSLDLHHIDLISSAAVNATPKALFV  275
            +T +L  LP  Q  SLS +PQ S       D+ENTLS+ LHH+DL+S ++ NATP ALF 
Sbjct  24   QTLTLNSLPQLQ--SLSWEPQLSS------DNENTLSVQLHHVDLLSPSSFNATPHALFK  75

Query  276  KRLQRDaarakalsllaaaaPPHNATRGRDFSSSVISGLAQGSGEYFTRLGVGTPPKYAF  455
             RLQRDA RAK+LSLL+A+A   N+T G+DFSSSVISGL+QGSGEYFTR+G+GTP KY +
Sbjct  76   LRLQRDAIRAKSLSLLSASA--ANST-GKDFSSSVISGLSQGSGEYFTRIGIGTPTKYVY  132

Query  456  MVLDTGSDVVWLQCSPCRKCYAQTDPVFDPSKSSSFVGVKCDSPLCRRLDSSGC  617
            +VLDTGSD+VW+QC PC KCY+Q+DPVFDPSKSSSF  V CDSPLCRRLDSSGC
Sbjct  133  LVLDTGSDIVWIQCLPCAKCYSQSDPVFDPSKSSSFSPVTCDSPLCRRLDSSGC  186



>ref|XP_009613969.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 2-like [Nicotiana 
tomentosiformis]
Length=510

 Score =   204 bits (518),  Expect = 9e-59, Method: Compositional matrix adjust.
 Identities = 117/185 (63%), Positives = 137/185 (74%), Gaps = 11/185 (6%)
 Frame = +3

Query  96   ETXSLRPLPTAQHYSLSSKPQYSQTLVQPD----DSENTLSLDLHHIDLISSAAVNATPK  263
            +T  L  LP ++  SLS   +  +  +  D    D + TLS+ LHH+DL+S ++ NATP 
Sbjct  53   QTLVLNSLPNSEPQSLSWATEDFEAQLSGDGSNPDPDTTLSVQLHHVDLVSPSSFNATPH  112

Query  264  ALFVKRLQRDaarakalsllaaaa-------PPHNATRGRDFSSSVISGLAQGSGEYFTR  422
            ALF  RLQRDAARAKALS LAAA          H+    RDFSSSV SGLAQGSGEYFTR
Sbjct  113  ALFKLRLQRDAARAKALSDLAAANITVGRRGGGHHVVGSRDFSSSVTSGLAQGSGEYFTR  172

Query  423  LGVGTPPKYAFMVLDTGSDVVWLQCSPCRKCYAQTDPVFDPSKSSSFVGVKCDSPLCRRL  602
            LGVGTPPKYA+MVLDTGSDVVW+QCSPC+KCY Q+DPVFDP+KS+SF+GV C SPLCRRL
Sbjct  173  LGVGTPPKYAYMVLDTGSDVVWIQCSPCKKCYTQSDPVFDPTKSTSFLGVSCGSPLCRRL  232

Query  603  DSSGC  617
            DS GC
Sbjct  233  DSPGC  237



>ref|XP_011093028.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 2-like [Sesamum 
indicum]
Length=476

 Score =   198 bits (504),  Expect = 4e-57, Method: Compositional matrix adjust.
 Identities = 119/192 (62%), Positives = 142/192 (74%), Gaps = 6/192 (3%)
 Frame = +3

Query  51   FSYFLAIpssppsITETXSLRPLPTAQHYSLSSKPQYSQTLVQPDDSENTLSLDLHHIDL  230
             S FL I SS P   +T  L  LP  Q  S  ++ Q S+T VQP  S  TLSLDLHH+D 
Sbjct  14   LSLFLTISSSAPLQYQTFLLTSLPNPQSLSWPTQ-QDSETQVQPH-SHTTLSLDLHHVDN  71

Query  231  ISSAAVNATPKALFVKRLQRDaarakalsllaaaaPPHNATRGR---DFSSSVISGLAQG  401
            +S    N+TP++LF  RL+RDA R KALS ++A +  + + + R   DFSSSVISGLAQG
Sbjct  72   LS-PDFNSTPQSLFKLRLRRDAIRVKALSTISAVSQTNVSGQPRAAGDFSSSVISGLAQG  130

Query  402  SGEYFTRLGVGTPPKYAFMVLDTGSDVVWLQCSPCRKCYAQTDPVFDPSKSSSFVGVKCD  581
            SGEYFTR+G+GTPPKY +MVLDTGSDVVW+QCSPCRKCY+QTDPVFDP  S+SF+GV C 
Sbjct  131  SGEYFTRIGIGTPPKYVYMVLDTGSDVVWVQCSPCRKCYSQTDPVFDPKASTSFLGVSCG  190

Query  582  SPLCRRLDSSGC  617
            SPLCRRLDS GC
Sbjct  191  SPLCRRLDSPGC  202



>ref|XP_004229990.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 2-like [Solanum 
lycopersicum]
Length=500

 Score =   197 bits (500),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 107/186 (58%), Positives = 125/186 (67%), Gaps = 17/186 (9%)
 Frame = +3

Query  96   ETXSLRPLPTAQHYSLSSKPQYSQTLVQPD----DSENTLSLDLHHIDLISSAAVNATPK  263
             T  L  LP  Q   L     +   L+  D    D +N LSL LHH+DL+S ++ NATP 
Sbjct  47   HTLLLHSLPLTQ---LQKSLHFDAQLLSGDGSDLDPDNALSLQLHHVDLVSPSSFNATPH  103

Query  264  ALFVKRLQRDa--------arakalsllaaaaPPHNATRGRDFSSSVISGLAQGSGEYFT  419
            ALF  RLQRDA          +   ++   A  PH    GRDFSSSV+SGL+QGSGEYFT
Sbjct  104  ALFKLRLQRDAYRAKAISDLASANATVGRRAGKPHPG--GRDFSSSVVSGLSQGSGEYFT  161

Query  420  RLGVGTPPKYAFMVLDTGSDVVWLQCSPCRKCYAQTDPVFDPSKSSSFVGVKCDSPLCRR  599
            R+GVGTP KY +MVLDTGSDVVW+QCSPC+KCY Q+DPVFDPSKSSSF+GV C SPLCRR
Sbjct  162  RIGVGTPSKYVYMVLDTGSDVVWIQCSPCKKCYTQSDPVFDPSKSSSFLGVACGSPLCRR  221

Query  600  LDSSGC  617
            LDS  C
Sbjct  222  LDSGSC  227



>gb|EYU40714.1| hypothetical protein MIMGU_mgv1a019320mg [Erythranthe guttata]
Length=469

 Score =   196 bits (498),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 111/178 (62%), Positives = 137/178 (77%), Gaps = 11/178 (6%)
 Frame = +3

Query  96   ETXSLRPLPTAQHYSLS-SKPQYSQTLVQPDDSENTLSLDLHHID-LISSAAVNATPKAL  269
            +T  L  LP  Q  SLS    Q S + ++P+ S+ TLSLDLHH+D L  SAA ++TP++L
Sbjct  25   QTLVLTSLPNPQSQSLSWPTQQQSDSQIRPE-SDTTLSLDLHHLDNLPPSAAFSSTPQSL  83

Query  270  FVKRLQRDaarakalsllaaaaPPHNATRGR--DFSSSVISGLAQGSGEYFTRLGVGTPP  443
            F  RL+RDA R +ALS LA      N + GR  DFSSS++SGLAQGSGEYFTR+G+GTPP
Sbjct  84   FKLRLRRDAVRVRALSTLA------NVSGGRPGDFSSSIVSGLAQGSGEYFTRIGIGTPP  137

Query  444  KYAFMVLDTGSDVVWLQCSPCRKCYAQTDPVFDPSKSSSFVGVKCDSPLCRRLDSSGC  617
            KY +MVLDTGSDVVW+QCSPCRKCY+Q+DPVFDP  S+SF+G+ CDSP+CRRLDS GC
Sbjct  138  KYVYMVLDTGSDVVWVQCSPCRKCYSQSDPVFDPKSSTSFLGLTCDSPVCRRLDSPGC  195



>ref|XP_009775618.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 2-like [Nicotiana 
sylvestris]
Length=491

 Score =   196 bits (499),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 119/185 (64%), Positives = 137/185 (74%), Gaps = 11/185 (6%)
 Frame = +3

Query  96   ETXSLRPLPTAQHYSLSSKPQYSQTLVQPD----DSENTLSLDLHHIDLISSAAVNATPK  263
            +T  L  LP +Q  SLS   +  +  +  D    D + TLS+ LHH+DL+S ++ NATP 
Sbjct  34   QTLVLNSLPNSQPQSLSWATEDFEAQLSGDGSNPDPDYTLSVQLHHVDLVSPSSFNATPH  93

Query  264  ALFVKRLQRDaarakalsllaaaa-------PPHNATRGRDFSSSVISGLAQGSGEYFTR  422
             LF  RLQRDAARAKALS LAAA          H+   GRDFSSSV SGLAQGSGEYFTR
Sbjct  94   TLFKLRLQRDAARAKALSDLAAANITVGRRGGGHHVVGGRDFSSSVTSGLAQGSGEYFTR  153

Query  423  LGVGTPPKYAFMVLDTGSDVVWLQCSPCRKCYAQTDPVFDPSKSSSFVGVKCDSPLCRRL  602
            LGVGTPPKYA+MVLDTGSDVVW+QCSPC+KCY Q+DPVFDP+KSSSF+GV C SPLCRRL
Sbjct  154  LGVGTPPKYAYMVLDTGSDVVWIQCSPCKKCYTQSDPVFDPTKSSSFLGVSCGSPLCRRL  213

Query  603  DSSGC  617
            DS GC
Sbjct  214  DSPGC  218



>gb|EYU38885.1| hypothetical protein MIMGU_mgv1a026932mg [Erythranthe guttata]
Length=471

 Score =   194 bits (492),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 108/180 (60%), Positives = 137/180 (76%), Gaps = 13/180 (7%)
 Frame = +3

Query  96   ETXSLRPLPTAQHYSLS-SKPQYSQTLVQPDDSENTLSLDLHHIDLI---SSAAVNATPK  263
            +T  L  LP  Q  SLS    Q S + ++P+ S+ TLSLDLHH+D +   +SAA ++TP+
Sbjct  25   QTLVLTSLPNPQSQSLSWPTQQQSDSQIRPE-SDTTLSLDLHHVDNLPPSASAAFSSTPQ  83

Query  264  ALFVKRLQRDaarakalsllaaaaPPHNATRGR--DFSSSVISGLAQGSGEYFTRLGVGT  437
            +LF  RL+RDA R +ALS +A      N + GR  DFSSS++SGLAQGSGEYFTR+G+GT
Sbjct  84   SLFKLRLRRDAVRVRALSTIA------NVSVGRPGDFSSSIVSGLAQGSGEYFTRIGIGT  137

Query  438  PPKYAFMVLDTGSDVVWLQCSPCRKCYAQTDPVFDPSKSSSFVGVKCDSPLCRRLDSSGC  617
            PPKY +MVLDTGSDVVW+QCSPCRKCY+Q+DPVFDP  S+SF+G+ C SP+CRRLDS GC
Sbjct  138  PPKYVYMVLDTGSDVVWVQCSPCRKCYSQSDPVFDPKSSTSFLGLTCHSPVCRRLDSPGC  197



>ref|XP_011093892.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 2 [Sesamum 
indicum]
Length=478

 Score =   193 bits (491),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 112/177 (63%), Positives = 130/177 (73%), Gaps = 8/177 (5%)
 Frame = +3

Query  96   ETXSLRPLPTAQHYSLSSKPQYSQTLVQPDDSENTLSLDLHHIDLISSAAVNATPKALFV  275
            +T  L PLPT Q  S    P   ++ + P  SENT SL+LHH+D +S  A N+TP++LF 
Sbjct  33   QTLVLTPLPTPQTLSW---PSQQESELGPL-SENTFSLNLHHVDSLS-PAFNSTPESLFK  87

Query  276  KRLQRDaarakalsllaaaaPPHNATRGRD---FSSSVISGLAQGSGEYFTRLGVGTPPK  446
             RL RD  R KALS LAAA   + + R R    FSSSV SGLAQGSGEYFTRLGVGTP K
Sbjct  88   LRLHRDGVRVKALSTLAAATQTNVSARARGAPGFSSSVTSGLAQGSGEYFTRLGVGTPAK  147

Query  447  YAFMVLDTGSDVVWLQCSPCRKCYAQTDPVFDPSKSSSFVGVKCDSPLCRRLDSSGC  617
            Y +MVLDTGSDVVW+QCSPCR+CY Q+DPVFDP KS+SF+GV C SPLCRRLDS GC
Sbjct  148  YVYMVLDTGSDVVWVQCSPCRRCYTQSDPVFDPRKSTSFLGVSCGSPLCRRLDSPGC  204



>gb|EYU32252.1| hypothetical protein MIMGU_mgv1a005685mg [Erythranthe guttata]
Length=474

 Score =   192 bits (489),  Expect = 7e-55, Method: Compositional matrix adjust.
 Identities = 113/191 (59%), Positives = 137/191 (72%), Gaps = 4/191 (2%)
 Frame = +3

Query  51   FSYFLAIpssppsITETXSLRPLPTAQHYSLSSKPQYSQTLVQPDDSENTLSLDLHHIDL  230
             S+FL I  S P   +T  L  LP  Q  S  S+ Q SQ +  P +SE   SL+LHH+D 
Sbjct  12   LSFFLTISFSAPLQYQTFVLTSLPQPQTISWVSQ-QESQVIETPSESETDFSLNLHHVDS  70

Query  231  ISSAAVNATPKALFVKRLQRDaarakalsllaaaa--PPHNATRGRDFSSSVISGLAQGS  404
            +S +++ +TP++LF  RL+RD  R +ALS LAA+A  P + + +   FSSSVISGLA GS
Sbjct  71   LSPSSI-STPESLFQLRLRRDGVRVEALSTLAASAAAPTNVSGKPHGFSSSVISGLAHGS  129

Query  405  GEYFTRLGVGTPPKYAFMVLDTGSDVVWLQCSPCRKCYAQTDPVFDPSKSSSFVGVKCDS  584
            GEYFTRLGVGTP KY +MVLDTGSDVVW+QCSPCRKCY Q+DPVFDP KS +F GV C S
Sbjct  130  GEYFTRLGVGTPAKYVYMVLDTGSDVVWIQCSPCRKCYTQSDPVFDPKKSKTFSGVACGS  189

Query  585  PLCRRLDSSGC  617
            PLCRRLDS GC
Sbjct  190  PLCRRLDSPGC  200



>ref|XP_006444833.1| hypothetical protein CICLE_v10019938mg [Citrus clementina]
 gb|ESR58073.1| hypothetical protein CICLE_v10019938mg [Citrus clementina]
Length=480

 Score =   190 bits (482),  Expect = 8e-54, Method: Compositional matrix adjust.
 Identities = 97/150 (65%), Positives = 114/150 (76%), Gaps = 9/150 (6%)
 Frame = +3

Query  186  DSENTLSLDLHHIDLISSAAVNATPKALFVKRLQRDa---arakalsllaaaaPPHNATR  356
            D+E++LSL LHH+D +S    N TP+ LF  R+QRD        A +  A   PP N +R
Sbjct  60   DAESSLSLRLHHVDSLS---FNRTPEHLFNLRIQRDVLRVKSLTAFAESAVRVPPRNRSR  116

Query  357  GR---DFSSSVISGLAQGSGEYFTRLGVGTPPKYAFMVLDTGSDVVWLQCSPCRKCYAQT  527
            GR    FSSSVISGLAQGSGEYFTRLGVGTPP+Y +MVLDTGSDVVW+QC+PC+KCY+QT
Sbjct  117  GRANGGFSSSVISGLAQGSGEYFTRLGVGTPPRYVYMVLDTGSDVVWIQCAPCKKCYSQT  176

Query  528  DPVFDPSKSSSFVGVKCDSPLCRRLDSSGC  617
            DPVFDP+KS SF  V C SPLCR+LDSSGC
Sbjct  177  DPVFDPAKSRSFATVPCRSPLCRKLDSSGC  206



>ref|XP_006491285.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 2-like [Citrus 
sinensis]
 gb|KDO86492.1| hypothetical protein CISIN_1g040810mg [Citrus sinensis]
Length=480

 Score =   189 bits (481),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 97/150 (65%), Positives = 114/150 (76%), Gaps = 9/150 (6%)
 Frame = +3

Query  186  DSENTLSLDLHHIDLISSAAVNATPKALFVKRLQRDa---arakalsllaaaaPPHNATR  356
            D+E++LSL LHH+D +S    N TP+ LF  R+QRD        A +  A   PP N +R
Sbjct  60   DAESSLSLRLHHVDSLS---FNRTPEHLFNLRIQRDVLRVKSLTAFAESAVRVPPRNRSR  116

Query  357  GR---DFSSSVISGLAQGSGEYFTRLGVGTPPKYAFMVLDTGSDVVWLQCSPCRKCYAQT  527
            GR    FSSSVISGLAQGSGEYFTRLGVGTPP+Y +MVLDTGSDVVW+QC+PC+KCY+QT
Sbjct  117  GRANGGFSSSVISGLAQGSGEYFTRLGVGTPPRYVYMVLDTGSDVVWIQCAPCKKCYSQT  176

Query  528  DPVFDPSKSSSFVGVKCDSPLCRRLDSSGC  617
            DPVFDP+KS SF  V C SPLCR+LDSSGC
Sbjct  177  DPVFDPAKSRSFATVPCRSPLCRKLDSSGC  206



>gb|KDP28482.1| hypothetical protein JCGZ_14253 [Jatropha curcas]
Length=478

 Score =   188 bits (477),  Expect = 4e-53, Method: Compositional matrix adjust.
 Identities = 107/177 (60%), Positives = 128/177 (72%), Gaps = 7/177 (4%)
 Frame = +3

Query  96   ETXSLRPLP--TAQHY-SLSSKPQYSQTLVQPDDSENTLSLDLHHIDLISSAAVNATPKA  266
            +T  L PLP  TA  + +  S+ +  QTL    DS  T SL LHHID +S+   N TP+ 
Sbjct  31   QTLVLNPLPRQTALSWPAADSEAETLQTLTDTADS-TTFSLQLHHIDALSN---NKTPQD  86

Query  267  LFVKRLQRDaarakalsllaaaaPPHNATRGRDFSSSVISGLAQGSGEYFTRLGVGTPPK  446
            LF +RLQRDA R +ALS +AA+A       G  FSSSVISGLAQGSGEYFTR+GVGTPP+
Sbjct  87   LFGERLQRDAFRVEALSSVAASAVGAGGRVGTGFSSSVISGLAQGSGEYFTRIGVGTPPR  146

Query  447  YAFMVLDTGSDVVWLQCSPCRKCYAQTDPVFDPSKSSSFVGVKCDSPLCRRLDSSGC  617
            Y +MVLDTGSD+VW+QC+PC KCY+Q+DPVFDP KS SF G+ C SPLC RLDS GC
Sbjct  147  YVYMVLDTGSDIVWIQCAPCNKCYSQSDPVFDPRKSRSFAGIPCGSPLCNRLDSPGC  203



>ref|XP_004494825.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 1-like [Cicer 
arietinum]
Length=473

 Score =   186 bits (471),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 95/155 (61%), Positives = 117/155 (75%), Gaps = 5/155 (3%)
 Frame = +3

Query  153  PQYSQTLVQPDDSENTLSLDLHHIDLISSAAVNATPKALFVKRLQRDaarakalsllaaa  332
            P+  + L  P+     LSL LHH+D +S+   N TP+ LF  RLQRDAAR ++ +L AA 
Sbjct  49   PESEELLSIPESDPQPLSLQLHHVDALSN---NKTPQQLFHLRLQRDAARVESFTLAAAL  105

Query  333  aPPHNATRGRDFSSSVISGLAQGSGEYFTRLGVGTPPKYAFMVLDTGSDVVWLQCSPCRK  512
               H +  G  FSSS++SGL+QGSGEYFTR+GVGTP KY FMVLDTGSDVVWLQC+PCRK
Sbjct  106  NQSHRS--GSGFSSSIVSGLSQGSGEYFTRIGVGTPAKYVFMVLDTGSDVVWLQCAPCRK  163

Query  513  CYAQTDPVFDPSKSSSFVGVKCDSPLCRRLDSSGC  617
            CY+Q DP+FDP+KS +F G+ C +PLCRRLDSSGC
Sbjct  164  CYSQQDPIFDPTKSRTFAGIPCGAPLCRRLDSSGC  198



>gb|KEH24641.1| eukaryotic aspartyl protease family protein [Medicago truncatula]
Length=485

 Score =   185 bits (469),  Expect = 6e-52, Method: Compositional matrix adjust.
 Identities = 95/172 (55%), Positives = 122/172 (71%), Gaps = 7/172 (4%)
 Frame = +3

Query  108  LRPLPTAQHYSLSSKPQYSQTLVQPDD--SENTLSLDLHHIDLISSAAVNATPKALFVKR  281
            +R LP     +     Q S ++ +  D   + +LSL LHHID +SS   + TP+ LF  R
Sbjct  44   IRSLPNPSTLTWPESEQESLSIPESVDPIEQESLSLQLHHIDTLSS---DKTPQQLFHLR  100

Query  282  LQRDaarakalsllaaaaPPHNATRGRDFSSSVISGLAQGSGEYFTRLGVGTPPKYAFMV  461
            LQRDAAR ++ +       PH +  G  FSSS++SGL+QGSGEYFTR+GVGTP +Y FMV
Sbjct  101  LQRDAARVESFATALNKTRPHRSATG--FSSSIVSGLSQGSGEYFTRIGVGTPARYVFMV  158

Query  462  LDTGSDVVWLQCSPCRKCYAQTDPVFDPSKSSSFVGVKCDSPLCRRLDSSGC  617
            LDTGSDVVWLQC+PCRKCY+Q DPVFDP+KS S+ G+ C +PLCRRLD++GC
Sbjct  159  LDTGSDVVWLQCAPCRKCYSQADPVFDPTKSRSYAGIPCGAPLCRRLDTAGC  210



>ref|XP_010053832.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 2 [Eucalyptus 
grandis]
 gb|KCW78191.1| hypothetical protein EUGRSUZ_D02381 [Eucalyptus grandis]
Length=485

 Score =   184 bits (468),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 106/174 (61%), Positives = 131/174 (75%), Gaps = 8/174 (5%)
 Frame = +3

Query  111  RPLPTAQHYSLSSKPQYSQTLVQPDDSENT-LSLDLHHIDLISSAAVNATPKALFVKRLQ  287
            RP P +   S ++    S+T  + D +  T LS++L H+D +S    N TP+ALF  RLQ
Sbjct  41   RPAPASWPESEAAASLSSETEAESDSAATTSLSVELQHVDALS---FNLTPQALFHLRLQ  97

Query  288  RDaarakals---llaaaaPPHNATRGR-DFSSSVISGLAQGSGEYFTRLGVGTPPKYAF  455
            RDA+R +++S   + AAAAP  N +R R  FSSSV+SGLAQGSGEYFTRLGVGTPP+Y +
Sbjct  98   RDASRVQSISDLAVAAAAAPAGNVSRPRLGFSSSVVSGLAQGSGEYFTRLGVGTPPRYVY  157

Query  456  MVLDTGSDVVWLQCSPCRKCYAQTDPVFDPSKSSSFVGVKCDSPLCRRLDSSGC  617
            MVLDTGSDVVW+QC+PCRKCY+QTDPVFDPSKS+SF  + C SPLCRRLDS GC
Sbjct  158  MVLDTGSDVVWIQCAPCRKCYSQTDPVFDPSKSTSFAAIPCSSPLCRRLDSPGC  211



>ref|XP_007217966.1| hypothetical protein PRUPE_ppa005289mg [Prunus persica]
 gb|EMJ19165.1| hypothetical protein PRUPE_ppa005289mg [Prunus persica]
Length=468

 Score =   183 bits (464),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 104/180 (58%), Positives = 124/180 (69%), Gaps = 19/180 (11%)
 Frame = +3

Query  96   ETXSLRPLPTAQHYSLSSKPQYSQTLVQPDDSENTLSLDLHHIDLISSAAVNATPKALFV  275
            +T  L PLP     S      + +++  P    NTLS+ LHH+D +S   +N TP  LF 
Sbjct  28   QTLVLNPLPNPPTLS------WPESVTDP----NTLSVQLHHLDALS---LNKTPSQLFN  74

Query  276  KRLQRDaa-rakalsllaaaaPPHNATRG-----RDFSSSVISGLAQGSGEYFTRLGVGT  437
             RLQRDA       S+ AAAA P+   RG     R FSSSV+SGLAQGSGEYFTRLGVGT
Sbjct  75   LRLQRDAVRVKTLSSIAAAAASPNRTARGGRVPIRGFSSSVVSGLAQGSGEYFTRLGVGT  134

Query  438  PPKYAFMVLDTGSDVVWLQCSPCRKCYAQTDPVFDPSKSSSFVGVKCDSPLCRRLDSSGC  617
            PPKY +MVLDTGSDVVWLQC+PC++CY+QTDPVFDP KS +F  + C SPLCR+LDSSGC
Sbjct  135  PPKYVYMVLDTGSDVVWLQCAPCKRCYSQTDPVFDPRKSGTFSTIPCGSPLCRKLDSSGC  194



>emb|CDP08669.1| unnamed protein product [Coffea canephora]
Length=487

 Score =   182 bits (462),  Expect = 7e-51, Method: Compositional matrix adjust.
 Identities = 96/152 (63%), Positives = 118/152 (78%), Gaps = 2/152 (1%)
 Frame = +3

Query  165  QTLVQPDDSENTLSLDLHHIDLISSAAVNATPKALFVKRLQRDaarakalsllaaaaPPH  344
            +T    +   N  SL+LHH+D +S  + +A+P++LF  RLQRDA RAK++S +A+     
Sbjct  63   ETAAGTEFQSNNFSLELHHVDALS-LSPHASPESLFNLRLQRDAFRAKSISDMASGRGRQ  121

Query  345  NATRGR-DFSSSVISGLAQGSGEYFTRLGVGTPPKYAFMVLDTGSDVVWLQCSPCRKCYA  521
                GR +FSSSVISGL+QGSGEYFTRLG+GTPPKY++MVLDTGSDVVW+QCSPC+KCY 
Sbjct  122  GVGLGRMNFSSSVISGLSQGSGEYFTRLGIGTPPKYSYMVLDTGSDVVWIQCSPCKKCYT  181

Query  522  QTDPVFDPSKSSSFVGVKCDSPLCRRLDSSGC  617
            Q DP+FDPS SSSF GV C SPLCRRLDS GC
Sbjct  182  QADPLFDPSHSSSFAGVACASPLCRRLDSPGC  213



>ref|XP_011038277.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 1-like [Populus 
euphratica]
Length=505

 Score =   182 bits (462),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 104/182 (57%), Positives = 123/182 (68%), Gaps = 11/182 (6%)
 Frame = +3

Query  96   ETXSLRPLPTAQHYSLSSKPQYSQTLVQPDDSE------NTLSLDLHHIDLISSAAVNAT  257
            +T +L PLP     S +     +QT   P  SE       +LS+ LHHID +SS     +
Sbjct  52   QTLTLNPLPNKPTISWADTEPGTQTFTDPTISEPSSSATTSLSVQLHHIDALSSGK---S  108

Query  258  PKALFVKRLQRDaarakalsllaaaaPPHNATRGRD--FSSSVISGLAQGSGEYFTRLGV  431
             + LF  RL RDAAR K+L  LAA     N TR R   FSSSVISGLAQGSGEYFTRLGV
Sbjct  109  SQDLFNSRLARDAARVKSLISLAATVGGTNLTRARGPGFSSSVISGLAQGSGEYFTRLGV  168

Query  432  GTPPKYAFMVLDTGSDVVWLQCSPCRKCYAQTDPVFDPSKSSSFVGVKCDSPLCRRLDSS  611
            GTP +Y +MVLDTGSD+VW+QC+PC+KCY+QTDPVFDP+KS SF  + C SPLCRRLD  
Sbjct  169  GTPARYVYMVLDTGSDIVWIQCAPCKKCYSQTDPVFDPTKSRSFASIPCGSPLCRRLDYP  228

Query  612  GC  617
            GC
Sbjct  229  GC  230



>ref|XP_004139658.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 1-like [Cucumis 
sativus]
 ref|XP_004154449.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 1-like [Cucumis 
sativus]
 gb|KGN44550.1| hypothetical protein Csa_7G329350 [Cucumis sativus]
Length=453

 Score =   180 bits (456),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 101/174 (58%), Positives = 119/174 (68%), Gaps = 19/174 (11%)
 Frame = +3

Query  96   ETXSLRPLPTAQHYSLSSKPQYSQTLVQPDDSENTLSLDLHHIDLISSAAVNATPKALFV  275
            +T +LR LPT     L    Q  Q+   PD     L+LDLHH+D   S ++N TP  LF 
Sbjct  24   QTLTLRSLPTPSPLPLFPDSQSLQS--SPD---APLTLDLHHLD---SLSLNKTPTDLFN  75

Query  276  KRLQRDaarakalsllaaaaPPHNATRGRDFSSSVISGLAQGSGEYFTRLGVGTPPKYAF  455
             RL RD  R  AL+           +R   FSSSV+SGL+QGSGEYFTRLGVGTPP+Y +
Sbjct  76   LRLHRDTLRVHALN-----------SRAAGFSSSVVSGLSQGSGEYFTRLGVGTPPRYLY  124

Query  456  MVLDTGSDVVWLQCSPCRKCYAQTDPVFDPSKSSSFVGVKCDSPLCRRLDSSGC  617
            MVLDTGSDVVWLQCSPCRKCY+Q+DP+F+P KS SF G+ C SPLCRRLDSSGC
Sbjct  125  MVLDTGSDVVWLQCSPCRKCYSQSDPIFNPYKSKSFAGIPCSSPLCRRLDSSGC  178



>ref|XP_010266550.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 2-like [Nelumbo 
nucifera]
Length=484

 Score =   181 bits (458),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 97/147 (66%), Positives = 113/147 (77%), Gaps = 8/147 (5%)
 Frame = +3

Query  192  ENTLSLDLHHIDLISSAAVNATPKALFVKRLQRDaarakalsllaaaaPP---HNATR--  356
            +  L+  L H D +   A N TP+ALF  RL+RDAAR ++LS +AA APP    NATR  
Sbjct  65   QTILTARLEHRDAL---AFNVTPEALFHLRLERDAARVESLSTMAAGAPPVTSRNATRSR  121

Query  357  GRDFSSSVISGLAQGSGEYFTRLGVGTPPKYAFMVLDTGSDVVWLQCSPCRKCYAQTDPV  536
            G  FSSSVISGL+QGSGEYFTR+GVGTPP+Y +MVLDTGSD+VW+QC+PCRKCY Q DP+
Sbjct  122  GNGFSSSVISGLSQGSGEYFTRIGVGTPPRYVYMVLDTGSDIVWIQCAPCRKCYTQADPM  181

Query  537  FDPSKSSSFVGVKCDSPLCRRLDSSGC  617
            FDP KS SF GV C SPLCRRLD SGC
Sbjct  182  FDPKKSRSFAGVSCGSPLCRRLDVSGC  208



>emb|CDY15187.1| BnaC05g00660D [Brassica napus]
Length=481

 Score =   180 bits (457),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 96/172 (56%), Positives = 125/172 (73%), Gaps = 8/172 (5%)
 Frame = +3

Query  117  LPTAQHYSL--SSKPQYSQTLVQPDDSENTLSLDLHHIDLISSAAVNATPKALFVKRLQR  290
            LP+A   S    S+P     +    DSE++++L+L HID +S+   N TP+ LF  RLQR
Sbjct  38   LPSASPISFQPESEPVSESLIGSGSDSESSITLNLDHIDALST---NRTPEELFSSRLQR  94

Query  291  DaarakalsllaaaaPPHNAT---RGRDFSSSVISGLAQGSGEYFTRLGVGTPPKYAFMV  461
            D+ R K+++ LAA  P  N T   R   FSSSV+SGL+QGSGEYFTRLGVGTP +Y +MV
Sbjct  95   DSRRVKSIATLAARIPRRNTTHAPRPGGFSSSVVSGLSQGSGEYFTRLGVGTPARYVYMV  154

Query  462  LDTGSDVVWLQCSPCRKCYAQTDPVFDPSKSSSFVGVKCDSPLCRRLDSSGC  617
            LDTGSD+VWLQC+PCR+CY+Q+DP+FDP KS ++  + C SPLCRRLDS+GC
Sbjct  155  LDTGSDIVWLQCAPCRRCYSQSDPIFDPRKSRTYSTIPCSSPLCRRLDSAGC  206



>ref|XP_006418409.1| hypothetical protein EUTSA_v10009389mg [Eutrema salsugineum]
 gb|ESQ36762.1| hypothetical protein EUTSA_v10009389mg [Eutrema salsugineum]
Length=486

 Score =   181 bits (458),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 91/147 (62%), Positives = 117/147 (80%), Gaps = 6/147 (4%)
 Frame = +3

Query  186  DSENTLSLDLHHIDLISSAAVNATPKALFVKRLQRDaarakalsllaaaaPPHNAT---R  356
            DSE++++L+L HID +S+   N TP+ LF  RLQRD+ R ++++ LAA  P  NAT   R
Sbjct  68   DSESSITLNLDHIDALST---NRTPQELFSFRLQRDSRRVESIATLAARIPRRNATHAPR  124

Query  357  GRDFSSSVISGLAQGSGEYFTRLGVGTPPKYAFMVLDTGSDVVWLQCSPCRKCYAQTDPV  536
               FSSSV+SGL+QGSGEYFTRLGVGTP +Y +MVLDTGSD+VWLQC+PCRKCY+Q+DP+
Sbjct  125  TVGFSSSVVSGLSQGSGEYFTRLGVGTPARYVYMVLDTGSDIVWLQCAPCRKCYSQSDPI  184

Query  537  FDPSKSSSFVGVKCDSPLCRRLDSSGC  617
            FDP KS ++  + C SPLCRRLDS+GC
Sbjct  185  FDPRKSRTYSTIPCSSPLCRRLDSAGC  211



>ref|XP_011023172.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 1 [Populus 
euphratica]
Length=492

 Score =   180 bits (456),  Expect = 6e-50, Method: Compositional matrix adjust.
 Identities = 105/186 (56%), Positives = 129/186 (69%), Gaps = 15/186 (8%)
 Frame = +3

Query  96   ETXSLRPLPT------AQHYSLSSKPQYSQTLVQPDDSE----NTLSLDLHHIDLISSAA  245
            +T ++ PLP       A   + +     +QTL     SE     +LS+ LHH+D +SS  
Sbjct  35   QTLTVNPLPNKPTLSWADTETETESEPEAQTLTDSTFSEASTTTSLSVQLHHLDALSS--  92

Query  246  VNATPKALFVKRLQRDaarakalsllaaaaPPHNATRGRD--FSSSVISGLAQGSGEYFT  419
             + TP+ LF  RL RDA+R K+L+ LAAA    N TR R   FSSSVISGLAQGSGEYFT
Sbjct  93   -DKTPQDLFNSRLARDASRVKSLTSLAAATGRTNRTRARGPGFSSSVISGLAQGSGEYFT  151

Query  420  RLGVGTPPKYAFMVLDTGSDVVWLQCSPCRKCYAQTDPVFDPSKSSSFVGVKCDSPLCRR  599
            RLGVGTP +Y FMVLDTGSD+VW+QC+PC+KCY+QTDPVF+P+KS SF  + C SPLCRR
Sbjct  152  RLGVGTPARYVFMVLDTGSDIVWIQCAPCKKCYSQTDPVFNPTKSRSFANIPCGSPLCRR  211

Query  600  LDSSGC  617
            LDS GC
Sbjct  212  LDSPGC  217



>ref|XP_008351846.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 1-like [Malus 
domestica]
Length=486

 Score =   179 bits (455),  Expect = 7e-50, Method: Compositional matrix adjust.
 Identities = 97/147 (66%), Positives = 113/147 (77%), Gaps = 10/147 (7%)
 Frame = +3

Query  195  NTLSLDLHHIDLISSAAVNATPKALFVKRLQRDaarakalsllaaaaPPHNATRG-----  359
            NTLS+ LHHID +   A+N TP  LF  RLQRDA R K L+ LAAA+P +  TRG     
Sbjct  70   NTLSVQLHHIDAV---ALNKTPTQLFNLRLQRDAFRVKTLTSLAAASP-NRTTRGGGXVP  125

Query  360  -RDFSSSVISGLAQGSGEYFTRLGVGTPPKYAFMVLDTGSDVVWLQCSPCRKCYAQTDPV  536
             R FSSSV+SGL+QGSGEYFTRLGVGTPP+Y +MVLDTGSDVVWLQC+PCR+CY Q+DP+
Sbjct  126  VRGFSSSVVSGLSQGSGEYFTRLGVGTPPRYVYMVLDTGSDVVWLQCAPCRRCYKQSDPI  185

Query  537  FDPSKSSSFVGVKCDSPLCRRLDSSGC  617
            FDP KS SF  + C SPLCR+LDS  C
Sbjct  186  FDPRKSRSFATIPCGSPLCRKLDSPSC  212



>ref|XP_008343434.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 1-like [Malus 
domestica]
Length=486

 Score =   179 bits (455),  Expect = 7e-50, Method: Compositional matrix adjust.
 Identities = 97/147 (66%), Positives = 113/147 (77%), Gaps = 10/147 (7%)
 Frame = +3

Query  195  NTLSLDLHHIDLISSAAVNATPKALFVKRLQRDaarakalsllaaaaPPHNATRG-----  359
            NTLS+ LHHID +   A+N TP  LF  RLQRDA R K L+ LAAA+P +  TRG     
Sbjct  70   NTLSVQLHHIDAV---ALNKTPTQLFNLRLQRDAFRVKTLTSLAAASP-NRTTRGGGRVP  125

Query  360  -RDFSSSVISGLAQGSGEYFTRLGVGTPPKYAFMVLDTGSDVVWLQCSPCRKCYAQTDPV  536
             R FSSSV+SGL+QGSGEYFTRLGVGTPP+Y +MVLDTGSDVVWLQC+PCR+CY Q+DP+
Sbjct  126  VRGFSSSVVSGLSQGSGEYFTRLGVGTPPRYVYMVLDTGSDVVWLQCAPCRRCYKQSDPI  185

Query  537  FDPSKSSSFVGVKCDSPLCRRLDSSGC  617
            FDP KS SF  + C SPLCR+LDS  C
Sbjct  186  FDPRKSRSFATIPCGSPLCRKLDSPSC  212



>ref|XP_008461984.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 1-like [Cucumis 
melo]
Length=517

 Score =   179 bits (454),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 103/174 (59%), Positives = 119/174 (68%), Gaps = 18/174 (10%)
 Frame = +3

Query  96   ETXSLRPLPTAQHYSLSSKPQYSQTLVQPDDSENTLSLDLHHIDLISSAAVNATPKALFV  275
            +T +LR LPT    SL    +  Q+          L+LDLHH+D   S ++N TP  LF 
Sbjct  87   QTLTLRSLPTPSPLSLFPDSESLQS-----SPAAALTLDLHHLD---SLSLNKTPTDLFN  138

Query  276  KRLQRDaarakalsllaaaaPPHNATRGRDFSSSVISGLAQGSGEYFTRLGVGTPPKYAF  455
             RL RDA R  AL+          A  G  FSSSVISGLAQGSGEYFTRLGVGTPP+Y +
Sbjct  139  LRLHRDALRVHALTS--------RAAPG--FSSSVISGLAQGSGEYFTRLGVGTPPRYLY  188

Query  456  MVLDTGSDVVWLQCSPCRKCYAQTDPVFDPSKSSSFVGVKCDSPLCRRLDSSGC  617
            MVLDTGSDVVWLQCSPCRKCY+Q+DP+F+P KS SF G+ C SPLCRRLDSSGC
Sbjct  189  MVLDTGSDVVWLQCSPCRKCYSQSDPIFNPYKSKSFAGIPCSSPLCRRLDSSGC  242



>ref|XP_002892074.1| aspartyl protease family protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH68333.1| aspartyl protease family protein [Arabidopsis lyrata subsp. lyrata]
Length=485

 Score =   179 bits (453),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 90/147 (61%), Positives = 115/147 (78%), Gaps = 6/147 (4%)
 Frame = +3

Query  186  DSENTLSLDLHHIDLISSAAVNATPKALFVKRLQRDaarakalsllaaaaPPHNAT---R  356
            DSE++++L+L HID +SS   N TP+ LF  RLQRD+ R K+++ LAA  P  N T   R
Sbjct  67   DSESSITLNLDHIDALSS---NKTPQELFSSRLQRDSRRVKSIATLAAQIPGRNVTHAPR  123

Query  357  GRDFSSSVISGLAQGSGEYFTRLGVGTPPKYAFMVLDTGSDVVWLQCSPCRKCYAQTDPV  536
               FSSSV+SGL+QGSGEYFTRLGVGTP +Y +MVLDTGSD+VWLQC+PCR+CY+Q+DP+
Sbjct  124  TGGFSSSVVSGLSQGSGEYFTRLGVGTPARYVYMVLDTGSDIVWLQCAPCRRCYSQSDPI  183

Query  537  FDPSKSSSFVGVKCDSPLCRRLDSSGC  617
            FDP KS ++  + C SP CRRLDS+GC
Sbjct  184  FDPRKSKTYATIPCSSPHCRRLDSAGC  210



>ref|XP_010095748.1| Aspartic proteinase nepenthesin-1 [Morus notabilis]
 gb|EXB62168.1| Aspartic proteinase nepenthesin-1 [Morus notabilis]
Length=491

 Score =   178 bits (452),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 95/144 (66%), Positives = 109/144 (76%), Gaps = 7/144 (5%)
 Frame = +3

Query  198  TLSLDLHHIDLISSAAVNATPKALFVKRLQRDaarakalsllaaaaPPHNATRGRD----  365
            ++S  LHHID +S+   + +P+ LF  RLQRDA R K L  + AAA   N +R R     
Sbjct  77   SISAQLHHIDALSA---DKSPEQLFDLRLQRDALRVKNLVEVTAAAASRNVSRTRGAAPG  133

Query  366  FSSSVISGLAQGSGEYFTRLGVGTPPKYAFMVLDTGSDVVWLQCSPCRKCYAQTDPVFDP  545
            FSSSVISGLAQGSGEYFTRLGVGTPP+Y +MVLDTGSDVVWLQC+PCRKCY Q DPVFDP
Sbjct  134  FSSSVISGLAQGSGEYFTRLGVGTPPRYVYMVLDTGSDVVWLQCAPCRKCYTQADPVFDP  193

Query  546  SKSSSFVGVKCDSPLCRRLDSSGC  617
            SKS SF  + C SPLCR+LDS GC
Sbjct  194  SKSRSFARISCGSPLCRKLDSPGC  217



>ref|XP_002523337.1| Aspartic proteinase nepenthesin-1 precursor, putative [Ricinus 
communis]
 gb|EEF39053.1| Aspartic proteinase nepenthesin-1 precursor, putative [Ricinus 
communis]
Length=469

 Score =   177 bits (450),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 98/172 (57%), Positives = 120/172 (70%), Gaps = 13/172 (8%)
 Frame = +3

Query  129  QHYSLSSKPQYSQTLVQPDDSEN---------TLSLDLHHIDLISSAAVNATPKALFVKR  281
             + +L + P  SQ  +   DSE+         T S+ LHH+D +S    N+TP+ LF  R
Sbjct  27   NYQTLVANPLRSQPTLSWTDSESPTDTAESSATFSVQLHHVDALS---FNSTPETLFTTR  83

Query  282  LQRDaarakalsllaaaaPPHNATRGRDFSSSVISGLAQGSGEYFTRLGVGTPPKYAFMV  461
            LQRDAAR +A+S LA  A       G  FSSSVISGLAQGSGEYFTR+GVGTPP+Y +MV
Sbjct  84   LQRDAARVEAISYLAETAGTGKRV-GTGFSSSVISGLAQGSGEYFTRIGVGTPPRYVYMV  142

Query  462  LDTGSDVVWLQCSPCRKCYAQTDPVFDPSKSSSFVGVKCDSPLCRRLDSSGC  617
            LDTGSD+VW+QC+PC++CYAQ+DPVFDP KS SF  + C SPLC RLDS GC
Sbjct  143  LDTGSDIVWIQCAPCKRCYAQSDPVFDPRKSRSFASIACRSPLCHRLDSPGC  194



>gb|EPS66029.1| hypothetical protein M569_08742 [Genlisea aurea]
Length=464

 Score =   177 bits (449),  Expect = 4e-49, Method: Compositional matrix adjust.
 Identities = 89/139 (64%), Positives = 107/139 (77%), Gaps = 1/139 (1%)
 Frame = +3

Query  204  SLDLHHIDLISSAAVNATPKALFVKRLQRDaarakalsllaaaaPPHNAT-RGRDFSSSV  380
            SL L H+D +  +  +A+P+ LF  RL+RDA R + LS     A   N + R RDFSSSV
Sbjct  50   SLGLFHVDDVYYSGADASPELLFQFRLRRDAIRVRDLSAAVVEAAARNVSGRARDFSSSV  109

Query  381  ISGLAQGSGEYFTRLGVGTPPKYAFMVLDTGSDVVWLQCSPCRKCYAQTDPVFDPSKSSS  560
             SGL+QGSGEYFTR+G+GTPP+Y +MVLDTGSDVVW+QCSPC KCY+QTDPVFDP  S+S
Sbjct  110  TSGLSQGSGEYFTRIGIGTPPRYVYMVLDTGSDVVWIQCSPCTKCYSQTDPVFDPRASTS  169

Query  561  FVGVKCDSPLCRRLDSSGC  617
            F+GV C SPLCRRLDS GC
Sbjct  170  FLGVSCASPLCRRLDSPGC  188



>ref|XP_008376086.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 2-like [Malus 
domestica]
Length=487

 Score =   177 bits (449),  Expect = 5e-49, Method: Compositional matrix adjust.
 Identities = 95/148 (64%), Positives = 110/148 (74%), Gaps = 10/148 (7%)
 Frame = +3

Query  195  NTLSLDLHHIDLISSAAVNATPKALFVKRLQRDa-arakalsllaaaaPPHNATRG----  359
            NTLS+ LHHID +   A+N TP  LF  RLQRDA       +L AAAA P+  TRG    
Sbjct  69   NTLSVQLHHIDAM---ALNKTPTQLFHLRLQRDAFRVKALTTLAAAAASPNRTTRGGGHV  125

Query  360  --RDFSSSVISGLAQGSGEYFTRLGVGTPPKYAFMVLDTGSDVVWLQCSPCRKCYAQTDP  533
                FSSSV+SGL+QGSGEYFTRLGVGTPP+Y +MVLDTGSDVVWLQC+PC++CY QTDP
Sbjct  126  PVTGFSSSVVSGLSQGSGEYFTRLGVGTPPRYVYMVLDTGSDVVWLQCAPCKRCYTQTDP  185

Query  534  VFDPSKSSSFVGVKCDSPLCRRLDSSGC  617
            +FDP KS SF  + C SPLCR+LDS GC
Sbjct  186  IFDPRKSGSFATIPCGSPLCRKLDSPGC  213



>emb|CBI40559.3| unnamed protein product [Vitis vinifera]
Length=436

 Score =   176 bits (445),  Expect = 7e-49, Method: Compositional matrix adjust.
 Identities = 99/185 (54%), Positives = 123/185 (66%), Gaps = 14/185 (8%)
 Frame = +3

Query  96   ETXSLRPLPTAQHYSLSSKPQYSQTLVQ-----PDDSENTLSLDLHHIDLISSAAVNATP  260
            E  SL   P  ++ +  S+  +++T  Q       +++ T+++ L H D++   A NATP
Sbjct  61   EYQSLVVRPLGENPTTKSQLSWTETETQISTLPVSETDPTMTMHLEHRDVL---AFNATP  117

Query  261  KALFVKRLQRDa----arakalsllaaaaPPHNAT--RGRDFSSSVISGLAQGSGEYFTR  422
            +ALF  RLQRDA    A +K  +         N T  +G  FSSSV SGLAQGSGEYFTR
Sbjct  118  EALFNLRLQRDAFRVEALSKMAAAAGGRRAGRNGTHAQGGGFSSSVTSGLAQGSGEYFTR  177

Query  423  LGVGTPPKYAFMVLDTGSDVVWLQCSPCRKCYAQTDPVFDPSKSSSFVGVKCDSPLCRRL  602
            LGVGTPPKY +MVLDTGSDVVW+QC+PCRKCY+QTDPVFDP KS SF  + C SPLC RL
Sbjct  178  LGVGTPPKYVYMVLDTGSDVVWIQCAPCRKCYSQTDPVFDPKKSGSFSSISCRSPLCLRL  237

Query  603  DSSGC  617
            DS GC
Sbjct  238  DSPGC  242



>gb|KJB49569.1| hypothetical protein B456_008G125700 [Gossypium raimondii]
Length=488

 Score =   177 bits (448),  Expect = 8e-49, Method: Compositional matrix adjust.
 Identities = 103/181 (57%), Positives = 123/181 (68%), Gaps = 14/181 (8%)
 Frame = +3

Query  108  LRPLPTAQHYSLSSKPQYSQTLVQPDD----SENT---LSLDLHHIDLISSAAVNATPKA  266
            LRPLP+A   S         +LV+  D    + NT   L L+LHH+D +SS     TP+ 
Sbjct  37   LRPLPSAPVLSWQDSDLPFNSLVETSDLDTVNSNTSLGLQLELHHLDALSS---EETPER  93

Query  267  LFVKRLQRDaaraka----lsllaaaaPPHNATRGRDFSSSVISGLAQGSGEYFTRLGVG  434
            LF  RLQRDA RA+     +S   A   P    R   FSSSVISGLAQGSGEYFTRLGVG
Sbjct  94   LFDLRLQRDALRAETINSLVSKAVARKHPRAPGRRPGFSSSVISGLAQGSGEYFTRLGVG  153

Query  435  TPPKYAFMVLDTGSDVVWLQCSPCRKCYAQTDPVFDPSKSSSFVGVKCDSPLCRRLDSSG  614
            TPP+Y +MVLDTGSDV+W+QCSPC+KCY+Q+DP+FDP+KS SF G+ C S LCR LDSSG
Sbjct  154  TPPRYLYMVLDTGSDVIWVQCSPCKKCYSQSDPIFDPTKSRSFSGIPCGSQLCRSLDSSG  213

Query  615  C  617
            C
Sbjct  214  C  214



>ref|XP_002320868.1| aspartyl protease family protein [Populus trichocarpa]
 gb|EEE99183.1| aspartyl protease family protein [Populus trichocarpa]
Length=488

 Score =   177 bits (448),  Expect = 8e-49, Method: Compositional matrix adjust.
 Identities = 104/182 (57%), Positives = 123/182 (68%), Gaps = 11/182 (6%)
 Frame = +3

Query  96   ETXSLRPLPTAQHYSLSSKPQYSQTLV-----QPDDSENT-LSLDLHHIDLISSAAVNAT  257
            +T +L PLP     S +     +QT       +P  S  T LS+ LHHID +SS   + +
Sbjct  35   QTLTLNPLPNKPTISWADTEPGTQTFTDQTTSEPSSSATTFLSVQLHHIDALSS---DKS  91

Query  258  PKALFVKRLQRDaarakalsllaaaaPPHNATRGRD--FSSSVISGLAQGSGEYFTRLGV  431
             + LF  RL RDAAR K+L  LAA     N TR R   FSSSVISGLAQGSGEYFTRLGV
Sbjct  92   SQDLFNSRLVRDAARVKSLISLAATVGGTNLTRARGPGFSSSVISGLAQGSGEYFTRLGV  151

Query  432  GTPPKYAFMVLDTGSDVVWLQCSPCRKCYAQTDPVFDPSKSSSFVGVKCDSPLCRRLDSS  611
            GTP +Y +MVLDTGSD+VW+QC+PC KCY+QTDPVFDP+KS SF  + C SPLCRRLD  
Sbjct  152  GTPARYVYMVLDTGSDIVWIQCAPCIKCYSQTDPVFDPTKSRSFANIPCGSPLCRRLDYP  211

Query  612  GC  617
            GC
Sbjct  212  GC  213



>ref|XP_002263964.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 2 [Vitis vinifera]
 emb|CAN64659.1| hypothetical protein VITISV_009613 [Vitis vinifera]
Length=489

 Score =   176 bits (445),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 105/185 (57%), Positives = 129/185 (70%), Gaps = 14/185 (8%)
 Frame = +3

Query  96   ETXSLRPLPTAQHYSLSSKPQYSQTLVQ-----PDDSENTLSLDLHHIDLISSAAVNATP  260
            E  SL   P  ++ +  S+  +++T  Q       +++ T+++ L H D++   A NATP
Sbjct  34   EYQSLVVRPLGENPTTKSQLSWTETETQISTLPVSETDPTMTMHLEHRDVL---AFNATP  90

Query  261  KALFVKRLQRDaarakalsllaaaaPPH----NAT--RGRDFSSSVISGLAQGSGEYFTR  422
            +ALF  RLQRDA R +ALS +AAAA       N T  +G  FSSSV SGLAQGSGEYFTR
Sbjct  91   EALFNLRLQRDAFRVEALSKMAAAAGGRRAGRNGTHAQGGGFSSSVTSGLAQGSGEYFTR  150

Query  423  LGVGTPPKYAFMVLDTGSDVVWLQCSPCRKCYAQTDPVFDPSKSSSFVGVKCDSPLCRRL  602
            LGVGTPPKY +MVLDTGSDVVW+QC+PCRKCY+QTDPVFDP KS SF  + C SPLC RL
Sbjct  151  LGVGTPPKYVYMVLDTGSDVVWIQCAPCRKCYSQTDPVFDPKKSGSFSSISCRSPLCLRL  210

Query  603  DSSGC  617
            DS GC
Sbjct  211  DSPGC  215



>ref|XP_009336767.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 1-like [Pyrus 
x bretschneideri]
Length=485

 Score =   174 bits (442),  Expect = 5e-48, Method: Compositional matrix adjust.
 Identities = 94/145 (65%), Positives = 110/145 (76%), Gaps = 11/145 (8%)
 Frame = +3

Query  201  LSLDLHHIDLISSAAVNATPKALFVKRLQRDaarakalsllaaaaPPHNATRG------R  362
            LS+ LHHID +   A+N TP  LF  RLQRDA R K L+ LAA+  P+  TRG      R
Sbjct  72   LSVQLHHIDAV---ALNKTPTQLFNLRLQRDAFRVKTLTSLAAS--PNRTTRGGGRVPVR  126

Query  363  DFSSSVISGLAQGSGEYFTRLGVGTPPKYAFMVLDTGSDVVWLQCSPCRKCYAQTDPVFD  542
             FSSSV+SGL+QGSGEYFTRLGVGTPP+Y +MVLDTGSDVVWLQC+PCR+CY Q+DP+FD
Sbjct  127  GFSSSVVSGLSQGSGEYFTRLGVGTPPRYVYMVLDTGSDVVWLQCAPCRRCYKQSDPIFD  186

Query  543  PSKSSSFVGVKCDSPLCRRLDSSGC  617
            P KS SF  + C SPLCR+LDS  C
Sbjct  187  PRKSRSFATIPCGSPLCRKLDSPSC  211



>ref|XP_010474721.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 1-like [Camelina 
sativa]
Length=484

 Score =   174 bits (442),  Expect = 6e-48, Method: Compositional matrix adjust.
 Identities = 85/139 (61%), Positives = 109/139 (78%), Gaps = 3/139 (2%)
 Frame = +3

Query  201  LSLDLHHIDLISSAAVNATPKALFVKRLQRDaarakalsllaaaaPPHNATRGRDFSSSV  380
            ++L+L HID +SS   N TP+ LF  RLQRD+ R ++++ LAA  P  N T    FSSSV
Sbjct  74   ITLNLDHIDALSS---NKTPQELFSSRLQRDSKRVQSIATLAARVPRRNVTHAPGFSSSV  130

Query  381  ISGLAQGSGEYFTRLGVGTPPKYAFMVLDTGSDVVWLQCSPCRKCYAQTDPVFDPSKSSS  560
            +SGL+QGSGEYFTRLGVGTP +Y +MVLDTGSD+VWLQC+PCR+CY+Q+DP+FDP KS +
Sbjct  131  VSGLSQGSGEYFTRLGVGTPARYVYMVLDTGSDIVWLQCAPCRRCYSQSDPIFDPRKSRT  190

Query  561  FVGVKCDSPLCRRLDSSGC  617
            +  + C SP CRRLDS+GC
Sbjct  191  YSTIPCSSPHCRRLDSAGC  209



>ref|XP_007147317.1| hypothetical protein PHAVU_006G113700g [Phaseolus vulgaris]
 gb|ESW19311.1| hypothetical protein PHAVU_006G113700g [Phaseolus vulgaris]
Length=534

 Score =   175 bits (443),  Expect = 7e-48, Method: Compositional matrix adjust.
 Identities = 108/175 (62%), Positives = 125/175 (71%), Gaps = 8/175 (5%)
 Frame = +3

Query  93   TETXSLRPLPTAQHYSLSSKPQYSQTLVQPDDSENTLSLDLHHIDLISSAAVNATPKALF  272
            T T SL  LP   H    S PQ ++ L +PD  E  LSL+LHHID +SS   N TP+ LF
Sbjct  94   TLTLSLHSLP---HSPTLSWPQ-AEALAEPD-PEEALSLNLHHIDALSS---NKTPEQLF  145

Query  273  VKRLQRDaarakalsllaaaaPPHNATRGRDFSSSVISGLAQGSGEYFTRLGVGTPPKYA  452
              RLQRD  R ++L  LAA    H    G  FSSS+ISGLAQGSGEYFTR+GVGTP KY 
Sbjct  146  HLRLQRDGKRVQSLLTLAALNSSHARRSGSGFSSSIISGLAQGSGEYFTRIGVGTPAKYV  205

Query  453  FMVLDTGSDVVWLQCSPCRKCYAQTDPVFDPSKSSSFVGVKCDSPLCRRLDSSGC  617
            +MVLDTGSDVVWLQC+PCRKCY QTDPVFDP+KS ++ G+ C +PLCRRLDS GC
Sbjct  206  YMVLDTGSDVVWLQCAPCRKCYTQTDPVFDPTKSRTYAGIPCGAPLCRRLDSPGC  260



>ref|XP_002302634.2| aspartyl protease family protein [Populus trichocarpa]
 gb|EEE81907.2| aspartyl protease family protein [Populus trichocarpa]
Length=490

 Score =   172 bits (436),  Expect = 4e-47, Method: Compositional matrix adjust.
 Identities = 93/139 (67%), Positives = 109/139 (78%), Gaps = 5/139 (4%)
 Frame = +3

Query  207  LDLHHIDLISSAAVNATPKALFVKRLQRDaarakalsllaaaaPPHNATRGRD--FSSSV  380
            + LHH+D +SS   + TP+ LF  RL RDA+R K+L+ LAAA    N TR R   FSSSV
Sbjct  80   VQLHHLDALSS---DETPQDLFNSRLARDASRVKSLTSLAAAVGSTNRTRARGPGFSSSV  136

Query  381  ISGLAQGSGEYFTRLGVGTPPKYAFMVLDTGSDVVWLQCSPCRKCYAQTDPVFDPSKSSS  560
             SGLAQGSGEYFTRLGVGTP +Y FMVLDTGSDVVW+QC+PC+KCY+QTDPVF+P+KS S
Sbjct  137  TSGLAQGSGEYFTRLGVGTPARYVFMVLDTGSDVVWIQCAPCKKCYSQTDPVFNPTKSRS  196

Query  561  FVGVKCDSPLCRRLDSSGC  617
            F  + C SPLCRRLDS GC
Sbjct  197  FANIPCGSPLCRRLDSPGC  215



>emb|CDX90023.1| BnaA10g00590D [Brassica napus]
Length=481

 Score =   171 bits (433),  Expect = 9e-47, Method: Compositional matrix adjust.
 Identities = 87/141 (62%), Positives = 110/141 (78%), Gaps = 6/141 (4%)
 Frame = +3

Query  204  SLDLHHIDLISSAAVNATPKALFVKRLQRDaarakalsllaaaaPPHNAT---RGRDFSS  374
            +L+L HID +S+   N TP+ LF  RLQRD+ R K+++ LAA  P  N T   R   FSS
Sbjct  69   TLNLDHIDALST---NRTPEELFSSRLQRDSRRVKSIATLAARIPRRNTTHAPRPGGFSS  125

Query  375  SVISGLAQGSGEYFTRLGVGTPPKYAFMVLDTGSDVVWLQCSPCRKCYAQTDPVFDPSKS  554
            SV+SGL+QGSGEYFTRLGVGTP +Y +MVLDTGSD+VWLQC+PCR+CY+Q+DP+FDP KS
Sbjct  126  SVVSGLSQGSGEYFTRLGVGTPARYVYMVLDTGSDIVWLQCAPCRRCYSQSDPIFDPRKS  185

Query  555  SSFVGVKCDSPLCRRLDSSGC  617
             ++  + C SPLCRRLDS+GC
Sbjct  186  RTYSTIPCSSPLCRRLDSAGC  206



>gb|AAM66061.1| chloroplast nucleoid DNA binding protein, putative [Arabidopsis 
thaliana]
Length=485

 Score =   171 bits (433),  Expect = 9e-47, Method: Compositional matrix adjust.
 Identities = 86/142 (61%), Positives = 110/142 (77%), Gaps = 6/142 (4%)
 Frame = +3

Query  201  LSLDLHHIDLISSAAVNATPKALFVKRLQRDaarakalsllaaaaPPHNAT---RGRDFS  371
            ++L+L HID +SS   N TP+ LF  RLQRD+ R ++++ LAA  P  N T   R   FS
Sbjct  72   ITLNLDHIDALSS---NKTPQELFSSRLQRDSRRVRSIATLAAQIPGRNVTHAPRPGGFS  128

Query  372  SSVISGLAQGSGEYFTRLGVGTPPKYAFMVLDTGSDVVWLQCSPCRKCYAQTDPVFDPSK  551
            SSV+SGL+QGSGEYFTRLGVGTP +Y +MVLDTGSD+VWLQC+PCR+CY+Q+DP+FDP K
Sbjct  129  SSVVSGLSQGSGEYFTRLGVGTPARYVYMVLDTGSDIVWLQCAPCRRCYSQSDPIFDPRK  188

Query  552  SSSFVGVKCDSPLCRRLDSSGC  617
            S ++  + C SP CRRLDS+GC
Sbjct  189  SKTYATIPCSSPHCRRLDSAGC  210



>ref|XP_009119684.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 1 [Brassica 
rapa]
Length=481

 Score =   171 bits (433),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 87/141 (62%), Positives = 110/141 (78%), Gaps = 6/141 (4%)
 Frame = +3

Query  204  SLDLHHIDLISSAAVNATPKALFVKRLQRDaarakalsllaaaaPPHNAT---RGRDFSS  374
            +L+L HID +S+   N TP+ LF  RLQRD+ R K+++ LAA  P  N T   R   FSS
Sbjct  69   TLNLDHIDALST---NRTPEELFSSRLQRDSRRVKSIATLAARIPRRNTTHAPRPGGFSS  125

Query  375  SVISGLAQGSGEYFTRLGVGTPPKYAFMVLDTGSDVVWLQCSPCRKCYAQTDPVFDPSKS  554
            SV+SGL+QGSGEYFTRLGVGTP +Y +MVLDTGSD+VWLQC+PCR+CY+Q+DP+FDP KS
Sbjct  126  SVVSGLSQGSGEYFTRLGVGTPARYVYMVLDTGSDIVWLQCAPCRRCYSQSDPIFDPRKS  185

Query  555  SSFVGVKCDSPLCRRLDSSGC  617
             ++  + C SPLCRRLDS+GC
Sbjct  186  RTYSTIPCSSPLCRRLDSAGC  206



>ref|XP_010457141.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 1-like [Camelina 
sativa]
Length=485

 Score =   171 bits (432),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 86/142 (61%), Positives = 109/142 (77%), Gaps = 6/142 (4%)
 Frame = +3

Query  201  LSLDLHHIDLISSAAVNATPKALFVKRLQRDaarakalsllaaaaPPHNAT---RGRDFS  371
            ++L+L HID +SS   N TP+ LF  RLQRD+ R  +++ LAA  P  N T   R   FS
Sbjct  72   ITLNLDHIDALSS---NKTPQELFSSRLQRDSRRVNSIATLAARVPRRNVTHAPRPGGFS  128

Query  372  SSVISGLAQGSGEYFTRLGVGTPPKYAFMVLDTGSDVVWLQCSPCRKCYAQTDPVFDPSK  551
            SSV+SGL+QGSGEYFTRLGVGTP +Y +MVLDTGSD+VWLQC+PCR+CY+Q+DP+FDP K
Sbjct  129  SSVVSGLSQGSGEYFTRLGVGTPARYVYMVLDTGSDIVWLQCAPCRRCYSQSDPIFDPRK  188

Query  552  SSSFVGVKCDSPLCRRLDSSGC  617
            S ++  + C SP CRRLDS+GC
Sbjct  189  SRTYSTIPCSSPHCRRLDSAGC  210



>ref|NP_171637.1| aspartyl protease family protein [Arabidopsis thaliana]
 gb|AAF97328.1|AC023628_9 Unknown protein [Arabidopsis thaliana]
 gb|AAM91547.1| chloroplast nucleoid DNA binding protein, putative [Arabidopsis 
thaliana]
 gb|AAP31963.1| At1g01300 [Arabidopsis thaliana]
 gb|AEE27268.1| aspartyl protease family protein [Arabidopsis thaliana]
Length=485

 Score =   170 bits (431),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 87/142 (61%), Positives = 109/142 (77%), Gaps = 6/142 (4%)
 Frame = +3

Query  201  LSLDLHHIDLISSAAVNATPKALFVKRLQRDaarakalsllaaaaPPHNAT---RGRDFS  371
            ++L+L HID +SS   N TP  LF  RLQRD+ R K+++ LAA  P  N T   R   FS
Sbjct  72   ITLNLDHIDALSS---NKTPDELFSSRLQRDSRRVKSIATLAAQIPGRNVTHAPRPGGFS  128

Query  372  SSVISGLAQGSGEYFTRLGVGTPPKYAFMVLDTGSDVVWLQCSPCRKCYAQTDPVFDPSK  551
            SSV+SGL+QGSGEYFTRLGVGTP +Y +MVLDTGSD+VWLQC+PCR+CY+Q+DP+FDP K
Sbjct  129  SSVVSGLSQGSGEYFTRLGVGTPARYVYMVLDTGSDIVWLQCAPCRRCYSQSDPIFDPRK  188

Query  552  SSSFVGVKCDSPLCRRLDSSGC  617
            S ++  + C SP CRRLDS+GC
Sbjct  189  SKTYATIPCSSPHCRRLDSAGC  210



>gb|KFK42512.1| hypothetical protein AALP_AA1G003500 [Arabis alpina]
Length=477

 Score =   169 bits (428),  Expect = 5e-46, Method: Compositional matrix adjust.
 Identities = 80/139 (58%), Positives = 111/139 (80%), Gaps = 3/139 (2%)
 Frame = +3

Query  201  LSLDLHHIDLISSAAVNATPKALFVKRLQRDaarakalsllaaaaPPHNATRGRDFSSSV  380
            ++L+L HID +++   N TP+ LF  RLQRD+ R K+++ LA+     +A R   FSSSV
Sbjct  67   ITLNLDHIDALTT---NRTPQELFTSRLQRDSKRVKSIATLASQRNTTHAPRTGTFSSSV  123

Query  381  ISGLAQGSGEYFTRLGVGTPPKYAFMVLDTGSDVVWLQCSPCRKCYAQTDPVFDPSKSSS  560
            +SGL+QGSGEYFTRLGVGTP +Y +MVLDTGSD+VWLQC+PC++CY+Q+DP++DP KS++
Sbjct  124  VSGLSQGSGEYFTRLGVGTPARYVYMVLDTGSDIVWLQCAPCKRCYSQSDPIYDPRKSTT  183

Query  561  FVGVKCDSPLCRRLDSSGC  617
            +  + C SPLC+RLDS+GC
Sbjct  184  YSTISCSSPLCKRLDSAGC  202



>ref|XP_010556596.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 2-like [Tarenaya 
hassleriana]
Length=467

 Score =   167 bits (423),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 80/135 (59%), Positives = 103/135 (76%), Gaps = 3/135 (2%)
 Frame = +3

Query  213  LHHIDLISSAAVNATPKALFVKRLQRDaarakalsllaaaaPPHNATRGRDFSSSVISGL  392
            LHHID +S+   N TP+ LF  RL RD+ R ++++ L       +A     FSSSVISGL
Sbjct  61   LHHIDALSA---NKTPEQLFHLRLHRDSRRVESIAALTRRGNASHAPSAAGFSSSVISGL  117

Query  393  AQGSGEYFTRLGVGTPPKYAFMVLDTGSDVVWLQCSPCRKCYAQTDPVFDPSKSSSFVGV  572
            +QGSGEYFTR+GVGTP +Y +MVLDTGSD+VWLQC+PCR+CY+Q+DP+F P+KS ++ G+
Sbjct  118  SQGSGEYFTRIGVGTPARYLYMVLDTGSDIVWLQCAPCRRCYSQSDPIFVPAKSKTYAGI  177

Query  573  KCDSPLCRRLDSSGC  617
             C SPLCRRLDS GC
Sbjct  178  SCSSPLCRRLDSPGC  192



>ref|XP_007135265.1| hypothetical protein PHAVU_010G114700g [Phaseolus vulgaris]
 gb|ESW07259.1| hypothetical protein PHAVU_010G114700g [Phaseolus vulgaris]
Length=477

 Score =   165 bits (417),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 108/178 (61%), Positives = 125/178 (70%), Gaps = 12/178 (7%)
 Frame = +3

Query  93   TETXSLRPLPTAQHYSLSSKPQYSQTLVQPDDSE---NTLSLDLHHIDLISSAAVNATPK  263
            ++T  LR LP     S      + ++     DSE   +T+S+++HHID +S   +N TP 
Sbjct  34   SQTLILRNLPNPPTLS------WPESTTLGSDSEPDPDTISVNVHHIDALS---LNKTPS  84

Query  264  ALFVKRLQRDaarakalsllaaaaPPHNATRGRDFSSSVISGLAQGSGEYFTRLGVGTPP  443
             LF  RLQRDAAR K+LS LAA       T G  FSSSVISGLAQGSGEYFTRLGVGTPP
Sbjct  85   QLFHFRLQRDAARVKSLSSLAALNQTRPTTSGSGFSSSVISGLAQGSGEYFTRLGVGTPP  144

Query  444  KYAFMVLDTGSDVVWLQCSPCRKCYAQTDPVFDPSKSSSFVGVKCDSPLCRRLDSSGC  617
            KY +MVLDTGSDVVWLQC PC KCY+QTD +FDPSKSSSF G+ C SPLCR LDS GC
Sbjct  145  KYVYMVLDTGSDVVWLQCKPCAKCYSQTDEIFDPSKSSSFAGISCSSPLCRSLDSPGC  202



>gb|AGV54495.1| aspartic proteinase nepenthesin-1-like protein [Phaseolus vulgaris]
Length=476

 Score =   165 bits (417),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 108/178 (61%), Positives = 125/178 (70%), Gaps = 12/178 (7%)
 Frame = +3

Query  93   TETXSLRPLPTAQHYSLSSKPQYSQTLVQPDDSE---NTLSLDLHHIDLISSAAVNATPK  263
            ++T  LR LP     S      + ++     DSE   +T+S+++HHID +S   +N TP 
Sbjct  34   SQTLILRNLPNPPTLS------WPESTTLGSDSEPDPDTISVNVHHIDALS---LNKTPS  84

Query  264  ALFVKRLQRDaarakalsllaaaaPPHNATRGRDFSSSVISGLAQGSGEYFTRLGVGTPP  443
             LF  RLQRDAAR K+LS LAA       T G  FSSSVISGLAQGSGEYFTRLGVGTPP
Sbjct  85   QLFHFRLQRDAARVKSLSSLAALNQTRPTTSGSGFSSSVISGLAQGSGEYFTRLGVGTPP  144

Query  444  KYAFMVLDTGSDVVWLQCSPCRKCYAQTDPVFDPSKSSSFVGVKCDSPLCRRLDSSGC  617
            KY +MVLDTGSDVVWLQC PC KCY+QTD +FDPSKSSSF G+ C SPLCR LDS GC
Sbjct  145  KYVYMVLDTGSDVVWLQCKPCAKCYSQTDEIFDPSKSSSFAGISCSSPLCRSLDSPGC  202



>ref|XP_006307379.1| hypothetical protein CARUB_v10009005mg [Capsella rubella]
 gb|EOA40277.1| hypothetical protein CARUB_v10009005mg [Capsella rubella]
Length=481

 Score =   163 bits (413),  Expect = 7e-44, Method: Compositional matrix adjust.
 Identities = 85/139 (61%), Positives = 104/139 (75%), Gaps = 6/139 (4%)
 Frame = +3

Query  210  DLHHIDLISSAAVNATPKALFVKRLQRDaarakalsllaaaaPPHNAT---RGRDFSSSV  380
            +L HID +SS   N TP  LF  RL RD+ R K++  LAA  P  N T   R   FSSSV
Sbjct  71   NLDHIDALSS---NKTPDELFSSRLLRDSRRVKSIVTLAARVPRRNVTHAPRPGGFSSSV  127

Query  381  ISGLAQGSGEYFTRLGVGTPPKYAFMVLDTGSDVVWLQCSPCRKCYAQTDPVFDPSKSSS  560
            +SGL+QGSGEYFTRLGVGTP +Y +MVLDTGSD+VWLQC+PCR+CY+Q+DP+FDP KS +
Sbjct  128  VSGLSQGSGEYFTRLGVGTPARYVYMVLDTGSDIVWLQCAPCRRCYSQSDPIFDPRKSRT  187

Query  561  FVGVKCDSPLCRRLDSSGC  617
            +  + C SP CRRLDS+GC
Sbjct  188  YSTIPCSSPQCRRLDSAGC  206



>gb|AGV54447.1| aspartic proteinase nepenthesin-1 precursor [Phaseolus vulgaris]
Length=477

 Score =   163 bits (413),  Expect = 8e-44, Method: Compositional matrix adjust.
 Identities = 107/178 (60%), Positives = 124/178 (70%), Gaps = 12/178 (7%)
 Frame = +3

Query  93   TETXSLRPLPTAQHYSLSSKPQYSQTLVQPDDSE---NTLSLDLHHIDLISSAAVNATPK  263
            ++T  LR LP     S      + ++     DSE   +T+S+++HHID +S   +N TP 
Sbjct  34   SQTLILRNLPNPPTLS------WPESTTLGSDSEPDPDTISVNVHHIDALS---LNKTPS  84

Query  264  ALFVKRLQRDaarakalsllaaaaPPHNATRGRDFSSSVISGLAQGSGEYFTRLGVGTPP  443
             LF  RLQRDAAR K+LS LAA       T G  FSSSVISGLAQGSGEYFTRLGVGTPP
Sbjct  85   QLFHFRLQRDAARVKSLSSLAALNQTRPTTSGSGFSSSVISGLAQGSGEYFTRLGVGTPP  144

Query  444  KYAFMVLDTGSDVVWLQCSPCRKCYAQTDPVFDPSKSSSFVGVKCDSPLCRRLDSSGC  617
            KY +MVLDTGSDVVWLQC PC KCY+QTD +FDPSKS SF G+ C SPLCRR DS GC
Sbjct  145  KYVYMVLDTGSDVVWLQCKPCAKCYSQTDEIFDPSKSKSFAGIPCYSPLCRRFDSPGC  202



>ref|XP_003554768.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 1-like [Glycine 
max]
Length=472

 Score =   163 bits (412),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 92/139 (66%), Positives = 106/139 (76%), Gaps = 3/139 (2%)
 Frame = +3

Query  201  LSLDLHHIDLISSAAVNATPKALFVKRLQRDaarakalsllaaaaPPHNATRGRDFSSSV  380
            LSL LHHID +SS   N TP+ LF  RLQRDA R + +  LAA    H    G  FSSS+
Sbjct  62   LSLHLHHIDALSS---NKTPEQLFQLRLQRDAKRVEGVVALAALNQSHARRSGSSFSSSI  118

Query  381  ISGLAQGSGEYFTRLGVGTPPKYAFMVLDTGSDVVWLQCSPCRKCYAQTDPVFDPSKSSS  560
            ISGLAQGSGEYFTR+GVGTP +Y +MVLDTGSDVVWLQC+PCRKCY Q DPVFDP+KS +
Sbjct  119  ISGLAQGSGEYFTRIGVGTPARYVYMVLDTGSDVVWLQCAPCRKCYTQADPVFDPTKSRT  178

Query  561  FVGVKCDSPLCRRLDSSGC  617
            + G+ C +PLCRRLDS GC
Sbjct  179  YAGIPCGAPLCRRLDSPGC  197



>ref|XP_007051537.1| Eukaryotic aspartyl protease family protein isoform 2 [Theobroma 
cacao]
 gb|EOX95694.1| Eukaryotic aspartyl protease family protein isoform 2 [Theobroma 
cacao]
Length=488

 Score =   162 bits (411),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 100/180 (56%), Positives = 120/180 (67%), Gaps = 14/180 (8%)
 Frame = +3

Query  111  RPLPTAQHYSLSSKPQYSQTLVQPDD-----SENTLS--LDLHHIDLISSAAVNATPKAL  269
            R LP+    S       S +LV+  D     S  TL   L+LHH+D  SS  +   P+ L
Sbjct  38   RTLPSPSTLSGQDSELESDSLVETSDLDTVNSNTTLEVQLELHHVDAFSSEEI---PERL  94

Query  270  FVKRLQRDaaraka----lsllaaaaPPHNATRGRDFSSSVISGLAQGSGEYFTRLGVGT  437
            F  RLQRD  RA+     ++   A  PP    R   FSSS+ISGLAQGSGEYFTRLGVGT
Sbjct  95   FDLRLQRDELRAETINSLVAKAVARNPPRAPGRRSGFSSSIISGLAQGSGEYFTRLGVGT  154

Query  438  PPKYAFMVLDTGSDVVWLQCSPCRKCYAQTDPVFDPSKSSSFVGVKCDSPLCRRLDSSGC  617
            PP+Y +MVLDTGSDVVW+QCSPC+KCY+Q+DP+FDP+KS SF G+ C SPLCR LDSSGC
Sbjct  155  PPRYLYMVLDTGSDVVWVQCSPCKKCYSQSDPIFDPTKSRSFSGIPCGSPLCRSLDSSGC  214



>ref|XP_007051536.1| Eukaryotic aspartyl protease family protein isoform 1 [Theobroma 
cacao]
 gb|EOX95693.1| Eukaryotic aspartyl protease family protein isoform 1 [Theobroma 
cacao]
Length=557

 Score =   162 bits (409),  Expect = 5e-43, Method: Compositional matrix adjust.
 Identities = 100/180 (56%), Positives = 120/180 (67%), Gaps = 14/180 (8%)
 Frame = +3

Query  111  RPLPTAQHYSLSSKPQYSQTLVQPDD-----SENTLS--LDLHHIDLISSAAVNATPKAL  269
            R LP+    S       S +LV+  D     S  TL   L+LHH+D  SS  +   P+ L
Sbjct  38   RTLPSPSTLSGQDSELESDSLVETSDLDTVNSNTTLEVQLELHHVDAFSSEEI---PERL  94

Query  270  FVKRLQRDaaraka----lsllaaaaPPHNATRGRDFSSSVISGLAQGSGEYFTRLGVGT  437
            F  RLQRD  RA+     ++   A  PP    R   FSSS+ISGLAQGSGEYFTRLGVGT
Sbjct  95   FDLRLQRDELRAETINSLVAKAVARNPPRAPGRRSGFSSSIISGLAQGSGEYFTRLGVGT  154

Query  438  PPKYAFMVLDTGSDVVWLQCSPCRKCYAQTDPVFDPSKSSSFVGVKCDSPLCRRLDSSGC  617
            PP+Y +MVLDTGSDVVW+QCSPC+KCY+Q+DP+FDP+KS SF G+ C SPLCR LDSSGC
Sbjct  155  PPRYLYMVLDTGSDVVWVQCSPCKKCYSQSDPIFDPTKSRSFSGIPCGSPLCRSLDSSGC  214



>gb|KJB09628.1| hypothetical protein B456_001G154400 [Gossypium raimondii]
Length=446

 Score =   159 bits (403),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 101/180 (56%), Positives = 121/180 (67%), Gaps = 14/180 (8%)
 Frame = +3

Query  111  RPLPTAQHYSLSSKPQYSQTL-----VQPDDSENTLS--LDLHHIDLISSAAVNATPKAL  269
            RPLP+A   S       S +L     + P  S  TL   L+LHH+D +SS     TP+ L
Sbjct  38   RPLPSAPTLSWHDSEPESNSLEETSQLDPLSSNTTLEVQLELHHVDALSS---EDTPELL  94

Query  270  FVKRLQRDaaraka----lsllaaaaPPHNATRGRDFSSSVISGLAQGSGEYFTRLGVGT  437
            F  RLQRDA R+      +S   A  PP  A R   FSSS+ISGLAQGSGEYFTRLGVGT
Sbjct  95   FDLRLQRDALRSGTIYSLVSKAVARNPPRAAGRRSGFSSSIISGLAQGSGEYFTRLGVGT  154

Query  438  PPKYAFMVLDTGSDVVWLQCSPCRKCYAQTDPVFDPSKSSSFVGVKCDSPLCRRLDSSGC  617
            P +  +MVLDTGSDVVW+QCSPC+ CY+Q+DP+FDP+KS+SF G+ C SPLCR LDSSGC
Sbjct  155  PARNLYMVLDTGSDVVWVQCSPCKSCYSQSDPIFDPTKSASFSGIPCRSPLCRSLDSSGC  214



>ref|XP_010918360.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 1-like [Elaeis 
guineensis]
Length=507

 Score =   160 bits (405),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 88/145 (61%), Positives = 105/145 (72%), Gaps = 8/145 (6%)
 Frame = +3

Query  201  LSLDLHHIDLISSAAVNATPKALFVKRLQRDaarakalsllaaaaPPH----NATRGR--  362
            L + L H+D  S  A N+TP+ L   RL RD AR   L  + AAA        A RGR  
Sbjct  78   LRVRLAHLD--SLLAANSTPEHLLSLRLGRDVARVSNLHEILAAAMAAGNATRAIRGRRR  135

Query  363  DFSSSVISGLAQGSGEYFTRLGVGTPPKYAFMVLDTGSDVVWLQCSPCRKCYAQTDPVFD  542
             FSSSV+SGLAQGSGEYFTR+G+GTP +YA+MVLDTGSDVVWLQC+PCR+CY+QTDPVFD
Sbjct  136  GFSSSVVSGLAQGSGEYFTRIGIGTPARYAYMVLDTGSDVVWLQCAPCRRCYSQTDPVFD  195

Query  543  PSKSSSFVGVKCDSPLCRRLDSSGC  617
            P +S S+  V CD+PLCR LD +GC
Sbjct  196  PRRSRSYAAVPCDAPLCRTLDVAGC  220



>gb|KJB09626.1| hypothetical protein B456_001G154400 [Gossypium raimondii]
Length=488

 Score =   160 bits (404),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 101/180 (56%), Positives = 121/180 (67%), Gaps = 14/180 (8%)
 Frame = +3

Query  111  RPLPTAQHYSLSSKPQYSQTL-----VQPDDSENTLS--LDLHHIDLISSAAVNATPKAL  269
            RPLP+A   S       S +L     + P  S  TL   L+LHH+D +SS     TP+ L
Sbjct  38   RPLPSAPTLSWHDSEPESNSLEETSQLDPLSSNTTLEVQLELHHVDALSS---EDTPELL  94

Query  270  FVKRLQRDaaraka----lsllaaaaPPHNATRGRDFSSSVISGLAQGSGEYFTRLGVGT  437
            F  RLQRDA R+      +S   A  PP  A R   FSSS+ISGLAQGSGEYFTRLGVGT
Sbjct  95   FDLRLQRDALRSGTIYSLVSKAVARNPPRAAGRRSGFSSSIISGLAQGSGEYFTRLGVGT  154

Query  438  PPKYAFMVLDTGSDVVWLQCSPCRKCYAQTDPVFDPSKSSSFVGVKCDSPLCRRLDSSGC  617
            P +  +MVLDTGSDVVW+QCSPC+ CY+Q+DP+FDP+KS+SF G+ C SPLCR LDSSGC
Sbjct  155  PARNLYMVLDTGSDVVWVQCSPCKSCYSQSDPIFDPTKSASFSGIPCRSPLCRSLDSSGC  214



>ref|XP_003529886.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 2-like [Glycine 
max]
Length=473

 Score =   159 bits (403),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 103/152 (68%), Positives = 114/152 (75%), Gaps = 11/152 (7%)
 Frame = +3

Query  174  VQPDDSENTLSLDLHHIDLISSAAVNATPKALFVKRLQRDaarakalsllaaaaPPHNAT  353
            V+PD  E T SL LHHID +S    N TP  LF  RL+RDAAR K L+ LAAA    N T
Sbjct  54   VEPD-PEPTTSLSLHHIDALS---FNKTPSQLFHLRLERDAARVKTLTHLAAAT---NKT  106

Query  354  RGRD----FSSSVISGLAQGSGEYFTRLGVGTPPKYAFMVLDTGSDVVWLQCSPCRKCYA  521
            R  +    FSSSV+SGL+QGSGEYFTRLGVGTPPKY +MVLDTGSDVVWLQC PC KCY+
Sbjct  107  RPANPGSGFSSSVVSGLSQGSGEYFTRLGVGTPPKYLYMVLDTGSDVVWLQCKPCTKCYS  166

Query  522  QTDPVFDPSKSSSFVGVKCDSPLCRRLDSSGC  617
            QTD +FDPSKS SF G+ C SPLCRRLDS GC
Sbjct  167  QTDQIFDPSKSKSFAGIPCYSPLCRRLDSPGC  198



>ref|XP_008437888.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 2-like [Cucumis 
melo]
Length=474

 Score =   159 bits (401),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 94/175 (54%), Positives = 118/175 (67%), Gaps = 6/175 (3%)
 Frame = +3

Query  96   ETXSLRPLPTAQHYSLSSKPQYSQTLVQPDDSENTLSLDLHHIDLISSAAVNATPKALFV  275
            +T  LR LP++  +     P  S + +  + +E T      H+  + + + N TP+ LF 
Sbjct  31   QTLILRSLPSSPSF----LPSDSNSFLSSEATE-TELGLELHLHHLDALSFNRTPEELFH  85

Query  276  KRLQRDaarakalsllaaaaPPHNATRGR-DFSSSVISGLAQGSGEYFTRLGVGTPPKYA  452
             RLQRDA R K LS L A +   +   G   FSSSVISGLAQGSGEYFTR+GVGTPPKY 
Sbjct  86   LRLQRDAIRVKKLSSLGATSRNLSRPSGTTGFSSSVISGLAQGSGEYFTRIGVGTPPKYV  145

Query  453  FMVLDTGSDVVWLQCSPCRKCYAQTDPVFDPSKSSSFVGVKCDSPLCRRLDSSGC  617
            +MVLDTGSD+VWLQC+PC+ CY+QTDPVF+P KS SF  V C +PLCRRL+S GC
Sbjct  146  YMVLDTGSDIVWLQCAPCKNCYSQTDPVFNPVKSGSFAKVLCRTPLCRRLESPGC  200



>ref|XP_008799615.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 1-like [Phoenix 
dactylifera]
Length=504

 Score =   159 bits (402),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 84/144 (58%), Positives = 103/144 (72%), Gaps = 9/144 (6%)
 Frame = +3

Query  201  LSLDLHHIDLISSAAVNATPKALFVKRLQRDaarakalsllaaaaPPHNATRG-----RD  365
            L + + H D  S  A N+TP+ L   RL RDA R   L  +  A    NAT       R 
Sbjct  78   LRVRIAHRD--SLFAANSTPEHLLGLRLGRDATRVSHLHEILGAE--GNATHAVRAGRRG  133

Query  366  FSSSVISGLAQGSGEYFTRLGVGTPPKYAFMVLDTGSDVVWLQCSPCRKCYAQTDPVFDP  545
            FSSSV+SGLAQGSGEYFTR+G+GTP +YA+MVLDTGSDVVWLQC+PCR+CY+QTDP+FDP
Sbjct  134  FSSSVVSGLAQGSGEYFTRIGIGTPARYAYMVLDTGSDVVWLQCAPCRRCYSQTDPIFDP  193

Query  546  SKSSSFVGVKCDSPLCRRLDSSGC  617
             +S S+  + CD+PLCRRLD +GC
Sbjct  194  RRSRSYATIPCDAPLCRRLDVAGC  217



>gb|KGN56421.1| Aspartic proteinase nepenthesin-1 [Cucumis sativus]
Length=512

 Score =   158 bits (399),  Expect = 9e-42, Method: Compositional matrix adjust.
 Identities = 84/126 (67%), Positives = 97/126 (77%), Gaps = 1/126 (1%)
 Frame = +3

Query  243  AVNATPKALFVKRLQRDaarakalsllaaaaPPHNATRGR-DFSSSVISGLAQGSGEYFT  419
            + N TP+ LF  RLQRDA R K LS L A +   +   G   FSSSVISGLAQGSGEYFT
Sbjct  113  SFNRTPEELFHLRLQRDAIRVKKLSSLGATSRNLSKPGGTTGFSSSVISGLAQGSGEYFT  172

Query  420  RLGVGTPPKYAFMVLDTGSDVVWLQCSPCRKCYAQTDPVFDPSKSSSFVGVKCDSPLCRR  599
            R+GVGTPPKY +MVLDTGSD+VWLQC+PC+ CY+QTDPVF+P KS SF  V C +PLCRR
Sbjct  173  RIGVGTPPKYVYMVLDTGSDIVWLQCAPCKNCYSQTDPVFNPVKSGSFAKVLCRTPLCRR  232

Query  600  LDSSGC  617
            L+S GC
Sbjct  233  LESPGC  238



>ref|XP_004133810.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 1-like [Cucumis 
sativus]
Length=471

 Score =   157 bits (398),  Expect = 9e-42, Method: Compositional matrix adjust.
 Identities = 84/126 (67%), Positives = 97/126 (77%), Gaps = 1/126 (1%)
 Frame = +3

Query  243  AVNATPKALFVKRLQRDaarakalsllaaaaPPHNATRGR-DFSSSVISGLAQGSGEYFT  419
            + N TP+ LF  RLQRDA R K LS L A +   +   G   FSSSVISGLAQGSGEYFT
Sbjct  72   SFNRTPEELFHLRLQRDAIRVKKLSSLGATSRNLSKPGGTTGFSSSVISGLAQGSGEYFT  131

Query  420  RLGVGTPPKYAFMVLDTGSDVVWLQCSPCRKCYAQTDPVFDPSKSSSFVGVKCDSPLCRR  599
            R+GVGTPPKY +MVLDTGSD+VWLQC+PC+ CY+QTDPVF+P KS SF  V C +PLCRR
Sbjct  132  RIGVGTPPKYVYMVLDTGSDIVWLQCAPCKNCYSQTDPVFNPVKSGSFAKVLCRTPLCRR  191

Query  600  LDSSGC  617
            L+S GC
Sbjct  192  LESPGC  197



>emb|CDY43952.1| BnaC04g21580D [Brassica napus]
Length=483

 Score =   157 bits (396),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 90/160 (56%), Positives = 111/160 (69%), Gaps = 7/160 (4%)
 Frame = +3

Query  147  SKPQYSQTLVQPDDSENTLSLDLHHIDLISSAAVNATPKALFVKRLQRDaarakalslla  326
            S P+ S++L  P  S  +LSL L HID ISS + +A+P  LF  RL+RD+ R ++L+ LA
Sbjct  44   SSPE-SESLTTPSQSTTSLSLHLSHIDAISSFS-DASPAELFDLRLKRDSIRVESLTSLA  101

Query  327  aaaPPHNATR-----GRDFSSSVISGLAQGSGEYFTRLGVGTPPKYAFMVLDTGSDVVWL  491
            A +   N TR        FS +VISGL+QGSGEYF RLGVGTP    +MVLDTGSDVVWL
Sbjct  102  AVSSRRNVTRRAPRSAGGFSGAVISGLSQGSGEYFMRLGVGTPATNMYMVLDTGSDVVWL  161

Query  492  QCSPCRKCYAQTDPVFDPSKSSSFVGVKCDSPLCRRLDSS  611
            QC+PC+ CY Q+D +FDPSKS +F  V C S LCRRLD S
Sbjct  162  QCAPCKVCYNQSDAIFDPSKSKTFATVPCGSRLCRRLDDS  201



>ref|XP_010665756.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 2-like [Beta 
vulgaris subsp. vulgaris]
Length=484

 Score =   156 bits (395),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 86/164 (52%), Positives = 114/164 (70%), Gaps = 13/164 (8%)
 Frame = +3

Query  156  QYSQTLVQPDDS---ENTLSLDLHHIDLISSAAVNATPKALFVKRLQRDaaraka--lsl  320
            Q +QTL + + S   ++T +L L H+D +SS   + TP+ LF  RL+RD ARAK      
Sbjct  49   QTTQTLEELELSTSIDSTFTLHLEHLDALSS---HLTPEELFSFRLKRDDARAKTIFARA  105

Query  321  laaaaPPHNATRG-----RDFSSSVISGLAQGSGEYFTRLGVGTPPKYAFMVLDTGSDVV  485
             +++   H   R      RDFSSS++SGL+QGSGEYFTRLGVGTPPKY +MVLDTGSD+V
Sbjct  106  HSSSRSAHKHGRNASHSTRDFSSSIVSGLSQGSGEYFTRLGVGTPPKYMYMVLDTGSDIV  165

Query  486  WLQCSPCRKCYAQTDPVFDPSKSSSFVGVKCDSPLCRRLDSSGC  617
            W+QC+PC+KCY QTD +F+P KS S+  + C S +C+RLD  GC
Sbjct  166  WIQCTPCKKCYDQTDRMFNPVKSGSYRSIPCRSKICQRLDQPGC  209



>emb|CDX89133.1| BnaA04g00530D [Brassica napus]
Length=483

 Score =   156 bits (395),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 89/160 (56%), Positives = 111/160 (69%), Gaps = 7/160 (4%)
 Frame = +3

Query  147  SKPQYSQTLVQPDDSENTLSLDLHHIDLISSAAVNATPKALFVKRLQRDaarakalslla  326
            S P+ S++L     S  +LSL L H+D ISS + +A+P  LF  RL+RD+ R ++L+ LA
Sbjct  44   SSPE-SESLTTVSQSTTSLSLHLSHVDAISSFS-DASPAELFNLRLKRDSLRVESLTTLA  101

Query  327  aaaPPHNATR-----GRDFSSSVISGLAQGSGEYFTRLGVGTPPKYAFMVLDTGSDVVWL  491
            A +   N TR        FS +VISGL+QGSGEYF RLGVGTP K  +MVLDTGSDVVWL
Sbjct  102  AVSSRRNVTRRAPRSAGGFSGAVISGLSQGSGEYFMRLGVGTPAKNMYMVLDTGSDVVWL  161

Query  492  QCSPCRKCYAQTDPVFDPSKSSSFVGVKCDSPLCRRLDSS  611
            QC+PC+ CY Q+D +FDPSKS +F  V C S LCRRLD S
Sbjct  162  QCAPCKVCYNQSDAIFDPSKSKTFAAVPCGSRLCRRLDDS  201



>gb|KFK35370.1| hypothetical protein AALP_AA5G276300 [Arabis alpina]
Length=485

 Score =   156 bits (395),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 86/162 (53%), Positives = 111/162 (69%), Gaps = 8/162 (5%)
 Frame = +3

Query  147  SKPQYSQTLVQPDDSENTLSLDLHHIDLISSAAVNATPKALFVKRLQRDaarakalslla  326
            S P  S++  + + +  +LS+ L HID +SS + ++TP  LF  RL+RD+ R  +++ LA
Sbjct  43   SWPDQSESEFKSESTTTSLSVHLSHIDALSSFS-DSTPSELFNLRLRRDSLRVNSITKLA  101

Query  327  aaaPPHNATRGR-------DFSSSVISGLAQGSGEYFTRLGVGTPPKYAFMVLDTGSDVV  485
            A +   N TR +        FS +VISGL+QGSGEYF RLGVGTP   A+MVLDTGSDVV
Sbjct  102  AVSTGRNITRKKRTPKSSGGFSGAVISGLSQGSGEYFMRLGVGTPATNAYMVLDTGSDVV  161

Query  486  WLQCSPCRKCYAQTDPVFDPSKSSSFVGVKCDSPLCRRLDSS  611
            WLQCSPC+ CY Q+DP+FDP KS S+  V C S LCRRLD S
Sbjct  162  WLQCSPCKVCYNQSDPIFDPKKSKSYATVACGSRLCRRLDDS  203



>ref|XP_009138753.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 1-like [Brassica 
rapa]
Length=483

 Score =   155 bits (393),  Expect = 5e-41, Method: Compositional matrix adjust.
 Identities = 89/160 (56%), Positives = 110/160 (69%), Gaps = 7/160 (4%)
 Frame = +3

Query  147  SKPQYSQTLVQPDDSENTLSLDLHHIDLISSAAVNATPKALFVKRLQRDaarakalslla  326
            S P+ S++L     S  +LSL L H+D ISS A +A+P  LF  RL+RD+ R ++L+ LA
Sbjct  44   SSPE-SESLTTVSQSTTSLSLHLSHVDAISSFA-DASPAELFNLRLKRDSLRVESLTTLA  101

Query  327  aaaPPHNATR-----GRDFSSSVISGLAQGSGEYFTRLGVGTPPKYAFMVLDTGSDVVWL  491
            A +   N TR        FS +VISGL+QGSGEYF RLGVGTP    +MVLDTGSDVVWL
Sbjct  102  AVSSRRNVTRRAPRSAGGFSGAVISGLSQGSGEYFMRLGVGTPATNMYMVLDTGSDVVWL  161

Query  492  QCSPCRKCYAQTDPVFDPSKSSSFVGVKCDSPLCRRLDSS  611
            QC+PC+ CY Q+D +FDPSKS +F  V C S LCRRLD S
Sbjct  162  QCAPCKVCYNQSDAIFDPSKSKTFAAVPCGSRLCRRLDDS  201



>ref|XP_010480432.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 2-like [Camelina 
sativa]
Length=488

 Score =   155 bits (393),  Expect = 6e-41, Method: Compositional matrix adjust.
 Identities = 86/142 (61%), Positives = 109/142 (77%), Gaps = 6/142 (4%)
 Frame = +3

Query  201  LSLDLHHIDLISSAAVNATPKALFVKRLQRDaarakalsllaaaaPPHNAT---RGRDFS  371
            ++L+L HID +SS   N TP+ LF  RLQRD+ R  +++ LAA  P  N T   R   FS
Sbjct  75   ITLNLDHIDALSS---NKTPQELFSSRLQRDSRRVNSIATLAARVPRRNVTHAPRSGGFS  131

Query  372  SSVISGLAQGSGEYFTRLGVGTPPKYAFMVLDTGSDVVWLQCSPCRKCYAQTDPVFDPSK  551
            SSV+SGL+QGSGEYFTRLGVGTP +Y +MVLDTGSD+VWLQC+PCR+CY+Q+DP+FDP K
Sbjct  132  SSVVSGLSQGSGEYFTRLGVGTPARYVYMVLDTGSDIVWLQCAPCRRCYSQSDPIFDPRK  191

Query  552  SSSFVGVKCDSPLCRRLDSSGC  617
            S ++  + C SP CRRLDS+GC
Sbjct  192  SRTYSTIPCSSPHCRRLDSAGC  213



>ref|XP_004306664.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 1-like [Fragaria 
vesca subsp. vesca]
Length=467

 Score =   155 bits (391),  Expect = 8e-41, Method: Compositional matrix adjust.
 Identities = 98/177 (55%), Positives = 123/177 (69%), Gaps = 13/177 (7%)
 Frame = +3

Query  96   ETXSLRPLPTAQHYSLSSKPQYSQTLVQPDDSENTLSLDLHHIDLISSAAVNATPKALFV  275
            +T  L PLP+A   SLS    +S+T  +PD   ++LSL LHH+D +SS   + TP  LF 
Sbjct  26   QTLLLSPLPSAP--SLSQPESFSETTSEPDSDPSSLSLPLHHLDALSS---DQTPSQLFH  80

Query  276  KRLQRDaarakalsllaaaaPPHNATRGRDFSSSVIS---GLAQGSGEYFTRLGVGTPPK  446
             RL+RD+ R  +L+ LA     +N TR    S    S   GL+QGSGEYFTR+GVG+PPK
Sbjct  81   LRLRRDSLRFNSLTSLA-----YNRTRPGPSSGFSSSIVSGLSQGSGEYFTRIGVGSPPK  135

Query  447  YAFMVLDTGSDVVWLQCSPCRKCYAQTDPVFDPSKSSSFVGVKCDSPLCRRLDSSGC  617
            Y +MVLDTGSDVVWLQC+PC++CY+QTD VFDP KSSS+  + C SPLCRRLDS GC
Sbjct  136  YLYMVLDTGSDVVWLQCAPCKRCYSQTDLVFDPRKSSSYSSLPCSSPLCRRLDSPGC  192



>ref|XP_010469025.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 1-like [Camelina 
sativa]
Length=486

 Score =   154 bits (390),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 83/150 (55%), Positives = 107/150 (71%), Gaps = 6/150 (4%)
 Frame = +3

Query  177  QPDDSENTLSLDLHHIDLISSAAVNATPKALFVKRLQRDaarakalsllaaaaPPHNATR  356
            QP+ + ++LS+ L H+D + S + +A+P ALF  RLQRD+ R +++S LAA +   N TR
Sbjct  56   QPESTTSSLSVHLSHVDALYSFS-DASPTALFNLRLQRDSLRVESISSLAAVSTGRNVTR  114

Query  357  -----GRDFSSSVISGLAQGSGEYFTRLGVGTPPKYAFMVLDTGSDVVWLQCSPCRKCYA  521
                    FS +VISGL+QGSGEYF RLGVGTP    +MVLDTGSDVVWLQCSPC+ CY 
Sbjct  115  RTPRSAGGFSGAVISGLSQGSGEYFMRLGVGTPATNVYMVLDTGSDVVWLQCSPCKACYN  174

Query  522  QTDPVFDPSKSSSFVGVKCDSPLCRRLDSS  611
            Q+DP+FDP +S ++  V C S LCRRLD S
Sbjct  175  QSDPIFDPKRSKTYATVPCGSRLCRRLDDS  204



>ref|XP_010512555.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 1-like [Camelina 
sativa]
Length=483

 Score =   154 bits (390),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 82/150 (55%), Positives = 107/150 (71%), Gaps = 6/150 (4%)
 Frame = +3

Query  177  QPDDSENTLSLDLHHIDLISSAAVNATPKALFVKRLQRDaarakalsllaaaaPPHNATR  356
            QP+ + ++LS+ L H+D +SS + +A+P  LF  RLQRD+ R ++++ LAA +   N TR
Sbjct  53   QPESTTSSLSVHLSHVDALSSLS-DASPTDLFNLRLQRDSLRVESIASLAAVSTGRNVTR  111

Query  357  -----GRDFSSSVISGLAQGSGEYFTRLGVGTPPKYAFMVLDTGSDVVWLQCSPCRKCYA  521
                    FS +VISGL+QGSGEYF RLGVGTP    +MVLDTGSDVVWLQCSPC+ CY 
Sbjct  112  KTPRSAGGFSGAVISGLSQGSGEYFMRLGVGTPATNVYMVLDTGSDVVWLQCSPCKACYN  171

Query  522  QTDPVFDPSKSSSFVGVKCDSPLCRRLDSS  611
            Q+DP+FDP +S ++  V C S LCRRLD S
Sbjct  172  QSDPIFDPKRSKTYATVPCGSRLCRRLDDS  201



>ref|XP_010413342.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 1-like [Camelina 
sativa]
Length=488

 Score =   153 bits (387),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 83/150 (55%), Positives = 107/150 (71%), Gaps = 6/150 (4%)
 Frame = +3

Query  177  QPDDSENTLSLDLHHIDLISSAAVNATPKALFVKRLQRDaarakalsllaaaaPPHNATR  356
            QP+ + ++LS+ L H+D + S + +A+P  LF  RLQRD+ R +++S LAA +   NATR
Sbjct  58   QPESTTSSLSVHLSHVDALFSFS-DASPTDLFNLRLQRDSLRVESISSLAAVSTGRNATR  116

Query  357  -----GRDFSSSVISGLAQGSGEYFTRLGVGTPPKYAFMVLDTGSDVVWLQCSPCRKCYA  521
                    FS +VISGL+QGSGEYF RLGVGTP    +MVLDTGSDVVWLQCSPC+ CY 
Sbjct  117  RTPRSAGGFSGAVISGLSQGSGEYFMRLGVGTPATNVYMVLDTGSDVVWLQCSPCKACYN  176

Query  522  QTDPVFDPSKSSSFVGVKCDSPLCRRLDSS  611
            Q+DP+FDP +S ++  V C S LCRRLD S
Sbjct  177  QSDPIFDPKRSKTYATVPCGSRLCRRLDDS  206



>ref|XP_010544842.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 2 [Tarenaya 
hassleriana]
Length=510

 Score =   152 bits (385),  Expect = 9e-40, Method: Compositional matrix adjust.
 Identities = 82/177 (46%), Positives = 110/177 (62%), Gaps = 5/177 (3%)
 Frame = +3

Query  96   ETXSLRPLPTAQHYSLSSKPQYSQTLVQPDDSENTLSLDLHHIDLISSAAVNATPKALFV  275
            +T  + PLPT+   S       +       ++  +LS  L H+D +S +  + +P+ LF 
Sbjct  63   QTLVVNPLPTSPTLSWPDSEFVTDGSDSLSETATSLSAQLLHVDALSPS--DTSPEHLFD  120

Query  276  KRLQRDa---arakalsllaaaaPPHNATRGRDFSSSVISGLAQGSGEYFTRLGVGTPPK  446
             RL+RD+       + +  +     H       FS +V+SGL+QGSGEYFTRLGVGTP  
Sbjct  121  LRLRRDSLRVETLTSFAAASVRNVTHAPRAAGGFSGAVVSGLSQGSGEYFTRLGVGTPAT  180

Query  447  YAFMVLDTGSDVVWLQCSPCRKCYAQTDPVFDPSKSSSFVGVKCDSPLCRRLDSSGC  617
            YA+MVLDTGSD+VWLQCSPC+ CY Q+DP+FDP+KS S+  V C S LCRRLDS GC
Sbjct  181  YAYMVLDTGSDIVWLQCSPCKVCYNQSDPIFDPAKSRSYATVPCASRLCRRLDSPGC  237



>ref|XP_009394177.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 1-like [Musa 
acuminata subsp. malaccensis]
Length=499

 Score =   152 bits (384),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 75/120 (63%), Positives = 93/120 (78%), Gaps = 3/120 (3%)
 Frame = +3

Query  267  LFVKRLQRDaarakalsllaaaa---PPHNATRGRDFSSSVISGLAQGSGEYFTRLGVGT  437
            +F+ RL RDAAR + LS + A A   P  N T  R FSS V+SGLAQGSGEYF R+G+GT
Sbjct  96   IFLLRLDRDAARVETLSQILAVATAPPAANVTSRRGFSSKVVSGLAQGSGEYFARIGIGT  155

Query  438  PPKYAFMVLDTGSDVVWLQCSPCRKCYAQTDPVFDPSKSSSFVGVKCDSPLCRRLDSSGC  617
            P +YA+MVLDTGSDVVWLQC+PCR+CY+Q+DP+FDP  S S+  + C +PLCRRLD +GC
Sbjct  156  PARYAYMVLDTGSDVVWLQCAPCRRCYSQSDPIFDPRSSRSYAAIPCGAPLCRRLDVAGC  215



>ref|XP_002878415.1| aspartyl protease family protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH54674.1| aspartyl protease family protein [Arabidopsis lyrata subsp. lyrata]
Length=486

 Score =   151 bits (382),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 89/177 (50%), Positives = 115/177 (65%), Gaps = 8/177 (5%)
 Frame = +3

Query  96   ETXSLRPLPTAQHYSLSSKPQYSQTLVQPDDSENTLSLDLHHIDLISSAAVNATPKALFV  275
            +T  +  LP++   S      +S   V   +S  +LS+ L H+D +SS + +A+P  LF 
Sbjct  31   QTLVVNTLPSSATLSWPESKSFSDESVS--ESTTSLSVHLSHVDALSSFS-DASPVDLFK  87

Query  276  KRLQRDaarakalsllaaaaPPHNATR-----GRDFSSSVISGLAQGSGEYFTRLGVGTP  440
             RLQRD+ R K+++ LAA +   NAT+        FS +VISGL+QGSGEYF RLGVGTP
Sbjct  88   LRLQRDSLRVKSITSLAAVSTGRNATKRTPRSAGGFSGAVISGLSQGSGEYFMRLGVGTP  147

Query  441  PKYAFMVLDTGSDVVWLQCSPCRKCYAQTDPVFDPSKSSSFVGVKCDSPLCRRLDSS  611
                +MVLDTGSDVVWLQCSPC+ CY Q+D +FDP KS +F  V C S LCRRLD S
Sbjct  148  ATNVYMVLDTGSDVVWLQCSPCKACYNQSDVIFDPKKSKTFATVPCGSRLCRRLDDS  204



>ref|XP_004171805.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 1-like, partial 
[Cucumis sativus]
Length=384

 Score =   149 bits (376),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 66/84 (79%), Positives = 75/84 (89%), Gaps = 0/84 (0%)
 Frame = +3

Query  366  FSSSVISGLAQGSGEYFTRLGVGTPPKYAFMVLDTGSDVVWLQCSPCRKCYAQTDPVFDP  545
            FSSSVISGLAQGSGEYFTR+GVGTPPKY +MVLDTGSD+VWLQC+PC+ CY+QTDPVF+P
Sbjct  27   FSSSVISGLAQGSGEYFTRIGVGTPPKYVYMVLDTGSDIVWLQCAPCKNCYSQTDPVFNP  86

Query  546  SKSSSFVGVKCDSPLCRRLDSSGC  617
             KS SF  V C +PLCRRL+S GC
Sbjct  87   VKSGSFAKVLCRTPLCRRLESPGC  110



>gb|ABK24467.1| unknown [Picea sitchensis]
Length=497

 Score =   151 bits (381),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 84/172 (49%), Positives = 118/172 (69%), Gaps = 17/172 (10%)
 Frame = +3

Query  147  SKPQYSQTLVQPDDSENTLSLDLHHIDLISSAAVNATPKALFVKRLQRDaara-------  305
            S  ++S+T VQ ++ +N++ L + H D +SS++  +  K +  +RL+RDAAR        
Sbjct  52   SAQEWSET-VQGEE-KNSIVLQVVHRDSLSSSSNTSLVKEILQERLKRDAARVDSINARV  109

Query  306  --kalsllaaaaPPHNATR------GRDFSSSVISGLAQGSGEYFTRLGVGTPPKYAFMV  461
               A+ +  A   P N +        +DFSSS+ISGLAQGSGEYFTRLGVGTPP+Y +MV
Sbjct  110  QLAAMGVSKAEMKPLNGSSIDARFDAKDFSSSIISGLAQGSGEYFTRLGVGTPPRYTYMV  169

Query  462  LDTGSDVVWLQCSPCRKCYAQTDPVFDPSKSSSFVGVKCDSPLCRRLDSSGC  617
            LDTGSD++W+QC PC KCY QTDP+F+P+ SS++  V C +PLC++LD SGC
Sbjct  170  LDTGSDIMWIQCLPCAKCYGQTDPLFNPAASSTYRKVPCATPLCKKLDISGC  221



>ref|XP_010924503.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 1-like [Elaeis 
guineensis]
Length=508

 Score =   150 bits (379),  Expect = 7e-39, Method: Compositional matrix adjust.
 Identities = 82/147 (56%), Positives = 102/147 (69%), Gaps = 8/147 (5%)
 Frame = +3

Query  195  NTLSLDLHHIDLISSAAVNATPKALFVKRLQRDaarakalsllaaaaPPHN------ATR  356
            ++  + L H D  S  A N TP+ L   RL RDAAR   L  + AAA            R
Sbjct  77   SSFHVSLAHRD--SLLAANTTPEHLLRLRLGRDAARVANLHKILAAATAAGNATHAVGAR  134

Query  357  GRDFSSSVISGLAQGSGEYFTRLGVGTPPKYAFMVLDTGSDVVWLQCSPCRKCYAQTDPV  536
             R FS+SV+SGL+QGSGEYFTR+G+GTP +Y  MVLDTGSDVVWLQC+PCR+CY+QTDP+
Sbjct  135  PRGFSASVVSGLSQGSGEYFTRIGIGTPARYLNMVLDTGSDVVWLQCAPCRRCYSQTDPI  194

Query  537  FDPSKSSSFVGVKCDSPLCRRLDSSGC  617
            FDP +S S+  V C++PLCRRLD +GC
Sbjct  195  FDPRQSRSYAAVPCEAPLCRRLDVAGC  221



>emb|CDY25081.1| BnaC06g18230D [Brassica napus]
Length=485

 Score =   150 bits (378),  Expect = 8e-39, Method: Compositional matrix adjust.
 Identities = 88/177 (50%), Positives = 118/177 (67%), Gaps = 9/177 (5%)
 Frame = +3

Query  96   ETXSLRPLPTAQHYSLSSKPQYSQTLVQPDDSENTLSLDLHHIDLISSAAVNATPKALFV  275
             T  +  LP++Q +S       + T+    DS  +L++ L H+D +SS + +A+P  LF 
Sbjct  30   NTLIVNTLPSSQIFSSPEPGSLTSTVF---DSITSLTVHLSHVDALSSFS-DASPLELFN  85

Query  276  KRLQRDaarakalsllaaaaPPHNATRGR-----DFSSSVISGLAQGSGEYFTRLGVGTP  440
             RL+RD+ R K+L+ LAA +   N T+        FS +VISGL+QGSGEYF RLGVGTP
Sbjct  86   LRLRRDSLRVKSLTTLAAVSTGKNVTKRTPRSPGGFSGAVISGLSQGSGEYFMRLGVGTP  145

Query  441  PKYAFMVLDTGSDVVWLQCSPCRKCYAQTDPVFDPSKSSSFVGVKCDSPLCRRLDSS  611
                +MVLDTGSDVVWLQCSPC+ CY Q+DP+F+P+KS++F  V C S LCRRLD S
Sbjct  146  ATNVYMVLDTGSDVVWLQCSPCKVCYNQSDPMFNPAKSTTFATVPCGSSLCRRLDES  202



>gb|KJB41527.1| hypothetical protein B456_007G108800, partial [Gossypium raimondii]
Length=460

 Score =   149 bits (377),  Expect = 8e-39, Method: Compositional matrix adjust.
 Identities = 95/184 (52%), Positives = 118/184 (64%), Gaps = 14/184 (8%)
 Frame = +3

Query  96   ETXSLRPLPTAQHYSLSSKPQYSQTLVQPDD----SENT---LSLDLHHIDLISSAAVNA  254
            +T  LRP P+A   S +     S +LV+  +    S NT   + L+LHH+D  SS     
Sbjct  26   QTLVLRPFPSAPTLSWTDAEPESDSLVEIFELNAVSFNTTLEMHLELHHLDAFSS---EE  82

Query  255  TPKALFVKRLQRDaarakalsllaaaaPPHN---ATRGRDFSSSVISGLAQGSGEYFTRL  425
            T + LF   LQRD  RA+ +  L + A   N   AT    FSSS+I GLAQGSGEYFTRL
Sbjct  83   TLERLFDLCLQRDMLRAETIYSLVSKAIACNRPRATGYLGFSSSIIFGLAQGSGEYFTRL  142

Query  426  GVGTPPKYAFMVLDTGSDVVWLQCSPCRKCYAQTDPVFDPSKSSSFVGVKCDSPLCRRLD  605
            GV T P+Y +MVLDTG DVVW+QCSPC+ CY+Q+DP+F P+KS SF G+ C SPL R LD
Sbjct  143  GVSTLPRYLYMVLDTG-DVVWVQCSPCKNCYSQSDPIFYPTKSHSFSGIPCGSPLYRSLD  201

Query  606  SSGC  617
            SSGC
Sbjct  202  SSGC  205



>gb|AAK64003.1| AT3g61820/F15G16_210 [Arabidopsis thaliana]
Length=362

 Score =   147 bits (370),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 81/140 (58%), Positives = 99/140 (71%), Gaps = 6/140 (4%)
 Frame = +3

Query  207  LDLHHIDLISSAAVNATPKALFVKRLQRDaarakalsllaaaaPPHNATR-----GRDFS  371
            + L H+D +SS + +A+P  LF  RLQRD+ R K+++ LAA +   NAT+        FS
Sbjct  63   VHLSHVDALSSFS-DASPADLFNLRLQRDSLRVKSITSLAAVSTGRNATKRTPRTAGGFS  121

Query  372  SSVISGLAQGSGEYFTRLGVGTPPKYAFMVLDTGSDVVWLQCSPCRKCYAQTDPVFDPSK  551
             +VISGL+QGSGEYF RLGVGTP    +MVLDTGSDVVWLQCSPC+ CY QTD +FDP K
Sbjct  122  GAVISGLSQGSGEYFMRLGVGTPATNVYMVLDTGSDVVWLQCSPCKACYNQTDAIFDPKK  181

Query  552  SSSFVGVKCDSPLCRRLDSS  611
            S +F  V C S LCRRLD S
Sbjct  182  SKTFATVPCGSRLCRRLDDS  201



>emb|CDX67868.1| BnaA07g19080D [Brassica napus]
Length=485

 Score =   147 bits (371),  Expect = 7e-38, Method: Compositional matrix adjust.
 Identities = 90/177 (51%), Positives = 117/177 (66%), Gaps = 9/177 (5%)
 Frame = +3

Query  96   ETXSLRPLPTAQHYSLSSKPQYSQTLVQPDDSENTLSLDLHHIDLISSAAVNATPKALFV  275
             T  +  LP++Q +S    P+         DS  +L++ L H+D +SS + +A+P  LF 
Sbjct  30   NTLVVNTLPSSQIFS---SPEPESLTSTVSDSTTSLTVHLSHVDALSSFS-DASPLELFN  85

Query  276  KRLQRDaarakalsllaaaaPPHNATRGR-----DFSSSVISGLAQGSGEYFTRLGVGTP  440
             RL+RD+ R K+L+ LAA +   N T+        FS +VISGL+QGSGEYF RLGVGTP
Sbjct  86   LRLRRDSLRVKSLTTLAAVSTGKNVTKRTPRSPGGFSGAVISGLSQGSGEYFMRLGVGTP  145

Query  441  PKYAFMVLDTGSDVVWLQCSPCRKCYAQTDPVFDPSKSSSFVGVKCDSPLCRRLDSS  611
                +MVLDTGSDVVWLQCSPC+ CY Q+DP+FDP+KS +F  V C SPLCRRLD S
Sbjct  146  ATNVYMVLDTGSDVVWLQCSPCKVCYNQSDPMFDPAKSKTFATVPCGSPLCRRLDES  202



>ref|NP_191741.1| aspartyl protease [Arabidopsis thaliana]
 emb|CAB71112.1| putative protein [Arabidopsis thaliana]
 gb|AEE80260.1| aspartyl protease [Arabidopsis thaliana]
Length=483

 Score =   147 bits (370),  Expect = 8e-38, Method: Compositional matrix adjust.
 Identities = 81/140 (58%), Positives = 99/140 (71%), Gaps = 6/140 (4%)
 Frame = +3

Query  207  LDLHHIDLISSAAVNATPKALFVKRLQRDaarakalsllaaaaPPHNATR-----GRDFS  371
            + L H+D +SS + +A+P  LF  RLQRD+ R K+++ LAA +   NAT+        FS
Sbjct  63   VHLSHVDALSSFS-DASPADLFNLRLQRDSLRVKSITSLAAVSTGRNATKRTPRTAGGFS  121

Query  372  SSVISGLAQGSGEYFTRLGVGTPPKYAFMVLDTGSDVVWLQCSPCRKCYAQTDPVFDPSK  551
             +VISGL+QGSGEYF RLGVGTP    +MVLDTGSDVVWLQCSPC+ CY QTD +FDP K
Sbjct  122  GAVISGLSQGSGEYFMRLGVGTPATNVYMVLDTGSDVVWLQCSPCKACYNQTDAIFDPKK  181

Query  552  SSSFVGVKCDSPLCRRLDSS  611
            S +F  V C S LCRRLD S
Sbjct  182  SKTFATVPCGSRLCRRLDDS  201



>ref|XP_004969076.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 2-like [Setaria 
italica]
Length=493

 Score =   146 bits (369),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 77/126 (61%), Positives = 91/126 (72%), Gaps = 1/126 (1%)
 Frame = +3

Query  243  AVNATPKALFVKRLQRDaarakalsllaaaaPPHNAT-RGRDFSSSVISGLAQGSGEYFT  419
            AVNAT   L   RL+RD  RA  +S  AA     N T RG   ++ V+SGLA+GSGEYFT
Sbjct  77   AVNATAAELLKHRLRRDKRRAARISKEAAGGAAANGTSRGGGVAAPVVSGLAEGSGEYFT  136

Query  420  RLGVGTPPKYAFMVLDTGSDVVWLQCSPCRKCYAQTDPVFDPSKSSSFVGVKCDSPLCRR  599
            ++GVGTP   A MVLDTGSDVVWLQC+PCR+CY Q+ PVFDP +SSS+  V C +PLCRR
Sbjct  137  KIGVGTPATPALMVLDTGSDVVWLQCAPCRRCYDQSGPVFDPRRSSSYGAVDCAAPLCRR  196

Query  600  LDSSGC  617
            LDS GC
Sbjct  197  LDSGGC  202



>ref|XP_009104352.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 1 [Brassica 
rapa]
Length=485

 Score =   146 bits (368),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 88/177 (50%), Positives = 118/177 (67%), Gaps = 9/177 (5%)
 Frame = +3

Query  96   ETXSLRPLPTAQHYSLSSKPQYSQTLVQPDDSENTLSLDLHHIDLISSAAVNATPKALFV  275
             T  +  LP++Q +S    P+         DS  +L++ L H+D +SS + +A+P  LF 
Sbjct  30   NTLVVNTLPSSQIFS---SPEPESLTSTVSDSTTSLTVHLSHVDALSSFS-DASPSELFN  85

Query  276  KRLQRDaarakalsllaaaaPPHNATRGR-----DFSSSVISGLAQGSGEYFTRLGVGTP  440
             RL+RD+ R K+L+ LAA +   N T+        FS +VISGL+QGSGEYF RLGVGTP
Sbjct  86   LRLRRDSLRVKSLTTLAAVSTGKNVTKRTPRSPGGFSGAVISGLSQGSGEYFMRLGVGTP  145

Query  441  PKYAFMVLDTGSDVVWLQCSPCRKCYAQTDPVFDPSKSSSFVGVKCDSPLCRRLDSS  611
                +MVLDTGSDVVWLQCSPC+ CY Q+DP+F+P+KS++F  V C SPLCR+LD S
Sbjct  146  ATNVYMVLDTGSDVVWLQCSPCKVCYNQSDPMFNPAKSTTFATVPCGSPLCRKLDES  202



>ref|XP_003520873.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 1-like [Glycine 
max]
Length=461

 Score =   144 bits (362),  Expect = 9e-37, Method: Compositional matrix adjust.
 Identities = 95/177 (54%), Positives = 116/177 (66%), Gaps = 18/177 (10%)
 Frame = +3

Query  93   TETXSLRPLPTAQHYSLSSKPQ-YSQTLVQPDDSENTLSLDLHH-IDLISSAAVNATPKA  266
            TET  L  LP         +P   S+TL +P ++ +       H ID +SS   N TP+ 
Sbjct  26   TETLPLHTLP---------EPHILSETLSEPQETLSLSLHLHLHHIDALSS---NKTPEQ  73

Query  267  LFVKRLQRDaarakalsllaaaaPPHNATRGRDFSSSVISGLAQGSGEYFTRLGVGTPPK  446
            LF  RLQRDA R +AL     A     ++     SSS+ISGLAQGSGEYFTR+GVGTP +
Sbjct  74   LFHLRLQRDAKRVEALLNQIHARRSAGSSF----SSSIISGLAQGSGEYFTRIGVGTPAR  129

Query  447  YAFMVLDTGSDVVWLQCSPCRKCYAQTDPVFDPSKSSSFVGVKCDSPLCRRLDSSGC  617
            Y +MVLDTGSDVVWLQC+PCRKCY QTD VFDP+KS ++ G+ C +PLCRRLDS GC
Sbjct  130  YVYMVLDTGSDVVWLQCAPCRKCYTQTDHVFDPTKSRTYAGIPCGAPLCRRLDSPGC  186



>gb|KHN16429.1| Aspartic proteinase nepenthesin-1, partial [Glycine soja]
Length=104

 Score =   135 bits (339),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 58/76 (76%), Positives = 67/76 (88%), Gaps = 0/76 (0%)
 Frame = +3

Query  390  LAQGSGEYFTRLGVGTPPKYAFMVLDTGSDVVWLQCSPCRKCYAQTDPVFDPSKSSSFVG  569
            LAQGSGEYFTR+GVGTP +Y +MVLDTGSDVVWLQC+PCRKCY Q DPVFDP+KS ++ G
Sbjct  1    LAQGSGEYFTRIGVGTPARYVYMVLDTGSDVVWLQCAPCRKCYTQADPVFDPTKSRTYAG  60

Query  570  VKCDSPLCRRLDSSGC  617
            + C +PLCRRLDS GC
Sbjct  61   IPCGAPLCRRLDSPGC  76



>ref|XP_003569303.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 1-like [Brachypodium 
distachyon]
Length=494

 Score =   139 bits (351),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 86/176 (49%), Positives = 106/176 (60%), Gaps = 12/176 (7%)
 Frame = +3

Query  108  LRPLPTAQHYSLS---SKPQYSQTLVQPDDSE-NTLSLDLHHIDLISSAAVNATPKALFV  275
            L P P +    L+    K  ++  L   +D+  +T+   + H D      VNAT   L  
Sbjct  41   LSPTPFSASSELARGDDKDVFAGNLAAAEDATPSTVQFSVVHRDDF---VVNATAAELLG  97

Query  276  KRLQRDaarakalsllaaaaPPHNATR--GRDFSSSVISGLAQGSGEYFTRLGVGTPPKY  449
             RLQRD  RA  +S  A A    N TR  G    + V+SGLAQGSGEYFT++GVGTP   
Sbjct  98   HRLQRDGKRAARISAAAGA---ANGTRRTGSGVVAPVVSGLAQGSGEYFTKIGVGTPATP  154

Query  450  AFMVLDTGSDVVWLQCSPCRKCYAQTDPVFDPSKSSSFVGVKCDSPLCRRLDSSGC  617
            A MVLDTGSDVVWLQC+PCR+CY Q+  VFDP +S S+  V C +PLCRRLDS GC
Sbjct  155  ALMVLDTGSDVVWLQCAPCRRCYDQSGQVFDPRRSRSYGAVGCSAPLCRRLDSGGC  210



>tpg|DAA58835.1| TPA: hypothetical protein ZEAMMB73_701358 [Zea mays]
Length=485

 Score =   139 bits (350),  Expect = 5e-35, Method: Compositional matrix adjust.
 Identities = 73/125 (58%), Positives = 88/125 (70%), Gaps = 3/125 (2%)
 Frame = +3

Query  243  AVNATPKALFVKRLQRDaarakalsllaaaaPPHNATRGRDFSSSVISGLAQGSGEYFTR  422
            AVNAT   L   RLQRD  RA  +S  A A   +     +  ++ V+SGLAQGSGEYFT+
Sbjct  76   AVNATAGELLKHRLQRDKRRAARISEAAGAGGGNGR---KGVAAPVVSGLAQGSGEYFTK  132

Query  423  LGVGTPPKYAFMVLDTGSDVVWLQCSPCRKCYAQTDPVFDPSKSSSFVGVKCDSPLCRRL  602
            +GVGTP   A MVLDTGSDVVW+QC+PCR+CY Q+ PVFDP +SSS+  V C + LCRRL
Sbjct  133  IGVGTPATQALMVLDTGSDVVWVQCAPCRRCYEQSGPVFDPRRSSSYGAVGCGAALCRRL  192

Query  603  DSSGC  617
            DS GC
Sbjct  193  DSGGC  197



>ref|XP_011007544.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 2-like [Populus 
euphratica]
Length=501

 Score =   139 bits (349),  Expect = 8e-35, Method: Compositional matrix adjust.
 Identities = 78/179 (44%), Positives = 111/179 (62%), Gaps = 14/179 (8%)
 Frame = +3

Query  90   ITETXSLRPLPTAQHYSLSSKPQYSQTLVQPDDS--ENTLSLDLHHIDLISSAAVNATPK  263
            ITET  +RPL ++Q+  LS        +  P+DS  E    L L H D +S         
Sbjct  63   ITET-KIRPLKSSQYQELS--------MNIPNDSGSEGKQKLKLVHRDKVSFNKKFHNHS  113

Query  264  ALFVKRLQRDaarakalsllaaaaPPHNATRG-RDFSSSVISGLAQGSGEYFTRLGVGTP  440
              F  R+QRD  R  +L    ++     A+ G  DF S V+SG+ QGSGEYF R+GVG+P
Sbjct  114  HDFHARMQRDVKRVVSLIRRVSSGSA--ASYGVEDFGSEVVSGMDQGSGEYFVRIGVGSP  171

Query  441  PKYAFMVLDTGSDVVWLQCSPCRKCYAQTDPVFDPSKSSSFVGVKCDSPLCRRLDSSGC  617
            P+  +MV+D+GSD+VW+QC PC +CY QTDP+FDP+ S+SF+GV C S +C +++++GC
Sbjct  172  PRSQYMVIDSGSDIVWVQCKPCTQCYHQTDPLFDPADSASFMGVSCSSAVCDQVENAGC  230



>ref|NP_001043485.1| Os01g0598600 [Oryza sativa Japonica Group]
 dbj|BAB63755.1| nucleoid DNA-binding protein cnd41-like [Oryza sativa Japonica 
Group]
 dbj|BAF05399.1| Os01g0598600 [Oryza sativa Japonica Group]
 gb|EAY74816.1| hypothetical protein OsI_02707 [Oryza sativa Indica Group]
Length=500

 Score =   139 bits (349),  Expect = 8e-35, Method: Compositional matrix adjust.
 Identities = 80/149 (54%), Positives = 96/149 (64%), Gaps = 9/149 (6%)
 Frame = +3

Query  189  SENTLSLDLHHIDLISSAAVNATPKALFVKRLQRDaarakalsllaaaaPPHNATR----  356
            + +T+ L + H D     AVNAT   L   RL+RD  RA  +S  A  A   N TR    
Sbjct  70   AASTVGLRVVHRDDF---AVNATAAELLAHRLRRDKRRASRISAAAGGAAAANGTRVGGG  126

Query  357  --GRDFSSSVISGLAQGSGEYFTRLGVGTPPKYAFMVLDTGSDVVWLQCSPCRKCYAQTD  530
              G  F + V+SGLAQGSGEYFT++GVGTP   A MVLDTGSDVVWLQC+PCR+CY Q+ 
Sbjct  127  GGGSGFVAPVVSGLAQGSGEYFTKIGVGTPVTPALMVLDTGSDVVWLQCAPCRRCYDQSG  186

Query  531  PVFDPSKSSSFVGVKCDSPLCRRLDSSGC  617
             +FDP  S S+  V C +PLCRRLDS GC
Sbjct  187  QMFDPRASHSYGAVDCAAPLCRRLDSGGC  215



>ref|XP_011031192.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 2-like [Populus 
euphratica]
Length=501

 Score =   138 bits (348),  Expect = 9e-35, Method: Compositional matrix adjust.
 Identities = 78/179 (44%), Positives = 111/179 (62%), Gaps = 14/179 (8%)
 Frame = +3

Query  90   ITETXSLRPLPTAQHYSLSSKPQYSQTLVQPDDS--ENTLSLDLHHIDLISSAAVNATPK  263
            ITET  +RPL ++Q+  LS        +  P+DS  E    L L H D +S         
Sbjct  63   ITET-KIRPLKSSQYQELS--------MNIPNDSGSEGKQKLKLVHRDKVSFNKKFHNHS  113

Query  264  ALFVKRLQRDaarakalsllaaaaPPHNATRG-RDFSSSVISGLAQGSGEYFTRLGVGTP  440
              F  R+QRD  R  +L    ++     A+ G  DF S V+SG+ QGSGEYF R+GVG+P
Sbjct  114  HDFHARMQRDVKRVVSLIRRVSSGSA--ASYGVEDFGSEVVSGMDQGSGEYFVRIGVGSP  171

Query  441  PKYAFMVLDTGSDVVWLQCSPCRKCYAQTDPVFDPSKSSSFVGVKCDSPLCRRLDSSGC  617
            P+  +MV+D+GSD+VW+QC PC +CY QTDP+FDP+ S+SF+GV C S +C +++++GC
Sbjct  172  PRSQYMVIDSGSDIVWVQCKPCTQCYHQTDPLFDPADSASFMGVSCSSAVCDQVENAGC  230



>ref|XP_011461997.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 2-like [Fragaria 
vesca subsp. vesca]
Length=261

 Score =   134 bits (337),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 86/167 (51%), Positives = 107/167 (64%), Gaps = 13/167 (8%)
 Frame = +3

Query  129  QHYSLSSKPQYSQTLVQPDDSENTLSLDLHHIDLISSAAVNATPKALFVKRLQRDaarak  308
            Q  SL       +   +PD   ++LSL LHH+D +SS   N TP  LF  RL+RD+ R  
Sbjct  18   QRVSLGDHESTLEKTSEPDSDPSSLSLPLHHLDALSS---NQTPSQLFHLRLRRDSLRFN  74

Query  309  alsllaaaaPPHNATRGRDFSSSVIS----GLAQGSGEYFTRLGVGTPPKYAFMVLDTGS  476
            +L+ LA     +N TR    SS   S    GL+QGSGEYFTR+GVG+ PKY +MVLDTGS
Sbjct  75   SLTSLA-----YNRTRPGPPSSGFSSSIVSGLSQGSGEYFTRIGVGSSPKYLYMVLDTGS  129

Query  477  DVVWLQCSPCRKCYAQTDPVFDPSKSSSFVGVKCDSPLCRRLDSSGC  617
            +VVWLQC+PC++CY+QTDP+FDP KSS        SPLC  LDS GC
Sbjct  130  EVVWLQCAPCKRCYSQTDPIFDPRKSSFSSLPC-SSPLCCHLDSLGC  175



>gb|EAZ12575.1| hypothetical protein OsJ_02481 [Oryza sativa Japonica Group]
Length=501

 Score =   137 bits (346),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 80/149 (54%), Positives = 96/149 (64%), Gaps = 9/149 (6%)
 Frame = +3

Query  189  SENTLSLDLHHIDLISSAAVNATPKALFVKRLQRDaarakalsllaaaaPPHNATR----  356
            + +T+ L + H D     AVNAT   L   RL+RD  RA  +S  A  A   N TR    
Sbjct  70   AASTVGLRVVHRDDF---AVNATAAELLAHRLRRDKRRASRISAAAGGAAAANGTRVGGG  126

Query  357  --GRDFSSSVISGLAQGSGEYFTRLGVGTPPKYAFMVLDTGSDVVWLQCSPCRKCYAQTD  530
              G  F + V+SGLAQGSGEYFT++GVGTP   A MVLDTGSDVVWLQC+PCR+CY Q+ 
Sbjct  127  GGGSGFVAPVVSGLAQGSGEYFTKIGVGTPVTPALMVLDTGSDVVWLQCAPCRRCYDQSG  186

Query  531  PVFDPSKSSSFVGVKCDSPLCRRLDSSGC  617
             +FDP  S S+  V C +PLCRRLDS GC
Sbjct  187  QMFDPRASHSYGAVDCAAPLCRRLDSGGC  215



>ref|XP_002306246.2| hypothetical protein POPTR_0005s06390g [Populus trichocarpa]
 gb|EEE93242.2| hypothetical protein POPTR_0005s06390g [Populus trichocarpa]
Length=502

 Score =   137 bits (346),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 78/179 (44%), Positives = 110/179 (61%), Gaps = 14/179 (8%)
 Frame = +3

Query  90   ITETXSLRPLPTAQHYSLSSKPQYSQTLVQPDDS--ENTLSLDLHHIDLISSAAVNATPK  263
            ITET  +RPL  + +  LS        +  P+DS  E    L L H D +S         
Sbjct  64   ITET-KIRPLKPSLYQELS--------MNIPNDSGSEGKQKLKLVHRDKVSFNNKFHNHS  114

Query  264  ALFVKRLQRDaarakalsllaaaaPPHNATRG-RDFSSSVISGLAQGSGEYFTRLGVGTP  440
             +F  R+QRD  R  +L    ++     A+ G  DF S V+SG+ QGSGEYF R+GVG+P
Sbjct  115  HVFHARMQRDVKRVVSLIRRVSSGS--TASYGVEDFGSEVVSGMDQGSGEYFVRIGVGSP  172

Query  441  PKYAFMVLDTGSDVVWLQCSPCRKCYAQTDPVFDPSKSSSFVGVKCDSPLCRRLDSSGC  617
            P+  +MV+D+GSD+VW+QC PC +CY QTDP+FDP+ S+SF+GV C S +C ++D++GC
Sbjct  173  PRSQYMVIDSGSDIVWVQCKPCTQCYHQTDPLFDPADSASFMGVSCSSAVCDQVDNAGC  231



>ref|XP_006402438.1| hypothetical protein EUTSA_v10005923mg [Eutrema salsugineum]
 dbj|BAJ34045.1| unnamed protein product [Thellungiella halophila]
 gb|ESQ43891.1| hypothetical protein EUTSA_v10005923mg [Eutrema salsugineum]
Length=484

 Score =   137 bits (345),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 85/155 (55%), Positives = 108/155 (70%), Gaps = 6/155 (4%)
 Frame = +3

Query  162  SQTLVQPDDSENTLSLDLHHIDLISSAAVNATPKALFVKRLQRDaarakalsllaaaaPP  341
            S++L+   DS  +LS+ L H+D   S++ +A+P  LF  RLQRD+ R ++L+ LAA +  
Sbjct  49   SESLISDSDSTTSLSVHLSHVD-ALSSSSDASPAELFNLRLQRDSLRVESLTSLAAVSAG  107

Query  342  HNATR-----GRDFSSSVISGLAQGSGEYFTRLGVGTPPKYAFMVLDTGSDVVWLQCSPC  506
             N T+        FS  VISGL+QGSGEYF RLGVGTP    +MVLDTGSDVVWLQCSPC
Sbjct  108  RNVTKRPPRSAGGFSGVVISGLSQGSGEYFMRLGVGTPATNMYMVLDTGSDVVWLQCSPC  167

Query  507  RKCYAQTDPVFDPSKSSSFVGVKCDSPLCRRLDSS  611
            + CY Q+DPVF+P+KS +F  V C S LCRRLD S
Sbjct  168  KVCYNQSDPVFNPAKSKTFATVPCGSRLCRRLDDS  202



>ref|XP_009629151.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 2 [Nicotiana 
tomentosiformis]
Length=491

 Score =   136 bits (343),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 76/190 (40%), Positives = 108/190 (57%), Gaps = 17/190 (9%)
 Frame = +3

Query  93   TETXSLRPLPTAQHYS-------LSSKPQYSQTLVQPD---DSEN-----TLSLDLHHID  227
            T   +L P PT ++++       L++K Q      + D   D EN      L L L H D
Sbjct  33   TTAHALFPYPTHENFNVQETISQLATKIQTPHEKQEEDFHFDDENGEEKRNLKLKLIHRD  92

Query  228  LISSAAVNATPKALFVKRLQRDaarakalsllaaaaPPHNATRGRDFSSSVISGLAQGSG  407
             +  +   +    +F  R++RD  R  +L          N  R  +F S V+SG+ QGSG
Sbjct  93   KLYFSNYFSNHSKMFEARMKRDVKRVSSLIHRITGGG--NGYRVEEFGSDVVSGMDQGSG  150

Query  408  EYFTRLGVGTPPKYAFMVLDTGSDVVWLQCSPCRKCYAQTDPVFDPSKSSSFVGVKCDSP  587
            EYF R+GVG+P +  +MV+D+GSD+VW+QC PC +CY Q+DPVFDPS S SF GV C S 
Sbjct  151  EYFVRIGVGSPARNQYMVIDSGSDIVWVQCQPCTQCYHQSDPVFDPSLSGSFAGVSCGSS  210

Query  588  LCRRLDSSGC  617
            +C R+++SGC
Sbjct  211  VCDRVENSGC  220



>ref|XP_006345303.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 2-like [Solanum 
tuberosum]
Length=477

 Score =   136 bits (342),  Expect = 6e-34, Method: Compositional matrix adjust.
 Identities = 77/177 (44%), Positives = 100/177 (56%), Gaps = 12/177 (7%)
 Frame = +3

Query  114  PLPTAQHYSLSSKPQYSQTLVQP---------DDSENTLSLDLHHIDLISSAAVNATPKA  266
            P PT +H  ++   + S TL+QP         DD  +   L L H D +  +     P  
Sbjct  32   PFPTHEHLDVNQAIKES-TLIQPPETHDINIVDDDNSRWKLKLLHRDKLPFSHFTDHPHR  90

Query  267  LFVKRLQRDaarakalsllaaaaPPHNATRGRDFSSSVISGLAQGSGEYFTRLGVGTPPK  446
             F  R++RD  R   L+             G  F S VISG+ QGSGEYF R+GVG+P +
Sbjct  91   -FQARMKRDIKRVHTLTATTNYDEVKEEEFG-GFGSEVISGMEQGSGEYFVRIGVGSPVR  148

Query  447  YAFMVLDTGSDVVWLQCSPCRKCYAQTDPVFDPSKSSSFVGVKCDSPLCRRLDSSGC  617
              +MV+D GSD+VW+QC PC  CY Q+DPVFDPS S+SF GV C S LC R+D+SGC
Sbjct  149  QQYMVIDAGSDIVWVQCQPCTHCYHQSDPVFDPSLSASFSGVPCSSSLCDRIDNSGC  205



>ref|XP_002455897.1| hypothetical protein SORBIDRAFT_03g026970 [Sorghum bicolor]
 gb|EES01017.1| hypothetical protein SORBIDRAFT_03g026970 [Sorghum bicolor]
Length=493

 Score =   135 bits (341),  Expect = 9e-34, Method: Compositional matrix adjust.
 Identities = 61/89 (69%), Positives = 73/89 (82%), Gaps = 0/89 (0%)
 Frame = +3

Query  351  TRGRDFSSSVISGLAQGSGEYFTRLGVGTPPKYAFMVLDTGSDVVWLQCSPCRKCYAQTD  530
            +RG   ++ V+SGLAQGSGEYFT++GVGTP   A MVLDTGSDVVWLQC+PCR+CY Q+ 
Sbjct  120  SRGGAVAAPVVSGLAQGSGEYFTKIGVGTPSTPALMVLDTGSDVVWLQCAPCRRCYDQSG  179

Query  531  PVFDPSKSSSFVGVKCDSPLCRRLDSSGC  617
            PVFDP +SSS+  V C +PLCRRLDS GC
Sbjct  180  PVFDPRRSSSYGAVDCAAPLCRRLDSGGC  208



>gb|KJB49971.1| hypothetical protein B456_008G147500 [Gossypium raimondii]
Length=480

 Score =   135 bits (339),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 73/174 (42%), Positives = 105/174 (60%), Gaps = 15/174 (9%)
 Frame = +3

Query  111  RPLPTAQHYSLSSKPQYSQTLVQPDDSENTLSLDLHHIDLISS--AAVNATPKALFVKRL  284
            RPL T++H+ +S             +++    L L H D +SS  +A        F  R+
Sbjct  46   RPLQTSEHHQVS----------DVSETQGKWKLKLVHRDKLSSNTSATFRDHSRRFHARM  95

Query  285  QRDaarakalsllaaaaPPHN---ATRGRDFSSSVISGLAQGSGEYFTRLGVGTPPKYAF  455
            QRD  R  +L    +    H+   A    DF S V+SG+ QGSGEYF R+GVG+PPK  +
Sbjct  96   QRDVKRVASLLRRLSGGGGHDGGAAYEVNDFGSDVVSGMDQGSGEYFVRIGVGSPPKSQY  155

Query  456  MVLDTGSDVVWLQCSPCRKCYAQTDPVFDPSKSSSFVGVKCDSPLCRRLDSSGC  617
            MV+D+GSD+VW+QC PC +CY Q+DPVFDP+ S+S+ G+ C S +C R+++SGC
Sbjct  156  MVIDSGSDIVWVQCQPCNQCYRQSDPVFDPADSASYAGISCSSAVCDRIENSGC  209



>gb|KDP40474.1| hypothetical protein JCGZ_24473 [Jatropha curcas]
Length=469

 Score =   135 bits (339),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 68/157 (43%), Positives = 100/157 (64%), Gaps = 5/157 (3%)
 Frame = +3

Query  156  QYSQTLVQPDDSE--NTLSLDLHHID-LISSAAVNATPKALFVKRLQRDaarakalslla  326
            QY Q  +  +DS+      L L H D +I+S+        LF  R+ RD  R  +L    
Sbjct  44   QYQQLFINQNDSQSQGIWKLKLVHRDRIITSSNSLHNHTHLFHARINRDIKRVASLIRRL  103

Query  327  aaaPPHNATRGRDFSSSVISGLAQGSGEYFTRLGVGTPPKYAFMVLDTGSDVVWLQCSPC  506
            ++  P    +  DF + V+SG+ QGSGEYF R+GVG+PP+  ++V+D+GSD+VW+QC PC
Sbjct  104  SS--PAATYQVNDFGAEVVSGMNQGSGEYFVRIGVGSPPRDQYVVIDSGSDIVWVQCQPC  161

Query  507  RKCYAQTDPVFDPSKSSSFVGVKCDSPLCRRLDSSGC  617
             +CY QTDPVFDP+ S+SF+GV C S +C R++++ C
Sbjct  162  TQCYHQTDPVFDPANSASFIGVSCSSAVCDRVENADC  198



>gb|KEH44446.1| aspartic protease in GUARD CELL-like protein [Medicago truncatula]
Length=486

 Score =   135 bits (339),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 69/177 (39%), Positives = 104/177 (59%), Gaps = 4/177 (2%)
 Frame = +3

Query  90   ITETX-SLRPLPTAQHYSLSSKPQYSQTLVQPDDSENTLSLDLHHIDLISSAAVNATPKA  266
            I ET  +L+P  T +    + K        + D       L L H D IS+  ++    +
Sbjct  42   IAETKLNLKPFHTTKQPQENKKSNAESMSEKSDAVSGKHKLKLLHRDKISAFNISGDHLS  101

Query  267  LFVKRLQRDaarakalsllaaaaPPHNATRGRDFSSSVISGLAQGSGEYFTRLGVGTPPK  446
             F  R++RD+ R  A+    A    +      +F S V+SG+ QGSGEYF R+GVG+PPK
Sbjct  102  RFNARMERDSKRVTAVVRQIAGGVGYET---EEFGSGVVSGMEQGSGEYFVRIGVGSPPK  158

Query  447  YAFMVLDTGSDVVWLQCSPCRKCYAQTDPVFDPSKSSSFVGVKCDSPLCRRLDSSGC  617
              ++V+D+GSD++W+QC PC +CY Q+DPVF+P  SSS+ GV C S +C R++++GC
Sbjct  159  NQYVVVDSGSDIIWVQCQPCTQCYHQSDPVFNPEDSSSYAGVSCGSTVCSRVENAGC  215



>gb|KJB79793.1| hypothetical protein B456_013G067200 [Gossypium raimondii]
Length=475

 Score =   134 bits (338),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 70/156 (45%), Positives = 95/156 (61%), Gaps = 7/156 (4%)
 Frame = +3

Query  171  LVQPDDSENTLSLDLHHIDLI----SSAAVNATPKALFVKRLQRDaarakalsllaaaaP  338
            L + DD     +L L H D +     S +        F  R+QRD  R  +L        
Sbjct  48   LSETDDHRGKWNLKLVHRDKLLSPNDSLSTLHNHGRRFHARMQRDVKRVASLLRRLPGKG  107

Query  339  PHN---ATRGRDFSSSVISGLAQGSGEYFTRLGVGTPPKYAFMVLDTGSDVVWLQCSPCR  509
             H+   A +  DF S V+SG+ QGSGEYF R+GVG+PP+  +MV+D+GSD+VW+QC PC 
Sbjct  108  THDGDAAYQVNDFGSDVVSGMDQGSGEYFVRIGVGSPPRSQYMVIDSGSDIVWVQCQPCN  167

Query  510  KCYAQTDPVFDPSKSSSFVGVKCDSPLCRRLDSSGC  617
            +CY Q+DPVFDP+ S+SF GV C S +C R+D+SGC
Sbjct  168  QCYRQSDPVFDPANSASFSGVSCGSSVCDRIDNSGC  203



>ref|NP_001056485.1| Os05g0590000 [Oryza sativa Japonica Group]
 gb|AAT58814.1| putative nucleoid DNA-binding protein [Oryza sativa Japonica 
Group]
 dbj|BAF18399.1| Os05g0590000 [Oryza sativa Japonica Group]
Length=481

 Score =   134 bits (337),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 81/173 (47%), Positives = 99/173 (57%), Gaps = 19/173 (11%)
 Frame = +3

Query  108  LRPLPTAQHYSLSSKPQYSQTLVQPDDSENTLSLDLHHIDLISSAAVNATPKALFVKRLQ  287
            L P P  Q   LS        L  P  + +TL   L H +     A+NAT   L      
Sbjct  40   LSPDPITQEQQLS--------LAAPRTNASTLHFRLAHREHF---ALNATASDLLAH---  85

Query  288  RDaarakalsllaaaaPPHNATRGR---DFSSSVISGLAQGSGEYFTRLGVGTPPKYAFM  458
                   A    A  A P+NATR R    F++ ++SGL QGSGEYF ++GVGTP   A M
Sbjct  86   --LLARDAARAAALLAAPNNATRPRRRGGFAAPLLSGLPQGSGEYFAQVGVGTPATTALM  143

Query  459  VLDTGSDVVWLQCSPCRKCYAQTDPVFDPSKSSSFVGVKCDSPLCRRLDSSGC  617
            VLDTGSDVVWLQC+PCR CYAQ+  VFDP +S S+  V C +P+CRRLDS+GC
Sbjct  144  VLDTGSDVVWLQCAPCRHCYAQSGRVFDPRRSRSYAAVDCVAPICRRLDSAGC  196



>gb|EAY99240.1| hypothetical protein OsI_21202 [Oryza sativa Indica Group]
Length=475

 Score =   134 bits (337),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 81/173 (47%), Positives = 99/173 (57%), Gaps = 19/173 (11%)
 Frame = +3

Query  108  LRPLPTAQHYSLSSKPQYSQTLVQPDDSENTLSLDLHHIDLISSAAVNATPKALFVKRLQ  287
            L P P  Q   LS        L  P  + +TL   L H +     A+NAT   L      
Sbjct  34   LSPDPITQEQQLS--------LAAPRTNASTLHFRLAHREHF---ALNATASDLLAH---  79

Query  288  RDaarakalsllaaaaPPHNATRGR---DFSSSVISGLAQGSGEYFTRLGVGTPPKYAFM  458
                   A    A  A P+NATR R    F++ ++SGL QGSGEYF ++GVGTP   A M
Sbjct  80   --LLARDAARAAALLAAPNNATRPRRRGGFAAPLLSGLPQGSGEYFAQVGVGTPATTALM  137

Query  459  VLDTGSDVVWLQCSPCRKCYAQTDPVFDPSKSSSFVGVKCDSPLCRRLDSSGC  617
            VLDTGSDVVWLQC+PCR CYAQ+  VFDP +S S+  V C +P+CRRLDS+GC
Sbjct  138  VLDTGSDVVWLQCAPCRHCYAQSGRVFDPRRSRSYAAVDCVAPICRRLDSAGC  190



>gb|AAT38006.1| unknow protein [Oryza sativa Japonica Group]
Length=475

 Score =   134 bits (337),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 81/173 (47%), Positives = 99/173 (57%), Gaps = 19/173 (11%)
 Frame = +3

Query  108  LRPLPTAQHYSLSSKPQYSQTLVQPDDSENTLSLDLHHIDLISSAAVNATPKALFVKRLQ  287
            L P P  Q   LS        L  P  + +TL   L H +     A+NAT   L      
Sbjct  34   LSPDPITQEQQLS--------LAAPRTNASTLHFRLAHREHF---ALNATASDLLAH---  79

Query  288  RDaarakalsllaaaaPPHNATRGR---DFSSSVISGLAQGSGEYFTRLGVGTPPKYAFM  458
                   A    A  A P+NATR R    F++ ++SGL QGSGEYF ++GVGTP   A M
Sbjct  80   --LLARDAARAAALLAAPNNATRPRRRGGFAAPLLSGLPQGSGEYFAQVGVGTPATTALM  137

Query  459  VLDTGSDVVWLQCSPCRKCYAQTDPVFDPSKSSSFVGVKCDSPLCRRLDSSGC  617
            VLDTGSDVVWLQC+PCR CYAQ+  VFDP +S S+  V C +P+CRRLDS+GC
Sbjct  138  VLDTGSDVVWLQCAPCRHCYAQSGRVFDPRRSRSYAAVDCVAPICRRLDSAGC  190



>ref|XP_011022942.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 2-like [Populus 
euphratica]
Length=502

 Score =   134 bits (336),  Expect = 5e-33, Method: Compositional matrix adjust.
 Identities = 74/186 (40%), Positives = 109/186 (59%), Gaps = 27/186 (15%)
 Frame = +3

Query  90   ITETXSLRPLPTAQHYSLSSKPQYSQTLVQPDDSENT---LSLDLHHIDLISSAAVNATP  260
            +TET + RP+  +Q+  L            P+DSE+T     L L H D +S +      
Sbjct  63   LTETKT-RPIKPSQYQELFK--------TNPNDSESTGGKQKLKLVHRDKVSFSNQLHNH  113

Query  261  KALFVKRLQRDaarakalsllaaaaPPHNATRG-------RDFSSSVISGLAQGSGEYFT  419
              +F  R+ RD  R  +L         H  + G        +F S V+SG+ QGSGEYF 
Sbjct  114  SHVFNARMHRDVKRVASLI--------HRLSSGSAAKYEVENFGSDVVSGMNQGSGEYFV  165

Query  420  RLGVGTPPKYAFMVLDTGSDVVWLQCSPCRKCYAQTDPVFDPSKSSSFVGVKCDSPLCRR  599
            R+G+G+PP+  +MV+D+GSD+VW+QC PC +CY QTDP+FDP+ S+SF+GV C S +C R
Sbjct  166  RIGLGSPPRSQYMVIDSGSDIVWVQCKPCTQCYHQTDPLFDPADSASFMGVSCSSAVCDR  225

Query  600  LDSSGC  617
            ++++GC
Sbjct  226  VENAGC  231



>ref|XP_002309912.2| hypothetical protein POPTR_0007s04120g [Populus trichocarpa]
 gb|EEE90362.2| hypothetical protein POPTR_0007s04120g [Populus trichocarpa]
Length=501

 Score =   133 bits (335),  Expect = 7e-33, Method: Compositional matrix adjust.
 Identities = 74/185 (40%), Positives = 107/185 (58%), Gaps = 26/185 (14%)
 Frame = +3

Query  90   ITETXSLRPLPTAQHYSLSSKPQYSQTLVQPDDSE--NTLSLDLHHIDLISSAAVNATPK  263
            +TET + RP+  +Q+  L            P+DSE      L L H D +S +       
Sbjct  63   LTETKT-RPIKPSQYQELFK--------TNPNDSESGGKQKLKLVHRDKVSFSNKLHNHS  113

Query  264  ALFVKRLQRDaarakalsllaaaaPPHNATRG-------RDFSSSVISGLAQGSGEYFTR  422
             +F  R+ RD  R  +L         H  + G        DF S V+SG+ QGSGEYF R
Sbjct  114  HVFHARMHRDVKRVASLI--------HRLSSGSAAKYEVEDFGSDVVSGMNQGSGEYFVR  165

Query  423  LGVGTPPKYAFMVLDTGSDVVWLQCSPCRKCYAQTDPVFDPSKSSSFVGVKCDSPLCRRL  602
            +G+G+PP+  +MV+D+GSD+VW+QC PC +CY QTDP+FDP+ S+SF+GV C S +C R+
Sbjct  166  IGLGSPPRSQYMVIDSGSDIVWVQCKPCTQCYHQTDPLFDPADSASFMGVSCSSAVCDRV  225

Query  603  DSSGC  617
            +++GC
Sbjct  226  ENAGC  230



>ref|XP_004147103.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 2-like [Cucumis 
sativus]
 ref|XP_004166359.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 2-like [Cucumis 
sativus]
 gb|KGN51568.1| hypothetical protein Csa_5G579060 [Cucumis sativus]
Length=482

 Score =   133 bits (334),  Expect = 7e-33, Method: Compositional matrix adjust.
 Identities = 68/146 (47%), Positives = 94/146 (64%), Gaps = 7/146 (5%)
 Frame = +3

Query  192  ENTLSLDLHHIDLISSAAVNATPKALFVKRLQRDaarakalsllaaaaPPHNATRGR---  362
             NT  L+L H D +S   V+   +  F  R++RDA R   L    +   P      R   
Sbjct  69   NNTFKLNLLHRDKLSH--VHGHRRG-FNDRMKRDAIRVATLVRRLSHGAPAAVKDSRYKV  125

Query  363  -DFSSSVISGLAQGSGEYFTRLGVGTPPKYAFMVLDTGSDVVWLQCSPCRKCYAQTDPVF  539
             +F++ VISG+  GSGEYF R+GVG+PP+  +MV+D+GSD+VW+QC PC +CY Q+DPVF
Sbjct  126  ANFATDVISGMEAGSGEYFVRIGVGSPPRNQYMVIDSGSDIVWVQCKPCSRCYQQSDPVF  185

Query  540  DPSKSSSFVGVKCDSPLCRRLDSSGC  617
            DP+ SSSF GV C S +C RL+++GC
Sbjct  186  DPADSSSFAGVSCGSDVCDRLENTGC  211



>ref|XP_006406427.1| hypothetical protein EUTSA_v10020671mg [Eutrema salsugineum]
 gb|ESQ47880.1| hypothetical protein EUTSA_v10020671mg [Eutrema salsugineum]
Length=468

 Score =   133 bits (334),  Expect = 7e-33, Method: Compositional matrix adjust.
 Identities = 70/156 (45%), Positives = 97/156 (62%), Gaps = 3/156 (2%)
 Frame = +3

Query  153  PQYSQTLVQPDDSENTLSLDLHHIDLISSAAVNATPKALFVKRLQRDaarakalsllaaa  332
            P ++ T   PD+S+ TL L LH     S +  N   +     R   D   A    +   +
Sbjct  44   PDFNNTTF-PDESKYTLRL-LHRDKFPSVSYRNHHHRLHARMRRDSDRVAAILRRISGKS  101

Query  333  aPPHNAT-RGRDFSSSVISGLAQGSGEYFTRLGVGTPPKYAFMVLDTGSDVVWLQCSPCR  509
             PP N+     DF S V+SG+ QGSGEYF R+GVG+PP+  +MV+D+GSD+VW+QC PC+
Sbjct  102  VPPSNSKYEVDDFGSDVVSGMDQGSGEYFVRIGVGSPPRDQYMVIDSGSDMVWVQCQPCK  161

Query  510  KCYAQTDPVFDPSKSSSFVGVKCDSPLCRRLDSSGC  617
             CY Q+DPVFDP+KS S+ GV C S +C R+++SGC
Sbjct  162  LCYKQSDPVFDPAKSGSYTGVSCGSSVCDRIENSGC  197



>gb|KJB77420.1| hypothetical protein B456_012G135900 [Gossypium raimondii]
Length=484

 Score =   132 bits (333),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 75/171 (44%), Positives = 104/171 (61%), Gaps = 7/171 (4%)
 Frame = +3

Query  126  AQHYSLSSKPQYSQTLVQPDDSEN--TLSLDLHHIDLISS--AAVNATPKALFVKRLQRD  293
            AQ   L +       L+   +SE+     L L H D +S+  A V+      F  R+QRD
Sbjct  43   AQPSPLQTSEYNHHELLNVTESEDQWKWKLKLIHRDWLSTENATVSRNHSRRFHARIQRD  102

Query  294  aarakalsllaaaaPPHN--ATRG-RDFSSSVISGLAQGSGEYFTRLGVGTPPKYAFMVL  464
              R  +L L       H+  A  G  DF S V+SG+ QGSGEYF R+GVG+PP+  +MV+
Sbjct  103  VKRVASLLLRIPGGVIHDGEAAHGVNDFGSDVVSGMDQGSGEYFVRIGVGSPPRSQYMVI  162

Query  465  DTGSDVVWLQCSPCRKCYAQTDPVFDPSKSSSFVGVKCDSPLCRRLDSSGC  617
            D+GSD+VW+QC PC +CY Q+DPVFDP+ S+S+ GV C S +C R+++SGC
Sbjct  163  DSGSDIVWVQCKPCNQCYKQSDPVFDPADSASYGGVPCSSSVCDRIENSGC  213



>ref|XP_006847790.1| hypothetical protein AMTR_s00029p00016750 [Amborella trichopoda]
 gb|ERN09371.1| hypothetical protein AMTR_s00029p00016750 [Amborella trichopoda]
Length=524

 Score =   132 bits (332),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 70/149 (47%), Positives = 93/149 (62%), Gaps = 6/149 (4%)
 Frame = +3

Query  177  QPDDSE--NTLSLDLHHIDLISSAAVNATPKALFVKRLQRDaarakalsllaaaaPPHNA  350
            QP  S+  N L L L H D       +++ K  F  R++RD  R  AL+        +  
Sbjct  108  QPSASKPGNLLRLKLLHRDSFKPTN-SSSHKHRFESRMRRDLLRVAALAKKLGLESGYKL  166

Query  351  TRGRDFSSSVISGLAQGSGEYFTRLGVGTPPKYAFMVLDTGSDVVWLQCSPCRKCYAQTD  530
            T   DF + V+SG+ QGSGEYF R+GVG+P +  FMV+DTGSD+VW+QC PC +CY Q D
Sbjct  167  T---DFGAEVVSGMEQGSGEYFVRIGVGSPARDQFMVIDTGSDIVWVQCRPCLQCYQQAD  223

Query  531  PVFDPSKSSSFVGVKCDSPLCRRLDSSGC  617
            PVFDP+ S +F GV C S +C RL++SGC
Sbjct  224  PVFDPAASETFAGVSCTSSVCSRLENSGC  252



>ref|XP_010279486.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 2-like [Nelumbo 
nucifera]
Length=483

 Score =   132 bits (331),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 65/146 (45%), Positives = 94/146 (64%), Gaps = 2/146 (1%)
 Frame = +3

Query  183  DDSENTLSLDLHHIDLISSAAVNATPKALFVKRLQRDaarakalsllaaaaPPHNATRG-  359
            D++E    L L H D+IS    +     L  +R++RD  R  +L+   +         G 
Sbjct  63   DEAEGRWKLKLVHRDMISLGNFSNHRHHL-SERIKRDVRRVASLTRRLSGGGGGGVNYGV  121

Query  360  RDFSSSVISGLAQGSGEYFTRLGVGTPPKYAFMVLDTGSDVVWLQCSPCRKCYAQTDPVF  539
             DF+S V+SG+ QGSGEYF R+GVG+PP+  +MV+D+GSD+VW+QC PC +CY Q DPVF
Sbjct  122  EDFASEVVSGVDQGSGEYFVRIGVGSPPRNQYMVIDSGSDIVWVQCQPCNQCYRQLDPVF  181

Query  540  DPSKSSSFVGVKCDSPLCRRLDSSGC  617
            DP+ S++F GV C S +C  L+++GC
Sbjct  182  DPADSATFAGVACSSTVCGLLENAGC  207



>ref|XP_009760593.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 2-like [Nicotiana 
sylvestris]
Length=494

 Score =   132 bits (331),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 70/194 (36%), Positives = 107/194 (55%), Gaps = 22/194 (11%)
 Frame = +3

Query  93   TETXSLRPLPTAQHYSL-SSKPQYSQTLVQPDDSEN------------------TLSLDL  215
            T   ++ P PT +++++  +  Q+S  +  P + +                      L L
Sbjct  33   TTAHAIFPYPTHENFNVQETISQFSTKIQTPHEKQEEDFHFDNENGEENGEEQKNWKLKL  92

Query  216  HHIDLISSAAVNATPKALFVKRLQRDaarakalsllaaaaPPHNATRGRDFSSSVISGLA  395
             H D +  +   +    +F  R++RD  R  +L         +   R  +F S+VISG+ 
Sbjct  93   IHRDKLHFSNYFSNHSKMFEARMKRDIKRVSSLIHRITGGGVY---RVEEFGSNVISGMD  149

Query  396  QGSGEYFTRLGVGTPPKYAFMVLDTGSDVVWLQCSPCRKCYAQTDPVFDPSKSSSFVGVK  575
            QGSGEYF R+GVG+P +  +MV+D+GSD+VW+QC PC +CY Q+DPVFDPS S SF GV 
Sbjct  150  QGSGEYFVRIGVGSPARNQYMVIDSGSDIVWVQCQPCTQCYHQSDPVFDPSLSGSFAGVS  209

Query  576  CDSPLCRRLDSSGC  617
            C S +C R+++SGC
Sbjct  210  CGSSVCNRVENSGC  223



>ref|XP_004497254.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 2-like [Cicer 
arietinum]
Length=486

 Score =   131 bits (330),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 74/183 (40%), Positives = 108/183 (59%), Gaps = 16/183 (9%)
 Frame = +3

Query  90   ITETX-SLRPLPTAQHYSLSSKPQYSQTLVQPDDSENTLS------LDLHHIDLISSAAV  248
            I ET   L+P  T +      +PQ +Q      +SE T S      L L H D I    +
Sbjct  42   IAETKRKLKPFHTTK------QPQENQKSNTDAESEKTESGSGKRKLKLLHRDEIHIFNI  95

Query  249  NATPKALFVKRLQRDaarakalsllaaaaPPHNATRGRDFSSSVISGLAQGSGEYFTRLG  428
            +   ++ F  R++RDA R  A+    A    +      +F S V+SG+ QGSGEYF R+G
Sbjct  96   SRDHRSRFNARMKRDAKRVAAVVRRIAGGVGYKT---EEFGSDVVSGMEQGSGEYFVRIG  152

Query  429  VGTPPKYAFMVLDTGSDVVWLQCSPCRKCYAQTDPVFDPSKSSSFVGVKCDSPLCRRLDS  608
            VG+PPK  ++V+D+GSD++W+QC PC +CY Q+DPVF+P  SSS+ GV C S +C R+++
Sbjct  153  VGSPPKNQYVVIDSGSDIIWVQCQPCTQCYRQSDPVFNPGDSSSYSGVSCGSTVCSRVEN  212

Query  609  SGC  617
            +GC
Sbjct  213  AGC  215



>gb|EYU40681.1| hypothetical protein MIMGU_mgv1a005122mg [Erythranthe guttata]
Length=496

 Score =   131 bits (329),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 70/172 (41%), Positives = 104/172 (60%), Gaps = 3/172 (2%)
 Frame = +3

Query  108  LRPLPTAQHYSLSSKPQYSQTLVQPDDSENTLSLDLH--HIDLISSAAVNATPKALFVKR  281
            LRP  ++ H +       S+   +P  + N+ +  LH  H D ++  + +   +  F  R
Sbjct  55   LRPPQSSSHDTNHYAAVDSELTQKPTTNHNSTAAKLHLVHRDKLA-FSWHHDHRRRFESR  113

Query  282  LQRDaarakalsllaaaaPPHNATRGRDFSSSVISGLAQGSGEYFTRLGVGTPPKYAFMV  461
            ++RDA R   L    +      A    DF S V+SG+ QGSGEYF R+GVG+P +  +MV
Sbjct  114  MKRDARRVGGLIRRLSGGGGAAAYEVADFGSEVVSGMDQGSGEYFVRIGVGSPARSQYMV  173

Query  462  LDTGSDVVWLQCSPCRKCYAQTDPVFDPSKSSSFVGVKCDSPLCRRLDSSGC  617
            +D+GSD+VW+QC PC +CY Q+DPVFDP+ S+SF GV C S +C R+++SGC
Sbjct  174  IDSGSDIVWVQCQPCSQCYHQSDPVFDPADSASFTGVSCSSSVCDRVENSGC  225



>ref|XP_002513132.1| Aspartic proteinase nepenthesin-1 precursor, putative [Ricinus 
communis]
 gb|EEF49635.1| Aspartic proteinase nepenthesin-1 precursor, putative [Ricinus 
communis]
Length=481

 Score =   131 bits (329),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 65/157 (41%), Positives = 99/157 (63%), Gaps = 3/157 (2%)
 Frame = +3

Query  156  QYSQTLVQPDDS--ENTLSLDLHHIDLISSAAVNATPKAL-FVKRLQRDaarakalslla  326
            QY +     +D+  E    L L H D I++   ++   +  F  R+QRD  R   L    
Sbjct  54   QYQELFDNQNDTLTEGKWKLKLVHRDKITAFNKSSYDHSHNFHARIQRDKKRVATLIRRL  113

Query  327  aaaPPHNATRGRDFSSSVISGLAQGSGEYFTRLGVGTPPKYAFMVLDTGSDVVWLQCSPC  506
            +     ++    +F + V+SG+ QGSGEYF R+GVG+PP+  ++V+D+GSD+VW+QC PC
Sbjct  114  SPRDATSSYSVEEFGAEVVSGMNQGSGEYFIRIGVGSPPREQYVVIDSGSDIVWVQCQPC  173

Query  507  RKCYAQTDPVFDPSKSSSFVGVKCDSPLCRRLDSSGC  617
             +CY QTDPVFDP+ S+SF+GV C S +C R++++GC
Sbjct  174  TQCYHQTDPVFDPADSASFMGVPCSSSVCERIENAGC  210



>gb|KDO69941.1| hypothetical protein CISIN_1g011042mg [Citrus sinensis]
Length=495

 Score =   131 bits (329),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 68/150 (45%), Positives = 95/150 (63%), Gaps = 9/150 (6%)
 Frame = +3

Query  192  ENTLSLDLHHIDLISSAAVNATPKAL-------FVKRLQRDaarakalsllaaaaPPHNA  350
            E   +L+L H D +SS++ N T           F  R+QRD  R   L    +      A
Sbjct  76   EARWNLELVHRDKMSSSS-NTTNNMHYHRHQHSFHARMQRDVKRVATLVRRLSGGGADAA  134

Query  351  TRG-RDFSSSVISGLAQGSGEYFTRLGVGTPPKYAFMVLDTGSDVVWLQCSPCRKCYAQT  527
                +DF + V+SG+ QGSGEYF R+GVG+PP+  +MV+D+GSD+VW+QC PC +CY Q+
Sbjct  135  KHEVQDFGTDVVSGMDQGSGEYFVRIGVGSPPRSQYMVIDSGSDIVWVQCQPCSQCYKQS  194

Query  528  DPVFDPSKSSSFVGVKCDSPLCRRLDSSGC  617
            DPVFDP+ S+SF GV C S +C RL+++GC
Sbjct  195  DPVFDPADSASFSGVSCSSAVCDRLENAGC  224



>ref|XP_004236867.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 2-like [Solanum 
lycopersicum]
Length=479

 Score =   130 bits (328),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 65/148 (44%), Positives = 91/148 (61%), Gaps = 2/148 (1%)
 Frame = +3

Query  174  VQPDDSENTLSLDLHHIDLISSAAVNATPKALFVKRLQRDaarakalsllaaaaPPHNAT  353
            ++ +     L L+L H D +           +F  R+ RD  R  ++         +   
Sbjct  63   IEQESGNLKLKLNLIHRDKLQIPHFPYNNDKVFEGRISRDLKRVSSIIHRIENGGVN--Y  120

Query  354  RGRDFSSSVISGLAQGSGEYFTRLGVGTPPKYAFMVLDTGSDVVWLQCSPCRKCYAQTDP  533
            R ++F S +ISG+ QGSGEYF R+GVG+PPK  +MVLD+GSD+VW+QC PC +CY Q+DP
Sbjct  121  RVKEFGSDLISGMDQGSGEYFVRVGVGSPPKNQYMVLDSGSDIVWVQCQPCTQCYHQSDP  180

Query  534  VFDPSKSSSFVGVKCDSPLCRRLDSSGC  617
            VFDPS S SF GV C S +C R+++SGC
Sbjct  181  VFDPSLSVSFTGVSCGSSVCDRVENSGC  208



>ref|XP_004961034.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 1-like [Setaria 
italica]
Length=517

 Score =   130 bits (328),  Expect = 6e-32, Method: Compositional matrix adjust.
 Identities = 58/87 (67%), Positives = 70/87 (80%), Gaps = 0/87 (0%)
 Frame = +3

Query  357  GRDFSSSVISGLAQGSGEYFTRLGVGTPPKYAFMVLDTGSDVVWLQCSPCRKCYAQTDPV  536
            G  F++ V+SGL+QGSGEYF ++GVGTPP  A +VLDTGSDVVWLQC+PCR CYAQ+  V
Sbjct  138  GSGFAAPVLSGLSQGSGEYFAQVGVGTPPTPALLVLDTGSDVVWLQCAPCRHCYAQSGRV  197

Query  537  FDPSKSSSFVGVKCDSPLCRRLDSSGC  617
            FDP +S S+  V C +PLCRRLDS GC
Sbjct  198  FDPRRSRSYATVPCAAPLCRRLDSGGC  224



>ref|XP_006484478.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 2-like [Citrus 
sinensis]
Length=495

 Score =   130 bits (328),  Expect = 6e-32, Method: Compositional matrix adjust.
 Identities = 68/150 (45%), Positives = 94/150 (63%), Gaps = 9/150 (6%)
 Frame = +3

Query  192  ENTLSLDLHHIDLISSAAVNATPKAL-------FVKRLQRDaarakalsllaaaaPPHNA  350
            E    L+L H D +SS++ N T           F  R+QRD  R   L    +      A
Sbjct  76   EARWKLELVHRDKMSSSS-NTTNNMHYHRHQHSFHARMQRDVKRVATLVRRLSGGGADAA  134

Query  351  TRG-RDFSSSVISGLAQGSGEYFTRLGVGTPPKYAFMVLDTGSDVVWLQCSPCRKCYAQT  527
                +DF + V+SG+ QGSGEYF R+GVG+PP+  +MV+D+GSD+VW+QC PC +CY Q+
Sbjct  135  KHEVQDFGTDVVSGMDQGSGEYFVRIGVGSPPRSQYMVIDSGSDIVWVQCQPCSQCYKQS  194

Query  528  DPVFDPSKSSSFVGVKCDSPLCRRLDSSGC  617
            DPVFDP+ S+SF GV C S +C RL+++GC
Sbjct  195  DPVFDPADSASFSGVSCSSAVCDRLENAGC  224



>ref|XP_006437655.1| hypothetical protein CICLE_v10031332mg [Citrus clementina]
 gb|ESR50895.1| hypothetical protein CICLE_v10031332mg [Citrus clementina]
Length=495

 Score =   130 bits (327),  Expect = 6e-32, Method: Compositional matrix adjust.
 Identities = 68/150 (45%), Positives = 94/150 (63%), Gaps = 9/150 (6%)
 Frame = +3

Query  192  ENTLSLDLHHIDLISSAAVNATPKAL-------FVKRLQRDaarakalsllaaaaPPHNA  350
            E    L+L H D +SS++ N T           F  R+QRD  R   L    +      A
Sbjct  76   EARWKLELVHRDKMSSSS-NTTNNMHYHRHQHSFHARMQRDVKRVATLVRRLSGGGADAA  134

Query  351  TRG-RDFSSSVISGLAQGSGEYFTRLGVGTPPKYAFMVLDTGSDVVWLQCSPCRKCYAQT  527
                +DF + V+SG+ QGSGEYF R+GVG+PP+  +MV+D+GSD+VW+QC PC +CY Q+
Sbjct  135  KHEVQDFGTDVVSGMDQGSGEYFVRIGVGSPPRSQYMVIDSGSDIVWVQCQPCSQCYKQS  194

Query  528  DPVFDPSKSSSFVGVKCDSPLCRRLDSSGC  617
            DPVFDP+ S+SF GV C S +C RL+++GC
Sbjct  195  DPVFDPADSASFSGVSCSSAVCDRLENAGC  224



>ref|XP_009351765.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 2 [Pyrus x 
bretschneideri]
Length=548

 Score =   130 bits (328),  Expect = 6e-32, Method: Compositional matrix adjust.
 Identities = 66/145 (46%), Positives = 92/145 (63%), Gaps = 9/145 (6%)
 Frame = +3

Query  207  LDLHHIDLISSAAVNATPKA--------LFVKRLQRDaarakalsllaaaaPPHNATRGR  362
            L + H D +SS   N             LF  R++RDA R  +L+        ++     
Sbjct  121  LKVVHRDKMSSQYSNRNGNGGSHTSHSHLFRARMKRDAKRVASLTRRLLNDS-NSELESL  179

Query  363  DFSSSVISGLAQGSGEYFTRLGVGTPPKYAFMVLDTGSDVVWLQCSPCRKCYAQTDPVFD  542
            DF S V+SG+ QGSGEYF R+GVG+PP+  +MV+D+GSD+VW+QC PC +CY Q+DP+FD
Sbjct  180  DFGSGVVSGMEQGSGEYFVRIGVGSPPRNQYMVIDSGSDIVWVQCQPCTECYHQSDPIFD  239

Query  543  PSKSSSFVGVKCDSPLCRRLDSSGC  617
            P++S+S+ GV CDS LC RL + GC
Sbjct  240  PARSASYSGVSCDSSLCGRLQNPGC  264



>ref|XP_010248951.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 2-like [Nelumbo 
nucifera]
Length=475

 Score =   130 bits (327),  Expect = 7e-32, Method: Compositional matrix adjust.
 Identities = 53/86 (62%), Positives = 69/86 (80%), Gaps = 0/86 (0%)
 Frame = +3

Query  360  RDFSSSVISGLAQGSGEYFTRLGVGTPPKYAFMVLDTGSDVVWLQCSPCRKCYAQTDPVF  539
             DF S VISG+ QGSGEYF R+GVG+PP+  +MVLD+GSD+VW+QC PC +CY Q DPVF
Sbjct  119  EDFGSEVISGMEQGSGEYFVRIGVGSPPRNQYMVLDSGSDIVWVQCQPCSQCYRQLDPVF  178

Query  540  DPSKSSSFVGVKCDSPLCRRLDSSGC  617
            DP+ S++F GV C S +C RL+++GC
Sbjct  179  DPAASATFAGVACSSTVCGRLENAGC  204



>ref|XP_009607692.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 2-like [Nicotiana 
tomentosiformis]
Length=489

 Score =   130 bits (326),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 73/182 (40%), Positives = 97/182 (53%), Gaps = 16/182 (9%)
 Frame = +3

Query  114  PLPTAQHYSLSSKPQYSQTLVQPDDSE--------------NTLSLDLHHIDLISSAAVN  251
            P P  +H+++    + S T + P  S+                  L L H D +      
Sbjct  39   PFPIHEHFNVKQTIKES-TRIHPPPSKTQGVAEEEEEFLEKGNWKLKLLHRDKLPFPHFT  97

Query  252  ATPKALFVKRLQRDaarakalsllaaaaPPHNATRGRDFSSSVISGLAQGSGEYFTRLGV  431
              P  L   R++RD  R   L         +N     +F S VISG+ QGSGEYF R+GV
Sbjct  98   DHPHRL-EARVKRDVKRVDTLIHKITGGNNNNVYEVEEFGSEVISGMEQGSGEYFVRIGV  156

Query  432  GTPPKYAFMVLDTGSDVVWLQCSPCRKCYAQTDPVFDPSKSSSFVGVKCDSPLCRRLDSS  611
            G+P +  +MV+D GSD+VW+QC PC  CY Q+DPVFDPS S+SF GV C S LC R+D+S
Sbjct  157  GSPVREQYMVIDAGSDIVWVQCQPCTHCYHQSDPVFDPSLSASFSGVPCTSSLCERVDNS  216

Query  612  GC  617
            GC
Sbjct  217  GC  218



>dbj|BAJ86414.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ92334.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=492

 Score =   129 bits (324),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 80/156 (51%), Positives = 95/156 (61%), Gaps = 9/156 (6%)
 Frame = +3

Query  159  YSQTLVQPDDS-ENTLSLDLHHIDLISSAAVNATPKALFVKRLQRDaarakalsllaaaa  335
            ++  L   +D+  +T+   L H D  S   VNAT   L   RL+RDA RA  LS  A   
Sbjct  59   FAGNLASAEDAPASTVRFRLVHRDDFS---VNATAAELLAYRLERDAKRAARLSAAAG--  113

Query  336  PPHNATRGRDFSSSVISG--LAQGSGEYFTRLGVGTPPKYAFMVLDTGSDVVWLQCSPCR  509
             P N TR             LAQGSGEYFT++GVGTP   A MVLDTGSDVVWLQC+PCR
Sbjct  114  -PANGTRRGGGGVVAPVVSGLAQGSGEYFTKIGVGTPATPALMVLDTGSDVVWLQCAPCR  172

Query  510  KCYAQTDPVFDPSKSSSFVGVKCDSPLCRRLDSSGC  617
            +CY Q+  VFDP +S S+  V C +PLCRRLDS GC
Sbjct  173  RCYEQSGQVFDPRRSRSYNAVGCAAPLCRRLDSGGC  208



>ref|XP_008465249.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 2 [Cucumis 
melo]
Length=477

 Score =   129 bits (324),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 65/145 (45%), Positives = 95/145 (66%), Gaps = 4/145 (3%)
 Frame = +3

Query  183  DDSENTLSLDLHHIDLISSAAVNATPKALFVKRLQRDaarakalsllaaaaPPHNATRGR  362
            + S++   L L H D +        P+  F +R+ RD+ R  +L  L + A     T   
Sbjct  66   NSSQSQWKLKLFHRDKLPLNFDTNHPRR-FKERISRDSKRVSSLLRLLSNASDEQVT---  121

Query  363  DFSSSVISGLAQGSGEYFTRLGVGTPPKYAFMVLDTGSDVVWLQCSPCRKCYAQTDPVFD  542
            DF S V+SG  QGSGEYF R+GVG+PP+  ++V+D+GSD+VW+QC PC +CY Q+DPVFD
Sbjct  122  DFGSDVVSGTEQGSGEYFVRIGVGSPPRSQYVVIDSGSDIVWVQCQPCSECYQQSDPVFD  181

Query  543  PSKSSSFVGVKCDSPLCRRLDSSGC  617
            P+ S+++ G+ CDS +C RLD++GC
Sbjct  182  PAGSATYAGISCDSSVCDRLDNAGC  206



>ref|XP_010487964.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 2-like [Camelina 
sativa]
Length=470

 Score =   129 bits (323),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 68/149 (46%), Positives = 94/149 (63%), Gaps = 5/149 (3%)
 Frame = +3

Query  183  DDSENTLSLDLHHIDLISSAAVNATPKALFVKRLQRDaarakalsllaaaaPPHNATRGR  362
            DDS +  +L L H D   S +       L   R++RD  R  AL    +     +++  R
Sbjct  52   DDSNSKHTLRLLHRDRFPSVSYRNHHHRLHA-RMRRDTDRVAALLRRISGKTVSSSSDAR  110

Query  363  ----DFSSSVISGLAQGSGEYFTRLGVGTPPKYAFMVLDTGSDVVWLQCSPCRKCYAQTD  530
                DF S V+SG+ QGSGEYF R+GVG+PP+  +MV+D+GSD+VW+QC PC+ CY Q+D
Sbjct  111  YEVDDFGSDVVSGMDQGSGEYFVRIGVGSPPRDQYMVIDSGSDMVWVQCQPCKLCYKQSD  170

Query  531  PVFDPSKSSSFVGVKCDSPLCRRLDSSGC  617
            PVFDP+KS S+ GV C S +C R+ +SGC
Sbjct  171  PVFDPAKSGSYTGVSCGSSVCDRVGNSGC  199



>ref|XP_002267930.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 2 [Vitis vinifera]
Length=479

 Score =   129 bits (323),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 52/85 (61%), Positives = 70/85 (82%), Gaps = 0/85 (0%)
 Frame = +3

Query  363  DFSSSVISGLAQGSGEYFTRLGVGTPPKYAFMVLDTGSDVVWLQCSPCRKCYAQTDPVFD  542
            DF + VISG+ QGSGEYF R+GVG+PP+  +MV+D+GSD+VW+QC PC +CY Q+DPVFD
Sbjct  124  DFGTDVISGMEQGSGEYFVRIGVGSPPRSQYMVIDSGSDIVWVQCQPCTQCYHQSDPVFD  183

Query  543  PSKSSSFVGVKCDSPLCRRLDSSGC  617
            P+ S+SF GV C S +C RL+++GC
Sbjct  184  PADSASFTGVSCSSSVCDRLENAGC  208



>gb|ABK25248.1| unknown [Picea sitchensis]
Length=366

 Score =   127 bits (320),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 76/186 (41%), Positives = 101/186 (54%), Gaps = 25/186 (13%)
 Frame = +3

Query  105  SLRPLPTAQ---HYSLSSKPQYSQTLVQPDDSENTLSLDLHHIDLISSAAVNATP-----  260
            SLR   TA     Y   +KP+ S   V+           +H   L+   A NAT      
Sbjct  50   SLRETDTAAGGAEYKRETKPRRSPWSVEV----------VHRDALLLKNAANATASYERR  99

Query  261  -------KALFVKRLQRDaarakalsllaaaaPPHNATRGRDFSSSVISGLAQGSGEYFT  419
                   +A+ V+ L+R   R   L+        + A    DF   V+SG+ QGSGEYFT
Sbjct  100  LKEKLRREAVRVRGLERQIERTLTLNKDPVNRYENVAEVDADFGGEVVSGMEQGSGEYFT  159

Query  420  RLGVGTPPKYAFMVLDTGSDVVWLQCSPCRKCYAQTDPVFDPSKSSSFVGVKCDSPLCRR  599
            R+GVGTP +  +MVLDTGSDV W+QC PCR+CY+Q DP+F+PS S+SF  V CDS +C +
Sbjct  160  RIGVGTPTREQYMVLDTGSDVAWIQCEPCRECYSQADPIFNPSYSASFSTVGCDSAVCSQ  219

Query  600  LDSSGC  617
            LD+  C
Sbjct  220  LDAYDC  225



>ref|XP_008445900.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 2-like [Cucumis 
melo]
Length=481

 Score =   128 bits (322),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 67/149 (45%), Positives = 94/149 (63%), Gaps = 14/149 (9%)
 Frame = +3

Query  192  ENTLSLDLHHIDLISSAAVNATPKALFVKRLQRDaarakalsllaaaaPPHNATRGRD--  365
             +T  L+L H D +S    +   +  F  R++RDA R   L    +    H A    D  
Sbjct  69   NDTFKLNLLHRDKLSHVHGH---RRGFNDRMKRDAIRVATLVRRLS----HGAAAVEDSR  121

Query  366  -----FSSSVISGLAQGSGEYFTRLGVGTPPKYAFMVLDTGSDVVWLQCSPCRKCYAQTD  530
                 F++ VISG+ +GSGEYF R+GVG+PP+  +MV+D+GSD+VW+QC PC +CY Q+D
Sbjct  122  FKVANFATDVISGMEEGSGEYFVRIGVGSPPRSQYMVIDSGSDIVWVQCKPCSRCYQQSD  181

Query  531  PVFDPSKSSSFVGVKCDSPLCRRLDSSGC  617
            PVFDP+ SSSF GV C S +C RL+++GC
Sbjct  182  PVFDPADSSSFAGVSCGSDVCDRLENTGC  210



>ref|XP_002885351.1| pepsin A [Arabidopsis lyrata subsp. lyrata]
 gb|EFH61610.1| pepsin A [Arabidopsis lyrata subsp. lyrata]
Length=471

 Score =   128 bits (322),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 67/149 (45%), Positives = 93/149 (62%), Gaps = 5/149 (3%)
 Frame = +3

Query  183  DDSENTLSLDLHHIDLISSAAVNATPKALFVKRLQRDaarakalsllaaaaPPHNATRGR  362
            DDS +  +L L H D   S         L   R++RD  R  A+    +      ++  R
Sbjct  53   DDSNSKYTLRLLHRDRFPSVTYRNHHHRLHA-RMRRDTDRVSAILRRISGKVVVASSDSR  111

Query  363  ----DFSSSVISGLAQGSGEYFTRLGVGTPPKYAFMVLDTGSDVVWLQCSPCRKCYAQTD  530
                DF S V+SG+ QGSGEYF R+GVG+PP+  +MV+D+GSD+VW+QC PC+ CY Q+D
Sbjct  112  YEVNDFGSDVVSGMDQGSGEYFVRIGVGSPPRDQYMVIDSGSDMVWVQCQPCKLCYKQSD  171

Query  531  PVFDPSKSSSFVGVKCDSPLCRRLDSSGC  617
            PVFDP+KS S+ GV C S +C R+++SGC
Sbjct  172  PVFDPAKSGSYTGVSCGSSVCDRIENSGC  200



>gb|ABK24480.1| unknown [Picea sitchensis]
Length=496

 Score =   128 bits (322),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 53/85 (62%), Positives = 69/85 (81%), Gaps = 0/85 (0%)
 Frame = +3

Query  363  DFSSSVISGLAQGSGEYFTRLGVGTPPKYAFMVLDTGSDVVWLQCSPCRKCYAQTDPVFD  542
            +F S V+SG+ QGSGEYFTR+G+GTP +  +MVLDTGSDVVW+QC PCR+CY+Q DP+F+
Sbjct  138  EFGSEVVSGMEQGSGEYFTRIGIGTPTREQYMVLDTGSDVVWIQCEPCRECYSQADPIFN  197

Query  543  PSKSSSFVGVKCDSPLCRRLDSSGC  617
            PS S SF  V CDS +C +LD++ C
Sbjct  198  PSSSVSFSTVGCDSAVCSQLDANDC  222



>ref|XP_007142740.1| hypothetical protein PHAVU_007G013000g [Phaseolus vulgaris]
 gb|ESW14734.1| hypothetical protein PHAVU_007G013000g [Phaseolus vulgaris]
Length=475

 Score =   128 bits (322),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 64/145 (44%), Positives = 90/145 (62%), Gaps = 2/145 (1%)
 Frame = +3

Query  183  DDSENTLSLDLHHIDLISSAAVNATPKALFVKRLQRDaarakalsllaaaaPPHNATRGR  362
            D S     L L H D +S+       +  F  R++RDA R   L    AA  P       
Sbjct  62   DSSSTKWKLKLLHRDKVSTFNTTLDHQTRFNARIERDARRVAVLLRRLAAGKP--TLDSE  119

Query  363  DFSSSVISGLAQGSGEYFTRLGVGTPPKYAFMVLDTGSDVVWLQCSPCRKCYAQTDPVFD  542
             F S V+SG+ QGSGEYF R+GVG+PP+  ++V+D+GSD++W+QC PC +CY Q+DPVF+
Sbjct  120  AFGSDVVSGMEQGSGEYFVRIGVGSPPRNQYVVIDSGSDIIWVQCEPCTQCYRQSDPVFN  179

Query  543  PSKSSSFVGVKCDSPLCRRLDSSGC  617
            P+ SSS+ GV C S +C  +D++GC
Sbjct  180  PADSSSYAGVSCASTVCSHVDNAGC  204



>emb|CBI35367.3| unnamed protein product [Vitis vinifera]
Length=521

 Score =   128 bits (322),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 52/85 (61%), Positives = 70/85 (82%), Gaps = 0/85 (0%)
 Frame = +3

Query  363  DFSSSVISGLAQGSGEYFTRLGVGTPPKYAFMVLDTGSDVVWLQCSPCRKCYAQTDPVFD  542
            DF + VISG+ QGSGEYF R+GVG+PP+  +MV+D+GSD+VW+QC PC +CY Q+DPVFD
Sbjct  185  DFGTDVISGMEQGSGEYFVRIGVGSPPRSQYMVIDSGSDIVWVQCQPCTQCYHQSDPVFD  244

Query  543  PSKSSSFVGVKCDSPLCRRLDSSGC  617
            P+ S+SF GV C S +C RL+++GC
Sbjct  245  PADSASFTGVSCSSSVCDRLENAGC  269



>ref|XP_006360843.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 2-like [Solanum 
tuberosum]
Length=479

 Score =   128 bits (321),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 64/148 (43%), Positives = 89/148 (60%), Gaps = 2/148 (1%)
 Frame = +3

Query  174  VQPDDSENTLSLDLHHIDLISSAAVNATPKALFVKRLQRDaarakalsllaaaaPPHNAT  353
            ++ ++    L L L H D +           +F  R+ RD  R  ++         +   
Sbjct  63   IEQENGNWKLKLKLIHRDKLQIPHFPYNNNKVFEGRINRDLKRVSSIIHRIENGGVN--Y  120

Query  354  RGRDFSSSVISGLAQGSGEYFTRLGVGTPPKYAFMVLDTGSDVVWLQCSPCRKCYAQTDP  533
            R  +F S +ISG+ QGSGEYF R+GVG+P K  +MVLD+GSD+VW+QC PC +CY Q+DP
Sbjct  121  RVEEFGSDLISGMDQGSGEYFVRIGVGSPAKNQYMVLDSGSDIVWVQCQPCTQCYHQSDP  180

Query  534  VFDPSKSSSFVGVKCDSPLCRRLDSSGC  617
            VFDPS S SF GV C S +C R+++SGC
Sbjct  181  VFDPSLSVSFTGVPCGSSVCDRVENSGC  208



>ref|XP_004253208.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 2-like [Solanum 
lycopersicum]
Length=486

 Score =   128 bits (321),  Expect = 5e-31, Method: Compositional matrix adjust.
 Identities = 55/87 (63%), Positives = 67/87 (77%), Gaps = 0/87 (0%)
 Frame = +3

Query  357  GRDFSSSVISGLAQGSGEYFTRLGVGTPPKYAFMVLDTGSDVVWLQCSPCRKCYAQTDPV  536
            G  F S VISG+ QGSGEYF R+GVG+P +  +MV+D GSD+VW+QC PC  CY Q+DPV
Sbjct  127  GFGFGSEVISGMEQGSGEYFVRIGVGSPVRQQYMVIDAGSDIVWVQCQPCTHCYHQSDPV  186

Query  537  FDPSKSSSFVGVKCDSPLCRRLDSSGC  617
            FDPS S+SF GV C S LC R+D+SGC
Sbjct  187  FDPSLSASFTGVPCSSSLCNRIDNSGC  213



>gb|KFK39328.1| hypothetical protein AALP_AA3G230300 [Arabis alpina]
Length=460

 Score =   127 bits (320),  Expect = 5e-31, Method: Compositional matrix adjust.
 Identities = 52/85 (61%), Positives = 70/85 (82%), Gaps = 0/85 (0%)
 Frame = +3

Query  363  DFSSSVISGLAQGSGEYFTRLGVGTPPKYAFMVLDTGSDVVWLQCSPCRKCYAQTDPVFD  542
            DF S V+SG+ QGSGEYF R+GVG+PP+  +MV+D+GSD+VW+QC PC+ CY Q+DPVFD
Sbjct  105  DFGSDVVSGMDQGSGEYFVRIGVGSPPRDQYMVIDSGSDMVWVQCQPCKLCYKQSDPVFD  164

Query  543  PSKSSSFVGVKCDSPLCRRLDSSGC  617
            P+KS S+ GV C S +C R+++SGC
Sbjct  165  PAKSGSYTGVSCGSSVCDRIENSGC  189



>ref|XP_003555824.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 2-like [Glycine 
max]
Length=473

 Score =   128 bits (321),  Expect = 5e-31, Method: Compositional matrix adjust.
 Identities = 71/176 (40%), Positives = 100/176 (57%), Gaps = 8/176 (5%)
 Frame = +3

Query  90   ITETXSLRPLPTAQHYSLSSKPQYSQTLVQPDDSENTLSLDLHHIDLISSAAVNATPKAL  269
            +TET  L P  T +H            +     S     L L H D + +   +   +  
Sbjct  35   LTET-KLNPTNTYKHLQ-----HQKLNIATEASSPAKYKLKLVHRDKVPTFNTSHDHRTR  88

Query  270  FVKRLQRDaarakalsllaaaaPPHNATRGRDFSSSVISGLAQGSGEYFTRLGVGTPPKY  449
            F  R+QRD  R  AL    AA  P  A     F S V+SG+ QGSGEYF R+GVG+PP+ 
Sbjct  89   FNARMQRDTKRVAALRRHLAAGKPTYAEEA--FGSDVVSGMEQGSGEYFVRIGVGSPPRN  146

Query  450  AFMVLDTGSDVVWLQCSPCRKCYAQTDPVFDPSKSSSFVGVKCDSPLCRRLDSSGC  617
             ++V+D+GSD++W+QC PC +CY Q+DPVF+P+ SSS+ GV C S +C  +D++GC
Sbjct  147  QYVVIDSGSDIIWVQCEPCTQCYHQSDPVFNPADSSSYAGVSCASTVCSHVDNAGC  202



>ref|XP_009145693.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 2 [Brassica 
rapa]
Length=467

 Score =   127 bits (320),  Expect = 5e-31, Method: Compositional matrix adjust.
 Identities = 52/85 (61%), Positives = 70/85 (82%), Gaps = 0/85 (0%)
 Frame = +3

Query  363  DFSSSVISGLAQGSGEYFTRLGVGTPPKYAFMVLDTGSDVVWLQCSPCRKCYAQTDPVFD  542
            DF S V+SG+ QGSGEYF R+GVG+PP+  +MV+D+GSD+VW+QC PC+ CY Q+DPVFD
Sbjct  112  DFGSDVVSGMDQGSGEYFVRIGVGSPPRDQYMVIDSGSDMVWVQCQPCKLCYKQSDPVFD  171

Query  543  PSKSSSFVGVKCDSPLCRRLDSSGC  617
            P+KS S+ GV C S +C R+++SGC
Sbjct  172  PAKSGSYTGVSCGSSVCDRIENSGC  196



>ref|XP_007043208.1| Aspartic proteinase nepenthesin-1, putative [Theobroma cacao]
 gb|EOX99039.1| Aspartic proteinase nepenthesin-1, putative [Theobroma cacao]
Length=481

 Score =   127 bits (320),  Expect = 6e-31, Method: Compositional matrix adjust.
 Identities = 51/85 (60%), Positives = 70/85 (82%), Gaps = 0/85 (0%)
 Frame = +3

Query  363  DFSSSVISGLAQGSGEYFTRLGVGTPPKYAFMVLDTGSDVVWLQCSPCRKCYAQTDPVFD  542
            DF S V+SG+ QGSGEYF R+GVG+PP+  +MV+D+GSD+VW+QC PC +CY Q+DPVFD
Sbjct  126  DFGSDVVSGMDQGSGEYFVRIGVGSPPRSQYMVIDSGSDIVWVQCQPCNQCYRQSDPVFD  185

Query  543  PSKSSSFVGVKCDSPLCRRLDSSGC  617
            P+ S+S+ GV C S +C R+++SGC
Sbjct  186  PANSASYSGVSCTSSVCDRIENSGC  210



>ref|XP_010508355.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 2-like [Camelina 
sativa]
Length=471

 Score =   127 bits (319),  Expect = 7e-31, Method: Compositional matrix adjust.
 Identities = 68/149 (46%), Positives = 92/149 (62%), Gaps = 5/149 (3%)
 Frame = +3

Query  183  DDSENTLSLDLHHIDLISSAAVNATPKALFVKRLQRDaarakalsllaaaaPPHNATRGR  362
            DDS +  +L L H D   S         L   R++RD  R  AL          +++  R
Sbjct  53   DDSTSKHTLRLLHRDRFPSVTYRNHHHRLHA-RMRRDTDRVAALLRRICGKAVSSSSDAR  111

Query  363  ----DFSSSVISGLAQGSGEYFTRLGVGTPPKYAFMVLDTGSDVVWLQCSPCRKCYAQTD  530
                DF S V+SG+ QGSGEYF R+GVG+PP+  +MV+D+GSD+VW+QC PC+ CY Q+D
Sbjct  112  YEVDDFGSDVVSGMDQGSGEYFVRIGVGSPPRDQYMVIDSGSDMVWVQCQPCKLCYKQSD  171

Query  531  PVFDPSKSSSFVGVKCDSPLCRRLDSSGC  617
            PVFDP+KS S+ GV C S +C R+ +SGC
Sbjct  172  PVFDPAKSGSYTGVSCGSSVCDRVGNSGC  200



>ref|XP_010466176.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 2 [Camelina 
sativa]
Length=470

 Score =   127 bits (319),  Expect = 7e-31, Method: Compositional matrix adjust.
 Identities = 68/149 (46%), Positives = 92/149 (62%), Gaps = 5/149 (3%)
 Frame = +3

Query  183  DDSENTLSLDLHHIDLISSAAVNATPKALFVKRLQRDaarakalsllaaaaPPHNATRGR  362
            DDS +  +L L H D   S         L   R++RD  R  AL    +     +++  R
Sbjct  52   DDSTSKYTLRLLHRDRFPSVTYRNHHHRLHA-RMRRDTDRVAALLRRISGKAVSSSSDAR  110

Query  363  ----DFSSSVISGLAQGSGEYFTRLGVGTPPKYAFMVLDTGSDVVWLQCSPCRKCYAQTD  530
                DF S V+SG+ QGSGEYF R+GVG+PP+  +MV+D+GSD+VW+QC PC+ CY Q+D
Sbjct  111  YEVDDFGSDVVSGMDQGSGEYFVRIGVGSPPRDQYMVIDSGSDMVWVQCQPCKLCYKQSD  170

Query  531  PVFDPSKSSSFVGVKCDSPLCRRLDSSGC  617
            PVFDP+KS S+ GV C S +C R+  SGC
Sbjct  171  PVFDPAKSGSYTGVSCGSSVCDRVGISGC  199



>ref|XP_004150193.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 2-like [Cucumis 
sativus]
 ref|XP_004170426.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 2-like [Cucumis 
sativus]
Length=476

 Score =   127 bits (319),  Expect = 7e-31, Method: Compositional matrix adjust.
 Identities = 65/147 (44%), Positives = 96/147 (65%), Gaps = 8/147 (5%)
 Frame = +3

Query  183  DDSENTLSLDLHHIDLISSAAVNATPK--ALFVKRLQRDaarakalsllaaaaPPHNATR  356
            + S++   L L H D +    +N  P     F +R+ RD+ R  +L  L ++      T 
Sbjct  65   NSSQSQWKLKLFHRDKL---PLNFDPDHPRRFKERISRDSKRVSSLLRLLSSGSDEQVT-  120

Query  357  GRDFSSSVISGLAQGSGEYFTRLGVGTPPKYAFMVLDTGSDVVWLQCSPCRKCYAQTDPV  536
              DF S V+SG  QGSGEYF R+GVG+PP+  ++V+D+GSD+VW+QC PC +CY Q+DPV
Sbjct  121  --DFGSDVVSGTEQGSGEYFVRIGVGSPPRSQYVVIDSGSDIVWVQCQPCSECYQQSDPV  178

Query  537  FDPSKSSSFVGVKCDSPLCRRLDSSGC  617
            FDP+ S+++ G+ CDS +C RLD++GC
Sbjct  179  FDPAGSATYAGISCDSSVCDRLDNAGC  205



>ref|NP_188636.2| protein ASPARTIC PROTEASE IN GUARD CELL 2 [Arabidopsis thaliana]
 sp|Q9LHE3.1|ASPG2_ARATH RecName: Full=Protein ASPARTIC PROTEASE IN GUARD CELL 2; Short=AtASPG2; 
Flags: Precursor [Arabidopsis thaliana]
 dbj|BAB03167.1| nucleoid chloroplast DNA-binding protein-like [Arabidopsis thaliana]
 gb|AAO41867.1| unknown protein [Arabidopsis thaliana]
 gb|AEE76319.1| protein aspartic protease in guard cell 2 [Arabidopsis thaliana]
Length=470

 Score =   127 bits (319),  Expect = 8e-31, Method: Compositional matrix adjust.
 Identities = 51/85 (60%), Positives = 70/85 (82%), Gaps = 0/85 (0%)
 Frame = +3

Query  363  DFSSSVISGLAQGSGEYFTRLGVGTPPKYAFMVLDTGSDVVWLQCSPCRKCYAQTDPVFD  542
            DF S ++SG+ QGSGEYF R+GVG+PP+  +MV+D+GSD+VW+QC PC+ CY Q+DPVFD
Sbjct  115  DFGSDIVSGMDQGSGEYFVRIGVGSPPRDQYMVIDSGSDMVWVQCQPCKLCYKQSDPVFD  174

Query  543  PSKSSSFVGVKCDSPLCRRLDSSGC  617
            P+KS S+ GV C S +C R+++SGC
Sbjct  175  PAKSGSYTGVSCGSSVCDRIENSGC  199



>gb|ABR17085.1| unknown [Picea sitchensis]
Length=498

 Score =   127 bits (319),  Expect = 9e-31, Method: Compositional matrix adjust.
 Identities = 76/186 (41%), Positives = 101/186 (54%), Gaps = 25/186 (13%)
 Frame = +3

Query  105  SLRPLPTAQ---HYSLSSKPQYSQTLVQPDDSENTLSLDLHHIDLISSAAVNATP-----  260
            SLR   TA     Y   +KP+ S   V+           +H   L+   A NAT      
Sbjct  50   SLRETDTAAGGAEYKRETKPRRSPWSVEV----------VHRDALLLKNAANATASYERR  99

Query  261  -------KALFVKRLQRDaarakalsllaaaaPPHNATRGRDFSSSVISGLAQGSGEYFT  419
                   +A+ V+ L+R   R   L+        + A    DF   V+SG+ QGSGEYFT
Sbjct  100  LKEKLRREAVRVRGLERQIERTLTLNKDPVNRYENVAEVDADFGGEVVSGMEQGSGEYFT  159

Query  420  RLGVGTPPKYAFMVLDTGSDVVWLQCSPCRKCYAQTDPVFDPSKSSSFVGVKCDSPLCRR  599
            R+GVGTP +  +MVLDTGSDV W+QC PCR+CY+Q DP+F+PS S+SF  V CDS +C +
Sbjct  160  RIGVGTPTREQYMVLDTGSDVAWIQCEPCRECYSQADPIFNPSYSASFSTVGCDSAVCSQ  219

Query  600  LDSSGC  617
            LD+  C
Sbjct  220  LDAYDC  225



>ref|XP_008340423.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 2 [Malus domestica]
Length=547

 Score =   127 bits (319),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 51/85 (60%), Positives = 69/85 (81%), Gaps = 0/85 (0%)
 Frame = +3

Query  363  DFSSSVISGLAQGSGEYFTRLGVGTPPKYAFMVLDTGSDVVWLQCSPCRKCYAQTDPVFD  542
            DF S V+SG+ QGSGEYF R+GVG+PP+  +MV+D+GSD+VW+QC PC +CY Q+DP+FD
Sbjct  179  DFGSGVVSGMEQGSGEYFVRIGVGSPPRNQYMVIDSGSDIVWVQCQPCTECYHQSDPIFD  238

Query  543  PSKSSSFVGVKCDSPLCRRLDSSGC  617
            P++S+S+ GV C S LC RL + GC
Sbjct  239  PARSASYSGVSCASSLCGRLQNPGC  263



>ref|XP_003536757.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 2-like [Glycine 
max]
Length=475

 Score =   127 bits (318),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 75/189 (40%), Positives = 105/189 (56%), Gaps = 6/189 (3%)
 Frame = +3

Query  51   FSYFLAIpssppsITETXSLRPLPTAQHYSLSSKPQYSQTLVQPDDSENTLSLDLHHIDL  230
            + +F  +      +TET  L P PT       +K   S T      S     L L H D 
Sbjct  22   YPHFQQLNVKQIILTET-KLYPNPTQPSKHPHNKKLNSAT---EASSSAKYKLKLVHRDK  77

Query  231  ISSAAVNATPKALFVKRLQRDaarakalsllaaaaPPHNATRGRDFSSSVISGLAQGSGE  410
            + +       +  F  R+QRD  RA +L    AA  P  A     F S V+SG+ QGSGE
Sbjct  78   VPTFNTYHDHRTRFNARMQRDTKRAASLLRRLAAGKPTYAAEA--FGSDVVSGMEQGSGE  135

Query  411  YFTRLGVGTPPKYAFMVLDTGSDVVWLQCSPCRKCYAQTDPVFDPSKSSSFVGVKCDSPL  590
            YF R+GVG+PP+  ++V+D+GSD++W+QC PC +CY Q+DPVF+P+ SSSF GV C S +
Sbjct  136  YFVRIGVGSPPRNQYVVMDSGSDIIWVQCEPCTQCYHQSDPVFNPADSSSFSGVSCASTV  195

Query  591  CRRLDSSGC  617
            C  +D++ C
Sbjct  196  CSHVDNAAC  204



>emb|CDP04865.1| unnamed protein product [Coffea canephora]
Length=523

 Score =   127 bits (318),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 51/86 (59%), Positives = 69/86 (80%), Gaps = 0/86 (0%)
 Frame = +3

Query  360  RDFSSSVISGLAQGSGEYFTRLGVGTPPKYAFMVLDTGSDVVWLQCSPCRKCYAQTDPVF  539
             +F + V+SG+ QGSGEYF R+GVG+PP+  +MV+D+GSD+VW+QC PC  CY Q+DPVF
Sbjct  167  EEFGTEVVSGMEQGSGEYFVRIGVGSPPRNQYMVVDSGSDIVWVQCQPCNLCYHQSDPVF  226

Query  540  DPSKSSSFVGVKCDSPLCRRLDSSGC  617
            DPS S+SF GV C S +C R+++SGC
Sbjct  227  DPSLSASFAGVSCGSSICDRVENSGC  252



>ref|XP_006297584.1| hypothetical protein CARUB_v10013606mg [Capsella rubella]
 gb|EOA30482.1| hypothetical protein CARUB_v10013606mg [Capsella rubella]
Length=475

 Score =   126 bits (316),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 52/85 (61%), Positives = 69/85 (81%), Gaps = 0/85 (0%)
 Frame = +3

Query  363  DFSSSVISGLAQGSGEYFTRLGVGTPPKYAFMVLDTGSDVVWLQCSPCRKCYAQTDPVFD  542
            DF S V+SG+ QGSGEYF R+GVG+PP+  +MV+D+GSD+VW+QC PC+ CY Q+DPVFD
Sbjct  120  DFGSDVVSGMDQGSGEYFVRIGVGSPPRDQYMVIDSGSDMVWVQCQPCKLCYKQSDPVFD  179

Query  543  PSKSSSFVGVKCDSPLCRRLDSSGC  617
            P+KS S+ GV C S +C R+ +SGC
Sbjct  180  PAKSGSYTGVSCGSSVCDRVGNSGC  204



>ref|XP_010031370.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 2 [Eucalyptus 
grandis]
Length=496

 Score =   126 bits (316),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 52/86 (60%), Positives = 69/86 (80%), Gaps = 0/86 (0%)
 Frame = +3

Query  360  RDFSSSVISGLAQGSGEYFTRLGVGTPPKYAFMVLDTGSDVVWLQCSPCRKCYAQTDPVF  539
             DF S V+SG+ QGSGEYF R+GVG+P +  +MV+D+GSD+VW+QC PC +CY Q+DPVF
Sbjct  142  EDFGSDVVSGMDQGSGEYFVRIGVGSPARSQYMVIDSGSDIVWVQCQPCNQCYRQSDPVF  201

Query  540  DPSKSSSFVGVKCDSPLCRRLDSSGC  617
            DPS S+SF GV C S +C RL+++GC
Sbjct  202  DPSASASFSGVPCGSTVCDRLENAGC  227



>ref|XP_009337150.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 1-like [Pyrus 
x bretschneideri]
Length=487

 Score =   125 bits (314),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 74/169 (44%), Positives = 102/169 (60%), Gaps = 16/169 (9%)
 Frame = +3

Query  141  LSSKPQYSQTLVQPDDSENTLSLDLHHIDLISSAAVNATPKALFVKRLQRDaarakalsl  320
            L S+ Q SQ L     + +  SL LH  D + ++  +   K+L + RL RD+AR  +L  
Sbjct  57   LESQSQESQPL-----NSSAFSLQLHPRDALFNSQ-HKDYKSLTLTRLGRDSARVNSLHT  110

Query  321  laaaa----------PPHNATRGRDFSSSVISGLAQGSGEYFTRLGVGTPPKYAFMVLDT  470
                A          P H   + +D S+ V+SG++QGSGEYF+R+GVGTP K  +MVLDT
Sbjct  111  KLQLALQGIKRVDLEPMHTEIQSQDLSTPVVSGVSQGSGEYFSRIGVGTPAKSFYMVLDT  170

Query  471  GSDVVWLQCSPCRKCYAQTDPVFDPSKSSSFVGVKCDSPLCRRLDSSGC  617
            GSDV WLQC PC  CY Q+DPVF+P+ SS++  + CD+P C+ L  S C
Sbjct  171  GSDVNWLQCGPCSDCYQQSDPVFNPAGSSTYSQLTCDAPQCQALQVSAC  219



>ref|XP_010541885.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 2-like, partial 
[Tarenaya hassleriana]
Length=188

 Score =   120 bits (302),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 48/80 (60%), Positives = 66/80 (83%), Gaps = 0/80 (0%)
 Frame = +3

Query  363  DFSSSVISGLAQGSGEYFTRLGVGTPPKYAFMVLDTGSDVVWLQCSPCRKCYAQTDPVFD  542
            DF S V+SG+ QGSGEYF R+GVG+PP+  +MV+D+GSD+VW+QC PC+ CY Q+DPVFD
Sbjct  109  DFGSDVVSGMDQGSGEYFVRIGVGSPPRNQYMVIDSGSDMVWVQCQPCKLCYKQSDPVFD  168

Query  543  PSKSSSFVGVKCDSPLCRRL  602
            P++S+S+ GV C S +C R+
Sbjct  169  PAESASYTGVSCGSSVCDRV  188



>ref|XP_010935575.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 2-like [Elaeis 
guineensis]
Length=467

 Score =   125 bits (313),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 50/78 (64%), Positives = 66/78 (85%), Gaps = 0/78 (0%)
 Frame = +3

Query  360  RDFSSSVISGLAQGSGEYFTRLGVGTPPKYAFMVLDTGSDVVWLQCSPCRKCYAQTDPVF  539
             DF S V+SGL +GSGEYF R+G+G+PPK  FMV+D+GSD+VW+QC PC +CYAQ+DPVF
Sbjct  105  EDFGSDVVSGLDEGSGEYFVRIGLGSPPKEQFMVIDSGSDIVWVQCQPCTQCYAQSDPVF  164

Query  540  DPSKSSSFVGVKCDSPLC  593
            DP+ S+SF G+ C+SP+C
Sbjct  165  DPADSASFAGISCNSPIC  182



>ref|XP_007209939.1| hypothetical protein PRUPE_ppa004726mg [Prunus persica]
 gb|EMJ11138.1| hypothetical protein PRUPE_ppa004726mg [Prunus persica]
Length=494

 Score =   125 bits (313),  Expect = 5e-30, Method: Compositional matrix adjust.
 Identities = 56/94 (60%), Positives = 67/94 (71%), Gaps = 0/94 (0%)
 Frame = +3

Query  336  PPHNATRGRDFSSSVISGLAQGSGEYFTRLGVGTPPKYAFMVLDTGSDVVWLQCSPCRKC  515
            P H   R  D S+ V+SG++QGSGEYFTR+GVGTP K  +MVLDTGSD+ WLQC PC  C
Sbjct  133  PMHTEIRPEDLSTPVVSGVSQGSGEYFTRIGVGTPAKSLYMVLDTGSDINWLQCEPCSDC  192

Query  516  YAQTDPVFDPSKSSSFVGVKCDSPLCRRLDSSGC  617
            Y QTDPVF+P+ SS++  V CDS  C  L  S C
Sbjct  193  YQQTDPVFNPTGSSTYRPVTCDSAQCHSLHVSAC  226



>ref|XP_009145889.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 1 [Brassica 
rapa]
Length=492

 Score =   125 bits (313),  Expect = 5e-30, Method: Compositional matrix adjust.
 Identities = 66/148 (45%), Positives = 95/148 (64%), Gaps = 5/148 (3%)
 Frame = +3

Query  186  DSENTLSLDLHHIDLISSAAVNATPKALFVKRLQRDaarakalsllaaaaPPHNATRGR-  362
            +S + LSL+LH  D +  A+ +   K+L + RL+RD++R  ++      A     +  R 
Sbjct  75   NSSSPLSLELHSRDTLV-ASQHKDYKSLVLSRLERDSSRVASIIAKVNLAVEGADSETRY  133

Query  363  ---DFSSSVISGLAQGSGEYFTRLGVGTPPKYAFMVLDTGSDVVWLQCSPCRKCYAQTDP  533
               + ++ VISG +QGSGEYF+RLGVGTP K  +MVLDTGSD+ W+QC PC  CY Q+DP
Sbjct  134  NPEELTTPVISGASQGSGEYFSRLGVGTPAKEMYMVLDTGSDINWIQCKPCSSCYQQSDP  193

Query  534  VFDPSKSSSFVGVKCDSPLCRRLDSSGC  617
            +FDPS SS++  + C +P C  L +S C
Sbjct  194  IFDPSSSSTYKSLTCSAPQCASLRASAC  221



>ref|XP_008244017.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 1 [Prunus 
mume]
Length=494

 Score =   125 bits (313),  Expect = 5e-30, Method: Compositional matrix adjust.
 Identities = 56/94 (60%), Positives = 67/94 (71%), Gaps = 0/94 (0%)
 Frame = +3

Query  336  PPHNATRGRDFSSSVISGLAQGSGEYFTRLGVGTPPKYAFMVLDTGSDVVWLQCSPCRKC  515
            P H   R  D S+ V+SG++QGSGEYFTR+GVGTP K  +MVLDTGSD+ WLQC PC  C
Sbjct  133  PMHTEIRPEDLSTPVVSGVSQGSGEYFTRIGVGTPAKSLYMVLDTGSDINWLQCEPCSDC  192

Query  516  YAQTDPVFDPSKSSSFVGVKCDSPLCRRLDSSGC  617
            Y QTDPVF+P+ SS++  V CDS  C  L  S C
Sbjct  193  YQQTDPVFNPTGSSTYHPVTCDSAQCHSLHVSAC  226



>emb|CDX92240.1| BnaA05g21670D [Brassica napus]
Length=491

 Score =   125 bits (313),  Expect = 6e-30, Method: Compositional matrix adjust.
 Identities = 67/148 (45%), Positives = 95/148 (64%), Gaps = 5/148 (3%)
 Frame = +3

Query  186  DSENTLSLDLHHIDLISSAAVNATPKALFVKRLQRDaarakalsllaaaaPPHNATRGR-  362
            +S + LSL+LH  D +  A+ +   K+L + RL+RD++R  A+      A     +  R 
Sbjct  75   NSSSPLSLELHSRDTLV-ASQHKDYKSLVLSRLERDSSRVAAIIAKVNLAVEGADSETRY  133

Query  363  ---DFSSSVISGLAQGSGEYFTRLGVGTPPKYAFMVLDTGSDVVWLQCSPCRKCYAQTDP  533
               + ++ VISG +QGSGEYF+RLGVGTP K  +MVLDTGSD+ W+QC PC  CY Q+DP
Sbjct  134  QPEELTTPVISGASQGSGEYFSRLGVGTPAKEMYMVLDTGSDINWIQCKPCSSCYQQSDP  193

Query  534  VFDPSKSSSFVGVKCDSPLCRRLDSSGC  617
            +FDPS SS++  + C +P C  L +S C
Sbjct  194  IFDPSSSSTYKSLTCSAPQCASLRASAC  221



>dbj|BAK07248.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=500

 Score =   125 bits (313),  Expect = 6e-30, Method: Compositional matrix adjust.
 Identities = 84/185 (45%), Positives = 110/185 (59%), Gaps = 21/185 (11%)
 Frame = +3

Query  111  RPLPTAQHYSLSSKPQYSQTLVQPDD-SENTLSLDLHHIDLI-SSAAVNATPKALFVKRL  284
            RPL    H SL+S    +  LV+ +  S   L+L LH  D +      + +  +L + RL
Sbjct  52   RPL---LHQSLASTD--TDALVKEEQRSGGKLALRLHSRDFLPEEQGRHESYSSLVLARL  106

Query  285  QRDaarakalsllaaaaP---------PHNAT-----RGRDFSSSVISGLAQGSGEYFTR  422
            +RD+ARA ALS  A+ A          P NAT        +    V+SG+ QGSGEYF+R
Sbjct  107  RRDSARAAALSARASLAADGISRADLRPANATPVFEASAAEIQGPVVSGVGQGSGEYFSR  166

Query  423  LGVGTPPKYAFMVLDTGSDVVWLQCSPCRKCYAQTDPVFDPSKSSSFVGVKCDSPLCRRL  602
            +GVG P +  +MVLDTGSDV WLQC PC  CYAQ+DPV+DPS S+S+  V CDSP CR L
Sbjct  167  VGVGRPARQLYMVLDTGSDVTWLQCQPCADCYAQSDPVYDPSVSTSYATVGCDSPRCRDL  226

Query  603  DSSGC  617
            D++ C
Sbjct  227  DAAAC  231



>ref|XP_008802841.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 2 [Phoenix 
dactylifera]
Length=470

 Score =   124 bits (312),  Expect = 6e-30, Method: Compositional matrix adjust.
 Identities = 51/77 (66%), Positives = 65/77 (84%), Gaps = 0/77 (0%)
 Frame = +3

Query  363  DFSSSVISGLAQGSGEYFTRLGVGTPPKYAFMVLDTGSDVVWLQCSPCRKCYAQTDPVFD  542
            DF S V+SGL +GSGEYF R+GVG+PPK  FMV+D+GSD+VW+QC PC +CYAQ+DPVFD
Sbjct  110  DFGSDVVSGLDEGSGEYFVRIGVGSPPKEQFMVIDSGSDIVWVQCRPCTQCYAQSDPVFD  169

Query  543  PSKSSSFVGVKCDSPLC  593
            P+ S+SF G+ C SP+C
Sbjct  170  PADSTSFAGISCKSPIC  186



>ref|XP_004137465.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 1-like [Cucumis 
sativus]
 gb|KGN64110.1| hypothetical protein Csa_1G042220 [Cucumis sativus]
Length=491

 Score =   124 bits (312),  Expect = 8e-30, Method: Compositional matrix adjust.
 Identities = 70/161 (43%), Positives = 95/161 (59%), Gaps = 11/161 (7%)
 Frame = +3

Query  165  QTLVQPDDSENTLSLDLHHIDLISSAAVNATPKALFVKRLQRDaaraka----------l  314
            Q  + P +S  + SL LH  D + +A  +   K+L + RL RD++R K+           
Sbjct  64   QVHLVPSNSSFSFSLQLHPRDSLHNAG-HKDYKSLVLSRLSRDSSRVKSIYDRLEFALSE  122

Query  315  sllaaaaPPHNATRGRDFSSSVISGLAQGSGEYFTRLGVGTPPKYAFMVLDTGSDVVWLQ  494
               +   P        D S+ +ISG +QGSGEYF+R+GVG P K  +MVLDTGSD+ WLQ
Sbjct  123  LKRSDLEPLKTEILPEDLSTPIISGTSQGSGEYFSRVGVGQPAKPFYMVLDTGSDINWLQ  182

Query  495  CSPCRKCYAQTDPVFDPSKSSSFVGVKCDSPLCRRLDSSGC  617
            C PC  CY QTDP+FDP  SSSF  + C+S  C+ L++SGC
Sbjct  183  CQPCTDCYQQTDPIFDPRSSSSFASLPCESQQCQALETSGC  223



>ref|XP_004157423.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 1-like [Cucumis 
sativus]
Length=491

 Score =   124 bits (312),  Expect = 8e-30, Method: Compositional matrix adjust.
 Identities = 70/161 (43%), Positives = 95/161 (59%), Gaps = 11/161 (7%)
 Frame = +3

Query  165  QTLVQPDDSENTLSLDLHHIDLISSAAVNATPKALFVKRLQRDaaraka----------l  314
            Q  + P +S  + SL LH  D + +A  +   K+L + RL RD++R K+           
Sbjct  64   QVHLVPSNSSFSFSLQLHPRDSLHNAG-HKDYKSLVLSRLSRDSSRVKSIYDRLEFALSE  122

Query  315  sllaaaaPPHNATRGRDFSSSVISGLAQGSGEYFTRLGVGTPPKYAFMVLDTGSDVVWLQ  494
               +   P        D S+ +ISG +QGSGEYF+R+GVG P K  +MVLDTGSD+ WLQ
Sbjct  123  LKRSDLEPLKTEILPEDLSTPIISGTSQGSGEYFSRVGVGQPAKPFYMVLDTGSDINWLQ  182

Query  495  CSPCRKCYAQTDPVFDPSKSSSFVGVKCDSPLCRRLDSSGC  617
            C PC  CY QTDP+FDP  SSSF  + C+S  C+ L++SGC
Sbjct  183  CQPCTDCYQQTDPIFDPRSSSSFASLPCESQQCQALETSGC  223



>ref|XP_006485768.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 1-like [Citrus 
sinensis]
Length=495

 Score =   124 bits (311),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 69/156 (44%), Positives = 94/156 (60%), Gaps = 11/156 (7%)
 Frame = +3

Query  180  PDDSENTLSLDLHHIDLISSAAVNATPKALFVKRLQRDaarakalsllaaaa--------  335
            P +S ++ SL LH  +++     N   ++L + RL+RD+AR   L      A        
Sbjct  73   PLNSSSSFSLPLHSREILHKTRHNDY-RSLVLSRLERDSARVNTLITKLQLAIYNVDRHE  131

Query  336  --PPHNATRGRDFSSSVISGLAQGSGEYFTRLGVGTPPKYAFMVLDTGSDVVWLQCSPCR  509
              P        DFS+ V+SG +QGSGEYF+R+GVGTPP+   MVLDTGSD+ WLQC PC 
Sbjct  132  LKPAEAQILPEDFSTPVVSGASQGSGEYFSRIGVGTPPRQFSMVLDTGSDINWLQCRPCT  191

Query  510  KCYAQTDPVFDPSKSSSFVGVKCDSPLCRRLDSSGC  617
            +CY Q+DP+FDP  SSS+  + C +P C+ LD S C
Sbjct  192  ECYQQSDPIFDPKTSSSYSPLPCAAPQCKSLDVSAC  227



>ref|XP_006440937.1| hypothetical protein CICLE_v10019848mg [Citrus clementina]
 gb|ESR54177.1| hypothetical protein CICLE_v10019848mg [Citrus clementina]
Length=495

 Score =   124 bits (311),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 69/156 (44%), Positives = 94/156 (60%), Gaps = 11/156 (7%)
 Frame = +3

Query  180  PDDSENTLSLDLHHIDLISSAAVNATPKALFVKRLQRDaarakalsllaaaa--------  335
            P +S ++ SL LH  +++     N   ++L + RL+RD+AR   L      A        
Sbjct  73   PLNSSSSFSLPLHSREILHKTRHNDY-RSLVLSRLERDSARVNTLITKLQLAIYNVDRHE  131

Query  336  --PPHNATRGRDFSSSVISGLAQGSGEYFTRLGVGTPPKYAFMVLDTGSDVVWLQCSPCR  509
              P        DFS+ V+SG +QGSGEYF+R+GVGTPP+   MVLDTGSD+ WLQC PC 
Sbjct  132  LKPAEAQILPEDFSTPVVSGASQGSGEYFSRIGVGTPPRQFSMVLDTGSDINWLQCRPCT  191

Query  510  KCYAQTDPVFDPSKSSSFVGVKCDSPLCRRLDSSGC  617
            +CY Q+DP+FDP  SSS+  + C +P C+ LD S C
Sbjct  192  ECYQQSDPIFDPKTSSSYSPLPCAAPQCKSLDVSAC  227



>ref|XP_007152794.1| hypothetical protein PHAVU_004G160200g [Phaseolus vulgaris]
 gb|ESW24788.1| hypothetical protein PHAVU_004G160200g [Phaseolus vulgaris]
Length=486

 Score =   124 bits (311),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 80/175 (46%), Positives = 99/175 (57%), Gaps = 17/175 (10%)
 Frame = +3

Query  141  LSSKPQ--YSQTLVQPDD----SENTLSLDLHHIDLISSAAVNATPKALFVKRLQRDaar  302
            LS KPQ  + QTL Q       S +  SL LH  + + +A  +   K L + RL RD+AR
Sbjct  45   LSFKPQQAFQQTLTQKQTPTSRSSSFFSLQLHTRETLFNAQ-HPDYKTLVLSRLARDSAR  103

Query  303  akalsllaaaa----------PPHNATRGRDFSSSVISGLAQGSGEYFTRLGVGTPPKYA  452
              +L      A          P     R  D S+ V SG +QGSGEYF+R+GVG P K  
Sbjct  104  VNSLETKLQLALNSVKRSELYPTQTEIRPEDLSTPVSSGTSQGSGEYFSRVGVGQPAKPF  163

Query  453  FMVLDTGSDVVWLQCSPCRKCYAQTDPVFDPSKSSSFVGVKCDSPLCRRLDSSGC  617
            FMVLDTGSDV WLQC PC  CY QTDPVFDP+ SSS+  + CD+  C+ L+ S C
Sbjct  164  FMVLDTGSDVNWLQCKPCSDCYQQTDPVFDPTSSSSYYPLTCDAQQCQDLEMSAC  218



>gb|KDO64536.1| hypothetical protein CISIN_1g011045mg [Citrus sinensis]
Length=495

 Score =   124 bits (311),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 69/156 (44%), Positives = 94/156 (60%), Gaps = 11/156 (7%)
 Frame = +3

Query  180  PDDSENTLSLDLHHIDLISSAAVNATPKALFVKRLQRDaarakalsllaaaa--------  335
            P +S ++ SL LH  +++     N   ++L + RL+RD+AR   L      A        
Sbjct  73   PLNSSSSFSLPLHSREILHKTRHNDY-RSLVLSRLERDSARVNTLITKLQLAIYNVDRHE  131

Query  336  --PPHNATRGRDFSSSVISGLAQGSGEYFTRLGVGTPPKYAFMVLDTGSDVVWLQCSPCR  509
              P        DFS+ V+SG +QGSGEYF+R+GVGTPP+   MVLDTGSD+ WLQC PC 
Sbjct  132  LKPAEAQILPEDFSTPVVSGASQGSGEYFSRIGVGTPPRQFSMVLDTGSDINWLQCRPCT  191

Query  510  KCYAQTDPVFDPSKSSSFVGVKCDSPLCRRLDSSGC  617
            +CY Q+DP+FDP  SSS+  + C +P C+ LD S C
Sbjct  192  ECYQQSDPIFDPKTSSSYSPLPCAAPQCKSLDVSAC  227



>ref|XP_007153018.1| hypothetical protein PHAVU_003G000900g [Phaseolus vulgaris]
 gb|ESW25012.1| hypothetical protein PHAVU_003G000900g [Phaseolus vulgaris]
Length=464

 Score =   124 bits (311),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 65/151 (43%), Positives = 96/151 (64%), Gaps = 7/151 (5%)
 Frame = +3

Query  177  QPDDSE---NTLSLDLHHIDLISSAA-VNATPKALFVKRLQRDaarakalsllaaaaPPH  344
            +P+D E       + L H D IS A  +N + +  F +R++RDA R  ++    + A   
Sbjct  46   EPEDLEEKQGNWKVQLLHRDKISKAPPMNHSTR--FNQRMKRDAKRVSSIVNKNSDARTE  103

Query  345  NATRGRDFSSSVISGLAQGSGEYFTRLGVGTPPKYAFMVLDTGSDVVWLQCSPCRKCYAQ  524
             A     F S V+SG+ +GSGEYF R+G+G+P  Y +MV+D+GSD+VW+QC PC  CY Q
Sbjct  104  AAEEA-SFGSDVVSGMEEGSGEYFVRIGIGSPATYQYMVIDSGSDIVWVQCQPCDLCYNQ  162

Query  525  TDPVFDPSKSSSFVGVKCDSPLCRRLDSSGC  617
            +DP+F+P+ S+SF GV C S +C +LD +GC
Sbjct  163  SDPIFNPALSASFAGVPCSSSVCDQLDDAGC  193



>ref|XP_006653026.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 2-like [Oryza 
brachyantha]
Length=477

 Score =   124 bits (311),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 52/86 (60%), Positives = 67/86 (78%), Gaps = 0/86 (0%)
 Frame = +3

Query  360  RDFSSSVISGLAQGSGEYFTRLGVGTPPKYAFMVLDTGSDVVWLQCSPCRKCYAQTDPVF  539
             D  S V+SGL +GSGEYF R+GVG+PP   ++V+D+GSDV+W+QC PC +CYAQTDP+F
Sbjct  117  EDLGSDVVSGLGEGSGEYFVRVGVGSPPTDQYLVVDSGSDVIWVQCRPCDQCYAQTDPLF  176

Query  540  DPSKSSSFVGVKCDSPLCRRLDSSGC  617
            DP+ SSSF GV C S +CR L  +GC
Sbjct  177  DPATSSSFSGVACGSAICRMLPRTGC  202



>ref|XP_003565317.2| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 1 [Brachypodium 
distachyon]
Length=529

 Score =   124 bits (311),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 52/80 (65%), Positives = 66/80 (83%), Gaps = 0/80 (0%)
 Frame = +3

Query  378  VISGLAQGSGEYFTRLGVGTPPKYAFMVLDTGSDVVWLQCSPCRKCYAQTDPVFDPSKSS  557
            V+SG+ QGSGEYF+R+G+G+P +  +MVLDTGSDV WLQC+PC  CYAQ+DP+FDP+ SS
Sbjct  174  VVSGVGQGSGEYFSRIGIGSPARQLYMVLDTGSDVTWLQCAPCADCYAQSDPLFDPALSS  233

Query  558  SFVGVKCDSPLCRRLDSSGC  617
            S+  V CDSP CR LD+S C
Sbjct  234  SYATVPCDSPHCRALDASAC  253



>emb|CDY24483.1| BnaC05g34710D [Brassica napus]
Length=491

 Score =   124 bits (311),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 67/153 (44%), Positives = 94/153 (61%), Gaps = 15/153 (10%)
 Frame = +3

Query  186  DSENTLSLDLHHIDLISSAAVNATPKALFVKRLQRDaarakalsllaaaaPPHNATRGRD  365
            +S + LSL+LH  D +  A+ +   K+L + RL+RD++R  ++           A  G D
Sbjct  75   NSSSPLSLELHSRDTLV-ASQHKNYKSLVLSRLERDSSRVASIIAKVKL-----AVEGAD  128

Query  366  ---------FSSSVISGLAQGSGEYFTRLGVGTPPKYAFMVLDTGSDVVWLQCSPCRKCY  518
                      ++ VISG +QGSGEYF+RLGVGTP K  +MVLDTGSD+ W+QC PC  CY
Sbjct  129  SETHYQPEELTTPVISGASQGSGEYFSRLGVGTPAKEMYMVLDTGSDINWIQCKPCSSCY  188

Query  519  AQTDPVFDPSKSSSFVGVKCDSPLCRRLDSSGC  617
             Q+DP+FDPS SS++  + C +P C  L +S C
Sbjct  189  QQSDPIFDPSSSSTYKSLTCSAPQCASLRASAC  221



>ref|XP_008457107.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 1-like [Cucumis 
melo]
Length=489

 Score =   124 bits (311),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 69/161 (43%), Positives = 95/161 (59%), Gaps = 11/161 (7%)
 Frame = +3

Query  165  QTLVQPDDSENTLSLDLHHIDLISSAAVNATPKALFVKRLQRDaaraka----------l  314
            Q  + P +S  + SL LH  D + +A  +   K+L + RL RD++R K+           
Sbjct  62   QVRLVPSNSSFSFSLQLHPRDSLHNAG-HKDYKSLVLSRLSRDSSRVKSIYDRLEFALSE  120

Query  315  sllaaaaPPHNATRGRDFSSSVISGLAQGSGEYFTRLGVGTPPKYAFMVLDTGSDVVWLQ  494
               +   P        D S+ ++SG +QGSGEYF+R+GVG P K  +MVLDTGSD+ WLQ
Sbjct  121  LKRSDLEPLKTEILPEDLSTPIVSGTSQGSGEYFSRVGVGQPAKPFYMVLDTGSDINWLQ  180

Query  495  CSPCRKCYAQTDPVFDPSKSSSFVGVKCDSPLCRRLDSSGC  617
            C PC  CY QTDP+FDP  SSSF  + C+S  C+ L++SGC
Sbjct  181  CQPCTDCYQQTDPIFDPRSSSSFASLPCESQQCQALETSGC  221



>ref|XP_009770623.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 2-like [Nicotiana 
sylvestris]
Length=512

 Score =   124 bits (311),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 52/86 (60%), Positives = 68/86 (79%), Gaps = 0/86 (0%)
 Frame = +3

Query  360  RDFSSSVISGLAQGSGEYFTRLGVGTPPKYAFMVLDTGSDVVWLQCSPCRKCYAQTDPVF  539
             +F S VISG+ QGSGEYF R+GVG+P +  +MV+D GSD+VW+QC PC +CY Q+DPVF
Sbjct  156  EEFGSEVISGMEQGSGEYFVRIGVGSPVREQYMVIDAGSDIVWVQCQPCTQCYHQSDPVF  215

Query  540  DPSKSSSFVGVKCDSPLCRRLDSSGC  617
            DPS S+SF GV C S LC ++++SGC
Sbjct  216  DPSLSASFSGVPCTSSLCEQVENSGC  241



>ref|XP_004498097.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 2-like isoform 
X1 [Cicer arietinum]
Length=478

 Score =   124 bits (310),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 63/168 (38%), Positives = 92/168 (55%), Gaps = 19/168 (11%)
 Frame = +3

Query  120  PTAQHYSLSS---KPQYSQTLVQPDDSENTLSLDLHHIDLISSAAVNATPKALFVKRLQR  290
            P+ QH  L     +PQ+   L   D          H I+ I++A      K  F+ R++R
Sbjct  48   PSKQHSQLEKEQQQPQWKTKLFHRD----------HIINHINTAT---NHKTRFISRIKR  94

Query  291  Daarak---alsllaaaaPPHNATRGRDFSSSVISGLAQGSGEYFTRLGVGTPPKYAFMV  461
            D  R                   T    F S ++SG  +GSGEYF R+G+G+P  Y +MV
Sbjct  95   DIKRVSFLHNRLNKHTQVTEQETTADTSFGSDIVSGSEEGSGEYFVRIGIGSPAIYQYMV  154

Query  462  LDTGSDVVWLQCSPCRKCYAQTDPVFDPSKSSSFVGVKCDSPLCRRLD  605
            +D+GSD+VW+QC PC +CY Q+DP+F+P+ S+SF+GV C S +C +LD
Sbjct  155  IDSGSDIVWIQCQPCHQCYNQSDPIFNPATSASFIGVSCSSSVCDQLD  202



>emb|CDM80984.1| unnamed protein product [Triticum aestivum]
Length=503

 Score =   124 bits (310),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 74/162 (46%), Positives = 97/162 (60%), Gaps = 15/162 (9%)
 Frame = +3

Query  177  QPDDSENTLSLDLHHIDLI-SSAAVNATPKALFVKRLQRDaarakalsllaaaaP-----  338
             P      L+L LH  D +      + + ++L + RL+RD+ARA ALS  A+ A      
Sbjct  73   HPSGPSGRLALRLHSRDFLPEEQGRHESYRSLVLARLRRDSARAAALSARASLAADGVSR  132

Query  339  ----PHNAT-----RGRDFSSSVISGLAQGSGEYFTRLGVGTPPKYAFMVLDTGSDVVWL  491
                P NAT        +    V+SG+ QGSGEYF+R+GVG P +  +MVLDTGSDV WL
Sbjct  133  ADLRPANATPVFEASAAEIQGPVVSGVGQGSGEYFSRVGVGRPARQLYMVLDTGSDVTWL  192

Query  492  QCSPCRKCYAQTDPVFDPSKSSSFVGVKCDSPLCRRLDSSGC  617
            QC PC  CY Q+DPV+DPS S+S+  V CDSP CR LD++ C
Sbjct  193  QCQPCADCYTQSDPVYDPSVSASYAAVGCDSPRCRDLDAAAC  234



>ref|XP_004498098.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 2-like isoform 
X2 [Cicer arietinum]
Length=465

 Score =   124 bits (310),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 63/168 (38%), Positives = 92/168 (55%), Gaps = 19/168 (11%)
 Frame = +3

Query  120  PTAQHYSLSS---KPQYSQTLVQPDDSENTLSLDLHHIDLISSAAVNATPKALFVKRLQR  290
            P+ QH  L     +PQ+   L   D          H I+ I++A      K  F+ R++R
Sbjct  48   PSKQHSQLEKEQQQPQWKTKLFHRD----------HIINHINTAT---NHKTRFISRIKR  94

Query  291  Daarak---alsllaaaaPPHNATRGRDFSSSVISGLAQGSGEYFTRLGVGTPPKYAFMV  461
            D  R                   T    F S ++SG  +GSGEYF R+G+G+P  Y +MV
Sbjct  95   DIKRVSFLHNRLNKHTQVTEQETTADTSFGSDIVSGSEEGSGEYFVRIGIGSPAIYQYMV  154

Query  462  LDTGSDVVWLQCSPCRKCYAQTDPVFDPSKSSSFVGVKCDSPLCRRLD  605
            +D+GSD+VW+QC PC +CY Q+DP+F+P+ S+SF+GV C S +C +LD
Sbjct  155  IDSGSDIVWIQCQPCHQCYNQSDPIFNPATSASFIGVSCSSSVCDQLD  202



>ref|XP_004297710.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 2 [Fragaria 
vesca subsp. vesca]
Length=477

 Score =   123 bits (309),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 71/182 (39%), Positives = 105/182 (58%), Gaps = 10/182 (5%)
 Frame = +3

Query  90   ITETXSLRPLPTAQHYSLSSKPQYSQTLVQPDDSENT----LSLDLHHIDLISSAAVNAT  257
            IT     + L   Q  + +S   Y + L   +DS  +      + + H D I   A  + 
Sbjct  27   ITTYPDFQQLHVKQTIAAASTKLYKEEL--KEDSSGSGGGRWRVKVVHRDKIFPQA--SH  82

Query  258  PKALFVKRLQRDaarakalsllaaaaPPHNATRGR-DFSSSVISGLAQGSGEYFTRLGVG  434
             K++F  R+ RD  R  +L               + DF S V+SG+AQGSGEYF R+GVG
Sbjct  83   NKSIFHARIHRDVKRVDSLMRRLGGNSNDQVMNKKLDFGSEVVSGMAQGSGEYFVRIGVG  142

Query  435  TPPKYAFMVLDTGSDVVWLQCSPCRKCYAQTDPVFDPSKSSSFVGVKCDSPLCRRL-DSS  611
            +P +  ++V+D+GSD+VW+QC PC +CY Q+DP+FDPS+S+S+ GV C S +C RL +S+
Sbjct  143  SPARSQYVVIDSGSDIVWVQCQPCSQCYHQSDPIFDPSRSASYSGVSCTSTVCDRLQNSA  202

Query  612  GC  617
            GC
Sbjct  203  GC  204



>ref|XP_009112699.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 1 [Brassica 
rapa]
 emb|CDY18523.1| BnaA01g26720D [Brassica napus]
Length=499

 Score =   123 bits (309),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 67/157 (43%), Positives = 98/157 (62%), Gaps = 14/157 (9%)
 Frame = +3

Query  186  DSENTLSLDLHHIDLISSAAVNATPKALFVKRLQRDaarakalsll----------aaaa  335
            +S + LSL+LH  D +  A+ +   K+L + RL+RD++R   ++            +   
Sbjct  74   NSSSPLSLELHSRDTLV-ASQHKDYKSLVLSRLERDSSRVAGITAKIRFAVEGIDRSDLK  132

Query  336  PPHN---ATRGRDFSSSVISGLAQGSGEYFTRLGVGTPPKYAFMVLDTGSDVVWLQCSPC  506
            P +N   + +  D ++ V+SG +QGSGEYF+R+GVGTP K  FMVLDTGSD+ W+QC PC
Sbjct  133  PVYNDETSYQPEDLTTPVVSGASQGSGEYFSRIGVGTPAKEMFMVLDTGSDINWIQCQPC  192

Query  507  RKCYAQTDPVFDPSKSSSFVGVKCDSPLCRRLDSSGC  617
              CY Q+DPVFDP+ SS+F  + C +P C  L+ S C
Sbjct  193  SDCYQQSDPVFDPASSSTFKSLSCSAPQCGSLEVSAC  229



>ref|XP_008799310.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 1-like [Phoenix 
dactylifera]
Length=507

 Score =   123 bits (309),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 73/159 (46%), Positives = 94/159 (59%), Gaps = 24/159 (15%)
 Frame = +3

Query  201  LSLDLHHIDLISSAAVNATP-----KALFVKRLQRDaarakalsllaaaaPPHNATRG--  359
            L+L+LH  D + +   NA P     KAL + RL+RD+ R K+++   A A  H   R   
Sbjct  76   LTLELHSRDFLPT---NAQPRPTDYKALTLDRLRRDSTRVKSIAARLALAA-HGVKRSDL  131

Query  360  -------------RDFSSSVISGLAQGSGEYFTRLGVGTPPKYAFMVLDTGSDVVWLQCS  500
                               ++SG +QGSGEYF+R+G+G+PPK  +MVLDTGSDV W QC 
Sbjct  132  KPVTEEEEFEASAEAIRGPIVSGTSQGSGEYFSRVGIGSPPKPLYMVLDTGSDVTWAQCQ  191

Query  501  PCRKCYAQTDPVFDPSKSSSFVGVKCDSPLCRRLDSSGC  617
            PC  CY Q+DPVFDPS SSS+  + CDSP CR LD S C
Sbjct  192  PCADCYQQSDPVFDPSASSSYTPLPCDSPRCRALDVSAC  230



>ref|XP_010916474.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 1-like [Elaeis 
guineensis]
Length=512

 Score =   123 bits (309),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 73/157 (46%), Positives = 102/157 (65%), Gaps = 20/157 (13%)
 Frame = +3

Query  201  LSLDLHHIDLISSAAVNATP---KALFVKRLQRDaarakalsllaaaaPPHNATRG----  359
            L+L+LH  D + ++A +  P   K L + RL+RD+AR K+++   A A  H+  R     
Sbjct  82   LTLELHSRDFLPTSA-HPRPNDYKTLTLDRLRRDSARVKSIAAQLALAA-HSVKRTDLKP  139

Query  360  ----RDFSSS-------VISGLAQGSGEYFTRLGVGTPPKYAFMVLDTGSDVVWLQCSPC  506
                ++F++S       ++SG +QGSGEYF+R+G+G PPK  +MVLDTGSDV W+QC PC
Sbjct  140  VAEEKEFAASAESIRGPIVSGTSQGSGEYFSRVGIGNPPKPLYMVLDTGSDVTWVQCQPC  199

Query  507  RKCYAQTDPVFDPSKSSSFVGVKCDSPLCRRLDSSGC  617
              CY Q+DP+FDPS SSS+  + CDSP CR LD S C
Sbjct  200  ADCYEQSDPIFDPSASSSYSPLPCDSPRCRALDISAC  236



>gb|ABR16474.1| unknown [Picea sitchensis]
Length=538

 Score =   123 bits (309),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 52/85 (61%), Positives = 67/85 (79%), Gaps = 0/85 (0%)
 Frame = +3

Query  363  DFSSSVISGLAQGSGEYFTRLGVGTPPKYAFMVLDTGSDVVWLQCSPCRKCYAQTDPVFD  542
            +F   V+SG+AQGSGEYFTR+GVGTP +  +MVLDTGSDVVW+QC PC KCY+Q DP+F+
Sbjct  181  EFGGEVVSGMAQGSGEYFTRIGVGTPMREQYMVLDTGSDVVWIQCEPCSKCYSQVDPIFN  240

Query  543  PSKSSSFVGVKCDSPLCRRLDSSGC  617
            PS S+SF  + C+S +C  LD+  C
Sbjct  241  PSLSASFSTLGCNSAVCSYLDAYNC  265



>ref|XP_003637421.1| Aspartic proteinase nepenthesin-1, partial [Medicago truncatula]
Length=280

 Score =   120 bits (302),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 67/144 (47%), Positives = 92/144 (64%), Gaps = 10/144 (7%)
 Frame = +3

Query  189  SENTLSLDLHHIDLISSAAVNATPKALFVKRLQRDaarakalsllaaaaPPHNATRGRD-  365
            S +TLSL LH    +SS   +A  K+L + RL RD+AR K ++         N     D 
Sbjct  66   STSTLSLQLHSRASLSS---HADYKSLTLSRLDRDSARVKYITTKL------NQNFNTDK  116

Query  366  FSSSVISGLAQGSGEYFTRLGVGTPPKYAFMVLDTGSDVVWLQCSPCRKCYAQTDPVFDP  545
             S  +ISG +QGSGEYF+R+G+G PP  A+MVLDTGSD+ W+QC+PC  CY Q DP+F+P
Sbjct  117  LSGPIISGTSQGSGEYFSRIGIGEPPSQAYMVLDTGSDISWVQCAPCADCYRQADPIFEP  176

Query  546  SKSSSFVGVKCDSPLCRRLDSSGC  617
            + S+S+  + C++  CR LD S C
Sbjct  177  TASASYAPLSCEAAQCRYLDQSQC  200



>emb|CDM83204.1| unnamed protein product [Triticum aestivum]
Length=492

 Score =   123 bits (308),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 54/76 (71%), Positives = 62/76 (82%), Gaps = 0/76 (0%)
 Frame = +3

Query  390  LAQGSGEYFTRLGVGTPPKYAFMVLDTGSDVVWLQCSPCRKCYAQTDPVFDPSKSSSFVG  569
            LAQGSGEYFT++GVGTP   A MVLDTGSDVVWLQC+PCR+CY Q+  VFDP +S S+  
Sbjct  133  LAQGSGEYFTKIGVGTPATPALMVLDTGSDVVWLQCAPCRRCYEQSGQVFDPRRSRSYGA  192

Query  570  VKCDSPLCRRLDSSGC  617
            V C +PLCRRLDS GC
Sbjct  193  VGCAAPLCRRLDSGGC  208



>emb|CDY69364.1| BnaCnng63170D [Brassica napus]
Length=501

 Score =   122 bits (307),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 67/157 (43%), Positives = 97/157 (62%), Gaps = 14/157 (9%)
 Frame = +3

Query  186  DSENTLSLDLHHIDLISSAAVNATPKALFVKRLQRDaarakalsll----------aaaa  335
            +S + LSL+LH  D +  A+ +   K+L + RL+RD++R   ++            +   
Sbjct  76   NSSSPLSLELHSRDTLV-ASQHKDYKSLVLSRLERDSSRVAGITTKIRFAVEGIDRSDLK  134

Query  336  PPHNAT---RGRDFSSSVISGLAQGSGEYFTRLGVGTPPKYAFMVLDTGSDVVWLQCSPC  506
            P +N     +  D ++ V+SG +QGSGEYF+R+GVGTP K  FMVLDTGSD+ W+QC PC
Sbjct  135  PVYNDETLYQPEDLTTPVVSGASQGSGEYFSRIGVGTPAKEMFMVLDTGSDINWIQCQPC  194

Query  507  RKCYAQTDPVFDPSKSSSFVGVKCDSPLCRRLDSSGC  617
              CY Q+DPVFDP+ SS+F  + C +P C  L+ S C
Sbjct  195  SDCYQQSDPVFDPASSSTFKSLSCSAPQCGSLEVSAC  231



>gb|KFK39179.1| hypothetical protein AALP_AA3G210500 [Arabis alpina]
Length=499

 Score =   122 bits (307),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 68/157 (43%), Positives = 96/157 (61%), Gaps = 14/157 (9%)
 Frame = +3

Query  186  DSENTLSLDLHHIDLISSAAVNATPKALFVKRLQRDaarakalsll----------aaaa  335
            +S + LSL LH  D +  A+ +   K+L + RL+RD++R   ++            +   
Sbjct  74   NSSSPLSLTLHSRDTLV-ASQHKDYKSLVLSRLERDSSRVAGITAKIRFAVEGIDRSDLK  132

Query  336  PPHN-ATR--GRDFSSSVISGLAQGSGEYFTRLGVGTPPKYAFMVLDTGSDVVWLQCSPC  506
            P +N  TR    D ++ V+SG  QGSGEYF+R+GVGTP K  FMVLDTGSD+ W+QC PC
Sbjct  133  PVYNDETRYQTEDLTTPVVSGAGQGSGEYFSRIGVGTPAKEMFMVLDTGSDINWIQCQPC  192

Query  507  RKCYAQTDPVFDPSKSSSFVGVKCDSPLCRRLDSSGC  617
              CY Q+DP+FDP+ SS+F  + C +P C  L+ S C
Sbjct  193  SDCYQQSDPIFDPTSSSTFKSLTCSAPQCSSLEVSAC  229



>ref|XP_006852628.1| hypothetical protein AMTR_s00021p00234660 [Amborella trichopoda]
 gb|ERN14095.1| hypothetical protein AMTR_s00021p00234660 [Amborella trichopoda]
Length=489

 Score =   122 bits (307),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 86/204 (42%), Positives = 115/204 (56%), Gaps = 41/204 (20%)
 Frame = +3

Query  93   TETXSLRPLPTAQHYSLSSKPQYSQTLVQPDDSENTLS------LDLHHIDLISSAAVNA  254
            ++T  LRPL         SKP      ++ +++E  LS      L LHH D   S ++N 
Sbjct  25   SQTLLLRPL---------SKPPLLDEDLKQEETEGDLSDQTSLFLTLHHRD---SLSLNL  72

Query  255  TPKALFVKRLQRDaarakalsl----------------laaaaPPHNAT-------RGRD  365
            T + LF  RL+RD AR K+L+                   AA P  +A        RG+ 
Sbjct  73   TAEELFKLRLERDDARVKSLTNWVNLAAALGSSHRGHHHGAANPAAHANGSVQTRGRGQA  132

Query  366  FSSSVISGLAQGSGEYFTRLGVGTPPKYAFMVLDTGSDVVWLQCSPCRKCYAQTDPVFDP  545
            F++ V+SGL QGSGEYF R+ VGTPP+  +MVLDTGSD+ WLQC+PCR CY Q  P+F+P
Sbjct  133  FTAPVVSGLPQGSGEYFARVKVGTPPQPMYMVLDTGSDLAWLQCTPCRHCYRQVGPIFNP  192

Query  546  SKSSSFVGVKCDSPLCRRLDSSGC  617
            S SSS+  + C +PLCRRL+   C
Sbjct  193  SSSSSYSTLPCAAPLCRRLEIRAC  216



>ref|XP_009337317.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 1-like [Pyrus 
x bretschneideri]
Length=487

 Score =   122 bits (306),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 73/169 (43%), Positives = 101/169 (60%), Gaps = 16/169 (9%)
 Frame = +3

Query  141  LSSKPQYSQTLVQPDDSENTLSLDLHHIDLISSAAVNATPKALFVKRLQRDaarakalsl  320
            L S+ Q SQ L     + +  SL LH  D + ++  +   K+L + RL RD+AR  +L  
Sbjct  57   LESQSQESQPL-----NSSAFSLQLHPRDALFNSQ-HKDYKSLTLTRLGRDSARVNSLHT  110

Query  321  laaaa----------PPHNATRGRDFSSSVISGLAQGSGEYFTRLGVGTPPKYAFMVLDT  470
                A          P H   + +D S+ V+SG++QGSGEYF+R+GVGTP K  +MVLDT
Sbjct  111  KLQLALQGIKRVDLEPMHTEVQSQDLSTPVVSGVSQGSGEYFSRIGVGTPAKSFYMVLDT  170

Query  471  GSDVVWLQCSPCRKCYAQTDPVFDPSKSSSFVGVKCDSPLCRRLDSSGC  617
            GSDV WLQC PC  CY Q+DPVF+P+ SS++  + CD+  C+ L  S C
Sbjct  171  GSDVNWLQCGPCSDCYQQSDPVFNPAGSSTYSQLTCDASQCQALQVSAC  219



>emb|CDY24395.1| BnaCnng04620D [Brassica napus]
Length=482

 Score =   122 bits (306),  Expect = 5e-29, Method: Compositional matrix adjust.
 Identities = 75/186 (40%), Positives = 109/186 (59%), Gaps = 26/186 (14%)
 Frame = +3

Query  105  SLRPLPTAQHYSLSSKPQYSQTLVQPDDSENTLSLDLHHIDLISSAAVNATP----KALF  272
            S+R    A  + L+ + ++SQ    P  S  + SL LH     S A+V  T      +L 
Sbjct  41   SIRKTKDASSFRLNQQEEHSQ---YPTSS--SFSLQLH-----SRASVRGTEHPDYNSLT  90

Query  273  VKRLQRDaarakalsllaaaaPPHNATRG-----------RDFSSSVISGLAQGSGEYFT  419
            + RL RD+AR K+L+        +N TR             +  + +ISG  QGSGEYFT
Sbjct  91   LARLHRDSARVKSLTARLNL-AINNITRADLKHTMYTTEQEEIEAPLISGTTQGSGEYFT  149

Query  420  RLGVGTPPKYAFMVLDTGSDVVWLQCSPCRKCYAQTDPVFDPSKSSSFVGVKCDSPLCRR  599
            R+G+G+P +  +MVLDTGSDV WLQC+PC +CY QT+P+F+P+ SSS+  + CD+P C+ 
Sbjct  150  RVGIGSPAREVYMVLDTGSDVNWLQCAPCAQCYHQTEPIFEPTSSSSYATLSCDAPQCKA  209

Query  600  LDSSGC  617
            L++S C
Sbjct  210  LEASEC  215



>ref|XP_002457394.1| hypothetical protein SORBIDRAFT_03g006630 [Sorghum bicolor]
 gb|EES02514.1| hypothetical protein SORBIDRAFT_03g006630 [Sorghum bicolor]
Length=509

 Score =   122 bits (306),  Expect = 5e-29, Method: Compositional matrix adjust.
 Identities = 75/155 (48%), Positives = 99/155 (64%), Gaps = 16/155 (10%)
 Frame = +3

Query  201  LSLDLHHIDLISSAAV-NATPKALFVKRLQRDaarakalsllaaaaP---------PHN-  347
            L+L LH  D +  A   +AT ++L   RL+RD+ARA ALS  A  A          P N 
Sbjct  83   LTLRLHSRDFLPEAQQRHATYRSLVQSRLRRDSARAAALSARATLAADGVTRQDLRPANE  142

Query  348  -ATRGRDFSSS----VISGLAQGSGEYFTRLGVGTPPKYAFMVLDTGSDVVWLQCSPCRK  512
             A  G   +++    V+SG+ QGSGEYF+R+G+G+P +  +MVLDTGSDV W+QC PC  
Sbjct  143  SAVFGASLAAAIQGPVVSGVGQGSGEYFSRVGIGSPARELYMVLDTGSDVTWVQCQPCAD  202

Query  513  CYAQTDPVFDPSKSSSFVGVKCDSPLCRRLDSSGC  617
            CY Q+DPVFDPS S+S+  V CDSP CR LD++ C
Sbjct  203  CYQQSDPVFDPSLSASYAAVSCDSPRCRDLDTAAC  237



>ref|XP_010103590.1| Aspartic proteinase nepenthesin-2 [Morus notabilis]
 gb|EXB96367.1| Aspartic proteinase nepenthesin-2 [Morus notabilis]
Length=521

 Score =   122 bits (306),  Expect = 5e-29, Method: Compositional matrix adjust.
 Identities = 59/123 (48%), Positives = 84/123 (68%), Gaps = 6/123 (5%)
 Frame = +3

Query  267  LFVKRLQRDaarakalsllaaaaPPHNATRG------RDFSSSVISGLAQGSGEYFTRLG  428
            +F +R++RDA R  +L    A +  ++   G       DF S V+SG+ QGSGEYF R+G
Sbjct  128  IFNERMKRDAHRVASLVRRLANSSNNSRISGSDKYEVEDFGSEVVSGMDQGSGEYFVRIG  187

Query  429  VGTPPKYAFMVLDTGSDVVWLQCSPCRKCYAQTDPVFDPSKSSSFVGVKCDSPLCRRLDS  608
            VG+P +  +MV+D+GSD+VW+QC PC +CY QTDPVFDP+ S+S+  V C S +C RL+ 
Sbjct  188  VGSPARSQYMVIDSGSDIVWVQCQPCSQCYHQTDPVFDPADSASYEFVSCSSAVCDRLED  247

Query  609  SGC  617
            +GC
Sbjct  248  AGC  250



>ref|XP_004960076.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 2-like [Setaria 
italica]
Length=468

 Score =   122 bits (305),  Expect = 5e-29, Method: Compositional matrix adjust.
 Identities = 67/138 (49%), Positives = 92/138 (67%), Gaps = 5/138 (4%)
 Frame = +3

Query  204  SLDLHHIDLISSAAVNATPKALFVKRLQRDaarakalsllaaaaPPHNATRGRDFSSSVI  383
            SL + H D IS A   +   A+ + R+ RD ARA+ L+   +  P +  T   D  S V+
Sbjct  61   SLAMVHRDAISGATYPSRRHAV-LDRVARDNARAEYLARRLS--PTYLPTT--DLGSEVV  115

Query  384  SGLAQGSGEYFTRLGVGTPPKYAFMVLDTGSDVVWLQCSPCRKCYAQTDPVFDPSKSSSF  563
            SGL +GSGEYF R+GVG+PP   ++V+D+GSDV+W+QC PC +CYAQ DP+FDP+ S++F
Sbjct  116  SGLDEGSGEYFVRVGVGSPPTEQYLVVDSGSDVIWVQCKPCSQCYAQADPLFDPASSTTF  175

Query  564  VGVKCDSPLCRRLDSSGC  617
              V C S +CR L SSGC
Sbjct  176  SAVSCGSAICRMLSSSGC  193



>ref|XP_008782298.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 1-like [Phoenix 
dactylifera]
Length=513

 Score =   122 bits (306),  Expect = 5e-29, Method: Compositional matrix adjust.
 Identities = 72/156 (46%), Positives = 94/156 (60%), Gaps = 18/156 (12%)
 Frame = +3

Query  201  LSLDLHHIDLISSAAV--NATPKALFVKRLQRDaarakalsllaaaaPPHNATRG-----  359
            L+L+LH  D + +AA   +   +AL + RL RD+AR K+++   A A  H   R      
Sbjct  80   LTLELHSRDFLPTAAQARHTDYRALTLARLHRDSARVKSIAARVALAA-HGVKRSDLKPL  138

Query  360  ----------RDFSSSVISGLAQGSGEYFTRLGVGTPPKYAFMVLDTGSDVVWLQCSPCR  509
                      R     ++SG +QGSGEYF+R+G+G P K  +MVLDTGSDV W+QC PC 
Sbjct  139  AEEKELAASERAIKGPIVSGTSQGSGEYFSRVGIGNPAKPFYMVLDTGSDVTWVQCQPCT  198

Query  510  KCYAQTDPVFDPSKSSSFVGVKCDSPLCRRLDSSGC  617
             CY Q+DPVFDPS SSS+  + CDSP CR LD S C
Sbjct  199  DCYQQSDPVFDPSASSSYSLLPCDSPRCRALDISAC  234



>ref|XP_003589787.1| Aspartic proteinase nepenthesin-2 [Medicago truncatula]
Length=456

 Score =   122 bits (305),  Expect = 6e-29, Method: Compositional matrix adjust.
 Identities = 63/172 (37%), Positives = 92/172 (53%), Gaps = 16/172 (9%)
 Frame = +3

Query  90   ITETXSLRPLPTAQHYSLSSKPQYSQTLVQPDDSENTLSLDLHHIDLISSAAVNATPKAL  269
            I+ET  L+PL    H +   +PQ+   L   D+    L    H    IS    +      
Sbjct  38   ISET-KLKPLKQQNHNT--QQPQWKTKLFHRDNIN--LKKTTHKTRFISRINRDIKRVTF  92

Query  270  FVKRLQRDaarakalsllaaaaPPHNATRGRDFSSSVISGLAQGSGEYFTRLGVGTPPKY  449
             + RL ++    +                   F S V+SG  +GSGEYF R+G+G+P  Y
Sbjct  93   LLNRLNKNTQEQQTT-----------TATEASFGSDVVSGTEEGSGEYFVRIGIGSPAIY  141

Query  450  AFMVLDTGSDVVWLQCSPCRKCYAQTDPVFDPSKSSSFVGVKCDSPLCRRLD  605
             +MV+D+GSD+VW+QC PC +CY QTDP+F+P+ S+SF+GV C S +C +LD
Sbjct  142  QYMVIDSGSDIVWIQCEPCDQCYNQTDPIFNPATSASFIGVACSSNVCNQLD  193



>ref|XP_009385987.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 2 [Musa acuminata 
subsp. malaccensis]
Length=464

 Score =   121 bits (304),  Expect = 7e-29, Method: Compositional matrix adjust.
 Identities = 65/141 (46%), Positives = 89/141 (63%), Gaps = 5/141 (4%)
 Frame = +3

Query  189  SENTLSLDLHHIDLISSAAVNATPKALFVKRLQRDaarakalsllaaaaPPHNATRGRDF  368
              N LSL L H D +     +     L  + L+RD+ R   L+   + A  H      DF
Sbjct  49   GHNRLSLSLFHRDALPGRNFSGHRHRL-DRLLERDSRRVVTLTRRLSTARYHV----DDF  103

Query  369  SSSVISGLAQGSGEYFTRLGVGTPPKYAFMVLDTGSDVVWLQCSPCRKCYAQTDPVFDPS  548
             S V+SGL +GSGEYF R+GVG PP+  ++V+D+GSD+VW+QC PC +CYAQ++PVFDP+
Sbjct  104  GSEVVSGLEEGSGEYFVRVGVGVPPRDQYLVVDSGSDIVWIQCRPCSQCYAQSEPVFDPA  163

Query  549  KSSSFVGVKCDSPLCRRLDSS  611
            +S+SF GV C SP+C  L S 
Sbjct  164  ESASFAGVACGSPICGLLLSG  184



>gb|AES60038.2| aspartic protease in GUARD CELL-like protein [Medicago truncatula]
Length=469

 Score =   121 bits (304),  Expect = 7e-29, Method: Compositional matrix adjust.
 Identities = 63/172 (37%), Positives = 92/172 (53%), Gaps = 16/172 (9%)
 Frame = +3

Query  90   ITETXSLRPLPTAQHYSLSSKPQYSQTLVQPDDSENTLSLDLHHIDLISSAAVNATPKAL  269
            I+ET  L+PL    H +   +PQ+   L   D+    L    H    IS    +      
Sbjct  38   ISET-KLKPLKQQNHNT--QQPQWKTKLFHRDNIN--LKKTTHKTRFISRINRDIKRVTF  92

Query  270  FVKRLQRDaarakalsllaaaaPPHNATRGRDFSSSVISGLAQGSGEYFTRLGVGTPPKY  449
             + RL ++    +                   F S V+SG  +GSGEYF R+G+G+P  Y
Sbjct  93   LLNRLNKNTQEQQ-----------TTTATEASFGSDVVSGTEEGSGEYFVRIGIGSPAIY  141

Query  450  AFMVLDTGSDVVWLQCSPCRKCYAQTDPVFDPSKSSSFVGVKCDSPLCRRLD  605
             +MV+D+GSD+VW+QC PC +CY QTDP+F+P+ S+SF+GV C S +C +LD
Sbjct  142  QYMVIDSGSDIVWIQCEPCDQCYNQTDPIFNPATSASFIGVACSSNVCNQLD  193



>ref|XP_010908909.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 2-like [Elaeis 
guineensis]
Length=448

 Score =   121 bits (304),  Expect = 8e-29, Method: Compositional matrix adjust.
 Identities = 70/154 (45%), Positives = 96/154 (62%), Gaps = 5/154 (3%)
 Frame = +3

Query  144  SSKPQYSQTLVQPDDSENTLSLDLHHIDLISSAAVNATPKALFVKRLQRDaarakalsll  323
            S+  Q S+T V      N  +L+L H D ISS   ++     F + + RDA R   L+  
Sbjct  23   SNLHQLSKTHVH---KANKWALNLVHRDTISSRNYSSHHHR-FQELMNRDARRVAGLTRR  78

Query  324  aaaaPPHNATRGRDFSSSVISGLAQGSGEYFTRLGVGTPPKYAFMVLDTGSDVVWLQCSP  503
             AA+    A    DF S V+SGL +GSGEYF R+GVG+PP+  +MV+D+GSD+ W+QC P
Sbjct  79   LAASTGL-AYSSEDFGSEVVSGLEEGSGEYFVRVGVGSPPREQYMVIDSGSDITWVQCQP  137

Query  504  CRKCYAQTDPVFDPSKSSSFVGVKCDSPLCRRLD  605
            C +CY Q DPVFDP++S+SF  + CDS +C  LD
Sbjct  138  CSQCYHQADPVFDPAQSASFYSIGCDSAVCGLLD  171



>ref|XP_010036867.1| PREDICTED: LOW QUALITY PROTEIN: protein ASPARTIC PROTEASE IN 
GUARD CELL 1-like [Eucalyptus grandis]
Length=496

 Score =   121 bits (304),  Expect = 8e-29, Method: Compositional matrix adjust.
 Identities = 69/130 (53%), Positives = 83/130 (64%), Gaps = 12/130 (9%)
 Frame = +3

Query  261  KALFVKRLQRDaarakalsllaaaaPPHNATRG-----------RDFSSSVISGLAQGSG  407
            KAL + RL RD+AR  AL+     A  +N TR             D S+ V+SG +QGSG
Sbjct  99   KALVLARLGRDSARVDALASKLNLAL-NNVTRTDLTPLRTEIQPEDLSTPVVSGTSQGSG  157

Query  408  EYFTRLGVGTPPKYAFMVLDTGSDVVWLQCSPCRKCYAQTDPVFDPSKSSSFVGVKCDSP  587
            EYF+R+GVGTP K  +MVLDTGSDV WLQC PC  CY QTDPVF PS SSS+  + C+SP
Sbjct  158  EYFSRIGVGTPAKQFYMVLDTGSDVNWLQCQPCTDCYQQTDPVFTPSSSSSYTALTCESP  217

Query  588  LCRRLDSSGC  617
             C  L+ S C
Sbjct  218  QCGSLEVSAC  227



>ref|XP_008374731.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 1 [Malus domestica]
Length=487

 Score =   121 bits (304),  Expect = 9e-29, Method: Compositional matrix adjust.
 Identities = 72/166 (43%), Positives = 99/166 (60%), Gaps = 11/166 (7%)
 Frame = +3

Query  150  KPQYSQTLVQPDDSENTLSLDLHHIDLISSAAVNATPKALFVKRLQRDaarakalsllaa  329
            KP  SQ+      + +  SL LH  D + ++  +   K+L + RL RD+AR  +L     
Sbjct  55   KPLESQSQESRPLNSSAFSLQLHPRDALFNSQ-HKDYKSLTLTRLDRDSARVNSLHTKLQ  113

Query  330  aa----------PPHNATRGRDFSSSVISGLAQGSGEYFTRLGVGTPPKYAFMVLDTGSD  479
             A          P H     +D S+ V+SG++QGSGEYF+R+GVGTP K  +MVLDTGSD
Sbjct  114  LALQGIKKSDLEPMHAEILPQDLSTPVVSGVSQGSGEYFSRIGVGTPAKSFYMVLDTGSD  173

Query  480  VVWLQCSPCRKCYAQTDPVFDPSKSSSFVGVKCDSPLCRRLDSSGC  617
            V WLQC+PC  CY Q+DPVF P+ SS++  + CD+P C+ L  S C
Sbjct  174  VNWLQCNPCSDCYQQSDPVFSPAGSSTYSQLTCDAPQCQALHVSAC  219



>ref|XP_004968151.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 1-like [Setaria 
italica]
Length=517

 Score =   121 bits (304),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 50/80 (63%), Positives = 64/80 (80%), Gaps = 0/80 (0%)
 Frame = +3

Query  378  VISGLAQGSGEYFTRLGVGTPPKYAFMVLDTGSDVVWLQCSPCRKCYAQTDPVFDPSKSS  557
            V+SG+ QGSGEYF+R+G+G+P +  +MVLDTGSDV W+QC PC  CY Q+DPVFDPS S+
Sbjct  166  VVSGVGQGSGEYFSRVGIGSPARQLYMVLDTGSDVTWVQCQPCADCYQQSDPVFDPSLSA  225

Query  558  SFVGVKCDSPLCRRLDSSGC  617
            S+  V CDSP CR LD++ C
Sbjct  226  SYAAVSCDSPRCRDLDTAAC  245



>tpg|DAA53545.1| TPA: hypothetical protein ZEAMMB73_483039 [Zea mays]
Length=506

 Score =   121 bits (303),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 72/160 (45%), Positives = 98/160 (61%), Gaps = 14/160 (9%)
 Frame = +3

Query  180  PDDSENTLSLDLHHIDLI-SSAAVNATPKALFVKRLQRDaarakalsllaaaaP------  338
            P   E  L+L LH  D +      + T ++L + RL+RD+ARA A+S  A  A       
Sbjct  75   PRAREGGLTLRLHSRDFLPEEQGRHETYRSLVLSRLRRDSARAAAVSARATLAADGVTRL  134

Query  339  ---PHNATRGRDFSSS----VISGLAQGSGEYFTRLGVGTPPKYAFMVLDTGSDVVWLQC  497
               P N +     S++    V+SG+ QGSGEYF+R+G+G+P +  +MVLDTGSDV W+QC
Sbjct  135  DLRPANGSAVFAASAAIQGPVVSGVGQGSGEYFSRVGIGSPARQLYMVLDTGSDVTWVQC  194

Query  498  SPCRKCYAQTDPVFDPSKSSSFVGVKCDSPLCRRLDSSGC  617
             PC  CY Q+DPVFDPS S+S+  V CDS  CR LD++ C
Sbjct  195  QPCADCYQQSDPVFDPSLSASYAAVSCDSQRCRDLDTAAC  234



>ref|XP_002440367.1| hypothetical protein SORBIDRAFT_09g030430 [Sorghum bicolor]
 gb|EES18797.1| hypothetical protein SORBIDRAFT_09g030430 [Sorghum bicolor]
Length=462

 Score =   120 bits (302),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 67/110 (61%), Positives = 81/110 (74%), Gaps = 6/110 (5%)
 Frame = +3

Query  267  LFVKRLQRDaarakalsllaaaaPPHNATR-GRDFSSSVISGLAQGSGEYFTRLGVGTPP  443
            L   RL RDAARA+A+S+ A      N TR G  FS+ V+SGLAQGSGEYF  +GVGTPP
Sbjct  98   LLAHRLARDAARAEAISVSA-----RNVTRAGGGFSAPVVSGLAQGSGEYFASVGVGTPP  152

Query  444  KYAFMVLDTGSDVVWLQCSPCRKCYAQTDPVFDPSKSSSFVGVKCDSPLC  593
              A +VLDTGSDVVWLQC+PCR+CYAQ+  VFDP +S S+  V+C +P C
Sbjct  153  TPALLVLDTGSDVVWLQCAPCRQCYAQSGRVFDPRRSRSYAAVRCGAPPC  202



>ref|XP_010506935.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 1 [Camelina 
sativa]
Length=501

 Score =   120 bits (301),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 71/191 (37%), Positives = 116/191 (61%), Gaps = 17/191 (9%)
 Frame = +3

Query  90   ITETXSLRPLPTAQHYSLSSKPQYSQTLVQPD--DSENTLSLDLHHIDLISSAAVNATPK  263
            + +T ++  L  A+    S++P+ S +L  P   +S + LSL+LH  D+   A+ +   K
Sbjct  43   LQQTQTILSLDPARSSFTSTRPE-SVSLSDPVFLNSSSPLSLELHSRDIFV-ASQHKDYK  100

Query  264  ALFVKRLQRDaarakalsll----------aaaaPPHNAT---RGRDFSSSVISGLAQGS  404
            +L + RL+RD++R   ++            +   P +N     + ++ ++ V+SG +QGS
Sbjct  101  SLVLSRLERDSSRVAGIAAKIRFAVEGIDRSDLKPVYNEDTRYQTQELTTPVVSGASQGS  160

Query  405  GEYFTRLGVGTPPKYAFMVLDTGSDVVWLQCSPCRKCYAQTDPVFDPSKSSSFVGVKCDS  584
            GEYF+R+GVGTP K  ++VLDTGSDV W+QC PC  CY Q+DPVF+P+ SS++  + C +
Sbjct  161  GEYFSRIGVGTPAKEMYLVLDTGSDVNWIQCEPCSDCYQQSDPVFNPTSSSTYKSLTCSA  220

Query  585  PLCRRLDSSGC  617
            P C  L++S C
Sbjct  221  PQCSLLETSAC  231



>gb|KJB37242.1| hypothetical protein B456_006G195400 [Gossypium raimondii]
Length=482

 Score =   120 bits (301),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 74/185 (40%), Positives = 103/185 (56%), Gaps = 19/185 (10%)
 Frame = +3

Query  117  LPTAQHYSLSSKPQ----YSQTLVQPDDSENTLSLDLHHIDLISSAAVNATP----KALF  272
            L  AQH  LS  PQ    ++QT  QP    ++ S  +  + L S  +V+ T     KAL 
Sbjct  43   LSQAQHI-LSFDPQSLKAFAQTQTQPLFFNSSTSAAVFSVPLHSRGSVHKTHHTDYKALV  101

Query  273  VKRLQRDaa----------rakalsllaaaaPPHNATRGRDFSSSVISGLAQGSGEYFTR  422
            + RL+RD+A           A      +   P     +    S+ +ISG +QGSGEYF+R
Sbjct  102  LSRLERDSARVDSLSTKLLLALNGVKKSQLRPLPTQIQAEALSTPIISGTSQGSGEYFSR  161

Query  423  LGVGTPPKYAFMVLDTGSDVVWLQCSPCRKCYAQTDPVFDPSKSSSFVGVKCDSPLCRRL  602
            +GVG P K  +MVLDTGSD+ W+QC PC +CY Q+DP+F+PS SS++  V C+S  C  L
Sbjct  162  VGVGKPAKQFYMVLDTGSDINWIQCEPCNECYQQSDPIFNPSGSSTYSPVTCESKQCSSL  221

Query  603  DSSGC  617
            + S C
Sbjct  222  EVSAC  226



>ref|XP_006298983.1| hypothetical protein CARUB_v10015108mg [Capsella rubella]
 gb|EOA31881.1| hypothetical protein CARUB_v10015108mg [Capsella rubella]
Length=501

 Score =   120 bits (301),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 74/191 (39%), Positives = 116/191 (61%), Gaps = 17/191 (9%)
 Frame = +3

Query  90   ITETXSLRPLPTAQHYSLSSKPQYSQTLVQPD--DSENTLSLDLHHIDLISSAAVNATPK  263
            + +T S+  L  ++    S++P+ S++L  P   +S + LSL+LH  D+   A+ +   K
Sbjct  43   LQQTQSILSLDPSRSSLTSTRPE-SESLFDPVFLNSSSPLSLELHSRDIFV-ASQHKDYK  100

Query  264  ALFVKRLQRDaarakalsll----------aaaaPPHNA-TRGR--DFSSSVISGLAQGS  404
            +L + RL+RD++R   ++            +   P  N  TR +  D ++ V+SG +QGS
Sbjct  101  SLVLSRLERDSSRVNGIAAKVRFAVEGIDRSDLKPVSNEDTRYQPEDLTTPVVSGASQGS  160

Query  405  GEYFTRLGVGTPPKYAFMVLDTGSDVVWLQCSPCRKCYAQTDPVFDPSKSSSFVGVKCDS  584
            GEYF+R+GVGTP K  ++VLDTGSDV W+QC PC  CY Q+DPVF P+ SS++  + C +
Sbjct  161  GEYFSRIGVGTPAKEMYLVLDTGSDVNWIQCQPCSDCYQQSDPVFSPTSSSTYKSLTCAA  220

Query  585  PLCRRLDSSGC  617
            P C  L++S C
Sbjct  221  PQCSLLETSAC  231



>ref|XP_009346910.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 1-like [Pyrus 
x bretschneideri]
Length=487

 Score =   120 bits (300),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 73/168 (43%), Positives = 99/168 (59%), Gaps = 11/168 (7%)
 Frame = +3

Query  144  SSKPQYSQTLVQPDDSENTLSLDLHHIDLISSAAVNATPKALFVKRLQRDaar-------  302
            S KP  SQ+      + + LSL LH  D + ++  +   K+L   RL RD+AR       
Sbjct  53   SLKPLESQSQESRPLNSSALSLQLHPRDALFNSQ-HKDYKSLTRTRLYRDSARVHSLHSK  111

Query  303  ---akalsllaaaaPPHNATRGRDFSSSVISGLAQGSGEYFTRLGVGTPPKYAFMVLDTG  473
               A      +   P H     +D S+ V+SG++QGSGEYF+R+GVGTP K  +MV DTG
Sbjct  112  LQLALQGIKKSDLEPMHAKILPQDLSTPVVSGVSQGSGEYFSRIGVGTPAKSFYMVPDTG  171

Query  474  SDVVWLQCSPCRKCYAQTDPVFDPSKSSSFVGVKCDSPLCRRLDSSGC  617
            SDV WLQC PC  CY Q+DPVF+P+ SSS+  + CD+P C+ L+ S C
Sbjct  172  SDVNWLQCDPCSDCYQQSDPVFNPAGSSSYSQLTCDAPQCQALEVSAC  219



>gb|KEH44258.1| aspartic protease in GUARD CELL-like protein [Medicago truncatula]
Length=467

 Score =   120 bits (300),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 67/144 (47%), Positives = 92/144 (64%), Gaps = 10/144 (7%)
 Frame = +3

Query  189  SENTLSLDLHHIDLISSAAVNATPKALFVKRLQRDaarakalsllaaaaPPHNATRGRD-  365
            S +TLSL LH    +SS   +A  K+L + RL RD+AR K ++         N     D 
Sbjct  66   STSTLSLQLHSRASLSS---HADYKSLTLSRLDRDSARVKYITTKL------NQNFNTDK  116

Query  366  FSSSVISGLAQGSGEYFTRLGVGTPPKYAFMVLDTGSDVVWLQCSPCRKCYAQTDPVFDP  545
             S  +ISG +QGSGEYF+R+G+G PP  A+MVLDTGSD+ W+QC+PC  CY Q DP+F+P
Sbjct  117  LSGPIISGTSQGSGEYFSRIGIGEPPSQAYMVLDTGSDISWVQCAPCADCYRQADPIFEP  176

Query  546  SKSSSFVGVKCDSPLCRRLDSSGC  617
            + S+S+  + C++  CR LD S C
Sbjct  177  TASASYAPLSCEAAQCRYLDQSQC  200



>ref|XP_009398943.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 1-like [Musa 
acuminata subsp. malaccensis]
Length=522

 Score =   120 bits (301),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 79/185 (43%), Positives = 107/185 (58%), Gaps = 23/185 (12%)
 Frame = +3

Query  132  HYSLSSKPQYSQTL---VQPDDSENTLSLDLHHIDLI-----SSAAVNATPKALFVKRLQ  287
            H +LS +P  S  L   + P D  + +S+ LH  D +     SSA  +   KAL + RL 
Sbjct  54   HLALSYRPPSSTELPSHLLPYDPSSAISVALHSRDFLPSFVGSSAHGHPDYKALTLARLF  113

Query  288  RDaarakalsllaaaa---------PPHNATRGRDFSS------SVISGLAQGSGEYFTR  422
            RD AR +++++ A  A          P+   +    ++      SVISG + GSGEYF+R
Sbjct  114  RDVARVRSIAVRATLAFGAVADSVLNPNTDVKALQIAAVNSIMGSVISGASMGSGEYFSR  173

Query  423  LGVGTPPKYAFMVLDTGSDVVWLQCSPCRKCYAQTDPVFDPSKSSSFVGVKCDSPLCRRL  602
            +GVG+PPK  +M+LDTGSDV W+QC PC  CY Q+DPVFDPS SSS+  + CDS LC  L
Sbjct  174  VGVGSPPKPLYMILDTGSDVSWVQCLPCADCYEQSDPVFDPSDSSSYTLLSCDSSLCHSL  233

Query  603  DSSGC  617
              S C
Sbjct  234  ALSAC  238



>ref|XP_006406598.1| hypothetical protein EUTSA_v10020568mg [Eutrema salsugineum]
 dbj|BAJ33681.1| unnamed protein product [Thellungiella halophila]
 gb|ESQ48051.1| hypothetical protein EUTSA_v10020568mg [Eutrema salsugineum]
Length=502

 Score =   120 bits (300),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 66/157 (42%), Positives = 96/157 (61%), Gaps = 14/157 (9%)
 Frame = +3

Query  186  DSENTLSLDLHHIDLISSAAVNATPKALFVKRLQRDaarakalslla---------aaaP  338
            +S + LSL+LH  D +  A+ +   K+L + RL+RD++R   ++            +   
Sbjct  77   NSSSPLSLELHSRDTLV-ASQHKDYKSLVLSRLERDSSRVAGIAAKIRFAVEGIDRSDLK  135

Query  339  PHNATRGR----DFSSSVISGLAQGSGEYFTRLGVGTPPKYAFMVLDTGSDVVWLQCSPC  506
            P +    R    D ++ V+SG +QGSGEYF+R+GVGTP K  ++VLDTGSDV W+QC PC
Sbjct  136  PVDIDETRFQPEDLTTPVVSGTSQGSGEYFSRIGVGTPAKEMYVVLDTGSDVNWIQCLPC  195

Query  507  RKCYAQTDPVFDPSKSSSFVGVKCDSPLCRRLDSSGC  617
             +CY Q+DP+FDP+ SS+F  + C  P C  LD S C
Sbjct  196  SECYQQSDPIFDPTSSSTFKSLTCSDPKCASLDVSAC  232



>ref|XP_008351878.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 1-like [Malus 
domestica]
Length=487

 Score =   120 bits (300),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 75/177 (42%), Positives = 104/177 (59%), Gaps = 16/177 (9%)
 Frame = +3

Query  132  HYSLSSKPQYSQTL-VQPDDSE----NTLSLDLHHIDLISSAAVNATPKALFVKRLQRDa  296
            H  LS  P+  Q L  Q  +S+    +  SL LH  D + ++  +   K+L + RL RD+
Sbjct  44   HAVLSFDPESLQPLEXQSQESQPLNSSAFSLQLHPRDXLFNSQ-HKDYKSLTLTRLGRDS  102

Query  297  arakalsllaaaa----------PPHNATRGRDFSSSVISGLAQGSGEYFTRLGVGTPPK  446
            AR  +L      A          P H   + +D S+ V+SG++QGSGEYF+R+GVGTP K
Sbjct  103  ARVNSLHTKLQLALQGIKRGDLEPMHAEIQPQDLSTPVVSGVSQGSGEYFSRIGVGTPAK  162

Query  447  YAFMVLDTGSDVVWLQCSPCRKCYAQTDPVFDPSKSSSFVGVKCDSPLCRRLDSSGC  617
              +MVLDTGSDV WLQC PC  CY Q+DP F+P+ SS++  + CD+P C+ L  S C
Sbjct  163  SFYMVLDTGSDVNWLQCGPCSDCYQQSDPXFNPAGSSTYSQLTCDAPQCQALQVSXC  219



>ref|XP_011459743.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 1-like [Fragaria 
vesca subsp. vesca]
Length=227

 Score =   116 bits (291),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 73/127 (57%), Positives = 86/127 (68%), Gaps = 12/127 (9%)
 Frame = +3

Query  249  NATPKALFVKRLQRDaarakalsllaaaaPPHNATRGRDFSSSVIS----GLAQGSGEYF  416
            N TP  LF  RL+RD+    +L+        +N TR    SS   S    GL+QGSGEYF
Sbjct  30   NQTPSQLFHLRLRRDSLHFNSLA--------YNRTRPGPPSSGFSSSIVSGLSQGSGEYF  81

Query  417  TRLGVGTPPKYAFMVLDTGSDVVWLQCSPCRKCYAQTDPVFDPSKSSSFVGVKCDSPLCR  596
            TR+  G+PPKY +MVLDTGSDVVWLQC+PC+ CY+QTDPVFDP KSSSF  + C SPL R
Sbjct  82   TRIDDGSPPKYLYMVLDTGSDVVWLQCAPCKHCYSQTDPVFDPRKSSSFSSLPCSSPLYR  141

Query  597  RLDSSGC  617
             LDS GC
Sbjct  142  HLDSPGC  148



>ref|XP_007227097.1| hypothetical protein PRUPE_ppa025647mg [Prunus persica]
 gb|EMJ28296.1| hypothetical protein PRUPE_ppa025647mg [Prunus persica]
Length=524

 Score =   120 bits (301),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 47/84 (56%), Positives = 67/84 (80%), Gaps = 0/84 (0%)
 Frame = +3

Query  366  FSSSVISGLAQGSGEYFTRLGVGTPPKYAFMVLDTGSDVVWLQCSPCRKCYAQTDPVFDP  545
            F S V+SG+ QGSGEYF R+GVG+PP+  ++V+D+GSD+VW+QC PC +CY Q+DP+FDP
Sbjct  170  FGSEVVSGMEQGSGEYFVRIGVGSPPRSQYIVIDSGSDIVWVQCQPCSQCYHQSDPIFDP  229

Query  546  SKSSSFVGVKCDSPLCRRLDSSGC  617
            + S+S++GV C S +C  L + GC
Sbjct  230  AHSASYMGVSCSSSVCGHLQNPGC  253



>ref|XP_002970504.1| hypothetical protein SELMODRAFT_93504 [Selaginella moellendorffii]
 gb|EFJ28634.1| hypothetical protein SELMODRAFT_93504 [Selaginella moellendorffii]
Length=483

 Score =   120 bits (300),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 70/158 (44%), Positives = 90/158 (57%), Gaps = 4/158 (3%)
 Frame = +3

Query  153  PQYSQTLVQPDDSENTLSLDLHHIDLISSAAVNA--TPKALFVKRLQRDaarak-alsll  323
            P  ++  + P D   TLSL+L H + +   A     T + L ++ LQRD  R +   S  
Sbjct  41   PVKNKLQLSPRDG-GTLSLELIHRNSLLREAKEKLHTHEQLLLETLQRDEQRVRWIESKA  99

Query  324  aaaaPPHNATRGRDFSSSVISGLAQGSGEYFTRLGVGTPPKYAFMVLDTGSDVVWLQCSP  503
              A    +     D +  V SGL  GSGEYF RLGVGTP +  FMV+DTGSD+ WLQC P
Sbjct  100  QLAGKKKDEASSTDLNGPVTSGLLYGSGEYFVRLGVGTPARSLFMVVDTGSDLPWLQCQP  159

Query  504  CRKCYAQTDPVFDPSKSSSFVGVKCDSPLCRRLDSSGC  617
            C+ CY Q DP+FDP  SSSF  + C SPLC+ L+   C
Sbjct  160  CKSCYKQADPIFDPRNSSSFQRIPCLSPLCKALEIHSC  197



>ref|XP_008221090.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 2 [Prunus 
mume]
Length=542

 Score =   120 bits (301),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 47/84 (56%), Positives = 67/84 (80%), Gaps = 0/84 (0%)
 Frame = +3

Query  366  FSSSVISGLAQGSGEYFTRLGVGTPPKYAFMVLDTGSDVVWLQCSPCRKCYAQTDPVFDP  545
            F S V+SG+ QGSGEYF R+GVG+PP+  ++V+D+GSD+VW+QC PC +CY Q+DP+FDP
Sbjct  169  FGSEVVSGMEQGSGEYFVRIGVGSPPRSQYIVIDSGSDIVWVQCQPCSQCYHQSDPIFDP  228

Query  546  SKSSSFVGVKCDSPLCRRLDSSGC  617
            + S+S++GV C S +C  L + GC
Sbjct  229  AHSASYMGVSCSSSVCGHLQNPGC  252



>gb|EAY72467.1| hypothetical protein OsI_00323 [Oryza sativa Indica Group]
Length=500

 Score =   119 bits (299),  Expect = 5e-28, Method: Compositional matrix adjust.
 Identities = 73/173 (42%), Positives = 101/173 (58%), Gaps = 16/173 (9%)
 Frame = +3

Query  147  SKPQYSQTLVQPDDSENTLSLDLHHIDLI---SSAAVNATPKALFVKRLQRDaarakals  317
            S    S  ++  +  E  L+L LH  D +        +A+ ++L + RL+RD+ARA A+S
Sbjct  59   SAAAVSTEVIGEEHEEGRLALRLHSRDFLPEEQGRQRHASYRSLVLARLRRDSARAAAVS  118

Query  318  llaaaaP---------PHNAT----RGRDFSSSVISGLAQGSGEYFTRLGVGTPPKYAFM  458
              AA A          P N T       +    V+SG+  GSGEYF+R+GVG+P +  +M
Sbjct  119  ARAAMAADGVSRFDLVPANVTAFEASAAEIQGPVVSGVGLGSGEYFSRVGVGSPARQLYM  178

Query  459  VLDTGSDVVWLQCSPCRKCYAQTDPVFDPSKSSSFVGVKCDSPLCRRLDSSGC  617
            VLDTGSDV W+QC PC  CY Q+DPVFDPS S+S+  V CD+P C  LD++ C
Sbjct  179  VLDTGSDVTWVQCQPCADCYQQSDPVFDPSLSTSYASVACDNPRCHDLDAAAC  231



>ref|XP_010465949.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 1-like [Camelina 
sativa]
Length=502

 Score =   119 bits (299),  Expect = 5e-28, Method: Compositional matrix adjust.
 Identities = 70/191 (37%), Positives = 116/191 (61%), Gaps = 17/191 (9%)
 Frame = +3

Query  90   ITETXSLRPLPTAQHYSLSSKPQYSQTLVQPD--DSENTLSLDLHHIDLISSAAVNATPK  263
            + +T ++  L  A+    S++P+ S +L  P   +S + LSL+LH  D++  A+ +   K
Sbjct  44   LQQTQTILSLDPARSSFTSTRPE-SVSLSDPVFLNSSSPLSLELHSRDILV-ASQHKDYK  101

Query  264  ALFVKRLQRDaarakalsllaa----------aaPPHNAT---RGRDFSSSVISGLAQGS  404
            +L + RL+R+++R   ++                P +N     + ++ ++ V+SG +QGS
Sbjct  102  SLVLSRLERESSRVAGIAAKIQFAVEGIDRSDLKPVYNEDTRYQTQELTTPVVSGASQGS  161

Query  405  GEYFTRLGVGTPPKYAFMVLDTGSDVVWLQCSPCRKCYAQTDPVFDPSKSSSFVGVKCDS  584
            GEYF+R+GVGTP K  ++VLDTGSDV W+QC PC  CY Q+DPVF+P+ SS++  + C +
Sbjct  162  GEYFSRIGVGTPAKEMYLVLDTGSDVNWIQCQPCSDCYQQSDPVFNPTSSSTYKSLTCSA  221

Query  585  PLCRRLDSSGC  617
            P C  L++S C
Sbjct  222  PQCSLLETSAC  232



>ref|XP_008367576.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 1-like [Malus 
domestica]
Length=487

 Score =   119 bits (298),  Expect = 5e-28, Method: Compositional matrix adjust.
 Identities = 52/94 (55%), Positives = 69/94 (73%), Gaps = 0/94 (0%)
 Frame = +3

Query  336  PPHNATRGRDFSSSVISGLAQGSGEYFTRLGVGTPPKYAFMVLDTGSDVVWLQCSPCRKC  515
            P H   + +D S+ V+SG++QGSGEYF+R+GVGTP K  +MVLDTGSDV WLQC PC  C
Sbjct  126  PMHAEIQPQDLSTPVVSGVSQGSGEYFSRIGVGTPAKSFYMVLDTGSDVNWLQCGPCSDC  185

Query  516  YAQTDPVFDPSKSSSFVGVKCDSPLCRRLDSSGC  617
            Y Q+DP F+P+ SS++  + CD+P C+ L  S C
Sbjct  186  YQQSDPXFNPAGSSTYSQLTCDAPQCQALQVSXC  219



>ref|XP_009109887.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 1-like [Brassica 
rapa]
Length=482

 Score =   119 bits (298),  Expect = 6e-28, Method: Compositional matrix adjust.
 Identities = 73/186 (39%), Positives = 106/186 (57%), Gaps = 26/186 (14%)
 Frame = +3

Query  105  SLRPLPTAQHYSLSSKPQYSQTLVQPDDSENTLSLDLHHIDLISSAAVNATP----KALF  272
            S+R    A  + L+ + + S     P  S  + SL LH     S A+V  T      +L 
Sbjct  41   SIRKTKDASSFRLNQQEEQSH---YPTSS--SFSLQLH-----SRASVRGTEHPDYNSLT  90

Query  273  VKRLQRDaarakalsllaaaaPPHNATRG-----------RDFSSSVISGLAQGSGEYFT  419
            + RL RD+ R K+L+        +N TR             +  + +ISG  QGSGEYFT
Sbjct  91   LARLHRDSTRVKSLTARLNL-AINNITRANLKHTMYTTEQEEIEAPLISGTTQGSGEYFT  149

Query  420  RLGVGTPPKYAFMVLDTGSDVVWLQCSPCRKCYAQTDPVFDPSKSSSFVGVKCDSPLCRR  599
            R+G+G+P +  +MVLDTGSDV WLQC+PC +CY QT+P+F+P+ SSS+  + CD+P C+ 
Sbjct  150  RVGIGSPAREVYMVLDTGSDVNWLQCAPCAECYHQTEPIFEPTTSSSYATLSCDAPQCKA  209

Query  600  LDSSGC  617
            L++S C
Sbjct  210  LEASEC  215



>ref|XP_009409187.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 1-like [Musa 
acuminata subsp. malaccensis]
Length=522

 Score =   119 bits (298),  Expect = 6e-28, Method: Compositional matrix adjust.
 Identities = 74/160 (46%), Positives = 98/160 (61%), Gaps = 17/160 (11%)
 Frame = +3

Query  189  SENTLSLDLHHIDLISSAAVNATP--KALFVKRLQRDaarakalsllaaaa---------  335
            S   +SL  H  D + S+A +  P  KAL + RL+RDAAR ++++  AA A         
Sbjct  78   SAAAISLAFHSRDFLPSSAGHRHPDYKALTLARLRRDAARVRSIAARAALAVSGVAASDL  137

Query  336  PPHNATRGRDFSSS------VISGLAQGSGEYFTRLGVGTPPKYAFMVLDTGSDVVWLQC  497
             P    +    +++      V+SG + GSGEYF+R+GVG+P +  +MVLDTGSDV WLQC
Sbjct  138  KPVAEEKAAPIAAADSIEGPVVSGTSVGSGEYFSRVGVGSPARPFYMVLDTGSDVSWLQC  197

Query  498  SPCRKCYAQTDPVFDPSKSSSFVGVKCDSPLCRRLDSSGC  617
             PC  CY QTDPVFDPS SSS+  + CDS  CR LD+S C
Sbjct  198  LPCADCYQQTDPVFDPSASSSYAPISCDSSQCRSLDASAC  237



>ref|XP_004135107.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 1-like [Cucumis 
sativus]
 gb|KGN52057.1| hypothetical protein Csa_5G608450 [Cucumis sativus]
Length=486

 Score =   119 bits (297),  Expect = 7e-28, Method: Compositional matrix adjust.
 Identities = 48/86 (56%), Positives = 66/86 (77%), Gaps = 0/86 (0%)
 Frame = +3

Query  360  RDFSSSVISGLAQGSGEYFTRLGVGTPPKYAFMVLDTGSDVVWLQCSPCRKCYAQTDPVF  539
             DF S ++SG +QGSGEYF+R+G+G PP   +MVLDTGSDV W+QC+PC +CY QTDP+F
Sbjct  134  EDFESPIVSGASQGSGEYFSRVGIGRPPSPVYMVLDTGSDVSWVQCAPCAECYEQTDPIF  193

Query  540  DPSKSSSFVGVKCDSPLCRRLDSSGC  617
            +P+ S+SF  + C++  C+ LD S C
Sbjct  194  EPTSSASFTSLSCETEQCKSLDVSEC  219



>ref|XP_008446567.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 1 [Cucumis 
melo]
Length=486

 Score =   118 bits (296),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 48/86 (56%), Positives = 66/86 (77%), Gaps = 0/86 (0%)
 Frame = +3

Query  360  RDFSSSVISGLAQGSGEYFTRLGVGTPPKYAFMVLDTGSDVVWLQCSPCRKCYAQTDPVF  539
             DF S ++SG +QGSGEYF+R+G+G PP   +MVLDTGSDV W+QC+PC +CY QTDP+F
Sbjct  134  EDFESPIVSGASQGSGEYFSRVGIGRPPSPVYMVLDTGSDVSWVQCAPCAECYEQTDPIF  193

Query  540  DPSKSSSFVGVKCDSPLCRRLDSSGC  617
            +P+ S+SF  + C++  C+ LD S C
Sbjct  194  EPTSSASFTSLSCETEQCKSLDVSEC  219



>ref|XP_006354732.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 1-like [Solanum 
tuberosum]
Length=491

 Score =   118 bits (296),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 50/86 (58%), Positives = 65/86 (76%), Gaps = 0/86 (0%)
 Frame = +3

Query  360  RDFSSSVISGLAQGSGEYFTRLGVGTPPKYAFMVLDTGSDVVWLQCSPCRKCYAQTDPVF  539
             +F + +ISG +QGSGEYF RLGVG P K  +M +DTGSD+ WLQC PC +CY QTDP+F
Sbjct  138  EEFQTPLISGSSQGSGEYFARLGVGEPAKEFYMAIDTGSDINWLQCEPCDECYQQTDPIF  197

Query  540  DPSKSSSFVGVKCDSPLCRRLDSSGC  617
            +PS SS++  + CDSP+C  L+ SGC
Sbjct  198  NPSDSSTYNQLSCDSPVCAALELSGC  223



>ref|XP_002275164.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 1 [Vitis vinifera]
Length=496

 Score =   118 bits (295),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 75/184 (41%), Positives = 100/184 (54%), Gaps = 16/184 (9%)
 Frame = +3

Query  111  RPLPTAQHYSLSSKPQYSQ----TLVQPDDSENTLSLDLHHIDLISSAAVNATPKALFVK  278
            + L    H S  SKP   +    T   P    ++ SL+LH  +L+   + +   +AL + 
Sbjct  46   KTLDVLSHKSSVSKPSDQRDEKTTSFSPTSLASSFSLELHPRELLHGGS-HKDYRALMLS  104

Query  279  RLQRDaarakalsllaaaaPPHNATRG-----------RDFSSSVISGLAQGSGEYFTRL  425
            RL RD+AR KA++     A                   +DFS+ V SG +QGSGEYF R+
Sbjct  105  RLARDSARVKAINTKLQLAVSGTDKSDLVPMDTEILHPQDFSTPVTSGTSQGSGEYFLRV  164

Query  426  GVGTPPKYAFMVLDTGSDVVWLQCSPCRKCYAQTDPVFDPSKSSSFVGVKCDSPLCRRLD  605
            G+G P K  +MV+DTGSDV WLQC PC  CY Q DP+FDP+ SSSF  + C +P CR LD
Sbjct  165  GIGRPSKTFYMVIDTGSDVNWLQCKPCDDCYQQVDPIFDPASSSSFSRLGCQTPQCRNLD  224

Query  606  SSGC  617
               C
Sbjct  225  VFAC  228



>ref|XP_010487776.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 1-like [Camelina 
sativa]
Length=501

 Score =   118 bits (295),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 63/157 (40%), Positives = 98/157 (62%), Gaps = 14/157 (9%)
 Frame = +3

Query  186  DSENTLSLDLHHIDLISSAAVNATPKALFVKRLQRDaarakalsll----------aaaa  335
            +S + LSL+LH  D+   A+ +   K+L + RL+RD++R   ++            +   
Sbjct  76   NSSSPLSLELHSRDIFV-ASQHKDYKSLVLSRLERDSSRVSGIAAKIRFAVEGIDRSDLK  134

Query  336  PPHNAT---RGRDFSSSVISGLAQGSGEYFTRLGVGTPPKYAFMVLDTGSDVVWLQCSPC  506
            P  N     + ++ ++ V+SG +QGSGEYF+R+GVGTP K  ++VLDTGSDV W+QC PC
Sbjct  135  PVDNEDTRYQTQELTTPVVSGASQGSGEYFSRIGVGTPAKEMYLVLDTGSDVNWIQCEPC  194

Query  507  RKCYAQTDPVFDPSKSSSFVGVKCDSPLCRRLDSSGC  617
              CY Q+DPVF+P+ SS++  + C +P C  L++S C
Sbjct  195  SDCYQQSDPVFNPTSSSTYKSLTCSAPQCSLLETSAC  231



>ref|XP_004241622.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 1-like [Solanum 
lycopersicum]
Length=495

 Score =   118 bits (295),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 50/85 (59%), Positives = 65/85 (76%), Gaps = 0/85 (0%)
 Frame = +3

Query  363  DFSSSVISGLAQGSGEYFTRLGVGTPPKYAFMVLDTGSDVVWLQCSPCRKCYAQTDPVFD  542
            +F + +ISG +QGSGEYF RLG+G P K  +MV+DTGSD+ WLQC PC  CY QTDP+F+
Sbjct  143  EFQTPLISGTSQGSGEYFARLGIGEPAKEFYMVIDTGSDINWLQCEPCDVCYQQTDPIFN  202

Query  543  PSKSSSFVGVKCDSPLCRRLDSSGC  617
            PS SS++  V C+SP+C  L+ SGC
Sbjct  203  PSDSSTYNQVSCNSPVCAALELSGC  227



>gb|ABR17396.1| unknown [Picea sitchensis]
Length=350

 Score =   117 bits (292),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 48/76 (63%), Positives = 62/76 (82%), Gaps = 0/76 (0%)
 Frame = +3

Query  390  LAQGSGEYFTRLGVGTPPKYAFMVLDTGSDVVWLQCSPCRKCYAQTDPVFDPSKSSSFVG  569
            + QGSGEYFTR+G+GTP +  +MVLDTGSDVVW+QC PCR+CY+Q DP+F+PS S SF  
Sbjct  1    MEQGSGEYFTRIGIGTPTREQYMVLDTGSDVVWIQCEPCRECYSQADPIFNPSSSVSFST  60

Query  570  VKCDSPLCRRLDSSGC  617
            V CDS +C +LD++ C
Sbjct  61   VGCDSAVCSQLDANDC  76



>ref|NP_188478.1| protein ASPARTIC PROTEASE IN GUARD CELL 1 [Arabidopsis thaliana]
 sp|Q9LS40.1|ASPG1_ARATH RecName: Full=Protein ASPARTIC PROTEASE IN GUARD CELL 1; Short=AtASPG1; 
Flags: Precursor [Arabidopsis thaliana]
 dbj|BAB01116.1| CND41, chloroplast nucleoid DNA binding protein-like [Arabidopsis 
thaliana]
 gb|AAN13013.1| putative chloroplast nucleoid DNA-binding protein [Arabidopsis 
thaliana]
 gb|AEE76104.1| protein aspartic protease in guard cell 1 [Arabidopsis thaliana]
Length=500

 Score =   118 bits (295),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 64/157 (41%), Positives = 96/157 (61%), Gaps = 14/157 (9%)
 Frame = +3

Query  186  DSENTLSLDLHHIDLISSAAVNATPKALFVKRLQRDaarakalsll----------aaaa  335
            +S + LSL+LH  D    A+ +   K+L + RL+RD++R   +             +   
Sbjct  75   NSSSPLSLELHSRDTFV-ASQHKDYKSLTLSRLERDSSRVAGIVAKIRFAVEGVDRSDLK  133

Query  336  PPHNAT---RGRDFSSSVISGLAQGSGEYFTRLGVGTPPKYAFMVLDTGSDVVWLQCSPC  506
            P +N     +  D ++ V+SG +QGSGEYF+R+GVGTP K  ++VLDTGSDV W+QC PC
Sbjct  134  PVYNEDTRYQTEDLTTPVVSGASQGSGEYFSRIGVGTPAKEMYLVLDTGSDVNWIQCEPC  193

Query  507  RKCYAQTDPVFDPSKSSSFVGVKCDSPLCRRLDSSGC  617
              CY Q+DPVF+P+ SS++  + C +P C  L++S C
Sbjct  194  ADCYQQSDPVFNPTSSSTYKSLTCSAPQCSLLETSAC  230



>ref|XP_009380958.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 1-like [Musa 
acuminata subsp. malaccensis]
Length=523

 Score =   118 bits (295),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 75/160 (47%), Positives = 100/160 (63%), Gaps = 17/160 (11%)
 Frame = +3

Query  189  SENTLSLDLHHIDLISSAAVNATP--KALFVKRLQRDaarakalsllaaaa---------  335
            S + +SL LH  D + S+  +  P  KAL + RL+RDAAR ++++  AA A         
Sbjct  73   SSSAISLPLHSRDFLPSSDGHRHPDYKALTLARLRRDAARVRSIAARAALAVGGVAASDL  132

Query  336  PPHNATRGRDFSSS------VISGLAQGSGEYFTRLGVGTPPKYAFMVLDTGSDVVWLQC  497
             P    +    +++      V+SG + GSGEYF+R+GVG+P K  +MVLDTGSDV W+QC
Sbjct  133  KPIAEEKALPIAAADSIEGPVVSGTSLGSGEYFSRVGVGSPAKPLYMVLDTGSDVSWIQC  192

Query  498  SPCRKCYAQTDPVFDPSKSSSFVGVKCDSPLCRRLDSSGC  617
            +PC  CY QTDPVFDPS SSS+V + CDS  CR LD S C
Sbjct  193  APCADCYQQTDPVFDPSASSSYVPLSCDSSQCRSLDISAC  232



>ref|XP_002885261.1| aspartyl protease family protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH61520.1| aspartyl protease family protein [Arabidopsis lyrata subsp. lyrata]
Length=500

 Score =   117 bits (294),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 64/157 (41%), Positives = 97/157 (62%), Gaps = 14/157 (9%)
 Frame = +3

Query  186  DSENTLSLDLHHIDLISSAAVNATPKALFVKRLQRDaarakalslla---------aaaP  338
            +S + LSL+LH  D +  A+ +   K+L + RL+RD++R   ++            +   
Sbjct  75   NSSSPLSLELHSRDTLV-ASQHKDYKSLVLSRLERDSSRVAGIAAKIRFAVEGIDRSDLK  133

Query  339  PHNATRGR----DFSSSVISGLAQGSGEYFTRLGVGTPPKYAFMVLDTGSDVVWLQCSPC  506
            P N    R      ++ V+SG++QGSGEYF+R+GVGTP K  ++VLDTGSDV W+QC PC
Sbjct  134  PVNNEDTRYQPEALTTPVVSGVSQGSGEYFSRIGVGTPAKEMYLVLDTGSDVNWIQCEPC  193

Query  507  RKCYAQTDPVFDPSKSSSFVGVKCDSPLCRRLDSSGC  617
              CY Q+DPVF+P+ SS++  + C +P C  L++S C
Sbjct  194  SDCYQQSDPVFNPTSSSTYKSLTCSAPQCSLLETSAC  230



>gb|ABK24255.1| unknown [Picea sitchensis]
 gb|ABR16185.1| unknown [Picea sitchensis]
Length=485

 Score =   117 bits (293),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 50/85 (59%), Positives = 65/85 (76%), Gaps = 0/85 (0%)
 Frame = +3

Query  363  DFSSSVISGLAQGSGEYFTRLGVGTPPKYAFMVLDTGSDVVWLQCSPCRKCYAQTDPVFD  542
            DF S V+SG+ QGSGEYF+R+GVG P +   MVLDTGSDV W+QC PC  CY Q+DP+++
Sbjct  129  DFQSPVVSGMDQGSGEYFSRIGVGAPRRDQLMVLDTGSDVTWIQCEPCSDCYQQSDPIYN  188

Query  543  PSKSSSFVGVKCDSPLCRRLDSSGC  617
            P+ SSS+  V C + LC++LD SGC
Sbjct  189  PALSSSYKLVGCQANLCQQLDVSGC  213



>ref|XP_004172253.1| PREDICTED: LOW QUALITY PROTEIN: protein ASPARTIC PROTEASE IN 
GUARD CELL 1-like [Cucumis sativus]
Length=486

 Score =   117 bits (293),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 48/86 (56%), Positives = 65/86 (76%), Gaps = 0/86 (0%)
 Frame = +3

Query  360  RDFSSSVISGLAQGSGEYFTRLGVGTPPKYAFMVLDTGSDVVWLQCSPCRKCYAQTDPVF  539
             DF S ++SG +QGSGEYF+R+G+G PP   +MVLDTGSDV W+QC+PC +CY QTDP F
Sbjct  134  EDFESPIVSGASQGSGEYFSRVGIGRPPSPVYMVLDTGSDVSWVQCAPCAECYEQTDPXF  193

Query  540  DPSKSSSFVGVKCDSPLCRRLDSSGC  617
            +P+ S+SF  + C++  C+ LD S C
Sbjct  194  EPTSSASFTSLSCETEQCKSLDVSEC  219



>gb|AAL87345.1| putative chloroplast nucleoid DNA-binding protein [Arabidopsis 
thaliana]
Length=500

 Score =   117 bits (293),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 64/157 (41%), Positives = 96/157 (61%), Gaps = 14/157 (9%)
 Frame = +3

Query  186  DSENTLSLDLHHIDLISSAAVNATPKALFVKRLQRDaarakalsll----------aaaa  335
            +S + LSL+LH  D    A+ +   K+L + RL+RD++R   +             +   
Sbjct  75   NSSSPLSLELHSRDTFV-ASQHKDYKSLTLSRLERDSSRVAGIVAKIRFAVEGVDRSDLK  133

Query  336  PPHNAT---RGRDFSSSVISGLAQGSGEYFTRLGVGTPPKYAFMVLDTGSDVVWLQCSPC  506
            P +N     +  D ++ V+SG +QGSGEYF+R+GVGTP K  ++VLDTGSDV W+QC PC
Sbjct  134  PVYNEDTRYQTEDLTTPVVSGASQGSGEYFSRIGVGTPAKDMYLVLDTGSDVNWIQCEPC  193

Query  507  RKCYAQTDPVFDPSKSSSFVGVKCDSPLCRRLDSSGC  617
              CY Q+DPVF+P+ SS++  + C +P C  L++S C
Sbjct  194  ADCYQQSDPVFNPTSSSTYKSLTCSAPQCSLLETSAC  230



>ref|XP_008791252.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 2-like [Phoenix 
dactylifera]
Length=469

 Score =   117 bits (292),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 47/84 (56%), Positives = 65/84 (77%), Gaps = 0/84 (0%)
 Frame = +3

Query  360  RDFSSSVISGLAQGSGEYFTRLGVGTPPKYAFMVLDTGSDVVWLQCSPCRKCYAQTDPVF  539
            +DF S V+SGL +GSGEYF R+GVG+PP+  +MV+D+GSD+ W+QC PC +CY Q  PVF
Sbjct  111  QDFGSEVVSGLEEGSGEYFVRVGVGSPPREQYMVIDSGSDITWVQCQPCSQCYHQAGPVF  170

Query  540  DPSKSSSFVGVKCDSPLCRRLDSS  611
            DP++S++F  V CDS +C  LD +
Sbjct  171  DPAQSTTFYNVGCDSTVCGLLDRA  194



>ref|XP_003520035.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 1-like [Glycine 
max]
Length=484

 Score =   117 bits (292),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 47/80 (59%), Positives = 64/80 (80%), Gaps = 0/80 (0%)
 Frame = +3

Query  378  VISGLAQGSGEYFTRLGVGTPPKYAFMVLDTGSDVVWLQCSPCRKCYAQTDPVFDPSKSS  557
            V+SG +QGSGEYF R+G+G PP  A++VLDTGSDV W+QC+PC +CY Q+DP+FDP  S+
Sbjct  138  VVSGTSQGSGEYFLRVGIGKPPSQAYVVLDTGSDVSWIQCAPCSECYQQSDPIFDPVSSN  197

Query  558  SFVGVKCDSPLCRRLDSSGC  617
            S+  ++CD+P C+ LD S C
Sbjct  198  SYSPIRCDAPQCKSLDLSEC  217



>ref|XP_002448772.1| hypothetical protein SORBIDRAFT_06g032900 [Sorghum bicolor]
 gb|EES13100.1| hypothetical protein SORBIDRAFT_06g032900 [Sorghum bicolor]
Length=471

 Score =   116 bits (291),  Expect = 5e-27, Method: Compositional matrix adjust.
 Identities = 47/82 (57%), Positives = 65/82 (79%), Gaps = 0/82 (0%)
 Frame = +3

Query  372  SSVISGLAQGSGEYFTRLGVGTPPKYAFMVLDTGSDVVWLQCSPCRKCYAQTDPVFDPSK  551
            S V+SGL +GSGEYF R+G+G+PP   ++V+D+GSDV+W+QC PC +CYAQ DP+FDP+ 
Sbjct  112  SKVVSGLDEGSGEYFVRVGIGSPPTEQYLVVDSGSDVIWVQCKPCLECYAQADPLFDPAS  171

Query  552  SSSFVGVKCDSPLCRRLDSSGC  617
            S++F  V C S +CR L +SGC
Sbjct  172  SATFSAVSCGSAICRTLRTSGC  193



>ref|XP_003517994.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 1-like [Glycine 
max]
Length=484

 Score =   116 bits (291),  Expect = 5e-27, Method: Compositional matrix adjust.
 Identities = 51/97 (53%), Positives = 69/97 (71%), Gaps = 5/97 (5%)
 Frame = +3

Query  342  HNATRGRDFSSS-----VISGLAQGSGEYFTRLGVGTPPKYAFMVLDTGSDVVWLQCSPC  506
            H A    +F S+     V+SG +QGSGEYF R+G+G PP  A++VLDTGSDV W+QC+PC
Sbjct  121  HPAESKAEFESNALQGPVVSGTSQGSGEYFLRVGIGKPPSQAYVVLDTGSDVSWIQCAPC  180

Query  507  RKCYAQTDPVFDPSKSSSFVGVKCDSPLCRRLDSSGC  617
             +CY Q+DP+FDP  S+S+  ++CD P C+ LD S C
Sbjct  181  SECYQQSDPIFDPISSNSYSPIRCDEPQCKSLDLSEC  217



>gb|EAY72465.1| hypothetical protein OsI_00321 [Oryza sativa Indica Group]
Length=343

 Score =   115 bits (289),  Expect = 5e-27, Method: Compositional matrix adjust.
 Identities = 48/85 (56%), Positives = 63/85 (74%), Gaps = 0/85 (0%)
 Frame = +3

Query  363  DFSSSVISGLAQGSGEYFTRLGVGTPPKYAFMVLDTGSDVVWLQCSPCRKCYAQTDPVFD  542
            +    V+SG+  GSGEYF+R+GVG+P +  +MVLDTGSDV W+QC PC  CY Q+DPVFD
Sbjct  151  EIQGPVVSGVGLGSGEYFSRVGVGSPARQLYMVLDTGSDVTWVQCQPCADCYQQSDPVFD  210

Query  543  PSKSSSFVGVKCDSPLCRRLDSSGC  617
            PS S+S+  V CD+P C  LD++ C
Sbjct  211  PSLSTSYASVACDNPRCHDLDAAAC  235



>ref|XP_002990366.1| hypothetical protein SELMODRAFT_43971, partial [Selaginella moellendorffii]
 gb|EFJ08635.1| hypothetical protein SELMODRAFT_43971, partial [Selaginella moellendorffii]
Length=420

 Score =   116 bits (290),  Expect = 5e-27, Method: Compositional matrix adjust.
 Identities = 52/84 (62%), Positives = 64/84 (76%), Gaps = 0/84 (0%)
 Frame = +3

Query  366  FSSSVISGLAQGSGEYFTRLGVGTPPKYAFMVLDTGSDVVWLQCSPCRKCYAQTDPVFDP  545
            F+S +ISG+A GSG+YF R+GVGTP +  +MV DTGSDV WLQCSPCRKCY Q DP+F+P
Sbjct  66   FASPLISGIAGGSGDYFARIGVGTPARSVYMVADTGSDVSWLQCSPCRKCYRQQDPIFNP  125

Query  546  SKSSSFVGVKCDSPLCRRLDSSGC  617
            S SSSF  + C S +C +L   GC
Sbjct  126  SLSSSFKPLACASSICGKLKIKGC  149



>emb|CDX75968.1| BnaC03g40510D [Brassica napus]
Length=503

 Score =   116 bits (290),  Expect = 7e-27, Method: Compositional matrix adjust.
 Identities = 66/157 (42%), Positives = 97/157 (62%), Gaps = 14/157 (9%)
 Frame = +3

Query  186  DSENTLSLDLHHIDLISSAAVNATPKALFVKRLQRDaarakalsll----------aaaa  335
            +S + L+L+LH  D +  A  +   K+L + RL+RD++R  A++            +   
Sbjct  78   NSSSPLTLELHSRDTLL-APHHKDYKSLVLSRLERDSSRVAAIAAKVRFSVEGVNRSDLK  136

Query  336  PPHN---ATRGRDFSSSVISGLAQGSGEYFTRLGVGTPPKYAFMVLDTGSDVVWLQCSPC  506
            P +N        + ++ V+SG +QGSGEYF+R+GVGTP K  +MVLDTGSDV WLQC PC
Sbjct  137  PVYNDETMYNPEELTTPVVSGASQGSGEYFSRIGVGTPAKEMYMVLDTGSDVNWLQCKPC  196

Query  507  RKCYAQTDPVFDPSKSSSFVGVKCDSPLCRRLDSSGC  617
              CY Q+DPVFDP++SS++  + C +P C  L+ S C
Sbjct  197  SDCYEQSDPVFDPAESSTYKPLTCAAPQCASLEVSTC  233



>ref|XP_007153356.1| hypothetical protein PHAVU_003G028600g [Phaseolus vulgaris]
 gb|ESW25350.1| hypothetical protein PHAVU_003G028600g [Phaseolus vulgaris]
Length=483

 Score =   115 bits (289),  Expect = 8e-27, Method: Compositional matrix adjust.
 Identities = 47/80 (59%), Positives = 62/80 (78%), Gaps = 0/80 (0%)
 Frame = +3

Query  378  VISGLAQGSGEYFTRLGVGTPPKYAFMVLDTGSDVVWLQCSPCRKCYAQTDPVFDPSKSS  557
            ++SG +QGSGEYF R+G+G PP  A++VLDTGSDV W+QC PC +CY Q+DP+FDP  SS
Sbjct  137  IVSGTSQGSGEYFLRVGIGKPPSQAYVVLDTGSDVSWIQCEPCSECYQQSDPIFDPLSSS  196

Query  558  SFVGVKCDSPLCRRLDSSGC  617
            S+  + CD+P C+ LD S C
Sbjct  197  SYAPIHCDAPQCKSLDLSEC  216



>ref|XP_009135580.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 1-like [Brassica 
rapa]
Length=499

 Score =   115 bits (289),  Expect = 9e-27, Method: Compositional matrix adjust.
 Identities = 65/157 (41%), Positives = 96/157 (61%), Gaps = 14/157 (9%)
 Frame = +3

Query  186  DSENTLSLDLHHIDLISSAAVNATPKALFVKRLQRDaarakalsll----------aaaa  335
            +S + L+L+LH  D +  A  +   K+L + RL+RD++R   ++            +   
Sbjct  73   NSSSPLTLELHSRDTLL-APHHKDYKSLVLSRLERDSSRVAGIAAKVRFSVEGVDRSDLK  131

Query  336  PPHN---ATRGRDFSSSVISGLAQGSGEYFTRLGVGTPPKYAFMVLDTGSDVVWLQCSPC  506
            P +N        + ++ V+SG +QGSGEYF+R+GVGTP K  +MVLDTGSDV WLQC PC
Sbjct  132  PVYNDETMYNPEELTTPVVSGASQGSGEYFSRIGVGTPAKEMYMVLDTGSDVNWLQCKPC  191

Query  507  RKCYAQTDPVFDPSKSSSFVGVKCDSPLCRRLDSSGC  617
              CY Q+DPVFDP++SS++  + C +P C  L+ S C
Sbjct  192  SDCYEQSDPVFDPAESSTYKPLTCAAPQCASLEVSTC  228



>ref|XP_010477900.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 1-like [Camelina 
sativa]
Length=483

 Score =   115 bits (289),  Expect = 9e-27, Method: Compositional matrix adjust.
 Identities = 67/171 (39%), Positives = 95/171 (56%), Gaps = 13/171 (8%)
 Frame = +3

Query  144  SSKPQYSQTLVQPDDSENTLSLDLHHIDLISSAAVNATPKALFVKRLQRDaarakalsll  323
            +  P   Q   Q + S++  SL LH    +     ++  K+L + RL RD AR K+L   
Sbjct  46   TKNPSSFQLNQQEEQSQSPFSLKLHSRASVRGGVEHSDYKSLTLARLDRDTARVKSLVTR  105

Query  324  aaaaPPHNA-------------TRGRDFSSSVISGLAQGSGEYFTRLGVGTPPKYAFMVL  464
               A  + +             T   D  + +ISG  QGSGEYFTR+G+G P +  +MVL
Sbjct  106  LDLALNNISKADLKPVITTMYTTDQEDIEAPLISGTTQGSGEYFTRVGIGNPAREVYMVL  165

Query  465  DTGSDVVWLQCSPCRKCYAQTDPVFDPSKSSSFVGVKCDSPLCRRLDSSGC  617
            DTGSDV WLQC+PC  CY QT+P+F+P+ SSS+  + CD+  C+ L+ S C
Sbjct  166  DTGSDVNWLQCAPCADCYHQTEPIFEPASSSSYQPLSCDTSQCKALEVSEC  216



>emb|CDX82342.1| BnaA03g34790D [Brassica napus]
Length=499

 Score =   115 bits (289),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 65/157 (41%), Positives = 96/157 (61%), Gaps = 14/157 (9%)
 Frame = +3

Query  186  DSENTLSLDLHHIDLISSAAVNATPKALFVKRLQRDaarakalsll----------aaaa  335
            +S + L+L+LH  D +  A  +   K+L + RL+RD++R   ++            +   
Sbjct  73   NSSSPLTLELHSRDTLL-APHHKDYKSLVLSRLERDSSRVAGIAAKVRFSVEGVDRSDLK  131

Query  336  PPHN---ATRGRDFSSSVISGLAQGSGEYFTRLGVGTPPKYAFMVLDTGSDVVWLQCSPC  506
            P +N        + ++ V+SG +QGSGEYF+R+GVGTP K  +MVLDTGSDV WLQC PC
Sbjct  132  PVYNDETMYNPEELTTPVVSGASQGSGEYFSRIGVGTPAKEMYMVLDTGSDVNWLQCKPC  191

Query  507  RKCYAQTDPVFDPSKSSSFVGVKCDSPLCRRLDSSGC  617
              CY Q+DPVFDP++SS++  + C +P C  L+ S C
Sbjct  192  SDCYEQSDPVFDPAESSTYKPLTCAAPQCASLEVSTC  228



>ref|NP_001041979.1| Os01g0140100 [Oryza sativa Japonica Group]
 dbj|BAB21205.1| putative aspartic proteinase nepenthesin I [Oryza sativa Japonica 
Group]
 dbj|BAF03893.1| Os01g0140100 [Oryza sativa Japonica Group]
 gb|EAZ10476.1| hypothetical protein OsJ_00309 [Oryza sativa Japonica Group]
 dbj|BAG91200.1| unnamed protein product [Oryza sativa Japonica Group]
Length=504

 Score =   115 bits (289),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 70/155 (45%), Positives = 95/155 (61%), Gaps = 16/155 (10%)
 Frame = +3

Query  201  LSLDLHHIDLI---SSAAVNATPKALFVKRLQRDaarakalsllaaaaP---------PH  344
            L+L LH  D +        +A+ ++L + RL+RD+ARA A+S  AA A          P 
Sbjct  81   LALRLHSRDFLPEEQGRQRHASYRSLVLARLRRDSARAAAVSARAAMAADGVSRFDLVPA  140

Query  345  NAT----RGRDFSSSVISGLAQGSGEYFTRLGVGTPPKYAFMVLDTGSDVVWLQCSPCRK  512
            N T       +    V+SG+  GSGEYF+R+GVG+P +  +MVLDTGSDV W+QC PC  
Sbjct  141  NVTAFEASAAEIQGPVVSGVGLGSGEYFSRVGVGSPARQLYMVLDTGSDVTWVQCQPCAD  200

Query  513  CYAQTDPVFDPSKSSSFVGVKCDSPLCRRLDSSGC  617
            CY Q+DPVFDPS S+S+  V CD+P C  LD++ C
Sbjct  201  CYQQSDPVFDPSLSTSYASVACDNPRCHDLDAAAC  235



>ref|XP_008668690.1| PREDICTED: protein ASPARTIC PROTEASE IN GUARD CELL 2 [Zea mays]
 tpg|DAA35354.1| TPA: hypothetical protein ZEAMMB73_186928 [Zea mays]
Length=464

 Score =   115 bits (288),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 47/82 (57%), Positives = 65/82 (79%), Gaps = 0/82 (0%)
 Frame = +3

Query  372  SSVISGLAQGSGEYFTRLGVGTPPKYAFMVLDTGSDVVWLQCSPCRKCYAQTDPVFDPSK  551
            S V+SGL +GSGEYF R+G+G+PP   ++V+D+GSDV+W+QC PC +CYAQ DP+FDP+ 
Sbjct  114  SKVVSGLDEGSGEYFVRVGIGSPPTEQYLVVDSGSDVIWVQCKPCLECYAQADPLFDPAT  173

Query  552  SSSFVGVKCDSPLCRRLDSSGC  617
            S++F  V C S +CR L +SGC
Sbjct  174  SATFSAVPCGSAVCRTLRTSGC  195



>ref|XP_006843768.1| hypothetical protein AMTR_s00007p00241440 [Amborella trichopoda]
 gb|ERN05443.1| hypothetical protein AMTR_s00007p00241440 [Amborella trichopoda]
Length=496

 Score =   115 bits (289),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 49/80 (61%), Positives = 60/80 (75%), Gaps = 0/80 (0%)
 Frame = +3

Query  378  VISGLAQGSGEYFTRLGVGTPPKYAFMVLDTGSDVVWLQCSPCRKCYAQTDPVFDPSKSS  557
            V+SG+ QGSGEYF+R+G+G P    +MVLDTGSDV W+QC PC  CY Q DPVF+P+ SS
Sbjct  149  VVSGMQQGSGEYFSRVGIGQPAHEQYMVLDTGSDVSWVQCEPCSDCYDQADPVFNPTSSS  208

Query  558  SFVGVKCDSPLCRRLDSSGC  617
            S+  V CDS +CR LD S C
Sbjct  209  SYRAVGCDSSVCRSLDVSAC  228



>dbj|BAJ97639.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=479

 Score =   115 bits (288),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 49/87 (56%), Positives = 67/87 (77%), Gaps = 2/87 (2%)
 Frame = +3

Query  363  DFSSSVISGLAQGSGEYFTRLGVGTPPKYAFMVLDTGSDVVWLQCSPCRKCYAQTDPVFD  542
            +  S V+SG+++GSGEYF R+GVG+PP   ++V+D+GSDV+W+QC PC +CY Q DP+FD
Sbjct  117  EVGSEVVSGISEGSGEYFVRVGVGSPPTEQYLVVDSGSDVIWIQCRPCAECYQQADPLFD  176

Query  543  PSKSSSFVGVKCDSPLCRRL--DSSGC  617
            P+ S+SF  V CDS +CR L   SSGC
Sbjct  177  PAASASFTAVPCDSGVCRTLPGGSSGC  203



>gb|KCW86348.1| hypothetical protein EUGRSUZ_B03036 [Eucalyptus grandis]
Length=492

 Score =   115 bits (287),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 50/84 (60%), Positives = 63/84 (75%), Gaps = 0/84 (0%)
 Frame = +3

Query  366  FSSSVISGLAQGSGEYFTRLGVGTPPKYAFMVLDTGSDVVWLQCSPCRKCYAQTDPVFDP  545
            F S V+SG +QGSGEYF+RLGVG PP   +MV+DTGSDV W+QC+PC  CY Q DP+F+P
Sbjct  145  FESPVVSGTSQGSGEYFSRLGVGDPPSQVYMVVDTGSDVNWVQCAPCADCYQQADPIFEP  204

Query  546  SKSSSFVGVKCDSPLCRRLDSSGC  617
            + S+SF  + CD+  CR LD S C
Sbjct  205  ASSASFSPLSCDTRQCRSLDVSEC  228



>ref|XP_006374138.1| hypothetical protein POPTR_0015s02540g [Populus trichocarpa]
 gb|ABK94105.1| unknown [Populus trichocarpa]
 gb|ERP51935.1| hypothetical protein POPTR_0015s02540g [Populus trichocarpa]
Length=499

 Score =   115 bits (287),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 62/145 (43%), Positives = 80/145 (55%), Gaps = 20/145 (14%)
 Frame = +3

Query  213  LHHIDLISSAAVNATPKALFVKRLQRDaarakalsl----------laaaaPPHNATRGR  362
            +HH D           K+L + RL RD  R  +L+            +   P     +  
Sbjct  95   IHHKDY----------KSLVLSRLHRDTVRFNSLTARLQLALEDISKSDLKPLETEIKPE  144

Query  363  DFSSSVISGLAQGSGEYFTRLGVGTPPKYAFMVLDTGSDVVWLQCSPCRKCYAQTDPVFD  542
            D S+ V SG +QGSGEYFTR+GVG P +  +MVLDTGSD+ WLQC PC  CY QTDP+FD
Sbjct  145  DLSTPVTSGTSQGSGEYFTRVGVGNPARQFYMVLDTGSDINWLQCQPCTDCYQQTDPIFD  204

Query  543  PSKSSSFVGVKCDSPLCRRLDSSGC  617
            P+ SS++  V C S  C  L+ S C
Sbjct  205  PTASSTYAPVTCQSQQCSSLEMSSC  229



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 870155291520