BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFF037K05

Length=599
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_006344529.1|  PREDICTED: ferredoxin--NADP reductase, root-...    293   5e-95   Solanum tuberosum [potatoes]
ref|XP_006363650.1|  PREDICTED: ferredoxin--NADP reductase, root-...    293   6e-95   Solanum tuberosum [potatoes]
ref|XP_009362229.1|  PREDICTED: ferredoxin--NADP reductase, root ...    292   2e-94   Pyrus x bretschneideri [bai li]
ref|XP_009761528.1|  PREDICTED: ferredoxin--NADP reductase, root-...    292   2e-94   Nicotiana sylvestris
ref|XP_009614066.1|  PREDICTED: ferredoxin--NADP reductase, root-...    291   5e-94   Nicotiana tomentosiformis
ref|XP_008346149.1|  PREDICTED: ferredoxin--NADP reductase, root ...    290   1e-93   Malus domestica [apple tree]
ref|XP_004231567.1|  PREDICTED: ferredoxin--NADP reductase, root-...    289   3e-93   Solanum lycopersicum
sp|O04397.1|FENR2_TOBAC  RecName: Full=Ferredoxin--NADP reductase...    289   3e-93   Nicotiana tabacum [American tobacco]
ref|XP_002523191.1|  ferredoxin--NADP reductase, putative               289   3e-93   Ricinus communis
gb|KJB56287.1|  hypothetical protein B456_009G115100                    283   3e-91   Gossypium raimondii
ref|XP_008383404.1|  PREDICTED: ferredoxin--NADP reductase, root ...    284   3e-91   Malus domestica [apple tree]
ref|XP_007211443.1|  hypothetical protein PRUPE_ppa007232mg             283   3e-91   Prunus persica
ref|XP_004293987.1|  PREDICTED: ferredoxin--NADP reductase, root ...    283   5e-91   Fragaria vesca subsp. vesca
gb|KJB56286.1|  hypothetical protein B456_009G115100                    283   6e-91   Gossypium raimondii
gb|KJB56288.1|  hypothetical protein B456_009G115100                    282   7e-91   Gossypium raimondii
ref|XP_002263658.2|  PREDICTED: ferredoxin--NADP reductase, root ...    283   7e-91   Vitis vinifera
gb|KDP34933.1|  hypothetical protein JCGZ_09221                         282   1e-90   Jatropha curcas
ref|XP_009344407.1|  PREDICTED: ferredoxin--NADP reductase, root ...    282   1e-90   Pyrus x bretschneideri [bai li]
ref|XP_011038878.1|  PREDICTED: ferredoxin--NADP reductase, root ...    282   2e-90   Populus euphratica
ref|XP_008225595.1|  PREDICTED: ferredoxin--NADP reductase, root ...    281   2e-90   Prunus mume [ume]
ref|XP_002298889.2|  ferredoxin-NADP reductase family protein           281   2e-90   Populus trichocarpa [western balsam poplar]
ref|XP_010051952.1|  PREDICTED: ferredoxin--NADP reductase, root ...    281   2e-90   Eucalyptus grandis [rose gum]
ref|XP_007022877.1|  Root FNR 1 isoform 1                               281   3e-90   
ref|XP_010098567.1|  Ferredoxin--NADP reductase, root isozyme           281   4e-90   
ref|XP_007147485.1|  hypothetical protein PHAVU_006G128400g             280   5e-90   Phaseolus vulgaris [French bean]
gb|KHG02797.1|  hypothetical protein F383_08810                         280   6e-90   Gossypium arboreum [tree cotton]
gb|ACY70395.1|  heterotrophic ferredoxin NADP+ oxidoreductase           278   3e-89   Populus tremula x Populus tremuloides
gb|EYU19120.1|  hypothetical protein MIMGU_mgv1a008446mg                277   9e-89   Erythranthe guttata [common monkey flower]
ref|XP_006597058.1|  PREDICTED: uncharacterized protein LOC100807...    276   2e-88   Glycine max [soybeans]
emb|CDP17310.1|  unnamed protein product                                278   2e-88   Coffea canephora [robusta coffee]
ref|XP_011085204.1|  PREDICTED: ferredoxin--NADP reductase, root-...    276   4e-88   Sesamum indicum [beniseed]
ref|XP_008439552.1|  PREDICTED: ferredoxin--NADP reductase, root ...    275   9e-88   Cucumis melo [Oriental melon]
ref|NP_001239798.1|  uncharacterized protein LOC100807968               274   2e-87   Glycine max [soybeans]
ref|XP_010247806.1|  PREDICTED: ferredoxin--NADP reductase, root ...    274   2e-87   Nelumbo nucifera [Indian lotus]
ref|XP_004486455.1|  PREDICTED: ferredoxin--NADP reductase, root ...    273   3e-87   Cicer arietinum [garbanzo]
ref|XP_011096684.1|  PREDICTED: ferredoxin--NADP reductase, root-...    274   3e-87   Sesamum indicum [beniseed]
ref|XP_006586681.1|  PREDICTED: uncharacterized protein LOC100789...    271   2e-86   Glycine max [soybeans]
ref|XP_004134584.1|  PREDICTED: ferredoxin--NADP reductase, root ...    271   3e-86   Cucumis sativus [cucumbers]
gb|KHN14331.1|  Ferredoxin--NADP reductase, root isozyme, chlorop...    270   4e-86   Glycine soja [wild soybean]
ref|NP_001239859.1|  uncharacterized protein LOC100789291               269   1e-85   Glycine max [soybeans]
ref|XP_006448909.1|  hypothetical protein CICLE_v100156271mg            263   2e-85   
ref|XP_008795712.1|  PREDICTED: ferredoxin--NADP reductase, root ...    263   3e-85   Phoenix dactylifera
ref|XP_010907335.1|  PREDICTED: ferredoxin--NADP reductase, root ...    268   4e-85   Elaeis guineensis
gb|AII16855.1|  ferredoxin-NADP(+) reductase                            267   7e-85   Ocimum basilicum [basil]
ref|XP_006468308.1|  PREDICTED: ferredoxin--NADP reductase, root ...    266   2e-84   Citrus sinensis [apfelsine]
ref|XP_003594526.1|  Ferredoxin-NADP reductase                          265   6e-84   Medicago truncatula
ref|XP_010691939.1|  PREDICTED: ferredoxin--NADP reductase, root ...    265   8e-84   Beta vulgaris subsp. vulgaris [field beet]
emb|CAA67796.1|  ferrodoxin NADP oxidoreductase                         264   1e-83   Pisum sativum [garden pea]
sp|Q41014.2|FENR2_PEA  RecName: Full=Ferredoxin--NADP reductase, ...    264   2e-83   Pisum sativum [garden pea]
ref|XP_006305070.1|  hypothetical protein CARUB_v10009436mg             261   1e-82   Capsella rubella
ref|XP_002893629.1|  ATRFNR2                                            258   4e-81   
ref|XP_010907336.1|  PREDICTED: ferredoxin--NADP reductase, root ...    257   6e-81   Elaeis guineensis
gb|EYU43232.1|  hypothetical protein MIMGU_mgv1a008184mg                256   1e-80   Erythranthe guttata [common monkey flower]
ref|XP_009397718.1|  PREDICTED: ferredoxin--NADP reductase, root ...    256   2e-80   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_006415461.1|  hypothetical protein EUTSA_v10007919mg             256   2e-80   Eutrema salsugineum [saltwater cress]
ref|XP_011016596.1|  PREDICTED: ferredoxin--NADP reductase, root ...    253   9e-80   Populus euphratica
gb|KFK32212.1|  hypothetical protein AALP_AA6G212100                    253   3e-79   Arabis alpina [alpine rockcress]
ref|XP_006844572.1|  hypothetical protein AMTR_s00016p00195680          253   3e-79   Amborella trichopoda
ref|XP_010529363.1|  PREDICTED: ferredoxin--NADP reductase, root ...    252   6e-79   Tarenaya hassleriana [spider flower]
ref|XP_010431466.1|  PREDICTED: ferredoxin--NADP reductase, root ...    252   6e-79   Camelina sativa [gold-of-pleasure]
ref|XP_006287956.1|  hypothetical protein CARUB_v10001191mg             252   7e-79   Capsella rubella
ref|XP_010422426.1|  PREDICTED: ferredoxin--NADP reductase, root ...    252   9e-79   Camelina sativa [gold-of-pleasure]
ref|XP_006415462.1|  hypothetical protein EUTSA_v10007919mg             251   1e-78   Eutrema salsugineum [saltwater cress]
ref|XP_006396605.1|  hypothetical protein EUTSA_v10028734mg             251   1e-78   Eutrema salsugineum [saltwater cress]
emb|CDY02299.1|  BnaA09g26030D                                          251   2e-78   
ref|XP_009397390.1|  PREDICTED: ferredoxin--NADP reductase, embry...    250   3e-78   Musa acuminata subsp. malaccensis [pisang utan]
emb|CDY09570.1|  BnaC05g23490D                                          250   4e-78   Brassica napus [oilseed rape]
ref|NP_564355.1|  ferredoxin--NADP reductase, root isozyme 2            250   5e-78   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009115136.1|  PREDICTED: ferredoxin--NADP reductase, root ...    250   5e-78   Brassica rapa
gb|AAM65564.1|  ferrodoxin NADP oxidoreductase, putative                250   6e-78   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010431473.1|  PREDICTED: ferredoxin--NADP reductase, root ...    249   6e-78   Camelina sativa [gold-of-pleasure]
ref|XP_010460851.1|  PREDICTED: ferredoxin--NADP reductase, root ...    249   6e-78   Camelina sativa [gold-of-pleasure]
gb|ABF99221.1|  Ferredoxin-NADP reductase, root isozyme, chloropl...    247   7e-78   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010478465.1|  PREDICTED: ferredoxin--NADP reductase, root ...    248   2e-77   Camelina sativa [gold-of-pleasure]
ref|NP_001051476.1|  Os03g0784700                                       248   2e-77   
gb|KFK44862.1|  hypothetical protein AALP_AA1G312100                    248   3e-77   Arabis alpina [alpine rockcress]
ref|XP_002461452.1|  hypothetical protein SORBIDRAFT_02g002900          248   3e-77   Sorghum bicolor [broomcorn]
ref|XP_006287955.1|  hypothetical protein CARUB_v10001191mg             247   4e-77   Capsella rubella
ref|XP_010422427.1|  PREDICTED: ferredoxin--NADP reductase, root ...    247   6e-77   Camelina sativa [gold-of-pleasure]
gb|AAM96978.1|  ferredoxin--NADP+ reductase-like protein                245   3e-76   Arabidopsis thaliana [mouse-ear cress]
ref|NP_567293.1|  ferredoxin--NADP reductase, root isozyme 1            245   3e-76   Arabidopsis thaliana [mouse-ear cress]
ref|NP_849734.1|  ferredoxin--NADP reductase, root isozyme 2            245   3e-76   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010460850.1|  PREDICTED: ferredoxin--NADP reductase, root ...    245   3e-76   Camelina sativa [gold-of-pleasure]
ref|XP_010478464.1|  PREDICTED: ferredoxin--NADP reductase, root ...    244   9e-76   Camelina sativa [gold-of-pleasure]
gb|AAM64825.1|  ferredoxin--NADP+ reductase-like protein                244   9e-76   Arabidopsis thaliana [mouse-ear cress]
gb|KFK44861.1|  hypothetical protein AALP_AA1G312100                    244   1e-75   Arabis alpina [alpine rockcress]
emb|CDY46362.1|  BnaA09g19760D                                          243   2e-75   Brassica napus [oilseed rape]
ref|XP_006650686.1|  PREDICTED: ferredoxin--NADP reductase, root ...    241   8e-75   Oryza brachyantha
emb|CDY39167.1|  BnaC09g21770D                                          241   2e-74   Brassica napus [oilseed rape]
ref|XP_009114485.1|  PREDICTED: ferredoxin--NADP reductase, root ...    241   2e-74   Brassica rapa
gb|AEZ00858.1|  putative ferredoxin NADP+ reductase protein             234   3e-74   Elaeis guineensis
ref|NP_001132762.1|  uncharacterized protein LOC100194249               240   4e-74   Zea mays [maize]
ref|XP_008650954.1|  PREDICTED: uncharacterized protein LOC100194...    239   8e-74   Zea mays [maize]
ref|XP_010537869.1|  PREDICTED: ferredoxin--NADP reductase, root ...    238   1e-73   Tarenaya hassleriana [spider flower]
ref|XP_007022878.1|  Ferredoxin--NADP reductase, root-type isozym...    236   2e-73   
ref|NP_001058890.1|  Os07g0147900                                       238   3e-73   
dbj|BAJ93902.1|  predicted protein                                      237   5e-73   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|EPS58368.1|  hypothetical protein M569_16446                         235   7e-73   Genlisea aurea
gb|EAZ02773.1|  hypothetical protein OsI_24896                          236   8e-73   Oryza sativa Indica Group [Indian rice]
gb|AGT15976.1|  ferredoxin--NADP reductase                              236   9e-73   Saccharum hybrid cultivar R570
gb|ACG35047.1|  ferredoxin--NADP reductase, embryo isozyme              236   9e-73   Zea mays [maize]
ref|XP_006658277.1|  PREDICTED: ferredoxin--NADP reductase, embry...    236   1e-72   
ref|XP_004955449.1|  PREDICTED: ferredoxin--NADP reductase, embry...    235   2e-72   Setaria italica
emb|CAB81081.1|  ferredoxin--NADP+ reductase-like protein               234   3e-72   Arabidopsis thaliana [mouse-ear cress]
gb|KJB56289.1|  hypothetical protein B456_009G115100                    233   4e-72   Gossypium raimondii
gb|EMT16236.1|  Ferredoxin--NADP reductase, root isozyme, chlorop...    234   5e-72   
ref|XP_002463784.1|  hypothetical protein SORBIDRAFT_01g006100          234   6e-72   Sorghum bicolor [broomcorn]
dbj|BAA02248.1|  ferredoxin-NADP+ reductase enzyme                      231   2e-71   Oryza sativa Japonica Group [Japonica rice]
ref|XP_008665551.1|  PREDICTED: ferredoxin--NADP reductase, root ...    232   6e-71   
gb|AAB40034.1|  ferredoxin-NADP reductase precursor                     229   2e-70   Zea mays [maize]
ref|XP_003558196.1|  PREDICTED: ferredoxin--NADP reductase, root ...    230   2e-70   Brachypodium distachyon [annual false brome]
gb|ACG39703.1|  ferredoxin--NADP reductase, root isozyme                230   2e-70   Zea mays [maize]
gb|EMT31879.1|  Ferredoxin--NADP reductase, embryo isozyme, chlor...    229   4e-70   
ref|XP_002874840.1|  ATRFNR1                                            226   7e-69   
gb|EMS52999.1|  Ferredoxin--NADP reductase, embryo isozyme, chlor...    229   7e-69   Triticum urartu
ref|NP_973942.1|  ferredoxin--NADP reductase, root isozyme 2            223   2e-68   Arabidopsis thaliana [mouse-ear cress]
gb|EMS61290.1|  Ferredoxin--NADP reductase, root isozyme, chlorop...    225   5e-68   Triticum urartu
pdb|1JB9|A  Chain A, Crystal Structure Of The Ferredoxin:nadp+ Re...    220   3e-67   Zea mays [maize]
pdb|3LO8|A  Chain A, Crystal Structure Of The Oxidized Form Of Fe...    212   3e-64   Zea mays [maize]
pdb|3LVB|A  Chain A, Crystal Structure Of The Ferredoxin:nadp+ Re...    212   3e-64   Zea mays [maize]
ref|NP_001190682.1|  ferredoxin--NADP reductase, root isozyme 1         209   2e-62   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002992209.1|  hypothetical protein SELMODRAFT_134886             202   1e-59   
ref|XP_002982108.1|  hypothetical protein SELMODRAFT_179376             200   4e-59   
ref|XP_001770917.1|  predicted protein                                  181   3e-51   
ref|XP_001774270.1|  predicted protein                                  176   1e-50   
ref|XP_007510909.1|  predicted protein                                  160   9e-44   Bathycoccus prasinos
ref|XP_003084170.1|  ferredoxin-NADP reductase (ISS)                    159   3e-43   Ostreococcus tauri
ref|XP_001422240.1|  predicted protein                                  158   9e-43   Ostreococcus lucimarinus CCE9901
ref|XP_002500720.1|  ferredoxin-NADP oxidoreductase chloroplast p...    157   2e-42   Micromonas commoda
gb|KIZ06612.1|  ferredoxin--NADP+ reductase                             155   5e-42   Monoraphidium neglectum
ref|XP_003064407.1|  ferredoxin-NADP oxidoreductase                     155   8e-42   Micromonas pusilla CCMP1545
gb|EWM23857.1|  Ferredoxin reductase-type FAD-binding domain protein    156   1e-41   Nannochloropsis gaditana
ref|XP_005853875.1|  ferredoxin--NADP+ reductase                        156   1e-41   Nannochloropsis gaditana CCMP526
ref|XP_002290014.1|  ferredoxin--NADP+ reductase                        152   2e-40   Thalassiosira pseudonana CCMP1335
ref|XP_002954986.1|  ferredoxin-NADP+ reductase                         151   2e-40   Volvox carteri f. nagariensis
ref|XP_009040433.1|  hypothetical protein AURANDRAFT_31888              150   3e-40   Aureococcus anophagefferens
ref|XP_005644145.1|  ferredoxin-NADP+ reductase                         150   5e-40   Coccomyxa subellipsoidea C-169
ref|XP_001697352.1|  ferredoxin-nadp reductase                          149   9e-40   Chlamydomonas reinhardtii
ref|XP_009035092.1|  hypothetical protein AURANDRAFT_23206              149   2e-39   Aureococcus anophagefferens
gb|AAP79145.1|  ferredoxin-NADP oxidoreductase                          149   3e-39   Bigelowiella natans
ref|XP_002180511.1|  predicted protein                                  147   4e-39   Phaeodactylum tricornutum CCAP 1055/1
ref|XP_002977684.1|  hypothetical protein SELMODRAFT_107413             146   6e-39   Selaginella moellendorffii
ref|XP_002979592.1|  hypothetical protein SELMODRAFT_419219             146   7e-39   Selaginella moellendorffii
ref|XP_002180502.1|  predicted protein                                  146   9e-39   Phaeodactylum tricornutum CCAP 1055/1
ref|XP_002295321.1|  ferredoxin-nadp reductase                          145   2e-38   Thalassiosira pseudonana CCMP1335
ref|XP_002184856.1|  predicted protein                                  145   3e-38   Phaeodactylum tricornutum CCAP 1055/1
ref|XP_002974410.1|  hypothetical protein SELMODRAFT_101002             141   4e-37   Selaginella moellendorffii
ref|XP_002985709.1|  hypothetical protein SELMODRAFT_122698             141   6e-37   Selaginella moellendorffii
ref|XP_005848997.1|  hypothetical protein CHLNCDRAFT_35035              140   4e-36   Chlorella variabilis
ref|XP_011400423.1|  Ferredoxin-NADP reductase, chloroplastic           138   7e-36   Auxenochlorella protothecoides
gb|AAV65380.1|  plastid ferredoxin-NADP reductase                       133   1e-35   Prototheca wickerhamii
gb|ABA55546.1|  chloroplast ferredoxin-dependent NADP oxireductase      139   1e-35   Karlodinium veneficum
sp|P53991.1|FENR_CHLRE  RecName: Full=Ferredoxin--NADP reductase,...    138   2e-35   Chlamydomonas reinhardtii
gb|EJK72001.1|  hypothetical protein THAOC_06509                        137   3e-35   Thalassiosira oceanica
gb|AAW79315.1|  chloroplast ferredoxin NADP(+) reductase                137   4e-35   Isochrysis galbana
ref|XP_005770769.1|  hypothetical protein EMIHUDRAFT_432385             136   1e-34   Emiliania huxleyi CCMP1516
ref|XP_005790923.1|  hypothetical protein EMIHUDRAFT_361737             137   1e-34   Emiliania huxleyi CCMP1516
gb|ABD51927.1|  chloroplast ferredoxin NADP oxidoreductase              136   1e-34   Guillardia theta
emb|CBN78345.1|  ferredoxin-NADP oxidoreductase                         136   3e-34   Ectocarpus siliculosus
emb|CBJ31206.1|  hypothetical protein Esi_0238_0041                     133   2e-33   Ectocarpus siliculosus
gb|ADM64306.2|  ferredoxin-NADP+ reductase                              127   8e-32   Pyropia yezoensis
gb|ACJ84937.1|  unknown                                                 122   1e-31   Medicago truncatula
gb|ABF73016.1|  plastid ferredoxin NADPH reductase protein precursor    128   2e-31   Karenia brevis
ref|XP_010103488.1|  Ferredoxin--NADP reductase, embryo isozyme         126   2e-31   
gb|KDD75893.1|  hypothetical protein H632_c449p0                        126   4e-31   Helicosporidium sp. ATCC 50920
ref|XP_005719376.1|  Ferredoxin-NADP+ oxidoreductase                    123   5e-30   Chondrus crispus [carageen]
ref|XP_009034033.1|  hypothetical protein AURANDRAFT_52453              122   2e-29   Aureococcus anophagefferens
ref|XP_005789289.1|  hypothetical protein EMIHUDRAFT_42969              119   1e-28   Emiliania huxleyi CCMP1516
sp|Q00598.1|FENR_CYAPA  RecName: Full=Ferredoxin--NADP reductase,...    114   2e-26   Cyanophora paradoxa
ref|XP_005706517.1|  ferredoxin--NADP+ reductase                        114   2e-26   Galdieria sulphuraria
ref|XP_005538366.1|  ferredoxin-NADP+ reductase                         108   1e-24   Cyanidioschyzon merolae strain 10D
ref|WP_036946982.1|  ferredoxin-NADP reductase                          107   4e-24   
dbj|BAF42337.1|  ferredoxin-NADP+ oxidoreductase                        107   5e-24   Cyanidium caldarium
ref|WP_036477079.1|  ferredoxin-NADP reductase                          107   6e-24   Myxosarcina sp. GI1
ref|XP_010268658.1|  PREDICTED: ferredoxin--NADP reductase, leaf ...    106   8e-24   Nelumbo nucifera [Indian lotus]
ref|XP_006393807.1|  hypothetical protein EUTSA_v10004465mg             106   8e-24   Eutrema salsugineum [saltwater cress]
ref|XP_004287805.1|  PREDICTED: ferredoxin--NADP reductase, leaf ...    106   9e-24   Fragaria vesca subsp. vesca
ref|XP_009382075.1|  PREDICTED: ferredoxin--NADP reductase, leaf ...    106   1e-23   Musa acuminata subsp. malaccensis [pisang utan]
gb|ACU19326.1|  unknown                                                 103   2e-23   Glycine max [soybeans]
ref|XP_006383096.1|  Chain A family protein                             105   2e-23   Populus trichocarpa [western balsam poplar]
ref|XP_008394226.1|  PREDICTED: ferredoxin--NADP reductase, leaf ...    105   2e-23   Malus domestica [apple tree]
ref|XP_008241828.1|  PREDICTED: ferredoxin--NADP reductase, leaf ...    105   2e-23   Prunus mume [ume]
ref|XP_007202096.1|  hypothetical protein PRUPE_ppa007547mg             105   2e-23   Prunus persica
gb|KDP36912.1|  hypothetical protein JCGZ_08203                         105   3e-23   Jatropha curcas
ref|WP_040688390.1|  ferredoxin-NADP reductase                          104   4e-23   
ref|XP_009382076.1|  PREDICTED: ferredoxin--NADP reductase, leaf ...    104   4e-23   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010550469.1|  PREDICTED: ferredoxin--NADP reductase, leaf ...    104   5e-23   Tarenaya hassleriana [spider flower]
ref|XP_010497428.1|  PREDICTED: ferredoxin--NADP reductase, leaf ...    100   6e-23   Camelina sativa [gold-of-pleasure]
ref|XP_009379399.1|  PREDICTED: ferredoxin--NADP reductase, leaf ...    103   6e-23   Pyrus x bretschneideri [bai li]
gb|KFK28280.1|  hypothetical protein AALP_AA8G495900                    103   6e-23   Arabis alpina [alpine rockcress]
ref|XP_003537636.1|  PREDICTED: ferredoxin--NADP reductase, leaf ...    103   7e-23   Glycine max [soybeans]
pdb|1BX1|A  Chain A, Ferredoxin:nadp+ Oxidoreductase (Ferredoxin ...    103   8e-23   Spinacia oleracea
sp|P00455.1|FENR_SPIOL  RecName: Full=Ferredoxin--NADP reductase,...    103   8e-23   Spinacia oleracea
pdb|3VO2|A  Chain A, Crystal Structure Of Zea Mays Leaf Ferredoxi...    103   8e-23   Zea mays [maize]
pdb|1BX0|A  Chain A, Ferredoxin:nadp+ Oxidoreductase (Ferredoxin ...    103   8e-23   Spinacia oleracea
gb|AAA34029.1|  ferredoxin-NADP oxidoreductase                          103   8e-23   Spinacia oleracea
pdb|1FRQ|A  Chain A, Ferredoxin:nadp+ Oxidoreductase (Ferredoxin ...    103   8e-23   Spinacia oleracea
pdb|1FNB|A  Chain A, Refined Crystal Structure Of Spinach Ferredo...    103   9e-23   Spinacia oleracea
ref|XP_002459129.1|  hypothetical protein SORBIDRAFT_03g046340          103   9e-23   Sorghum bicolor [broomcorn]
ref|XP_004233557.1|  PREDICTED: ferredoxin--NADP reductase, leaf-...    103   9e-23   Solanum lycopersicum
ref|WP_017715708.1|  ferredoxin--NADP reductase                         103   9e-23   Oscillatoria sp. PCC 10802
pdb|3VO1|A  Chain A, Crystal Structure Of Zea Mays Leaf Ferredoxi...    103   1e-22   Zea mays [maize]
gb|ACF85815.1|  unknown                                                 103   1e-22   Zea mays [maize]
tpg|DAA55763.1|  TPA: hypothetical protein ZEAMMB73_743777              103   1e-22   
tpg|DAA55764.1|  TPA: hypothetical protein ZEAMMB73_743777              103   1e-22   
ref|NP_001149023.1|  ferredoxin--NADP reductase, leaf isozyme           103   1e-22   
gb|ACF83556.1|  unknown                                                 103   2e-22   Zea mays [maize]
ref|NP_001104851.1|  ferredoxin                                         103   2e-22   Zea mays [maize]
emb|CDY18592.1|  BnaA09g08030D                                          102   2e-22   Brassica napus [oilseed rape]
ref|XP_002993724.1|  hypothetical protein SELMODRAFT_272335             102   2e-22   Selaginella moellendorffii
sp|P41343.1|FENR_MESCR  RecName: Full=Ferredoxin--NADP reductase,...    102   2e-22   Mesembryanthemum crystallinum
ref|XP_010484677.1|  PREDICTED: ferredoxin--NADP reductase, leaf ...    102   2e-22   Camelina sativa [gold-of-pleasure]
ref|XP_010444826.1|  PREDICTED: ferredoxin--NADP reductase, leaf ...    102   2e-22   
ref|WP_006632795.1|  ferredoxin--NADP reductase                         102   2e-22   Microcoleus vaginatus
gb|ACG35645.1|  ferredoxin--NADP reductase, leaf isozyme                102   2e-22   Zea mays [maize]
ref|XP_002865083.1|  ferredoxin-NADP+ reductase                         102   2e-22   Arabidopsis lyrata subsp. lyrata
gb|ELS32478.1|  Ferredoxin--NADP(+) reductase                           102   3e-22   Pseudanabaena biceps PCC 7429
ref|XP_009112283.1|  PREDICTED: ferredoxin--NADP reductase, leaf ...    102   3e-22   Brassica rapa
ref|XP_006380593.1|  Chain A family protein                             102   3e-22   Populus trichocarpa [western balsam poplar]
ref|XP_010465822.1|  PREDICTED: ferredoxin--NADP reductase, leaf ...    102   3e-22   Camelina sativa [gold-of-pleasure]
ref|XP_002533800.1|  ferredoxin--NADP reductase, putative               102   3e-22   
ref|NP_201420.1|  ferredoxin-NADP(+)-oxidoreductase 1                   102   3e-22   Arabidopsis thaliana [mouse-ear cress]
dbj|BAE98556.1|  ferredoxin-NADP+ reductase                             102   3e-22   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006280674.1|  hypothetical protein CARUB_v10026639mg             102   3e-22   Capsella rubella
ref|XP_009363490.1|  PREDICTED: ferredoxin--NADP reductase, leaf ...    102   3e-22   Pyrus x bretschneideri [bai li]
emb|CAB52472.1|  ferredoxin-NADP+ reductase                             102   3e-22   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010679926.1|  PREDICTED: ferredoxin--NADP reductase, chlor...    102   4e-22   Beta vulgaris subsp. vulgaris [field beet]
emb|CDY57760.1|  BnaC02g45020D                                          104   4e-22   Brassica napus [oilseed rape]
pdb|1FRN|A  Chain A, The Involvement Of Ser96 In The Catalytic Me...    101   4e-22   Spinacia oleracea
ref|XP_008788385.1|  PREDICTED: ferredoxin--NADP reductase, leaf ...    101   5e-22   Phoenix dactylifera
gb|AFW86198.1|  hypothetical protein ZEAMMB73_116832                  99.4    5e-22   
ref|WP_007357258.1|  MULTISPECIES: ferredoxin--NADP reductase           101   5e-22   Kamptonema
gb|ACJ84361.1|  unknown                                               98.6    6e-22   Medicago truncatula
gb|ABR25484.1|  ferredoxin--nadp reductase, leaf isozyme                100   6e-22   Oryza sativa Indica Group [Indian rice]
dbj|BAD07827.1|  putative ferredoxin-NADP(H) oxidoreductase             101   6e-22   Oryza sativa Japonica Group [Japonica rice]
gb|EAY84091.1|  hypothetical protein OsI_05475                          101   6e-22   Oryza sativa Indica Group [Indian rice]
ref|XP_011099850.1|  PREDICTED: ferredoxin--NADP reductase, leaf-...    101   7e-22   Sesamum indicum [beniseed]
ref|NP_001045608.1|  Os02g0103800                                       101   7e-22   
ref|WP_039727293.1|  MULTISPECIES: ferredoxin-NADP reductase            101   7e-22   Lyngbya confervoides
ref|WP_019504594.1|  hypothetical protein                               101   7e-22   Pleurocapsa sp. PCC 7319
ref|XP_011043184.1|  PREDICTED: ferredoxin--NADP reductase, leaf ...    100   8e-22   Populus euphratica
ref|XP_007046687.1|  Ferredoxin-NADP(+)-oxidoreductase 2                100   9e-22   
ref|XP_005835894.1|  hypothetical protein GUITHDRAFT_162347             100   9e-22   Guillardia theta CCMP2712
ref|XP_010920179.1|  PREDICTED: ferredoxin--NADP reductase, leaf ...    100   1e-21   
ref|XP_008361344.1|  PREDICTED: ferredoxin--NADP reductase, leaf ...    100   1e-21   Malus domestica [apple tree]
ref|WP_015203026.1|  ferredoxin--NADP(+) reductase                      100   1e-21   Crinalium epipsammum
ref|XP_011010543.1|  PREDICTED: ferredoxin--NADP reductase, leaf ...    100   1e-21   Populus euphratica
ref|WP_026720816.1|  ferredoxin-NADP reductase                          100   1e-21   Hapalosiphonaceae
ref|WP_016860625.1|  ferredoxin--NADP reductase                         100   1e-21   Fischerella muscicola
ref|XP_010113341.1|  Ferredoxin--NADP reductase, leaf isozyme           100   1e-21   
ref|WP_017312089.1|  MULTISPECIES: ferredoxin--NADP reductase           100   1e-21   Hapalosiphonaceae
ref|XP_010459681.1|  PREDICTED: ferredoxin--NADP reductase, leaf ...    100   2e-21   Camelina sativa [gold-of-pleasure]
pdb|1GAQ|A  Chain A, Crystal Structure Of The Complex Between Fer...  99.8    2e-21   Zea mays [maize]
ref|XP_009413066.1|  PREDICTED: ferredoxin--NADP reductase, leaf ...    100   2e-21   Musa acuminata subsp. malaccensis [pisang utan]
gb|KJB48299.1|  hypothetical protein B456_008G062600                  98.2    2e-21   Gossypium raimondii
ref|WP_015146553.1|  oxidoreductase FAD-binding domain-containing...    100   2e-21   Oscillatoria acuminata
ref|XP_010477227.1|  PREDICTED: ferredoxin--NADP reductase, leaf ...    100   2e-21   Camelina sativa [gold-of-pleasure]
ref|XP_003575004.1|  PREDICTED: ferredoxin--NADP reductase, leaf ...    100   2e-21   Brachypodium distachyon [annual false brome]
ref|XP_010498430.1|  PREDICTED: ferredoxin--NADP reductase, leaf ...    100   2e-21   Camelina sativa [gold-of-pleasure]
pdb|3W5U|A  Chain A, Cross-linked Complex Between Ferredoxin And ...  99.8    2e-21   Zea mays [maize]
ref|NP_001105568.1|  ferredoxin                                       99.8    2e-21   
gb|KJB58055.1|  hypothetical protein B456_009G194200                  99.0    2e-21   Gossypium raimondii
ref|XP_009390794.1|  PREDICTED: ferredoxin--NADP reductase, leaf ...  99.8    2e-21   Musa acuminata subsp. malaccensis [pisang utan]
gb|KJB48301.1|  hypothetical protein B456_008G062600                  98.6    2e-21   Gossypium raimondii
emb|CAD30025.1|  ferredoxin-NADP(H) oxidoreductase                    99.8    2e-21   Triticum aestivum [Canadian hard winter wheat]
ref|XP_008448550.1|  PREDICTED: ferredoxin--NADP reductase, leaf ...  99.8    2e-21   
ref|XP_003520228.1|  PREDICTED: ferredoxin--NADP reductase, leaf ...  99.8    2e-21   Glycine max [soybeans]
gb|EPS58323.1|  hypothetical protein M569_16492                       99.0    2e-21   Genlisea aurea
gb|KJB48298.1|  hypothetical protein B456_008G062600                  98.6    3e-21   Gossypium raimondii
ref|WP_009631217.1|  sulfite reductase, alpha subunit (flavoprotein)    100   3e-21   Synechocystis sp. PCC 7509
ref|XP_002274366.2|  PREDICTED: ferredoxin--NADP reductase, leaf-...  99.4    3e-21   Vitis vinifera
ref|XP_004952968.1|  PREDICTED: ferredoxin--NADP reductase, leaf ...  99.4    3e-21   Setaria italica
ref|XP_008448551.1|  PREDICTED: ferredoxin--NADP reductase, leaf ...  99.4    3e-21   Cucumis melo [Oriental melon]
gb|ERT04099.1|  ferredoxin--NADP reductase                            99.0    3e-21   Lyngbya aestuarii BL J
ref|XP_004952967.1|  PREDICTED: ferredoxin--NADP reductase, leaf ...  99.4    3e-21   
ref|XP_010029673.1|  PREDICTED: ferredoxin--NADP reductase, leaf ...  99.4    3e-21   Eucalyptus grandis [rose gum]
ref|WP_015118897.1|  FAD binding domaincontaining protein             99.8    3e-21   Rivularia sp. PCC 7116
gb|KJB48303.1|  hypothetical protein B456_008G062600                  99.0    3e-21   Gossypium raimondii
gb|KCW56622.1|  hypothetical protein EUGRSUZ_I02340                   99.0    3e-21   Eucalyptus grandis [rose gum]
ref|WP_009782586.1|  ferredoxin--NADP reductase                       99.4    3e-21   
gb|KJB48300.1|  hypothetical protein B456_008G062600                  97.8    3e-21   
ref|XP_007156158.1|  hypothetical protein PHAVU_003G263200g           99.0    3e-21   
ref|WP_008276486.1|  ferredoxin--NADP reductase                       99.4    3e-21   
ref|WP_008314925.1|  Oxidoreductase                                   99.4    3e-21   
ref|XP_002291633.1|  predicted protein                                98.6    4e-21   
gb|AFK38965.1|  unknown                                               97.8    4e-21   
sp|P41346.1|FENR_VICFA  RecName: Full=Ferredoxin--NADP reductase,...  99.0    4e-21   
gb|KFK44126.1|  hypothetical protein AALP_AA1G219100                  99.0    4e-21   
ref|WP_040484716.1|  ferredoxin-NADP reductase                        99.4    4e-21   
ref|XP_003547929.1|  PREDICTED: ferredoxin--NADP reductase, leaf ...  99.0    4e-21   
ref|WP_015179262.1|  Ferredoxin--NADP(+) reductase                    99.4    4e-21   
gb|KEH27588.1|  leaf ferredoxin-NADP reductase                        97.8    4e-21   
ref|WP_009459578.1|  MULTISPECIES: ferredoxin--NADP reductase         99.4    4e-21   
gb|KJB58054.1|  hypothetical protein B456_009G194200                  99.0    4e-21   
ref|XP_004170232.1|  PREDICTED: ferredoxin--NADP reductase, leaf ...  99.0    4e-21   
ref|XP_004146142.1|  PREDICTED: ferredoxin--NADP reductase, leaf ...  99.0    4e-21   
ref|XP_002510546.1|  ferredoxin--NADP reductase, putative             99.0    4e-21   
gb|AAF79911.1|AC022472_20  Contains similarity to ferredoxin-NADP...  98.6    4e-21   
gb|KJB58057.1|  hypothetical protein B456_009G194200                  99.0    4e-21   
gb|KHN01599.1|  Ferredoxin--NADP reductase, leaf isozyme, chlorop...  99.0    4e-21   
gb|EJK44714.1|  hypothetical protein THAOC_36724                      99.0    4e-21   
ref|XP_006304543.1|  hypothetical protein CARUB_v10011511mg           99.0    4e-21   
ref|XP_002437683.1|  hypothetical protein SORBIDRAFT_10g000720        98.6    5e-21   
ref|XP_003612185.1|  Ferredoxin-NADP reductase                        98.6    5e-21   
ref|NP_001077566.1|  ferredoxin--NADP reductase, leaf isozyme 2       98.6    5e-21   
ref|NP_173431.1|  ferredoxin--NADP reductase, leaf isozyme 2          98.6    5e-21   
ref|XP_004512139.1|  PREDICTED: ferredoxin--NADP reductase, leaf ...  98.6    5e-21   
gb|ABK21671.1|  unknown                                               98.6    5e-21   
sp|P00454.1|FENR_SPISP  RecName: Full=Ferredoxin--NADP reductase;...  98.2    5e-21   
emb|CDY43420.1|  BnaC07g14870D                                        98.6    5e-21   
ref|WP_016869824.1|  ferredoxin--NADP reductase                       99.0    6e-21   
emb|CAN59785.1|  hypothetical protein VITISV_042164                   98.6    6e-21   
ref|XP_002183949.1|  predicted protein                                98.2    6e-21   
ref|WP_006669353.1|  MULTISPECIES: ferredoxin--NADP reductase         98.6    6e-21   
dbj|BAH19611.1|  AT1G20020                                            97.8    6e-21   
ref|WP_006616221.1|  ferredoxin--NADP reductase                       98.6    6e-21   
gb|KDP46763.1|  hypothetical protein JCGZ_06551                       98.6    6e-21   
ref|XP_002265774.1|  PREDICTED: ferredoxin--NADP reductase, leaf-...  98.2    6e-21   
emb|CDX81408.1|  BnaC09g08190D                                        98.2    6e-21   
gb|ABK22336.1|  unknown                                               98.2    7e-21   
ref|XP_009110244.1|  PREDICTED: ferredoxin--NADP reductase, leaf ...  98.2    8e-21   
ref|XP_010536398.1|  PREDICTED: ferredoxin--NADP reductase, leaf ...  98.2    8e-21   
ref|XP_002992727.1|  hypothetical protein SELMODRAFT_25109            97.8    8e-21   
emb|CDX83730.1|  BnaC08g19150D                                        98.2    8e-21   
gb|KGN55659.1|  hypothetical protein Csa_3G002780                     98.2    8e-21   
emb|CDY62940.1|  BnaA08g31180D                                        97.8    9e-21   
gb|EYU30800.1|  hypothetical protein MIMGU_mgv1a008865mg              97.8    9e-21   
pdb|1QFY|A  Chain A, Pea Fnr Y308s Mutant In Complex With Nadp+       97.4    1e-20   
ref|WP_009556308.1|  FAD-binding protein                              98.2    1e-20   
ref|WP_038026814.1|  ferredoxin-NADP reductase                        97.4    1e-20   
pdb|1QGA|A  Chain A, Pea Fnr Y308w Mutant In Complex With Nadp+       97.4    1e-20   
pdb|4AF7|A  Chain A, Pea Fnr C266m Mutant                             97.4    1e-20   
sp|P10933.1|FENR1_PEA  RecName: Full=Ferredoxin--NADP reductase, ...  97.4    1e-20   
pdb|3MHP|A  Chain A, Fnr-Recruitment To The Thylakoid                 97.1    1e-20   
pdb|1QG0|A  Chain A, Wild-type Pea Fnr                                97.1    1e-20   
pdb|4AF6|A  Chain A, Pea Fnr L268v Mutant                             97.1    1e-20   
ref|XP_006416443.1|  hypothetical protein EUTSA_v10007988mg           97.4    1e-20   
gb|ABO87610.1|  chloroplast ferredoxin-NADP+ reductase                97.4    1e-20   
gb|AAX57356.1|  putative ferredoxin-NADP reductase                    97.1    1e-20   
ref|YP_002049405.1|  ferredoxin--NADP reductase (FNR)                 97.4    1e-20   
ref|WP_006624012.1|  ferredoxin--NADP reductase                       97.4    1e-20   
ref|XP_002890363.1|  ATLFNR2                                          97.1    2e-20   
ref|XP_004232495.1|  PREDICTED: ferredoxin--NADP reductase, leaf-...  97.1    2e-20   
ref|WP_012630377.1|  ferredoxin--NADP reductase                       97.4    2e-20   
emb|CAA55406.1|  ferredoxin NADP reductase                            96.3    2e-20   
ref|XP_007157909.1|  hypothetical protein PHAVU_002G108000g           97.1    2e-20   
ref|WP_015165197.1|  ferredoxin--NADP(+) reductase                    96.3    2e-20   
ref|WP_006453519.1|  ferredoxin--NADP reductase                       97.1    2e-20   
ref|WP_026797072.1|  MULTISPECIES: ferredoxin-NADP reductase          97.1    3e-20   
ref|WP_015133505.1|  ferredoxin--NADP(+) reductase                    96.7    3e-20   
ref|WP_016923929.1|  hypothetical protein                             96.3    3e-20   
ref|WP_017296635.1|  hypothetical protein                             97.1    3e-20   
ref|XP_009588213.1|  PREDICTED: ferredoxin--NADP reductase, leaf-...  96.7    3e-20   
ref|XP_009794242.1|  PREDICTED: ferredoxin--NADP reductase, leaf-...  96.7    3e-20   
gb|AAZ85322.1|  putative ferredoxin NADP reductase                    96.3    3e-20   
gb|AFO59573.1|  ferredoxin-NADP reductase                             96.3    3e-20   
ref|WP_036533347.1|  ferredoxin-NADP reductase                        96.7    3e-20   
ref|WP_017303294.1|  hypothetical protein                             96.3    4e-20   
ref|XP_007017817.1|  Ferredoxin-NADP(+)-oxidoreductase 1, putativ...  95.1    4e-20   
ref|WP_040932423.1|  ferredoxin-NADP reductase                        95.5    4e-20   
ref|XP_006361933.1|  PREDICTED: ferredoxin--NADP reductase, leaf-...  95.9    4e-20   
gb|AAX57358.1|  putative ferredoxin-NADP reductase                    95.9    4e-20   
ref|XP_006340740.1|  PREDICTED: ferredoxin--NADP reductase, leaf-...  95.9    5e-20   
ref|WP_039713239.1|  ferredoxin-NADP reductase                        96.3    5e-20   
prf||1005223A  ferredoxin NADP oxidoreductase                         95.1    5e-20
gb|AAZ85313.1|  putative ferredoxin NADP reductase                    95.5    6e-20   
dbj|BAJ98295.1|  predicted protein                                    95.5    6e-20   
ref|WP_035831811.1|  ferredoxin-NADP reductase                        95.9    6e-20   
ref|WP_027838885.1|  ferredoxin-NADP reductase                        96.3    6e-20   
ref|XP_004951191.1|  PREDICTED: ferredoxin--NADP reductase, leaf ...  95.5    6e-20   
ref|WP_017661358.1|  hypothetical protein                             95.9    6e-20   
gb|KJB43314.1|  hypothetical protein B456_007G193800                  95.5    6e-20   
ref|XP_009103366.1|  PREDICTED: ferredoxin--NADP reductase, leaf ...  95.5    6e-20   
ref|WP_018399210.1|  hypothetical protein                             95.9    7e-20   
emb|CDY57601.1|  BnaAnng14750D                                        95.5    7e-20   
gb|KJB43317.1|  hypothetical protein B456_007G193800                  94.7    7e-20   
ref|WP_017322256.1|  ferredoxin--NADP reductase                       96.3    7e-20   
ref|WP_025891782.1|  MULTISPECIES: ferredoxin-NADP reductase          95.5    7e-20   
ref|WP_025973953.1|  ferredoxin-NADP reductase                        95.5    7e-20   
ref|WP_025888618.1|  ferredoxin-NADP reductase                        95.5    7e-20   
ref|WP_025881692.1|  ferredoxin-NADP reductase                        95.5    7e-20   
gb|KJB43315.1|  hypothetical protein B456_007G193800                  95.1    7e-20   
ref|WP_025939411.1|  ferredoxin-NADP reductase                        95.1    7e-20   
ref|WP_015153058.1|  oxidoreductase FAD/NAD(P)-binding domain-con...  95.9    8e-20   
emb|CAB71293.1|  chloroplast ferredoxin-NADP+ oxidoreductase prec...  95.1    8e-20   
gb|EMS50455.1|  Ferredoxin--NADP reductase, leaf isozyme, chlorop...  94.7    8e-20   
gb|KJB43316.1|  hypothetical protein B456_007G193800                  94.7    9e-20   
ref|WP_025900667.1|  ferredoxin-NADP reductase                        95.1    9e-20   
ref|WP_012306481.1|  ferredoxin--NADP reductase                       95.5    9e-20   
ref|WP_030007560.1|  ferredoxin-NADP reductase                        95.5    1e-19   
ref|WP_024544655.1|  ferredoxin-NADP reductase                        95.1    1e-19   
ref|WP_036917951.1|  MULTISPECIES: ferredoxin-NADP reductase          94.7    1e-19   
gb|EMT15804.1|  Ferredoxin--NADP reductase, leaf isozyme, chlorop...  94.7    1e-19   
gb|ACP17903.1|  ferredoxin-NADP reductase                             89.7    1e-19   
ref|WP_011933463.1|  ferredoxin--NADP reductase                       95.1    1e-19   
ref|WP_036002854.1|  ferredoxin-NADP reductase                        95.1    1e-19   
ref|WP_025958422.1|  ferredoxin-NADP reductase                        94.7    1e-19   
ref|XP_006844481.1|  hypothetical protein AMTR_s00016p00108610        94.7    1e-19   
ref|WP_044304925.1|  ferredoxin-NADP reductase                        95.1    1e-19   
ref|WP_025975443.1|  ferredoxin-NADP reductase                        94.7    1e-19   
ref|WP_041244148.1|  ferredoxin-NADP reductase                        94.4    1e-19   
gb|AGY56260.1|  benzoyl-CoA oxygenase/reductase, BoxA protein         94.4    1e-19   
gb|ABV50826.1|  ferredoxin-NADP oxidoreductase (FNR)                  94.7    1e-19   
ref|WP_025906619.1|  MULTISPECIES: ferredoxin-NADP reductase          94.7    1e-19   
ref|WP_015129089.1|  ferredoxin--NADP(+) reductase                    95.5    1e-19   
gb|KDO71229.1|  hypothetical protein CISIN_1g0430222mg                93.6    1e-19   
ref|WP_035984557.1|  ferredoxin-NADP reductase                        95.1    1e-19   
ref|WP_040937819.1|  ferredoxin-NADP reductase                        94.4    1e-19   
ref|WP_040944897.1|  ferredoxin-NADP reductase                        94.4    1e-19   
emb|CCH68057.1|  Ferredoxin-NADP(+) reductase                         95.1    2e-19   
ref|WP_010303595.1|  ferredoxin--NADP reductase                       94.7    2e-19   
ref|WP_041484386.1|  ferredoxin-NADP reductase                        94.4    2e-19   
ref|WP_015192030.1|  Ferredoxin--NADP(+) reductase                    94.7    2e-19   
ref|WP_015229409.1|  FAD binding domain-containing protein            94.4    2e-19   
ref|WP_026788790.1|  MULTISPECIES: ferredoxin-NADP reductase          94.4    2e-19   
ref|WP_026794586.1|  MULTISPECIES: ferredoxin-NADP reductase          94.4    2e-19   
ref|XP_006425452.1|  hypothetical protein CICLE_v10027108mg           94.0    2e-19   
ref|WP_027254306.1|  ferredoxin-NADP reductase                        94.4    2e-19   
ref|WP_022606197.1|  oxidoreductase NAD-binding domain/FAD bindin...  94.4    2e-19   
sp|P21890.2|FENR_NOSSO  RecName: Full=Ferredoxin--NADP reductase;...  94.7    2e-19   
ref|WP_026733813.1|  ferredoxin-NADP reductase                        94.7    2e-19   
gb|ABG52720.1|  oxidoreductase FAD/NAD(P)-binding                     94.4    3e-19   
ref|WP_011317640.1|  ferredoxin--NADP reductase                       94.7    3e-19   
ref|WP_011142292.1|  ferredoxin--NADP reductase                       93.2    3e-19   
pdb|2BSA|A  Chain A, Ferredoxin-Nadp Reductase (Mutation: Y 303 S...  93.2    3e-19   
ref|WP_025955871.1|  MULTISPECIES: ferredoxin-NADP reductase          94.0    3e-19   
gb|KIJ82541.1|  ferredoxin-NADP reductase                             94.4    3e-19   
ref|WP_006170829.1|  ferredoxin--NADP reductase                       94.0    3e-19   
pdb|1E64|A  Chain A, Ferredoxin:nadp+ Reductase Mutant With Lys 7...  93.2    3e-19   
sp|O04977.1|FENR1_TOBAC  RecName: Full=Ferredoxin--NADP reductase...  93.6    3e-19   
pdb|1W34|A  Chain A, Ferredoxin-Nadp Reductase (Mutation: Y 303 S)    93.2    3e-19   
pdb|1E63|A  Chain A, Ferredoxin:nadp+ Reductase Mutant With Lys 7...  93.2    3e-19   
ref|XP_006655693.1|  PREDICTED: ferredoxin--NADP reductase, leaf ...  93.6    3e-19   
ref|WP_025922412.1|  ferredoxin-NADP reductase                        93.6    3e-19   
pdb|1GO2|A  Chain A, Structure Of Ferredoxin-nadp+ Reductase With...  93.2    3e-19   
pdb|2X3U|A  Chain A, Ferredoxin-Nadp Reductase Mutant With Tyr 30...  93.2    3e-19   
ref|WP_010998260.1|  ferredoxin--NADP reductase                       94.4    3e-19   
emb|CDP01892.1|  unnamed protein product                              93.6    3e-19   
pdb|1SM4|A  Chain A, Crystal Structure Analysis Of The Ferredoxin...  93.2    3e-19   
pdb|1W35|A  Chain A, Ferredoxin-Nadp+ Reductase (Mutation: Y 303 W)   93.2    3e-19   
pdb|1B2R|A  Chain A, Ferredoxin-Nadp+ Reductase (Mutation: E 301 A)   93.2    3e-19   
pdb|1GJR|A  Chain A, Ferredoxin-Nadp+ Reductase Complexed With Na...  93.2    3e-19   
ref|WP_044137750.1|  ferredoxin-NADP reductase                        94.0    3e-19   
ref|WP_015957129.1|  ferredoxin--NADP reductase                       94.0    3e-19   
emb|CDJ26603.1|  unnamed protein product                              94.4    3e-19   
ref|WP_026148517.1|  ferredoxin-NADP reductase                        94.0    3e-19   
pdb|1GR1|A  Chain A, Structure Of Ferredoxin-Nadp+ Reductase With...  93.2    3e-19   
emb|CAA37973.1|  ferredoxin--NADP(+) reductase                        93.2    3e-19   
pdb|1QUF|A  Chain A, X-Ray Structure Of A Complex Nadp+-Ferredoxi...  93.2    3e-19   
ref|NP_001056570.1|  Os06g0107700                                     93.6    3e-19   
gb|EAY99350.1|  hypothetical protein OsI_21320                        93.6    3e-19   
pdb|2VYQ|A  Chain A, Ferredoxin:nadp Reductase Mutant With Thr 15...  93.2    3e-19   
ref|WP_002806441.1|  ferredoxin--NADP reductase                       93.6    3e-19   
pdb|1QUE|A  Chain A, X-Ray Structure Of The Ferredoxin:nadp+ Redu...  93.2    3e-19   
pdb|1OGJ|A  Chain A, Ferredoxin:nadp+ Reductase Mutant With Leu 2...  93.2    3e-19   
ref|WP_006527921.1|  Oxidoreductase NAD-binding domain protein        93.6    3e-19   
pdb|1E62|A  Chain A, Ferredoxin:nadp+ Reductase Mutant With Lys 7...  93.2    3e-19   
ref|WP_006852296.1|  ferredoxin--NADP reductase                       93.6    3e-19   
ref|WP_015189196.1|  Ferredoxin--NADP(+) reductase                    94.4    3e-19   
pdb|1OGI|A  Chain A, Ferredoxin:nadp+ Reductase Mutant With Thr 1...  93.2    3e-19   
pdb|1EWY|A  Chain A, Anabaena Pcc7119 Ferredoxin:ferredoxin-Nadp+...  93.2    3e-19   
ref|WP_011130473.1|  ferredoxin--NADP reductase                       93.2    3e-19   
pdb|1H85|A  Chain A, Ferredoxin:nadp+ Reductase Mutant With Val 1...  92.8    4e-19   
pdb|1BJK|A  Chain A, Ferredoxin:nadp+ Reductase Mutant With Arg 2...  92.8    4e-19   
pdb|1QGY|A  Chain A, Ferredoxin:nadp+ Reductase Mutant With Lys 7...  92.8    4e-19   
ref|WP_041437721.1|  ferredoxin-NADP reductase                        92.8    4e-19   
pdb|1H42|A  Chain A, Ferredoxin:nadp+ Reductase Mutant With Thr 1...  92.8    4e-19   
pdb|1BQE|A  Chain A, Ferredoxin:nadp+ Reductase Mutant With Thr 1...  92.8    4e-19   
gb|ABD03802.1|  ferredoxin--NADP reductase                            92.8    4e-19   
pdb|2BMW|A  Chain A, Ferredoxin: Nadp+reductase Mutant With Thr 1...  92.8    4e-19   
pdb|2XNC|A  Chain A, Crystal Structure Of An Engineered Ferredoxi...  92.8    4e-19   
ref|WP_012953929.1|  ferredoxin--NADP reductase                       92.8    4e-19   
ref|XP_003557263.1|  PREDICTED: ferredoxin--NADP reductase, leaf ...  93.2    5e-19   
ref|WP_025956780.1|  ferredoxin-NADP reductase                        93.2    5e-19   
emb|CAD30024.2|  ferredoxin-NADP(H) oxidoreductase                    92.8    5e-19   
ref|WP_010476014.1|  ferredoxin--NADP reductase                       92.4    5e-19   
ref|WP_025925380.1|  MULTISPECIES: ferredoxin-NADP reductase          92.8    6e-19   
ref|WP_017745124.1|  ferredoxin--NADP reductase                       93.6    6e-19   
ref|WP_015208880.1|  sulfite reductase, alpha subunit (flavoprotein)  94.0    6e-19   
gb|AEP13013.1|  Oxidoreductase NAD-binding domain protein             92.4    6e-19   
pdb|4C43|A  Chain A, Ferredoxin Nadp Reductase Mutant With Glu 10...  92.0    7e-19   
ref|WP_025968699.1|  ferredoxin-NADP reductase                        92.8    7e-19   
ref|WP_041570044.1|  ferredoxin-NADP reductase                        92.0    7e-19   
ref|WP_025941824.1|  MULTISPECIES: ferredoxin-NADP reductase          92.4    7e-19   
pdb|3ZBT|A  Chain A, Ferredoxin-nadp Reductase Mutant With Ser 59...  92.0    7e-19   
pdb|3ZBU|A  Chain A, Ferredoxin-nadp Reductase Mutant With Ser 80...  92.0    7e-19   
ref|WP_025893387.1|  ferredoxin-NADP reductase                        92.4    7e-19   
ref|WP_006518023.1|  FAD-binding protein                              92.8    8e-19   
pdb|4BPR|A  Chain A, Ferredoxin-nadp Reductase Mutant With Tyr 79...  92.0    8e-19   
ref|WP_032519107.1|  ferredoxin-NADP reductase                        92.4    8e-19   
gb|KIE10321.1|  ferredoxin-NADP reductase                             93.2    8e-19   
ref|WP_015145548.1|  oxidoreductase NAD-binding domain-containing...  92.8    8e-19   
ref|WP_011132708.1|  ferredoxin--NADP reductase                       92.4    9e-19   
ref|WP_006507842.1|  Oxidoreductase FAD-binding domain protein        92.4    9e-19   
ref|WP_013320531.1|  ferredoxin--NADP reductase                       92.4    1e-18   
ref|WP_010873079.1|  ferredoxin--NADP reductase                       92.8    1e-18   
ref|WP_043326144.1|  ferredoxin-NADP reductase                        92.4    1e-18   
gb|AFK41176.1|  unknown                                               92.0    1e-18   
ref|WP_011825598.1|  ferredoxin--NADP reductase                       92.0    1e-18   
ref|WP_040055011.1|  ferredoxin--NADP reductase                       91.3    1e-18   



>ref|XP_006344529.1| PREDICTED: ferredoxin--NADP reductase, root-type isozyme, chloroplastic-like 
[Solanum tuberosum]
Length=374

 Score =   293 bits (750),  Expect = 5e-95, Method: Compositional matrix adjust.
 Identities = 143/182 (79%), Positives = 157/182 (86%), Gaps = 2/182 (1%)
 Frame = +3

Query  54   AVSQLMQVSVAVALNGDSSLQRSAFKANSITFNNRSPISFQPFDLKTRNGKSRSQYVVCM  233
            A S + QVSVAV L  DSS +RS FKA S+TF+++  IS    DLK    +SRSQY+VCM
Sbjct  2    AHSAISQVSVAVPLQTDSSFRRSTFKATSLTFSDKLCISMPSIDLKA--ARSRSQYIVCM  59

Query  234  SVQQANIPKVTVSPLSLEDAKEPPLNLYKPKGPYTATIASVERIVGPKAPGETCHIVIDH  413
            SVQQA+  KV+VSPLSLEDAKEPPLN+YKPK PYTATI SVERIVGPKAPGETCHIVIDH
Sbjct  60   SVQQASKAKVSVSPLSLEDAKEPPLNIYKPKEPYTATIVSVERIVGPKAPGETCHIVIDH  119

Query  414  GGNVPYWEGQSYGVIPPGENPKKPGSPHNVRLYSIASSRYGDSFDGKTTSLCVRRAVYYD  593
             GN+PYWEGQSYGV+PPGENPKKPGSPHNVRLYSIAS+RYGDSFDGKT SLCVRRAVYYD
Sbjct  120  DGNLPYWEGQSYGVVPPGENPKKPGSPHNVRLYSIASTRYGDSFDGKTASLCVRRAVYYD  179

Query  594  PE  599
            PE
Sbjct  180  PE  181



>ref|XP_006363650.1| PREDICTED: ferredoxin--NADP reductase, root-type isozyme, chloroplastic-like 
[Solanum tuberosum]
Length=374

 Score =   293 bits (750),  Expect = 6e-95, Method: Compositional matrix adjust.
 Identities = 143/182 (79%), Positives = 157/182 (86%), Gaps = 2/182 (1%)
 Frame = +3

Query  54   AVSQLMQVSVAVALNGDSSLQRSAFKANSITFNNRSPISFQPFDLKTRNGKSRSQYVVCM  233
            A S + QVSVAV L  DSS +RS FKA S+TF+++S IS    DLK    +SRSQY+VCM
Sbjct  2    AHSAISQVSVAVPLQTDSSFRRSTFKATSLTFSDKSCISMPSIDLKAT--RSRSQYIVCM  59

Query  234  SVQQANIPKVTVSPLSLEDAKEPPLNLYKPKGPYTATIASVERIVGPKAPGETCHIVIDH  413
            SVQ A+  KV+VSPLSLEDAKEPPLN+YKPK PYTATI SVERIVGPKAPGETCHIVIDH
Sbjct  60   SVQHASKAKVSVSPLSLEDAKEPPLNIYKPKEPYTATIVSVERIVGPKAPGETCHIVIDH  119

Query  414  GGNVPYWEGQSYGVIPPGENPKKPGSPHNVRLYSIASSRYGDSFDGKTTSLCVRRAVYYD  593
             GN+PYWEGQSYGV+PPGENPKKPGSPHNVRLYSIAS+RYGDSFDGKT SLCVRRAVYYD
Sbjct  120  DGNLPYWEGQSYGVVPPGENPKKPGSPHNVRLYSIASTRYGDSFDGKTASLCVRRAVYYD  179

Query  594  PE  599
            PE
Sbjct  180  PE  181



>ref|XP_009362229.1| PREDICTED: ferredoxin--NADP reductase, root isozyme, chloroplastic 
[Pyrus x bretschneideri]
Length=377

 Score =   292 bits (747),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 139/178 (78%), Positives = 153/178 (86%), Gaps = 0/178 (0%)
 Frame = +3

Query  66   LMQVSVAVALNGDSSLQRSAFKANSITFNNRSPISFQPFDLKTRNGKSRSQYVVCMSVQQ  245
            L Q S+ V +  D SL+RS FKA S+ FN++S     P DLKT+NG+ R+Q +VCMSVQQ
Sbjct  6    LSQGSLTVPVASDFSLRRSVFKARSVNFNDKSWAPILPLDLKTKNGQLRNQRIVCMSVQQ  65

Query  246  ANIPKVTVSPLSLEDAKEPPLNLYKPKGPYTATIASVERIVGPKAPGETCHIVIDHGGNV  425
            A+ PKV V+PL LEDA EPPLN+YKPK PYTATI SVERIVGPKAPGETCHIVIDHGGNV
Sbjct  66   ASAPKVNVAPLQLEDANEPPLNIYKPKEPYTATILSVERIVGPKAPGETCHIVIDHGGNV  125

Query  426  PYWEGQSYGVIPPGENPKKPGSPHNVRLYSIASSRYGDSFDGKTTSLCVRRAVYYDPE  599
            PYWEGQSYGVIPPGENPKKPG+PHNVRLYSIASSRYGD FDGKTTSLCVRRAVYYDPE
Sbjct  126  PYWEGQSYGVIPPGENPKKPGAPHNVRLYSIASSRYGDYFDGKTTSLCVRRAVYYDPE  183



>ref|XP_009761528.1| PREDICTED: ferredoxin--NADP reductase, root-type isozyme, chloroplastic 
[Nicotiana sylvestris]
Length=375

 Score =   292 bits (747),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 145/183 (79%), Positives = 159/183 (87%), Gaps = 3/183 (2%)
 Frame = +3

Query  54   AVSQLMQVSVAVALNGDSSLQRSAFKANSITFNNRSP-ISFQPFDLKTRNGKSRSQYVVC  230
            A S L QVSVAV L  DSS +RS FKA S+TF++RS  IS  P DLK    +SR+Q++VC
Sbjct  2    AHSALSQVSVAVPLQTDSSFRRSTFKATSVTFSDRSSWISMPPIDLKA--PRSRNQHIVC  59

Query  231  MSVQQANIPKVTVSPLSLEDAKEPPLNLYKPKGPYTATIASVERIVGPKAPGETCHIVID  410
            MSVQQA+  KV+VSPLSLEDAKEPPLN+YKPK PYTATI SVER+VGPKAPGETCHIVID
Sbjct  60   MSVQQASKAKVSVSPLSLEDAKEPPLNIYKPKEPYTATIVSVERLVGPKAPGETCHIVID  119

Query  411  HGGNVPYWEGQSYGVIPPGENPKKPGSPHNVRLYSIASSRYGDSFDGKTTSLCVRRAVYY  590
            H GN+PYWEGQSYGVIPPGENPKKPGSPHNVRLYSIAS+RYGDSFDGKT SLCVRRAVYY
Sbjct  120  HDGNLPYWEGQSYGVIPPGENPKKPGSPHNVRLYSIASTRYGDSFDGKTASLCVRRAVYY  179

Query  591  DPE  599
            DPE
Sbjct  180  DPE  182



>ref|XP_009614066.1| PREDICTED: ferredoxin--NADP reductase, root-type isozyme, chloroplastic 
[Nicotiana tomentosiformis]
Length=375

 Score =   291 bits (744),  Expect = 5e-94, Method: Compositional matrix adjust.
 Identities = 145/183 (79%), Positives = 158/183 (86%), Gaps = 3/183 (2%)
 Frame = +3

Query  54   AVSQLMQVSVAVALNGDSSLQRSAFKANSITFNNRSP-ISFQPFDLKTRNGKSRSQYVVC  230
            A S L QVSVAV L  DSS +RS FKA SITF++RS  IS  P DLK     SR+Q++VC
Sbjct  2    AHSALSQVSVAVPLQTDSSFRRSTFKATSITFSDRSSWISMPPIDLKA--APSRNQHIVC  59

Query  231  MSVQQANIPKVTVSPLSLEDAKEPPLNLYKPKGPYTATIASVERIVGPKAPGETCHIVID  410
            MSVQQA+  KV+VSPLSLEDAKEPPLN+YKPK PYTATI SVER+VGPKAPGETCHIVID
Sbjct  60   MSVQQASKAKVSVSPLSLEDAKEPPLNIYKPKEPYTATIVSVERLVGPKAPGETCHIVID  119

Query  411  HGGNVPYWEGQSYGVIPPGENPKKPGSPHNVRLYSIASSRYGDSFDGKTTSLCVRRAVYY  590
            H GN+PYWEGQSYGVIPPGENPKKPG+PHNVRLYSIAS+RYGDSFDGKT SLCVRRAVYY
Sbjct  120  HDGNLPYWEGQSYGVIPPGENPKKPGNPHNVRLYSIASTRYGDSFDGKTASLCVRRAVYY  179

Query  591  DPE  599
            DPE
Sbjct  180  DPE  182



>ref|XP_008346149.1| PREDICTED: ferredoxin--NADP reductase, root isozyme, chloroplastic 
[Malus domestica]
Length=377

 Score =   290 bits (742),  Expect = 1e-93, Method: Compositional matrix adjust.
 Identities = 138/178 (78%), Positives = 153/178 (86%), Gaps = 0/178 (0%)
 Frame = +3

Query  66   LMQVSVAVALNGDSSLQRSAFKANSITFNNRSPISFQPFDLKTRNGKSRSQYVVCMSVQQ  245
            L Q S+ V +  D SL+RS FKA S+ FN++S     P DLKT+NG+ R+Q +VCMSVQQ
Sbjct  6    LSQGSLTVPVASDFSLRRSVFKAQSVNFNDKSWAPILPLDLKTKNGQLRNQRIVCMSVQQ  65

Query  246  ANIPKVTVSPLSLEDAKEPPLNLYKPKGPYTATIASVERIVGPKAPGETCHIVIDHGGNV  425
            A+ PKV V+PL LEDA EPPLN++KPK PYTATI SVERIVGPKAPGETCHIVIDHGGNV
Sbjct  66   ASAPKVNVAPLQLEDANEPPLNIHKPKEPYTATILSVERIVGPKAPGETCHIVIDHGGNV  125

Query  426  PYWEGQSYGVIPPGENPKKPGSPHNVRLYSIASSRYGDSFDGKTTSLCVRRAVYYDPE  599
            PYWEGQSYGVIPPGENPKKPG+PHNVRLYSIASSRYGD FDGKTTSLCVRRAVYYDPE
Sbjct  126  PYWEGQSYGVIPPGENPKKPGAPHNVRLYSIASSRYGDYFDGKTTSLCVRRAVYYDPE  183



>ref|XP_004231567.1| PREDICTED: ferredoxin--NADP reductase, root-type isozyme, chloroplastic 
[Solanum lycopersicum]
Length=374

 Score =   289 bits (739),  Expect = 3e-93, Method: Compositional matrix adjust.
 Identities = 141/182 (77%), Positives = 156/182 (86%), Gaps = 2/182 (1%)
 Frame = +3

Query  54   AVSQLMQVSVAVALNGDSSLQRSAFKANSITFNNRSPISFQPFDLKTRNGKSRSQYVVCM  233
            A S + QVSVAV L  DSS +RS FKA S+TF+++S IS    DLK    +SRSQY+VCM
Sbjct  2    AHSAISQVSVAVPLQTDSSFRRSTFKATSLTFSDKSCISMPSIDLKAT--RSRSQYIVCM  59

Query  234  SVQQANIPKVTVSPLSLEDAKEPPLNLYKPKGPYTATIASVERIVGPKAPGETCHIVIDH  413
            SVQ A+  KV+VSPLSLE+A EPPLN+YKPK PYTATI SVERIVGPKAPGETCHIVIDH
Sbjct  60   SVQHASKAKVSVSPLSLENATEPPLNIYKPKEPYTATIVSVERIVGPKAPGETCHIVIDH  119

Query  414  GGNVPYWEGQSYGVIPPGENPKKPGSPHNVRLYSIASSRYGDSFDGKTTSLCVRRAVYYD  593
             GN+PYWEGQSYGV+PPGENPKKPGSPHNVRLYSIAS+RYGDSFDGKT SLCVRRAVYYD
Sbjct  120  DGNLPYWEGQSYGVVPPGENPKKPGSPHNVRLYSIASTRYGDSFDGKTASLCVRRAVYYD  179

Query  594  PE  599
            PE
Sbjct  180  PE  181



>sp|O04397.1|FENR2_TOBAC RecName: Full=Ferredoxin--NADP reductase, root-type isozyme, 
chloroplastic; Short=FNR; Flags: Precursor [Nicotiana tabacum]
 dbj|BAA20365.1| ferredoxin-NADP oxidoreductase [Nicotiana tabacum]
Length=375

 Score =   289 bits (739),  Expect = 3e-93, Method: Compositional matrix adjust.
 Identities = 144/183 (79%), Positives = 157/183 (86%), Gaps = 3/183 (2%)
 Frame = +3

Query  54   AVSQLMQVSVAVALNGDSSLQRSAFKANSITFNNRSP-ISFQPFDLKTRNGKSRSQYVVC  230
            A S L QVSVAV L  DSS +RS FKA SITF++RS  IS  P DLK     SR+Q++VC
Sbjct  2    AHSALSQVSVAVPLQTDSSFRRSTFKATSITFSDRSSWISMPPIDLKA--APSRNQHIVC  59

Query  231  MSVQQANIPKVTVSPLSLEDAKEPPLNLYKPKGPYTATIASVERIVGPKAPGETCHIVID  410
            MSVQQA+  KV+VSPLSLEDAKEPPLN+YKPK PYTATI SVER+VGPKAPGETCHIVID
Sbjct  60   MSVQQASKAKVSVSPLSLEDAKEPPLNIYKPKEPYTATIVSVERLVGPKAPGETCHIVID  119

Query  411  HGGNVPYWEGQSYGVIPPGENPKKPGSPHNVRLYSIASSRYGDSFDGKTTSLCVRRAVYY  590
            H GN+PYWEGQSYGVIPPGENPKKPG+PHNVRLY IAS+RYGDSFDGKT SLCVRRAVYY
Sbjct  120  HDGNLPYWEGQSYGVIPPGENPKKPGNPHNVRLYLIASTRYGDSFDGKTASLCVRRAVYY  179

Query  591  DPE  599
            DPE
Sbjct  180  DPE  182



>ref|XP_002523191.1| ferredoxin--NADP reductase, putative [Ricinus communis]
 gb|EEF39222.1| ferredoxin--NADP reductase, putative [Ricinus communis]
Length=378

 Score =   289 bits (739),  Expect = 3e-93, Method: Compositional matrix adjust.
 Identities = 137/184 (74%), Positives = 158/184 (86%), Gaps = 0/184 (0%)
 Frame = +3

Query  48   MAAVSQLMQVSVAVALNGDSSLQRSAFKANSITFNNRSPISFQPFDLKTRNGKSRSQYVV  227
            MA  + + QVS+AV +  DS+L+RS FK +SI+F+ +S       DLK+R  + ++QYVV
Sbjct  1    MAHSAAVSQVSLAVPVGSDSTLKRSVFKTHSISFSGKSWAPSLALDLKSRKVQLKNQYVV  60

Query  228  CMSVQQANIPKVTVSPLSLEDAKEPPLNLYKPKGPYTATIASVERIVGPKAPGETCHIVI  407
            CMSVQQA+  KV VSPL LEDAKEPPLNLYKPK PYTATIASVER+VGPKAPGETCHIVI
Sbjct  61   CMSVQQASRSKVAVSPLELEDAKEPPLNLYKPKEPYTATIASVERLVGPKAPGETCHIVI  120

Query  408  DHGGNVPYWEGQSYGVIPPGENPKKPGSPHNVRLYSIASSRYGDSFDGKTTSLCVRRAVY  587
            DHGGNVPYWEGQSYGVIPPGENPKKPG+PHNVRLYSIAS+RYGD+FDGKT +LCVRRA+Y
Sbjct  121  DHGGNVPYWEGQSYGVIPPGENPKKPGAPHNVRLYSIASTRYGDNFDGKTATLCVRRALY  180

Query  588  YDPE  599
            YDPE
Sbjct  181  YDPE  184



>gb|KJB56287.1| hypothetical protein B456_009G115100 [Gossypium raimondii]
Length=349

 Score =   283 bits (723),  Expect = 3e-91, Method: Compositional matrix adjust.
 Identities = 138/182 (76%), Positives = 152/182 (84%), Gaps = 0/182 (0%)
 Frame = +3

Query  54   AVSQLMQVSVAVALNGDSSLQRSAFKANSITFNNRSPISFQPFDLKTRNGKSRSQYVVCM  233
            A S + QVSVAV +  D SL+RS  K + I+F N+S  S   FDLK+RN +    Y+VCM
Sbjct  2    AQSTVSQVSVAVPVGNDISLRRSVTKRDIISFGNKSWASTLSFDLKSRNAQKNKPYIVCM  61

Query  234  SVQQANIPKVTVSPLSLEDAKEPPLNLYKPKGPYTATIASVERIVGPKAPGETCHIVIDH  413
            SVQQA+  K+ VSPL LE AKEPPLN +KPK PYTATI SVER+VGPKAPGETCHIVIDH
Sbjct  62   SVQQASKSKIAVSPLELEIAKEPPLNTFKPKEPYTATIVSVERLVGPKAPGETCHIVIDH  121

Query  414  GGNVPYWEGQSYGVIPPGENPKKPGSPHNVRLYSIASSRYGDSFDGKTTSLCVRRAVYYD  593
            GGNVPYWEGQSYGVIPPGENPKKPGSPHNVRLYSIASSRYGDSFDGKTTSLCVRRAVYY+
Sbjct  122  GGNVPYWEGQSYGVIPPGENPKKPGSPHNVRLYSIASSRYGDSFDGKTTSLCVRRAVYYN  181

Query  594  PE  599
            PE
Sbjct  182  PE  183



>ref|XP_008383404.1| PREDICTED: ferredoxin--NADP reductase, root isozyme, chloroplastic-like 
[Malus domestica]
Length=379

 Score =   284 bits (726),  Expect = 3e-91, Method: Compositional matrix adjust.
 Identities = 133/175 (76%), Positives = 149/175 (85%), Gaps = 0/175 (0%)
 Frame = +3

Query  75   VSVAVALNGDSSLQRSAFKANSITFNNRSPISFQPFDLKTRNGKSRSQYVVCMSVQQANI  254
            ++V V L  D SL+RS FKA S++FN++S     P D KT+NG+ R+Q ++CMSVQQA+ 
Sbjct  11   LTVTVPLGSDFSLRRSVFKARSVSFNDKSWTPILPLDFKTKNGRLRNQRILCMSVQQASA  70

Query  255  PKVTVSPLSLEDAKEPPLNLYKPKGPYTATIASVERIVGPKAPGETCHIVIDHGGNVPYW  434
            PKV V+PL LEDA EPPLN YKPK PYTATI SVERIVGP APGETCHIVIDHGGNVPYW
Sbjct  71   PKVNVAPLQLEDANEPPLNTYKPKEPYTATILSVERIVGPNAPGETCHIVIDHGGNVPYW  130

Query  435  EGQSYGVIPPGENPKKPGSPHNVRLYSIASSRYGDSFDGKTTSLCVRRAVYYDPE  599
            EGQSYGVIPPGENPKKPG+P NVRLYSIAS+RYGD FDGKTTSLCVRRAVYYDPE
Sbjct  131  EGQSYGVIPPGENPKKPGAPQNVRLYSIASTRYGDYFDGKTTSLCVRRAVYYDPE  185



>ref|XP_007211443.1| hypothetical protein PRUPE_ppa007232mg [Prunus persica]
 gb|EMJ12642.1| hypothetical protein PRUPE_ppa007232mg [Prunus persica]
Length=377

 Score =   283 bits (725),  Expect = 3e-91, Method: Compositional matrix adjust.
 Identities = 136/178 (76%), Positives = 149/178 (84%), Gaps = 0/178 (0%)
 Frame = +3

Query  66   LMQVSVAVALNGDSSLQRSAFKANSITFNNRSPISFQPFDLKTRNGKSRSQYVVCMSVQQ  245
            + Q S+   +  D S++RS FKA SI FN++S       DLKT+NG  R+Q +VCMSVQQ
Sbjct  6    ISQGSLTAPVGSDFSIRRSVFKAQSINFNDKSWAPLLSLDLKTKNGGLRNQRIVCMSVQQ  65

Query  246  ANIPKVTVSPLSLEDAKEPPLNLYKPKGPYTATIASVERIVGPKAPGETCHIVIDHGGNV  425
            A++PKV VSPL LEDA EPPLN YKPK PYTATI SVERIVGPKAPGETCHIVIDHGGNV
Sbjct  66   ASVPKVAVSPLQLEDANEPPLNTYKPKEPYTATIRSVERIVGPKAPGETCHIVIDHGGNV  125

Query  426  PYWEGQSYGVIPPGENPKKPGSPHNVRLYSIASSRYGDSFDGKTTSLCVRRAVYYDPE  599
            PYWEGQSYGVIPPGENPKKPG+P NVRLYSIASSRYGD FDGKTTSLCVRRAVYYDPE
Sbjct  126  PYWEGQSYGVIPPGENPKKPGAPQNVRLYSIASSRYGDYFDGKTTSLCVRRAVYYDPE  183



>ref|XP_004293987.1| PREDICTED: ferredoxin--NADP reductase, root isozyme, chloroplastic 
[Fragaria vesca subsp. vesca]
Length=380

 Score =   283 bits (725),  Expect = 5e-91, Method: Compositional matrix adjust.
 Identities = 135/186 (73%), Positives = 159/186 (85%), Gaps = 2/186 (1%)
 Frame = +3

Query  48   MAAVSQLMQVSVA--VALNGDSSLQRSAFKANSITFNNRSPISFQPFDLKTRNGKSRSQY  221
            M+ +  L QVS+   V++  D+SL+RS FKA ++ F+++S     P DLKT++G+ R++ 
Sbjct  1    MSHLMALSQVSLGATVSVGSDASLRRSVFKAQNVNFSDKSWAPVLPLDLKTKSGRLRNKS  60

Query  222  VVCMSVQQANIPKVTVSPLSLEDAKEPPLNLYKPKGPYTATIASVERIVGPKAPGETCHI  401
            VVCMSVQQA+ PKV VSPL L++A EPPLN+YKPK PYTATI SVERIVGPKAPGETCHI
Sbjct  61   VVCMSVQQASAPKVAVSPLELDNATEPPLNIYKPKEPYTATIVSVERIVGPKAPGETCHI  120

Query  402  VIDHGGNVPYWEGQSYGVIPPGENPKKPGSPHNVRLYSIASSRYGDSFDGKTTSLCVRRA  581
            VIDHGGNVPYWEGQSYGVIPPGENPKKPG+P+NVRLYSIAS+RYGD FDGKTTSLCVRRA
Sbjct  121  VIDHGGNVPYWEGQSYGVIPPGENPKKPGAPNNVRLYSIASTRYGDYFDGKTTSLCVRRA  180

Query  582  VYYDPE  599
            VYYDPE
Sbjct  181  VYYDPE  186



>gb|KJB56286.1| hypothetical protein B456_009G115100 [Gossypium raimondii]
Length=376

 Score =   283 bits (723),  Expect = 6e-91, Method: Compositional matrix adjust.
 Identities = 138/182 (76%), Positives = 152/182 (84%), Gaps = 0/182 (0%)
 Frame = +3

Query  54   AVSQLMQVSVAVALNGDSSLQRSAFKANSITFNNRSPISFQPFDLKTRNGKSRSQYVVCM  233
            A S + QVSVAV +  D SL+RS  K + I+F N+S  S   FDLK+RN +    Y+VCM
Sbjct  2    AQSTVSQVSVAVPVGNDISLRRSVTKRDIISFGNKSWASTLSFDLKSRNAQKNKPYIVCM  61

Query  234  SVQQANIPKVTVSPLSLEDAKEPPLNLYKPKGPYTATIASVERIVGPKAPGETCHIVIDH  413
            SVQQA+  K+ VSPL LE AKEPPLN +KPK PYTATI SVER+VGPKAPGETCHIVIDH
Sbjct  62   SVQQASKSKIAVSPLELEIAKEPPLNTFKPKEPYTATIVSVERLVGPKAPGETCHIVIDH  121

Query  414  GGNVPYWEGQSYGVIPPGENPKKPGSPHNVRLYSIASSRYGDSFDGKTTSLCVRRAVYYD  593
            GGNVPYWEGQSYGVIPPGENPKKPGSPHNVRLYSIASSRYGDSFDGKTTSLCVRRAVYY+
Sbjct  122  GGNVPYWEGQSYGVIPPGENPKKPGSPHNVRLYSIASSRYGDSFDGKTTSLCVRRAVYYN  181

Query  594  PE  599
            PE
Sbjct  182  PE  183



>gb|KJB56288.1| hypothetical protein B456_009G115100 [Gossypium raimondii]
Length=364

 Score =   282 bits (722),  Expect = 7e-91, Method: Compositional matrix adjust.
 Identities = 138/182 (76%), Positives = 152/182 (84%), Gaps = 0/182 (0%)
 Frame = +3

Query  54   AVSQLMQVSVAVALNGDSSLQRSAFKANSITFNNRSPISFQPFDLKTRNGKSRSQYVVCM  233
            A S + QVSVAV +  D SL+RS  K + I+F N+S  S   FDLK+RN +    Y+VCM
Sbjct  2    AQSTVSQVSVAVPVGNDISLRRSVTKRDIISFGNKSWASTLSFDLKSRNAQKNKPYIVCM  61

Query  234  SVQQANIPKVTVSPLSLEDAKEPPLNLYKPKGPYTATIASVERIVGPKAPGETCHIVIDH  413
            SVQQA+  K+ VSPL LE AKEPPLN +KPK PYTATI SVER+VGPKAPGETCHIVIDH
Sbjct  62   SVQQASKSKIAVSPLELEIAKEPPLNTFKPKEPYTATIVSVERLVGPKAPGETCHIVIDH  121

Query  414  GGNVPYWEGQSYGVIPPGENPKKPGSPHNVRLYSIASSRYGDSFDGKTTSLCVRRAVYYD  593
            GGNVPYWEGQSYGVIPPGENPKKPGSPHNVRLYSIASSRYGDSFDGKTTSLCVRRAVYY+
Sbjct  122  GGNVPYWEGQSYGVIPPGENPKKPGSPHNVRLYSIASSRYGDSFDGKTTSLCVRRAVYYN  181

Query  594  PE  599
            PE
Sbjct  182  PE  183



>ref|XP_002263658.2| PREDICTED: ferredoxin--NADP reductase, root isozyme, chloroplastic 
[Vitis vinifera]
 emb|CBI31015.3| unnamed protein product [Vitis vinifera]
Length=377

 Score =   283 bits (723),  Expect = 7e-91, Method: Compositional matrix adjust.
 Identities = 135/175 (77%), Positives = 152/175 (87%), Gaps = 0/175 (0%)
 Frame = +3

Query  72   QVSVAVALNGDSSLQRSAFKANSITFNNRSPISFQPFDLKTRNGKSRSQYVVCMSVQQAN  251
            QVSV V + G+SSL+RS F+ + I+F+ +S       DLKT+N + +++YVVCMSVQQA+
Sbjct  8    QVSVTVPVGGESSLRRSVFQRHIISFHEKSWAPILALDLKTKNVRLKNRYVVCMSVQQAS  67

Query  252  IPKVTVSPLSLEDAKEPPLNLYKPKGPYTATIASVERIVGPKAPGETCHIVIDHGGNVPY  431
            IPKV VSPL LEDAK PPLNLYKPK PYTATI SVERIVGPKAPGETCHIVIDHGG VPY
Sbjct  68   IPKVAVSPLELEDAKGPPLNLYKPKEPYTATIVSVERIVGPKAPGETCHIVIDHGGIVPY  127

Query  432  WEGQSYGVIPPGENPKKPGSPHNVRLYSIASSRYGDSFDGKTTSLCVRRAVYYDP  596
            WEGQSYGVIPPGENPKKPG+PHNVRLYSIAS+RYGD FDGKTT+LCVRRAVYYDP
Sbjct  128  WEGQSYGVIPPGENPKKPGAPHNVRLYSIASTRYGDFFDGKTTTLCVRRAVYYDP  182



>gb|KDP34933.1| hypothetical protein JCGZ_09221 [Jatropha curcas]
Length=379

 Score =   282 bits (722),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 133/185 (72%), Positives = 159/185 (86%), Gaps = 1/185 (1%)
 Frame = +3

Query  48   MAAVSQLMQVSVAVALNGDSSLQRSAFKA-NSITFNNRSPISFQPFDLKTRNGKSRSQYV  224
            MA  + + QVS+AV +  DS+L+RS FK  +S+TFN++S       DLK++N + +++Y+
Sbjct  1    MAHSAAVSQVSLAVPVGSDSTLRRSVFKQPHSVTFNDKSWAPSLSLDLKSKNARLKNRYM  60

Query  225  VCMSVQQANIPKVTVSPLSLEDAKEPPLNLYKPKGPYTATIASVERIVGPKAPGETCHIV  404
            VCMSVQQA+  KV VSPL LEDA+EPPLN+YKPK PYTATI SVER+VGPKAPGETCHIV
Sbjct  61   VCMSVQQASRSKVAVSPLELEDAEEPPLNIYKPKEPYTATIVSVERLVGPKAPGETCHIV  120

Query  405  IDHGGNVPYWEGQSYGVIPPGENPKKPGSPHNVRLYSIASSRYGDSFDGKTTSLCVRRAV  584
            IDHGGNVPYWEGQSYGVIPPGENPKKPG+PHNVRLYSIAS+RYGD+FDGKT +LCVRRA+
Sbjct  121  IDHGGNVPYWEGQSYGVIPPGENPKKPGAPHNVRLYSIASTRYGDNFDGKTATLCVRRAL  180

Query  585  YYDPE  599
            YYDPE
Sbjct  181  YYDPE  185



>ref|XP_009344407.1| PREDICTED: ferredoxin--NADP reductase, root isozyme, chloroplastic-like 
[Pyrus x bretschneideri]
Length=379

 Score =   282 bits (721),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 133/175 (76%), Positives = 148/175 (85%), Gaps = 0/175 (0%)
 Frame = +3

Query  75   VSVAVALNGDSSLQRSAFKANSITFNNRSPISFQPFDLKTRNGKSRSQYVVCMSVQQANI  254
            ++V V L  D SL+RS FKA S+ FN++S     P D KT+ G+ R+Q ++CMSVQQA+ 
Sbjct  11   LTVTVPLGSDFSLRRSGFKARSVNFNDKSWPPILPLDFKTKRGQLRNQRILCMSVQQASA  70

Query  255  PKVTVSPLSLEDAKEPPLNLYKPKGPYTATIASVERIVGPKAPGETCHIVIDHGGNVPYW  434
            PKV V+PL LEDA EPPLN YKPK PYTATI SVERIVGP APGETCHIVIDHGGNVPYW
Sbjct  71   PKVNVAPLQLEDANEPPLNTYKPKEPYTATILSVERIVGPNAPGETCHIVIDHGGNVPYW  130

Query  435  EGQSYGVIPPGENPKKPGSPHNVRLYSIASSRYGDSFDGKTTSLCVRRAVYYDPE  599
            EGQSYGVIPPGENPKKPG+PHNVRLYSIAS+RYGD FDGKTTSLCVRRAVYYDPE
Sbjct  131  EGQSYGVIPPGENPKKPGAPHNVRLYSIASTRYGDYFDGKTTSLCVRRAVYYDPE  185



>ref|XP_011038878.1| PREDICTED: ferredoxin--NADP reductase, root isozyme, chloroplastic-like 
[Populus euphratica]
Length=378

 Score =   282 bits (721),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 134/184 (73%), Positives = 152/184 (83%), Gaps = 0/184 (0%)
 Frame = +3

Query  48   MAAVSQLMQVSVAVALNGDSSLQRSAFKANSITFNNRSPISFQPFDLKTRNGKSRSQYVV  227
            MA ++ L QVS AV    D++L+RSAFK  +I+F ++S       DLK+RN   + + +V
Sbjct  1    MAHLAALSQVSFAVPAGSDTTLRRSAFKIQNISFGDKSWHPASSLDLKSRNAGLKKRLLV  60

Query  228  CMSVQQANIPKVTVSPLSLEDAKEPPLNLYKPKGPYTATIASVERIVGPKAPGETCHIVI  407
            CMSVQQA+  KV VSPL LEDAKEPPLN YKPK PYTATI SVER+VGP APGETCH+VI
Sbjct  61   CMSVQQASRSKVAVSPLGLEDAKEPPLNTYKPKEPYTATIVSVERLVGPNAPGETCHVVI  120

Query  408  DHGGNVPYWEGQSYGVIPPGENPKKPGSPHNVRLYSIASSRYGDSFDGKTTSLCVRRAVY  587
            DHGGNVPYWEGQSYGVIPPGENPKKPG+PHNVRLYSIAS+RYGDSFDGKT SLCVRRAVY
Sbjct  121  DHGGNVPYWEGQSYGVIPPGENPKKPGAPHNVRLYSIASTRYGDSFDGKTASLCVRRAVY  180

Query  588  YDPE  599
            YDPE
Sbjct  181  YDPE  184



>ref|XP_008225595.1| PREDICTED: ferredoxin--NADP reductase, root isozyme, chloroplastic 
[Prunus mume]
Length=377

 Score =   281 bits (720),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 135/178 (76%), Positives = 149/178 (84%), Gaps = 0/178 (0%)
 Frame = +3

Query  66   LMQVSVAVALNGDSSLQRSAFKANSITFNNRSPISFQPFDLKTRNGKSRSQYVVCMSVQQ  245
            + QVS+   +  D S++RS FKA SI FN++S     P DLKT+NG  R+Q +VCMSVQQ
Sbjct  6    ISQVSLTAPVGSDFSIRRSVFKAQSINFNDKSWAPLLPLDLKTKNGGLRNQRIVCMSVQQ  65

Query  246  ANIPKVTVSPLSLEDAKEPPLNLYKPKGPYTATIASVERIVGPKAPGETCHIVIDHGGNV  425
            A++PKV VSPL LEDA EPPLN YKPK PYTATI SVERIVGPKAPGE CHIVIDH GNV
Sbjct  66   ASVPKVAVSPLQLEDANEPPLNTYKPKEPYTATIRSVERIVGPKAPGEPCHIVIDHDGNV  125

Query  426  PYWEGQSYGVIPPGENPKKPGSPHNVRLYSIASSRYGDSFDGKTTSLCVRRAVYYDPE  599
            PYWEGQSYGVIPPGENPKKPG+P NVRLYSIASSRYGD FDGKTTSLCVRRAVYYDP+
Sbjct  126  PYWEGQSYGVIPPGENPKKPGAPQNVRLYSIASSRYGDYFDGKTTSLCVRRAVYYDPK  183



>ref|XP_002298889.2| ferredoxin-NADP reductase family protein [Populus trichocarpa]
 gb|EEE83694.2| ferredoxin-NADP reductase family protein [Populus trichocarpa]
Length=378

 Score =   281 bits (720),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 135/184 (73%), Positives = 152/184 (83%), Gaps = 0/184 (0%)
 Frame = +3

Query  48   MAAVSQLMQVSVAVALNGDSSLQRSAFKANSITFNNRSPISFQPFDLKTRNGKSRSQYVV  227
            MA ++ L QVS AV    D++L+RSAFK  +I+F ++S       DLK+RN   + + +V
Sbjct  1    MAHLAALSQVSFAVPAGSDTTLRRSAFKIQNISFGDKSWHPASSLDLKSRNTGLKKRLLV  60

Query  228  CMSVQQANIPKVTVSPLSLEDAKEPPLNLYKPKGPYTATIASVERIVGPKAPGETCHIVI  407
            CMSVQQA+  KV VSPL LEDAKEPPLN YKPK PYTATI SVERIVGP APGETCH+VI
Sbjct  61   CMSVQQASRSKVAVSPLGLEDAKEPPLNTYKPKEPYTATIVSVERIVGPNAPGETCHVVI  120

Query  408  DHGGNVPYWEGQSYGVIPPGENPKKPGSPHNVRLYSIASSRYGDSFDGKTTSLCVRRAVY  587
            DHGGNVPYWEGQSYGVIPPGENPKKPG+PHNVRLYSIAS+RYGDSFDGKT SLCVRRAVY
Sbjct  121  DHGGNVPYWEGQSYGVIPPGENPKKPGAPHNVRLYSIASTRYGDSFDGKTASLCVRRAVY  180

Query  588  YDPE  599
            YDPE
Sbjct  181  YDPE  184



>ref|XP_010051952.1| PREDICTED: ferredoxin--NADP reductase, root isozyme, chloroplastic 
[Eucalyptus grandis]
 gb|KCW75780.1| hypothetical protein EUGRSUZ_D00177 [Eucalyptus grandis]
Length=377

 Score =   281 bits (720),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 134/184 (73%), Positives = 155/184 (84%), Gaps = 4/184 (2%)
 Frame = +3

Query  54   AVSQLMQVSVAVALNGDSSLQRSAFKANSITFNN--RSPISFQPFDLKTRNGKSRSQYVV  227
            A S + QVSVAV +  DSS++RS FKA++++F    R+P+     DL T+N +S+  Y +
Sbjct  2    AHSAVSQVSVAVPVGSDSSIRRSVFKAHTLSFCGTLRAPV--LTLDLSTKNARSKKGYTI  59

Query  228  CMSVQQANIPKVTVSPLSLEDAKEPPLNLYKPKGPYTATIASVERIVGPKAPGETCHIVI  407
            CMSVQQAN PKV VSPL LEDAKEPPLN +KPK PYTATI SVER+VGPKAPGE CH+VI
Sbjct  60   CMSVQQANAPKVAVSPLQLEDAKEPPLNTFKPKEPYTATIVSVERLVGPKAPGEVCHVVI  119

Query  408  DHGGNVPYWEGQSYGVIPPGENPKKPGSPHNVRLYSIASSRYGDSFDGKTTSLCVRRAVY  587
            DHGGNVPYWEGQSYGVIPPGENPKKPG+PHNVRLYSIAS+RYGDSFDG+T SLCVRRA+Y
Sbjct  120  DHGGNVPYWEGQSYGVIPPGENPKKPGNPHNVRLYSIASTRYGDSFDGRTASLCVRRALY  179

Query  588  YDPE  599
            YDPE
Sbjct  180  YDPE  183



>ref|XP_007022877.1| Root FNR 1 isoform 1 [Theobroma cacao]
 gb|EOY25499.1| Root FNR 1 isoform 1 [Theobroma cacao]
Length=387

 Score =   281 bits (720),  Expect = 3e-90, Method: Compositional matrix adjust.
 Identities = 139/193 (72%), Positives = 156/193 (81%), Gaps = 11/193 (6%)
 Frame = +3

Query  54   AVSQLMQVSVAVALNGDSSLQRSA-----------FKANSITFNNRSPISFQPFDLKTRN  200
            A S + QVSVAV +  D SL+RS             + NSI+F ++S +S    DLK+RN
Sbjct  2    AHSAVSQVSVAVPIGSDISLRRSVSKFLTQKHLALLQRNSISFGDKSWVSTLSLDLKSRN  61

Query  201  GKSRSQYVVCMSVQQANIPKVTVSPLSLEDAKEPPLNLYKPKGPYTATIASVERIVGPKA  380
             +  +QY+VCMSVQQA+  KV VSPL LE+AKEPPLNL+KPK PYTATI SVER+VGPKA
Sbjct  62   IQKSNQYIVCMSVQQASKSKVAVSPLELENAKEPPLNLFKPKEPYTATIVSVERLVGPKA  121

Query  381  PGETCHIVIDHGGNVPYWEGQSYGVIPPGENPKKPGSPHNVRLYSIASSRYGDSFDGKTT  560
            PGETCHIVIDHGGNVPYWEGQSYGVIPPGENPKKPGSPHNVRLYSIAS+RYGDSFDGKT 
Sbjct  122  PGETCHIVIDHGGNVPYWEGQSYGVIPPGENPKKPGSPHNVRLYSIASTRYGDSFDGKTA  181

Query  561  SLCVRRAVYYDPE  599
            SLCVRRAVYYDPE
Sbjct  182  SLCVRRAVYYDPE  194



>ref|XP_010098567.1| Ferredoxin--NADP reductase, root isozyme [Morus notabilis]
 gb|EXB75227.1| Ferredoxin--NADP reductase, root isozyme [Morus notabilis]
Length=393

 Score =   281 bits (719),  Expect = 4e-90, Method: Compositional matrix adjust.
 Identities = 132/182 (73%), Positives = 154/182 (85%), Gaps = 1/182 (1%)
 Frame = +3

Query  57   VSQLMQVSVAVALNGDSSLQRSAFKANSITFNNR-SPISFQPFDLKTRNGKSRSQYVVCM  233
            + + + +SV V +  D SL+RS FK N+I+F+++   I     + KT+NG+SR   ++CM
Sbjct  18   IKEFVAISVTVPVGNDCSLRRSVFKTNNISFSDKLWVIPTLSLNFKTKNGRSRDHQILCM  77

Query  234  SVQQANIPKVTVSPLSLEDAKEPPLNLYKPKGPYTATIASVERIVGPKAPGETCHIVIDH  413
            SVQQA+ PKV+VSPL+LEDAKE PLN+YKPKGPYTATI SVER+VGPKAPGETCHIVIDH
Sbjct  78   SVQQASTPKVSVSPLNLEDAKETPLNIYKPKGPYTATIVSVERLVGPKAPGETCHIVIDH  137

Query  414  GGNVPYWEGQSYGVIPPGENPKKPGSPHNVRLYSIASSRYGDSFDGKTTSLCVRRAVYYD  593
            GGNVPYWEGQSYGVIPPGENPKKPGSPHNVRLYSIAS+RYGD FDGKT SLCVRRAVYYD
Sbjct  138  GGNVPYWEGQSYGVIPPGENPKKPGSPHNVRLYSIASTRYGDFFDGKTASLCVRRAVYYD  197

Query  594  PE  599
             E
Sbjct  198  RE  199



>ref|XP_007147485.1| hypothetical protein PHAVU_006G128400g [Phaseolus vulgaris]
 gb|ESW19479.1| hypothetical protein PHAVU_006G128400g [Phaseolus vulgaris]
Length=377

 Score =   280 bits (717),  Expect = 5e-90, Method: Compositional matrix adjust.
 Identities = 135/178 (76%), Positives = 152/178 (85%), Gaps = 0/178 (0%)
 Frame = +3

Query  66   LMQVSVAVALNGDSSLQRSAFKANSITFNNRSPISFQPFDLKTRNGKSRSQYVVCMSVQQ  245
            L QV+V V ++ D SL+RSAFKA ++ F ++S       DLK  + + RSQ VVCMSVQQ
Sbjct  6    LSQVAVTVPVSSDLSLRRSAFKAPNLNFWDKSWSPVLTLDLKANSSRLRSQNVVCMSVQQ  65

Query  246  ANIPKVTVSPLSLEDAKEPPLNLYKPKGPYTATIASVERIVGPKAPGETCHIVIDHGGNV  425
            A++PKV+VSPL LEDAKE PLNLYKPK PYTATI SV+R+VGPKAPGETCHIVIDHGGNV
Sbjct  66   ASVPKVSVSPLDLEDAKETPLNLYKPKEPYTATIVSVDRLVGPKAPGETCHIVIDHGGNV  125

Query  426  PYWEGQSYGVIPPGENPKKPGSPHNVRLYSIASSRYGDSFDGKTTSLCVRRAVYYDPE  599
            PYWEGQSYGVIPPGENPKKPG+PHNVRLYSIAS+RYGD FDGKT SLCVRRAVYYDPE
Sbjct  126  PYWEGQSYGVIPPGENPKKPGAPHNVRLYSIASTRYGDFFDGKTASLCVRRAVYYDPE  183



>gb|KHG02797.1| hypothetical protein F383_08810 [Gossypium arboreum]
Length=376

 Score =   280 bits (717),  Expect = 6e-90, Method: Compositional matrix adjust.
 Identities = 137/182 (75%), Positives = 150/182 (82%), Gaps = 0/182 (0%)
 Frame = +3

Query  54   AVSQLMQVSVAVALNGDSSLQRSAFKANSITFNNRSPISFQPFDLKTRNGKSRSQYVVCM  233
            A S + QVSVAV +  D SL+RS    N I+F N+S  S   FDLK+RN +    Y+VC+
Sbjct  2    AQSTVSQVSVAVPVGNDISLRRSVTNRNIISFGNKSWASTLAFDLKSRNAQKNKPYIVCL  61

Query  234  SVQQANIPKVTVSPLSLEDAKEPPLNLYKPKGPYTATIASVERIVGPKAPGETCHIVIDH  413
            SVQQA+  K+ VSPL LE AKEPPLN +KPK PYTATI SVER+VGPKAPGETCHIVIDH
Sbjct  62   SVQQASKSKIAVSPLELEIAKEPPLNTFKPKEPYTATIVSVERLVGPKAPGETCHIVIDH  121

Query  414  GGNVPYWEGQSYGVIPPGENPKKPGSPHNVRLYSIASSRYGDSFDGKTTSLCVRRAVYYD  593
            GGNVPYWEGQSYGVIPPGENPKKPGSPHNVRLYSIASSRYGDSFDGKTTSLCVRRAVYYD
Sbjct  122  GGNVPYWEGQSYGVIPPGENPKKPGSPHNVRLYSIASSRYGDSFDGKTTSLCVRRAVYYD  181

Query  594  PE  599
             E
Sbjct  182  TE  183



>gb|ACY70395.1| heterotrophic ferredoxin NADP+ oxidoreductase [Populus tremula 
x Populus tremuloides]
Length=378

 Score =   278 bits (712),  Expect = 3e-89, Method: Compositional matrix adjust.
 Identities = 133/184 (72%), Positives = 152/184 (83%), Gaps = 0/184 (0%)
 Frame = +3

Query  48   MAAVSQLMQVSVAVALNGDSSLQRSAFKANSITFNNRSPISFQPFDLKTRNGKSRSQYVV  227
            MA ++ L QVS A     D++L+RSAFK  +I+F ++S       DLK+RN   + + +V
Sbjct  1    MAHLAALSQVSFAAPAGSDTTLRRSAFKIQNISFGDKSWHPALSLDLKSRNTGLKKRLLV  60

Query  228  CMSVQQANIPKVTVSPLSLEDAKEPPLNLYKPKGPYTATIASVERIVGPKAPGETCHIVI  407
            CMSVQQA+  KV VSPL LEDAKEPPLN YKPK PYTATIASVER+VGP APGETCH+VI
Sbjct  61   CMSVQQASRSKVAVSPLELEDAKEPPLNTYKPKEPYTATIASVERLVGPNAPGETCHVVI  120

Query  408  DHGGNVPYWEGQSYGVIPPGENPKKPGSPHNVRLYSIASSRYGDSFDGKTTSLCVRRAVY  587
            DHGGNVPYWEGQSYGVIPPGENPKKPG+PHNVRLYSIAS+RYGDSFDGKT SLCVRRAVY
Sbjct  121  DHGGNVPYWEGQSYGVIPPGENPKKPGAPHNVRLYSIASTRYGDSFDGKTASLCVRRAVY  180

Query  588  YDPE  599
            Y+PE
Sbjct  181  YNPE  184



>gb|EYU19120.1| hypothetical protein MIMGU_mgv1a008446mg [Erythranthe guttata]
Length=373

 Score =   277 bits (709),  Expect = 9e-89, Method: Compositional matrix adjust.
 Identities = 133/182 (73%), Positives = 152/182 (84%), Gaps = 4/182 (2%)
 Frame = +3

Query  54   AVSQLMQVSVAVALNGDSSLQRSAFKANSITFNNRSPISFQPFDLKTRNGKSRSQYVVCM  233
            A S L QV  AV++N D+SL RS FK N+++F N+S       D K  + +S++++ VCM
Sbjct  2    ASSALSQVPAAVSVNSDTSLPRSVFKTNNVSFRNKS----WTLDSKIASSRSKNRFAVCM  57

Query  234  SVQQANIPKVTVSPLSLEDAKEPPLNLYKPKGPYTATIASVERIVGPKAPGETCHIVIDH  413
            SVQQA+ PKV VSPL LED KEPPL+LYK K PYTATI SV+R+VGPKAPGETCHIVIDH
Sbjct  58   SVQQASTPKVGVSPLDLEDVKEPPLHLYKNKQPYTATIVSVDRLVGPKAPGETCHIVIDH  117

Query  414  GGNVPYWEGQSYGVIPPGENPKKPGSPHNVRLYSIASSRYGDSFDGKTTSLCVRRAVYYD  593
            GGNVPYWEGQSYGVIPPGENPKKPG+PHNVRLYSIAS+RYGDSFDGKT SLCVRRAVYYD
Sbjct  118  GGNVPYWEGQSYGVIPPGENPKKPGTPHNVRLYSIASTRYGDSFDGKTASLCVRRAVYYD  177

Query  594  PE  599
            PE
Sbjct  178  PE  179



>ref|XP_006597058.1| PREDICTED: uncharacterized protein LOC100807968 isoform X1 [Glycine 
max]
Length=378

 Score =   276 bits (707),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 134/184 (73%), Positives = 152/184 (83%), Gaps = 0/184 (0%)
 Frame = +3

Query  48   MAAVSQLMQVSVAVALNGDSSLQRSAFKANSITFNNRSPISFQPFDLKTRNGKSRSQYVV  227
            MA ++   Q++V V +  D SL+RSA KA ++ F ++S       DLK  N   RS++VV
Sbjct  1    MAHLALSQQMAVTVPVGNDLSLRRSAVKAPNLNFWDKSWAPVFTLDLKPNNPSLRSRHVV  60

Query  228  CMSVQQANIPKVTVSPLSLEDAKEPPLNLYKPKGPYTATIASVERIVGPKAPGETCHIVI  407
            CMSVQQA++ KV VSPL LEDAKEPPLNLYKPK PYTATI SV+R+VGPKAPGETCHIVI
Sbjct  61   CMSVQQASVSKVNVSPLELEDAKEPPLNLYKPKEPYTATIVSVDRLVGPKAPGETCHIVI  120

Query  408  DHGGNVPYWEGQSYGVIPPGENPKKPGSPHNVRLYSIASSRYGDSFDGKTTSLCVRRAVY  587
            DHGGNVPYWEGQSYGVIPPGENPKKPG+PHNVRLYSIAS+RYGD FDGKT SLCVRRAVY
Sbjct  121  DHGGNVPYWEGQSYGVIPPGENPKKPGAPHNVRLYSIASTRYGDFFDGKTASLCVRRAVY  180

Query  588  YDPE  599
            YDPE
Sbjct  181  YDPE  184



>emb|CDP17310.1| unnamed protein product [Coffea canephora]
Length=442

 Score =   278 bits (712),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 138/192 (72%), Positives = 160/192 (83%), Gaps = 3/192 (2%)
 Frame = +3

Query  33   LWSAIMA-AVSQLMQVSVAVA-LNGDSSLQRSAFKANSITFNNRSPISFQPFDLKTRNG-  203
             +S++MA A S L Q++ AV   N DSS +RS  K N++ F+++S IS   FDLKT+N  
Sbjct  57   FYSSMMAQAHSALSQITFAVYPCNSDSSFRRSILKTNNVRFHDKSWISVSDFDLKTKNVV  116

Query  204  KSRSQYVVCMSVQQANIPKVTVSPLSLEDAKEPPLNLYKPKGPYTATIASVERIVGPKAP  383
             SRSQ ++C SVQQA+ PKV VSPL LED KEPP++LYKPK PY+ATI SVER+VGPKAP
Sbjct  117  HSRSQRILCFSVQQASKPKVGVSPLLLEDPKEPPMHLYKPKEPYSATIVSVERLVGPKAP  176

Query  384  GETCHIVIDHGGNVPYWEGQSYGVIPPGENPKKPGSPHNVRLYSIASSRYGDSFDGKTTS  563
            GETCHIVIDHGGNVPYWEGQSYGVIPPGENPKKPGSP+NVRLYSIAS+RYGDSFDGKT S
Sbjct  177  GETCHIVIDHGGNVPYWEGQSYGVIPPGENPKKPGSPNNVRLYSIASTRYGDSFDGKTAS  236

Query  564  LCVRRAVYYDPE  599
             CVRRAVYYDP+
Sbjct  237  FCVRRAVYYDPD  248



>ref|XP_011085204.1| PREDICTED: ferredoxin--NADP reductase, root-type isozyme, chloroplastic-like 
[Sesamum indicum]
Length=393

 Score =   276 bits (706),  Expect = 4e-88, Method: Compositional matrix adjust.
 Identities = 132/182 (73%), Positives = 154/182 (85%), Gaps = 0/182 (0%)
 Frame = +3

Query  54   AVSQLMQVSVAVALNGDSSLQRSAFKANSITFNNRSPISFQPFDLKTRNGKSRSQYVVCM  233
            A S + QV VAV++N D+SL +S FK+N+++F+++S  S    D K    ++R + VVCM
Sbjct  18   AHSAITQVPVAVSINADTSLPKSVFKSNNVSFHDKSWSSRLSLDFKIAISRTRGRPVVCM  77

Query  234  SVQQANIPKVTVSPLSLEDAKEPPLNLYKPKGPYTATIASVERIVGPKAPGETCHIVIDH  413
            SVQQA+ PKV VSPLSLEDAK+PPL+LYK K PYT TI SVER+VGPKAPGETCHIVIDH
Sbjct  78   SVQQASQPKVAVSPLSLEDAKDPPLHLYKNKEPYTGTIVSVERLVGPKAPGETCHIVIDH  137

Query  414  GGNVPYWEGQSYGVIPPGENPKKPGSPHNVRLYSIASSRYGDSFDGKTTSLCVRRAVYYD  593
            GGNVPYWEGQSYG+IPPGENPKKPG+PHNVRLYSIAS+RYGD FDGKT SLCVRRAVYYD
Sbjct  138  GGNVPYWEGQSYGIIPPGENPKKPGNPHNVRLYSIASTRYGDLFDGKTASLCVRRAVYYD  197

Query  594  PE  599
            PE
Sbjct  198  PE  199



>ref|XP_008439552.1| PREDICTED: ferredoxin--NADP reductase, root isozyme, chloroplastic 
[Cucumis melo]
Length=379

 Score =   275 bits (703),  Expect = 9e-88, Method: Compositional matrix adjust.
 Identities = 133/184 (72%), Positives = 151/184 (82%), Gaps = 2/184 (1%)
 Frame = +3

Query  54   AVSQLMQVSVAVALNGDSSLQRSAFKANSITFNNR--SPISFQPFDLKTRNGKSRSQYVV  227
            A S   QV+VAV +  D S++RS FK +S+ F+++  SP+      L+    +   +  V
Sbjct  2    AHSTFSQVAVAVPVGSDLSVKRSVFKTSSLNFHDKPWSPVIALNLSLRGTRARGWQRQTV  61

Query  228  CMSVQQANIPKVTVSPLSLEDAKEPPLNLYKPKGPYTATIASVERIVGPKAPGETCHIVI  407
            CMSVQQA+ PKV+V+PL LEDAKEPPLNLYKPK PYTATI SVER+VGPKAPGETCHIVI
Sbjct  62   CMSVQQASAPKVSVAPLDLEDAKEPPLNLYKPKEPYTATIVSVERLVGPKAPGETCHIVI  121

Query  408  DHGGNVPYWEGQSYGVIPPGENPKKPGSPHNVRLYSIASSRYGDSFDGKTTSLCVRRAVY  587
            DHGGNVPYWEGQSYGVIPPGENPKKPGSPHNVRLYSIAS+RYGDSFDGKT SLCVRRAVY
Sbjct  122  DHGGNVPYWEGQSYGVIPPGENPKKPGSPHNVRLYSIASTRYGDSFDGKTASLCVRRAVY  181

Query  588  YDPE  599
            YDPE
Sbjct  182  YDPE  185



>ref|NP_001239798.1| uncharacterized protein LOC100807968 [Glycine max]
 gb|ACU22765.1| unknown [Glycine max]
Length=377

 Score =   274 bits (701),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 133/178 (75%), Positives = 149/178 (84%), Gaps = 0/178 (0%)
 Frame = +3

Query  66   LMQVSVAVALNGDSSLQRSAFKANSITFNNRSPISFQPFDLKTRNGKSRSQYVVCMSVQQ  245
            L Q++V V +  D SL+RSA KA ++ F ++S       DLK  N   RS++VVCMSVQQ
Sbjct  6    LSQMAVTVPVGNDLSLRRSAVKAPNLNFWDKSWAPVFTLDLKPNNPSLRSRHVVCMSVQQ  65

Query  246  ANIPKVTVSPLSLEDAKEPPLNLYKPKGPYTATIASVERIVGPKAPGETCHIVIDHGGNV  425
            A++ KV VSPL LEDAKEPPLNLYKPK PYTATI SV+R+VGPKAPGETCHIVIDHGGNV
Sbjct  66   ASVSKVNVSPLELEDAKEPPLNLYKPKEPYTATIVSVDRLVGPKAPGETCHIVIDHGGNV  125

Query  426  PYWEGQSYGVIPPGENPKKPGSPHNVRLYSIASSRYGDSFDGKTTSLCVRRAVYYDPE  599
            PYWEGQSYGVIPPGENPKKPG+PHNVRLYSIAS+RYGD FDGKT SLCVRRAVYYDPE
Sbjct  126  PYWEGQSYGVIPPGENPKKPGAPHNVRLYSIASTRYGDFFDGKTASLCVRRAVYYDPE  183



>ref|XP_010247806.1| PREDICTED: ferredoxin--NADP reductase, root isozyme, chloroplastic-like 
[Nelumbo nucifera]
Length=377

 Score =   274 bits (700),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 134/182 (74%), Positives = 149/182 (82%), Gaps = 0/182 (0%)
 Frame = +3

Query  54   AVSQLMQVSVAVALNGDSSLQRSAFKANSITFNNRSPISFQPFDLKTRNGKSRSQYVVCM  233
            A S + Q SV V +  DSSL+RS FK  ++ F ++  +S    DLK  N +S S+Y +CM
Sbjct  2    AHSIVTQASVTVPVANDSSLRRSIFKTYNLKFQDKPWVSVLSSDLKINNPRSTSEYKLCM  61

Query  234  SVQQANIPKVTVSPLSLEDAKEPPLNLYKPKGPYTATIASVERIVGPKAPGETCHIVIDH  413
            SV+Q    KV VSPL LE AKEPPLN+YKPK P+TATI SVERIVGPKAPGETCHIVIDH
Sbjct  62   SVKQVTPSKVAVSPLQLEGAKEPPLNIYKPKEPHTATIVSVERIVGPKAPGETCHIVIDH  121

Query  414  GGNVPYWEGQSYGVIPPGENPKKPGSPHNVRLYSIASSRYGDSFDGKTTSLCVRRAVYYD  593
            GGNVPYWEGQSYGVIPPGENPKKPG+PHNVRLYSIASSRYGDSFDGKTTSLCVRRAVYYD
Sbjct  122  GGNVPYWEGQSYGVIPPGENPKKPGTPHNVRLYSIASSRYGDSFDGKTTSLCVRRAVYYD  181

Query  594  PE  599
            PE
Sbjct  182  PE  183



>ref|XP_004486455.1| PREDICTED: ferredoxin--NADP reductase, root isozyme, chloroplastic-like 
[Cicer arietinum]
Length=377

 Score =   273 bits (699),  Expect = 3e-87, Method: Compositional matrix adjust.
 Identities = 128/176 (73%), Positives = 148/176 (84%), Gaps = 0/176 (0%)
 Frame = +3

Query  72   QVSVAVALNGDSSLQRSAFKANSITFNNRSPISFQPFDLKTRNGKSRSQYVVCMSVQQAN  251
            Q++V V ++ D S++RSAFK  ++ F ++S       DLK +N   R+  V+CMSVQQA+
Sbjct  8    QIAVTVPVSSDLSIRRSAFKGFNLNFRDKSWAPVFSLDLKAKNSGRRNHNVICMSVQQAS  67

Query  252  IPKVTVSPLSLEDAKEPPLNLYKPKGPYTATIASVERIVGPKAPGETCHIVIDHGGNVPY  431
            +PKV VSPL LE+A EPPLNL+KPK PYTATI SVER+VGPKAPGETCHIVIDHGGNVPY
Sbjct  68   VPKVAVSPLELENATEPPLNLHKPKEPYTATIVSVERLVGPKAPGETCHIVIDHGGNVPY  127

Query  432  WEGQSYGVIPPGENPKKPGSPHNVRLYSIASSRYGDSFDGKTTSLCVRRAVYYDPE  599
            WEGQSYGVIPPGENPKKPG+PHNVRLYSIAS+RYGD FDGKT SLCVRRAVYYDPE
Sbjct  128  WEGQSYGVIPPGENPKKPGAPHNVRLYSIASTRYGDFFDGKTASLCVRRAVYYDPE  183



>ref|XP_011096684.1| PREDICTED: ferredoxin--NADP reductase, root-type isozyme, chloroplastic-like 
[Sesamum indicum]
Length=401

 Score =   274 bits (701),  Expect = 3e-87, Method: Compositional matrix adjust.
 Identities = 135/186 (73%), Positives = 153/186 (82%), Gaps = 1/186 (1%)
 Frame = +3

Query  45   IMAAVSQLMQVSVAVALNGD-SSLQRSAFKANSITFNNRSPISFQPFDLKTRNGKSRSQY  221
            +  A+S L QV V V +N D SSL  S FK N+++F+N+   S    D    N + + ++
Sbjct  22   LTMALSALSQVPVPVPINTDTSSLSTSLFKNNNVSFHNKLWTSGLCLDSNIANSRLKKRF  81

Query  222  VVCMSVQQANIPKVTVSPLSLEDAKEPPLNLYKPKGPYTATIASVERIVGPKAPGETCHI  401
            VVCMSVQQA+ PKV VSPLSLEDAKEPPL+LYK K PYTATI SVER+VGPKAPGETCH+
Sbjct  82   VVCMSVQQASKPKVGVSPLSLEDAKEPPLHLYKNKEPYTATIVSVERLVGPKAPGETCHV  141

Query  402  VIDHGGNVPYWEGQSYGVIPPGENPKKPGSPHNVRLYSIASSRYGDSFDGKTTSLCVRRA  581
            VIDHGGNVPYWEGQSYGVIPPGENPKKPG+PHNVRLYSIAS+RYGDSFDGKT SLCVRRA
Sbjct  142  VIDHGGNVPYWEGQSYGVIPPGENPKKPGTPHNVRLYSIASTRYGDSFDGKTASLCVRRA  201

Query  582  VYYDPE  599
            VYYDPE
Sbjct  202  VYYDPE  207



>ref|XP_006586681.1| PREDICTED: uncharacterized protein LOC100789291 isoform X1 [Glycine 
max]
Length=378

 Score =   271 bits (694),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 132/184 (72%), Positives = 150/184 (82%), Gaps = 0/184 (0%)
 Frame = +3

Query  48   MAAVSQLMQVSVAVALNGDSSLQRSAFKANSITFNNRSPISFQPFDLKTRNGKSRSQYVV  227
            MA ++   Q++V V +  D SL+RSA KA +  F ++S        LK  N   RS++VV
Sbjct  1    MAHLALSQQMAVTVPVGSDLSLRRSAVKAPNFNFWDKSWAPVFTLYLKANNSSLRSRHVV  60

Query  228  CMSVQQANIPKVTVSPLSLEDAKEPPLNLYKPKGPYTATIASVERIVGPKAPGETCHIVI  407
             MSVQQA++PKV VSPL LEDAKEPPLNL+KPK PYTATI SV+R+VGPKAPGETCHIVI
Sbjct  61   FMSVQQASVPKVNVSPLELEDAKEPPLNLHKPKEPYTATIVSVDRLVGPKAPGETCHIVI  120

Query  408  DHGGNVPYWEGQSYGVIPPGENPKKPGSPHNVRLYSIASSRYGDSFDGKTTSLCVRRAVY  587
            DHGGNVPYWEGQSYGVIPPGENPKKPG+PHNVRLYSIAS+RYGD FDGKT SLCVRRAVY
Sbjct  121  DHGGNVPYWEGQSYGVIPPGENPKKPGAPHNVRLYSIASTRYGDFFDGKTASLCVRRAVY  180

Query  588  YDPE  599
            YDPE
Sbjct  181  YDPE  184



>ref|XP_004134584.1| PREDICTED: ferredoxin--NADP reductase, root isozyme, chloroplastic-like 
[Cucumis sativus]
 ref|XP_004172626.1| PREDICTED: LOW QUALITY PROTEIN: ferredoxin--NADP reductase, root 
isozyme, chloroplastic-like [Cucumis sativus]
 gb|KGN49459.1| hypothetical protein Csa_6G525450 [Cucumis sativus]
Length=378

 Score =   271 bits (693),  Expect = 3e-86, Method: Compositional matrix adjust.
 Identities = 132/183 (72%), Positives = 149/183 (81%), Gaps = 1/183 (1%)
 Frame = +3

Query  54   AVSQLMQVSVAVALNGDSSLQRSAFKANSITFNNRSPIS-FQPFDLKTRNGKSRSQYVVC  230
            A S   QV+VAV +  D S++RS FK  S+ F+++S  S     +   R  ++R    VC
Sbjct  2    AHSTFSQVAVAVPVGSDLSVKRSVFKTRSLNFHDKSWSSPVIALNSNLRGTRARGWQTVC  61

Query  231  MSVQQANIPKVTVSPLSLEDAKEPPLNLYKPKGPYTATIASVERIVGPKAPGETCHIVID  410
            MSVQQA+ PKV+V+PL LEDAKEPPLNLYKPK PYTATI SVER+VGPKAPGETCHIVID
Sbjct  62   MSVQQASAPKVSVAPLDLEDAKEPPLNLYKPKEPYTATIVSVERLVGPKAPGETCHIVID  121

Query  411  HGGNVPYWEGQSYGVIPPGENPKKPGSPHNVRLYSIASSRYGDSFDGKTTSLCVRRAVYY  590
            HGGNVPYWEGQSYGVIPPGENPKKPG+PHNVRLYSIAS+RYGDSFDG T SLCVRRAVYY
Sbjct  122  HGGNVPYWEGQSYGVIPPGENPKKPGNPHNVRLYSIASTRYGDSFDGNTASLCVRRAVYY  181

Query  591  DPE  599
            DPE
Sbjct  182  DPE  184



>gb|KHN14331.1| Ferredoxin--NADP reductase, root isozyme, chloroplastic [Glycine 
soja]
Length=369

 Score =   270 bits (691),  Expect = 4e-86, Method: Compositional matrix adjust.
 Identities = 131/175 (75%), Positives = 147/175 (84%), Gaps = 0/175 (0%)
 Frame = +3

Query  75   VSVAVALNGDSSLQRSAFKANSITFNNRSPISFQPFDLKTRNGKSRSQYVVCMSVQQANI  254
            ++V V +  D SL+RSA KA ++ F ++S       DLK  N   RS++VVCMSVQQA++
Sbjct  1    MAVTVPVGNDLSLRRSAVKAPNLNFWDKSWAPVFTLDLKPNNPSLRSRHVVCMSVQQASV  60

Query  255  PKVTVSPLSLEDAKEPPLNLYKPKGPYTATIASVERIVGPKAPGETCHIVIDHGGNVPYW  434
             KV VSPL LEDAKEPPLNLYKPK PYTATI SV+R+VGPKAPGETCHIVIDHGGNVPYW
Sbjct  61   SKVNVSPLELEDAKEPPLNLYKPKEPYTATIVSVDRLVGPKAPGETCHIVIDHGGNVPYW  120

Query  435  EGQSYGVIPPGENPKKPGSPHNVRLYSIASSRYGDSFDGKTTSLCVRRAVYYDPE  599
            EGQSYGVIPPGENPKKPG+PHNVRLYSIAS+RYGD FDGKT SLCVRRAVYYDPE
Sbjct  121  EGQSYGVIPPGENPKKPGAPHNVRLYSIASTRYGDFFDGKTASLCVRRAVYYDPE  175



>ref|NP_001239859.1| uncharacterized protein LOC100789291 [Glycine max]
 gb|ACU18286.1| unknown [Glycine max]
 gb|KHN23002.1| Ferredoxin--NADP reductase, root isozyme, chloroplastic [Glycine 
soja]
Length=377

 Score =   269 bits (688),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 131/178 (74%), Positives = 147/178 (83%), Gaps = 0/178 (0%)
 Frame = +3

Query  66   LMQVSVAVALNGDSSLQRSAFKANSITFNNRSPISFQPFDLKTRNGKSRSQYVVCMSVQQ  245
            L Q++V V +  D SL+RSA KA +  F ++S        LK  N   RS++VV MSVQQ
Sbjct  6    LSQMAVTVPVGSDLSLRRSAVKAPNFNFWDKSWAPVFTLYLKANNSSLRSRHVVFMSVQQ  65

Query  246  ANIPKVTVSPLSLEDAKEPPLNLYKPKGPYTATIASVERIVGPKAPGETCHIVIDHGGNV  425
            A++PKV VSPL LEDAKEPPLNL+KPK PYTATI SV+R+VGPKAPGETCHIVIDHGGNV
Sbjct  66   ASVPKVNVSPLELEDAKEPPLNLHKPKEPYTATIVSVDRLVGPKAPGETCHIVIDHGGNV  125

Query  426  PYWEGQSYGVIPPGENPKKPGSPHNVRLYSIASSRYGDSFDGKTTSLCVRRAVYYDPE  599
            PYWEGQSYGVIPPGENPKKPG+PHNVRLYSIAS+RYGD FDGKT SLCVRRAVYYDPE
Sbjct  126  PYWEGQSYGVIPPGENPKKPGAPHNVRLYSIASTRYGDFFDGKTASLCVRRAVYYDPE  183



>ref|XP_006448909.1| hypothetical protein CICLE_v100156271mg, partial [Citrus clementina]
 gb|ESR62149.1| hypothetical protein CICLE_v100156271mg, partial [Citrus clementina]
Length=212

 Score =   263 bits (672),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 130/178 (73%), Positives = 147/178 (83%), Gaps = 3/178 (2%)
 Frame = +3

Query  72   QVSVAVALNGDSSLQRSA--FKANSITFNNRSPISFQPFDLKTRNGKSRSQYVVCMSVQQ  245
            QV+VAV +  DS+L RSA  FK  ++    +S       DLK+RN + R++YVVCMSVQQ
Sbjct  8    QVAVAVPVGTDSTL-RSAPLFKTQNLRLGEKSWAPVLSLDLKSRNPRLRNRYVVCMSVQQ  66

Query  246  ANIPKVTVSPLSLEDAKEPPLNLYKPKGPYTATIASVERIVGPKAPGETCHIVIDHGGNV  425
            A+  KV VSPL LE+  +PPLNLYKPK PYTATI SVER+VG KAPGETCHIVIDHGGNV
Sbjct  67   ASKSKVAVSPLELEEQSQPPLNLYKPKEPYTATIVSVERVVGAKAPGETCHIVIDHGGNV  126

Query  426  PYWEGQSYGVIPPGENPKKPGSPHNVRLYSIASSRYGDSFDGKTTSLCVRRAVYYDPE  599
            PYWEGQSYGVIPPGENPKKPG+PHNVRLYSIAS+RYGDSFDG+T SLCVRRAVYYDPE
Sbjct  127  PYWEGQSYGVIPPGENPKKPGNPHNVRLYSIASTRYGDSFDGQTASLCVRRAVYYDPE  184



>ref|XP_008795712.1| PREDICTED: ferredoxin--NADP reductase, root isozyme, chloroplastic-like 
[Phoenix dactylifera]
Length=216

 Score =   263 bits (672),  Expect = 3e-85, Method: Compositional matrix adjust.
 Identities = 127/178 (71%), Positives = 148/178 (83%), Gaps = 2/178 (1%)
 Frame = +3

Query  72   QVSVAVALNGDSSLQRSAFKA-NSITFNNRSPISFQPFDLKTRNGKSRSQY-VVCMSVQQ  245
            Q S++V +  D SL++S  K  N+++F+N   + F   DL + N +S+ Q+ VVCMS+QQ
Sbjct  8    QASLSVPVRTDVSLRKSGLKGRNNLSFHNNLWVPFTSLDLGSNNVQSKHQFKVVCMSIQQ  67

Query  246  ANIPKVTVSPLSLEDAKEPPLNLYKPKGPYTATIASVERIVGPKAPGETCHIVIDHGGNV  425
            A+  KV V PL LE+A+ PPLNLYKPK PYTATI SVER+VGPKAPGETCHIVIDHGGNV
Sbjct  68   ASRSKVAVKPLELENAQGPPLNLYKPKEPYTATIVSVERLVGPKAPGETCHIVIDHGGNV  127

Query  426  PYWEGQSYGVIPPGENPKKPGSPHNVRLYSIASSRYGDSFDGKTTSLCVRRAVYYDPE  599
            PYWEGQSYG+IPPGENPKKPGSPHNVRLYSIAS+RYGDSFDGKT SLCVRRAVYYDPE
Sbjct  128  PYWEGQSYGIIPPGENPKKPGSPHNVRLYSIASTRYGDSFDGKTASLCVRRAVYYDPE  185



>ref|XP_010907335.1| PREDICTED: ferredoxin--NADP reductase, root isozyme, chloroplastic-like 
isoform X1 [Elaeis guineensis]
Length=379

 Score =   268 bits (685),  Expect = 4e-85, Method: Compositional matrix adjust.
 Identities = 128/178 (72%), Positives = 150/178 (84%), Gaps = 2/178 (1%)
 Frame = +3

Query  72   QVSVAVALNGDSSLQRSAFKA-NSITFNNRSPISFQPFDLKTRNGKSRSQY-VVCMSVQQ  245
            QVS+++ +  D SL++S  K  N+++F+N   + F   DL++   +S+ ++ VVCMSVQQ
Sbjct  8    QVSLSLPVGTDVSLRKSGLKGCNNVSFHNNFWVPFTSLDLRSNKVQSKCRFKVVCMSVQQ  67

Query  246  ANIPKVTVSPLSLEDAKEPPLNLYKPKGPYTATIASVERIVGPKAPGETCHIVIDHGGNV  425
            A+  KV V PL LEDAKEPPLNLYKPK PYTATI SVER+VGPKAPGETCHIVIDHGGNV
Sbjct  68   ASKSKVAVKPLELEDAKEPPLNLYKPKEPYTATIVSVERLVGPKAPGETCHIVIDHGGNV  127

Query  426  PYWEGQSYGVIPPGENPKKPGSPHNVRLYSIASSRYGDSFDGKTTSLCVRRAVYYDPE  599
            PYWEGQSYG+IPPGENPKKPG+PHNVRLYSIAS+RYGDSFDGKT SLCVRRAVYYDPE
Sbjct  128  PYWEGQSYGIIPPGENPKKPGAPHNVRLYSIASTRYGDSFDGKTASLCVRRAVYYDPE  185



>gb|AII16855.1| ferredoxin-NADP(+) reductase, partial [Ocimum basilicum]
Length=372

 Score =   267 bits (683),  Expect = 7e-85, Method: Compositional matrix adjust.
 Identities = 128/178 (72%), Positives = 147/178 (83%), Gaps = 0/178 (0%)
 Frame = +3

Query  66   LMQVSVAVALNGDSSLQRSAFKANSITFNNRSPISFQPFDLKTRNGKSRSQYVVCMSVQQ  245
            L QV VAV++  D SL+ S FK+N+++F+  S  S    D +  + KSRSQ VVCMSVQQ
Sbjct  1    LAQVPVAVSVKNDVSLRSSVFKSNNVSFHETSRASRLSMDFRATSFKSRSQPVVCMSVQQ  60

Query  246  ANIPKVTVSPLSLEDAKEPPLNLYKPKGPYTATIASVERIVGPKAPGETCHIVIDHGGNV  425
            A+  KV VSPLSLEDAK+PPL+L+K K PY  TI SVER+VGP+APGETCHIVIDHGG V
Sbjct  61   ASKSKVAVSPLSLEDAKDPPLHLFKNKEPYEGTIVSVERLVGPQAPGETCHIVIDHGGKV  120

Query  426  PYWEGQSYGVIPPGENPKKPGSPHNVRLYSIASSRYGDSFDGKTTSLCVRRAVYYDPE  599
            PYWEGQSYG+IPPGENPKKPG+PHNVRLYSIAS+RYGDSFDGKT S CVRRAVYYDPE
Sbjct  121  PYWEGQSYGIIPPGENPKKPGNPHNVRLYSIASTRYGDSFDGKTASFCVRRAVYYDPE  178



>ref|XP_006468308.1| PREDICTED: ferredoxin--NADP reductase, root isozyme, chloroplastic-like 
[Citrus sinensis]
 gb|KDO75263.1| hypothetical protein CISIN_1g017070mg [Citrus sinensis]
Length=378

 Score =   266 bits (680),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 133/184 (72%), Positives = 150/184 (82%), Gaps = 3/184 (2%)
 Frame = +3

Query  54   AVSQLMQVSVAVALNGDSSLQRSA--FKANSITFNNRSPISFQPFDLKTRNGKSRSQYVV  227
            A S + QV+VAV +  DS+L RSA  FK  ++    +S       DLK+RN + R++YVV
Sbjct  2    AHSAVSQVAVAVPVGTDSTL-RSAPLFKTQNLRLGEKSWAPVLSLDLKSRNPRLRNRYVV  60

Query  228  CMSVQQANIPKVTVSPLSLEDAKEPPLNLYKPKGPYTATIASVERIVGPKAPGETCHIVI  407
            CMSVQQA+  KV VSPL LE+  +PPLNLYKPK PYTATI SVER+VG KAPGETCHIVI
Sbjct  61   CMSVQQASKSKVAVSPLELEERSQPPLNLYKPKEPYTATIVSVERVVGAKAPGETCHIVI  120

Query  408  DHGGNVPYWEGQSYGVIPPGENPKKPGSPHNVRLYSIASSRYGDSFDGKTTSLCVRRAVY  587
            DHGGNVPYWEGQSYGVIPPGENPKKPG+PHNVRLYSIAS+RYGDSFDGKT SLCVRRAVY
Sbjct  121  DHGGNVPYWEGQSYGVIPPGENPKKPGNPHNVRLYSIASTRYGDSFDGKTASLCVRRAVY  180

Query  588  YDPE  599
            YDPE
Sbjct  181  YDPE  184



>ref|XP_003594526.1| Ferredoxin-NADP reductase [Medicago truncatula]
 gb|AES64777.1| ferredoxin reductase-like NAD(P) binding domain protein [Medicago 
truncatula]
 gb|AFK47886.1| unknown [Medicago truncatula]
Length=378

 Score =   265 bits (677),  Expect = 6e-84, Method: Compositional matrix adjust.
 Identities = 126/177 (71%), Positives = 148/177 (84%), Gaps = 1/177 (1%)
 Frame = +3

Query  72   QVSVAVALNGDSSLQRSAFKANSITFNNRSPISFQPFDLKTRN-GKSRSQYVVCMSVQQA  248
            Q++V V ++ D S +RS FKA++I F ++S       D+K +N G  R+Q V+CMSVQQA
Sbjct  8    QMAVTVPVSNDFSARRSVFKASNINFRDKSWAPVFALDMKAKNCGWRRNQNVICMSVQQA  67

Query  249  NIPKVTVSPLSLEDAKEPPLNLYKPKGPYTATIASVERIVGPKAPGETCHIVIDHGGNVP  428
            ++PKV VSPL LE+  EPPLNL+KPK PYTATI SVER+VGPKAPGETCH+VI+H GNVP
Sbjct  68   SVPKVAVSPLELENPAEPPLNLHKPKEPYTATIVSVERLVGPKAPGETCHVVINHDGNVP  127

Query  429  YWEGQSYGVIPPGENPKKPGSPHNVRLYSIASSRYGDSFDGKTTSLCVRRAVYYDPE  599
            YWEGQSYGVIPPGENPKKPG+PHNVRLYSIAS+RYGD FDGKT SLCVRRAVYYDPE
Sbjct  128  YWEGQSYGVIPPGENPKKPGAPHNVRLYSIASTRYGDFFDGKTASLCVRRAVYYDPE  184



>ref|XP_010691939.1| PREDICTED: ferredoxin--NADP reductase, root isozyme, chloroplastic-like 
[Beta vulgaris subsp. vulgaris]
Length=376

 Score =   265 bits (676),  Expect = 8e-84, Method: Compositional matrix adjust.
 Identities = 125/182 (69%), Positives = 147/182 (81%), Gaps = 0/182 (0%)
 Frame = +3

Query  54   AVSQLMQVSVAVALNGDSSLQRSAFKANSITFNNRSPISFQPFDLKTRNGKSRSQYVVCM  233
            A S + +VSVA+ +  DSS++ S FK  S++F N+S       +LK +N + R   V CM
Sbjct  2    AHSAIAKVSVAIPVTNDSSVKGSVFKTYSVSFGNKSWDPVYTLNLKAKNLRLRKHSVSCM  61

Query  234  SVQQANIPKVTVSPLSLEDAKEPPLNLYKPKGPYTATIASVERIVGPKAPGETCHIVIDH  413
            SVQ+A  PKV VSPL LED KEPPL+L+K K PYT TI SVER+VGPKAPGETCHIVIDH
Sbjct  62   SVQEAITPKVAVSPLELEDTKEPPLHLFKNKEPYTGTIVSVERLVGPKAPGETCHIVIDH  121

Query  414  GGNVPYWEGQSYGVIPPGENPKKPGSPHNVRLYSIASSRYGDSFDGKTTSLCVRRAVYYD  593
            GGNVPYWEGQSYG+IPPGENPKKPG+PHNVRLYSIAS+RYGD+FDGKT +LCVRRA+YYD
Sbjct  122  GGNVPYWEGQSYGIIPPGENPKKPGNPHNVRLYSIASTRYGDNFDGKTGTLCVRRALYYD  181

Query  594  PE  599
            PE
Sbjct  182  PE  183



>emb|CAA67796.1| ferrodoxin NADP oxidoreductase [Pisum sativum]
Length=378

 Score =   264 bits (675),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 124/175 (71%), Positives = 148/175 (85%), Gaps = 0/175 (0%)
 Frame = +3

Query  72   QVSVAVALNGDSSLQRSAFKANSITFNNRSPISFQPFDLKTRNGKSRSQYVVCMSVQQAN  251
            Q++V V ++ D S++RSAFK++++ F ++S        +K +N   R+  V+CMSVQQA+
Sbjct  9    QMAVTVPVSSDFSVRRSAFKSSNLNFRDKSWAPVFTLGMKAKNCGWRNHNVICMSVQQAS  68

Query  252  IPKVTVSPLSLEDAKEPPLNLYKPKGPYTATIASVERIVGPKAPGETCHIVIDHGGNVPY  431
            +PKVTVSPL LE+  EPPLNL+KPK PYTATI SVER+VGPKAPGETCHIVI+H GNVPY
Sbjct  69   VPKVTVSPLELENPSEPPLNLHKPKEPYTATIVSVERLVGPKAPGETCHIVINHDGNVPY  128

Query  432  WEGQSYGVIPPGENPKKPGSPHNVRLYSIASSRYGDSFDGKTTSLCVRRAVYYDP  596
            WEGQSYGVIPPGENPKKPGSPHNVRLYSIAS+RYGD+FDGKT SLCVRRAVYYDP
Sbjct  129  WEGQSYGVIPPGENPKKPGSPHNVRLYSIASTRYGDNFDGKTASLCVRRAVYYDP  183



>sp|Q41014.2|FENR2_PEA RecName: Full=Ferredoxin--NADP reductase, root isozyme, chloroplastic; 
Short=FNR; Flags: Precursor [Pisum sativum]
Length=377

 Score =   264 bits (674),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 124/175 (71%), Positives = 148/175 (85%), Gaps = 0/175 (0%)
 Frame = +3

Query  72   QVSVAVALNGDSSLQRSAFKANSITFNNRSPISFQPFDLKTRNGKSRSQYVVCMSVQQAN  251
            Q++V V ++ D S++RSAFK++++ F ++S        +K +N   R+  V+CMSVQQA+
Sbjct  8    QMAVTVPVSSDFSVRRSAFKSSNLNFRDKSWAPVFTLGMKAKNCGWRNHNVICMSVQQAS  67

Query  252  IPKVTVSPLSLEDAKEPPLNLYKPKGPYTATIASVERIVGPKAPGETCHIVIDHGGNVPY  431
            +PKVTVSPL LE+  EPPLNL+KPK PYTATI SVER+VGPKAPGETCHIVI+H GNVPY
Sbjct  68   VPKVTVSPLELENPSEPPLNLHKPKEPYTATIVSVERLVGPKAPGETCHIVINHDGNVPY  127

Query  432  WEGQSYGVIPPGENPKKPGSPHNVRLYSIASSRYGDSFDGKTTSLCVRRAVYYDP  596
            WEGQSYGVIPPGENPKKPGSPHNVRLYSIAS+RYGD+FDGKT SLCVRRAVYYDP
Sbjct  128  WEGQSYGVIPPGENPKKPGSPHNVRLYSIASTRYGDNFDGKTASLCVRRAVYYDP  182



>ref|XP_006305070.1| hypothetical protein CARUB_v10009436mg [Capsella rubella]
 gb|EOA37968.1| hypothetical protein CARUB_v10009436mg [Capsella rubella]
Length=382

 Score =   261 bits (668),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 129/186 (69%), Positives = 148/186 (80%), Gaps = 5/186 (3%)
 Frame = +3

Query  51   AAVSQLMQVSVAVALNGDSSLQRSAFKANSITFNNRSPISFQPFDLKTRNGKSRSQYV--  224
            A VSQ   VSV++    + SL+RS FK NSI+FN+++  S    + KT N +   +Y   
Sbjct  5    AVVSQAGAVSVSIG--NERSLRRSVFKNNSISFNSKTWSSSLALNQKTTNVRDAKRYTNT  62

Query  225  -VCMSVQQANIPKVTVSPLSLEDAKEPPLNLYKPKGPYTATIASVERIVGPKAPGETCHI  401
             +CMSVQQ +  KVTVSP+ LED K+PPLNLYKPK  YTA I SVER+VGPKAPGETCHI
Sbjct  63   TICMSVQQTSSSKVTVSPIELEDPKDPPLNLYKPKESYTAKIVSVERVVGPKAPGETCHI  122

Query  402  VIDHGGNVPYWEGQSYGVIPPGENPKKPGSPHNVRLYSIASSRYGDSFDGKTTSLCVRRA  581
            VIDH GN+PYWEGQSYGVIPPGENPKKPG+PHNVRLYSIAS+RYGDSFDGKT SLCVRRA
Sbjct  123  VIDHDGNLPYWEGQSYGVIPPGENPKKPGAPHNVRLYSIASTRYGDSFDGKTASLCVRRA  182

Query  582  VYYDPE  599
            VYYDPE
Sbjct  183  VYYDPE  188



>ref|XP_002893629.1| ATRFNR2 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH69888.1| ATRFNR2 [Arabidopsis lyrata subsp. lyrata]
Length=381

 Score =   258 bits (659),  Expect = 4e-81, Method: Compositional matrix adjust.
 Identities = 124/177 (70%), Positives = 143/177 (81%), Gaps = 3/177 (2%)
 Frame = +3

Query  78   SVAVALNGDSSLQRSAFKANSITFNNRSPISFQPFDLKT---RNGKSRSQYVVCMSVQQA  248
            +V+V++  + SL+RS FK NSI+F  +S  S    + KT   R+ K  +   +CMSVQQ 
Sbjct  11   AVSVSIGNERSLRRSVFKNNSISFKGKSWSSSLALNQKTTGIRDAKRYTNTTICMSVQQT  70

Query  249  NIPKVTVSPLSLEDAKEPPLNLYKPKGPYTATIASVERIVGPKAPGETCHIVIDHGGNVP  428
            +  KVTVSP+ LEDAK+PPLNLYKPK  YTA I SVER+VGPKAPGETCHIVIDH GN+P
Sbjct  71   SSSKVTVSPIDLEDAKDPPLNLYKPKDSYTAKIVSVERVVGPKAPGETCHIVIDHDGNLP  130

Query  429  YWEGQSYGVIPPGENPKKPGSPHNVRLYSIASSRYGDSFDGKTTSLCVRRAVYYDPE  599
            YWEGQSYGVIPPGENPKKPG+PHNVRLYSIAS+RYGD FDGKT SLCVRRAVYYDPE
Sbjct  131  YWEGQSYGVIPPGENPKKPGAPHNVRLYSIASTRYGDFFDGKTASLCVRRAVYYDPE  187



>ref|XP_010907336.1| PREDICTED: ferredoxin--NADP reductase, root isozyme, chloroplastic-like 
isoform X2 [Elaeis guineensis]
Length=360

 Score =   257 bits (656),  Expect = 6e-81, Method: Compositional matrix adjust.
 Identities = 120/157 (76%), Positives = 136/157 (87%), Gaps = 1/157 (1%)
 Frame = +3

Query  132  ANSITFNNRSPISFQPFDLKTRNGKSRSQY-VVCMSVQQANIPKVTVSPLSLEDAKEPPL  308
             N+++F+N   + F   DL++   +S+ ++ VVCMSVQQA+  KV V PL LEDAKEPPL
Sbjct  10   CNNVSFHNNFWVPFTSLDLRSNKVQSKCRFKVVCMSVQQASKSKVAVKPLELEDAKEPPL  69

Query  309  NLYKPKGPYTATIASVERIVGPKAPGETCHIVIDHGGNVPYWEGQSYGVIPPGENPKKPG  488
            NLYKPK PYTATI SVER+VGPKAPGETCHIVIDHGGNVPYWEGQSYG+IPPGENPKKPG
Sbjct  70   NLYKPKEPYTATIVSVERLVGPKAPGETCHIVIDHGGNVPYWEGQSYGIIPPGENPKKPG  129

Query  489  SPHNVRLYSIASSRYGDSFDGKTTSLCVRRAVYYDPE  599
            +PHNVRLYSIAS+RYGDSFDGKT SLCVRRAVYYDPE
Sbjct  130  APHNVRLYSIASTRYGDSFDGKTASLCVRRAVYYDPE  166



>gb|EYU43232.1| hypothetical protein MIMGU_mgv1a008184mg [Erythranthe guttata]
Length=382

 Score =   256 bits (655),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 128/186 (69%), Positives = 152/186 (82%), Gaps = 4/186 (2%)
 Frame = +3

Query  51   AAVSQLMQVSVAVALNGDSSLQRSAFKANSITFN-NRSPISFQPFDLKTRNGKSR--SQY  221
            +A+SQ+  V+V  + + D+SL ++ FK N+++FN  +S IS    D KT N +S+  S+ 
Sbjct  4    SALSQV-PVTVCFSYSSDTSLPKTVFKGNNVSFNGKKSWISRLSSDFKTANSRSKGKSRP  62

Query  222  VVCMSVQQANIPKVTVSPLSLEDAKEPPLNLYKPKGPYTATIASVERIVGPKAPGETCHI  401
            V+CMSV+QA+  K  +SPLSLEDAKEPPL+LYK K PYTATI SVERIVGP APGETCH+
Sbjct  63   VICMSVEQASKEKAAISPLSLEDAKEPPLHLYKNKEPYTATIVSVERIVGPTAPGETCHV  122

Query  402  VIDHGGNVPYWEGQSYGVIPPGENPKKPGSPHNVRLYSIASSRYGDSFDGKTTSLCVRRA  581
            VIDHGGNVPYWEGQSYG+IPPGEN KKPGS HNVRLYSIAS+RYGD FDGKT SLCVRRA
Sbjct  123  VIDHGGNVPYWEGQSYGIIPPGENLKKPGSSHNVRLYSIASTRYGDFFDGKTASLCVRRA  182

Query  582  VYYDPE  599
            VYYDPE
Sbjct  183  VYYDPE  188



>ref|XP_009397718.1| PREDICTED: ferredoxin--NADP reductase, root isozyme, chloroplastic-like 
[Musa acuminata subsp. malaccensis]
Length=379

 Score =   256 bits (654),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 123/177 (69%), Positives = 146/177 (82%), Gaps = 2/177 (1%)
 Frame = +3

Query  75   VSVAVALNGDSSLQRSAFK-ANSITFNNRSPISFQPFDLKTRNGKSRSQY-VVCMSVQQA  248
             SV+ ++  D+SL+++ FK  N + F+N+  I+    +LK+R   ++ Q+ V+ MSVQQA
Sbjct  9    ASVSPSVGTDASLRKTGFKDHNKLRFDNKLWITLSSVNLKSRYSSTKYQFKVMSMSVQQA  68

Query  249  NIPKVTVSPLSLEDAKEPPLNLYKPKGPYTATIASVERIVGPKAPGETCHIVIDHGGNVP  428
               K+ V PL LE+A EPPLNLYKPK PYTATI SVER+VGPKAPGETCHIVIDHGGNVP
Sbjct  69   VRSKIPVQPLELENANEPPLNLYKPKEPYTATIVSVERLVGPKAPGETCHIVIDHGGNVP  128

Query  429  YWEGQSYGVIPPGENPKKPGSPHNVRLYSIASSRYGDSFDGKTTSLCVRRAVYYDPE  599
            YWEGQSYG+IPPGENPKKPGSPHNVRLYSIAS+RYGDSFDGKT SLCVRRA+YYDPE
Sbjct  129  YWEGQSYGIIPPGENPKKPGSPHNVRLYSIASTRYGDSFDGKTASLCVRRAIYYDPE  185



>ref|XP_006415461.1| hypothetical protein EUTSA_v10007919mg [Eutrema salsugineum]
 gb|ESQ33814.1| hypothetical protein EUTSA_v10007919mg [Eutrema salsugineum]
Length=381

 Score =   256 bits (653),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 126/186 (68%), Positives = 145/186 (78%), Gaps = 5/186 (3%)
 Frame = +3

Query  51   AAVSQLMQVSVAVALNGDSSLQRSAFKANSITFNNR---SPISFQPFDLKTRNGKSRSQY  221
            +AVSQ   VSV +    + SL RS FK NSI+FN++   S ++       TR+ K  +  
Sbjct  4    SAVSQAAAVSVPIG--NERSLSRSVFKNNSISFNSKPWSSSLALNQKTTITRDAKRYTST  61

Query  222  VVCMSVQQANIPKVTVSPLSLEDAKEPPLNLYKPKGPYTATIASVERIVGPKAPGETCHI  401
             +CMSVQQ +  KV+VSP+ LED K+PPLNLYKPK  YTA I SVER+VGPKAPGETCHI
Sbjct  62   TICMSVQQTSSSKVSVSPIELEDPKDPPLNLYKPKDSYTAKIVSVERVVGPKAPGETCHI  121

Query  402  VIDHGGNVPYWEGQSYGVIPPGENPKKPGSPHNVRLYSIASSRYGDSFDGKTTSLCVRRA  581
            VIDH GN+PYWEGQSYGVIPPGENPKKPG+PHNVRLYSIAS+RYGD FDGKT SLCVRRA
Sbjct  122  VIDHDGNLPYWEGQSYGVIPPGENPKKPGAPHNVRLYSIASTRYGDFFDGKTASLCVRRA  181

Query  582  VYYDPE  599
            VYYDPE
Sbjct  182  VYYDPE  187



>ref|XP_011016596.1| PREDICTED: ferredoxin--NADP reductase, root isozyme 1, chloroplastic-like 
[Populus euphratica]
Length=355

 Score =   253 bits (647),  Expect = 9e-80, Method: Compositional matrix adjust.
 Identities = 118/158 (75%), Positives = 133/158 (84%), Gaps = 0/158 (0%)
 Frame = +3

Query  126  FKANSITFNNRSPISFQPFDLKTRNGKSRSQYVVCMSVQQANIPKVTVSPLSLEDAKEPP  305
             +  +I+F ++S       DLK+RN   + + +VCMSVQQA+  KV VSPL LEDAKEPP
Sbjct  4    LQIQNISFGDKSWHPASSLDLKSRNAGLKKRLLVCMSVQQASRSKVAVSPLGLEDAKEPP  63

Query  306  LNLYKPKGPYTATIASVERIVGPKAPGETCHIVIDHGGNVPYWEGQSYGVIPPGENPKKP  485
            LN YKPK PYTATI SVER+VGP APGETCH+VIDHGGNVPYWEGQSYGVIPPGENPKKP
Sbjct  64   LNTYKPKEPYTATIVSVERLVGPNAPGETCHVVIDHGGNVPYWEGQSYGVIPPGENPKKP  123

Query  486  GSPHNVRLYSIASSRYGDSFDGKTTSLCVRRAVYYDPE  599
            G+PHNVRLYSIAS+RYGDSFDGKT SLC+RRAVYYDPE
Sbjct  124  GAPHNVRLYSIASTRYGDSFDGKTASLCIRRAVYYDPE  161



>gb|KFK32212.1| hypothetical protein AALP_AA6G212100 [Arabis alpina]
Length=377

 Score =   253 bits (645),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 124/184 (67%), Positives = 142/184 (77%), Gaps = 1/184 (1%)
 Frame = +3

Query  48   MAAVSQLMQVSVAVALNGDSSLQRSAFKANSITFNNRSPISFQPFDLKTRNGKSRSQYVV  227
            MA  + + Q+SV+     D S  RS  K  SI+F  +S       D K+R+   + Q  +
Sbjct  1    MALSTPISQMSVSFLTGVDGS-TRSMIKVQSISFTEKSWSPLLGLDSKSRSLGVKKQSTI  59

Query  228  CMSVQQANIPKVTVSPLSLEDAKEPPLNLYKPKGPYTATIASVERIVGPKAPGETCHIVI  407
            CMS+QQA+  KV V+PL LE+ KE PLNLYKPK PYTATI SVERIVGP+APGETCHIVI
Sbjct  60   CMSLQQASKSKVLVTPLELEEPKETPLNLYKPKEPYTATIVSVERIVGPQAPGETCHIVI  119

Query  408  DHGGNVPYWEGQSYGVIPPGENPKKPGSPHNVRLYSIASSRYGDSFDGKTTSLCVRRAVY  587
            DH GNVPYWEGQSYGVIPPGENPKKPG+PHNVRLYSIAS+RYGDSFDGKT SLCVRRA+Y
Sbjct  120  DHDGNVPYWEGQSYGVIPPGENPKKPGAPHNVRLYSIASTRYGDSFDGKTASLCVRRALY  179

Query  588  YDPE  599
            YDPE
Sbjct  180  YDPE  183



>ref|XP_006844572.1| hypothetical protein AMTR_s00016p00195680 [Amborella trichopoda]
 gb|ERN06247.1| hypothetical protein AMTR_s00016p00195680 [Amborella trichopoda]
Length=377

 Score =   253 bits (645),  Expect = 3e-79, Method: Compositional matrix adjust.
 Identities = 121/182 (66%), Positives = 143/182 (79%), Gaps = 0/182 (0%)
 Frame = +3

Query  54   AVSQLMQVSVAVALNGDSSLQRSAFKANSITFNNRSPISFQPFDLKTRNGKSRSQYVVCM  233
            A S   Q +  V  + D+S++RS+F+ +S++F  ++ +     +   +   S++ Y  CM
Sbjct  2    AYSICSQAANLVHASCDTSVRRSSFQKSSLSFQGKAWVPVLSLNGSPKTLSSKAGYTTCM  61

Query  234  SVQQANIPKVTVSPLSLEDAKEPPLNLYKPKGPYTATIASVERIVGPKAPGETCHIVIDH  413
            SVQQA   KV VSPL LEDA+EPPLNLYKPK  YTATI SVER+VGPKAPGETCHIVIDH
Sbjct  62   SVQQAKRSKVAVSPLELEDAREPPLNLYKPKDSYTATIVSVERLVGPKAPGETCHIVIDH  121

Query  414  GGNVPYWEGQSYGVIPPGENPKKPGSPHNVRLYSIASSRYGDSFDGKTTSLCVRRAVYYD  593
            GGNVPYWEGQSYGVIPPGENPKKPG+P NVRLYSIAS+RYGD FDGKT SLCVRRAVYYD
Sbjct  122  GGNVPYWEGQSYGVIPPGENPKKPGAPQNVRLYSIASTRYGDFFDGKTASLCVRRAVYYD  181

Query  594  PE  599
            P+
Sbjct  182  PD  183



>ref|XP_010529363.1| PREDICTED: ferredoxin--NADP reductase, root isozyme 1, chloroplastic 
[Tarenaya hassleriana]
Length=377

 Score =   252 bits (644),  Expect = 6e-79, Method: Compositional matrix adjust.
 Identities = 128/186 (69%), Positives = 146/186 (78%), Gaps = 4/186 (2%)
 Frame = +3

Query  42   AIMAAVSQLMQVSVAVALNGDSSLQRSAFKANSITFNNRSPISFQPFDLKTRNGKSRSQY  221
            A+ AA SQ+   SV     GDSS + S  K  SI+F  +S       + ++RN     + 
Sbjct  2    ALSAAASQM---SVLPLPAGDSS-RGSMLKVQSISFGEKSWAPVLRLESRSRNLCVTKRG  57

Query  222  VVCMSVQQANIPKVTVSPLSLEDAKEPPLNLYKPKGPYTATIASVERIVGPKAPGETCHI  401
             +CMSVQQA+  KV+V+PL LEDAKEPPL+L+KPK PYTATI SVER+VGPKAPGETCHI
Sbjct  58   TICMSVQQASKSKVSVTPLELEDAKEPPLHLHKPKEPYTATIVSVERLVGPKAPGETCHI  117

Query  402  VIDHGGNVPYWEGQSYGVIPPGENPKKPGSPHNVRLYSIASSRYGDSFDGKTTSLCVRRA  581
            VIDH GNVPYWEGQSYGVIPPGENPKKPG+PHNVRLYSIAS+RYGDSFDGKT SLCVRRA
Sbjct  118  VIDHSGNVPYWEGQSYGVIPPGENPKKPGNPHNVRLYSIASTRYGDSFDGKTASLCVRRA  177

Query  582  VYYDPE  599
            VYYDPE
Sbjct  178  VYYDPE  183



>ref|XP_010431466.1| PREDICTED: ferredoxin--NADP reductase, root isozyme 1, chloroplastic 
isoform X1 [Camelina sativa]
Length=377

 Score =   252 bits (644),  Expect = 6e-79, Method: Compositional matrix adjust.
 Identities = 126/184 (68%), Positives = 142/184 (77%), Gaps = 1/184 (1%)
 Frame = +3

Query  48   MAAVSQLMQVSVAVALNGDSSLQRSAFKANSITFNNRSPISFQPFDLKTRNGKSRSQYVV  227
            MA  + L Q+SVA+    D S  RS  K  S +F  +S       D K+R+   + +  V
Sbjct  1    MALSTPLSQMSVALPTGIDGS-TRSMIKLQSQSFTEKSWGPRLRLDSKSRSFSVKKRSTV  59

Query  228  CMSVQQANIPKVTVSPLSLEDAKEPPLNLYKPKGPYTATIASVERIVGPKAPGETCHIVI  407
            CMS+QQA+  KV V+PL LED KE PLNLY+PK PYTATI SVERIVGPKAPGETCHIVI
Sbjct  60   CMSLQQASKSKVLVTPLELEDPKETPLNLYRPKEPYTATIVSVERIVGPKAPGETCHIVI  119

Query  408  DHGGNVPYWEGQSYGVIPPGENPKKPGSPHNVRLYSIASSRYGDSFDGKTTSLCVRRAVY  587
            DH GNVPYWEGQSYGVIPPGENPKKPG+PHNVRLYSIAS+RYGDSFDGKT SLCVRRA+Y
Sbjct  120  DHDGNVPYWEGQSYGVIPPGENPKKPGAPHNVRLYSIASTRYGDSFDGKTASLCVRRAIY  179

Query  588  YDPE  599
            YDPE
Sbjct  180  YDPE  183



>ref|XP_006287956.1| hypothetical protein CARUB_v10001191mg [Capsella rubella]
 gb|EOA20854.1| hypothetical protein CARUB_v10001191mg [Capsella rubella]
Length=377

 Score =   252 bits (643),  Expect = 7e-79, Method: Compositional matrix adjust.
 Identities = 127/184 (69%), Positives = 139/184 (76%), Gaps = 1/184 (1%)
 Frame = +3

Query  48   MAAVSQLMQVSVAVALNGDSSLQRSAFKANSITFNNRSPISFQPFDLKTRNGKSRSQYVV  227
            MA  + L Q+SV +    D S  RS  K  SI F   S  S    D K+R+        V
Sbjct  1    MALSTPLSQMSVTLPTGIDGS-SRSMIKLQSINFTETSWGSRLRLDSKSRSLSVNKWSTV  59

Query  228  CMSVQQANIPKVTVSPLSLEDAKEPPLNLYKPKGPYTATIASVERIVGPKAPGETCHIVI  407
            CMS+QQA+  KV V+PL LED KE PLNLY+PK PYTATI SVERIVGPKAPGETCHIVI
Sbjct  60   CMSLQQASKSKVLVTPLELEDPKETPLNLYRPKEPYTATIVSVERIVGPKAPGETCHIVI  119

Query  408  DHGGNVPYWEGQSYGVIPPGENPKKPGSPHNVRLYSIASSRYGDSFDGKTTSLCVRRAVY  587
            DH GNVPYWEGQSYGVIPPGENPKKPG+PHNVRLYSIAS+RYGDSFDGKT SLCVRRA+Y
Sbjct  120  DHDGNVPYWEGQSYGVIPPGENPKKPGAPHNVRLYSIASTRYGDSFDGKTASLCVRRAIY  179

Query  588  YDPE  599
            YDPE
Sbjct  180  YDPE  183



>ref|XP_010422426.1| PREDICTED: ferredoxin--NADP reductase, root isozyme 1, chloroplastic-like 
isoform X1 [Camelina sativa]
Length=377

 Score =   252 bits (643),  Expect = 9e-79, Method: Compositional matrix adjust.
 Identities = 126/184 (68%), Positives = 142/184 (77%), Gaps = 1/184 (1%)
 Frame = +3

Query  48   MAAVSQLMQVSVAVALNGDSSLQRSAFKANSITFNNRSPISFQPFDLKTRNGKSRSQYVV  227
            MA  + L Q+SVA+    D S  RS  K  SI+F  +S       D K+R+     +  V
Sbjct  1    MALSTPLSQISVALPTGIDGS-SRSMIKLQSISFTEKSWGPRLRLDSKSRSLCVNKRSTV  59

Query  228  CMSVQQANIPKVTVSPLSLEDAKEPPLNLYKPKGPYTATIASVERIVGPKAPGETCHIVI  407
            CMS+QQA+  KV V+PL LED KE PLNLY+PK PYTATI SVERIVGP+APGETCHIVI
Sbjct  60   CMSLQQASKSKVLVTPLELEDPKETPLNLYRPKEPYTATIVSVERIVGPQAPGETCHIVI  119

Query  408  DHGGNVPYWEGQSYGVIPPGENPKKPGSPHNVRLYSIASSRYGDSFDGKTTSLCVRRAVY  587
            DH GNVPYWEGQSYGVIPPGENPKKPG+PHNVRLYSIAS+RYGDSFDGKT SLCVRRA+Y
Sbjct  120  DHDGNVPYWEGQSYGVIPPGENPKKPGAPHNVRLYSIASTRYGDSFDGKTASLCVRRAIY  179

Query  588  YDPE  599
            YDPE
Sbjct  180  YDPE  183



>ref|XP_006415462.1| hypothetical protein EUTSA_v10007919mg [Eutrema salsugineum]
 gb|ESQ33815.1| hypothetical protein EUTSA_v10007919mg [Eutrema salsugineum]
Length=382

 Score =   251 bits (642),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 126/187 (67%), Positives = 145/187 (78%), Gaps = 6/187 (3%)
 Frame = +3

Query  51   AAVSQLMQVSVAVALNGDSSLQRSAFKAN-SITFNNR---SPISFQPFDLKTRNGKSRSQ  218
            +AVSQ   VSV +    + SL RS FK N SI+FN++   S ++       TR+ K  + 
Sbjct  4    SAVSQAAAVSVPIG--NERSLSRSVFKQNNSISFNSKPWSSSLALNQKTTITRDAKRYTS  61

Query  219  YVVCMSVQQANIPKVTVSPLSLEDAKEPPLNLYKPKGPYTATIASVERIVGPKAPGETCH  398
              +CMSVQQ +  KV+VSP+ LED K+PPLNLYKPK  YTA I SVER+VGPKAPGETCH
Sbjct  62   TTICMSVQQTSSSKVSVSPIELEDPKDPPLNLYKPKDSYTAKIVSVERVVGPKAPGETCH  121

Query  399  IVIDHGGNVPYWEGQSYGVIPPGENPKKPGSPHNVRLYSIASSRYGDSFDGKTTSLCVRR  578
            IVIDH GN+PYWEGQSYGVIPPGENPKKPG+PHNVRLYSIAS+RYGD FDGKT SLCVRR
Sbjct  122  IVIDHDGNLPYWEGQSYGVIPPGENPKKPGAPHNVRLYSIASTRYGDFFDGKTASLCVRR  181

Query  579  AVYYDPE  599
            AVYYDPE
Sbjct  182  AVYYDPE  188



>ref|XP_006396605.1| hypothetical protein EUTSA_v10028734mg [Eutrema salsugineum]
 gb|ESQ38058.1| hypothetical protein EUTSA_v10028734mg [Eutrema salsugineum]
Length=377

 Score =   251 bits (641),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 124/184 (67%), Positives = 142/184 (77%), Gaps = 1/184 (1%)
 Frame = +3

Query  48   MAAVSQLMQVSVAVALNGDSSLQRSAFKANSITFNNRSPISFQPFDLKTRNGKSRSQYVV  227
            MA  +   Q+SVA+    D S  RS  K  SI+F  +S       D K+R    + +  +
Sbjct  1    MALSTHPSQMSVALPTGIDGS-SRSMIKVQSISFTEKSWGPLLRLDSKSRKLSLKKRSTI  59

Query  228  CMSVQQANIPKVTVSPLSLEDAKEPPLNLYKPKGPYTATIASVERIVGPKAPGETCHIVI  407
            CMS+QQA+  KV+V+PL LED KE PLNLYKPK PYTATI SVERIVGP+APGETCHIVI
Sbjct  60   CMSLQQASRSKVSVTPLELEDPKETPLNLYKPKEPYTATIVSVERIVGPQAPGETCHIVI  119

Query  408  DHGGNVPYWEGQSYGVIPPGENPKKPGSPHNVRLYSIASSRYGDSFDGKTTSLCVRRAVY  587
            +H GNVPYWEGQSYGVIPPGENPKKPG+PHNVRLYSIAS+RYGDSFDGKT SLCVRRA+Y
Sbjct  120  NHDGNVPYWEGQSYGVIPPGENPKKPGAPHNVRLYSIASTRYGDSFDGKTASLCVRRALY  179

Query  588  YDPE  599
            YDPE
Sbjct  180  YDPE  183



>emb|CDY02299.1| BnaA09g26030D [Brassica napus]
Length=382

 Score =   251 bits (641),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 128/187 (68%), Positives = 143/187 (76%), Gaps = 6/187 (3%)
 Frame = +3

Query  51   AAVSQLMQVSVAVALNGDSSLQRSAFKAN-SITFNNRSPISFQPFDLKT---RNGKSRSQ  218
            +AVSQ   VSV++    + SL RS FK N SI+FN +   S      KT   R+ K  S 
Sbjct  4    SAVSQAAAVSVSIG--NERSLTRSVFKQNNSISFNTKPWSSSLALTQKTSTIRDAKRYSN  61

Query  219  YVVCMSVQQANIPKVTVSPLSLEDAKEPPLNLYKPKGPYTATIASVERIVGPKAPGETCH  398
              +CMSVQQA+  KV VSP+ LED  +PPLNLYKPK  YTA I SVER+VGPKAPGETCH
Sbjct  62   TTICMSVQQASSSKVNVSPIELEDPTDPPLNLYKPKDSYTAKIVSVERVVGPKAPGETCH  121

Query  399  IVIDHGGNVPYWEGQSYGVIPPGENPKKPGSPHNVRLYSIASSRYGDSFDGKTTSLCVRR  578
            IVIDH GN+PYWEGQSYGVIPPGENPKKPG+PHNVRLYSIAS+RYGD FDGKT SLCVRR
Sbjct  122  IVIDHDGNLPYWEGQSYGVIPPGENPKKPGAPHNVRLYSIASTRYGDFFDGKTASLCVRR  181

Query  579  AVYYDPE  599
            AVYYDPE
Sbjct  182  AVYYDPE  188



>ref|XP_009397390.1| PREDICTED: ferredoxin--NADP reductase, embryo isozyme, chloroplastic-like 
[Musa acuminata subsp. malaccensis]
Length=379

 Score =   250 bits (639),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 126/184 (68%), Positives = 147/184 (80%), Gaps = 4/184 (2%)
 Frame = +3

Query  54   AVSQLMQVSVAVALNGDSSLQRSAFKANS-ITFNNRSPISFQPFDLKTRNGKSRSQ-YVV  227
            A+  L  VS +VA   D+SL+++ FK N+ ++++N+  I     +LK+R   ++ Q  VV
Sbjct  4    ALGALASVSPSVA--ADASLRKAGFKINNNLSYDNKLWIPLSSVNLKSRFSSTKFQCKVV  61

Query  228  CMSVQQANIPKVTVSPLSLEDAKEPPLNLYKPKGPYTATIASVERIVGPKAPGETCHIVI  407
             MSVQQ    K+ V PL LE+AKEPPLNLYKPK PYTATI SVER+VGP APGETCHIVI
Sbjct  62   SMSVQQTVQSKIPVQPLELENAKEPPLNLYKPKEPYTATIVSVERLVGPNAPGETCHIVI  121

Query  408  DHGGNVPYWEGQSYGVIPPGENPKKPGSPHNVRLYSIASSRYGDSFDGKTTSLCVRRAVY  587
            DHGGNVPYWEGQSYGVIPPGENPKKPG+PHNVRLYSIAS+RYGDSFDGKT SLCVRRAVY
Sbjct  122  DHGGNVPYWEGQSYGVIPPGENPKKPGNPHNVRLYSIASTRYGDSFDGKTASLCVRRAVY  181

Query  588  YDPE  599
            YD E
Sbjct  182  YDAE  185



>emb|CDY09570.1| BnaC05g23490D [Brassica napus]
Length=382

 Score =   250 bits (639),  Expect = 4e-78, Method: Compositional matrix adjust.
 Identities = 128/187 (68%), Positives = 143/187 (76%), Gaps = 6/187 (3%)
 Frame = +3

Query  51   AAVSQLMQVSVAVALNGDSSLQRSAFKAN-SITFNNRSPISFQPFDLKT---RNGKSRSQ  218
            +AVSQ   VSV++    + SL RS FK N SI+FN +   S      KT   R+ K  S 
Sbjct  4    SAVSQAAAVSVSIG--NERSLTRSVFKHNNSISFNTKPWSSSLALTQKTSTIRDAKRYSN  61

Query  219  YVVCMSVQQANIPKVTVSPLSLEDAKEPPLNLYKPKGPYTATIASVERIVGPKAPGETCH  398
              +CMSVQQA+  KV VSP+ LED  +PPLNLYKPK  YTA I SVER+VGPKAPGETCH
Sbjct  62   TTICMSVQQASSSKVNVSPIELEDPTDPPLNLYKPKDSYTAKIVSVERVVGPKAPGETCH  121

Query  399  IVIDHGGNVPYWEGQSYGVIPPGENPKKPGSPHNVRLYSIASSRYGDSFDGKTTSLCVRR  578
            IVIDH GN+PYWEGQSYGVIPPGENPKKPG+PHNVRLYSIAS+RYGD FDGKT SLCVRR
Sbjct  122  IVIDHEGNLPYWEGQSYGVIPPGENPKKPGAPHNVRLYSIASTRYGDFFDGKTASLCVRR  181

Query  579  AVYYDPE  599
            AVYYDPE
Sbjct  182  AVYYDPE  188



>ref|NP_564355.1| ferredoxin--NADP reductase, root isozyme 2 [Arabidopsis thaliana]
 gb|AEE31236.1| ferredoxin--NADP reductase, root isozyme 2 [Arabidopsis thaliana]
Length=381

 Score =   250 bits (638),  Expect = 5e-78, Method: Compositional matrix adjust.
 Identities = 130/186 (70%), Positives = 147/186 (79%), Gaps = 5/186 (3%)
 Frame = +3

Query  51   AAVSQLMQVSVAVALNGDSSLQRSAFKANSITFNNRSPISFQPFDLKT---RNGKSRSQY  221
            +AVSQ   VSV++      SL+RS FK NSI+FN++S  S    + KT   R+GK     
Sbjct  4    SAVSQAGAVSVSI--ENQRSLRRSVFKNNSISFNSKSWSSSLALNQKTTSIRDGKRYPST  61

Query  222  VVCMSVQQANIPKVTVSPLSLEDAKEPPLNLYKPKGPYTATIASVERIVGPKAPGETCHI  401
             +CMSVQQ +  KVTVSP+ LED K+PPLNLYKPK  YTA I SVER+VGPKAPGETCHI
Sbjct  62   TICMSVQQTSSSKVTVSPIELEDPKDPPLNLYKPKESYTAKIVSVERVVGPKAPGETCHI  121

Query  402  VIDHGGNVPYWEGQSYGVIPPGENPKKPGSPHNVRLYSIASSRYGDSFDGKTTSLCVRRA  581
            VIDH GN+PYWEGQSYGVIPPGENPKKPG+PHNVRLYSIAS+RYGD FDGKT SLCVRRA
Sbjct  122  VIDHDGNLPYWEGQSYGVIPPGENPKKPGAPHNVRLYSIASTRYGDFFDGKTASLCVRRA  181

Query  582  VYYDPE  599
            VYYDPE
Sbjct  182  VYYDPE  187



>ref|XP_009115136.1| PREDICTED: ferredoxin--NADP reductase, root isozyme 2, chloroplastic 
[Brassica rapa]
Length=382

 Score =   250 bits (638),  Expect = 5e-78, Method: Compositional matrix adjust.
 Identities = 128/187 (68%), Positives = 143/187 (76%), Gaps = 6/187 (3%)
 Frame = +3

Query  51   AAVSQLMQVSVAVALNGDSSLQRSAFKAN-SITFNNRSPISFQPFDLKT---RNGKSRSQ  218
            +AVSQ   VSV++    + SL RS FK N SI+FN +   S      KT   R+ K  S 
Sbjct  4    SAVSQAAAVSVSIG--NERSLTRSVFKQNNSISFNTKPWSSSLALTQKTSTIRDAKRYSN  61

Query  219  YVVCMSVQQANIPKVTVSPLSLEDAKEPPLNLYKPKGPYTATIASVERIVGPKAPGETCH  398
              +CMSVQQA+  KV VSP+ LED  +PPLNLYKPK  YTA I SVER+VGPKAPGETCH
Sbjct  62   TTLCMSVQQASSSKVNVSPVELEDPTDPPLNLYKPKDSYTAKIVSVERVVGPKAPGETCH  121

Query  399  IVIDHGGNVPYWEGQSYGVIPPGENPKKPGSPHNVRLYSIASSRYGDSFDGKTTSLCVRR  578
            IVIDH GN+PYWEGQSYGVIPPGENPKKPG+PHNVRLYSIAS+RYGD FDGKT SLCVRR
Sbjct  122  IVIDHDGNLPYWEGQSYGVIPPGENPKKPGAPHNVRLYSIASTRYGDFFDGKTASLCVRR  181

Query  579  AVYYDPE  599
            AVYYDPE
Sbjct  182  AVYYDPE  188



>gb|AAM65564.1| ferrodoxin NADP oxidoreductase, putative [Arabidopsis thaliana]
Length=381

 Score =   250 bits (638),  Expect = 6e-78, Method: Compositional matrix adjust.
 Identities = 130/186 (70%), Positives = 147/186 (79%), Gaps = 5/186 (3%)
 Frame = +3

Query  51   AAVSQLMQVSVAVALNGDSSLQRSAFKANSITFNNRSPISFQPFDLKT---RNGKSRSQY  221
            +AVSQ   VSV++      SL+RS FK NSI+FN++S  S    + KT   R+GK     
Sbjct  4    SAVSQAGAVSVSI--ENQRSLRRSVFKNNSISFNSKSWSSSLALNQKTTSIRDGKRYPST  61

Query  222  VVCMSVQQANIPKVTVSPLSLEDAKEPPLNLYKPKGPYTATIASVERIVGPKAPGETCHI  401
             +CMSVQQ +  KVTVSP+ LED K+PPLNLYKPK  YTA I SVER+VGPKAPGETCHI
Sbjct  62   TICMSVQQTSSSKVTVSPIELEDPKDPPLNLYKPKESYTAKIVSVERVVGPKAPGETCHI  121

Query  402  VIDHGGNVPYWEGQSYGVIPPGENPKKPGSPHNVRLYSIASSRYGDSFDGKTTSLCVRRA  581
            VIDH GN+PYWEGQSYGVIPPGENPKKPG+PHNVRLYSIAS+RYGD FDGKT SLCVRRA
Sbjct  122  VIDHDGNLPYWEGQSYGVIPPGENPKKPGAPHNVRLYSIASTRYGDFFDGKTASLCVRRA  181

Query  582  VYYDPE  599
            VYYDPE
Sbjct  182  VYYDPE  187



>ref|XP_010431473.1| PREDICTED: ferredoxin--NADP reductase, root isozyme 1, chloroplastic 
isoform X2 [Camelina sativa]
Length=375

 Score =   249 bits (637),  Expect = 6e-78, Method: Compositional matrix adjust.
 Identities = 126/184 (68%), Positives = 142/184 (77%), Gaps = 3/184 (2%)
 Frame = +3

Query  48   MAAVSQLMQVSVAVALNGDSSLQRSAFKANSITFNNRSPISFQPFDLKTRNGKSRSQYVV  227
            MA  + L Q+SVA+    D S  RS  K+ S T  +  P      D K+R+   + +  V
Sbjct  1    MALSTPLSQMSVALPTGIDGS-TRSMIKSQSFTEKSWGP--RLRLDSKSRSFSVKKRSTV  57

Query  228  CMSVQQANIPKVTVSPLSLEDAKEPPLNLYKPKGPYTATIASVERIVGPKAPGETCHIVI  407
            CMS+QQA+  KV V+PL LED KE PLNLY+PK PYTATI SVERIVGPKAPGETCHIVI
Sbjct  58   CMSLQQASKSKVLVTPLELEDPKETPLNLYRPKEPYTATIVSVERIVGPKAPGETCHIVI  117

Query  408  DHGGNVPYWEGQSYGVIPPGENPKKPGSPHNVRLYSIASSRYGDSFDGKTTSLCVRRAVY  587
            DH GNVPYWEGQSYGVIPPGENPKKPG+PHNVRLYSIAS+RYGDSFDGKT SLCVRRA+Y
Sbjct  118  DHDGNVPYWEGQSYGVIPPGENPKKPGAPHNVRLYSIASTRYGDSFDGKTASLCVRRAIY  177

Query  588  YDPE  599
            YDPE
Sbjct  178  YDPE  181



>ref|XP_010460851.1| PREDICTED: ferredoxin--NADP reductase, root isozyme 2, chloroplastic-like 
isoform X2 [Camelina sativa]
Length=382

 Score =   249 bits (637),  Expect = 6e-78, Method: Compositional matrix adjust.
 Identities = 129/186 (69%), Positives = 147/186 (79%), Gaps = 5/186 (3%)
 Frame = +3

Query  51   AAVSQLMQVSVAVALNGDSSLQRSAFKANSITFNNRSPISFQPFDLKTRNGKSRSQYV--  224
            A VSQ   VSV++    + SL+RS FK NSI+FN++S  S    + KT N +   +Y   
Sbjct  5    AVVSQAGAVSVSIG--NERSLRRSVFKNNSISFNSKSWSSSLAMNQKTTNVRDAKRYTNR  62

Query  225  -VCMSVQQANIPKVTVSPLSLEDAKEPPLNLYKPKGPYTATIASVERIVGPKAPGETCHI  401
             +CMSVQQ +  KVTVSP+ LED K+PPLNLYKPK  YTA I SVER+VGPKAPGETCHI
Sbjct  63   TICMSVQQTSSSKVTVSPIELEDPKDPPLNLYKPKESYTAKIVSVERVVGPKAPGETCHI  122

Query  402  VIDHGGNVPYWEGQSYGVIPPGENPKKPGSPHNVRLYSIASSRYGDSFDGKTTSLCVRRA  581
            VIDH GN+PYWEGQSYGVIPPGENPKKPG+PHNVRLYSIAS+RYGD FDGKT SLCVRRA
Sbjct  123  VIDHDGNLPYWEGQSYGVIPPGENPKKPGAPHNVRLYSIASTRYGDFFDGKTASLCVRRA  182

Query  582  VYYDPE  599
            VYYDPE
Sbjct  183  VYYDPE  188



>gb|ABF99221.1| Ferredoxin-NADP reductase, root isozyme, chloroplast precursor, 
putative, expressed [Oryza sativa Japonica Group]
Length=304

 Score =   247 bits (630),  Expect = 7e-78, Method: Compositional matrix adjust.
 Identities = 123/184 (67%), Positives = 145/184 (79%), Gaps = 3/184 (2%)
 Frame = +3

Query  54   AVSQLMQVSVAVALNGDSSLQRSAFK-ANSITFNNRSPISFQPFDLKTRNGKSR-SQYVV  227
            A +   QV+V+     D  L+ S  + +N+I+F+N+S +       +++  + R +  V+
Sbjct  2    ATAVASQVAVSAPAGSDRGLRSSGIQGSNNISFSNKSWVG-TTLAWESKATRPRHANKVL  60

Query  228  CMSVQQANIPKVTVSPLSLEDAKEPPLNLYKPKGPYTATIASVERIVGPKAPGETCHIVI  407
            CMSVQQA+  KV V PL LE A EPPLN YKPK PYTATI SVERIVGPKAPGETCHIVI
Sbjct  61   CMSVQQASESKVAVKPLDLESANEPPLNTYKPKEPYTATIVSVERIVGPKAPGETCHIVI  120

Query  408  DHGGNVPYWEGQSYGVIPPGENPKKPGSPHNVRLYSIASSRYGDSFDGKTTSLCVRRAVY  587
            DHGGNVPYWEGQSYG+IPPGENPKKPG+PHNVRLYSIAS+RYGDSFDG+TTSLCVRRAVY
Sbjct  121  DHGGNVPYWEGQSYGIIPPGENPKKPGAPHNVRLYSIASTRYGDSFDGRTTSLCVRRAVY  180

Query  588  YDPE  599
            YDPE
Sbjct  181  YDPE  184



>ref|XP_010478465.1| PREDICTED: ferredoxin--NADP reductase, root isozyme 2, chloroplastic 
isoform X2 [Camelina sativa]
Length=382

 Score =   248 bits (634),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 128/186 (69%), Positives = 146/186 (78%), Gaps = 5/186 (3%)
 Frame = +3

Query  51   AAVSQLMQVSVAVALNGDSSLQRSAFKANSITFNNRSPISFQPFDLKTRNGKSRSQYV--  224
            A VSQ   VSV++    + SL+RS FK NSI+FN++S  S    + KT N +   +Y   
Sbjct  5    AVVSQAGAVSVSIG--NERSLRRSVFKNNSISFNSKSWSSSLALNQKTTNVRDAKRYTSR  62

Query  225  -VCMSVQQANIPKVTVSPLSLEDAKEPPLNLYKPKGPYTATIASVERIVGPKAPGETCHI  401
             +CMSVQQ +  KVTVSP+ LED  +PPLNLYKPK  YTA I SVER+VGPKAPGETCHI
Sbjct  63   TICMSVQQTSCSKVTVSPIELEDPNDPPLNLYKPKESYTAKIVSVERVVGPKAPGETCHI  122

Query  402  VIDHGGNVPYWEGQSYGVIPPGENPKKPGSPHNVRLYSIASSRYGDSFDGKTTSLCVRRA  581
            VIDH GN+PYWEGQSYGVIPPGENPKKPG+PHNVRLYSIAS+RYGD FDGKT SLCVRRA
Sbjct  123  VIDHDGNLPYWEGQSYGVIPPGENPKKPGAPHNVRLYSIASTRYGDFFDGKTASLCVRRA  182

Query  582  VYYDPE  599
            VYYDPE
Sbjct  183  VYYDPE  188



>ref|NP_001051476.1| Os03g0784700 [Oryza sativa Japonica Group]
 sp|P41345.1|FENR2_ORYSJ RecName: Full=Ferredoxin--NADP reductase, root isozyme, chloroplastic; 
Short=FNR; Flags: Precursor [Oryza sativa Japonica 
Group]
 gb|AAK72892.1|AC091123_11 ferredoxin-NADP+ reductase [Oryza sativa Japonica Group]
 dbj|BAA04232.1| ferredoxin-NADP+ reductase [Oryza sativa Japonica Group]
 dbj|BAA07479.1| root ferredoxin-NADP+ reductase [Oryza sativa Japonica Group]
 gb|ABF99220.1| Ferredoxin-NADP reductase, root isozyme, chloroplast precursor, 
putative, expressed [Oryza sativa Japonica Group]
 dbj|BAF13390.1| Os03g0784700 [Oryza sativa Japonica Group]
 gb|EAY92083.1| hypothetical protein OsI_13788 [Oryza sativa Indica Group]
 gb|EAZ28818.1| hypothetical protein OsJ_12850 [Oryza sativa Japonica Group]
 dbj|BAG96344.1| unnamed protein product [Oryza sativa Japonica Group]
 prf||2113196A ferredoxin-NADP oxidoreductase
Length=378

 Score =   248 bits (634),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 122/178 (69%), Positives = 143/178 (80%), Gaps = 3/178 (2%)
 Frame = +3

Query  72   QVSVAVALNGDSSLQRSAFK-ANSITFNNRSPISFQPFDLKTRNGKSR-SQYVVCMSVQQ  245
            QV+V+     D  L+ S  + +N+I+F+N+S +       +++  + R +  V+CMSVQQ
Sbjct  8    QVAVSAPAGSDRGLRSSGIQGSNNISFSNKSWVG-TTLAWESKATRPRHANKVLCMSVQQ  66

Query  246  ANIPKVTVSPLSLEDAKEPPLNLYKPKGPYTATIASVERIVGPKAPGETCHIVIDHGGNV  425
            A+  KV V PL LE A EPPLN YKPK PYTATI SVERIVGPKAPGETCHIVIDHGGNV
Sbjct  67   ASESKVAVKPLDLESANEPPLNTYKPKEPYTATIVSVERIVGPKAPGETCHIVIDHGGNV  126

Query  426  PYWEGQSYGVIPPGENPKKPGSPHNVRLYSIASSRYGDSFDGKTTSLCVRRAVYYDPE  599
            PYWEGQSYG+IPPGENPKKPG+PHNVRLYSIAS+RYGDSFDG+TTSLCVRRAVYYDPE
Sbjct  127  PYWEGQSYGIIPPGENPKKPGAPHNVRLYSIASTRYGDSFDGRTTSLCVRRAVYYDPE  184



>gb|KFK44862.1| hypothetical protein AALP_AA1G312100 [Arabis alpina]
Length=383

 Score =   248 bits (633),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 121/174 (70%), Positives = 135/174 (78%), Gaps = 3/174 (2%)
 Frame = +3

Query  87   VALNGDSSLQRSAFKANSITFNNRSPISFQPFDLKT---RNGKSRSQYVVCMSVQQANIP  257
            V+   + SL+RS FK NSI+FN++S  S      +T   R  K  +   +CMSVQQ +  
Sbjct  16   VSSGNERSLKRSIFKNNSISFNSKSWASSLALSQRTTSLREAKRCTNTTICMSVQQTSSS  75

Query  258  KVTVSPLSLEDAKEPPLNLYKPKGPYTATIASVERIVGPKAPGETCHIVIDHGGNVPYWE  437
            KV V+PL LED KEPPLNLYKPK  YTA I SVER VGP APGETCHIVIDH GN+PYWE
Sbjct  76   KVAVTPLELEDPKEPPLNLYKPKSSYTAKIVSVERAVGPNAPGETCHIVIDHDGNLPYWE  135

Query  438  GQSYGVIPPGENPKKPGSPHNVRLYSIASSRYGDSFDGKTTSLCVRRAVYYDPE  599
            GQSYGVIPPGENPKKPG+PHNVRLYSIAS+RYGD FDGKT SLCVRRAVYYDPE
Sbjct  136  GQSYGVIPPGENPKKPGAPHNVRLYSIASTRYGDFFDGKTASLCVRRAVYYDPE  189



>ref|XP_002461452.1| hypothetical protein SORBIDRAFT_02g002900 [Sorghum bicolor]
 gb|EER97973.1| hypothetical protein SORBIDRAFT_02g002900 [Sorghum bicolor]
Length=381

 Score =   248 bits (633),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 125/186 (67%), Positives = 143/186 (77%), Gaps = 7/186 (4%)
 Frame = +3

Query  54   AVSQLMQVSVAVALNGDSSLQRSAFKANS-ITFNNRSPISFQPFDLKTRNGKSRSQY---  221
            A+   +  + +V +  D   + +A K NS + F N+  I      L  +N   +S++   
Sbjct  5    ALGSQVAAAASVPVGSDCCFKGTALKGNSNLNFRNKPCIGMA---LAWKNKTQQSRHLNK  61

Query  222  VVCMSVQQANIPKVTVSPLSLEDAKEPPLNLYKPKGPYTATIASVERIVGPKAPGETCHI  401
            V CMSVQQA+  KV V P+ LE+AKEPPLNLYKPK PYTATI SVERIVGPKAPGETCHI
Sbjct  62   VFCMSVQQASRSKVAVKPIELENAKEPPLNLYKPKEPYTATIVSVERIVGPKAPGETCHI  121

Query  402  VIDHGGNVPYWEGQSYGVIPPGENPKKPGSPHNVRLYSIASSRYGDSFDGKTTSLCVRRA  581
            VIDHGGNVPYWEGQSYGVIPPGENPKKPGSP+ VRLYSIAS+RYGDSFDGKTTSLCVRRA
Sbjct  122  VIDHGGNVPYWEGQSYGVIPPGENPKKPGSPNTVRLYSIASTRYGDSFDGKTTSLCVRRA  181

Query  582  VYYDPE  599
            VYYDPE
Sbjct  182  VYYDPE  187



>ref|XP_006287955.1| hypothetical protein CARUB_v10001191mg [Capsella rubella]
 gb|EOA20853.1| hypothetical protein CARUB_v10001191mg [Capsella rubella]
Length=375

 Score =   247 bits (631),  Expect = 4e-77, Method: Compositional matrix adjust.
 Identities = 127/184 (69%), Positives = 139/184 (76%), Gaps = 3/184 (2%)
 Frame = +3

Query  48   MAAVSQLMQVSVAVALNGDSSLQRSAFKANSITFNNRSPISFQPFDLKTRNGKSRSQYVV  227
            MA  + L Q+SV +    D S  RS  K  SI F   S  S    D K+R+        V
Sbjct  1    MALSTPLSQMSVTLPTGIDGS-SRSMIK--SINFTETSWGSRLRLDSKSRSLSVNKWSTV  57

Query  228  CMSVQQANIPKVTVSPLSLEDAKEPPLNLYKPKGPYTATIASVERIVGPKAPGETCHIVI  407
            CMS+QQA+  KV V+PL LED KE PLNLY+PK PYTATI SVERIVGPKAPGETCHIVI
Sbjct  58   CMSLQQASKSKVLVTPLELEDPKETPLNLYRPKEPYTATIVSVERIVGPKAPGETCHIVI  117

Query  408  DHGGNVPYWEGQSYGVIPPGENPKKPGSPHNVRLYSIASSRYGDSFDGKTTSLCVRRAVY  587
            DH GNVPYWEGQSYGVIPPGENPKKPG+PHNVRLYSIAS+RYGDSFDGKT SLCVRRA+Y
Sbjct  118  DHDGNVPYWEGQSYGVIPPGENPKKPGAPHNVRLYSIASTRYGDSFDGKTASLCVRRAIY  177

Query  588  YDPE  599
            YDPE
Sbjct  178  YDPE  181



>ref|XP_010422427.1| PREDICTED: ferredoxin--NADP reductase, root isozyme 1, chloroplastic-like 
isoform X2 [Camelina sativa]
Length=375

 Score =   247 bits (630),  Expect = 6e-77, Method: Compositional matrix adjust.
 Identities = 126/184 (68%), Positives = 142/184 (77%), Gaps = 3/184 (2%)
 Frame = +3

Query  48   MAAVSQLMQVSVAVALNGDSSLQRSAFKANSITFNNRSPISFQPFDLKTRNGKSRSQYVV  227
            MA  + L Q+SVA+    D S  RS  K  SI+F  +S       D K+R+     +  V
Sbjct  1    MALSTPLSQISVALPTGIDGS-SRSMIK--SISFTEKSWGPRLRLDSKSRSLCVNKRSTV  57

Query  228  CMSVQQANIPKVTVSPLSLEDAKEPPLNLYKPKGPYTATIASVERIVGPKAPGETCHIVI  407
            CMS+QQA+  KV V+PL LED KE PLNLY+PK PYTATI SVERIVGP+APGETCHIVI
Sbjct  58   CMSLQQASKSKVLVTPLELEDPKETPLNLYRPKEPYTATIVSVERIVGPQAPGETCHIVI  117

Query  408  DHGGNVPYWEGQSYGVIPPGENPKKPGSPHNVRLYSIASSRYGDSFDGKTTSLCVRRAVY  587
            DH GNVPYWEGQSYGVIPPGENPKKPG+PHNVRLYSIAS+RYGDSFDGKT SLCVRRA+Y
Sbjct  118  DHDGNVPYWEGQSYGVIPPGENPKKPGAPHNVRLYSIASTRYGDSFDGKTASLCVRRAIY  177

Query  588  YDPE  599
            YDPE
Sbjct  178  YDPE  181



>gb|AAM96978.1| ferredoxin--NADP+ reductase-like protein [Arabidopsis thaliana]
Length=378

 Score =   245 bits (626),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 123/188 (65%), Positives = 145/188 (77%), Gaps = 8/188 (4%)
 Frame = +3

Query  48   MAAVSQLMQVSVAVALNGDSSLQRSAFKANSITFNNRSPISFQP----FDLKTRNGKSRS  215
            MA  +   Q+SVA+    D S  RS  K  SI+F ++S   + P     D K+R+   + 
Sbjct  1    MALSTTPSQMSVALPTRIDGS-SRSMIKVQSISFTDKS---WGPPLLRLDSKSRSLGVKK  56

Query  216  QYVVCMSVQQANIPKVTVSPLSLEDAKEPPLNLYKPKGPYTATIASVERIVGPKAPGETC  395
            +  +CMS+QQ++  KV V+PL LED KE PLNL++PK PYTATI SVERIVGP+APGETC
Sbjct  57   RSTICMSLQQSSKSKVLVTPLELEDPKETPLNLFRPKEPYTATIVSVERIVGPQAPGETC  116

Query  396  HIVIDHGGNVPYWEGQSYGVIPPGENPKKPGSPHNVRLYSIASSRYGDSFDGKTTSLCVR  575
            HIVIDH GNVPYWEGQSYGVIPPGENPKKPG+PHNVRLYSIAS+RYGDSFDGKT SLCVR
Sbjct  117  HIVIDHDGNVPYWEGQSYGVIPPGENPKKPGAPHNVRLYSIASTRYGDSFDGKTASLCVR  176

Query  576  RAVYYDPE  599
            RA+YYDPE
Sbjct  177  RAIYYDPE  184



>ref|NP_567293.1| ferredoxin--NADP reductase, root isozyme 1 [Arabidopsis thaliana]
 sp|Q9M0V6.2|FNRR1_ARATH RecName: Full=Ferredoxin--NADP reductase, root isozyme 1, chloroplastic; 
AltName: Full=Root FNR 1; Short=AtRFNR1; Flags: 
Precursor [Arabidopsis thaliana]
 gb|AAL61946.1| ferredoxin-NADP+ reductase-like protein [Arabidopsis thaliana]
 gb|AAM47928.1| ferredoxin-NADP+ reductase-like protein [Arabidopsis thaliana]
 gb|AEE82512.1| ferredoxin--NADP reductase, root isozyme 1 [Arabidopsis thaliana]
Length=378

 Score =   245 bits (626),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 123/188 (65%), Positives = 145/188 (77%), Gaps = 8/188 (4%)
 Frame = +3

Query  48   MAAVSQLMQVSVAVALNGDSSLQRSAFKANSITFNNRSPISFQP----FDLKTRNGKSRS  215
            MA  +   Q+SVA+    D S  RS  K  SI+F ++S   + P     D K+R+   + 
Sbjct  1    MALSTTPSQMSVALPTRIDGS-SRSMIKVQSISFTDKS---WGPPLLRLDSKSRSLGVKK  56

Query  216  QYVVCMSVQQANIPKVTVSPLSLEDAKEPPLNLYKPKGPYTATIASVERIVGPKAPGETC  395
            +  +CMS+QQ++  KV V+PL LED KE PLNL++PK PYTATI SVERIVGP+APGETC
Sbjct  57   RSTICMSLQQSSKSKVLVTPLELEDPKETPLNLFRPKEPYTATIVSVERIVGPQAPGETC  116

Query  396  HIVIDHGGNVPYWEGQSYGVIPPGENPKKPGSPHNVRLYSIASSRYGDSFDGKTTSLCVR  575
            HIVIDH GNVPYWEGQSYGVIPPGENPKKPG+PHNVRLYSIAS+RYGDSFDGKT SLCVR
Sbjct  117  HIVIDHDGNVPYWEGQSYGVIPPGENPKKPGAPHNVRLYSIASTRYGDSFDGKTASLCVR  176

Query  576  RAVYYDPE  599
            RA+YYDPE
Sbjct  177  RAIYYDPE  184



>ref|NP_849734.1| ferredoxin--NADP reductase, root isozyme 2 [Arabidopsis thaliana]
 sp|Q9S9P8.1|FNRR2_ARATH RecName: Full=Ferredoxin--NADP reductase, root isozyme 2, chloroplastic; 
AltName: Full=Root FNR 2; Short=AtRFNR2; Flags: 
Precursor [Arabidopsis thaliana]
 gb|AAF19753.1|AC009917_12 Strong similarity to gi|3913653 Ferredoxin-NADP Reductase, Embryo 
Isozyme Precurser from Oryza sativa, containing an Oxidoreductase 
FAD/NAD-binding PF|00175 domain. ESTs gb|N38303, 
gb|T21235, gb|AA721819, gb|T44416, gb|AI995147, gb|H76681, gb|N65405, 
gb|F14270 come from this gene [Arabidopsis thaliana]
 gb|AAL11588.1|AF424594_1 At1g30510/F26G16_5 [Arabidopsis thaliana]
 gb|AAM98159.1| ferrodoxin NADP oxidoreductase, putative [Arabidopsis thaliana]
 gb|AAP37827.1| At1g30510 [Arabidopsis thaliana]
 gb|AEE31237.1| ferredoxin--NADP reductase, root isozyme 2 [Arabidopsis thaliana]
Length=382

 Score =   245 bits (626),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 130/187 (70%), Positives = 147/187 (79%), Gaps = 6/187 (3%)
 Frame = +3

Query  51   AAVSQLMQVSVAVALNGDSSLQRSAFKAN-SITFNNRSPISFQPFDLKT---RNGKSRSQ  218
            +AVSQ   VSV++      SL+RS FK N SI+FN++S  S    + KT   R+GK    
Sbjct  4    SAVSQAGAVSVSI--ENQRSLRRSVFKQNNSISFNSKSWSSSLALNQKTTSIRDGKRYPS  61

Query  219  YVVCMSVQQANIPKVTVSPLSLEDAKEPPLNLYKPKGPYTATIASVERIVGPKAPGETCH  398
              +CMSVQQ +  KVTVSP+ LED K+PPLNLYKPK  YTA I SVER+VGPKAPGETCH
Sbjct  62   TTICMSVQQTSSSKVTVSPIELEDPKDPPLNLYKPKESYTAKIVSVERVVGPKAPGETCH  121

Query  399  IVIDHGGNVPYWEGQSYGVIPPGENPKKPGSPHNVRLYSIASSRYGDSFDGKTTSLCVRR  578
            IVIDH GN+PYWEGQSYGVIPPGENPKKPG+PHNVRLYSIAS+RYGD FDGKT SLCVRR
Sbjct  122  IVIDHDGNLPYWEGQSYGVIPPGENPKKPGAPHNVRLYSIASTRYGDFFDGKTASLCVRR  181

Query  579  AVYYDPE  599
            AVYYDPE
Sbjct  182  AVYYDPE  188



>ref|XP_010460850.1| PREDICTED: ferredoxin--NADP reductase, root isozyme 2, chloroplastic-like 
isoform X1 [Camelina sativa]
Length=383

 Score =   245 bits (626),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 129/187 (69%), Positives = 147/187 (79%), Gaps = 6/187 (3%)
 Frame = +3

Query  51   AAVSQLMQVSVAVALNGDSSLQRSAFKAN-SITFNNRSPISFQPFDLKTRNGKSRSQYV-  224
            A VSQ   VSV++    + SL+RS FK N SI+FN++S  S    + KT N +   +Y  
Sbjct  5    AVVSQAGAVSVSIG--NERSLRRSVFKQNNSISFNSKSWSSSLAMNQKTTNVRDAKRYTN  62

Query  225  --VCMSVQQANIPKVTVSPLSLEDAKEPPLNLYKPKGPYTATIASVERIVGPKAPGETCH  398
              +CMSVQQ +  KVTVSP+ LED K+PPLNLYKPK  YTA I SVER+VGPKAPGETCH
Sbjct  63   RTICMSVQQTSSSKVTVSPIELEDPKDPPLNLYKPKESYTAKIVSVERVVGPKAPGETCH  122

Query  399  IVIDHGGNVPYWEGQSYGVIPPGENPKKPGSPHNVRLYSIASSRYGDSFDGKTTSLCVRR  578
            IVIDH GN+PYWEGQSYGVIPPGENPKKPG+PHNVRLYSIAS+RYGD FDGKT SLCVRR
Sbjct  123  IVIDHDGNLPYWEGQSYGVIPPGENPKKPGAPHNVRLYSIASTRYGDFFDGKTASLCVRR  182

Query  579  AVYYDPE  599
            AVYYDPE
Sbjct  183  AVYYDPE  189



>ref|XP_010478464.1| PREDICTED: ferredoxin--NADP reductase, root isozyme 2, chloroplastic 
isoform X1 [Camelina sativa]
Length=383

 Score =   244 bits (623),  Expect = 9e-76, Method: Compositional matrix adjust.
 Identities = 128/187 (68%), Positives = 146/187 (78%), Gaps = 6/187 (3%)
 Frame = +3

Query  51   AAVSQLMQVSVAVALNGDSSLQRSAFKAN-SITFNNRSPISFQPFDLKTRNGKSRSQYV-  224
            A VSQ   VSV++    + SL+RS FK N SI+FN++S  S    + KT N +   +Y  
Sbjct  5    AVVSQAGAVSVSIG--NERSLRRSVFKQNNSISFNSKSWSSSLALNQKTTNVRDAKRYTS  62

Query  225  --VCMSVQQANIPKVTVSPLSLEDAKEPPLNLYKPKGPYTATIASVERIVGPKAPGETCH  398
              +CMSVQQ +  KVTVSP+ LED  +PPLNLYKPK  YTA I SVER+VGPKAPGETCH
Sbjct  63   RTICMSVQQTSCSKVTVSPIELEDPNDPPLNLYKPKESYTAKIVSVERVVGPKAPGETCH  122

Query  399  IVIDHGGNVPYWEGQSYGVIPPGENPKKPGSPHNVRLYSIASSRYGDSFDGKTTSLCVRR  578
            IVIDH GN+PYWEGQSYGVIPPGENPKKPG+PHNVRLYSIAS+RYGD FDGKT SLCVRR
Sbjct  123  IVIDHDGNLPYWEGQSYGVIPPGENPKKPGAPHNVRLYSIASTRYGDFFDGKTASLCVRR  182

Query  579  AVYYDPE  599
            AVYYDPE
Sbjct  183  AVYYDPE  189



>gb|AAM64825.1| ferredoxin--NADP+ reductase-like protein [Arabidopsis thaliana]
Length=378

 Score =   244 bits (623),  Expect = 9e-76, Method: Compositional matrix adjust.
 Identities = 122/188 (65%), Positives = 145/188 (77%), Gaps = 8/188 (4%)
 Frame = +3

Query  48   MAAVSQLMQVSVAVALNGDSSLQRSAFKANSITFNNRSPISFQP----FDLKTRNGKSRS  215
            MA  +   Q+SVA+    D S  RS  K  SI+F ++S   + P     D K+R+   + 
Sbjct  1    MALSTTPSQMSVALPTRIDGS-SRSMIKVQSISFTDKS---WGPPLLRLDSKSRSLGVKK  56

Query  216  QYVVCMSVQQANIPKVTVSPLSLEDAKEPPLNLYKPKGPYTATIASVERIVGPKAPGETC  395
            +  +CMS+QQ++  KV V+PL LED KE PLNL++PK PYTATI SVERIVGP+APGETC
Sbjct  57   RSTICMSLQQSSKSKVLVTPLELEDPKETPLNLFRPKEPYTATIVSVERIVGPQAPGETC  116

Query  396  HIVIDHGGNVPYWEGQSYGVIPPGENPKKPGSPHNVRLYSIASSRYGDSFDGKTTSLCVR  575
            HIVIDH GNVPYWEG+SYGVIPPGENPKKPG+PHNVRLYSIAS+RYGDSFDGKT SLCVR
Sbjct  117  HIVIDHDGNVPYWEGKSYGVIPPGENPKKPGAPHNVRLYSIASTRYGDSFDGKTASLCVR  176

Query  576  RAVYYDPE  599
            RA+YYDPE
Sbjct  177  RAIYYDPE  184



>gb|KFK44861.1| hypothetical protein AALP_AA1G312100 [Arabis alpina]
Length=384

 Score =   244 bits (622),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 121/175 (69%), Positives = 135/175 (77%), Gaps = 4/175 (2%)
 Frame = +3

Query  87   VALNGDSSLQRSAFKAN-SITFNNRSPISFQPFDLKT---RNGKSRSQYVVCMSVQQANI  254
            V+   + SL+RS FK N SI+FN++S  S      +T   R  K  +   +CMSVQQ + 
Sbjct  16   VSSGNERSLKRSIFKQNNSISFNSKSWASSLALSQRTTSLREAKRCTNTTICMSVQQTSS  75

Query  255  PKVTVSPLSLEDAKEPPLNLYKPKGPYTATIASVERIVGPKAPGETCHIVIDHGGNVPYW  434
             KV V+PL LED KEPPLNLYKPK  YTA I SVER VGP APGETCHIVIDH GN+PYW
Sbjct  76   SKVAVTPLELEDPKEPPLNLYKPKSSYTAKIVSVERAVGPNAPGETCHIVIDHDGNLPYW  135

Query  435  EGQSYGVIPPGENPKKPGSPHNVRLYSIASSRYGDSFDGKTTSLCVRRAVYYDPE  599
            EGQSYGVIPPGENPKKPG+PHNVRLYSIAS+RYGD FDGKT SLCVRRAVYYDPE
Sbjct  136  EGQSYGVIPPGENPKKPGAPHNVRLYSIASTRYGDFFDGKTASLCVRRAVYYDPE  190



>emb|CDY46362.1| BnaA09g19760D [Brassica napus]
Length=378

 Score =   243 bits (621),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 122/185 (66%), Positives = 140/185 (76%), Gaps = 2/185 (1%)
 Frame = +3

Query  48   MAAVSQLMQVSVAVALNGDSSLQRSAFKANSITFNNRSPISFQPFDLKTRNGKSRSQYVV  227
            MA  + L Q+SVA+ +  D S  RS  K  S++F  +S       D  +R    + +  V
Sbjct  1    MALSTPLSQMSVALPIGIDGS-SRSMIKVQSVSFTEKSCGPLLRLDTVSRKLSLKKRSTV  59

Query  228  CMSVQQ-ANIPKVTVSPLSLEDAKEPPLNLYKPKGPYTATIASVERIVGPKAPGETCHIV  404
            CMS+QQ A+  KV+V+PL LED KE PLNLY+PK PYTA I SVERIVGP+APGETCHIV
Sbjct  60   CMSLQQQASRSKVSVTPLELEDPKETPLNLYRPKEPYTAKIVSVERIVGPQAPGETCHIV  119

Query  405  IDHGGNVPYWEGQSYGVIPPGENPKKPGSPHNVRLYSIASSRYGDSFDGKTTSLCVRRAV  584
            IDH G VPYWEGQSYGVIPPGENPKKPG+PHNVRLYSIAS+RYGDSFDGKT SLCVRRA 
Sbjct  120  IDHDGKVPYWEGQSYGVIPPGENPKKPGAPHNVRLYSIASTRYGDSFDGKTASLCVRRAQ  179

Query  585  YYDPE  599
            YYDPE
Sbjct  180  YYDPE  184



>ref|XP_006650686.1| PREDICTED: ferredoxin--NADP reductase, root isozyme, chloroplastic-like 
[Oryza brachyantha]
Length=378

 Score =   241 bits (616),  Expect = 8e-75, Method: Compositional matrix adjust.
 Identities = 120/178 (67%), Positives = 139/178 (78%), Gaps = 3/178 (2%)
 Frame = +3

Query  72   QVSVAVALNGDSSLQRSAFK-ANSITFNNRSPISFQPFDLKTRNGKSRS-QYVVCMSVQQ  245
            QV V+     D  ++ S  +  NS++F ++S I       +++  + R    V CMSVQQ
Sbjct  8    QVPVSAPAGSDCRVRSSGIQVTNSVSFGSKSWIG-AALAWESKAARPRHVNKVHCMSVQQ  66

Query  246  ANIPKVTVSPLSLEDAKEPPLNLYKPKGPYTATIASVERIVGPKAPGETCHIVIDHGGNV  425
            A+  KV V PL LE AKEPPLN +KPK PYTATI SVERIVGPKAPGETCHIVIDHGGN+
Sbjct  67   ASKGKVAVKPLDLESAKEPPLNTFKPKEPYTATIVSVERIVGPKAPGETCHIVIDHGGNM  126

Query  426  PYWEGQSYGVIPPGENPKKPGSPHNVRLYSIASSRYGDSFDGKTTSLCVRRAVYYDPE  599
            PYWEGQSYG+IPPGENPKKPG+PHNVRLYSIAS+RYGDSFDG+TTSLCVRRAVYYDPE
Sbjct  127  PYWEGQSYGIIPPGENPKKPGAPHNVRLYSIASTRYGDSFDGRTTSLCVRRAVYYDPE  184



>emb|CDY39167.1| BnaC09g21770D [Brassica napus]
Length=378

 Score =   241 bits (614),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 120/185 (65%), Positives = 139/185 (75%), Gaps = 2/185 (1%)
 Frame = +3

Query  48   MAAVSQLMQVSVAVALNGDSSLQRSAFKANSITFNNRSPISFQPFDLKTRNGKSRSQYVV  227
            MA  + L Q+SVA+ +  D S   S  K  S++F  +S +     D  +R    + +  V
Sbjct  1    MALSTPLSQMSVALPIGIDGS-SGSMIKVQSVSFTEKSCVPLLRLDTVSRKLSLKKRSTV  59

Query  228  CMSVQQ-ANIPKVTVSPLSLEDAKEPPLNLYKPKGPYTATIASVERIVGPKAPGETCHIV  404
            CMS+QQ A   KV+V+PL LED KE PLNLY+PK PYTA I SV+RIVGP+APGETCHIV
Sbjct  60   CMSLQQQARRSKVSVTPLELEDPKETPLNLYRPKEPYTAKIVSVDRIVGPQAPGETCHIV  119

Query  405  IDHGGNVPYWEGQSYGVIPPGENPKKPGSPHNVRLYSIASSRYGDSFDGKTTSLCVRRAV  584
            IDH G VPYWEGQSYGVIPPGENPKKPG+PHNVRLYSIAS+RYGDSFDGKT SLCVRRA 
Sbjct  120  IDHDGKVPYWEGQSYGVIPPGENPKKPGAPHNVRLYSIASTRYGDSFDGKTASLCVRRAQ  179

Query  585  YYDPE  599
            YYDPE
Sbjct  180  YYDPE  184



>ref|XP_009114485.1| PREDICTED: ferredoxin--NADP reductase, root isozyme 1, chloroplastic 
[Brassica rapa]
Length=378

 Score =   241 bits (614),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 121/185 (65%), Positives = 140/185 (76%), Gaps = 2/185 (1%)
 Frame = +3

Query  48   MAAVSQLMQVSVAVALNGDSSLQRSAFKANSITFNNRSPISFQPFDLKTRNGKSRSQYVV  227
            MA  + L Q+SVA+ +  D S  RS  K  S++F  +S       D  +R    + +  V
Sbjct  1    MALSTPLSQMSVALPIGIDGS-SRSMIKVQSVSFTEKSCGPLLRLDTVSRKLSLKKRSKV  59

Query  228  CMSVQQ-ANIPKVTVSPLSLEDAKEPPLNLYKPKGPYTATIASVERIVGPKAPGETCHIV  404
            CMS+QQ A+  KV+V+PL LE+ KE PLNLY+PK PYTA I SVERIVGP+APGETCHIV
Sbjct  60   CMSLQQQASRSKVSVTPLELEEPKETPLNLYRPKEPYTAKIVSVERIVGPQAPGETCHIV  119

Query  405  IDHGGNVPYWEGQSYGVIPPGENPKKPGSPHNVRLYSIASSRYGDSFDGKTTSLCVRRAV  584
            IDH G VPYWEGQSYGVIPPGENPKKPG+PHNVRLYSIAS+RYGDSFDGKT SLCVRRA 
Sbjct  120  IDHDGKVPYWEGQSYGVIPPGENPKKPGAPHNVRLYSIASTRYGDSFDGKTASLCVRRAQ  179

Query  585  YYDPE  599
            YYDPE
Sbjct  180  YYDPE  184



>gb|AEZ00858.1| putative ferredoxin NADP+ reductase protein, partial [Elaeis 
guineensis]
Length=217

 Score =   234 bits (598),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 110/123 (89%), Positives = 115/123 (93%), Gaps = 0/123 (0%)
 Frame = +3

Query  231  MSVQQANIPKVTVSPLSLEDAKEPPLNLYKPKGPYTATIASVERIVGPKAPGETCHIVID  410
            MSVQQA+  KV V PL LEDAKEPPLNLYKPK PYTATI SVER+VGPKAPGETCHIVID
Sbjct  1    MSVQQASKSKVAVKPLELEDAKEPPLNLYKPKEPYTATIVSVERLVGPKAPGETCHIVID  60

Query  411  HGGNVPYWEGQSYGVIPPGENPKKPGSPHNVRLYSIASSRYGDSFDGKTTSLCVRRAVYY  590
            HGGNVPYWEGQSYG+IPPGENPKKPG+PHNVRLYSIAS+RYGDSFDGKT SLCVRRAVYY
Sbjct  61   HGGNVPYWEGQSYGIIPPGENPKKPGAPHNVRLYSIASTRYGDSFDGKTASLCVRRAVYY  120

Query  591  DPE  599
            DPE
Sbjct  121  DPE  123



>ref|NP_001132762.1| uncharacterized protein LOC100194249 [Zea mays]
 gb|ACF81748.1| unknown [Zea mays]
 tpg|DAA59536.1| TPA: ferredoxin--NADP reductase [Zea mays]
Length=381

 Score =   240 bits (612),  Expect = 4e-74, Method: Compositional matrix adjust.
 Identities = 122/184 (66%), Positives = 140/184 (76%), Gaps = 3/184 (2%)
 Frame = +3

Query  54   AVSQLMQVSVAVALNGDSSLQRSAFKANSITFNNRS-PISFQPFDLKTRNGKSRS-QYVV  227
            A+   +  + +V +  DS  + +A K NS T N R+ P        K R  + R    V+
Sbjct  5    ALGSQVAAAASVPVGSDSLAKGAALKGNS-TLNFRTKPCIGMALAWKNRTQQPRRLNKVL  63

Query  228  CMSVQQANIPKVTVSPLSLEDAKEPPLNLYKPKGPYTATIASVERIVGPKAPGETCHIVI  407
            CMSVQQA+  KV V P+ LE AKEPPL+LYKPK PYTATI SVER+VGP+APGETCH+VI
Sbjct  64   CMSVQQASRSKVAVVPIELEKAKEPPLHLYKPKEPYTATIVSVERLVGPRAPGETCHVVI  123

Query  408  DHGGNVPYWEGQSYGVIPPGENPKKPGSPHNVRLYSIASSRYGDSFDGKTTSLCVRRAVY  587
            DHGGNVPYWEGQSYGVIPPGENPKKPGSP+ VRLYSIAS+RYGDSFDGKT SLCVRRAVY
Sbjct  124  DHGGNVPYWEGQSYGVIPPGENPKKPGSPNTVRLYSIASTRYGDSFDGKTASLCVRRAVY  183

Query  588  YDPE  599
            YDPE
Sbjct  184  YDPE  187



>ref|XP_008650954.1| PREDICTED: uncharacterized protein LOC100194249 isoform X1 [Zea 
mays]
Length=396

 Score =   239 bits (611),  Expect = 8e-74, Method: Compositional matrix adjust.
 Identities = 122/184 (66%), Positives = 140/184 (76%), Gaps = 3/184 (2%)
 Frame = +3

Query  54   AVSQLMQVSVAVALNGDSSLQRSAFKANSITFNNRS-PISFQPFDLKTRNGKSRS-QYVV  227
            A+   +  + +V +  DS  + +A K NS T N R+ P        K R  + R    V+
Sbjct  5    ALGSQVAAAASVPVGSDSLAKGAALKGNS-TLNFRTKPCIGMALAWKNRTQQPRRLNKVL  63

Query  228  CMSVQQANIPKVTVSPLSLEDAKEPPLNLYKPKGPYTATIASVERIVGPKAPGETCHIVI  407
            CMSVQQA+  KV V P+ LE AKEPPL+LYKPK PYTATI SVER+VGP+APGETCH+VI
Sbjct  64   CMSVQQASRSKVAVVPIELEKAKEPPLHLYKPKEPYTATIVSVERLVGPRAPGETCHVVI  123

Query  408  DHGGNVPYWEGQSYGVIPPGENPKKPGSPHNVRLYSIASSRYGDSFDGKTTSLCVRRAVY  587
            DHGGNVPYWEGQSYGVIPPGENPKKPGSP+ VRLYSIAS+RYGDSFDGKT SLCVRRAVY
Sbjct  124  DHGGNVPYWEGQSYGVIPPGENPKKPGSPNTVRLYSIASTRYGDSFDGKTASLCVRRAVY  183

Query  588  YDPE  599
            YDPE
Sbjct  184  YDPE  187



>ref|XP_010537869.1| PREDICTED: ferredoxin--NADP reductase, root isozyme 1, chloroplastic 
[Tarenaya hassleriana]
Length=378

 Score =   238 bits (608),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 122/185 (66%), Positives = 142/185 (77%), Gaps = 2/185 (1%)
 Frame = +3

Query  48   MAAVSQLMQVSVAVALNGDSSLQRSAFKANSITFNNRSPISFQPFDLKTRNGK-SRSQYV  224
            MA  + L Q+SV + L    S   S F   SI+F  +        + + +N + +R +  
Sbjct  1    MALSASLSQMSV-LPLLSGDSSSGSMFTVQSISFGQKPWTPMLRLESRCKNLRVTRKRGT  59

Query  225  VCMSVQQANIPKVTVSPLSLEDAKEPPLNLYKPKGPYTATIASVERIVGPKAPGETCHIV  404
            +CMSVQQA+  KV+V+PL LEDAK+PPL+LYK K PY ATI SVER+VGPKAPGETCHIV
Sbjct  60   ICMSVQQASKSKVSVNPLELEDAKDPPLHLYKTKEPYPATIVSVERLVGPKAPGETCHIV  119

Query  405  IDHGGNVPYWEGQSYGVIPPGENPKKPGSPHNVRLYSIASSRYGDSFDGKTTSLCVRRAV  584
            IDHGGNVPYWEGQSYGVIPPGENPKKPG+ HNVRLYSIAS+RYGDSFDGKT SLCVRRAV
Sbjct  120  IDHGGNVPYWEGQSYGVIPPGENPKKPGNTHNVRLYSIASTRYGDSFDGKTASLCVRRAV  179

Query  585  YYDPE  599
            YYDPE
Sbjct  180  YYDPE  184



>ref|XP_007022878.1| Ferredoxin--NADP reductase, root-type isozyme, chloroplastic 
isoform 2 [Theobroma cacao]
 gb|EOY25500.1| Ferredoxin--NADP reductase, root-type isozyme, chloroplastic 
isoform 2 [Theobroma cacao]
Length=316

 Score =   236 bits (601),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 111/123 (90%), Positives = 116/123 (94%), Gaps = 0/123 (0%)
 Frame = +3

Query  231  MSVQQANIPKVTVSPLSLEDAKEPPLNLYKPKGPYTATIASVERIVGPKAPGETCHIVID  410
            MSVQQA+  KV VSPL LE+AKEPPLNL+KPK PYTATI SVER+VGPKAPGETCHIVID
Sbjct  1    MSVQQASKSKVAVSPLELENAKEPPLNLFKPKEPYTATIVSVERLVGPKAPGETCHIVID  60

Query  411  HGGNVPYWEGQSYGVIPPGENPKKPGSPHNVRLYSIASSRYGDSFDGKTTSLCVRRAVYY  590
            HGGNVPYWEGQSYGVIPPGENPKKPGSPHNVRLYSIAS+RYGDSFDGKT SLCVRRAVYY
Sbjct  61   HGGNVPYWEGQSYGVIPPGENPKKPGSPHNVRLYSIASTRYGDSFDGKTASLCVRRAVYY  120

Query  591  DPE  599
            DPE
Sbjct  121  DPE  123



>ref|NP_001058890.1| Os07g0147900 [Oryza sativa Japonica Group]
 sp|O23877.1|FENR3_ORYSJ RecName: Full=Ferredoxin--NADP reductase, embryo isozyme, chloroplastic; 
Short=FNR; Flags: Precursor [Oryza sativa Japonica 
Group]
 dbj|BAA13417.1| precursor ferredoxin-NADP+ oxidoreductase [Oryza sativa (japonica 
cultivar-group)]
 dbj|BAC83340.1| Ferredoxin--NADP reductase, embryo isozyme, chloroplast precursor 
(FNR) [Oryza sativa Japonica Group]
 dbj|BAF20804.1| Os07g0147900 [Oryza sativa Japonica Group]
 gb|EAZ38695.1| hypothetical protein OsJ_23093 [Oryza sativa Japonica Group]
Length=378

 Score =   238 bits (606),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 122/181 (67%), Positives = 141/181 (78%), Gaps = 9/181 (5%)
 Frame = +3

Query  72   QVSVAVALNGDSSLQRSAFK-ANSITFNNRSPI----SFQPFDLKTRNGKSRSQYVVCMS  236
            Q SVA  +      + S+ K +N++ F N+S I    +++   LK+R+       +  MS
Sbjct  8    QASVAAPIGAGGYGRSSSSKGSNTVNFCNKSWIGTTLAWESKALKSRH----MNKIFSMS  63

Query  237  VQQANIPKVTVSPLSLEDAKEPPLNLYKPKGPYTATIASVERIVGPKAPGETCHIVIDHG  416
            VQQA+  KV V PL L++AKEPPLNLYKPK PYTATI SVER+VGPKAPGETCHIVIDHG
Sbjct  64   VQQASKSKVAVKPLELDNAKEPPLNLYKPKEPYTATIVSVERLVGPKAPGETCHIVIDHG  123

Query  417  GNVPYWEGQSYGVIPPGENPKKPGSPHNVRLYSIASSRYGDSFDGKTTSLCVRRAVYYDP  596
            GNVPYWEGQSYGVIPPGENPKKPGSP+ VRLYSIAS+RYGDSFDGKT SLCVRRAVYYDP
Sbjct  124  GNVPYWEGQSYGVIPPGENPKKPGSPNTVRLYSIASTRYGDSFDGKTASLCVRRAVYYDP  183

Query  597  E  599
            E
Sbjct  184  E  184



>dbj|BAJ93902.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=376

 Score =   237 bits (604),  Expect = 5e-73, Method: Compositional matrix adjust.
 Identities = 120/184 (65%), Positives = 139/184 (76%), Gaps = 5/184 (3%)
 Frame = +3

Query  54   AVSQLMQVSVAVALNG-DSSLQRSAFKA-NSITFNNRSPISFQPFDLKTRNGKSRSQYVV  227
            A +   QV+ +  + G D +++ S  K  NS++F N+S I      L         Q  V
Sbjct  2    ATAAASQVAFSAPVPGSDRAVRSSGIKGTNSLSFGNKSWIGTA---LACDGKAVLQQRHV  58

Query  228  CMSVQQANIPKVTVSPLSLEDAKEPPLNLYKPKGPYTATIASVERIVGPKAPGETCHIVI  407
            C +VQQ++  KV+V+PL LE AKEPPLN YKPKGPYTATI SVER VGP APGETCH+VI
Sbjct  59   CRAVQQSSKSKVSVAPLDLESAKEPPLNTYKPKGPYTATIVSVERAVGPNAPGETCHVVI  118

Query  408  DHGGNVPYWEGQSYGVIPPGENPKKPGSPHNVRLYSIASSRYGDSFDGKTTSLCVRRAVY  587
            DHGGNVPYWEGQSYG+IPPGENPKKPG+P NVRLYSIAS+RYGDSFDGKT SLCVRRAVY
Sbjct  119  DHGGNVPYWEGQSYGIIPPGENPKKPGNPQNVRLYSIASTRYGDSFDGKTASLCVRRAVY  178

Query  588  YDPE  599
            YDPE
Sbjct  179  YDPE  182



>gb|EPS58368.1| hypothetical protein M569_16446, partial [Genlisea aurea]
Length=330

 Score =   235 bits (599),  Expect = 7e-73, Method: Compositional matrix adjust.
 Identities = 109/132 (83%), Positives = 119/132 (90%), Gaps = 0/132 (0%)
 Frame = +3

Query  204  KSRSQYVVCMSVQQANIPKVTVSPLSLEDAKEPPLNLYKPKGPYTATIASVERIVGPKAP  383
            +SR + VVCMSVQQ +  KV VSPL LE+AKEPPL+++K K PYT TI SVERIVGP+AP
Sbjct  3    RSRDRPVVCMSVQQVSTKKVAVSPLVLEEAKEPPLHVFKNKEPYTGTIVSVERIVGPRAP  62

Query  384  GETCHIVIDHGGNVPYWEGQSYGVIPPGENPKKPGSPHNVRLYSIASSRYGDSFDGKTTS  563
            GETCHIVIDHGGNVPYWEGQSYG+IPPGENPKKPGSPHNVRLYSIAS+RYGD FDGKT S
Sbjct  63   GETCHIVIDHGGNVPYWEGQSYGIIPPGENPKKPGSPHNVRLYSIASTRYGDFFDGKTAS  122

Query  564  LCVRRAVYYDPE  599
            LCVRRAVYYDPE
Sbjct  123  LCVRRAVYYDPE  134



>gb|EAZ02773.1| hypothetical protein OsI_24896 [Oryza sativa Indica Group]
Length=379

 Score =   236 bits (603),  Expect = 8e-73, Method: Compositional matrix adjust.
 Identities = 120/189 (63%), Positives = 142/189 (75%), Gaps = 8/189 (4%)
 Frame = +3

Query  45   IMAAVSQLMQVSVAVALNGDSSLQRSAFKANSITFNNRSPI----SFQPFDLKTRNGKSR  212
            + +A+     V+  +   G      S+  +N++ F N+S I    +++   LK+R+    
Sbjct  1    MASALGAQASVAAPIGAGGYGRRSSSSKGSNTVNFCNKSWIGTTLAWESKALKSRHMNK-  59

Query  213  SQYVVCMSVQQANIPKVTVSPLSLEDAKEPPLNLYKPKGPYTATIASVERIVGPKAPGET  392
               +  MSVQQA+  KV V PL L++AKEPPLNLYKPK PYTATI SVER+VGPKAPGET
Sbjct  60   ---IFSMSVQQASKSKVAVKPLELDNAKEPPLNLYKPKEPYTATIVSVERLVGPKAPGET  116

Query  393  CHIVIDHGGNVPYWEGQSYGVIPPGENPKKPGSPHNVRLYSIASSRYGDSFDGKTTSLCV  572
            CHIVIDHGGNVPYWEGQSYGVIPPGENPKKPGSP+ VRLYSIAS+RYGDSFDGKT SLCV
Sbjct  117  CHIVIDHGGNVPYWEGQSYGVIPPGENPKKPGSPNTVRLYSIASTRYGDSFDGKTASLCV  176

Query  573  RRAVYYDPE  599
            RRAVYYDPE
Sbjct  177  RRAVYYDPE  185



>gb|AGT15976.1| ferredoxin--NADP reductase [Saccharum hybrid cultivar R570]
Length=377

 Score =   236 bits (603),  Expect = 9e-73, Method: Compositional matrix adjust.
 Identities = 123/186 (66%), Positives = 140/186 (75%), Gaps = 11/186 (6%)
 Frame = +3

Query  54   AVSQLMQVSVAVALNGDSSLQRSAFKANS-ITFNNRSPISFQPFDLKTRNGKSRSQY---  221
            A+   +  + +V +  DS +     K NS + F N+  I      L  +N   + ++   
Sbjct  5    ALGSQVAAAASVPVGSDSFV----LKGNSNLNFRNKPCIGMA---LAWKNKTQQPRHLNK  57

Query  222  VVCMSVQQANIPKVTVSPLSLEDAKEPPLNLYKPKGPYTATIASVERIVGPKAPGETCHI  401
            V CMSVQQA+  KV V P+ LE+AKEPPLNLYKPK PYTATI SVERIVGPKAPGETCHI
Sbjct  58   VFCMSVQQASRSKVAVKPVELENAKEPPLNLYKPKEPYTATIVSVERIVGPKAPGETCHI  117

Query  402  VIDHGGNVPYWEGQSYGVIPPGENPKKPGSPHNVRLYSIASSRYGDSFDGKTTSLCVRRA  581
            VIDH GNVPYWEGQSYGVIPPGENPKKPGSP+ VRLYSIAS+RYGDSFDGKTTSLCVRRA
Sbjct  118  VIDHSGNVPYWEGQSYGVIPPGENPKKPGSPNTVRLYSIASTRYGDSFDGKTTSLCVRRA  177

Query  582  VYYDPE  599
            VYYDPE
Sbjct  178  VYYDPE  183



>gb|ACG35047.1| ferredoxin--NADP reductase, embryo isozyme [Zea mays]
Length=381

 Score =   236 bits (603),  Expect = 9e-73, Method: Compositional matrix adjust.
 Identities = 121/184 (66%), Positives = 139/184 (76%), Gaps = 3/184 (2%)
 Frame = +3

Query  54   AVSQLMQVSVAVALNGDSSLQRSAFKANSITFNNRS-PISFQPFDLKTRNGKSRS-QYVV  227
            A+   +  + +V +  DS  + +A K NS T N R+ P        K R  + R    V+
Sbjct  5    ALGSQVAAAASVPVGSDSLAKGAALKGNS-TLNFRTKPCIGMALAWKNRTQQPRRLNKVL  63

Query  228  CMSVQQANIPKVTVSPLSLEDAKEPPLNLYKPKGPYTATIASVERIVGPKAPGETCHIVI  407
            CMSVQQA+  KV V P+ LE AKEP L+LYKPK PYTATI SVER+VGP+APGETCH+VI
Sbjct  64   CMSVQQASRSKVAVMPVELEKAKEPLLHLYKPKEPYTATIVSVERLVGPRAPGETCHVVI  123

Query  408  DHGGNVPYWEGQSYGVIPPGENPKKPGSPHNVRLYSIASSRYGDSFDGKTTSLCVRRAVY  587
            DHGGNVPYWEGQSYGVIPPGENPKKPGSP+ VRLYSIAS+RYGDSFDGKT SLCVRRAVY
Sbjct  124  DHGGNVPYWEGQSYGVIPPGENPKKPGSPNTVRLYSIASTRYGDSFDGKTASLCVRRAVY  183

Query  588  YDPE  599
            YDPE
Sbjct  184  YDPE  187



>ref|XP_006658277.1| PREDICTED: ferredoxin--NADP reductase, embryo isozyme, chloroplastic-like 
[Oryza brachyantha]
Length=368

 Score =   236 bits (601),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 116/159 (73%), Positives = 130/159 (82%), Gaps = 8/159 (5%)
 Frame = +3

Query  135  NSITFNNRSPI----SFQPFDLKTRNGKSRSQYVVCMSVQQANIPKVTVSPLSLEDAKEP  302
            N++ F N+S I    +++   LK R+       + CMSVQQA+  KV V PL L++AKEP
Sbjct  20   NTVNFCNKSWIGTTLAWESKALKARHMNK----IFCMSVQQASKSKVAVKPLELDNAKEP  75

Query  303  PLNLYKPKGPYTATIASVERIVGPKAPGETCHIVIDHGGNVPYWEGQSYGVIPPGENPKK  482
            PLNLYKPK PYTATI SVER+VGPKAPGETCHIVIDHGGNVPYWEGQSYGVIPPGENPKK
Sbjct  76   PLNLYKPKEPYTATIVSVERLVGPKAPGETCHIVIDHGGNVPYWEGQSYGVIPPGENPKK  135

Query  483  PGSPHNVRLYSIASSRYGDSFDGKTTSLCVRRAVYYDPE  599
            PGSP+ VRLYSIAS+RYGDSFDGK  SLCVRRAVYYDPE
Sbjct  136  PGSPNTVRLYSIASTRYGDSFDGKRASLCVRRAVYYDPE  174



>ref|XP_004955449.1| PREDICTED: ferredoxin--NADP reductase, embryo isozyme, chloroplastic-like 
[Setaria italica]
Length=380

 Score =   235 bits (600),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 119/184 (65%), Positives = 138/184 (75%), Gaps = 2/184 (1%)
 Frame = +3

Query  51   AAVSQLMQVSVAVALNGDSSLQRSAFKANS-ITFNNRSPISFQPFDLKTRNGKSRSQYVV  227
            AA+   +  +    +  D  L  S+ K N+ + F ++  I       KT+  +  ++ V 
Sbjct  4    AALGTQVAATALAPVGSDGFLNGSSLKGNNNLNFRSKPWIRRTLAWEKTQQSRHLNK-VF  62

Query  228  CMSVQQANIPKVTVSPLSLEDAKEPPLNLYKPKGPYTATIASVERIVGPKAPGETCHIVI  407
            CMSVQ A+  KV V P+ LE+AKEPPLNLYKPK PYTATI SVER+VGPKAPGE CHIVI
Sbjct  63   CMSVQLASKSKVAVKPVELENAKEPPLNLYKPKEPYTATIVSVERLVGPKAPGEICHIVI  122

Query  408  DHGGNVPYWEGQSYGVIPPGENPKKPGSPHNVRLYSIASSRYGDSFDGKTTSLCVRRAVY  587
            DHGGNVPYWEGQSYGVIPPGENPKKPGSP+ VRLYSIAS+RYGDSFDGKT SLCVRRAVY
Sbjct  123  DHGGNVPYWEGQSYGVIPPGENPKKPGSPNTVRLYSIASTRYGDSFDGKTASLCVRRAVY  182

Query  588  YDPE  599
            YDPE
Sbjct  183  YDPE  186



>emb|CAB81081.1| ferredoxin--NADP+ reductase-like protein [Arabidopsis thaliana]
Length=360

 Score =   234 bits (598),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 113/167 (68%), Positives = 135/167 (81%), Gaps = 5/167 (3%)
 Frame = +3

Query  108  SLQRSAFKANSITFNNRS---PISFQPFDLKTRNGKSRSQYVVCMSVQQANIPKVTVSPL  278
            +L  +  +  SI+F ++S   P+     D K+R+   + +  +CMS+QQ++  KV V+PL
Sbjct  2    ALSTTPSQVQSISFTDKSWGPPL--LRLDSKSRSLGVKKRSTICMSLQQSSKSKVLVTPL  59

Query  279  SLEDAKEPPLNLYKPKGPYTATIASVERIVGPKAPGETCHIVIDHGGNVPYWEGQSYGVI  458
             LED KE PLNL++PK PYTATI SVERIVGP+APGETCHIVIDH GNVPYWEGQSYGVI
Sbjct  60   ELEDPKETPLNLFRPKEPYTATIVSVERIVGPQAPGETCHIVIDHDGNVPYWEGQSYGVI  119

Query  459  PPGENPKKPGSPHNVRLYSIASSRYGDSFDGKTTSLCVRRAVYYDPE  599
            PPGENPKKPG+PHNVRLYSIAS+RYGDSFDGKT SLCVRRA+YYDPE
Sbjct  120  PPGENPKKPGAPHNVRLYSIASTRYGDSFDGKTASLCVRRAIYYDPE  166



>gb|KJB56289.1| hypothetical protein B456_009G115100 [Gossypium raimondii]
Length=316

 Score =   233 bits (594),  Expect = 4e-72, Method: Compositional matrix adjust.
 Identities = 110/123 (89%), Positives = 115/123 (93%), Gaps = 0/123 (0%)
 Frame = +3

Query  231  MSVQQANIPKVTVSPLSLEDAKEPPLNLYKPKGPYTATIASVERIVGPKAPGETCHIVID  410
            MSVQQA+  K+ VSPL LE AKEPPLN +KPK PYTATI SVER+VGPKAPGETCHIVID
Sbjct  1    MSVQQASKSKIAVSPLELEIAKEPPLNTFKPKEPYTATIVSVERLVGPKAPGETCHIVID  60

Query  411  HGGNVPYWEGQSYGVIPPGENPKKPGSPHNVRLYSIASSRYGDSFDGKTTSLCVRRAVYY  590
            HGGNVPYWEGQSYGVIPPGENPKKPGSPHNVRLYSIASSRYGDSFDGKTTSLCVRRAVYY
Sbjct  61   HGGNVPYWEGQSYGVIPPGENPKKPGSPHNVRLYSIASSRYGDSFDGKTTSLCVRRAVYY  120

Query  591  DPE  599
            +PE
Sbjct  121  NPE  123



>gb|EMT16236.1| Ferredoxin--NADP reductase, root isozyme, chloroplastic [Aegilops 
tauschii]
Length=372

 Score =   234 bits (597),  Expect = 5e-72, Method: Compositional matrix adjust.
 Identities = 117/178 (66%), Positives = 137/178 (77%), Gaps = 5/178 (3%)
 Frame = +3

Query  72   QVSVAVALNG-DSSLQRSAFKA-NSITFNNRSPISFQPFDLKTRNGKSRSQYVVCMSVQQ  245
            QV+ +  + G D +++ S  +  NS++F N+S I        ++    R    VC +VQQ
Sbjct  4    QVAFSAPVGGSDRAVRSSGIQGINSLSFGNKSWIG-TALACDSKAAAQRGH--VCRAVQQ  60

Query  246  ANIPKVTVSPLSLEDAKEPPLNLYKPKGPYTATIASVERIVGPKAPGETCHIVIDHGGNV  425
            ++  KV+V PL LE AKEPPLN YKPKGPYTATI SVER VGP APGETCH+VIDHGGNV
Sbjct  61   SSKSKVSVVPLDLESAKEPPLNTYKPKGPYTATIVSVERAVGPNAPGETCHVVIDHGGNV  120

Query  426  PYWEGQSYGVIPPGENPKKPGSPHNVRLYSIASSRYGDSFDGKTTSLCVRRAVYYDPE  599
            PYWEGQSYG+IPPGENPKKPG+P NVRLYSIAS+RYGDSFDGKT SLCVRRAVYYDPE
Sbjct  121  PYWEGQSYGIIPPGENPKKPGNPQNVRLYSIASTRYGDSFDGKTASLCVRRAVYYDPE  178



>ref|XP_002463784.1| hypothetical protein SORBIDRAFT_01g006100 [Sorghum bicolor]
 gb|EER90782.1| hypothetical protein SORBIDRAFT_01g006100 [Sorghum bicolor]
Length=380

 Score =   234 bits (597),  Expect = 6e-72, Method: Compositional matrix adjust.
 Identities = 115/171 (67%), Positives = 136/171 (80%), Gaps = 9/171 (5%)
 Frame = +3

Query  102  DSSLQRSAFKANS-ITFNNRS----PISFQPFDLKTRNGKSRSQYVVCMSVQQANIPKVT  266
            D   + S  K N+ ++F N+S     ++++   ++ R+       V+CMSVQQA+  KV+
Sbjct  20   DGGARSSGIKGNNNVSFGNKSWVGGTLAWESSSVRPRH----VNKVLCMSVQQASKSKVS  75

Query  267  VSPLSLEDAKEPPLNLYKPKGPYTATIASVERIVGPKAPGETCHIVIDHGGNVPYWEGQS  446
            V+PL LE AKEPPLN YKPK P+TATI SVER+VGPKAPGETCHIVIDHGGNVPYWEGQS
Sbjct  76   VAPLDLESAKEPPLNTYKPKEPFTATIVSVERLVGPKAPGETCHIVIDHGGNVPYWEGQS  135

Query  447  YGVIPPGENPKKPGSPHNVRLYSIASSRYGDSFDGKTTSLCVRRAVYYDPE  599
            YGVIPPGENPKKPG+P NVRLYSIAS+RYGD FDG+T SLCVRRAVYYDPE
Sbjct  136  YGVIPPGENPKKPGAPQNVRLYSIASTRYGDYFDGRTGSLCVRRAVYYDPE  186



>dbj|BAA02248.1| ferredoxin-NADP+ reductase enzyme [Oryza sativa Japonica Group]
Length=317

 Score =   231 bits (589),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 108/123 (88%), Positives = 113/123 (92%), Gaps = 0/123 (0%)
 Frame = +3

Query  231  MSVQQANIPKVTVSPLSLEDAKEPPLNLYKPKGPYTATIASVERIVGPKAPGETCHIVID  410
            MSVQQA+  KV V PL LE A EPPLN YKPK PYTATI SVERIVGPKAPGETCHIVID
Sbjct  1    MSVQQASESKVAVKPLDLESANEPPLNTYKPKEPYTATIVSVERIVGPKAPGETCHIVID  60

Query  411  HGGNVPYWEGQSYGVIPPGENPKKPGSPHNVRLYSIASSRYGDSFDGKTTSLCVRRAVYY  590
            HGGNVPYWEGQSYG+IPPGENPKKPG+PHNVRLYSIAS+RYGDSFDG+TTSLCVRRAVYY
Sbjct  61   HGGNVPYWEGQSYGIIPPGENPKKPGAPHNVRLYSIASTRYGDSFDGRTTSLCVRRAVYY  120

Query  591  DPE  599
            DPE
Sbjct  121  DPE  123



>ref|XP_008665551.1| PREDICTED: ferredoxin--NADP reductase, root isozyme, chloroplastic 
[Zea mays]
 gb|ACF87736.1| unknown [Zea mays]
 gb|ACN29024.1| unknown [Zea mays]
 gb|ACR35923.1| unknown [Zea mays]
 gb|ACR36711.1| unknown [Zea mays]
 tpg|DAA51768.1| TPA: ferredoxin-NADP reductase Precursor [Zea mays]
Length=381

 Score =   232 bits (591),  Expect = 6e-71, Method: Compositional matrix adjust.
 Identities = 107/130 (82%), Positives = 118/130 (91%), Gaps = 0/130 (0%)
 Frame = +3

Query  210  RSQYVVCMSVQQANIPKVTVSPLSLEDAKEPPLNLYKPKGPYTATIASVERIVGPKAPGE  389
            R+  V+CMSVQQA+  KV+V+PL LE AKEPPLN YKPK P+TATI SVE +VGPKAPGE
Sbjct  58   RASKVLCMSVQQASRSKVSVAPLHLESAKEPPLNTYKPKEPFTATIVSVESLVGPKAPGE  117

Query  390  TCHIVIDHGGNVPYWEGQSYGVIPPGENPKKPGSPHNVRLYSIASSRYGDSFDGKTTSLC  569
            TCHIVIDHGGNVPYWEGQSYGVIPPGENPKKPG+P NVRLYSIAS+RYGD+FDG+T SLC
Sbjct  118  TCHIVIDHGGNVPYWEGQSYGVIPPGENPKKPGAPQNVRLYSIASTRYGDNFDGRTGSLC  177

Query  570  VRRAVYYDPE  599
            VRRAVYYDPE
Sbjct  178  VRRAVYYDPE  187



>gb|AAB40034.1| ferredoxin-NADP reductase precursor [Zea mays]
Length=327

 Score =   229 bits (583),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 106/126 (84%), Positives = 116/126 (92%), Gaps = 0/126 (0%)
 Frame = +3

Query  222  VVCMSVQQANIPKVTVSPLSLEDAKEPPLNLYKPKGPYTATIASVERIVGPKAPGETCHI  401
            V+CMSVQQA+  KV+V+PL LE AKEPPLN YKPK P+TATI SVE +VGPKAPGETCHI
Sbjct  8    VLCMSVQQASRSKVSVAPLHLESAKEPPLNTYKPKEPFTATIVSVESLVGPKAPGETCHI  67

Query  402  VIDHGGNVPYWEGQSYGVIPPGENPKKPGSPHNVRLYSIASSRYGDSFDGKTTSLCVRRA  581
            VIDHGGNVPYWEGQSYGVIPPGENPKKPG+P NVRLYSIAS+RYGD+FDG+T SLCVRRA
Sbjct  68   VIDHGGNVPYWEGQSYGVIPPGENPKKPGAPQNVRLYSIASTRYGDNFDGRTGSLCVRRA  127

Query  582  VYYDPE  599
            VYYDPE
Sbjct  128  VYYDPE  133



>ref|XP_003558196.1| PREDICTED: ferredoxin--NADP reductase, root isozyme, chloroplastic 
[Brachypodium distachyon]
Length=380

 Score =   230 bits (587),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 111/156 (71%), Positives = 123/156 (79%), Gaps = 0/156 (0%)
 Frame = +3

Query  132  ANSITFNNRSPISFQPFDLKTRNGKSRSQYVVCMSVQQANIPKVTVSPLSLEDAKEPPLN  311
             ++++F NRS I            + R    V  SVQQA+  KV V+PL LE AKEPPLN
Sbjct  31   GSNLSFTNRSWIGTTLASESKVAAQRRHVSKVLCSVQQASKSKVAVTPLHLESAKEPPLN  90

Query  312  LYKPKGPYTATIASVERIVGPKAPGETCHIVIDHGGNVPYWEGQSYGVIPPGENPKKPGS  491
             YKPKGPYTATI SVER VGP APGETCH+VIDHGGNVPYWEGQSYG+IPPGENPKKPG+
Sbjct  91   TYKPKGPYTATIVSVERAVGPNAPGETCHVVIDHGGNVPYWEGQSYGIIPPGENPKKPGN  150

Query  492  PHNVRLYSIASSRYGDSFDGKTTSLCVRRAVYYDPE  599
            P NVRLYSIAS+RYGDSFDGKT SLCVRRAVYYDP+
Sbjct  151  PQNVRLYSIASTRYGDSFDGKTASLCVRRAVYYDPQ  186



>gb|ACG39703.1| ferredoxin--NADP reductase, root isozyme [Zea mays]
Length=381

 Score =   230 bits (587),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 106/126 (84%), Positives = 116/126 (92%), Gaps = 0/126 (0%)
 Frame = +3

Query  222  VVCMSVQQANIPKVTVSPLSLEDAKEPPLNLYKPKGPYTATIASVERIVGPKAPGETCHI  401
            V+CMSVQQA+  KV+V+PL LE AKEPPLN YKPK P+TATI SVE +VGPKAPGETCHI
Sbjct  62   VLCMSVQQASRSKVSVAPLHLESAKEPPLNTYKPKEPFTATIVSVESLVGPKAPGETCHI  121

Query  402  VIDHGGNVPYWEGQSYGVIPPGENPKKPGSPHNVRLYSIASSRYGDSFDGKTTSLCVRRA  581
            VIDHGGNVPYWEGQSYGVIPPGENPKKPG+P NVRLYSIAS+RYGD+FDG+T SLCVRRA
Sbjct  122  VIDHGGNVPYWEGQSYGVIPPGENPKKPGAPQNVRLYSIASTRYGDNFDGRTGSLCVRRA  181

Query  582  VYYDPE  599
            VYYDPE
Sbjct  182  VYYDPE  187



>gb|EMT31879.1| Ferredoxin--NADP reductase, embryo isozyme, chloroplastic [Aegilops 
tauschii]
Length=378

 Score =   229 bits (585),  Expect = 4e-70, Method: Compositional matrix adjust.
 Identities = 116/178 (65%), Positives = 132/178 (74%), Gaps = 3/178 (2%)
 Frame = +3

Query  72   QVSVAVALNGDSSLQRSAFKANSITFNNRSPISFQPFDLKTRNGKSRSQYVVCMSVQQAN  251
            QV+    +  D    RS          N+S      ++ KT   +  ++ V CM VQQA+
Sbjct  8    QVAAVAPIGSDGRHYRSCSSLKGNNSCNKSWTGKLAWENKTLQPR-HTKKVFCMYVQQAS  66

Query  252  IPK--VTVSPLSLEDAKEPPLNLYKPKGPYTATIASVERIVGPKAPGETCHIVIDHGGNV  425
              K  V + PL LE+ KEPPLNLYKPKGPYTA+I SVERIVGPKAPGETCHIVIDHGGNV
Sbjct  67   KSKCKVAIKPLELENTKEPPLNLYKPKGPYTASIVSVERIVGPKAPGETCHIVIDHGGNV  126

Query  426  PYWEGQSYGVIPPGENPKKPGSPHNVRLYSIASSRYGDSFDGKTTSLCVRRAVYYDPE  599
            PYWEGQSYGVIPPGENPKKPG+P+ VRLYSIAS+RYGDSFDG+T SLCVRRAVYYDPE
Sbjct  127  PYWEGQSYGVIPPGENPKKPGAPNTVRLYSIASTRYGDSFDGRTASLCVRRAVYYDPE  184



>ref|XP_002874840.1| ATRFNR1 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH51099.1| ATRFNR1 [Arabidopsis lyrata subsp. lyrata]
Length=355

 Score =   226 bits (575),  Expect = 7e-69, Method: Compositional matrix adjust.
 Identities = 109/172 (63%), Positives = 130/172 (76%), Gaps = 3/172 (2%)
 Frame = +3

Query  69   MQVSVAVALNGDSSLQRSAFKANSITFNNRSPISFQPFDLKTRNGKSRSQYVVCMSVQQA  248
            M +++   ++G S   RS  K  SI+F  +S       D K+R+     +  +CMS+QQA
Sbjct  1    MSIALPTGIDGSS---RSMIKVQSISFTEKSWSPLLRLDSKSRSLSVNKRSTICMSLQQA  57

Query  249  NIPKVTVSPLSLEDAKEPPLNLYKPKGPYTATIASVERIVGPKAPGETCHIVIDHGGNVP  428
            +  KV V+PL LE  KE PLNLY+PK PYTATI SVERIVGP+APGETCHIVIDH GNVP
Sbjct  58   SRSKVAVTPLELEYPKETPLNLYRPKEPYTATIVSVERIVGPQAPGETCHIVIDHDGNVP  117

Query  429  YWEGQSYGVIPPGENPKKPGSPHNVRLYSIASSRYGDSFDGKTTSLCVRRAV  584
            YWEGQSYGVIPPGENPKKPG+PHNVRLYSIAS+RYGDSFDGKT SLC ++ +
Sbjct  118  YWEGQSYGVIPPGENPKKPGAPHNVRLYSIASTRYGDSFDGKTASLCEKKIL  169



>gb|EMS52999.1| Ferredoxin--NADP reductase, embryo isozyme, chloroplastic [Triticum 
urartu]
Length=488

 Score =   229 bits (584),  Expect = 7e-69, Method: Compositional matrix adjust.
 Identities = 108/131 (82%), Positives = 118/131 (90%), Gaps = 2/131 (2%)
 Frame = +3

Query  213  SQYVVCMSVQQANIPK--VTVSPLSLEDAKEPPLNLYKPKGPYTATIASVERIVGPKAPG  386
            ++ V CMSVQQA+  K  V + PL LE+ KEPPLNLYKPKGPYTA+I SVERIVGPKAPG
Sbjct  164  TKKVFCMSVQQASKSKCKVAIKPLELENTKEPPLNLYKPKGPYTASIVSVERIVGPKAPG  223

Query  387  ETCHIVIDHGGNVPYWEGQSYGVIPPGENPKKPGSPHNVRLYSIASSRYGDSFDGKTTSL  566
            ETCHIVIDHGGNVPYWEGQSYGVIPPGENPKKPG+P+ VRLYSIAS+RYGDSFDG+T SL
Sbjct  224  ETCHIVIDHGGNVPYWEGQSYGVIPPGENPKKPGAPNTVRLYSIASTRYGDSFDGRTASL  283

Query  567  CVRRAVYYDPE  599
            CVRRAVYYDPE
Sbjct  284  CVRRAVYYDPE  294


 Score =   152 bits (384),  Expect = 7e-40, Method: Compositional matrix adjust.
 Identities = 80/138 (58%), Positives = 93/138 (67%), Gaps = 3/138 (2%)
 Frame = +3

Query  72   QVSVAVALNGDSSLQRSAFKANSITFNNRSPISFQPFDLKTRNGKSRSQYVVCMSVQQAN  251
            QV+    +  D    RS          N+S      ++ KT   +  ++ V CMSVQQA+
Sbjct  8    QVAAVAPIGSDGRHYRSCSSLKGNNSRNKSWTGKLAWENKTLQPR-HTKKVFCMSVQQAS  66

Query  252  IPK--VTVSPLSLEDAKEPPLNLYKPKGPYTATIASVERIVGPKAPGETCHIVIDHGGNV  425
              K  V + PL LE+ KEPPLNLYKPKGPYTA+I SVERIVGPKAPGETCHIVIDHGGNV
Sbjct  67   KSKCKVAIKPLELENTKEPPLNLYKPKGPYTASIVSVERIVGPKAPGETCHIVIDHGGNV  126

Query  426  PYWEGQSYGVIPPGENPK  479
            PYWEGQSYGVIPPG N +
Sbjct  127  PYWEGQSYGVIPPGNNSR  144



>ref|NP_973942.1| ferredoxin--NADP reductase, root isozyme 2 [Arabidopsis thaliana]
 gb|AEE31235.1| ferredoxin--NADP reductase, root isozyme 2 [Arabidopsis thaliana]
Length=317

 Score =   223 bits (568),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 104/123 (85%), Positives = 111/123 (90%), Gaps = 0/123 (0%)
 Frame = +3

Query  231  MSVQQANIPKVTVSPLSLEDAKEPPLNLYKPKGPYTATIASVERIVGPKAPGETCHIVID  410
            MSVQQ +  KVTVSP+ LED K+PPLNLYKPK  YTA I SVER+VGPKAPGETCHIVID
Sbjct  1    MSVQQTSSSKVTVSPIELEDPKDPPLNLYKPKESYTAKIVSVERVVGPKAPGETCHIVID  60

Query  411  HGGNVPYWEGQSYGVIPPGENPKKPGSPHNVRLYSIASSRYGDSFDGKTTSLCVRRAVYY  590
            H GN+PYWEGQSYGVIPPGENPKKPG+PHNVRLYSIAS+RYGD FDGKT SLCVRRAVYY
Sbjct  61   HDGNLPYWEGQSYGVIPPGENPKKPGAPHNVRLYSIASTRYGDFFDGKTASLCVRRAVYY  120

Query  591  DPE  599
            DPE
Sbjct  121  DPE  123



>gb|EMS61290.1| Ferredoxin--NADP reductase, root isozyme, chloroplastic [Triticum 
urartu]
Length=419

 Score =   225 bits (574),  Expect = 5e-68, Method: Compositional matrix adjust.
 Identities = 114/176 (65%), Positives = 133/176 (76%), Gaps = 13/176 (7%)
 Frame = +3

Query  102  DSSLQRSAFKA-NSITFNNRSPISFQPFDLKTRNGKSRSQYVVCMSVQQANIPKVTVSPL  278
            D +++ S  +  NS++F+N+S I            +SR    +C +VQQ++  KV+V+PL
Sbjct  53   DRAVRSSGIQGINSLSFSNKSWIGTALACDSKAAAQSRH---LCRAVQQSSKSKVSVAPL  109

Query  279  SLEDAKEPPLNLYKPKGPYTATIASVERIVGPKAPGETCHIVIDHGGNVPYWEGQSYGVI  458
             LE AKEPPLN YKPKGPYTATI SVER VGP APGETCH+VIDHGGNVPYWEGQSYG+I
Sbjct  110  DLESAKEPPLNTYKPKGPYTATIVSVERAVGPNAPGETCHVVIDHGGNVPYWEGQSYGII  169

Query  459  ---------PPGENPKKPGSPHNVRLYSIASSRYGDSFDGKTTSLCVRRAVYYDPE  599
                     PPGENPKKPG+P NVRLYSIAS+RYGDSFDGKT SLCVRRAVYYDPE
Sbjct  170  PPENYLRIVPPGENPKKPGNPQNVRLYSIASTRYGDSFDGKTASLCVRRAVYYDPE  225



>pdb|1JB9|A Chain A, Crystal Structure Of The Ferredoxin:nadp+ Reductase 
From Maize Root At 1.7 Angstroms
Length=316

 Score =   220 bits (561),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 103/122 (84%), Positives = 112/122 (92%), Gaps = 0/122 (0%)
 Frame = +3

Query  234  SVQQANIPKVTVSPLSLEDAKEPPLNLYKPKGPYTATIASVERIVGPKAPGETCHIVIDH  413
            SVQQA+  KV+V+PL LE AKEPPLN YKPK P+TATI SVE +VGPKAPGETCHIVIDH
Sbjct  1    SVQQASRSKVSVAPLHLESAKEPPLNTYKPKEPFTATIVSVESLVGPKAPGETCHIVIDH  60

Query  414  GGNVPYWEGQSYGVIPPGENPKKPGSPHNVRLYSIASSRYGDSFDGKTTSLCVRRAVYYD  593
            GGNVPYWEGQSYGVIPPGENPKKPG+P NVRLYSIAS+RYGD+FDG+T SLCVRRAVYYD
Sbjct  61   GGNVPYWEGQSYGVIPPGENPKKPGAPQNVRLYSIASTRYGDNFDGRTGSLCVRRAVYYD  120

Query  594  PE  599
            PE
Sbjct  121  PE  122



>pdb|3LO8|A Chain A, Crystal Structure Of The Oxidized Form Of Ferredoxin:nadp+ 
Reductase From Maize Root At 1.05 Angstroms
Length=311

 Score =   212 bits (540),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 98/114 (86%), Positives = 106/114 (93%), Gaps = 0/114 (0%)
 Frame = +3

Query  258  KVTVSPLSLEDAKEPPLNLYKPKGPYTATIASVERIVGPKAPGETCHIVIDHGGNVPYWE  437
            KV+V+PL LE AKEPPLN YKPK P+TATI SVE +VGPKAPGETCHIVIDHGGNVPYWE
Sbjct  4    KVSVAPLHLESAKEPPLNTYKPKEPFTATIVSVESLVGPKAPGETCHIVIDHGGNVPYWE  63

Query  438  GQSYGVIPPGENPKKPGSPHNVRLYSIASSRYGDSFDGKTTSLCVRRAVYYDPE  599
            GQSYGVIPPGENPKKPG+P NVRLYSIAS+RYGD+FDG+T SLCVRRAVYYDPE
Sbjct  64   GQSYGVIPPGENPKKPGAPQNVRLYSIASTRYGDNFDGRTGSLCVRRAVYYDPE  117



>pdb|3LVB|A Chain A, Crystal Structure Of The Ferredoxin:nadp+ Reductase 
From Maize Root At 1.7 Angstroms - Test Set Withheld
Length=311

 Score =   212 bits (540),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 98/114 (86%), Positives = 106/114 (93%), Gaps = 0/114 (0%)
 Frame = +3

Query  258  KVTVSPLSLEDAKEPPLNLYKPKGPYTATIASVERIVGPKAPGETCHIVIDHGGNVPYWE  437
            KV+V+PL LE AKEPPLN YKPK P+TATI SVE +VGPKAPGETCHIVIDHGGNVPYWE
Sbjct  4    KVSVAPLHLESAKEPPLNTYKPKEPFTATIVSVESLVGPKAPGETCHIVIDHGGNVPYWE  63

Query  438  GQSYGVIPPGENPKKPGSPHNVRLYSIASSRYGDSFDGKTTSLCVRRAVYYDPE  599
            GQSYGVIPPGENPKKPG+P NVRLYSIAS+RYGD+FDG+T SLCVRRAVYYDPE
Sbjct  64   GQSYGVIPPGENPKKPGAPQNVRLYSIASTRYGDNFDGRTGSLCVRRAVYYDPE  117



>ref|NP_001190682.1| ferredoxin--NADP reductase, root isozyme 1 [Arabidopsis thaliana]
 gb|AEE82513.1| ferredoxin--NADP reductase, root isozyme 1 [Arabidopsis thaliana]
Length=350

 Score =   209 bits (531),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 113/184 (61%), Positives = 128/184 (70%), Gaps = 28/184 (15%)
 Frame = +3

Query  48   MAAVSQLMQVSVAVALNGDSSLQRSAFKANSITFNNRSPISFQPFDLKTRNGKSRSQYVV  227
            MA  +   Q+SVA+    D S  RS  K  SI+F ++S   + P  L+  + KSRS    
Sbjct  1    MALSTTPSQMSVALPTRIDGS-SRSMIKVQSISFTDKS---WGPPLLRL-DSKSRSL---  52

Query  228  CMSVQQANIPKVTVSPLSLEDAKEPPLNLYKPKGPYTATIASVERIVGPKAPGETCHIVI  407
                                D KE PLNL++PK PYTATI SVERIVGP+APGETCHIVI
Sbjct  53   --------------------DPKETPLNLFRPKEPYTATIVSVERIVGPQAPGETCHIVI  92

Query  408  DHGGNVPYWEGQSYGVIPPGENPKKPGSPHNVRLYSIASSRYGDSFDGKTTSLCVRRAVY  587
            DH GNVPYWEGQSYGVIPPGENPKKPG+PHNVRLYSIAS+RYGDSFDGKT SLCVRRA+Y
Sbjct  93   DHDGNVPYWEGQSYGVIPPGENPKKPGAPHNVRLYSIASTRYGDSFDGKTASLCVRRAIY  152

Query  588  YDPE  599
            YDPE
Sbjct  153  YDPE  156



>ref|XP_002992209.1| hypothetical protein SELMODRAFT_134886 [Selaginella moellendorffii]
 gb|EFJ06706.1| hypothetical protein SELMODRAFT_134886 [Selaginella moellendorffii]
Length=348

 Score =   202 bits (513),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 93/119 (78%), Positives = 102/119 (86%), Gaps = 0/119 (0%)
 Frame = +3

Query  243  QANIPKVTVSPLSLEDAKEPPLNLYKPKGPYTATIASVERIVGPKAPGETCHIVIDHGGN  422
            + N    T +   L+ A +PPLN++KPK PYTATI SVERIVG KAPGETCHIVIDHGGN
Sbjct  31   RVNAKVATTAAPDLDTASDPPLNIFKPKTPYTATIKSVERIVGDKAPGETCHIVIDHGGN  90

Query  423  VPYWEGQSYGVIPPGENPKKPGSPHNVRLYSIASSRYGDSFDGKTTSLCVRRAVYYDPE  599
            VPYWEGQSYGVIPPGENPKKPG+PH VRLYSIAS+RYGD FDGKT SLCVRRAVY+DPE
Sbjct  91   VPYWEGQSYGVIPPGENPKKPGTPHAVRLYSIASTRYGDDFDGKTASLCVRRAVYWDPE  149



>ref|XP_002982108.1| hypothetical protein SELMODRAFT_179376 [Selaginella moellendorffii]
 gb|EFJ16776.1| hypothetical protein SELMODRAFT_179376 [Selaginella moellendorffii]
Length=348

 Score =   200 bits (509),  Expect = 4e-59, Method: Compositional matrix adjust.
 Identities = 93/119 (78%), Positives = 103/119 (87%), Gaps = 0/119 (0%)
 Frame = +3

Query  243  QANIPKVTVSPLSLEDAKEPPLNLYKPKGPYTATIASVERIVGPKAPGETCHIVIDHGGN  422
            + N    T +  +L+ A +PPLNL+KPK PYTATI SVERIVG KAPGETCHIVIDHGGN
Sbjct  31   RVNAKVATTAAPNLDTASDPPLNLFKPKTPYTATIKSVERIVGDKAPGETCHIVIDHGGN  90

Query  423  VPYWEGQSYGVIPPGENPKKPGSPHNVRLYSIASSRYGDSFDGKTTSLCVRRAVYYDPE  599
            VPYWEGQSYGVIPPGENPKKPG+P+ VRLYSIAS+RYGD FDGKT SLCVRRAVY+DPE
Sbjct  91   VPYWEGQSYGVIPPGENPKKPGTPNAVRLYSIASTRYGDDFDGKTASLCVRRAVYWDPE  149



>ref|XP_001770917.1| predicted protein [Physcomitrella patens]
 ref|XP_001770962.1| predicted protein [Physcomitrella patens]
 gb|EDQ64247.1| predicted protein [Physcomitrella patens]
 gb|EDQ64292.1| predicted protein [Physcomitrella patens]
Length=378

 Score =   181 bits (458),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 85/129 (66%), Positives = 98/129 (76%), Gaps = 1/129 (1%)
 Frame = +3

Query  213  SQYVVCMSVQQANIPKVTVSPLSLEDAKEPPLNLYKPKGPYTATIASVERIVGPKAPGET  392
            SQ  V  +       KV ++   LE   EPP++L+K K P+  T+ SVERIVGP A GET
Sbjct  57   SQRRVFTAALTEQASKVALTA-DLEGEPEPPMHLFKNKEPFIGTVKSVERIVGPNATGET  115

Query  393  CHIVIDHGGNVPYWEGQSYGVIPPGENPKKPGSPHNVRLYSIASSRYGDSFDGKTTSLCV  572
            CHIVIDHGG +PYWEGQSYG+IPPGENPKKPG P+ VRLYSIAS+RYGD FDGKT SLCV
Sbjct  116  CHIVIDHGGQMPYWEGQSYGIIPPGENPKKPGQPNTVRLYSIASTRYGDEFDGKTASLCV  175

Query  573  RRAVYYDPE  599
            RRAVY+ PE
Sbjct  176  RRAVYWCPE  184



>ref|XP_001774270.1| predicted protein [Physcomitrella patens]
 gb|EDQ60906.1| predicted protein [Physcomitrella patens]
Length=291

 Score =   176 bits (447),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 78/98 (80%), Positives = 88/98 (90%), Gaps = 0/98 (0%)
 Frame = +3

Query  306  LNLYKPKGPYTATIASVERIVGPKAPGETCHIVIDHGGNVPYWEGQSYGVIPPGENPKKP  485
            ++L+K K P+  TI SVERIVGPKAPGETCHIVIDH GNVPYWEGQSYG+IPPGENPKKP
Sbjct  1    MHLFKNKEPFIGTIKSVERIVGPKAPGETCHIVIDHEGNVPYWEGQSYGIIPPGENPKKP  60

Query  486  GSPHNVRLYSIASSRYGDSFDGKTTSLCVRRAVYYDPE  599
            G P++VRLYSIAS+RYGD FDG+T S CVRRAVY+DPE
Sbjct  61   GQPNSVRLYSIASTRYGDDFDGRTASFCVRRAVYWDPE  98



>ref|XP_007510909.1| predicted protein [Bathycoccus prasinos]
 emb|CCO66469.1| predicted protein [Bathycoccus prasinos]
Length=369

 Score =   160 bits (406),  Expect = 9e-44, Method: Compositional matrix adjust.
 Identities = 76/111 (68%), Positives = 87/111 (78%), Gaps = 3/111 (3%)
 Frame = +3

Query  273  PLSLEDAKEPPLNLYKPKGPYTATIASVERIVGPKAPGETCHIVIDHGGNVPYWEGQSYG  452
            PL+LE+  E PLN YK K P+T T+ SVERIVGPKA GET HI+IDHGG +P+WEGQSYG
Sbjct  67   PLALEEG-EMPLNTYKNKTPFTGTVKSVERIVGPKATGETTHIIIDHGGKMPFWEGQSYG  125

Query  453  VIPPGE--NPKKPGSPHNVRLYSIASSRYGDSFDGKTTSLCVRRAVYYDPE  599
            VIPPG   N K     H VRLYSIAS+RYGDSFDG+T +LCVRRA Y+D E
Sbjct  126  VIPPGTKINSKGKEVAHGVRLYSIASTRYGDSFDGQTATLCVRRATYWDEE  176



>ref|XP_003084170.1| ferredoxin-NADP reductase (ISS) [Ostreococcus tauri]
 emb|CAL58586.1| Ferredoxin-NADP+ reductase [Ostreococcus tauri]
Length=364

 Score =   159 bits (402),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 76/111 (68%), Positives = 85/111 (77%), Gaps = 3/111 (3%)
 Frame = +3

Query  273  PLSLEDAKEPPLNLYKPKGPYTATIASVERIVGPKAPGETCHIVIDHGGNVPYWEGQSYG  452
            PL +E   E PLN YK K P+  TI SVERIVGP A GETCHI+I+HGG +P+WEGQSYG
Sbjct  62   PLEMEKM-ELPLNTYKNKEPFVGTIRSVERIVGPNATGETCHIIIEHGGKMPFWEGQSYG  120

Query  453  VIPPGE--NPKKPGSPHNVRLYSIASSRYGDSFDGKTTSLCVRRAVYYDPE  599
            VIPPG   N K    PH VRLYSIASSRYGDS+DG T +LCVRRA Y+DPE
Sbjct  121  VIPPGTKVNSKGKEVPHGVRLYSIASSRYGDSYDGLTATLCVRRATYWDPE  171



>ref|XP_001422240.1| predicted protein [Ostreococcus lucimarinus CCE9901]
 gb|ABP00557.1| predicted protein [Ostreococcus lucimarinus CCE9901]
Length=360

 Score =   158 bits (399),  Expect = 9e-43, Method: Compositional matrix adjust.
 Identities = 75/111 (68%), Positives = 86/111 (77%), Gaps = 3/111 (3%)
 Frame = +3

Query  273  PLSLEDAKEPPLNLYKPKGPYTATIASVERIVGPKAPGETCHIVIDHGGNVPYWEGQSYG  452
            PL LED    PLN +K K P+T  + SVERIVGP A GETCHI+I+HGG +P+WEGQSYG
Sbjct  58   PLELEDMP-LPLNTFKNKEPFTGKVRSVERIVGPNATGETCHIIIEHGGKMPFWEGQSYG  116

Query  453  VIPPGE--NPKKPGSPHNVRLYSIASSRYGDSFDGKTTSLCVRRAVYYDPE  599
            VIPPG   N K    PH VRLYSIASSRYGDS+DG+T +LCVRRA Y+DPE
Sbjct  117  VIPPGTKVNSKGKEVPHGVRLYSIASSRYGDSYDGQTATLCVRRATYWDPE  167



>ref|XP_002500720.1| ferredoxin-NADP oxidoreductase chloroplast precursor [Micromonas 
sp. RCC299]
 gb|ACO61978.1| ferredoxin-NADP oxidoreductase chloroplast precursor [Micromonas 
sp. RCC299]
Length=368

 Score =   157 bits (397),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 75/111 (68%), Positives = 84/111 (76%), Gaps = 3/111 (3%)
 Frame = +3

Query  273  PLSLEDAKEPPLNLYKPKGPYTATIASVERIVGPKAPGETCHIVIDHGGNVPYWEGQSYG  452
            PL LED    PLN +K K P+  TI SVERIVGP A GETCHI+I+HGG +P+WEGQSYG
Sbjct  66   PLELEDMP-LPLNTFKNKAPFVGTIKSVERIVGPNATGETCHIIIEHGGKMPFWEGQSYG  124

Query  453  VIPPGE--NPKKPGSPHNVRLYSIASSRYGDSFDGKTTSLCVRRAVYYDPE  599
            VIPPG   N K    PH VRLYSIAS+RYGD FDGKT +LCVRRA Y+ PE
Sbjct  125  VIPPGTKVNSKGKEVPHGVRLYSIASTRYGDEFDGKTATLCVRRATYWCPE  175



>gb|KIZ06612.1| ferredoxin--NADP+ reductase [Monoraphidium neglectum]
Length=341

 Score =   155 bits (392),  Expect = 5e-42, Method: Compositional matrix adjust.
 Identities = 76/111 (68%), Positives = 87/111 (78%), Gaps = 3/111 (3%)
 Frame = +3

Query  273  PLSLEDAKEPPLNLYKPKGPYTATIASVERIVGPKAPGETCHIVIDHGGNVPYWEGQSYG  452
            PL+LE+  E PLN +  K P+T TI SV+RIVGP A GETC IVI+  G++PYWEGQSYG
Sbjct  39   PLALEEG-EMPLNTFSNKKPFTGTIRSVKRIVGPNATGETCDIVIETNGDIPYWEGQSYG  97

Query  453  VIPPGE--NPKKPGSPHNVRLYSIASSRYGDSFDGKTTSLCVRRAVYYDPE  599
            VIPPG   N K    PH VRLYSIA+SRYGD+FDGKTT+LCVRRAVY DPE
Sbjct  98   VIPPGTKINSKGKEVPHGVRLYSIAASRYGDTFDGKTTTLCVRRAVYVDPE  148



>ref|XP_003064407.1| ferredoxin-NADP oxidoreductase [Micromonas pusilla CCMP1545]
 gb|EEH51312.1| ferredoxin-NADP oxidoreductase [Micromonas pusilla CCMP1545]
Length=383

 Score =   155 bits (393),  Expect = 8e-42, Method: Compositional matrix adjust.
 Identities = 85/184 (46%), Positives = 110/184 (60%), Gaps = 19/184 (10%)
 Frame = +3

Query  102  DSSLQRSAFKANSITFNN--RSPISFQPFDLKTRNGKSRSQYVVCMSVQQANIPKVTVSP  275
            ++ L +SAFK ++    +  R+P++     ++  NG      +   +  Q +I K   +P
Sbjct  8    NAGLAKSAFKGSNAGLKSSARAPVARVATVVRA-NGTDYGLGLEMKTTAQKSIAKGGRAP  66

Query  276  LSLEDAKEP--------------PLNLYKPKGPYTATIASVERIVGPKAPGETCHIVIDH  413
            + LE  K                PLN +K K P+T  I SVERIVGP A GETCHI+I+H
Sbjct  67   VPLELEKASQGSRPSSRSPAMPLPLNTFKNKAPFTGKIKSVERIVGPNATGETCHIIIEH  126

Query  414  GGNVPYWEGQSYGVIPPGE--NPKKPGSPHNVRLYSIASSRYGDSFDGKTTSLCVRRAVY  587
            GG +P+WEGQSYGVIPPG   N K    PH VRLYSIAS+RYGD FDG T +LCVRRA Y
Sbjct  127  GGKMPFWEGQSYGVIPPGTKVNSKGKEVPHGVRLYSIASTRYGDEFDGNTATLCVRRATY  186

Query  588  YDPE  599
            +D E
Sbjct  187  WDSE  190



>gb|EWM23857.1| Ferredoxin reductase-type FAD-binding domain protein [Nannochloropsis 
gaditana]
Length=437

 Score =   156 bits (395),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 73/104 (70%), Positives = 82/104 (79%), Gaps = 1/104 (1%)
 Frame = +3

Query  288  DAKEPPLNLYKPKGPYTATIASVERIVGPKAPGETCHIVIDHGGNVPYWEGQSYGVIPPG  467
            D    PLN YK K P+T  I SV+RIVGPKA GETCHI+IDHGG +PYWEGQSYGV+PPG
Sbjct  140  DQSNIPLNTYKNKEPHTGKIVSVKRIVGPKATGETCHIIIDHGGAMPYWEGQSYGVVPPG  199

Query  468  ENPKKPGSPHNVRLYSIASSRYGDSFDGKTTSLCVRRAVYYDPE  599
             NPK  G P+NVRLYSIAS+RYGD   G+T SLCVRRA Y+ PE
Sbjct  200  INPKN-GKPNNVRLYSIASTRYGDDMKGQTASLCVRRATYWCPE  242



>ref|XP_005853875.1| ferredoxin--NADP+ reductase [Nannochloropsis gaditana CCMP526]
 gb|EKU22482.1| ferredoxin--NADP+ reductase [Nannochloropsis gaditana CCMP526]
Length=411

 Score =   156 bits (394),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 73/104 (70%), Positives = 82/104 (79%), Gaps = 1/104 (1%)
 Frame = +3

Query  288  DAKEPPLNLYKPKGPYTATIASVERIVGPKAPGETCHIVIDHGGNVPYWEGQSYGVIPPG  467
            D    PLN YK K P+T  I SV+RIVGPKA GETCHI+IDHGG +PYWEGQSYGV+PPG
Sbjct  114  DQSNIPLNTYKNKEPHTGKIVSVKRIVGPKATGETCHIIIDHGGAMPYWEGQSYGVVPPG  173

Query  468  ENPKKPGSPHNVRLYSIASSRYGDSFDGKTTSLCVRRAVYYDPE  599
             NPK  G P+NVRLYSIAS+RYGD   G+T SLCVRRA Y+ PE
Sbjct  174  INPKN-GKPNNVRLYSIASTRYGDDMKGQTASLCVRRATYWCPE  216



>ref|XP_002290014.1| ferredoxin--NADP+ reductase [Thalassiosira pseudonana CCMP1335]
 gb|EED93551.1| ferredoxin--NADP+ reductase [Thalassiosira pseudonana CCMP1335]
Length=361

 Score =   152 bits (383),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 70/104 (67%), Positives = 80/104 (77%), Gaps = 1/104 (1%)
 Frame = +3

Query  288  DAKEPPLNLYKPKGPYTATIASVERIVGPKAPGETCHIVIDHGGNVPYWEGQSYGVIPPG  467
            D    P+N+YK K P+T  + S +RIVGP+A GETCHIVIDH GN PYWEGQS+GVIPPG
Sbjct  64   DQSNVPVNVYKNKAPFTGKVVSTKRIVGPQATGETCHIVIDHQGNFPYWEGQSWGVIPPG  123

Query  468  ENPKKPGSPHNVRLYSIASSRYGDSFDGKTTSLCVRRAVYYDPE  599
               +K G PH+VRLYSIASSRYGD F G T SLCVRRA Y+ PE
Sbjct  124  TR-EKDGKPHSVRLYSIASSRYGDDFTGNTGSLCVRRATYWCPE  166



>ref|XP_002954986.1| ferredoxin-NADP+ reductase [Volvox carteri f. nagariensis]
 gb|AAB40978.1| ferredoxin-NADP+ reductase [Volvox carteri]
 gb|EFJ43974.1| ferredoxin-NADP+ reductase [Volvox carteri f. nagariensis]
Length=346

 Score =   151 bits (382),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 77/119 (65%), Positives = 86/119 (72%), Gaps = 4/119 (3%)
 Frame = +3

Query  249  NIPKVTVSPLSLEDAKEPPLNLYKPKGPYTATIASVERIVGPKAPGETCHIVIDHGGNVP  428
            ++ K TV P +LE+  E PLN Y  K P+ A I SVE I GPKA GETCHI+I+  G +P
Sbjct  37   DVSKRTV-PTALEEG-EMPLNTYSNKAPFKAKIRSVETITGPKATGETCHIIIETEGKIP  94

Query  429  YWEGQSYGVIPPGE--NPKKPGSPHNVRLYSIASSRYGDSFDGKTTSLCVRRAVYYDPE  599
            +WEGQSYGVIPPG   N K    PH  RLYSIASSRYGD FDGKT SLCVRRAVY DPE
Sbjct  95   FWEGQSYGVIPPGTKINSKGKEVPHGTRLYSIASSRYGDDFDGKTASLCVRRAVYVDPE  153



>ref|XP_009040433.1| hypothetical protein AURANDRAFT_31888 [Aureococcus anophagefferens]
 gb|EGB04876.1| hypothetical protein AURANDRAFT_31888 [Aureococcus anophagefferens]
Length=336

 Score =   150 bits (380),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 69/104 (66%), Positives = 78/104 (75%), Gaps = 1/104 (1%)
 Frame = +3

Query  288  DAKEPPLNLYKPKGPYTATIASVERIVGPKAPGETCHIVIDHGGNVPYWEGQSYGVIPPG  467
            D    P+N YK K PYT  + S +RIVGP+A GETCHI+ DH G +PYWEGQS+GVI  G
Sbjct  39   DQSTVPVNTYKNKSPYTTKVVSCKRIVGPEATGETCHIIFDHQGKMPYWEGQSFGVIADG  98

Query  468  ENPKKPGSPHNVRLYSIASSRYGDSFDGKTTSLCVRRAVYYDPE  599
             NPK  G PH VRLYSIA+SRYGD   GKTTSLCVRRA Y+DPE
Sbjct  99   TNPKN-GKPHTVRLYSIAASRYGDDMTGKTTSLCVRRATYWDPE  141



>ref|XP_005644145.1| ferredoxin-NADP+ reductase [Coccomyxa subellipsoidea C-169]
 gb|EIE19601.1| ferredoxin-NADP+ reductase [Coccomyxa subellipsoidea C-169]
Length=349

 Score =   150 bits (379),  Expect = 5e-40, Method: Compositional matrix adjust.
 Identities = 78/132 (59%), Positives = 90/132 (68%), Gaps = 5/132 (4%)
 Frame = +3

Query  210  RSQYVVCMSVQQANIPKVTVSPLSLEDAKEPPLNLYKPKGPYTATIASVERIVGPKAPGE  389
            RS  VV  +  Q    K    P  LE   + P+N +  K P+ AT+ SVERIVGPKA GE
Sbjct  28   RSHRVVAEAATQT--LKKNKVPAELEKG-DLPMNTFNNKKPFKATVKSVERIVGPKATGE  84

Query  390  TCHIVIDHGGNVPYWEGQSYGVIPPGE--NPKKPGSPHNVRLYSIASSRYGDSFDGKTTS  563
            TCHIVI+  G +PYWEGQSYGVIPPG   N K    PH  RLYSIA++RYGD+FDGKTTS
Sbjct  85   TCHIVIETRGEIPYWEGQSYGVIPPGTKINSKGKEVPHGTRLYSIAATRYGDTFDGKTTS  144

Query  564  LCVRRAVYYDPE  599
            LCVRRA Y+ PE
Sbjct  145  LCVRRAEYWCPE  156



>ref|XP_001697352.1| ferredoxin-nadp reductase [Chlamydomonas reinhardtii]
 gb|EDP00292.1| ferredoxin-nadp reductase [Chlamydomonas reinhardtii]
Length=346

 Score =   149 bits (377),  Expect = 9e-40, Method: Compositional matrix adjust.
 Identities = 75/119 (63%), Positives = 86/119 (72%), Gaps = 4/119 (3%)
 Frame = +3

Query  249  NIPKVTVSPLSLEDAKEPPLNLYKPKGPYTATIASVERIVGPKAPGETCHIVIDHGGNVP  428
            ++ K TV P  LE+  E PLN Y  K P+ A + SVE+I GPKA GETCHI+I+  G +P
Sbjct  37   DMSKRTV-PTKLEEG-EMPLNTYSNKAPFKAKVRSVEKITGPKATGETCHIIIETEGKIP  94

Query  429  YWEGQSYGVIPPGE--NPKKPGSPHNVRLYSIASSRYGDSFDGKTTSLCVRRAVYYDPE  599
            +WEGQSYGVIPPG   N K    PH  RLYSIASSRYGD FDG+T SLCVRRAVY DPE
Sbjct  95   FWEGQSYGVIPPGTKINSKGKEVPHGTRLYSIASSRYGDDFDGQTASLCVRRAVYVDPE  153



>ref|XP_009035092.1| hypothetical protein AURANDRAFT_23206 [Aureococcus anophagefferens]
 gb|EGB10278.1| hypothetical protein AURANDRAFT_23206 [Aureococcus anophagefferens]
Length=342

 Score =   149 bits (375),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 68/104 (65%), Positives = 78/104 (75%), Gaps = 1/104 (1%)
 Frame = +3

Query  288  DAKEPPLNLYKPKGPYTATIASVERIVGPKAPGETCHIVIDHGGNVPYWEGQSYGVIPPG  467
            D    P+N YK K PYT  + S +RIVGP+A GETCHI+ DH G +PYWEGQS+GVI  G
Sbjct  45   DQSTVPVNTYKNKSPYTTKVVSCKRIVGPEATGETCHIIFDHQGKMPYWEGQSFGVIADG  104

Query  468  ENPKKPGSPHNVRLYSIASSRYGDSFDGKTTSLCVRRAVYYDPE  599
             NPK  G PH VRLYSIA+SRYGD   G+TTSLCVRRA Y+DPE
Sbjct  105  TNPKN-GKPHTVRLYSIAASRYGDDMTGQTTSLCVRRATYWDPE  147



>gb|AAP79145.1| ferredoxin-NADP oxidoreductase [Bigelowiella natans]
Length=367

 Score =   149 bits (375),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 70/104 (67%), Positives = 81/104 (78%), Gaps = 1/104 (1%)
 Frame = +3

Query  288  DAKEPPLNLYKPKGPYTATIASVERIVGPKAPGETCHIVIDHGGNVPYWEGQSYGVIPPG  467
            D    P+N +K K P TA + SVERIVGPKA GETC+IVIDH G +PYWEGQS GVIPPG
Sbjct  70   DKSTIPVNTHKNKAPLTAKVVSVERIVGPKATGETCNIVIDHEGKMPYWEGQSAGVIPPG  129

Query  468  ENPKKPGSPHNVRLYSIASSRYGDSFDGKTTSLCVRRAVYYDPE  599
             +PK+   P+ VRLYSIAS+RYGD F GKT +LCVRRA Y+DPE
Sbjct  130  IDPKR-NKPYGVRLYSIASTRYGDDFTGKTMTLCVRRATYWDPE  172



>ref|XP_002180511.1| predicted protein [Phaeodactylum tricornutum CCAP 1055/1]
 gb|EEC47919.1| predicted protein, partial [Phaeodactylum tricornutum CCAP 1055/1]
Length=298

 Score =   147 bits (370),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 68/104 (65%), Positives = 79/104 (76%), Gaps = 1/104 (1%)
 Frame = +3

Query  288  DAKEPPLNLYKPKGPYTATIASVERIVGPKAPGETCHIVIDHGGNVPYWEGQSYGVIPPG  467
            D    P+N+YK K P+T  + S +RIVGP A GETCH+VIDH GN PYWEGQS+GVIPPG
Sbjct  1    DQSSVPVNVYKNKAPFTGKVVSTKRIVGPLATGETCHVVIDHEGNFPYWEGQSWGVIPPG  60

Query  468  ENPKKPGSPHNVRLYSIASSRYGDSFDGKTTSLCVRRAVYYDPE  599
               +K G PH+VRLYSIAS+RYGD   GKT SLCVRRA Y+ PE
Sbjct  61   VR-EKDGKPHSVRLYSIASTRYGDDMTGKTGSLCVRRATYWCPE  103



>ref|XP_002977684.1| hypothetical protein SELMODRAFT_107413 [Selaginella moellendorffii]
 gb|EFJ21022.1| hypothetical protein SELMODRAFT_107413 [Selaginella moellendorffii]
Length=303

 Score =   146 bits (369),  Expect = 6e-39, Method: Compositional matrix adjust.
 Identities = 70/110 (64%), Positives = 82/110 (75%), Gaps = 0/110 (0%)
 Frame = +3

Query  267  VSPLSLEDAKEPPLNLYKPKGPYTATIASVERIVGPKAPGETCHIVIDHGGNVPYWEGQS  446
            V P SLE  K+ P NLY  K PY ATI SV R+   +  G+T HIVIDHGGNVP+WEGQS
Sbjct  5    VLPRSLELLKKAPTNLYTRKSPYIATIESVHRLTTGENGGDTYHIVIDHGGNVPFWEGQS  64

Query  447  YGVIPPGENPKKPGSPHNVRLYSIASSRYGDSFDGKTTSLCVRRAVYYDP  596
            YG++PPG NPK+PG+P   RLYS+ASSRYGD   G+T SLCV+R V YDP
Sbjct  65   YGILPPGTNPKRPGAPPPNRLYSLASSRYGDDLSGRTASLCVKRIVSYDP  114



>ref|XP_002979592.1| hypothetical protein SELMODRAFT_419219 [Selaginella moellendorffii]
 gb|EFJ19481.1| hypothetical protein SELMODRAFT_419219 [Selaginella moellendorffii]
Length=303

 Score =   146 bits (369),  Expect = 7e-39, Method: Compositional matrix adjust.
 Identities = 69/110 (63%), Positives = 82/110 (75%), Gaps = 0/110 (0%)
 Frame = +3

Query  267  VSPLSLEDAKEPPLNLYKPKGPYTATIASVERIVGPKAPGETCHIVIDHGGNVPYWEGQS  446
            V P SLE  K+ P NLY  K PY ATI SV R+   +  G+T HIVIDHGGN+P+WEGQS
Sbjct  5    VLPRSLELLKKAPTNLYTRKSPYVATIESVHRLTTGENGGDTYHIVIDHGGNIPFWEGQS  64

Query  447  YGVIPPGENPKKPGSPHNVRLYSIASSRYGDSFDGKTTSLCVRRAVYYDP  596
            YG++PPG NPK+PG+P   RLYS+ASSRYGD   G+T SLCV+R V YDP
Sbjct  65   YGILPPGTNPKRPGAPPPNRLYSLASSRYGDDLSGRTASLCVKRIVSYDP  114



>ref|XP_002180502.1| predicted protein [Phaeodactylum tricornutum CCAP 1055/1]
 gb|EEC47910.1| predicted protein [Phaeodactylum tricornutum CCAP 1055/1]
Length=320

 Score =   146 bits (369),  Expect = 9e-39, Method: Compositional matrix adjust.
 Identities = 68/104 (65%), Positives = 79/104 (76%), Gaps = 1/104 (1%)
 Frame = +3

Query  288  DAKEPPLNLYKPKGPYTATIASVERIVGPKAPGETCHIVIDHGGNVPYWEGQSYGVIPPG  467
            D    P+N+YK K P+T  + S +RIVGP A GETCH+VIDH GN PYWEGQS+GVIPPG
Sbjct  23   DQSSVPVNVYKNKAPFTGKVVSTKRIVGPLATGETCHVVIDHEGNFPYWEGQSWGVIPPG  82

Query  468  ENPKKPGSPHNVRLYSIASSRYGDSFDGKTTSLCVRRAVYYDPE  599
               +K G PH+VRLYSIAS+RYGD   GKT SLCVRRA Y+ PE
Sbjct  83   VR-EKDGKPHSVRLYSIASTRYGDDMTGKTGSLCVRRATYWCPE  125



>ref|XP_002295321.1| ferredoxin-nadp reductase [Thalassiosira pseudonana CCMP1335]
 gb|EED87387.1| ferredoxin-nadp reductase [Thalassiosira pseudonana CCMP1335]
Length=339

 Score =   145 bits (367),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 67/97 (69%), Positives = 76/97 (78%), Gaps = 1/97 (1%)
 Frame = +3

Query  309  NLYKPKGPYTATIASVERIVGPKAPGETCHIVIDHGGNVPYWEGQSYGVIPPGENPKKPG  488
            N YK K P+T  + S +RIVGPKA GETCHI+IDH G+ PYWEGQS+GVIPPG   +K G
Sbjct  49   NTYKNKAPFTGKVVSTKRIVGPKATGETCHIIIDHNGDFPYWEGQSWGVIPPGTR-EKDG  107

Query  489  SPHNVRLYSIASSRYGDSFDGKTTSLCVRRAVYYDPE  599
             PH+VRLYSIASSRYGD   GKT SLCVRRA Y+ PE
Sbjct  108  KPHSVRLYSIASSRYGDDMTGKTGSLCVRRATYWCPE  144



>ref|XP_002184856.1| predicted protein [Phaeodactylum tricornutum CCAP 1055/1]
 gb|EEC43592.1| predicted protein [Phaeodactylum tricornutum CCAP 1055/1]
Length=340

 Score =   145 bits (367),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 66/104 (63%), Positives = 80/104 (77%), Gaps = 1/104 (1%)
 Frame = +3

Query  288  DAKEPPLNLYKPKGPYTATIASVERIVGPKAPGETCHIVIDHGGNVPYWEGQSYGVIPPG  467
            D    P+N+YK K P+T  + S +RIVGPKA GETCHI+IDH G+ P+WEGQS+GVIPPG
Sbjct  43   DQSTVPVNVYKNKAPFTGKVVSSKRIVGPKATGETCHIIIDHNGDFPFWEGQSWGVIPPG  102

Query  468  ENPKKPGSPHNVRLYSIASSRYGDSFDGKTTSLCVRRAVYYDPE  599
               +K G PH+VRLYSIAS+RYGD   GKT SLCVRRA Y+ P+
Sbjct  103  TR-EKDGKPHSVRLYSIASTRYGDDMTGKTGSLCVRRATYWCPD  145



>ref|XP_002974410.1| hypothetical protein SELMODRAFT_101002 [Selaginella moellendorffii]
 gb|EFJ24632.1| hypothetical protein SELMODRAFT_101002 [Selaginella moellendorffii]
Length=304

 Score =   141 bits (356),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 62/106 (58%), Positives = 81/106 (76%), Gaps = 3/106 (3%)
 Frame = +3

Query  282  LEDAKEPPLNLYKPKGPYTATIASVERIVGPKAPGETCHIVIDHGGNVPYWEGQSYGVIP  461
            LE   +PP +LY  + PYTAT++S++R+      G+  HIVIDHGGNVP+WEGQSYG++P
Sbjct  8    LERGNKPPFHLYTSQLPYTATVSSIQRLT---RDGQVSHIVIDHGGNVPFWEGQSYGILP  64

Query  462  PGENPKKPGSPHNVRLYSIASSRYGDSFDGKTTSLCVRRAVYYDPE  599
            PGEN K+PG+ H   LYSIASSRYGD   G++ SLCV+RA+Y DP+
Sbjct  65   PGENSKRPGTRHPYHLYSIASSRYGDDLSGRSASLCVKRAIYVDPQ  110



>ref|XP_002985709.1| hypothetical protein SELMODRAFT_122698 [Selaginella moellendorffii]
 gb|EFJ13287.1| hypothetical protein SELMODRAFT_122698 [Selaginella moellendorffii]
Length=304

 Score =   141 bits (355),  Expect = 6e-37, Method: Compositional matrix adjust.
 Identities = 62/106 (58%), Positives = 81/106 (76%), Gaps = 3/106 (3%)
 Frame = +3

Query  282  LEDAKEPPLNLYKPKGPYTATIASVERIVGPKAPGETCHIVIDHGGNVPYWEGQSYGVIP  461
            LE   +PP +LY  + PYTAT++S++R+      G+  HIVIDHGGNVP+WEGQSYG++P
Sbjct  8    LERGNKPPFHLYTSQLPYTATVSSIQRLT---RDGQVSHIVIDHGGNVPFWEGQSYGILP  64

Query  462  PGENPKKPGSPHNVRLYSIASSRYGDSFDGKTTSLCVRRAVYYDPE  599
            PGEN K+PG+ H   LYSIASSRYGD   G++ SLCV+RA+Y DP+
Sbjct  65   PGENSKRPGTRHPYHLYSIASSRYGDDLSGRSASLCVKRAIYVDPQ  110



>ref|XP_005848997.1| hypothetical protein CHLNCDRAFT_35035 [Chlorella variabilis]
 gb|EFN56895.1| hypothetical protein CHLNCDRAFT_35035 [Chlorella variabilis]
Length=358

 Score =   140 bits (353),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 69/111 (62%), Positives = 79/111 (71%), Gaps = 3/111 (3%)
 Frame = +3

Query  273  PLSLEDAKEPPLNLYKPKGPYTATIASVERIVGPKAPGETCHIVIDHGGNVPYWEGQSYG  452
            PL LE+    P+N + PK P+   I SVE I GPKA GETCHI+I     +P+ EGQSYG
Sbjct  50   PLELEEIG-LPMNTFGPKNPFIGKIVSVETITGPKATGETCHIIIQTDKKIPFVEGQSYG  108

Query  453  VIPPGE--NPKKPGSPHNVRLYSIASSRYGDSFDGKTTSLCVRRAVYYDPE  599
            VIPPG   N K    PH  RLYSIA++RYGDSFDG TTSLCVRRAVY+DPE
Sbjct  109  VIPPGTKINSKGKEVPHGTRLYSIAATRYGDSFDGMTTSLCVRRAVYWDPE  159



>ref|XP_011400423.1| Ferredoxin-NADP reductase, chloroplastic [Auxenochlorella protothecoides]
 gb|KFM27456.1| Ferredoxin-NADP reductase, chloroplastic [Auxenochlorella protothecoides]
Length=293

 Score =   138 bits (347),  Expect = 7e-36, Method: Compositional matrix adjust.
 Identities = 65/100 (65%), Positives = 76/100 (76%), Gaps = 2/100 (2%)
 Frame = +3

Query  306  LNLYKPKGPYTATIASVERIVGPKAPGETCHIVIDHGGNVPYWEGQSYGVIPPGE--NPK  479
            +N +  K P+ A + SVERIVGPKA GETCHIV++ GG +P+ EGQSYGVIPPG   N K
Sbjct  1    MNTFNIKKPFKAKVISVERIVGPKATGETCHIVLETGGEIPFAEGQSYGVIPPGTKINSK  60

Query  480  KPGSPHNVRLYSIASSRYGDSFDGKTTSLCVRRAVYYDPE  599
                PH  RLYSIAS+RYGD+FDGKT SLCVRRA Y+D E
Sbjct  61   GKEVPHGTRLYSIASTRYGDNFDGKTASLCVRRATYWDEE  100



>gb|AAV65380.1| plastid ferredoxin-NADP reductase [Prototheca wickerhamii]
Length=136

 Score =   133 bits (335),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 64/101 (63%), Positives = 76/101 (75%), Gaps = 2/101 (2%)
 Frame = +3

Query  303  PLNLYKPKGPYTATIASVERIVGPKAPGETCHIVIDHGGNVPYWEGQSYGVIPPGE--NP  476
            PLN +  + P+TA I SV+RIVGPKA GET H+V++  G +P+ EGQSYGVIPPG   N 
Sbjct  10   PLNTFNNRKPFTARIVSVDRIVGPKATGETYHVVLETRGEIPFAEGQSYGVIPPGSKVNS  69

Query  477  KKPGSPHNVRLYSIASSRYGDSFDGKTTSLCVRRAVYYDPE  599
            K    PH  RLYSIAS+RYGD FDG+T SLCVRRA Y+DPE
Sbjct  70   KGKEVPHGTRLYSIASTRYGDFFDGRTASLCVRRATYWDPE  110



>gb|ABA55546.1| chloroplast ferredoxin-dependent NADP oxireductase [Karlodinium 
veneficum]
Length=382

 Score =   139 bits (351),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 68/104 (65%), Positives = 79/104 (76%), Gaps = 1/104 (1%)
 Frame = +3

Query  288  DAKEPPLNLYKPKGPYTATIASVERIVGPKAPGETCHIVIDHGGNVPYWEGQSYGVIPPG  467
            D    P N Y+PK P+ A I SV+RIVGPKA GETC +VI+HGG++PY EGQSYGVIPPG
Sbjct  85   DKSTMPDNTYRPKSPFEAKIVSVKRIVGPKATGETCDVVINHGGDMPYIEGQSYGVIPPG  144

Query  468  ENPKKPGSPHNVRLYSIASSRYGDSFDGKTTSLCVRRAVYYDPE  599
             NPK  G P+ V+  SIASSRYGD   GKTT+LCVRRA Y+ PE
Sbjct  145  VNPKN-GKPNKVQFGSIASSRYGDDMTGKTTTLCVRRATYWCPE  187



>sp|P53991.1|FENR_CHLRE RecName: Full=Ferredoxin--NADP reductase, chloroplastic; Short=FNR; 
Flags: Precursor [Chlamydomonas reinhardtii]
 gb|AAA79131.1| ferredoxin-NADP+ reductase [Chlamydomonas reinhardtii]
Length=354

 Score =   138 bits (348),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 71/118 (60%), Positives = 82/118 (69%), Gaps = 3/118 (3%)
 Frame = +3

Query  249  NIPKVTVSPLSLEDAKEPPLNLYKPKGPYTATIASVERIVGPKAPGETCHIVIDHGGNVP  428
            ++ K TV P  LE+  E PLN Y  K P+ A + SVE+I GPKA GETCHI+I+  G +P
Sbjct  46   DMSKRTV-PTKLEEG-EMPLNTYSNKAPFKAKVRSVEKITGPKATGETCHIIIETEGKIP  103

Query  429  YWEGQSYGVIPPGENPKKPGSPH-NVRLYSIASSRYGDSFDGKTTSLCVRRAVYYDPE  599
            +WEGQSYGVIPPG      G      RLYSIASSRYGD  DG+T SLCVRRAVY DPE
Sbjct  104  FWEGQSYGVIPPGTKINSKGKEVPTARLYSIASSRYGDDGDGQTASLCVRRAVYVDPE  161



>gb|EJK72001.1| hypothetical protein THAOC_06509 [Thalassiosira oceanica]
Length=340

 Score =   137 bits (345),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 65/98 (66%), Positives = 75/98 (77%), Gaps = 1/98 (1%)
 Frame = +3

Query  306  LNLYKPKGPYTATIASVERIVGPKAPGETCHIVIDHGGNVPYWEGQSYGVIPPGENPKKP  485
            +N +K K P+T  + S +RIVGPKA GETCHI+IDH G+ PY EGQS+GVIPPG   +K 
Sbjct  49   VNTHKNKAPFTGKVVSTKRIVGPKATGETCHIIIDHEGDFPYIEGQSWGVIPPGTR-EKD  107

Query  486  GSPHNVRLYSIASSRYGDSFDGKTTSLCVRRAVYYDPE  599
            G PH VRLYSIASSRYGD   GKT SLCVRRA Y+ PE
Sbjct  108  GKPHAVRLYSIASSRYGDDMTGKTGSLCVRRATYWCPE  145



>gb|AAW79315.1| chloroplast ferredoxin NADP(+) reductase, partial [Isochrysis 
galbana]
 gb|ABA55514.1| chloroplast ferredoxin dependent NADH oxireductase, partial [Isochrysis 
galbana]
Length=367

 Score =   137 bits (346),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 69/104 (66%), Positives = 78/104 (75%), Gaps = 1/104 (1%)
 Frame = +3

Query  288  DAKEPPLNLYKPKGPYTATIASVERIVGPKAPGETCHIVIDHGGNVPYWEGQSYGVIPPG  467
            D    P+N YK K P+T  I SV+RIVG  A GETC IV+ HGG +PYWEGQSYGVIPPG
Sbjct  70   DQSNIPINTYKNKAPFTGKIISVKRIVGAAATGETCDIVMSHGGKMPYWEGQSYGVIPPG  129

Query  468  ENPKKPGSPHNVRLYSIASSRYGDSFDGKTTSLCVRRAVYYDPE  599
             NPK  G P++VRLYSIASSRYGD   G TT+LCVRRA Y+ PE
Sbjct  130  TNPKN-GKPNSVRLYSIASSRYGDDMTGTTTTLCVRRATYWCPE  172



>ref|XP_005770769.1| hypothetical protein EMIHUDRAFT_432385 [Emiliania huxleyi CCMP1516]
 gb|EOD18340.1| hypothetical protein EMIHUDRAFT_432385 [Emiliania huxleyi CCMP1516]
Length=352

 Score =   136 bits (343),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 69/104 (66%), Positives = 78/104 (75%), Gaps = 1/104 (1%)
 Frame = +3

Query  288  DAKEPPLNLYKPKGPYTATIASVERIVGPKAPGETCHIVIDHGGNVPYWEGQSYGVIPPG  467
            D    P+N YK K P+T  I S +RIVGP+A GETC IVI H G +PYWEGQSYGVIPPG
Sbjct  52   DQSTIPVNTYKNKAPFTGKIVSTKRIVGPEATGETCDIVIGHEGKMPYWEGQSYGVIPPG  111

Query  468  ENPKKPGSPHNVRLYSIASSRYGDSFDGKTTSLCVRRAVYYDPE  599
             NPK  G P++VRLYSIASSRYGD   G TT+LCVRRA Y+ PE
Sbjct  112  TNPKN-GKPNSVRLYSIASSRYGDDMTGTTTTLCVRRATYWCPE  154



>ref|XP_005790923.1| hypothetical protein EMIHUDRAFT_361737 [Emiliania huxleyi CCMP1516]
 gb|EOD38494.1| hypothetical protein EMIHUDRAFT_361737 [Emiliania huxleyi CCMP1516]
Length=382

 Score =   137 bits (344),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 67/104 (64%), Positives = 78/104 (75%), Gaps = 1/104 (1%)
 Frame = +3

Query  288  DAKEPPLNLYKPKGPYTATIASVERIVGPKAPGETCHIVIDHGGNVPYWEGQSYGVIPPG  467
            D    P+N YK K P+   I S +RIVGP+A GETC +V+ HGG +PYWEGQSYGVIPPG
Sbjct  82   DQSTIPVNTYKNKAPFVGKIVSTKRIVGPEATGETCDVVMSHGGKMPYWEGQSYGVIPPG  141

Query  468  ENPKKPGSPHNVRLYSIASSRYGDSFDGKTTSLCVRRAVYYDPE  599
             NPK  G P++VRLYSIASSRYGD   G TT+LCVRRA Y+ PE
Sbjct  142  TNPKN-GKPNSVRLYSIASSRYGDDMTGTTTTLCVRRATYWCPE  184



>gb|ABD51927.1| chloroplast ferredoxin NADP oxidoreductase [Guillardia theta]
Length=366

 Score =   136 bits (343),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 64/98 (65%), Positives = 77/98 (79%), Gaps = 1/98 (1%)
 Frame = +3

Query  306  LNLYKPKGPYTATIASVERIVGPKAPGETCHIVIDHGGNVPYWEGQSYGVIPPGENPKKP  485
            +N+ K K P    I SV+RIVGP +PGETC+I+IDH G +PYWEGQSYGV+PPG +PKK 
Sbjct  74   VNIAKQKNPLIGKIISVQRIVGPNSPGETCNIIIDHQGKLPYWEGQSYGVVPPGIDPKK-  132

Query  486  GSPHNVRLYSIASSRYGDSFDGKTTSLCVRRAVYYDPE  599
              P+ VRLYSIAS+RYGD   GKTT+LCVRRA Y+ PE
Sbjct  133  NKPYGVRLYSIASTRYGDDKTGKTTTLCVRRATYWCPE  170



>emb|CBN78345.1| ferredoxin-NADP oxidoreductase [Ectocarpus siliculosus]
Length=414

 Score =   136 bits (342),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 67/104 (64%), Positives = 76/104 (73%), Gaps = 1/104 (1%)
 Frame = +3

Query  288  DAKEPPLNLYKPKGPYTATIASVERIVGPKAPGETCHIVIDHGGNVPYWEGQSYGVIPPG  467
            D    P+N YK K P    + SV+RIVGP+A GETC +VI HGG +PYWEGQSYGVIPPG
Sbjct  88   DQSNVPVNTYKAKDPMIGKVVSVKRIVGPEATGETCDVVISHGGKMPYWEGQSYGVIPPG  147

Query  468  ENPKKPGSPHNVRLYSIASSRYGDSFDGKTTSLCVRRAVYYDPE  599
             N  K G P+ VRLYSIASSRYGD   G TT+LCVRRA Y+D E
Sbjct  148  NN-WKTGKPNGVRLYSIASSRYGDDMTGTTTTLCVRRATYWDEE  190



>emb|CBJ31206.1| hypothetical protein Esi_0238_0041 [Ectocarpus siliculosus]
Length=398

 Score =   133 bits (335),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 62/104 (60%), Positives = 74/104 (71%), Gaps = 2/104 (2%)
 Frame = +3

Query  288  DAKEPPLNLYKPKGPYTATIASVERIVGPKAPGETCHIVIDHGGNVPYWEGQSYGVIPPG  467
            D  E P++ +K K PYT TI +VE++V P A GE  H+ + H GN+PYWEGQS GV PPG
Sbjct  105  DMSELPMHTFKAKAPYTGTIETVEKLVQPGASGEVFHVKLRHEGNMPYWEGQSLGVTPPG  164

Query  468  ENPKKPGSPHNVRLYSIASSRYGDSFDGKTTSLCVRRAVYYDPE  599
             + K  G PH VRLYSIAS+RYGD  DG+T SLCVRRA   DPE
Sbjct  165  LDAK--GKPHKVRLYSIASTRYGDDGDGRTVSLCVRRATVIDPE  206



>gb|ADM64306.2| ferredoxin-NADP+ reductase [Pyropia yezoensis]
Length=297

 Score =   127 bits (320),  Expect = 8e-32, Method: Compositional matrix adjust.
 Identities = 62/99 (63%), Positives = 72/99 (73%), Gaps = 2/99 (2%)
 Frame = +3

Query  303  PLNLYKPKGPYTATIASVERIVGPKAPGETCHIVIDHGGNVPYWEGQSYGVIPPGENPKK  482
            PLNL++PK PY AT+    RIVG  APGET H++ +H GNVPY EGQS GVI PG + K 
Sbjct  10   PLNLFRPKAPYEATVLYNARIVGKDAPGETMHMIFNHDGNVPYMEGQSIGVIAPGVDAK-  68

Query  483  PGSPHNVRLYSIASSRYGDSFDGKTTSLCVRRAVYYDPE  599
             G PH VRLYSIAS+RYGD  DGKT SL V+R VY D +
Sbjct  69   -GKPHKVRLYSIASTRYGDFGDGKTVSLSVKRLVYEDAD  106



>gb|ACJ84937.1| unknown [Medicago truncatula]
Length=122

 Score =   122 bits (307),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 62/106 (58%), Positives = 80/106 (75%), Gaps = 1/106 (1%)
 Frame = +3

Query  72   QVSVAVALNGDSSLQRSAFKANSITFNNRSPISFQPFDLKTRN-GKSRSQYVVCMSVQQA  248
            Q++V V ++ D S +RS FKA++I F ++S       D+K +N G  R+Q V+CMSVQQA
Sbjct  8    QMAVTVPVSNDFSARRSVFKASNINFRDKSWAPVFALDMKAKNCGWRRNQNVICMSVQQA  67

Query  249  NIPKVTVSPLSLEDAKEPPLNLYKPKGPYTATIASVERIVGPKAPG  386
            ++PKV VSPL LE+  EPPLNL+KPK PYTATI SVER+VGPKAPG
Sbjct  68   SVPKVAVSPLELENPAEPPLNLHKPKEPYTATIVSVERLVGPKAPG  113



>gb|ABF73016.1| plastid ferredoxin NADPH reductase protein precursor [Karenia 
brevis]
Length=398

 Score =   128 bits (321),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 70/104 (67%), Positives = 78/104 (75%), Gaps = 1/104 (1%)
 Frame = +3

Query  288  DAKEPPLNLYKPKGPYTATIASVERIVGPKAPGETCHIVIDHGGNVPYWEGQSYGVIPPG  467
            D    P N +KPK P+   I SVERIVGPKA GETC++VIDH G +PY EGQSYGVIPPG
Sbjct  101  DRSTMPDNTFKPKSPFEGKIISVERIVGPKATGETCNVVIDHFGKMPYIEGQSYGVIPPG  160

Query  468  ENPKKPGSPHNVRLYSIASSRYGDSFDGKTTSLCVRRAVYYDPE  599
             NPK  G P+ VRLYSIASSRYGD   G TT+LCVRRA Y+ PE
Sbjct  161  LNPKN-GKPNKVRLYSIASSRYGDDTKGTTTTLCVRRATYWCPE  203



>ref|XP_010103488.1| Ferredoxin--NADP reductase, embryo isozyme [Morus notabilis]
 gb|EXC46730.1| Ferredoxin--NADP reductase, embryo isozyme [Morus notabilis]
Length=295

 Score =   126 bits (317),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 59/110 (54%), Positives = 78/110 (71%), Gaps = 1/110 (1%)
 Frame = +3

Query  249  NIPKVTVSPLSLEDAKEPPLNLYKPKGPYTATIASVERIVGPKAPGETCHIVIDHGGNVP  428
             + +V V+PL LED + PP NLY  + P+TATI SVE+I GP+A  ET +IV DHGG +P
Sbjct  3    QVRRVPVAPLKLEDDRRPPTNLYTAEAPHTATILSVEKISGPEAANETYNIVFDHGGLLP  62

Query  429  YWEGQSYGVIP-PGENPKKPGSPHNVRLYSIASSRYGDSFDGKTTSLCVR  575
            +WEGQ +G +P P ENP +PG    +  +S ASSRYGD F+ +T +LCVR
Sbjct  63   HWEGQVFGALPAPSENPFEPGDATKLSYFSGASSRYGDYFNDRTATLCVR  112



>gb|KDD75893.1| hypothetical protein H632_c449p0, partial [Helicosporidium sp. 
ATCC 50920]
Length=327

 Score =   126 bits (316),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 56/101 (55%), Positives = 74/101 (73%), Gaps = 2/101 (2%)
 Frame = +3

Query  303  PLNLYKPKGPYTATIASVERIVGPKAPGETCHIVIDHGGNVPYWEGQSYGVIPPGE--NP  476
            P+N Y  K P+ A + SV+++VGP+A GET H+VI+  G +P+ EGQSYGV+PPG   N 
Sbjct  33   PMNTYSMKKPFKARVMSVDKLVGPRATGETYHVVIETRGEIPFAEGQSYGVVPPGSRLNS  92

Query  477  KKPGSPHNVRLYSIASSRYGDSFDGKTTSLCVRRAVYYDPE  599
            +    PH  RLYSIAS+RYGD FDG+T S C+RRA ++DPE
Sbjct  93   RGKTVPHATRLYSIASTRYGDRFDGRTASFCIRRATFWDPE  133



>ref|XP_005719376.1| Ferredoxin-NADP+ oxidoreductase [Chondrus crispus]
 emb|CDF39465.1| Ferredoxin-NADP+ oxidoreductase [Chondrus crispus]
Length=340

 Score =   123 bits (309),  Expect = 5e-30, Method: Compositional matrix adjust.
 Identities = 59/104 (57%), Positives = 74/104 (71%), Gaps = 2/104 (2%)
 Frame = +3

Query  288  DAKEPPLNLYKPKGPYTATIASVERIVGPKAPGETCHIVIDHGGNVPYWEGQSYGVIPPG  467
            D  + PLN+Y+PK PYTA +   ERIVG  APGET H++ +H GNVPY EGQS G++ PG
Sbjct  49   DKSKIPLNVYRPKNPYTAKVLYNERIVGEDAPGETMHMIFNHDGNVPYLEGQSIGIVAPG  108

Query  468  ENPKKPGSPHNVRLYSIASSRYGDSFDGKTTSLCVRRAVYYDPE  599
             +  K G PH  RLYSIAS+++GD  DGKT SL V+R VY D +
Sbjct  109  TD--KKGRPHKPRLYSIASTQHGDFGDGKTVSLSVKRLVYQDAD  150



>ref|XP_009034033.1| hypothetical protein AURANDRAFT_52453 [Aureococcus anophagefferens]
 gb|EGB11690.1| hypothetical protein AURANDRAFT_52453 [Aureococcus anophagefferens]
Length=418

 Score =   122 bits (307),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 62/117 (53%), Positives = 75/117 (64%), Gaps = 4/117 (3%)
 Frame = +3

Query  252  IPKVTVSP-LSLEDAKEPPLNLYKPKGPYTATIASVERIVGPKAPGETCHIVIDHGGNVP  428
            +P    +P L   +  E P   +KP  PY + I SV+R +GP APGE CH+V+   G +P
Sbjct  111  LPDAPAAPTLDFLEYAEIPKTAFKPTAPYKSAIRSVKRAIGPDAPGEICHVVMTTEGKLP  170

Query  429  YWEGQSYGVIPPGENPKKPGSPHNVRLYSIASSRYGDSFDGKTTSLCVRRAVYYDPE  599
            Y EGQS GV+PPG    K G PH  RLYSIAS+RYGD   G + SLCVRRAVY DPE
Sbjct  171  YVEGQSVGVVPPG---NKGGKPHQQRLYSIASTRYGDDGAGDSVSLCVRRAVYVDPE  224



>ref|XP_005789289.1| hypothetical protein EMIHUDRAFT_42969, partial [Emiliania huxleyi 
CCMP1516]
 gb|EOD36860.1| hypothetical protein EMIHUDRAFT_42969, partial [Emiliania huxleyi 
CCMP1516]
Length=320

 Score =   119 bits (299),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 60/103 (58%), Positives = 67/103 (65%), Gaps = 8/103 (8%)
 Frame = +3

Query  291  AKEPPLNLYKPKGPYTATIASVERIVGPKAPGETCHIVIDHGGNVPYWEGQSYGVIPPGE  470
            A   PLN YK K P    I S +RIVGP APGE CHI I  G N  YWEGQS GVIPPG 
Sbjct  10   AANLPLNTYKNKAPLAGAIISAKRIVGPAAPGEVCHIRIGTGDNFRYWEGQSLGVIPPG-  68

Query  471  NPKKPGSPHNVRLYSIASSRYGDSFDGKTTSLCVRRAVYYDPE  599
                   P+ VRLYSIAS+RYGD   G + SLCVRRA+Y+D +
Sbjct  69   -------PNAVRLYSIASTRYGDDAKGSSVSLCVRRALYWDAD  104



>sp|Q00598.1|FENR_CYAPA RecName: Full=Ferredoxin--NADP reductase, cyanelle; Short=FNR; 
Flags: Precursor [Cyanophora paradoxa]
 emb|CAA47015.1| ferredoxin--NADP(+) reductase [Cyanophora paradoxa]
Length=363

 Score =   114 bits (284),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 59/105 (56%), Positives = 69/105 (66%), Gaps = 5/105 (5%)
 Frame = +3

Query  288  DAKEP---PLNLYKPKGPYTATIASVERIVGPKAPGETCHIVIDHGGNVPYWEGQSYGVI  458
            DAK+    PLNL++P  PY       ERIVG  APGET HI+  H G VPY EGQS G+I
Sbjct  69   DAKKKGDIPLNLFRPANPYIGKCIYNERIVGEGAPGETKHIIFTHEGKVPYLEGQSIGII  128

Query  459  PPGENPKKPGSPHNVRLYSIASSRYGDSFDGKTTSLCVRRAVYYD  593
            PPG +  K G PH +RLYSIAS+R+GD  D KT SL V+R  Y D
Sbjct  129  PPGTD--KDGKPHKLRLYSIASTRHGDFGDDKTVSLSVKRLEYTD  171



>ref|XP_005706517.1| ferredoxin--NADP+ reductase [Galdieria sulphuraria]
 gb|EME29997.1| ferredoxin--NADP+ reductase [Galdieria sulphuraria]
Length=354

 Score =   114 bits (284),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 57/101 (56%), Positives = 69/101 (68%), Gaps = 2/101 (2%)
 Frame = +3

Query  294  KEPPLNLYKPKGPYTATIASVERIVGPKAPGETCHIVIDHGGNVPYWEGQSYGVIPPGEN  473
            +E PLN+++P  P+ AT  S E IV   APGET H+V +  G + Y EGQS GVIPPG +
Sbjct  64   REVPLNIFRPNKPFEATCLSNELIVDKDAPGETWHMVFNTDGALRYIEGQSIGVIPPGSD  123

Query  474  PKKPGSPHNVRLYSIASSRYGDSFDGKTTSLCVRRAVYYDP  596
             K  G PH VRLYSIAS+ +GD  D KT SLCV+R VY DP
Sbjct  124  DK--GKPHKVRLYSIASTSHGDHKDDKTLSLCVKRLVYTDP  162



>ref|XP_005538366.1| ferredoxin-NADP+ reductase [Cyanidioschyzon merolae strain 10D]
 dbj|BAM82330.1| ferredoxin-NADP+ reductase [Cyanidioschyzon merolae strain 10D]
Length=342

 Score =   108 bits (270),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 53/98 (54%), Positives = 66/98 (67%), Gaps = 2/98 (2%)
 Frame = +3

Query  294  KEPPLNLYKPKGPYTATIASVERIVGPKAPGETCHIVIDHGGNVPYWEGQSYGVIPPGEN  473
            K+ P+NLYKP  P   T    ++IVG  APG+TCH++I H G +PY EGQS G+IP G +
Sbjct  53   KKVPVNLYKPNDPLIGTCIYNKKIVGDDAPGDTCHVIIHHDGKLPYLEGQSVGIIPEGTD  112

Query  474  PKKPGSPHNVRLYSIASSRYGDSFDGKTTSLCVRRAVY  587
             K  G PH +RLYSIAS+  GD  D KT SL V+R VY
Sbjct  113  EK--GRPHKLRLYSIASTAAGDFGDYKTLSLVVKRLVY  148



>ref|WP_036946982.1| ferredoxin-NADP reductase, partial [Pseudanabaena sp. PCC 6802]
Length=299

 Score =   107 bits (266),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 54/106 (51%), Positives = 71/106 (67%), Gaps = 3/106 (3%)
 Frame = +3

Query  285  EDAKEPPLNLYKPKGPYTATIASVERIVGPKAPGETCHIVID-HGGNVPYWEGQSYGVIP  461
            ++ K+ P+N+Y+P  P+     S E ++ P APG+T H+  D  GG++ Y EGQS GVIP
Sbjct  5    KEKKDIPVNIYRPNSPFVGKCISNESLLRPGAPGDTRHVKFDISGGDLRYLEGQSIGVIP  64

Query  462  PGENPKKPGSPHNVRLYSIASSRYGDSFDGKTTSLCVRRAVYYDPE  599
            PGE+  K G PH +RLYSIAS+R+GD  D KT SL VRR  Y  PE
Sbjct  65   PGED--KNGKPHKIRLYSIASTRHGDDIDDKTVSLSVRRLEYKHPE  108



>dbj|BAF42337.1| ferredoxin-NADP+ oxidoreductase [Cyanidium caldarium]
Length=342

 Score =   107 bits (266),  Expect = 5e-24, Method: Compositional matrix adjust.
 Identities = 52/98 (53%), Positives = 66/98 (67%), Gaps = 2/98 (2%)
 Frame = +3

Query  294  KEPPLNLYKPKGPYTATIASVERIVGPKAPGETCHIVIDHGGNVPYWEGQSYGVIPPGEN  473
            K+ P+NL+KP  P   T    ++IVG  APG+TCH++I H G +PY EGQS G+IP G +
Sbjct  53   KKVPVNLFKPSSPLVGTCIYNKKIVGDDAPGDTCHVIIHHDGKLPYLEGQSVGIIPEGTD  112

Query  474  PKKPGSPHNVRLYSIASSRYGDSFDGKTTSLCVRRAVY  587
             K  G PH +RLYSIAS+  GD  D KT SL V+R VY
Sbjct  113  DK--GRPHKLRLYSIASTAAGDFGDYKTLSLVVKRLVY  148



>ref|WP_036477079.1| ferredoxin-NADP reductase [Myxosarcina sp. GI1]
Length=401

 Score =   107 bits (266),  Expect = 6e-24, Method: Compositional matrix adjust.
 Identities = 58/139 (42%), Positives = 79/139 (57%), Gaps = 3/139 (2%)
 Frame = +3

Query  186  LKTRNGKSRSQYVVCMSVQQANIPKVTVSPLSLEDAKEPPLNLYKPKGPYTATIASVERI  365
            +K  NG+S  +     S QQ N         + E+ K+ P+N+Y P+ PY      +  +
Sbjct  72   IKPLNGESAKEANKTGSKQQTNSNNGKSMTQAKEEKKKVPVNIYSPRDPYMGKCVEIYDL  131

Query  366  VGPKAPGETCHIVID-HGGNVPYWEGQSYGVIPPGENPKKPGSPHNVRLYSIASSRYGDS  542
            V     G  CH+  D   G++ Y EGQS G+IPPG+N K  G PH +RLYSIAS+R+GD+
Sbjct  132  VDEGGIGTCCHMTFDISEGDLYYLEGQSIGIIPPGKNEK--GKPHKLRLYSIASTRHGDN  189

Query  543  FDGKTTSLCVRRAVYYDPE  599
             D KT SLCVR+  Y  PE
Sbjct  190  LDDKTVSLCVRKLEYDHPE  208



>ref|XP_010268658.1| PREDICTED: ferredoxin--NADP reductase, leaf isozyme, chloroplastic 
[Nelumbo nucifera]
Length=365

 Score =   106 bits (265),  Expect = 8e-24, Method: Compositional matrix adjust.
 Identities = 64/145 (44%), Positives = 80/145 (55%), Gaps = 3/145 (2%)
 Frame = +3

Query  165  ISFQPFDLKTRNGKSRSQYVVCMSVQQANIPKVTVSPLSLEDAKEPPLNLYKPKGPYTAT  344
            I F    L  RN   R + VV +  Q        V  +S ++ ++  +N +KPK PYT  
Sbjct  34   IGFSKTCLYYRNVSIRGR-VVSIRAQVTTEAPAKVEKISKKNEEDVVVNKFKPKNPYTGR  92

Query  345  IASVERIVGPKAPGETCHIVIDHGGNVPYWEGQSYGVIPPGENPKKPGSPHNVRLYSIAS  524
                 +I G  APGET H+V    G VPY EGQS GVIP G +  K G PH +RLYSIAS
Sbjct  93   CLLNTKITGDDAPGETWHMVFSTEGEVPYREGQSIGVIPDGVD--KNGKPHKLRLYSIAS  150

Query  525  SRYGDSFDGKTTSLCVRRAVYYDPE  599
            S  GD  D KT SLCV+R VY + +
Sbjct  151  SALGDFGDSKTVSLCVKRLVYTNEQ  175



>ref|XP_006393807.1| hypothetical protein EUTSA_v10004465mg [Eutrema salsugineum]
 ref|XP_006393808.1| hypothetical protein EUTSA_v10004465mg [Eutrema salsugineum]
 ref|XP_006393809.1| hypothetical protein EUTSA_v10004465mg [Eutrema salsugineum]
 gb|ESQ31093.1| hypothetical protein EUTSA_v10004465mg [Eutrema salsugineum]
 gb|ESQ31094.1| hypothetical protein EUTSA_v10004465mg [Eutrema salsugineum]
 gb|ESQ31095.1| hypothetical protein EUTSA_v10004465mg [Eutrema salsugineum]
Length=362

 Score =   106 bits (265),  Expect = 8e-24, Method: Compositional matrix adjust.
 Identities = 66/157 (42%), Positives = 84/157 (54%), Gaps = 10/157 (6%)
 Frame = +3

Query  117  RSAFKANSITFNNRSPISFQPFDLKTRNGKSRSQYVVCMSVQQANIPKVTVSPLSLEDAK  296
            +++F ++   F N+S + ++   +  R        VV +  Q      V V   S +  +
Sbjct  22   KTSFVSHQRIFLNKSTLCYRDACIGGR--------VVSVKAQVTTEAPVKVEKESKKQEE  73

Query  297  EPPLNLYKPKGPYTATIASVERIVGPKAPGETCHIVIDHGGNVPYWEGQSYGVIPPGENP  476
               +N +KPK PYT       RI G  APGET HIV    G VPY EGQS GVIP G + 
Sbjct  74   GIVVNKFKPKNPYTGRCLLNTRITGDDAPGETWHIVFSTDGEVPYREGQSIGVIPEGID-  132

Query  477  KKPGSPHNVRLYSIASSRYGDSFDGKTTSLCVRRAVY  587
             K G PH +RLYSIASS  GD  D KT SLCV+R VY
Sbjct  133  -KNGKPHKLRLYSIASSAIGDFGDSKTVSLCVKRLVY  168



>ref|XP_004287805.1| PREDICTED: ferredoxin--NADP reductase, leaf isozyme, chloroplastic 
[Fragaria vesca subsp. vesca]
Length=363

 Score =   106 bits (265),  Expect = 9e-24, Method: Compositional matrix adjust.
 Identities = 54/94 (57%), Positives = 62/94 (66%), Gaps = 1/94 (1%)
 Frame = +3

Query  306  LNLYKPKGPYTATIASVERIVGPKAPGETCHIVIDHGGNVPYWEGQSYGVIPPGENPKKP  485
            +N YKPK PYT  +    +I G  APGET H+V    G +PY EGQS GVIP G +PK  
Sbjct  77   VNKYKPKNPYTGRVLLNTKITGDDAPGETWHMVFSTDGEMPYREGQSIGVIPDGIDPKN-  135

Query  486  GSPHNVRLYSIASSRYGDSFDGKTTSLCVRRAVY  587
            G PH +RLYSIASS  GD  D KT SLCV+R VY
Sbjct  136  GKPHKLRLYSIASSALGDFGDSKTVSLCVKRLVY  169



>ref|XP_009382075.1| PREDICTED: ferredoxin--NADP reductase, leaf isozyme, chloroplastic-like 
isoform X1 [Musa acuminata subsp. malaccensis]
Length=369

 Score =   106 bits (264),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 63/155 (41%), Positives = 84/155 (54%), Gaps = 10/155 (6%)
 Frame = +3

Query  159  SPISFQPFDLKTRNGKSRSQYV--------VCMSVQQANIPKVTVSPLSLEDAKEPPLNL  314
            SP+S +    + +  + +S+ V        V +  Q        V+ +S +D +    N 
Sbjct  27   SPVSLERISFQKQAARLQSRKVPAADARKLVSVRAQVTTEAPAKVAKVSKKDDEGVVTNK  86

Query  315  YKPKGPYTATIASVERIVGPKAPGETCHIVIDHGGNVPYWEGQSYGVIPPGENPKKPGSP  494
            +KPK PYT T     +I G  APGET H+V    G +PY EGQS GVIP G +  K G P
Sbjct  87   FKPKDPYTGTCLLNTKITGDDAPGETWHMVFSTEGEIPYREGQSIGVIPDGVD--KNGKP  144

Query  495  HNVRLYSIASSRYGDSFDGKTTSLCVRRAVYYDPE  599
            H +RLYSIASS  GD  D KT SLCV+R VY + +
Sbjct  145  HKLRLYSIASSALGDFGDSKTVSLCVKRLVYTNEQ  179



>gb|ACU19326.1| unknown [Glycine max]
Length=234

 Score =   103 bits (258),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 71/175 (41%), Positives = 91/175 (52%), Gaps = 5/175 (3%)
 Frame = +3

Query  69   MQVSVAVALNGDSSLQRSAFKANSITFNNRSPISFQPFDLKTRNGKSRSQYVVCMSVQQA  248
            M  +V  A++  ++   S     SIT  +R  I F+   L+ R+  S S  VV +  Q  
Sbjct  1    MATAVTAAVSFPATKSTSLSSRTSITAPDR--IVFKKVSLQYRD-VSTSGRVVSIRAQVT  57

Query  249  NIPKVTVSPLSLEDAKEPPLNLYKPKGPYTATIASVERIVGPKAPGETCHIVIDHGGNVP  428
                  V   S +  +   +N +KPK PY        +I G  APGET H+V    G VP
Sbjct  58   TEAPAKVEKESKKQEEGVIVNKFKPKNPYIGRCLLNTKITGDDAPGETWHMVFSTEGEVP  117

Query  429  YWEGQSYGVIPPGENPKKPGSPHNVRLYSIASSRYGDSFDGKTTSLCVRRAVYYD  593
            Y EGQS GVIP G +  K G PH +RLYSIASS  GD  D KT SLCV+R VY +
Sbjct  118  YREGQSIGVIPDGVD--KNGKPHKLRLYSIASSALGDFGDSKTVSLCVKRLVYTN  170



>ref|XP_006383096.1| Chain A family protein [Populus trichocarpa]
 gb|ABK96401.1| unknown [Populus trichocarpa x Populus deltoides]
 gb|ERP60893.1| Chain A family protein [Populus trichocarpa]
Length=363

 Score =   105 bits (262),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 61/127 (48%), Positives = 73/127 (57%), Gaps = 2/127 (2%)
 Frame = +3

Query  207  SRSQYVVCMSVQQANIPKVTVSPLSLEDAKEPPLNLYKPKGPYTATIASVERIVGPKAPG  386
            S S  V+ +  Q      V V  +S +D +   +N +KPK PYT       +I G  APG
Sbjct  45   SASGRVISIRAQVTTEAPVKVEKVSKKDDEGVVVNKFKPKNPYTGRCLLNTKITGDDAPG  104

Query  387  ETCHIVIDHGGNVPYWEGQSYGVIPPGENPKKPGSPHNVRLYSIASSRYGDSFDGKTTSL  566
            ET H+V    G VPY EGQS GVIP G +  K G PH +RLYSIASS  GD  D KT SL
Sbjct  105  ETWHMVFSTEGEVPYREGQSIGVIPDGID--KNGKPHKLRLYSIASSAIGDFGDSKTVSL  162

Query  567  CVRRAVY  587
            CV+R VY
Sbjct  163  CVKRLVY  169



>ref|XP_008394226.1| PREDICTED: ferredoxin--NADP reductase, leaf isozyme, chloroplastic 
[Malus domestica]
Length=363

 Score =   105 bits (262),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 55/94 (59%), Positives = 61/94 (65%), Gaps = 2/94 (2%)
 Frame = +3

Query  306  LNLYKPKGPYTATIASVERIVGPKAPGETCHIVIDHGGNVPYWEGQSYGVIPPGENPKKP  485
            +N YKPK PY A +    RI G  APGET H+V    G VPY EGQS GVIP G +  K 
Sbjct  78   VNKYKPKNPYIARVLLNTRITGDDAPGETWHMVFSTEGEVPYREGQSIGVIPEGVD--KN  135

Query  486  GSPHNVRLYSIASSRYGDSFDGKTTSLCVRRAVY  587
            G PH +RLYSIASS  GD  D KT SLCV+R VY
Sbjct  136  GKPHKLRLYSIASSALGDFGDSKTVSLCVKRLVY  169



>ref|XP_008241828.1| PREDICTED: ferredoxin--NADP reductase, leaf isozyme, chloroplastic 
[Prunus mume]
Length=365

 Score =   105 bits (262),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 54/94 (57%), Positives = 62/94 (66%), Gaps = 2/94 (2%)
 Frame = +3

Query  306  LNLYKPKGPYTATIASVERIVGPKAPGETCHIVIDHGGNVPYWEGQSYGVIPPGENPKKP  485
            +N YKPK PYTA +    +I G  APGET H+V    G +PY EGQS GVIP G +  K 
Sbjct  80   VNKYKPKNPYTARVLLNTKITGDDAPGETWHMVFSTEGEIPYREGQSIGVIPDGID--KN  137

Query  486  GSPHNVRLYSIASSRYGDSFDGKTTSLCVRRAVY  587
            G PH +RLYSIASS  GD  D KT SLCV+R VY
Sbjct  138  GKPHKLRLYSIASSALGDFGDSKTVSLCVKRLVY  171



>ref|XP_007202096.1| hypothetical protein PRUPE_ppa007547mg [Prunus persica]
 gb|EMJ03295.1| hypothetical protein PRUPE_ppa007547mg [Prunus persica]
Length=364

 Score =   105 bits (262),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 54/94 (57%), Positives = 62/94 (66%), Gaps = 2/94 (2%)
 Frame = +3

Query  306  LNLYKPKGPYTATIASVERIVGPKAPGETCHIVIDHGGNVPYWEGQSYGVIPPGENPKKP  485
            +N YKPK PYTA +    +I G  APGET H+V    G +PY EGQS GVIP G +  K 
Sbjct  79   VNKYKPKNPYTARVLLNTKITGDDAPGETWHMVFSTEGEIPYREGQSIGVIPDGID--KN  136

Query  486  GSPHNVRLYSIASSRYGDSFDGKTTSLCVRRAVY  587
            G PH +RLYSIASS  GD  D KT SLCV+R VY
Sbjct  137  GKPHKLRLYSIASSALGDFGDSKTVSLCVKRLVY  170



>gb|KDP36912.1| hypothetical protein JCGZ_08203 [Jatropha curcas]
Length=362

 Score =   105 bits (261),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 61/131 (47%), Positives = 75/131 (57%), Gaps = 6/131 (5%)
 Frame = +3

Query  207  SRSQYV----VCMSVQQANIPKVTVSPLSLEDAKEPPLNLYKPKGPYTATIASVERIVGP  374
            SR+ YV    V +  Q    P   V  +S ++ +   +N +KPK PYT T     +I   
Sbjct  40   SRNVYVGGRRVTIKAQVTTQPPAKVEKVSKKNEEGVVVNKFKPKNPYTGTCLLNTKITAD  99

Query  375  KAPGETCHIVIDHGGNVPYWEGQSYGVIPPGENPKKPGSPHNVRLYSIASSRYGDSFDGK  554
             APGET H+V    G VPY EGQS G+IP G +  K G PH +RLYSIASS  GD  D K
Sbjct  100  DAPGETWHMVFGTEGEVPYREGQSIGIIPDGID--KNGKPHKLRLYSIASSALGDLGDSK  157

Query  555  TTSLCVRRAVY  587
            T SLCV+R VY
Sbjct  158  TVSLCVKRLVY  168



>ref|WP_040688390.1| ferredoxin-NADP reductase, partial [Pseudanabaena biceps]
Length=298

 Score =   104 bits (259),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 54/106 (51%), Positives = 72/106 (68%), Gaps = 3/106 (3%)
 Frame = +3

Query  273  PLSLEDAKEPPLNLYKPKGPYTATIASVERIVGPKAPGETCHIVID-HGGNVPYWEGQSY  449
            P+S    K+ P+N+Y+P  P+TA   S + +V P A G+T H+ ID  GG++ Y EGQS 
Sbjct  1    PMSANSEKDIPVNIYRPANPFTAKCISNDVLVRPGAVGDTRHVKIDISGGDLRYLEGQSI  60

Query  450  GVIPPGENPKKPGSPHNVRLYSIASSRYGDSFDGKTTSLCVRRAVY  587
            GV+PPGE+  K G P+ +RLYSIAS+R GD  DGKT SL V+R  Y
Sbjct  61   GVVPPGED--KNGKPNKLRLYSIASTRLGDDLDGKTLSLSVKRLEY  104



>ref|XP_009382076.1| PREDICTED: ferredoxin--NADP reductase, leaf isozyme, chloroplastic-like 
isoform X2 [Musa acuminata subsp. malaccensis]
Length=368

 Score =   104 bits (260),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 56/111 (50%), Positives = 69/111 (62%), Gaps = 2/111 (2%)
 Frame = +3

Query  267  VSPLSLEDAKEPPLNLYKPKGPYTATIASVERIVGPKAPGETCHIVIDHGGNVPYWEGQS  446
            V+ +S +D +    N +KPK PYT T     +I G  APGET H+V    G +PY EGQS
Sbjct  70   VAKVSKKDDEGVVTNKFKPKDPYTGTCLLNTKITGDDAPGETWHMVFSTEGEIPYREGQS  129

Query  447  YGVIPPGENPKKPGSPHNVRLYSIASSRYGDSFDGKTTSLCVRRAVYYDPE  599
             GVIP G +  K G PH +RLYSIASS  GD  D KT SLCV+R VY + +
Sbjct  130  IGVIPDGVD--KNGKPHKLRLYSIASSALGDFGDSKTVSLCVKRLVYTNEQ  178



>ref|XP_010550469.1| PREDICTED: ferredoxin--NADP reductase, leaf isozyme 1, chloroplastic 
[Tarenaya hassleriana]
Length=365

 Score =   104 bits (259),  Expect = 5e-23, Method: Compositional matrix adjust.
 Identities = 60/124 (48%), Positives = 73/124 (59%), Gaps = 7/124 (6%)
 Frame = +3

Query  231  MSVQQANIPKVTVSPLSLEDAKEPP-----LNLYKPKGPYTATIASVERIVGPKAPGETC  395
            +SV+     +VT +P+ +E   +       +N +KPK PYT       R+ G  APGET 
Sbjct  50   VSVRAQVTTEVTEAPVKVEKESKKQEEGIVVNKFKPKNPYTGRCLLNVRLTGDDAPGETW  109

Query  396  HIVIDHGGNVPYWEGQSYGVIPPGENPKKPGSPHNVRLYSIASSRYGDSFDGKTTSLCVR  575
            HIV    G VPY EGQS GVIP G +  K G PH +RLYSIASS  GD  D KT SLCV+
Sbjct  110  HIVFSTEGEVPYREGQSIGVIPDGID--KNGKPHKLRLYSIASSAIGDFGDSKTVSLCVK  167

Query  576  RAVY  587
            R VY
Sbjct  168  RLVY  171



>ref|XP_010497428.1| PREDICTED: ferredoxin--NADP reductase, leaf isozyme 1, chloroplastic-like, 
partial [Camelina sativa]
Length=136

 Score =   100 bits (248),  Expect = 6e-23, Method: Compositional matrix adjust.
 Identities = 54/94 (57%), Positives = 60/94 (64%), Gaps = 2/94 (2%)
 Frame = +3

Query  306  LNLYKPKGPYTATIASVERIVGPKAPGETCHIVIDHGGNVPYWEGQSYGVIPPGENPKKP  485
            +N YKPK PYT       +I G  APGET HIV    G +PY EGQS GVIP G +  K 
Sbjct  6    VNKYKPKNPYTGRCLLNTKITGDDAPGETWHIVFTTEGEIPYREGQSIGVIPEGID--KN  63

Query  486  GSPHNVRLYSIASSRYGDSFDGKTTSLCVRRAVY  587
            G PH +RLYSIASS  GD  D KT SLCV+R VY
Sbjct  64   GKPHKLRLYSIASSAIGDFGDSKTVSLCVKRLVY  97



>ref|XP_009379399.1| PREDICTED: ferredoxin--NADP reductase, leaf isozyme, chloroplastic-like 
[Pyrus x bretschneideri]
Length=363

 Score =   103 bits (258),  Expect = 6e-23, Method: Compositional matrix adjust.
 Identities = 54/94 (57%), Positives = 61/94 (65%), Gaps = 2/94 (2%)
 Frame = +3

Query  306  LNLYKPKGPYTATIASVERIVGPKAPGETCHIVIDHGGNVPYWEGQSYGVIPPGENPKKP  485
            +N YKPK PY A +    +I G  APGET H+V    G VPY EGQS GVIP G +  K 
Sbjct  78   VNKYKPKNPYIARVLLNTKITGDDAPGETWHMVFSTEGEVPYREGQSIGVIPEGVD--KN  135

Query  486  GSPHNVRLYSIASSRYGDSFDGKTTSLCVRRAVY  587
            G PH +RLYSIASS  GD  D KT SLCV+R VY
Sbjct  136  GKPHKLRLYSIASSALGDFGDSKTVSLCVKRLVY  169



>gb|KFK28280.1| hypothetical protein AALP_AA8G495900 [Arabis alpina]
Length=361

 Score =   103 bits (258),  Expect = 6e-23, Method: Compositional matrix adjust.
 Identities = 57/109 (52%), Positives = 66/109 (61%), Gaps = 2/109 (2%)
 Frame = +3

Query  261  VTVSPLSLEDAKEPPLNLYKPKGPYTATIASVERIVGPKAPGETCHIVIDHGGNVPYWEG  440
            V V  +S +  +   +N +KPK PYT       RI G  APGET HIV    G VPY EG
Sbjct  61   VKVEKVSKKQEEGIVVNKFKPKNPYTGRCLLNTRITGDDAPGETWHIVFTTEGEVPYREG  120

Query  441  QSYGVIPPGENPKKPGSPHNVRLYSIASSRYGDSFDGKTTSLCVRRAVY  587
            QS G+IP G +  K G PH +RLYSIASS  GD  D KT SLCV+R VY
Sbjct  121  QSIGIIPDGID--KNGKPHKLRLYSIASSAIGDFGDSKTVSLCVKRLVY  167



>ref|XP_003537636.1| PREDICTED: ferredoxin--NADP reductase, leaf isozyme, chloroplastic 
isoform 1 [Glycine max]
 gb|KHN41893.1| Ferredoxin--NADP reductase, leaf isozyme, chloroplastic [Glycine 
soja]
Length=362

 Score =   103 bits (258),  Expect = 7e-23, Method: Compositional matrix adjust.
 Identities = 71/173 (41%), Positives = 90/173 (52%), Gaps = 5/173 (3%)
 Frame = +3

Query  69   MQVSVAVALNGDSSLQRSAFKANSITFNNRSPISFQPFDLKTRNGKSRSQYVVCMSVQQA  248
            M  +V  A++  ++   S     SIT  +R  I F+   L+ R+  S S  VV +  Q  
Sbjct  1    MATAVTAAVSFPATKSTSLSSRTSITAPDR--IVFKKVSLQYRD-VSTSGRVVSIRAQVT  57

Query  249  NIPKVTVSPLSLEDAKEPPLNLYKPKGPYTATIASVERIVGPKAPGETCHIVIDHGGNVP  428
                  V   S +  +   +N +KPK PY        +I G  APGET H+V    G VP
Sbjct  58   TEAPAKVEKESKKQEEGVIVNKFKPKNPYIGRCLLNTKITGDDAPGETWHMVFSTEGEVP  117

Query  429  YWEGQSYGVIPPGENPKKPGSPHNVRLYSIASSRYGDSFDGKTTSLCVRRAVY  587
            Y EGQS GVIP G +  K G PH +RLYSIASS  GD  D KT SLCV+R VY
Sbjct  118  YREGQSIGVIPDGVD--KNGKPHKLRLYSIASSALGDFGDSKTVSLCVKRLVY  168



>pdb|1BX1|A Chain A, Ferredoxin:nadp+ Oxidoreductase (Ferredoxin Reductase) 
Mutant E312q
Length=314

 Score =   103 bits (257),  Expect = 8e-23, Method: Compositional matrix adjust.
 Identities = 51/94 (54%), Positives = 61/94 (65%), Gaps = 2/94 (2%)
 Frame = +3

Query  306  LNLYKPKGPYTATIASVERIVGPKAPGETCHIVIDHGGNVPYWEGQSYGVIPPGENPKKP  485
            +N +KPK PY        +I G  APGET H+V  H G +PY EGQS GVIP GE+  K 
Sbjct  29   VNKFKPKTPYVGRCLLNTKITGDDAPGETWHMVFSHEGEIPYREGQSVGVIPDGED--KN  86

Query  486  GSPHNVRLYSIASSRYGDSFDGKTTSLCVRRAVY  587
            G PH +RLYSIASS  GD  D K+ SLCV+R +Y
Sbjct  87   GKPHKLRLYSIASSALGDFGDAKSVSLCVKRLIY  120



>sp|P00455.1|FENR_SPIOL RecName: Full=Ferredoxin--NADP reductase, chloroplastic; Short=FNR; 
Flags: Precursor [Spinacia oleracea]
 emb|CAA30791.1| unnamed protein product [Spinacia oleracea]
Length=369

 Score =   103 bits (258),  Expect = 8e-23, Method: Compositional matrix adjust.
 Identities = 51/94 (54%), Positives = 61/94 (65%), Gaps = 2/94 (2%)
 Frame = +3

Query  306  LNLYKPKGPYTATIASVERIVGPKAPGETCHIVIDHGGNVPYWEGQSYGVIPPGENPKKP  485
            +N +KPK PY        +I G  APGET H+V  H G +PY EGQS GVIP GE+  K 
Sbjct  84   VNKFKPKTPYVGRCLLNTKITGDDAPGETWHMVFSHEGEIPYREGQSVGVIPDGED--KN  141

Query  486  GSPHNVRLYSIASSRYGDSFDGKTTSLCVRRAVY  587
            G PH +RLYSIASS  GD  D K+ SLCV+R +Y
Sbjct  142  GKPHKLRLYSIASSALGDFGDAKSVSLCVKRLIY  175



>pdb|3VO2|A Chain A, Crystal Structure Of Zea Mays Leaf Ferredoxin-Nadp+ 
Reductase Iii
 pdb|3VO2|B Chain B, Crystal Structure Of Zea Mays Leaf Ferredoxin-Nadp+ 
Reductase Iii
Length=310

 Score =   103 bits (256),  Expect = 8e-23, Method: Compositional matrix adjust.
 Identities = 53/93 (57%), Positives = 59/93 (63%), Gaps = 2/93 (2%)
 Frame = +3

Query  309  NLYKPKGPYTATIASVERIVGPKAPGETCHIVIDHGGNVPYWEGQSYGVIPPGENPKKPG  488
            N YKPK PY     S  RI G  APGET H+V    G +PY EGQS G+I  GE+  K G
Sbjct  26   NKYKPKEPYVGRCLSNTRITGDDAPGETWHMVFSTEGEIPYREGQSIGIIADGED--KNG  83

Query  489  SPHNVRLYSIASSRYGDSFDGKTTSLCVRRAVY  587
             PH +RLYSIASS  GD  D KT SLCV+R VY
Sbjct  84   KPHKLRLYSIASSALGDFGDSKTVSLCVKRLVY  116



>pdb|1BX0|A Chain A, Ferredoxin:nadp+ Oxidoreductase (Ferredoxin Reductase) 
Mutant E312l
Length=314

 Score =   103 bits (257),  Expect = 8e-23, Method: Compositional matrix adjust.
 Identities = 51/94 (54%), Positives = 61/94 (65%), Gaps = 2/94 (2%)
 Frame = +3

Query  306  LNLYKPKGPYTATIASVERIVGPKAPGETCHIVIDHGGNVPYWEGQSYGVIPPGENPKKP  485
            +N +KPK PY        +I G  APGET H+V  H G +PY EGQS GVIP GE+  K 
Sbjct  29   VNKFKPKTPYVGRCLLNTKITGDDAPGETWHMVFSHEGEIPYREGQSVGVIPDGED--KN  86

Query  486  GSPHNVRLYSIASSRYGDSFDGKTTSLCVRRAVY  587
            G PH +RLYSIASS  GD  D K+ SLCV+R +Y
Sbjct  87   GKPHKLRLYSIASSALGDFGDAKSVSLCVKRLIY  120



>gb|AAA34029.1| ferredoxin-NADP oxidoreductase [Spinacia oleracea]
Length=369

 Score =   103 bits (257),  Expect = 8e-23, Method: Compositional matrix adjust.
 Identities = 51/94 (54%), Positives = 61/94 (65%), Gaps = 2/94 (2%)
 Frame = +3

Query  306  LNLYKPKGPYTATIASVERIVGPKAPGETCHIVIDHGGNVPYWEGQSYGVIPPGENPKKP  485
            +N +KPK PY        +I G  APGET H+V  H G +PY EGQS GVIP GE+  K 
Sbjct  84   VNKFKPKTPYVGRCLLNTKITGDDAPGETWHMVFSHEGEIPYREGQSVGVIPDGED--KN  141

Query  486  GSPHNVRLYSIASSRYGDSFDGKTTSLCVRRAVY  587
            G PH +RLYSIASS  GD  D K+ SLCV+R +Y
Sbjct  142  GKPHKLRLYSIASSALGDFGDAKSVSLCVKRLIY  175



>pdb|1FRQ|A Chain A, Ferredoxin:nadp+ Oxidoreductase (Ferredoxin Reductase) 
Mutant E312a
Length=314

 Score =   103 bits (256),  Expect = 8e-23, Method: Compositional matrix adjust.
 Identities = 51/94 (54%), Positives = 61/94 (65%), Gaps = 2/94 (2%)
 Frame = +3

Query  306  LNLYKPKGPYTATIASVERIVGPKAPGETCHIVIDHGGNVPYWEGQSYGVIPPGENPKKP  485
            +N +KPK PY        +I G  APGET H+V  H G +PY EGQS GVIP GE+  K 
Sbjct  29   VNKFKPKTPYVGRCLLNTKITGDDAPGETWHMVFSHEGEIPYREGQSVGVIPDGED--KN  86

Query  486  GSPHNVRLYSIASSRYGDSFDGKTTSLCVRRAVY  587
            G PH +RLYSIASS  GD  D K+ SLCV+R +Y
Sbjct  87   GKPHKLRLYSIASSALGDFGDAKSVSLCVKRLIY  120



>pdb|1FNB|A Chain A, Refined Crystal Structure Of Spinach Ferredoxin Reductase 
At 1.7 Angstroms Resolution: Oxidized, Reduced, And 2'- 
Phospho-5'-Amp Bound States
 pdb|1FNC|A Chain A, Refined Crystal Structure Of Spinach Ferredoxin Reductase 
At 1.7 Angstroms Resolution: Oxidized, Reduced, And 2'- 
Phospho-5'-Amp Bound States
 pdb|1FND|A Chain A, Refined Crystal Structure Of Spinach Ferredoxin Reductase 
At 1.7 Angstroms Resolution: Oxidized, Reduced, And 2'- 
Phospho-5'-Amp Bound States
Length=314

 Score =   103 bits (256),  Expect = 9e-23, Method: Compositional matrix adjust.
 Identities = 51/94 (54%), Positives = 61/94 (65%), Gaps = 2/94 (2%)
 Frame = +3

Query  306  LNLYKPKGPYTATIASVERIVGPKAPGETCHIVIDHGGNVPYWEGQSYGVIPPGENPKKP  485
            +N +KPK PY        +I G  APGET H+V  H G +PY EGQS GVIP GE+  K 
Sbjct  29   VNKFKPKTPYVGRCLLNTKITGDDAPGETWHMVFSHEGEIPYREGQSVGVIPDGED--KN  86

Query  486  GSPHNVRLYSIASSRYGDSFDGKTTSLCVRRAVY  587
            G PH +RLYSIASS  GD  D K+ SLCV+R +Y
Sbjct  87   GKPHKLRLYSIASSALGDFGDAKSVSLCVKRLIY  120



>ref|XP_002459129.1| hypothetical protein SORBIDRAFT_03g046340 [Sorghum bicolor]
 gb|EES04249.1| hypothetical protein SORBIDRAFT_03g046340 [Sorghum bicolor]
Length=368

 Score =   103 bits (257),  Expect = 9e-23, Method: Compositional matrix adjust.
 Identities = 53/93 (57%), Positives = 59/93 (63%), Gaps = 2/93 (2%)
 Frame = +3

Query  309  NLYKPKGPYTATIASVERIVGPKAPGETCHIVIDHGGNVPYWEGQSYGVIPPGENPKKPG  488
            N Y+PK PY     S  RI G  APGET H+V    G VPY EGQS G+I  GE+  K G
Sbjct  84   NKYRPKEPYVGRCLSNTRITGDDAPGETWHMVFSTEGEVPYREGQSIGIIADGED--KNG  141

Query  489  SPHNVRLYSIASSRYGDSFDGKTTSLCVRRAVY  587
             PH +RLYSIASS  GD  D KT SLCV+R VY
Sbjct  142  KPHKLRLYSIASSALGDFGDSKTVSLCVKRLVY  174



>ref|XP_004233557.1| PREDICTED: ferredoxin--NADP reductase, leaf-type isozyme, chloroplastic-like 
[Solanum lycopersicum]
Length=362

 Score =   103 bits (257),  Expect = 9e-23, Method: Compositional matrix adjust.
 Identities = 71/171 (42%), Positives = 90/171 (53%), Gaps = 5/171 (3%)
 Frame = +3

Query  81   VAVALNGDSSLQRSAFKANSITFNNRSP--ISFQPFDLKTRNGKSRSQYVVCMSVQQANI  254
            +A AL+   SLQ S   + SI     SP  I+F    L  RN  S S+ V  +  Q    
Sbjct  1    MAAALSASVSLQSSNSTSLSIKTIFISPENITFNKVLLCNRN-VSVSRKVFHIRAQLTTE  59

Query  255  PKVTVSPLSLEDAKEPPLNLYKPKGPYTATIASVERIVGPKAPGETCHIVIDHGGNVPYW  434
                V+ +S +  +   +N ++PK PY        +I G  APGET H+V    G +PY 
Sbjct  60   IPAKVAKVSKKQDEGVVVNKFRPKDPYIGRCLLNTKITGDDAPGETWHMVFSTEGEIPYR  119

Query  435  EGQSYGVIPPGENPKKPGSPHNVRLYSIASSRYGDSFDGKTTSLCVRRAVY  587
            EGQS GVIP G +    G PH +RLYSIASS  GD  D KT SLCV+R VY
Sbjct  120  EGQSIGVIPDGVDSN--GKPHKLRLYSIASSALGDFGDSKTVSLCVKRLVY  168



>ref|WP_017715708.1| ferredoxin--NADP reductase [Oscillatoria sp. PCC 10802]
Length=409

 Score =   103 bits (258),  Expect = 9e-23, Method: Compositional matrix adjust.
 Identities = 56/121 (46%), Positives = 73/121 (60%), Gaps = 4/121 (3%)
 Frame = +3

Query  243  QANIPKVTVSPLSLEDAK-EPPLNLYKPKGPYTATIASVERIVGPKAPGETCHIVID-HG  416
            QA  P+    P++    K E P+N+Y+P  PY     S E +V     G   H++ D  G
Sbjct  100  QATQPEEKSKPMTEAKQKTEVPVNIYRPNNPYIGKCLSNEELVREGGDGTVRHLLFDISG  159

Query  417  GNVPYWEGQSYGVIPPGENPKKPGSPHNVRLYSIASSRYGDSFDGKTTSLCVRRAVYYDP  596
            G++ Y EGQS G+IPPG + K  G PH +RLYSIAS+R+GD  D KT SLCVR+ VY  P
Sbjct  160  GDLRYLEGQSIGIIPPGTDDK--GKPHKLRLYSIASTRHGDRVDDKTVSLCVRQLVYKHP  217

Query  597  E  599
            E
Sbjct  218  E  218



>pdb|3VO1|A Chain A, Crystal Structure Of Zea Mays Leaf Ferredoxin-Nadp+ 
Reductase Ii
 pdb|3VO1|B Chain B, Crystal Structure Of Zea Mays Leaf Ferredoxin-Nadp+ 
Reductase Ii
Length=314

 Score =   103 bits (256),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 54/93 (58%), Positives = 59/93 (63%), Gaps = 2/93 (2%)
 Frame = +3

Query  309  NLYKPKGPYTATIASVERIVGPKAPGETCHIVIDHGGNVPYWEGQSYGVIPPGENPKKPG  488
            N YKPK PY        RI G +APGET H+V    G VPY EGQS GVI  GE+  K G
Sbjct  30   NKYKPKEPYVGRCLLNTRITGDQAPGETWHMVFSTEGEVPYREGQSIGVIADGED--KNG  87

Query  489  SPHNVRLYSIASSRYGDSFDGKTTSLCVRRAVY  587
             PH +RLYSIASS  GD  D KT SLCV+R VY
Sbjct  88   KPHKLRLYSIASSALGDFGDSKTVSLCVKRLVY  120



>gb|ACF85815.1| unknown [Zea mays]
 gb|AFW83918.1| ferredoxin--NADP reductase, leaf isozyme [Zea mays]
Length=369

 Score =   103 bits (257),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 53/93 (57%), Positives = 59/93 (63%), Gaps = 2/93 (2%)
 Frame = +3

Query  309  NLYKPKGPYTATIASVERIVGPKAPGETCHIVIDHGGNVPYWEGQSYGVIPPGENPKKPG  488
            N YKPK PY     S  RI G  APGET H+V    G +PY EGQS G+I  GE+  K G
Sbjct  85   NKYKPKEPYVGRCLSNTRITGDDAPGETWHMVFSTEGEIPYREGQSIGIIADGED--KNG  142

Query  489  SPHNVRLYSIASSRYGDSFDGKTTSLCVRRAVY  587
             PH +RLYSIASS  GD  D KT SLCV+R VY
Sbjct  143  KPHKLRLYSIASSALGDFGDSKTVSLCVKRLVY  175



>tpg|DAA55763.1| TPA: hypothetical protein ZEAMMB73_743777 [Zea mays]
Length=342

 Score =   103 bits (256),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 54/93 (58%), Positives = 59/93 (63%), Gaps = 2/93 (2%)
 Frame = +3

Query  309  NLYKPKGPYTATIASVERIVGPKAPGETCHIVIDHGGNVPYWEGQSYGVIPPGENPKKPG  488
            N YKPK PY        RI G +APGET H+V    G VPY EGQS GVI  GE+  K G
Sbjct  84   NKYKPKEPYVGRCLLNTRITGDQAPGETWHMVFSTEGEVPYREGQSIGVIADGED--KNG  141

Query  489  SPHNVRLYSIASSRYGDSFDGKTTSLCVRRAVY  587
             PH +RLYSIASS  GD  D KT SLCV+R VY
Sbjct  142  KPHKLRLYSIASSALGDFGDSKTVSLCVKRLVY  174



>tpg|DAA55764.1| TPA: hypothetical protein ZEAMMB73_743777 [Zea mays]
Length=367

 Score =   103 bits (256),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 54/93 (58%), Positives = 59/93 (63%), Gaps = 2/93 (2%)
 Frame = +3

Query  309  NLYKPKGPYTATIASVERIVGPKAPGETCHIVIDHGGNVPYWEGQSYGVIPPGENPKKPG  488
            N YKPK PY        RI G +APGET H+V    G VPY EGQS GVI  GE+  K G
Sbjct  84   NKYKPKEPYVGRCLLNTRITGDQAPGETWHMVFSTEGEVPYREGQSIGVIADGED--KNG  141

Query  489  SPHNVRLYSIASSRYGDSFDGKTTSLCVRRAVY  587
             PH +RLYSIASS  GD  D KT SLCV+R VY
Sbjct  142  KPHKLRLYSIASSALGDFGDSKTVSLCVKRLVY  174



>ref|NP_001149023.1| ferredoxin--NADP reductase, leaf isozyme [Zea mays]
 gb|ACG33858.1| ferredoxin--NADP reductase, leaf isozyme [Zea mays]
Length=369

 Score =   103 bits (256),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 53/93 (57%), Positives = 59/93 (63%), Gaps = 2/93 (2%)
 Frame = +3

Query  309  NLYKPKGPYTATIASVERIVGPKAPGETCHIVIDHGGNVPYWEGQSYGVIPPGENPKKPG  488
            N YKPK PY     S  RI G  APGET H+V    G +PY EGQS G+I  GE+  K G
Sbjct  85   NKYKPKEPYVGRCLSNTRITGDDAPGETWHMVFSTEGEIPYREGQSIGIIADGED--KNG  142

Query  489  SPHNVRLYSIASSRYGDSFDGKTTSLCVRRAVY  587
             PH +RLYSIASS  GD  D KT SLCV+R VY
Sbjct  143  KPHKLRLYSIASSALGDFGDSKTVSLCVKRLVY  175



>gb|ACF83556.1| unknown [Zea mays]
Length=368

 Score =   103 bits (256),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 54/93 (58%), Positives = 59/93 (63%), Gaps = 2/93 (2%)
 Frame = +3

Query  309  NLYKPKGPYTATIASVERIVGPKAPGETCHIVIDHGGNVPYWEGQSYGVIPPGENPKKPG  488
            N YKPK PY        RI G +APGET H+V    G VPY EGQS GVI  GE+  K G
Sbjct  84   NKYKPKEPYVGRCLLNTRITGDQAPGETWHMVFSTEGEVPYREGQSIGVIADGED--KNG  141

Query  489  SPHNVRLYSIASSRYGDSFDGKTTSLCVRRAVY  587
             PH +RLYSIASS  GD  D KT SLCV+R VY
Sbjct  142  KPHKLRLYSIASSALGDFGDSKTVSLCVKRLVY  174



>ref|NP_001104851.1| ferredoxin [Zea mays]
 dbj|BAA88237.1| ferredoxin [Zea mays]
 tpg|DAA55765.1| TPA: ferredoxin--NADP reductase, leaf isozyme [Zea mays]
 tpg|DAA55766.1| TPA: ferredoxin--NADP reductase, leaf isozyme [Zea mays]
Length=368

 Score =   103 bits (256),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 54/93 (58%), Positives = 59/93 (63%), Gaps = 2/93 (2%)
 Frame = +3

Query  309  NLYKPKGPYTATIASVERIVGPKAPGETCHIVIDHGGNVPYWEGQSYGVIPPGENPKKPG  488
            N YKPK PY        RI G +APGET H+V    G VPY EGQS GVI  GE+  K G
Sbjct  84   NKYKPKEPYVGRCLLNTRITGDQAPGETWHMVFSTEGEVPYREGQSIGVIADGED--KNG  141

Query  489  SPHNVRLYSIASSRYGDSFDGKTTSLCVRRAVY  587
             PH +RLYSIASS  GD  D KT SLCV+R VY
Sbjct  142  KPHKLRLYSIASSALGDFGDSKTVSLCVKRLVY  174



>emb|CDY18592.1| BnaA09g08030D [Brassica napus]
Length=362

 Score =   102 bits (255),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 54/94 (57%), Positives = 60/94 (64%), Gaps = 2/94 (2%)
 Frame = +3

Query  306  LNLYKPKGPYTATIASVERIVGPKAPGETCHIVIDHGGNVPYWEGQSYGVIPPGENPKKP  485
            +N +KPK PYT       RI G  APGET HIV    G VPY EGQS G+IP G +  K 
Sbjct  77   VNKFKPKDPYTGRCLLNTRITGDDAPGETWHIVFTTEGEVPYREGQSIGIIPEGID--KN  134

Query  486  GSPHNVRLYSIASSRYGDSFDGKTTSLCVRRAVY  587
            G PH +RLYSIASS  GD  D KT SLCV+R VY
Sbjct  135  GKPHKLRLYSIASSAIGDFGDSKTVSLCVKRLVY  168



>ref|XP_002993724.1| hypothetical protein SELMODRAFT_272335 [Selaginella moellendorffii]
 gb|EFJ05216.1| hypothetical protein SELMODRAFT_272335 [Selaginella moellendorffii]
Length=373

 Score =   102 bits (255),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 56/119 (47%), Positives = 71/119 (60%), Gaps = 2/119 (2%)
 Frame = +3

Query  231  MSVQQANIPKVTVSPLSLEDAKEPPLNLYKPKGPYTATIASVERIVGPKAPGETCHIVID  410
             SV+ A +   TV  +  +D +    NL++PK PY        +IVG  APGET H+V  
Sbjct  63   FSVRAAAVSTETVEKVKKKDEEGVVTNLFRPKEPYVGRCLLNTKIVGDDAPGETWHMVFT  122

Query  411  HGGNVPYWEGQSYGVIPPGENPKKPGSPHNVRLYSIASSRYGDSFDGKTTSLCVRRAVY  587
              G +PY EGQS G++PPG + K  G P  +RLYSIASS  GD  D KT SLCV+R VY
Sbjct  123  TEGKIPYREGQSIGIVPPGLDAK--GKPQKLRLYSIASSAPGDFGDYKTVSLCVKRLVY  179



>sp|P41343.1|FENR_MESCR RecName: Full=Ferredoxin--NADP reductase, chloroplastic; Short=FNR; 
Flags: Precursor [Mesembryanthemum crystallinum]
 gb|AAA33029.1| ferredoxin-NADP+ reductase precursor [Mesembryanthemum crystallinum]
 prf||1604475A ferredoxin NADP reductase
Length=365

 Score =   102 bits (255),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 65/161 (40%), Positives = 85/161 (53%), Gaps = 9/161 (6%)
 Frame = +3

Query  105  SSLQRSAFKANSITFNNRSPISFQPFDLKTRNGKSRSQYVVCMSVQQANIPKVTVSPLSL  284
            S+   S      I FN + P+ ++   +  + G  R+      S  +A + KV      +
Sbjct  20   STRTSSVITHEKINFN-KVPLYYRNVSVGGKVGTIRA----VASDVEAPVAKVEKHSKKM  74

Query  285  EDAKEPPLNLYKPKGPYTATIASVERIVGPKAPGETCHIVIDHGGNVPYWEGQSYGVIPP  464
            E+     +N YKPK PYT       +I G  APGET H+V  H G +PY EGQS GVIP 
Sbjct  75   EEG--VIVNKYKPKNPYTGRCLLNTKITGDDAPGETWHMVFSHEGEIPYREGQSVGVIPE  132

Query  465  GENPKKPGSPHNVRLYSIASSRYGDSFDGKTTSLCVRRAVY  587
            G +  K G PH +RLYSIAS   GD  D KT SLCV+R +Y
Sbjct  133  GID--KNGKPHKLRLYSIASRPLGDFGDSKTVSLCVKRLIY  171



>ref|XP_010484677.1| PREDICTED: ferredoxin--NADP reductase, leaf isozyme 1, chloroplastic 
[Camelina sativa]
Length=362

 Score =   102 bits (254),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 54/94 (57%), Positives = 60/94 (64%), Gaps = 2/94 (2%)
 Frame = +3

Query  306  LNLYKPKGPYTATIASVERIVGPKAPGETCHIVIDHGGNVPYWEGQSYGVIPPGENPKKP  485
            +N YKPK PYT       +I G  APGET HIV    G +PY EGQS GVIP G +  K 
Sbjct  77   VNKYKPKNPYTGRCLLNTKITGDDAPGETWHIVFTTEGEIPYREGQSIGVIPEGID--KN  134

Query  486  GSPHNVRLYSIASSRYGDSFDGKTTSLCVRRAVY  587
            G PH +RLYSIASS  GD  D KT SLCV+R VY
Sbjct  135  GKPHKLRLYSIASSAIGDFGDSKTVSLCVKRLVY  168



>ref|XP_010444826.1| PREDICTED: ferredoxin--NADP reductase, leaf isozyme 1, chloroplastic-like 
[Camelina sativa]
Length=362

 Score =   102 bits (254),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 54/94 (57%), Positives = 60/94 (64%), Gaps = 2/94 (2%)
 Frame = +3

Query  306  LNLYKPKGPYTATIASVERIVGPKAPGETCHIVIDHGGNVPYWEGQSYGVIPPGENPKKP  485
            +N YKPK PYT       +I G  APGET HIV    G +PY EGQS GVIP G +  K 
Sbjct  77   VNKYKPKNPYTGRCLLNTKITGDDAPGETWHIVFTTEGEIPYREGQSIGVIPEGID--KN  134

Query  486  GSPHNVRLYSIASSRYGDSFDGKTTSLCVRRAVY  587
            G PH +RLYSIASS  GD  D KT SLCV+R VY
Sbjct  135  GKPHKLRLYSIASSAIGDFGDSKTVSLCVKRLVY  168



>ref|WP_006632795.1| ferredoxin--NADP reductase [Microcoleus vaginatus]
 gb|EGK88014.1| Ferredoxin--NADP(+) reductase [Microcoleus vaginatus FGP-2]
Length=401

 Score =   102 bits (255),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 55/110 (50%), Positives = 65/110 (59%), Gaps = 6/110 (5%)
 Frame = +3

Query  282  LEDAKEP---PLNLYKPKGPYTATIASVERIVGPKAPGETCHIVID-HGGNVPYWEGQSY  449
            +  AKE    P+NLYKP  PY     S E +V     G   H+  D  GGN+ Y EGQS 
Sbjct  103  MTQAKEKVQVPVNLYKPANPYIGKCISTEELVREGGEGTVRHVTFDLSGGNLHYLEGQSI  162

Query  450  GVIPPGENPKKPGSPHNVRLYSIASSRYGDSFDGKTTSLCVRRAVYYDPE  599
            G+IP G +  K G PH +RLYSIAS+R+GD  D KT SLCVRR  Y  PE
Sbjct  163  GIIPDGTD--KNGKPHKIRLYSIASTRHGDHLDDKTISLCVRRLEYKSPE  210



>gb|ACG35645.1| ferredoxin--NADP reductase, leaf isozyme [Zea mays]
Length=335

 Score =   102 bits (254),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 54/93 (58%), Positives = 59/93 (63%), Gaps = 2/93 (2%)
 Frame = +3

Query  309  NLYKPKGPYTATIASVERIVGPKAPGETCHIVIDHGGNVPYWEGQSYGVIPPGENPKKPG  488
            N YKPK PY        RI G +APGET H+V    G VPY EGQS GVI  GE+  K G
Sbjct  51   NKYKPKEPYVGRCLLNTRITGDQAPGETWHMVFSTEGEVPYREGQSIGVIADGED--KNG  108

Query  489  SPHNVRLYSIASSRYGDSFDGKTTSLCVRRAVY  587
             PH +RLYSIASS  GD  D KT SLCV+R VY
Sbjct  109  KPHKLRLYSIASSALGDFGDSKTVSLCVKRLVY  141



>ref|XP_002865083.1| ferredoxin-NADP+ reductase [Arabidopsis lyrata subsp. lyrata]
 gb|EFH41342.1| ferredoxin-NADP+ reductase [Arabidopsis lyrata subsp. lyrata]
Length=361

 Score =   102 bits (254),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 57/111 (51%), Positives = 67/111 (60%), Gaps = 2/111 (2%)
 Frame = +3

Query  255  PKVTVSPLSLEDAKEPPLNLYKPKGPYTATIASVERIVGPKAPGETCHIVIDHGGNVPYW  434
            P V V+  S +  +   +N +KPK PYT       +I G  APGET HIV    G +PY 
Sbjct  59   PPVKVAKESKKQEEGIVVNKFKPKNPYTGRCLLNTKITGDDAPGETWHIVFTTQGEIPYR  118

Query  435  EGQSYGVIPPGENPKKPGSPHNVRLYSIASSRYGDSFDGKTTSLCVRRAVY  587
            EGQS GVIP G +  K G PH +RLYSIASS  GD  D KT SLCV+R VY
Sbjct  119  EGQSIGVIPEGID--KNGKPHKLRLYSIASSAIGDFGDSKTVSLCVKRLVY  167



>gb|ELS32478.1| Ferredoxin--NADP(+) reductase [Pseudanabaena biceps PCC 7429]
Length=297

 Score =   102 bits (253),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 53/105 (50%), Positives = 71/105 (68%), Gaps = 3/105 (3%)
 Frame = +3

Query  276  LSLEDAKEPPLNLYKPKGPYTATIASVERIVGPKAPGETCHIVID-HGGNVPYWEGQSYG  452
            +S    K+ P+N+Y+P  P+TA   S + +V P A G+T H+ ID  GG++ Y EGQS G
Sbjct  1    MSANSEKDIPVNIYRPANPFTAKCISNDVLVRPGAVGDTRHVKIDISGGDLRYLEGQSIG  60

Query  453  VIPPGENPKKPGSPHNVRLYSIASSRYGDSFDGKTTSLCVRRAVY  587
            V+PPGE+  K G P+ +RLYSIAS+R GD  DGKT SL V+R  Y
Sbjct  61   VVPPGED--KNGKPNKLRLYSIASTRLGDDLDGKTLSLSVKRLEY  103



>ref|XP_009112283.1| PREDICTED: ferredoxin--NADP reductase, leaf isozyme 1, chloroplastic 
[Brassica rapa]
Length=363

 Score =   102 bits (254),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 54/94 (57%), Positives = 60/94 (64%), Gaps = 2/94 (2%)
 Frame = +3

Query  306  LNLYKPKGPYTATIASVERIVGPKAPGETCHIVIDHGGNVPYWEGQSYGVIPPGENPKKP  485
            +N +KPK PYT       RI G  APGET HIV    G VPY EGQS G+IP G +  K 
Sbjct  78   VNKFKPKDPYTGRCLLNTRITGDDAPGETWHIVFTTEGEVPYREGQSIGIIPEGID--KN  135

Query  486  GSPHNVRLYSIASSRYGDSFDGKTTSLCVRRAVY  587
            G PH +RLYSIASS  GD  D KT SLCV+R VY
Sbjct  136  GKPHKLRLYSIASSAIGDFGDSKTVSLCVKRLVY  169



>ref|XP_006380593.1| Chain A family protein [Populus trichocarpa]
 gb|ERP58390.1| Chain A family protein [Populus trichocarpa]
Length=363

 Score =   102 bits (254),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 59/127 (46%), Positives = 72/127 (57%), Gaps = 2/127 (2%)
 Frame = +3

Query  207  SRSQYVVCMSVQQANIPKVTVSPLSLEDAKEPPLNLYKPKGPYTATIASVERIVGPKAPG  386
            S S  V+ +  Q        V  +S ++ +   +N +KPK PYT       +I G  APG
Sbjct  45   SASGRVISIRAQVTTEAPAKVEKVSKKNEEGVVVNKFKPKNPYTGRCLLNTKITGDDAPG  104

Query  387  ETCHIVIDHGGNVPYWEGQSYGVIPPGENPKKPGSPHNVRLYSIASSRYGDSFDGKTTSL  566
            ET H+V    G VPY EGQS GVIP G +  K G PH +RLYSIASS  GD  D KT SL
Sbjct  105  ETWHMVFSTEGEVPYREGQSIGVIPDGID--KNGKPHKLRLYSIASSAIGDFGDSKTVSL  162

Query  567  CVRRAVY  587
            CV+R VY
Sbjct  163  CVKRLVY  169



>ref|XP_010465822.1| PREDICTED: ferredoxin--NADP reductase, leaf isozyme 1, chloroplastic-like 
[Camelina sativa]
Length=363

 Score =   102 bits (253),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 53/94 (56%), Positives = 60/94 (64%), Gaps = 2/94 (2%)
 Frame = +3

Query  306  LNLYKPKGPYTATIASVERIVGPKAPGETCHIVIDHGGNVPYWEGQSYGVIPPGENPKKP  485
            +N +KPK PYT       +I G  APGET HIV    G VPY EGQS G+IP G +  K 
Sbjct  78   VNKFKPKNPYTGRCLLNTKITGDDAPGETMHIVFTTDGEVPYREGQSIGIIPEGID--KN  135

Query  486  GSPHNVRLYSIASSRYGDSFDGKTTSLCVRRAVY  587
            G PH +RLYSIASS  GD  D KT SLCV+R VY
Sbjct  136  GKPHKLRLYSIASSAIGDFGDSKTVSLCVKRLVY  169



>ref|XP_002533800.1| ferredoxin--NADP reductase, putative [Ricinus communis]
 gb|EEF28587.1| ferredoxin--NADP reductase, putative [Ricinus communis]
Length=346

 Score =   102 bits (253),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 63/134 (47%), Positives = 77/134 (57%), Gaps = 6/134 (4%)
 Frame = +3

Query  195  RNGKSRSQYVVCMSVQ---QANIPKVTVSPLSLEDAKEPPLNLYKPKGPYTATIASVERI  365
            R+  S  + VV +  Q   +A  P V V   S ++ +   +N +KPK PYT       +I
Sbjct  41   RDVVSAGKRVVSIRAQVTTEAEAP-VKVKKESKKNEEGIVVNKFKPKNPYTGRCLLNTKI  99

Query  366  VGPKAPGETCHIVIDHGGNVPYWEGQSYGVIPPGENPKKPGSPHNVRLYSIASSRYGDSF  545
             G  APGET H+V    G VPY EGQS GVIP G +  K G PH +RLYSIASS  GD  
Sbjct  100  TGDDAPGETWHMVFSTEGEVPYREGQSIGVIPDGID--KNGKPHKLRLYSIASSALGDFG  157

Query  546  DGKTTSLCVRRAVY  587
            D KT SLCV+R VY
Sbjct  158  DSKTVSLCVKRLVY  171



>ref|NP_201420.1| ferredoxin-NADP(+)-oxidoreductase 1 [Arabidopsis thaliana]
 sp|Q9FKW6.1|FNRL1_ARATH RecName: Full=Ferredoxin--NADP reductase, leaf isozyme 1, chloroplastic; 
AltName: Full=Leaf FNR 1; Short=AtLFNR1; Short=FNR-1; 
Flags: Precursor [Arabidopsis thaliana]
 dbj|BAB10424.1| ferredoxin-NADP+ reductase [Arabidopsis thaliana]
 gb|AAL59934.1| putative ferredoxin-NADP+ reductase [Arabidopsis thaliana]
 gb|AAM20299.1| putative ferredoxin-NADP+ reductase [Arabidopsis thaliana]
 gb|AED98174.1| ferredoxin-NADP(+)-oxidoreductase 1 [Arabidopsis thaliana]
Length=360

 Score =   102 bits (253),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 54/94 (57%), Positives = 60/94 (64%), Gaps = 2/94 (2%)
 Frame = +3

Query  306  LNLYKPKGPYTATIASVERIVGPKAPGETCHIVIDHGGNVPYWEGQSYGVIPPGENPKKP  485
            +N +KPK PYT       +I G  APGET HIV    G VPY EGQS GVIP G +  K 
Sbjct  75   VNKFKPKNPYTGRCLLNTKITGDDAPGETWHIVFTTEGEVPYREGQSIGVIPEGID--KN  132

Query  486  GSPHNVRLYSIASSRYGDSFDGKTTSLCVRRAVY  587
            G PH +RLYSIASS  GD  D KT SLCV+R VY
Sbjct  133  GKPHKLRLYSIASSAIGDFGDSKTVSLCVKRLVY  166



>dbj|BAE98556.1| ferredoxin-NADP+ reductase [Arabidopsis thaliana]
Length=360

 Score =   102 bits (253),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 54/94 (57%), Positives = 60/94 (64%), Gaps = 2/94 (2%)
 Frame = +3

Query  306  LNLYKPKGPYTATIASVERIVGPKAPGETCHIVIDHGGNVPYWEGQSYGVIPPGENPKKP  485
            +N +KPK PYT       +I G  APGET HIV    G VPY EGQS GVIP G +  K 
Sbjct  75   VNKFKPKNPYTGRCLLNTKITGDDAPGETWHIVFTTEGEVPYREGQSIGVIPEGID--KN  132

Query  486  GSPHNVRLYSIASSRYGDSFDGKTTSLCVRRAVY  587
            G PH +RLYSIASS  GD  D KT SLCV+R VY
Sbjct  133  GKPHKLRLYSIASSAIGDFGDSKTVSLCVKRLVY  166



>ref|XP_006280674.1| hypothetical protein CARUB_v10026639mg [Capsella rubella]
 gb|EOA13572.1| hypothetical protein CARUB_v10026639mg [Capsella rubella]
Length=364

 Score =   102 bits (253),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 54/94 (57%), Positives = 60/94 (64%), Gaps = 2/94 (2%)
 Frame = +3

Query  306  LNLYKPKGPYTATIASVERIVGPKAPGETCHIVIDHGGNVPYWEGQSYGVIPPGENPKKP  485
            +N +KPK PYT       +I G  APGET HIV    G VPY EGQS GVIP G +  K 
Sbjct  79   VNKFKPKNPYTGRCLLNTKITGDDAPGETWHIVFTTEGEVPYREGQSIGVIPEGID--KN  136

Query  486  GSPHNVRLYSIASSRYGDSFDGKTTSLCVRRAVY  587
            G PH +RLYSIASS  GD  D KT SLCV+R VY
Sbjct  137  GKPHKLRLYSIASSAIGDFGDSKTVSLCVKRLVY  170



>ref|XP_009363490.1| PREDICTED: ferredoxin--NADP reductase, leaf isozyme, chloroplastic 
[Pyrus x bretschneideri]
Length=363

 Score =   102 bits (253),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 53/94 (56%), Positives = 60/94 (64%), Gaps = 2/94 (2%)
 Frame = +3

Query  306  LNLYKPKGPYTATIASVERIVGPKAPGETCHIVIDHGGNVPYWEGQSYGVIPPGENPKKP  485
            +N +KPK PYT  +    RI    APGET H+V    G VPY EGQS GVIP G +  K 
Sbjct  78   VNKFKPKNPYTGRVLLNTRITADDAPGETWHMVFSTEGEVPYREGQSIGVIPDGID--KN  135

Query  486  GSPHNVRLYSIASSRYGDSFDGKTTSLCVRRAVY  587
            G PH +RLYSIASS  GD  D KT SLCV+R VY
Sbjct  136  GKPHKLRLYSIASSALGDFGDSKTVSLCVKRLVY  169



>emb|CAB52472.1| ferredoxin-NADP+ reductase [Arabidopsis thaliana]
Length=360

 Score =   102 bits (253),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 54/94 (57%), Positives = 60/94 (64%), Gaps = 2/94 (2%)
 Frame = +3

Query  306  LNLYKPKGPYTATIASVERIVGPKAPGETCHIVIDHGGNVPYWEGQSYGVIPPGENPKKP  485
            +N +KPK PYT       +I G  APGET HIV    G VPY EGQS GVIP G +  K 
Sbjct  75   VNKFKPKNPYTGRCLLNTKITGDDAPGETWHIVFTTEGGVPYREGQSIGVIPEGID--KN  132

Query  486  GSPHNVRLYSIASSRYGDSFDGKTTSLCVRRAVY  587
            G PH +RLYSIASS  GD  D KT SLCV+R VY
Sbjct  133  GKPHKLRLYSIASSAIGDFGDSKTVSLCVKRLVY  166



>ref|XP_010679926.1| PREDICTED: ferredoxin--NADP reductase, chloroplastic [Beta vulgaris 
subsp. vulgaris]
Length=369

 Score =   102 bits (253),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 52/94 (55%), Positives = 59/94 (63%), Gaps = 2/94 (2%)
 Frame = +3

Query  306  LNLYKPKGPYTATIASVERIVGPKAPGETCHIVIDHGGNVPYWEGQSYGVIPPGENPKKP  485
            +N YKPK PY        +I G  APGET H+V  H G +PY EGQS GVI  G +  K 
Sbjct  84   VNKYKPKNPYVGRCLLNTKITGDDAPGETWHMVFSHEGEIPYREGQSVGVIADGLD--KN  141

Query  486  GSPHNVRLYSIASSRYGDSFDGKTTSLCVRRAVY  587
            G PH +RLYSIASS  GD  D KT SLCV+R VY
Sbjct  142  GKPHKLRLYSIASSALGDFGDSKTVSLCVKRLVY  175



>emb|CDY57760.1| BnaC02g45020D [Brassica napus]
Length=1004

 Score =   104 bits (260),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 55/94 (59%), Positives = 60/94 (64%), Gaps = 2/94 (2%)
 Frame = +3

Query  306  LNLYKPKGPYTATIASVERIVGPKAPGETCHIVIDHGGNVPYWEGQSYGVIPPGENPKKP  485
            +N +KPK PYT       RI G  APGET HIV    G VPY EGQS GVIP G +  K 
Sbjct  720  VNKFKPKDPYTGRCLLNTRITGDDAPGETWHIVFTTQGEVPYREGQSIGVIPEGID--KN  777

Query  486  GSPHNVRLYSIASSRYGDSFDGKTTSLCVRRAVY  587
            G PH +RLYSIASS  GD  D KT SLCV+R VY
Sbjct  778  GKPHKLRLYSIASSAIGDFGDSKTVSLCVKRLVY  811



>pdb|1FRN|A Chain A, The Involvement Of Ser96 In The Catalytic Mechanism 
Of Ferredoxin-Nadp+ Reductase: Structure-Function Relationship 
As Studied By Site-Directed Mutagenesis And X- Ray Crystallography
Length=314

 Score =   101 bits (251),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 50/94 (53%), Positives = 60/94 (64%), Gaps = 2/94 (2%)
 Frame = +3

Query  306  LNLYKPKGPYTATIASVERIVGPKAPGETCHIVIDHGGNVPYWEGQSYGVIPPGENPKKP  485
            +N +KPK PY        +I G  APGET H+V  H G +PY EGQS GVIP GE+  K 
Sbjct  29   VNKFKPKTPYVGRCLLNTKITGDDAPGETWHMVFSHEGEIPYREGQSVGVIPDGED--KN  86

Query  486  GSPHNVRLYSIASSRYGDSFDGKTTSLCVRRAVY  587
            G PH +RLY IASS  GD  D K+ SLCV+R +Y
Sbjct  87   GKPHKLRLYVIASSALGDFGDAKSVSLCVKRLIY  120



>ref|XP_008788385.1| PREDICTED: ferredoxin--NADP reductase, leaf isozyme, chloroplastic 
[Phoenix dactylifera]
Length=366

 Score =   101 bits (252),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 56/111 (50%), Positives = 67/111 (60%), Gaps = 2/111 (2%)
 Frame = +3

Query  267  VSPLSLEDAKEPPLNLYKPKGPYTATIASVERIVGPKAPGETCHIVIDHGGNVPYWEGQS  446
            V  +S +D +   +N YKPK PY        +I G  APGET H+V    G VPY EGQS
Sbjct  68   VQRVSKKDDEGVVINKYKPKEPYIGRCLLNTKITGDDAPGETWHMVFSTEGEVPYREGQS  127

Query  447  YGVIPPGENPKKPGSPHNVRLYSIASSRYGDSFDGKTTSLCVRRAVYYDPE  599
             GVIP G +  K G PH +RLYSIASS  GD  D KT SLCV+R VY + +
Sbjct  128  IGVIPDGID--KNGKPHKLRLYSIASSALGDFGDSKTVSLCVKRLVYTNEQ  176



>gb|AFW86198.1| hypothetical protein ZEAMMB73_116832 [Zea mays]
Length=202

 Score = 99.4 bits (246),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 52/95 (55%), Positives = 59/95 (62%), Gaps = 2/95 (2%)
 Frame = +3

Query  309  NLYKPKGPYTATIASVERIVGPKAPGETCHIVIDHGGNVPYWEGQSYGVIPPGENPKKPG  488
            NLYKPK PY        +I G  APGET H+V    G +PY EGQS GVI  G +  K G
Sbjct  71   NLYKPKEPYVGRCLLNTKITGDDAPGETWHMVFSTEGKIPYREGQSIGVIADGVD--KNG  128

Query  489  SPHNVRLYSIASSRYGDSFDGKTTSLCVRRAVYYD  593
             PH VRLYSIASS  GD  D KT SLCV+R +Y +
Sbjct  129  KPHKVRLYSIASSAIGDFGDSKTVSLCVKRLIYTN  163



>ref|WP_007357258.1| MULTISPECIES: ferredoxin--NADP reductase [Kamptonema]
 emb|CBN58072.1| Ferredoxin--NADP reductase [ [[Oscillatoria] sp. PCC 6506]
Length=401

 Score =   101 bits (252),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 56/125 (45%), Positives = 73/125 (58%), Gaps = 7/125 (6%)
 Frame = +3

Query  231  MSVQQANIPKVTVSPLSLEDAK-EPPLNLYKPKGPYTATIASVERIVGPKAPGETCHIVI  407
            + VQ++  PK    P++    K + P+NLYKP  P+     S E +V     G   H+  
Sbjct  91   LQVQKSGEPK---KPMTQAKEKVDIPVNLYKPASPFIGKCISTEELVREGGEGTVRHVTF  147

Query  408  D-HGGNVPYWEGQSYGVIPPGENPKKPGSPHNVRLYSIASSRYGDSFDGKTTSLCVRRAV  584
            D  GGN+ Y EGQS G+IP G +    G PH +RLYSIAS+R+GD+ D KT SLCVRR  
Sbjct  148  DLSGGNLRYLEGQSIGIIPEGTDAN--GKPHKLRLYSIASTRHGDNLDDKTISLCVRRLE  205

Query  585  YYDPE  599
            Y  PE
Sbjct  206  YKHPE  210



>gb|ACJ84361.1| unknown [Medicago truncatula]
Length=175

 Score = 98.6 bits (244),  Expect = 6e-22, Method: Compositional matrix adjust.
 Identities = 53/109 (49%), Positives = 65/109 (60%), Gaps = 2/109 (2%)
 Frame = +3

Query  261  VTVSPLSLEDAKEPPLNLYKPKGPYTATIASVERIVGPKAPGETCHIVIDHGGNVPYWEG  440
            V V  +S +  +   +N +KPK PY        +I G  APGET H+V    G VPY EG
Sbjct  61   VKVEKISKKQEEGIVVNKFKPKTPYIGRCLLNTKITGDDAPGETWHMVFSTEGEVPYREG  120

Query  441  QSYGVIPPGENPKKPGSPHNVRLYSIASSRYGDSFDGKTTSLCVRRAVY  587
            QS G++P G +  K G PH +RLYSIASS  GD  D KT SLCV+R VY
Sbjct  121  QSIGIVPDGID--KNGKPHKLRLYSIASSALGDFGDSKTVSLCVKRLVY  167



>gb|ABR25484.1| ferredoxin--nadp reductase, leaf isozyme [Oryza sativa Indica 
Group]
Length=237

 Score =   100 bits (248),  Expect = 6e-22, Method: Compositional matrix adjust.
 Identities = 53/97 (55%), Positives = 61/97 (63%), Gaps = 2/97 (2%)
 Frame = +3

Query  309  NLYKPKGPYTATIASVERIVGPKAPGETCHIVIDHGGNVPYWEGQSYGVIPPGENPKKPG  488
            N Y+PK PYT       RI G  APGET H+V    G +PY EGQS GVIP G +  K G
Sbjct  82   NKYRPKEPYTGRCLLNTRITGDDAPGETWHMVFSTDGEIPYREGQSIGVIPDGID--KNG  139

Query  489  SPHNVRLYSIASSRYGDSFDGKTTSLCVRRAVYYDPE  599
             PH +RLYSIASS  GD  D KT SLCV+R VY + +
Sbjct  140  KPHKLRLYSIASSAIGDFADSKTVSLCVKRLVYTNDQ  176



>dbj|BAD07827.1| putative ferredoxin-NADP(H) oxidoreductase [Oryza sativa Japonica 
Group]
 gb|EAZ21407.1| hypothetical protein OsJ_05011 [Oryza sativa Japonica Group]
 dbj|BAG89459.1| unnamed protein product [Oryza sativa Japonica Group]
Length=366

 Score =   101 bits (251),  Expect = 6e-22, Method: Compositional matrix adjust.
 Identities = 53/93 (57%), Positives = 59/93 (63%), Gaps = 2/93 (2%)
 Frame = +3

Query  309  NLYKPKGPYTATIASVERIVGPKAPGETCHIVIDHGGNVPYWEGQSYGVIPPGENPKKPG  488
            N Y+PK PYT       RI G  APGET H+V    G +PY EGQS GVIP G +  K G
Sbjct  82   NKYRPKEPYTGRCLLNTRITGDDAPGETWHMVFSTDGEIPYREGQSIGVIPDGID--KNG  139

Query  489  SPHNVRLYSIASSRYGDSFDGKTTSLCVRRAVY  587
             PH +RLYSIASS  GD  D KT SLCV+R VY
Sbjct  140  KPHKLRLYSIASSAIGDFADSKTVSLCVKRLVY  172



>gb|EAY84091.1| hypothetical protein OsI_05475 [Oryza sativa Indica Group]
Length=366

 Score =   101 bits (251),  Expect = 6e-22, Method: Compositional matrix adjust.
 Identities = 53/93 (57%), Positives = 59/93 (63%), Gaps = 2/93 (2%)
 Frame = +3

Query  309  NLYKPKGPYTATIASVERIVGPKAPGETCHIVIDHGGNVPYWEGQSYGVIPPGENPKKPG  488
            N Y+PK PYT       RI G  APGET H+V    G +PY EGQS GVIP G +  K G
Sbjct  82   NKYRPKEPYTGRCLLNTRITGDDAPGETWHMVFSTDGEIPYREGQSIGVIPDGID--KNG  139

Query  489  SPHNVRLYSIASSRYGDSFDGKTTSLCVRRAVY  587
             PH +RLYSIASS  GD  D KT SLCV+R VY
Sbjct  140  KPHKLRLYSIASSAIGDFADSKTVSLCVKRLVY  172



>ref|XP_011099850.1| PREDICTED: ferredoxin--NADP reductase, leaf-type isozyme, chloroplastic 
[Sesamum indicum]
Length=366

 Score =   101 bits (251),  Expect = 7e-22, Method: Compositional matrix adjust.
 Identities = 61/145 (42%), Positives = 76/145 (52%), Gaps = 2/145 (1%)
 Frame = +3

Query  165  ISFQPFDLKTRNGKSRSQYVVCMSVQQANIPKVTVSPLSLEDAKEPPLNLYKPKGPYTAT  344
            I+F    L  RN       VV +  Q A      V     +  +   +N++KPK PY   
Sbjct  34   INFNKVPLYNRNVSLAGNKVVPIRAQVATEAPAKVEKEHKKQEEGVVVNVFKPKDPYIGR  93

Query  345  IASVERIVGPKAPGETCHIVIDHGGNVPYWEGQSYGVIPPGENPKKPGSPHNVRLYSIAS  524
                 +I G  APGET H+V    G +PY EGQS GVI  GE+  K G PH +RLYSIAS
Sbjct  94   CLLNTKITGDDAPGETWHMVFSTEGKLPYREGQSIGVIADGED--KNGKPHKLRLYSIAS  151

Query  525  SRYGDSFDGKTTSLCVRRAVYYDPE  599
            S  GD  D KT SLCV+R VY + +
Sbjct  152  SAIGDFGDSKTVSLCVKRLVYQNEQ  176



>ref|NP_001045608.1| Os02g0103800 [Oryza sativa Japonica Group]
 dbj|BAD07826.1| putative ferredoxin-NADP(H) oxidoreductase [Oryza sativa Japonica 
Group]
 dbj|BAF07522.1| Os02g0103800 [Oryza sativa Japonica Group]
Length=350

 Score =   101 bits (251),  Expect = 7e-22, Method: Compositional matrix adjust.
 Identities = 53/93 (57%), Positives = 59/93 (63%), Gaps = 2/93 (2%)
 Frame = +3

Query  309  NLYKPKGPYTATIASVERIVGPKAPGETCHIVIDHGGNVPYWEGQSYGVIPPGENPKKPG  488
            N Y+PK PYT       RI G  APGET H+V    G +PY EGQS GVIP G +  K G
Sbjct  82   NKYRPKEPYTGRCLLNTRITGDDAPGETWHMVFSTDGEIPYREGQSIGVIPDGID--KNG  139

Query  489  SPHNVRLYSIASSRYGDSFDGKTTSLCVRRAVY  587
             PH +RLYSIASS  GD  D KT SLCV+R VY
Sbjct  140  KPHKLRLYSIASSAIGDFADSKTVSLCVKRLVY  172



>ref|WP_039727293.1| MULTISPECIES: ferredoxin-NADP reductase [Oscillatoriophycideae]
 gb|KIF15272.1| ferredoxin-NADP reductase [Aphanocapsa montana BDHKU210001]
 gb|KIF40187.1| ferredoxin-NADP reductase [Lyngbya confervoides BDU141951]
Length=402

 Score =   101 bits (251),  Expect = 7e-22, Method: Compositional matrix adjust.
 Identities = 54/103 (52%), Positives = 66/103 (64%), Gaps = 3/103 (3%)
 Frame = +3

Query  294  KEPPLNLYKPKGPYTATIASVERIVGPKAPGETCHIVID-HGGNVPYWEGQSYGVIPPGE  470
            K+ P+NLYKPK P  A + S E +VG    G   HI ID  G +  Y EGQS G+IP G 
Sbjct  107  KDVPVNLYKPKDPLIAKVISNEPLVGEGGSGIVQHIKIDLSGSDYHYVEGQSAGIIPDGT  166

Query  471  NPKKPGSPHNVRLYSIASSRYGDSFDGKTTSLCVRRAVYYDPE  599
            + K  G PH +RLYSIAS+++GD  D KT SLCVR+  Y DPE
Sbjct  167  DEK--GKPHKLRLYSIASTQHGDDMDDKTVSLCVRQLEYQDPE  207



>ref|WP_019504594.1| hypothetical protein [Pleurocapsa sp. PCC 7319]
Length=402

 Score =   101 bits (251),  Expect = 7e-22, Method: Compositional matrix adjust.
 Identities = 48/100 (48%), Positives = 66/100 (66%), Gaps = 3/100 (3%)
 Frame = +3

Query  303  PLNLYKPKGPYTATIASVERIVGPKAPGETCHIVID-HGGNVPYWEGQSYGVIPPGENPK  479
            P+N+Y+PK PY      +  +VG    G   H+  D  GG++ Y EGQS G++PPGE+ +
Sbjct  112  PVNIYRPKNPYIGKCTEIYDLVGEGGIGTCRHMTFDLSGGDLHYVEGQSIGIVPPGEDEQ  171

Query  480  KPGSPHNVRLYSIASSRYGDSFDGKTTSLCVRRAVYYDPE  599
              G PH +RLYSIAS+R+GD+ + KT SLCVR+  Y DPE
Sbjct  172  --GKPHKLRLYSIASTRHGDNLEDKTVSLCVRKLEYKDPE  209



>ref|XP_011043184.1| PREDICTED: ferredoxin--NADP reductase, leaf isozyme, chloroplastic 
[Populus euphratica]
Length=363

 Score =   100 bits (250),  Expect = 8e-22, Method: Compositional matrix adjust.
 Identities = 53/93 (57%), Positives = 59/93 (63%), Gaps = 2/93 (2%)
 Frame = +3

Query  309  NLYKPKGPYTATIASVERIVGPKAPGETCHIVIDHGGNVPYWEGQSYGVIPPGENPKKPG  488
            N +KPK PYT       +I G  APGET H+V    G VPY EGQS GVIP G +  K G
Sbjct  79   NKFKPKNPYTGRCLLNTKITGDDAPGETWHMVFSTEGEVPYREGQSIGVIPDGVD--KNG  136

Query  489  SPHNVRLYSIASSRYGDSFDGKTTSLCVRRAVY  587
             PH +RLYSIASS  GD  D KT SLCV+R VY
Sbjct  137  KPHKLRLYSIASSALGDFGDSKTVSLCVKRLVY  169



>ref|XP_007046687.1| Ferredoxin-NADP(+)-oxidoreductase 2 [Theobroma cacao]
 gb|EOX90844.1| Ferredoxin-NADP(+)-oxidoreductase 2 [Theobroma cacao]
Length=368

 Score =   100 bits (250),  Expect = 9e-22, Method: Compositional matrix adjust.
 Identities = 53/94 (56%), Positives = 60/94 (64%), Gaps = 2/94 (2%)
 Frame = +3

Query  306  LNLYKPKGPYTATIASVERIVGPKAPGETCHIVIDHGGNVPYWEGQSYGVIPPGENPKKP  485
            +N +KPK PYT       +I G  APGET H+V    G VPY EGQS GVIP G +  K 
Sbjct  77   VNKFKPKNPYTGRCLLNTKITGDDAPGETWHMVFSTEGEVPYREGQSIGVIPDGID--KN  134

Query  486  GSPHNVRLYSIASSRYGDSFDGKTTSLCVRRAVY  587
            G PH +RLYSIASS  GD  D KT SLCV+R VY
Sbjct  135  GKPHKLRLYSIASSALGDFGDSKTVSLCVKRLVY  168



>ref|XP_005835894.1| hypothetical protein GUITHDRAFT_162347 [Guillardia theta CCMP2712]
 gb|EKX48914.1| hypothetical protein GUITHDRAFT_162347 [Guillardia theta CCMP2712]
Length=391

 Score =   100 bits (250),  Expect = 9e-22, Method: Compositional matrix adjust.
 Identities = 56/113 (50%), Positives = 67/113 (59%), Gaps = 16/113 (14%)
 Frame = +3

Query  306  LNLYKPKGPYTATIASVERIVGPKAPGETCHIVIDHGGNV---------------PYWEG  440
            +N+ K K P    I SV+RIVGP +PGETC+I+IDH G                 P   G
Sbjct  84   VNIAKQKNPLIGKIISVQRIVGPNSPGETCNIIIDHQGQALRTLVCGADSIYRQAPLLGG  143

Query  441  QSYGVIPPGENPKKPGSPHNVRLYSIASSRYGDSFDGKTTSLCVRRAVYYDPE  599
                  PPG +PKK   P+ VRLYSIAS+RYGD   GKTT+LCVRRA Y+ PE
Sbjct  144  PVLRCRPPGIDPKK-NKPYGVRLYSIASTRYGDDKTGKTTTLCVRRATYWCPE  195



>ref|XP_010920179.1| PREDICTED: ferredoxin--NADP reductase, leaf isozyme, chloroplastic 
[Elaeis guineensis]
Length=366

 Score =   100 bits (249),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 55/111 (50%), Positives = 68/111 (61%), Gaps = 2/111 (2%)
 Frame = +3

Query  267  VSPLSLEDAKEPPLNLYKPKGPYTATIASVERIVGPKAPGETCHIVIDHGGNVPYWEGQS  446
            V  +S ++ +   +N YKPK PY        +I G  APGET H+V    G+VPY EGQS
Sbjct  68   VQKISKKNDEGVVVNKYKPKEPYIGRCLLNTKITGDDAPGETWHMVFSTEGDVPYREGQS  127

Query  447  YGVIPPGENPKKPGSPHNVRLYSIASSRYGDSFDGKTTSLCVRRAVYYDPE  599
             GVIP G +  K G PH +RLYSIASS  GD  D KT SLCV+R VY + +
Sbjct  128  IGVIPDGID--KNGKPHKLRLYSIASSALGDFGDSKTVSLCVKRLVYTNEQ  176



>ref|XP_008361344.1| PREDICTED: ferredoxin--NADP reductase, leaf isozyme, chloroplastic-like 
[Malus domestica]
Length=363

 Score =   100 bits (249),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 52/94 (55%), Positives = 60/94 (64%), Gaps = 2/94 (2%)
 Frame = +3

Query  306  LNLYKPKGPYTATIASVERIVGPKAPGETCHIVIDHGGNVPYWEGQSYGVIPPGENPKKP  485
            +N +KPK PYT  +    +I    APGET H+V    G VPY EGQS GVIP G +  K 
Sbjct  78   VNKFKPKNPYTGRVLLNTKITADDAPGETWHMVFSTEGEVPYREGQSIGVIPDGID--KN  135

Query  486  GSPHNVRLYSIASSRYGDSFDGKTTSLCVRRAVY  587
            G PH +RLYSIASS  GD  D KT SLCV+R VY
Sbjct  136  GKPHKLRLYSIASSALGDFGDSKTVSLCVKRLVY  169



>ref|WP_015203026.1| ferredoxin--NADP(+) reductase [Crinalium epipsammum]
 gb|AFZ12910.1| Ferredoxin--NADP(+) reductase [Crinalium epipsammum PCC 9333]
Length=418

 Score =   100 bits (250),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 52/124 (42%), Positives = 73/124 (59%), Gaps = 3/124 (2%)
 Frame = +3

Query  231  MSVQQANIPKVTVSPLSLEDAKEPPLNLYKPKGPYTATIASVERIVGPKAPGETCHIVID  410
            M+  ++  P     P + +   + P+N+Y+P  PY     S E +VG    G   H++ D
Sbjct  102  MTQTESVQPVTETKPKAKKAESDVPVNIYRPNSPYIGKCLSNEELVGEGGIGTVRHLIFD  161

Query  411  -HGGNVPYWEGQSYGVIPPGENPKKPGSPHNVRLYSIASSRYGDSFDGKTTSLCVRRAVY  587
              GG++ Y EGQS G+IPPG + K    PH +RLYSIAS+R+GD+ D KT SLCVR+  Y
Sbjct  162  ISGGDLRYLEGQSIGIIPPGTDKKD--KPHKLRLYSIASTRHGDAVDDKTVSLCVRQLEY  219

Query  588  YDPE  599
              PE
Sbjct  220  KHPE  223



>ref|XP_011010543.1| PREDICTED: ferredoxin--NADP reductase, leaf isozyme, chloroplastic-like 
[Populus euphratica]
Length=363

 Score =   100 bits (249),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 58/127 (46%), Positives = 71/127 (56%), Gaps = 2/127 (2%)
 Frame = +3

Query  207  SRSQYVVCMSVQQANIPKVTVSPLSLEDAKEPPLNLYKPKGPYTATIASVERIVGPKAPG  386
            S S  V+ +  Q        V  +S ++ +   +N +KPK PY        +I G  APG
Sbjct  45   SASGRVISIRAQVTTEAPAKVEKVSKKNDEGVVVNKFKPKNPYIGRCLLNTKITGDDAPG  104

Query  387  ETCHIVIDHGGNVPYWEGQSYGVIPPGENPKKPGSPHNVRLYSIASSRYGDSFDGKTTSL  566
            ET H+V    G VPY EGQS GVIP G +  K G PH +RLYSIASS  GD  D KT SL
Sbjct  105  ETWHMVFSTEGEVPYREGQSIGVIPDGID--KNGKPHKLRLYSIASSALGDFGDSKTVSL  162

Query  567  CVRRAVY  587
            CV+R VY
Sbjct  163  CVKRLVY  169



>ref|WP_026720816.1| ferredoxin-NADP reductase [Fischerella sp. PCC 9431]
Length=427

 Score =   100 bits (250),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 67/178 (38%), Positives = 91/178 (51%), Gaps = 23/178 (13%)
 Frame = +3

Query  75   VSVAVALNGDSSLQRSAFKAN--SITFNNRSPISFQPFDLKTRNGKSRSQYVVCMSVQQA  248
            VSV    NG ++   SA++ N  +   N   P+  QP   +T+ GK+ +Q          
Sbjct  75   VSVLQQTNGKATSAESAYEGNGNATPVNAEPPVQQQPQKNETK-GKTMTQ----------  123

Query  249  NIPKVTVSPLSLEDAKEPPLNLYKPKGPYTATIASVERIVGPKAPGETCHIVID-HGGNV  425
                   +    +   + P+NLY+P  PY     S E +VG    G   H+  D  GGN+
Sbjct  124  -------AKAKKDAHADVPVNLYRPNAPYIGKCISNEALVGENGIGIVQHLKFDLSGGNL  176

Query  426  PYWEGQSYGVIPPGENPKKPGSPHNVRLYSIASSRYGDSFDGKTTSLCVRRAVYYDPE  599
             Y EGQS G+IPPG +  K G P  +RLYSIAS+R+GD  D KT SLCVR+  Y  PE
Sbjct  177  RYIEGQSIGIIPPGVD--KNGKPEKLRLYSIASTRHGDDVDDKTVSLCVRQLEYKHPE  232



>ref|WP_016860625.1| ferredoxin--NADP reductase [Fischerella muscicola]
Length=427

 Score =   100 bits (250),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 67/178 (38%), Positives = 91/178 (51%), Gaps = 23/178 (13%)
 Frame = +3

Query  75   VSVAVALNGDSSLQRSAFKAN--SITFNNRSPISFQPFDLKTRNGKSRSQYVVCMSVQQA  248
            VSV    NG ++   SA++ N  +   N   P+  QP   +T+ GK+ +Q          
Sbjct  75   VSVLQQTNGKATSAESAYEGNGNATPVNAEPPVQQQPQKNETK-GKTMTQ----------  123

Query  249  NIPKVTVSPLSLEDAKEPPLNLYKPKGPYTATIASVERIVGPKAPGETCHIVID-HGGNV  425
                   +    +   + P+NLY+P  PY     S E +VG    G   H+  D  GGN+
Sbjct  124  -------AKAKKDAHADVPVNLYRPNAPYIGKCISNEALVGENGIGIVQHLKFDLSGGNL  176

Query  426  PYWEGQSYGVIPPGENPKKPGSPHNVRLYSIASSRYGDSFDGKTTSLCVRRAVYYDPE  599
             Y EGQS G+IPPG +  K G P  +RLYSIAS+R+GD  D KT SLCVR+  Y  PE
Sbjct  177  RYIEGQSIGIIPPGLD--KNGKPEKLRLYSIASTRHGDDVDDKTVSLCVRQLEYKHPE  232



>ref|XP_010113341.1| Ferredoxin--NADP reductase, leaf isozyme [Morus notabilis]
 gb|EXC35348.1| Ferredoxin--NADP reductase, leaf isozyme [Morus notabilis]
Length=357

 Score =   100 bits (248),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 55/111 (50%), Positives = 65/111 (59%), Gaps = 2/111 (2%)
 Frame = +3

Query  255  PKVTVSPLSLEDAKEPPLNLYKPKGPYTATIASVERIVGPKAPGETCHIVIDHGGNVPYW  434
            P   V  +S ++ +    N +KPK PY        +I G  APGET H+V    G VPY 
Sbjct  55   PAKKVEKVSKKNEEGVVTNKFKPKNPYVGRCLLNTKITGDDAPGETWHMVFSTEGEVPYR  114

Query  435  EGQSYGVIPPGENPKKPGSPHNVRLYSIASSRYGDSFDGKTTSLCVRRAVY  587
            EGQS GVI  GE+  K G PH +RLYSIASS  GD  D KT SLCV+R VY
Sbjct  115  EGQSIGVIADGED--KNGKPHKLRLYSIASSALGDFGDSKTVSLCVKRLVY  163



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 774982056510