BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFF037K03

Length=578
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

gb|EYU35034.1|  hypothetical protein MIMGU_mgv1a003127mg              95.9    2e-27   Erythranthe guttata [common monkey flower]
ref|XP_011087626.1|  PREDICTED: auxin response factor 1-like          95.1    3e-27   Sesamum indicum [beniseed]
ref|XP_010912873.1|  PREDICTED: auxin response factor 7-like          93.6    2e-26   
ref|XP_008795276.1|  PREDICTED: auxin response factor 7-like isof...  92.8    3e-26   Phoenix dactylifera
ref|XP_008795277.1|  PREDICTED: auxin response factor 7-like isof...  92.8    3e-26   Phoenix dactylifera
ref|XP_010930543.1|  PREDICTED: auxin response factor 7-like          92.4    4e-26   Elaeis guineensis
gb|ACN31160.1|  unknown                                               93.2    5e-26   Zea mays [maize]
ref|XP_010252371.1|  PREDICTED: auxin response factor 1               92.0    5e-26   Nelumbo nucifera [Indian lotus]
ref|XP_008786460.1|  PREDICTED: auxin response factor 7-like          92.0    5e-26   Phoenix dactylifera
ref|NP_001152338.1|  LOC100285977                                     92.8    6e-26   Zea mays [maize]
ref|XP_002453992.1|  hypothetical protein SORBIDRAFT_04g022830        92.8    6e-26   Sorghum bicolor [broomcorn]
ref|XP_006349280.1|  PREDICTED: auxin response factor 1-like isof...  92.8    8e-26   Solanum tuberosum [potatoes]
gb|ADG43148.1|  auxin response factor 14                              92.4    1e-25   Zea mays [maize]
ref|XP_010657917.1|  PREDICTED: auxin response factor 1 isoform X2    91.7    1e-25   Vitis vinifera
ref|XP_002268348.2|  PREDICTED: auxin response factor 1 isoform X1    91.7    1e-25   Vitis vinifera
ref|NP_001183800.1|  hypothetical protein                             92.0    1e-25   
ref|XP_008460595.1|  PREDICTED: auxin response factor 1               93.2    1e-25   Cucumis melo [Oriental melon]
ref|XP_010323707.1|  PREDICTED: auxin response factor 1 isoform X1    92.0    2e-25   
ref|NP_001234871.1|  auxin response factor 1                          92.0    2e-25   
ref|XP_004142338.1|  PREDICTED: auxin response factor 1-like          92.8    2e-25   
ref|XP_003575147.1|  PREDICTED: auxin response factor 7-like          94.0    2e-25   
gb|KGN49710.1|  hypothetical protein Csa_5G077780                     92.4    2e-25   Cucumis sativus [cucumbers]
ref|XP_006653437.1|  PREDICTED: auxin response factor 9-like          94.7    3e-25   Oryza brachyantha
ref|XP_004952778.1|  PREDICTED: auxin response factor 7-like isof...  90.1    3e-25   
ref|XP_004485416.1|  PREDICTED: auxin response factor 1-like isof...  89.0    3e-25   Cicer arietinum [garbanzo]
ref|XP_010682136.1|  PREDICTED: auxin response factor 1               92.0    3e-25   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_009627009.1|  PREDICTED: auxin response factor 1               92.0    3e-25   Nicotiana tomentosiformis
ref|XP_009786487.1|  PREDICTED: auxin response factor 1               92.0    4e-25   Nicotiana sylvestris
gb|ABO80473.1|  AUX/IAA protein; Transcriptional factor B3; Auxin...  89.0    5e-25   Medicago truncatula
ref|XP_007148592.1|  hypothetical protein PHAVU_006G221500g           88.6    6e-25   Phaseolus vulgaris [French bean]
ref|XP_003592874.1|  Auxin response factor                            88.6    7e-25   Medicago truncatula
ref|XP_004172315.1|  PREDICTED: auxin response factor 1-like          92.0    7e-25   
ref|XP_003548301.1|  PREDICTED: auxin response factor 1-like isof...  88.2    8e-25   Glycine max [soybeans]
gb|KHN11044.1|  Auxin response factor 1                               88.2    8e-25   Glycine soja [wild soybean]
ref|XP_006598778.1|  PREDICTED: auxin response factor 1-like isof...  87.8    8e-25   
ref|XP_006598779.1|  PREDICTED: auxin response factor 1-like isof...  87.8    9e-25   Glycine max [soybeans]
emb|CAE02512.1|  P0076O17.10                                          92.8    1e-24   Oryza sativa Japonica Group [Japonica rice]
ref|XP_009404302.1|  PREDICTED: auxin response factor 7-like          93.2    1e-24   Musa acuminata subsp. malaccensis [pisang utan]
gb|EEC77345.1|  hypothetical protein OsI_16025                        92.4    2e-24   Oryza sativa Indica Group [Indian rice]
ref|XP_009406473.1|  PREDICTED: auxin response factor 7-like isof...  92.0    2e-24   
ref|NP_001052879.1|  Os04g0442000                                     92.0    2e-24   
emb|CAE04227.2|  OSJNBa0064D20.11                                     92.0    2e-24   Oryza sativa Japonica Group [Japonica rice]
ref|XP_011003708.1|  PREDICTED: auxin response factor 1-like          85.9    3e-24   Populus euphratica
ref|XP_003540131.1|  PREDICTED: auxin response factor 1-like          87.8    3e-24   Glycine max [soybeans]
ref|XP_011092260.1|  PREDICTED: auxin response factor 1 isoform X1    89.4    3e-24   Sesamum indicum [beniseed]
gb|EPS68815.1|  auxin response factor 1                               90.1    3e-24   Genlisea aurea
ref|XP_009379878.1|  PREDICTED: auxin response factor 7-like          94.7    3e-24   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_011092261.1|  PREDICTED: auxin response factor 1 isoform X2    89.4    4e-24   Sesamum indicum [beniseed]
ref|XP_010099783.1|  Auxin response factor 1                          88.6    4e-24   
gb|AIR95657.1|  auxin response factor 1 family protein                85.1    4e-24   Populus davidiana x Populus alba var. pyramidalis
ref|XP_004975691.1|  PREDICTED: auxin response factor 9-like          92.8    4e-24   Setaria italica
gb|KDP42510.1|  hypothetical protein JCGZ_00307                       84.7    5e-24   Jatropha curcas
ref|XP_006648743.1|  PREDICTED: auxin response factor 7-like          92.8    6e-24   Oryza brachyantha
gb|EEC73404.1|  hypothetical protein OsI_07659                        93.2    6e-24   Oryza sativa Indica Group [Indian rice]
ref|NP_001047137.1|  Os02g0557200                                     93.2    6e-24   
ref|XP_010548428.1|  PREDICTED: auxin response factor 1               86.3    8e-24   Tarenaya hassleriana [spider flower]
ref|XP_009406475.1|  PREDICTED: auxin response factor 7-like isof...  90.5    8e-24   
ref|XP_006385188.1|  auxin response factor 1 family protein           84.0    9e-24   Populus trichocarpa [western balsam poplar]
emb|CBA11999.1|  putative auxin response factor 1                     87.8    9e-24   Illicium parviflorum
ref|XP_008218645.1|  PREDICTED: auxin response factor 1               87.4    9e-24   Prunus mume [ume]
ref|XP_007225153.1|  hypothetical protein PRUPE_ppa002394mg           87.4    9e-24   Prunus persica
gb|KHG03459.1|  Auxin response factor 1 -like protein                 89.4    1e-23   Gossypium arboreum [tree cotton]
ref|XP_010065238.1|  PREDICTED: auxin response factor 1 isoform X1    88.6    1e-23   Eucalyptus grandis [rose gum]
ref|XP_002446522.1|  hypothetical protein SORBIDRAFT_06g017490        91.3    1e-23   Sorghum bicolor [broomcorn]
ref|XP_008669376.1|  PREDICTED: auxin response factor 9-like isof...  91.3    1e-23   
gb|KCW62583.1|  hypothetical protein EUGRSUZ_G00076                   88.2    1e-23   Eucalyptus grandis [rose gum]
ref|XP_007153915.1|  hypothetical protein PHAVU_003G075800g           85.5    1e-23   Phaseolus vulgaris [French bean]
gb|KCW62582.1|  hypothetical protein EUGRSUZ_G00076                   88.2    2e-23   Eucalyptus grandis [rose gum]
gb|KJB70781.1|  hypothetical protein B456_011G091100                  89.0    2e-23   Gossypium raimondii
gb|ADG43140.1|  auxin response factor 6                               90.9    2e-23   Zea mays [maize]
ref|XP_006470826.1|  PREDICTED: auxin response factor 1-like isof...  85.5    2e-23   Citrus sinensis [apfelsine]
ref|XP_008669375.1|  PREDICTED: auxin response factor 9-like isof...  90.9    2e-23   Zea mays [maize]
gb|KHN40198.1|  Auxin response factor 1                               85.1    2e-23   Glycine soja [wild soybean]
ref|XP_003528726.1|  PREDICTED: auxin response factor 1-like          85.1    2e-23   Glycine max [soybeans]
ref|XP_006470825.1|  PREDICTED: auxin response factor 1-like isof...  85.5    2e-23   Citrus sinensis [apfelsine]
ref|XP_006431443.1|  hypothetical protein CICLE_v10000491mg           85.1    2e-23   Citrus clementina [clementine]
emb|CBI16989.3|  unnamed protein product                              89.4    2e-23   Vitis vinifera
ref|XP_006470824.1|  PREDICTED: auxin response factor 1-like isof...  85.1    2e-23   Citrus sinensis [apfelsine]
ref|XP_002527835.1|  Auxin response factor, putative                  85.1    2e-23   
ref|XP_006470822.1|  PREDICTED: auxin response factor 1-like isof...  85.1    2e-23   Citrus sinensis [apfelsine]
ref|XP_002266947.1|  PREDICTED: auxin response factor 1-like          89.4    2e-23   Vitis vinifera
ref|XP_007023118.1|  Auxin response factor 1 isoform 1                85.5    2e-23   Theobroma cacao [chocolate]
ref|XP_010239942.1|  PREDICTED: auxin response factor 9-like          89.4    2e-23   Brachypodium distachyon [annual false brome]
ref|XP_008378943.1|  PREDICTED: auxin response factor 1               87.8    2e-23   
ref|XP_010065240.1|  PREDICTED: auxin response factor 1 isoform X2    87.8    3e-23   Eucalyptus grandis [rose gum]
ref|XP_009416967.1|  PREDICTED: auxin response factor 7-like          87.4    3e-23   
ref|XP_009355376.1|  PREDICTED: auxin response factor 1               87.4    3e-23   Pyrus x bretschneideri [bai li]
gb|ACX68650.3|  auxin response factor                                 84.0    4e-23   Dimocarpus longan [longan]
ref|XP_006385086.1|  hypothetical protein POPTR_0004s23770g           85.1    4e-23   
ref|XP_007023119.1|  Auxin response factor 1 isoform 2                85.1    4e-23   
ref|XP_004300014.1|  PREDICTED: auxin response factor 1               87.0    4e-23   Fragaria vesca subsp. vesca
ref|XP_011028402.1|  PREDICTED: auxin response factor 1               84.3    6e-23   Populus euphratica
gb|AAZ81521.1|  auxin response factor 1                               87.0    6e-23   Gossypium barbadense [Egyptian cotton]
gb|EMT27061.1|  Auxin response factor 9                               89.7    8e-23   
ref|XP_006431458.1|  hypothetical protein CICLE_v10003317mg           82.0    1e-22   
emb|CDO97653.1|  unnamed protein product                              77.8    8e-22   Coffea canephora [robusta coffee]
ref|XP_006392241.1|  hypothetical protein EUTSA_v10023326mg           81.6    1e-21   
emb|CDY27291.1|  BnaC04g18710D                                        80.5    3e-21   Brassica napus [oilseed rape]
ref|XP_009103121.1|  PREDICTED: auxin response factor 1 isoform X1    81.3    4e-21   Brassica rapa
ref|XP_009103143.1|  PREDICTED: auxin response factor 1 isoform X2    81.3    4e-21   Brassica rapa
emb|CDY33603.1|  BnaC01g28340D                                        81.3    4e-21   Brassica napus [oilseed rape]
emb|CDY65065.1|  BnaA01g35830D                                        80.9    4e-21   Brassica napus [oilseed rape]
gb|AAM91657.1|  auxin response factor 1                               82.0    6e-21   Arabidopsis thaliana [mouse-ear cress]
ref|NP_849830.1|  auxin response factor 1                             81.6    7e-21   Arabidopsis thaliana [mouse-ear cress]
ref|NP_176184.1|  auxin response factor 1                             81.6    7e-21   Arabidopsis thaliana [mouse-ear cress]
ref|NP_001185266.1|  auxin response factor 1                          81.6    7e-21   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006300434.1|  hypothetical protein CARUB_v10022415mg           81.3    8e-21   Capsella rubella
ref|XP_002888184.1|  hypothetical protein ARALYDRAFT_475338           81.3    9e-21   
ref|XP_010414657.1|  PREDICTED: auxin response factor 1-like isof...  80.5    1e-20   Camelina sativa [gold-of-pleasure]
ref|XP_010414655.1|  PREDICTED: auxin response factor 1-like isof...  80.5    1e-20   Camelina sativa [gold-of-pleasure]
ref|XP_010470201.1|  PREDICTED: auxin response factor 1-like isof...  80.5    1e-20   Camelina sativa [gold-of-pleasure]
ref|XP_010511014.1|  PREDICTED: auxin response factor 1 isoform X2    80.5    1e-20   Camelina sativa [gold-of-pleasure]
ref|XP_010470197.1|  PREDICTED: auxin response factor 1-like isof...  80.5    2e-20   Camelina sativa [gold-of-pleasure]
ref|XP_010511012.1|  PREDICTED: auxin response factor 1 isoform X1    80.5    2e-20   Camelina sativa [gold-of-pleasure]
ref|XP_009403719.1|  PREDICTED: auxin response factor 7-like          84.3    2e-20   Musa acuminata subsp. malaccensis [pisang utan]
pdb|4LDX|A  Chain A, Crystal Structure Of The Dna Binding Domain ...  80.1    3e-20   Arabidopsis thaliana [mouse-ear cress]
pdb|4LDV|A  Chain A, Crystal Structure Of The Dna Binding Domain ...  80.1    3e-20   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010418847.1|  PREDICTED: auxin response factor 1-like          79.7    3e-20   
pdb|4LDY|A  Chain A, Crystal Structure Of The Dna Binding Domain ...  77.8    2e-19   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009406474.1|  PREDICTED: auxin response factor 7-like isof...  92.4    3e-18   
ref|XP_010523816.1|  PREDICTED: auxin response factor 18-like iso...  84.0    5e-18   Tarenaya hassleriana [spider flower]
ref|XP_010523815.1|  PREDICTED: auxin response factor 18-like iso...  84.0    5e-18   Tarenaya hassleriana [spider flower]
tpg|DAA37676.1|  TPA: hypothetical protein ZEAMMB73_822305            89.0    7e-18   
ref|XP_010924913.1|  PREDICTED: LOW QUALITY PROTEIN: auxin respon...  81.3    1e-17   
ref|XP_010544846.1|  PREDICTED: auxin response factor 18              80.5    4e-17   Tarenaya hassleriana [spider flower]
ref|XP_006852604.1|  hypothetical protein AMTR_s00021p00221770        72.4    6e-17   Amborella trichopoda
emb|CBA11993.1|  putative auxin response factor 2                     83.6    1e-16   Amborella trichopoda
gb|ADW11246.1|  putative auxin response factor                        65.9    1e-16   Gossypium hirsutum [American cotton]
gb|EMT17168.1|  Auxin response factor 4                               82.4    1e-16   
ref|XP_009421032.1|  PREDICTED: auxin response factor 24-like iso...  84.0    2e-16   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009421031.1|  PREDICTED: auxin response factor 24-like iso...  84.0    2e-16   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009116845.1|  PREDICTED: auxin response factor 18              79.7    2e-16   Brassica rapa
gb|EMT09779.1|  Auxin response factor 4                               84.0    2e-16   
gb|EMS58454.1|  Auxin response factor 4                               81.6    2e-16   Triticum urartu
ref|XP_008806441.1|  PREDICTED: auxin response factor 18-like iso...  80.9    3e-16   
dbj|BAK03995.1|  predicted protein                                    82.0    3e-16   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|AFD01315.1|  auxin response factor 18-1                            78.6    3e-16   Brassica rapa subsp. pekinensis [bai cai]
ref|XP_008806468.1|  PREDICTED: auxin response factor 18-like iso...  80.5    4e-16   Phoenix dactylifera
ref|XP_010696146.1|  PREDICTED: auxin response factor 18-like         78.6    4e-16   Beta vulgaris subsp. vulgaris [field beet]
gb|KFK28953.1|  hypothetical protein AALP_AA7G070000                  79.3    4e-16   Arabis alpina [alpine rockcress]
dbj|BAJ96055.1|  predicted protein                                    82.8    5e-16   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|EMS47784.1|  Auxin response factor 4                               82.8    5e-16   Triticum urartu
ref|XP_006855394.1|  hypothetical protein AMTR_s00057p00141830        82.4    5e-16   
ref|XP_003564986.1|  PREDICTED: auxin response factor 4-like          84.0    8e-16   Brachypodium distachyon [annual false brome]
gb|AAW82475.1|  auxin response factor 2                               81.3    8e-16   Triticum aestivum [Canadian hard winter wheat]
gb|KFK35371.1|  hypothetical protein AALP_AA5G276400                  78.2    8e-16   Arabis alpina [alpine rockcress]
emb|CDM85878.1|  unnamed protein product                              82.0    9e-16   Triticum aestivum [Canadian hard winter wheat]
ref|XP_008811924.1|  PREDICTED: auxin response factor 23-like         79.7    9e-16   Phoenix dactylifera
ref|XP_006844540.1|  hypothetical protein AMTR_s00016p00168950        80.1    1e-15   
tpg|DAA56015.1|  TPA: hypothetical protein ZEAMMB73_705793            81.6    1e-15   
ref|XP_002456888.1|  hypothetical protein SORBIDRAFT_03g044630        81.6    1e-15   
gb|EYU21819.1|  hypothetical protein MIMGU_mgv1a001371mg              80.5    1e-15   Erythranthe guttata [common monkey flower]
gb|EYU21820.1|  hypothetical protein MIMGU_mgv1a001371mg              80.1    1e-15   Erythranthe guttata [common monkey flower]
gb|AFW84065.1|  hypothetical protein ZEAMMB73_313624                  81.6    1e-15   
ref|XP_004971147.1|  PREDICTED: auxin response factor 4-like isof...  81.3    1e-15   Setaria italica
gb|ADG43144.1|  auxin response factor 10                              81.3    1e-15   Zea mays [maize]
ref|XP_004971148.1|  PREDICTED: auxin response factor 4-like isof...  80.9    2e-15   Setaria italica
gb|KHG18665.1|  Auxin response factor 18 -like protein                74.3    2e-15   Gossypium arboreum [tree cotton]
ref|XP_008672541.1|  PREDICTED: uncharacterized protein LOC100274...  80.9    2e-15   
ref|XP_006646638.1|  PREDICTED: auxin response factor 4-like          80.1    2e-15   
ref|XP_006346635.1|  PREDICTED: auxin response factor 2-like          80.9    2e-15   Solanum tuberosum [potatoes]
dbj|BAB85913.1|  auxin response factor 2                              80.5    2e-15   Oryza sativa [red rice]
ref|NP_001045270.1|  Os01g0927600                                     80.5    2e-15   
gb|EEC72083.1|  hypothetical protein OsI_05027                        80.1    2e-15   Oryza sativa Indica Group [Indian rice]
ref|XP_010044876.1|  PREDICTED: auxin response factor 2-like          79.3    2e-15   Eucalyptus grandis [rose gum]
emb|CBA11996.1|  putative auxin response factor 2                     81.3    2e-15   Cabomba aquatica
gb|ADG43159.1|  auxin response factor 25                              80.5    2e-15   Zea mays [maize]
gb|ACN34502.1|  unknown                                               80.5    2e-15   Zea mays [maize]
ref|XP_011073189.1|  PREDICTED: auxin response factor 2-like          80.1    2e-15   Sesamum indicum [beniseed]
ref|XP_008656904.1|  PREDICTED: auxin response factor 4               80.5    2e-15   
gb|AFW84067.1|  hypothetical protein ZEAMMB73_313624                  80.5    2e-15   
gb|EEE55935.1|  hypothetical protein OsJ_04626                        79.7    3e-15   Oryza sativa Japonica Group [Japonica rice]
emb|CAC83756.1|  auxin response factor 1                              81.3    3e-15   Oryza sativa Japonica Group [Japonica rice]
ref|XP_009625132.1|  PREDICTED: auxin response factor 2-like isof...  80.9    3e-15   Nicotiana tomentosiformis
ref|XP_006402437.1|  hypothetical protein EUTSA_v10005857mg           77.0    3e-15   Eutrema salsugineum [saltwater cress]
ref|XP_009769543.1|  PREDICTED: auxin response factor 2-like isof...  80.9    3e-15   Nicotiana sylvestris
gb|KEH18629.1|  auxin response factor 2                               76.6    3e-15   Medicago truncatula
sp|Q2R3F5.2|ARFW_ORYSJ  RecName: Full=Auxin response factor 23; A...  80.9    3e-15   Oryza sativa Japonica Group [Japonica rice]
ref|NP_001067988.1|  Os11g0523800                                     80.9    3e-15   
ref|XP_007038118.1|  Auxin response factor-like protein isoform 1     80.1    3e-15   
gb|ABG22497.1|  Auxin response factor 2, putative, expressed          80.9    3e-15   Oryza sativa Japonica Group [Japonica rice]
ref|XP_009404739.1|  PREDICTED: auxin response factor 23-like iso...  79.7    4e-15   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009404741.1|  PREDICTED: auxin response factor 23-like iso...  79.7    4e-15   Musa acuminata subsp. malaccensis [pisang utan]
sp|A2ZET6.1|ARFW_ORYSI  RecName: Full=Auxin response factor 23; A...  80.9    4e-15   Oryza sativa Indica Group [Indian rice]
ref|XP_009404740.1|  PREDICTED: auxin response factor 23-like iso...  79.7    4e-15   Musa acuminata subsp. malaccensis [pisang utan]
gb|AAG43286.2|AF140228_1  putative auxin response factor 1            80.9    4e-15   Oryza sativa Indica Group [Indian rice]
ref|XP_006279989.1|  hypothetical protein CARUB_v10025860mg           79.0    4e-15   
emb|CDY00245.1|  BnaA06g21460D                                        79.0    4e-15   
ref|XP_009151321.1|  PREDICTED: auxin response factor 2               79.0    4e-15   Brassica rapa
ref|XP_004252281.1|  PREDICTED: auxin response factor 2-like          80.9    4e-15   Solanum lycopersicum
ref|XP_002268849.1|  PREDICTED: auxin response factor 2-like          79.7    4e-15   Vitis vinifera
ref|XP_009625131.1|  PREDICTED: auxin response factor 2-like isof...  80.1    4e-15   Nicotiana tomentosiformis
ref|XP_011083049.1|  PREDICTED: auxin response factor 2               80.5    4e-15   Sesamum indicum [beniseed]
ref|XP_009769542.1|  PREDICTED: auxin response factor 2-like isof...  80.1    4e-15   Nicotiana sylvestris
ref|XP_003520877.1|  PREDICTED: auxin response factor 9-like isof...  72.8    5e-15   
ref|XP_010237689.1|  PREDICTED: auxin response factor 23-like iso...  80.9    5e-15   
ref|XP_010237692.1|  PREDICTED: auxin response factor 23-like iso...  80.9    5e-15   
gb|KHN16426.1|  Auxin response factor 18                              72.8    5e-15   Glycine soja [wild soybean]
ref|XP_010100721.1|  Auxin response factor 18                         74.7    5e-15   
gb|KHG08457.1|  Auxin response factor 2 -like protein                 78.2    5e-15   Gossypium arboreum [tree cotton]
ref|XP_006394444.1|  hypothetical protein EUTSA_v10003641mg           78.6    5e-15   Eutrema salsugineum [saltwater cress]
ref|XP_009410807.1|  PREDICTED: auxin response factor 18-like iso...  77.4    5e-15   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_002864764.1|  hypothetical protein ARALYDRAFT_919450           78.6    5e-15   
gb|KJB40059.1|  hypothetical protein B456_007G044900                  78.2    5e-15   Gossypium raimondii
dbj|BAJ34183.1|  unnamed protein product                              78.6    5e-15   Eutrema halophilum
ref|XP_010324457.1|  PREDICTED: auxin response factor 12 isoform X2   75.5    5e-15   
ref|NP_001190591.1|  auxin response factor 2                          78.6    5e-15   Arabidopsis thaliana [mouse-ear cress]
dbj|BAD93968.1|  ARF1-binding protein                                 78.6    5e-15   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010483894.1|  PREDICTED: auxin response factor 2               78.6    5e-15   Camelina sativa [gold-of-pleasure]
emb|CBI35669.3|  unnamed protein product                              79.3    5e-15   Vitis vinifera
ref|NP_851244.1|  auxin response factor 2                             78.6    6e-15   Arabidopsis thaliana [mouse-ear cress]
dbj|BAD93891.1|  ARF1-binding protein                                 78.6    6e-15   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002322300.1|  auxin response factor 2 family protein           79.0    6e-15   Populus trichocarpa [western balsam poplar]
ref|XP_010458051.1|  PREDICTED: auxin response factor 2-like isof...  78.6    6e-15   Camelina sativa [gold-of-pleasure]
ref|XP_010324454.1|  PREDICTED: auxin response factor 12 isoform X1   75.5    6e-15   
gb|KFK37437.1|  auxin response factor 11                              77.0    6e-15   Arabis alpina [alpine rockcress]
ref|XP_010458034.1|  PREDICTED: auxin response factor 2-like isof...  78.6    6e-15   Camelina sativa [gold-of-pleasure]
ref|XP_006436945.1|  hypothetical protein CICLE_v10030696mg           78.6    6e-15   Citrus clementina [clementine]
emb|CDX86939.1|  BnaC03g52090D                                        79.0    7e-15   
ref|NP_001275789.1|  auxin-response factor                            78.6    7e-15   Citrus sinensis [apfelsine]
ref|XP_009130187.1|  PREDICTED: auxin response factor 2-like          78.2    7e-15   Brassica rapa
ref|XP_006436944.1|  hypothetical protein CICLE_v10030696mg           78.6    7e-15   
ref|XP_008791039.1|  PREDICTED: auxin response factor 23-like iso...  77.8    7e-15   Phoenix dactylifera
ref|XP_008791040.1|  PREDICTED: auxin response factor 23-like iso...  77.8    7e-15   Phoenix dactylifera
ref|XP_010318417.1|  PREDICTED: auxin response factor 2 isoform X2    80.5    7e-15   Solanum lycopersicum
gb|KJB40060.1|  hypothetical protein B456_007G044900                  77.8    7e-15   Gossypium raimondii
ref|NP_001233765.1|  auxin response factor 2                          80.1    8e-15   Solanum lycopersicum
gb|KJB40061.1|  hypothetical protein B456_007G044900                  77.8    8e-15   Gossypium raimondii
ref|XP_006341482.1|  PREDICTED: auxin response factor 2-like          80.1    8e-15   Solanum tuberosum [potatoes]
ref|XP_010942377.1|  PREDICTED: auxin response factor 23-like         80.1    8e-15   
ref|XP_004297494.1|  PREDICTED: auxin response factor 2               79.0    8e-15   Fragaria vesca subsp. vesca
gb|KJB07943.1|  hypothetical protein B456_001G054600                  78.6    9e-15   Gossypium raimondii
gb|KDO51288.1|  hypothetical protein CISIN_1g004792mg                 77.8    1e-14   Citrus sinensis [apfelsine]
ref|XP_004138020.1|  PREDICTED: auxin response factor 2-like          79.0    1e-14   Cucumis sativus [cucumbers]
ref|XP_004172696.1|  PREDICTED: auxin response factor 2-like          79.0    1e-14   
ref|XP_006339725.1|  PREDICTED: auxin response factor 9-like isof...  73.2    1e-14   Solanum tuberosum [potatoes]
gb|AFW60884.1|  auxin response factor                                 81.3    1e-14   
ref|XP_010327130.1|  PREDICTED: auxin response factor 18              73.2    1e-14   Solanum lycopersicum
ref|XP_010250544.1|  PREDICTED: auxin response factor 2-like isof...  79.0    1e-14   Nelumbo nucifera [Indian lotus]
gb|AAK55665.1|AF378862_1  AT5g62000/mtg10_20                          77.8    1e-14   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006397845.1|  hypothetical protein EUTSA_v10001365mg           81.3    1e-14   Eutrema salsugineum [saltwater cress]
gb|KDP22546.1|  hypothetical protein JCGZ_26377                       77.4    1e-14   Jatropha curcas
gb|KDO51287.1|  hypothetical protein CISIN_1g004792mg                 77.8    1e-14   Citrus sinensis [apfelsine]
emb|CDP19763.1|  unnamed protein product                              78.2    1e-14   Coffea canephora [robusta coffee]
ref|XP_006339723.1|  PREDICTED: auxin response factor 9-like isof...  72.8    1e-14   Solanum tuberosum [potatoes]
dbj|BAJ34449.1|  unnamed protein product                              81.6    1e-14   Eutrema halophilum
ref|XP_007038119.1|  Auxin response factor-like protein isoform 2     78.2    1e-14   
ref|XP_008790699.1|  PREDICTED: auxin response factor 4-like isof...  77.4    1e-14   Phoenix dactylifera
ref|XP_006339724.1|  PREDICTED: auxin response factor 9-like isof...  72.8    1e-14   Solanum tuberosum [potatoes]
ref|XP_006352241.1|  PREDICTED: auxin response factor 9-like isof...  73.6    1e-14   Solanum tuberosum [potatoes]
ref|XP_006352240.1|  PREDICTED: auxin response factor 9-like isof...  73.6    1e-14   Solanum tuberosum [potatoes]
ref|XP_010250545.1|  PREDICTED: auxin response factor 2-like isof...  78.6    1e-14   Nelumbo nucifera [Indian lotus]
ref|XP_002511100.1|  Auxin response factor, putative                  79.3    1e-14   
ref|XP_004979363.1|  PREDICTED: auxin response factor 23-like iso...  80.9    2e-14   
ref|XP_004979364.1|  PREDICTED: auxin response factor 23-like iso...  80.9    2e-14   
ref|XP_008790695.1|  PREDICTED: auxin response factor 4-like isof...  77.0    2e-14   Phoenix dactylifera
ref|XP_002876640.1|  hypothetical protein ARALYDRAFT_349241           75.5    2e-14   
ref|XP_003523174.1|  PREDICTED: auxin response factor 2-like          78.6    2e-14   Glycine max [soybeans]
gb|EPS63285.1|  auxin response factor 2                               76.6    2e-14   Genlisea aurea
gb|EYU24518.1|  hypothetical protein MIMGU_mgv1a003422mg              79.0    2e-14   Erythranthe guttata [common monkey flower]
ref|XP_010249208.1|  PREDICTED: auxin response factor 2-like isof...  79.7    2e-14   
ref|XP_010469026.1|  PREDICTED: auxin response factor 18-like         75.5    2e-14   Camelina sativa [gold-of-pleasure]
ref|XP_008676891.1|  PREDICTED: uncharacterized protein LOC100274...  80.5    2e-14   Zea mays [maize]
emb|CAB71113.1|  auxin response factor-like protein                   75.1    2e-14   Arabidopsis thaliana [mouse-ear cress]
ref|NP_567119.1|  auxin response factor 18                            75.1    2e-14   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008676892.1|  PREDICTED: uncharacterized protein LOC100274...  80.5    2e-14   
ref|XP_010249209.1|  PREDICTED: auxin response factor 2-like isof...  79.7    2e-14   Nelumbo nucifera [Indian lotus]
ref|NP_001142391.1|  uncharacterized protein LOC100274564             80.5    2e-14   
emb|CAG30068.1|  putative auxin response factor                       79.0    2e-14   Brassica napus [oilseed rape]
ref|XP_006663482.1|  PREDICTED: auxin response factor 23-like         79.3    2e-14   
ref|XP_010512556.1|  PREDICTED: auxin response factor 18              75.1    2e-14   Camelina sativa [gold-of-pleasure]
ref|XP_008776920.1|  PREDICTED: auxin response factor 4-like          77.0    2e-14   Phoenix dactylifera
gb|KHG00740.1|  Auxin response factor 2 -like protein                 77.0    2e-14   Gossypium arboreum [tree cotton]
gb|KDO51285.1|  hypothetical protein CISIN_1g004792mg                 77.0    2e-14   Citrus sinensis [apfelsine]
gb|KDO51286.1|  hypothetical protein CISIN_1g004792mg                 77.0    2e-14   Citrus sinensis [apfelsine]
ref|XP_010099050.1|  Auxin response factor 2                          77.8    2e-14   
ref|XP_007137862.1|  hypothetical protein PHAVU_009G161900g           78.2    2e-14   Phaseolus vulgaris [French bean]
ref|XP_006577348.1|  PREDICTED: auxin response factor 9-like isof...  70.5    2e-14   Glycine max [soybeans]
ref|XP_008464365.1|  PREDICTED: auxin response factor 2               78.6    2e-14   Cucumis melo [Oriental melon]
gb|AFW60886.1|  auxin response factor                                 80.1    3e-14   
ref|XP_011040259.1|  PREDICTED: auxin response factor 2 isoform X1    79.0    3e-14   
ref|XP_010926858.1|  PREDICTED: auxin response factor 4-like          76.3    3e-14   
ref|XP_009403790.1|  PREDICTED: auxin response factor 24-like iso...  81.3    3e-14   
ref|XP_011040260.1|  PREDICTED: auxin response factor 2 isoform X2    78.6    3e-14   
ref|NP_001234602.1|  auxin response factor 12                         73.9    3e-14   
ref|XP_009138752.1|  PREDICTED: auxin response factor 18-like         73.9    3e-14   
ref|XP_002318767.1|  auxin response factor 2 family protein           77.8    3e-14   
gb|KJB51286.1|  hypothetical protein B456_008G210200                  78.2    3e-14   
gb|KJB51283.1|  hypothetical protein B456_008G210200                  78.2    3e-14   
gb|KJB51282.1|  hypothetical protein B456_008G210200                  78.2    3e-14   
ref|XP_011042961.1|  PREDICTED: auxin response factor 2-like          77.8    3e-14   
emb|CAN67897.1|  hypothetical protein VITISV_040395                   77.0    3e-14   
ref|XP_010929664.1|  PREDICTED: auxin response factor 23-like         79.3    3e-14   
ref|XP_009403791.1|  PREDICTED: auxin response factor 24-like iso...  80.9    3e-14   
gb|KJB51289.1|  hypothetical protein B456_008G210200                  77.8    4e-14   
ref|XP_003526928.1|  PREDICTED: auxin response factor 2-like          77.4    4e-14   
gb|KHN09718.1|  Auxin response factor 2                               77.4    4e-14   
ref|XP_008233127.1|  PREDICTED: auxin response factor 18-like         80.5    5e-14   
dbj|BAJ85053.1|  predicted protein                                    76.3    5e-14   
ref|XP_009410808.1|  PREDICTED: auxin response factor 9-like isof...  74.7    5e-14   
ref|XP_009386645.1|  PREDICTED: auxin response factor 9-like isof...  80.5    5e-14   
ref|XP_009592684.1|  PREDICTED: auxin response factor 2-like isof...  79.7    5e-14   
ref|XP_002284543.1|  PREDICTED: auxin response factor 2               76.3    5e-14   
ref|XP_009386644.1|  PREDICTED: auxin response factor 9-like isof...  80.1    6e-14   
ref|XP_009386643.1|  PREDICTED: auxin response factor 9-like isof...  80.1    6e-14   
gb|EMT31591.1|  Auxin response factor 1                               72.4    6e-14   
ref|XP_010413341.1|  PREDICTED: auxin response factor 18-like         75.5    6e-14   
gb|AAP57471.1|  auxin response factor-like protein                    78.2    6e-14   
ref|XP_009592683.1|  PREDICTED: auxin response factor 2-like isof...  79.7    6e-14   
ref|XP_010541778.1|  PREDICTED: auxin response factor 9-like isof...  68.9    6e-14   
gb|EYU32262.1|  hypothetical protein MIMGU_mgv1a0027261mg             75.9    6e-14   
ref|XP_010927768.1|  PREDICTED: auxin response factor 4-like isof...  77.4    6e-14   
ref|XP_010927770.1|  PREDICTED: auxin response factor 4-like isof...  77.4    6e-14   
ref|XP_010541770.1|  PREDICTED: auxin response factor 9-like isof...  68.9    6e-14   
ref|XP_007220626.1|  hypothetical protein PRUPE_ppa002230mg           80.1    6e-14   
ref|XP_009798135.1|  PREDICTED: auxin response factor 2-like isof...  77.8    7e-14   
emb|CDY67247.1|  BnaCnng54100D                                        74.7    7e-14   
ref|XP_009592685.1|  PREDICTED: auxin response factor 2-like isof...  79.3    7e-14   
ref|XP_008437407.1|  PREDICTED: auxin response factor 9               71.6    7e-14   
ref|XP_006580627.1|  PREDICTED: auxin response factor 2-like isof...  77.0    7e-14   
ref|XP_003525433.1|  PREDICTED: auxin response factor 2-like isof...  77.0    7e-14   
gb|KGN50008.1|  hypothetical protein Csa_5G148790                     71.2    8e-14   
ref|XP_004143952.1|  PREDICTED: auxin response factor 9-like          71.2    8e-14   
gb|EEE53204.1|  hypothetical protein OsJ_36082                        79.7    8e-14   
ref|XP_004139643.1|  PREDICTED: auxin response factor 18-like         75.9    8e-14   
ref|NP_001066765.1|  Os12g0479400                                     79.7    8e-14   
sp|Q2QQX6.1|ARFX_ORYSJ  RecName: Full=Auxin response factor 24        79.7    8e-14   
ref|XP_009387026.1|  PREDICTED: auxin response factor 23-like iso...  79.7    9e-14   
ref|XP_009387025.1|  PREDICTED: auxin response factor 23-like iso...  79.7    9e-14   
ref|XP_009387024.1|  PREDICTED: auxin response factor 24-like iso...  79.7    9e-14   
ref|XP_007159966.1|  hypothetical protein PHAVU_002G282200g           76.6    9e-14   
ref|XP_010925954.1|  PREDICTED: auxin response factor 18-like iso...  73.9    9e-14   
gb|KFK33186.1|  hypothetical protein AALP_AA6G341400                  75.5    9e-14   
ref|XP_010925955.1|  PREDICTED: auxin response factor 18-like iso...  73.9    1e-13   
ref|XP_009798136.1|  PREDICTED: auxin response factor 2-like isof...  77.0    1e-13   
ref|XP_010237262.1|  PREDICTED: auxin response factor 24-like         79.7    1e-13   
ref|XP_006664554.1|  PREDICTED: auxin response factor 24-like         79.7    1e-13   
ref|XP_004503803.1|  PREDICTED: auxin response factor 2-like          76.6    1e-13   
ref|XP_003532359.1|  PREDICTED: auxin response factor 2-like          76.6    1e-13   
emb|CDM82308.1|  unnamed protein product                              71.6    1e-13   
gb|AET05061.2|  auxin response factor 2                               76.6    1e-13   
ref|XP_003630584.1|  Auxin response factor-like protein               76.6    1e-13   
emb|CDY50434.1|  BnaC07g38640D                                        79.0    1e-13   
ref|XP_008807235.1|  PREDICTED: auxin response factor 11-like iso...  79.3    1e-13   
ref|XP_008807236.1|  PREDICTED: auxin response factor 11-like iso...  79.3    1e-13   
dbj|BAB85920.1|  auxin response factor 16                             73.9    1e-13   
ref|XP_008374175.1|  PREDICTED: auxin response factor 2               75.1    1e-13   
ref|XP_010523495.1|  PREDICTED: auxin response factor 2 isoform X2    77.0    1e-13   
gb|EEC70260.1|  hypothetical protein OsI_01065                        73.9    1e-13   
ref|NP_001042528.1|  Os01g0236300                                     73.9    1e-13   
ref|XP_010523487.1|  PREDICTED: auxin response factor 2 isoform X1    77.0    1e-13   
ref|XP_009373631.1|  PREDICTED: auxin response factor 2-like          74.7    1e-13   
emb|CDY03502.1|  BnaC01g15800D                                        78.6    2e-13   
gb|EEC69273.1|  hypothetical protein OsI_38317                        79.0    2e-13   
gb|EEE54195.1|  hypothetical protein OsJ_01030                        73.9    2e-13   
ref|XP_009368800.1|  PREDICTED: auxin response factor 2-like          74.7    2e-13   
emb|CDX95705.1|  BnaC03g25860D                                        78.2    2e-13   
gb|KHN06318.1|  Auxin response factor 18                              79.0    2e-13   
ref|XP_004165777.1|  PREDICTED: LOW QUALITY PROTEIN: auxin respon...  70.1    2e-13   
emb|CDY10978.1|  BnaA03g46370D                                        78.6    2e-13   
gb|AET05059.2|  auxin response factor 2                               75.9    2e-13   
ref|XP_003630583.1|  Auxin response factor-like protein               75.9    2e-13   
ref|XP_009142634.1|  PREDICTED: auxin response factor 11              74.3    2e-13   
ref|XP_009137407.1|  PREDICTED: auxin response factor 9-like          78.6    2e-13   
gb|AFD01308.1|  auxin response factor 9                               78.6    2e-13   
emb|CDX80025.1|  BnaA05g01310D                                        74.3    2e-13   
ref|XP_007210901.1|  hypothetical protein PRUPE_ppa001392mg           74.3    2e-13   
ref|XP_004173327.1|  PREDICTED: LOW QUALITY PROTEIN: auxin respon...  74.7    2e-13   
ref|XP_003630586.1|  Auxin response factor-like protein               75.5    2e-13   
gb|AAP06759.1|  auxin response factor-like protein                    78.6    2e-13   
ref|XP_006645691.1|  PREDICTED: auxin response factor 1-like          73.2    2e-13   
ref|XP_008239553.1|  PREDICTED: auxin response factor 2               74.3    2e-13   
ref|XP_008392709.1|  PREDICTED: auxin response factor 2-like          75.1    2e-13   
ref|XP_008462117.1|  PREDICTED: auxin response factor 18-like         74.7    2e-13   
ref|XP_004967361.1|  PREDICTED: auxin response factor 1-like isof...  72.4    2e-13   
ref|XP_004967362.1|  PREDICTED: auxin response factor 1-like isof...  72.4    2e-13   
ref|XP_003630585.1|  Auxin response factor-like protein               75.5    2e-13   
ref|XP_006583222.1|  PREDICTED: auxin response factor 18-like iso...  78.2    2e-13   
ref|XP_006583221.1|  PREDICTED: auxin response factor 18-like iso...  78.2    3e-13   
ref|XP_006598901.1|  PREDICTED: auxin response factor 7-like isof...  78.2    3e-13   
ref|XP_010518327.1|  PREDICTED: auxin response factor 11-like iso...  73.9    3e-13   
ref|XP_010912181.1|  PREDICTED: auxin response factor 11 isoform X2   78.2    3e-13   
ref|XP_006598900.1|  PREDICTED: auxin response factor 7-like isof...  78.2    3e-13   
gb|EMS55418.1|  Auxin response factor 1                               70.1    3e-13   
emb|CBI40565.3|  unnamed protein product                              77.8    3e-13   
gb|AAY32331.1|  ARF1                                                  76.3    3e-13   
ref|XP_010547792.1|  PREDICTED: auxin response factor 2-like          74.3    3e-13   
gb|KDP22544.1|  hypothetical protein JCGZ_26375                       72.0    3e-13   
ref|XP_004967363.1|  PREDICTED: auxin response factor 1-like isof...  72.0    4e-13   
ref|XP_002457052.1|  hypothetical protein SORBIDRAFT_03g000530        72.8    4e-13   
ref|XP_010518326.1|  PREDICTED: auxin response factor 11-like iso...  73.6    4e-13   
ref|NP_001031548.1|  auxin response factor 11                         72.0    4e-13   
ref|XP_010538837.1|  PREDICTED: auxin response factor 9-like          66.6    4e-13   
ref|NP_182176.2|  auxin response factor 11                            72.0    5e-13   
ref|XP_010912174.1|  PREDICTED: auxin response factor 11 isoform X1   77.4    5e-13   
dbj|BAF01593.1|  ARF1 family auxin responsive transcription facto...  71.6    5e-13   
ref|XP_002443175.1|  hypothetical protein SORBIDRAFT_08g014320        73.6    5e-13   
gb|AIA57934.1|  auxin response factor                                 71.6    5e-13   
ref|XP_010267580.1|  PREDICTED: auxin response factor 18              77.4    5e-13   
ref|XP_002523326.1|  Auxin response factor, putative                  77.4    5e-13   
gb|ACN33905.1|  unknown                                               73.2    5e-13   
ref|XP_002880250.1|  hypothetical protein ARALYDRAFT_904120           71.6    6e-13   
gb|ACN33225.1|  unknown                                               73.2    6e-13   
ref|XP_010661956.1|  PREDICTED: auxin response factor 18              77.0    6e-13   
ref|NP_973701.1|  auxin response factor 11                            72.4    6e-13   
ref|XP_011093958.1|  PREDICTED: auxin response factor 18-like         77.0    6e-13   
ref|XP_010506661.1|  PREDICTED: auxin response factor 11              72.8    6e-13   
ref|XP_010508005.1|  PREDICTED: auxin response factor 11-like         72.8    7e-13   
gb|KDP28473.1|  hypothetical protein JCGZ_14244                       76.6    8e-13   
ref|XP_009590537.1|  PREDICTED: auxin response factor 9 isoform X2    76.6    8e-13   
ref|XP_009590536.1|  PREDICTED: auxin response factor 11 isoform X1   76.6    9e-13   
ref|XP_010266558.1|  PREDICTED: auxin response factor 9-like          76.6    9e-13   
emb|CBI34510.3|  unnamed protein product                              76.6    9e-13   
ref|XP_010659520.1|  PREDICTED: auxin response factor 9               76.6    9e-13   
dbj|BAO45870.1|  auxin response factor                                76.6    1e-12   
dbj|BAK06457.1|  predicted protein                                    72.4    1e-12   
gb|KJB41549.1|  hypothetical protein B456_007G109500                  76.3    1e-12   
gb|KJB41551.1|  hypothetical protein B456_007G109500                  75.5    1e-12   
gb|KJB18966.1|  hypothetical protein B456_003G078000                  76.3    1e-12   
gb|KJB18969.1|  hypothetical protein B456_003G078000                  76.3    1e-12   
tpg|DAA54917.1|  TPA: hypothetical protein ZEAMMB73_084407            72.4    1e-12   
ref|XP_004306655.1|  PREDICTED: auxin response factor 18              76.3    1e-12   
ref|XP_004962662.1|  PREDICTED: auxin response factor 24-like         72.8    1e-12   
gb|KJB18968.1|  hypothetical protein B456_003G078000                  76.3    1e-12   
gb|KJB18967.1|  hypothetical protein B456_003G078000                  76.3    1e-12   
gb|ADX60171.1|  ARF transcription factor                              73.2    1e-12   
gb|KJB41550.1|  hypothetical protein B456_007G109500                  76.3    1e-12   
gb|KJB18970.1|  hypothetical protein B456_003G078000                  76.3    1e-12   
gb|KJB41543.1|  hypothetical protein B456_007G109500                  76.3    1e-12   
ref|XP_008673473.1|  PREDICTED: auxin response factor 1               72.8    1e-12   
ref|XP_011020868.1|  PREDICTED: auxin response factor 2-like isof...  71.6    1e-12   
ref|XP_007147325.1|  hypothetical protein PHAVU_006G114300g           72.0    1e-12   
ref|XP_011020867.1|  PREDICTED: auxin response factor 2-like isof...  71.6    1e-12   
tpg|DAA54923.1|  TPA: hypothetical protein ZEAMMB73_084407            72.0    1e-12   
ref|XP_010053162.1|  PREDICTED: auxin response factor 9-like          75.9    1e-12   
ref|XP_010678349.1|  PREDICTED: auxin response factor 2               73.2    1e-12   
gb|KHG11573.1|  Auxin response factor 9 -like protein                 75.9    1e-12   
gb|KJB41546.1|  hypothetical protein B456_007G109500                  75.9    1e-12   
gb|KJB18971.1|  hypothetical protein B456_003G078000                  75.9    1e-12   
ref|XP_007051522.1|  Auxin response factor 11 isoform 1               76.3    1e-12   
gb|KJB41544.1|  hypothetical protein B456_007G109500                  75.5    2e-12   
gb|KJB41548.1|  hypothetical protein B456_007G109500                  75.5    2e-12   
gb|KJB41547.1|  hypothetical protein B456_007G109500                  75.5    2e-12   
ref|XP_006292708.1|  hypothetical protein CARUB_v10018954mg           75.5    2e-12   
gb|KCW86993.1|  hypothetical protein EUGRSUZ_B03551                   69.3    2e-12   
ref|XP_008662180.1|  PREDICTED: hypothetical protein isoform X3       72.8    2e-12   
ref|NP_001169329.1|  hypothetical protein                             72.8    2e-12   
ref|XP_008662179.1|  PREDICTED: hypothetical protein isoform X2       72.8    2e-12   
gb|ADG43162.1|  auxin response factor 28                              72.8    2e-12   
gb|KJB09636.1|  hypothetical protein B456_001G153900                  75.5    2e-12   
ref|XP_008662177.1|  PREDICTED: hypothetical protein isoform X1       72.8    2e-12   
ref|XP_008662181.1|  PREDICTED: hypothetical protein isoform X4       72.4    2e-12   
ref|XP_006385879.1|  hypothetical protein POPTR_0003s16210g           70.9    2e-12   
gb|KJB09638.1|  hypothetical protein B456_001G153900                  74.7    2e-12   
ref|XP_006385882.1|  hypothetical protein POPTR_0003s16210g           70.9    2e-12   
ref|XP_002303753.2|  hypothetical protein POPTR_0003s16210g           70.9    3e-12   
ref|XP_006385881.1|  hypothetical protein POPTR_0003s16210g           70.9    3e-12   
ref|XP_006385880.1|  hypothetical protein POPTR_0003s16210g           70.5    3e-12   
ref|XP_009421471.1|  PREDICTED: auxin response factor 11-like         72.0    3e-12   
ref|XP_007051523.1|  Auxin response factor 11 isoform 2               75.1    3e-12   
gb|KJB09637.1|  hypothetical protein B456_001G153900                  75.1    3e-12   
gb|KJB09639.1|  hypothetical protein B456_001G153900                  75.1    3e-12   
gb|KJB09635.1|  hypothetical protein B456_001G153900                  75.1    3e-12   
gb|KHG01748.1|  Auxin response factor 18 -like protein                75.1    3e-12   
ref|XP_009389945.1|  PREDICTED: auxin response factor 11-like         75.1    3e-12   
ref|XP_002527834.1|  Auxin response factor, putative                  49.7    4e-12   
ref|XP_006385883.1|  hypothetical protein POPTR_0003s16210g           70.1    4e-12   
ref|XP_006293856.1|  hypothetical protein CARUB_v10022841mg           70.9    5e-12   
ref|XP_009797447.1|  PREDICTED: auxin response factor 9-like          74.3    5e-12   
emb|CDP08662.1|  unnamed protein product                              74.3    5e-12   
gb|KHG20295.1|  Auxin response factor 9 -like protein                 73.9    6e-12   
ref|XP_009375409.1|  PREDICTED: auxin response factor 18 isoform X1   73.9    6e-12   
ref|XP_009375411.1|  PREDICTED: auxin response factor 18 isoform X2   73.9    6e-12   
ref|XP_007140506.1|  hypothetical protein PHAVU_008G118400g           73.6    7e-12   
ref|XP_007140507.1|  hypothetical protein PHAVU_008G118400g           73.9    7e-12   
ref|XP_008376148.1|  PREDICTED: auxin response factor 18 isoform X3   73.9    7e-12   
ref|XP_008376147.1|  PREDICTED: auxin response factor 18 isoform X2   73.9    8e-12   
ref|XP_008352656.1|  PREDICTED: auxin response factor 18-like iso...  73.6    9e-12   
ref|XP_008352781.1|  PREDICTED: auxin response factor 18-like iso...  73.6    1e-11   
ref|XP_010240998.1|  PREDICTED: auxin response factor 23-like         71.2    1e-11   
ref|XP_008808096.1|  PREDICTED: auxin response factor 18-like         73.2    1e-11   
gb|KJB49580.1|  hypothetical protein B456_008G126200                  72.4    2e-11   
gb|KJB49578.1|  hypothetical protein B456_008G126200                  72.4    2e-11   
gb|KJB49579.1|  hypothetical protein B456_008G126200                  72.4    2e-11   
gb|KJB49576.1|  hypothetical protein B456_008G126200                  72.4    2e-11   
gb|KJB49575.1|  hypothetical protein B456_008G126200                  72.0    3e-11   
gb|KJB49577.1|  hypothetical protein B456_008G126200                  72.0    3e-11   
gb|KJB49574.1|  hypothetical protein B456_008G126200                  72.0    3e-11   
ref|NP_001280753.1|  ADP-ribosylation factor 1                        72.0    3e-11   
ref|XP_006375370.1|  hypothetical protein POPTR_0014s09560g           72.0    3e-11   
ref|XP_006375371.1|  hypothetical protein POPTR_0014s09560g           72.0    3e-11   
ref|XP_006375372.1|  hypothetical protein POPTR_0014s09560g           71.6    3e-11   
emb|CBA12006.1|  putative auxin response factor 2/1/9                 63.2    3e-11   
gb|KCW48514.1|  hypothetical protein EUGRSUZ_K02197                   71.6    4e-11   
gb|KCW48518.1|  hypothetical protein EUGRSUZ_K02197                   71.2    5e-11   
gb|KCW48516.1|  hypothetical protein EUGRSUZ_K02197                   71.2    5e-11   
gb|KCW48515.1|  hypothetical protein EUGRSUZ_K02197                   71.2    5e-11   
ref|XP_010039004.1|  PREDICTED: auxin response factor 2               71.2    5e-11   
ref|XP_010915982.1|  PREDICTED: auxin response factor 9-like          70.9    6e-11   
ref|XP_006413488.1|  hypothetical protein EUTSA_v10024554mg           60.5    1e-10   



>gb|EYU35034.1| hypothetical protein MIMGU_mgv1a003127mg [Erythranthe guttata]
Length=606

 Score = 95.9 bits (237),  Expect(2) = 2e-27, Method: Composition-based stats.
 Identities = 45/48 (94%), Positives = 48/48 (100%), Gaps = 0/48 (0%)
 Frame = +3

Query  357  VGVRRLMRQLNNMPSSVISSHTMHLGVLATASHAINTRTLFSVFYRPR  500
            VGVRRLMRQLNNMPSSVISSH+MHLGVLATASHAI+TRTLFSVFY+PR
Sbjct  172  VGVRRLMRQLNNMPSSVISSHSMHLGVLATASHAISTRTLFSVFYKPR  219


 Score = 53.5 bits (127),  Expect(2) = 2e-27, Method: Composition-based stats.
 Identities = 26/35 (74%), Positives = 31/35 (89%), Gaps = 1/35 (3%)
 Frame = +1

Query  472  LFSLFFTGQGTSRSEFIVSVNKYIEAQNH*LSVGM  576
            LFS+F+  + TSRSEFIVS+NKY+EAQNH LSVGM
Sbjct  211  LFSVFYKPR-TSRSEFIVSLNKYLEAQNHKLSVGM  244



>ref|XP_011087626.1| PREDICTED: auxin response factor 1-like [Sesamum indicum]
Length=665

 Score = 95.1 bits (235),  Expect(2) = 3e-27, Method: Composition-based stats.
 Identities = 45/48 (94%), Positives = 48/48 (100%), Gaps = 0/48 (0%)
 Frame = +3

Query  357  VGVRRLMRQLNNMPSSVISSHTMHLGVLATASHAINTRTLFSVFYRPR  500
            VGVRRLMRQLNNMPSSVISSH+MHLGVLATASHAI+TRTLFSVFY+PR
Sbjct  223  VGVRRLMRQLNNMPSSVISSHSMHLGVLATASHAISTRTLFSVFYKPR  270


 Score = 53.5 bits (127),  Expect(2) = 3e-27, Method: Composition-based stats.
 Identities = 26/35 (74%), Positives = 31/35 (89%), Gaps = 1/35 (3%)
 Frame = +1

Query  472  LFSLFFTGQGTSRSEFIVSVNKYIEAQNH*LSVGM  576
            LFS+F+  + TSRSEFIVS+NKY+EAQNH LSVGM
Sbjct  262  LFSVFYKPR-TSRSEFIVSLNKYLEAQNHKLSVGM  295



>ref|XP_010912873.1| PREDICTED: auxin response factor 7-like [Elaeis guineensis]
Length=727

 Score = 93.6 bits (231),  Expect(2) = 2e-26, Method: Composition-based stats.
 Identities = 44/48 (92%), Positives = 47/48 (98%), Gaps = 0/48 (0%)
 Frame = +3

Query  357  VGVRRLMRQLNNMPSSVISSHTMHLGVLATASHAINTRTLFSVFYRPR  500
            VGVRRLMRQLNNMPSSVISSH+MHLGVLATASHAI+T TLFSVFY+PR
Sbjct  265  VGVRRLMRQLNNMPSSVISSHSMHLGVLATASHAISTGTLFSVFYKPR  312


 Score = 52.4 bits (124),  Expect(2) = 2e-26, Method: Composition-based stats.
 Identities = 25/35 (71%), Positives = 31/35 (89%), Gaps = 1/35 (3%)
 Frame = +1

Query  472  LFSLFFTGQGTSRSEFIVSVNKYIEAQNH*LSVGM  576
            LFS+F+  + TSRSEFI+SVNKY+EA+NH LSVGM
Sbjct  304  LFSVFYKPR-TSRSEFIISVNKYLEAKNHKLSVGM  337



>ref|XP_008795276.1| PREDICTED: auxin response factor 7-like isoform X1 [Phoenix dactylifera]
Length=686

 Score = 92.8 bits (229),  Expect(2) = 3e-26, Method: Composition-based stats.
 Identities = 44/48 (92%), Positives = 47/48 (98%), Gaps = 0/48 (0%)
 Frame = +3

Query  357  VGVRRLMRQLNNMPSSVISSHTMHLGVLATASHAINTRTLFSVFYRPR  500
            VGVRRLMRQLNNMPSSVISSH+MHLGVLATASHAI+T TLFSVFY+PR
Sbjct  224  VGVRRLMRQLNNMPSSVISSHSMHLGVLATASHAISTGTLFSVFYKPR  271


 Score = 52.4 bits (124),  Expect(2) = 3e-26, Method: Composition-based stats.
 Identities = 25/35 (71%), Positives = 31/35 (89%), Gaps = 1/35 (3%)
 Frame = +1

Query  472  LFSLFFTGQGTSRSEFIVSVNKYIEAQNH*LSVGM  576
            LFS+F+  + TSRSEFI+SVNKY+EA+NH LSVGM
Sbjct  263  LFSVFYKPR-TSRSEFIISVNKYLEAKNHKLSVGM  296



>ref|XP_008795277.1| PREDICTED: auxin response factor 7-like isoform X2 [Phoenix dactylifera]
Length=670

 Score = 92.8 bits (229),  Expect(2) = 3e-26, Method: Composition-based stats.
 Identities = 44/48 (92%), Positives = 47/48 (98%), Gaps = 0/48 (0%)
 Frame = +3

Query  357  VGVRRLMRQLNNMPSSVISSHTMHLGVLATASHAINTRTLFSVFYRPR  500
            VGVRRLMRQLNNMPSSVISSH+MHLGVLATASHAI+T TLFSVFY+PR
Sbjct  224  VGVRRLMRQLNNMPSSVISSHSMHLGVLATASHAISTGTLFSVFYKPR  271


 Score = 52.4 bits (124),  Expect(2) = 3e-26, Method: Composition-based stats.
 Identities = 25/35 (71%), Positives = 31/35 (89%), Gaps = 1/35 (3%)
 Frame = +1

Query  472  LFSLFFTGQGTSRSEFIVSVNKYIEAQNH*LSVGM  576
            LFS+F+  + TSRSEFI+SVNKY+EA+NH LSVGM
Sbjct  263  LFSVFYKPR-TSRSEFIISVNKYLEAKNHKLSVGM  296



>ref|XP_010930543.1| PREDICTED: auxin response factor 7-like [Elaeis guineensis]
 ref|XP_010930544.1| PREDICTED: auxin response factor 7-like [Elaeis guineensis]
 ref|XP_010930545.1| PREDICTED: auxin response factor 7-like [Elaeis guineensis]
Length=682

 Score = 92.4 bits (228),  Expect(2) = 4e-26, Method: Composition-based stats.
 Identities = 43/48 (90%), Positives = 47/48 (98%), Gaps = 0/48 (0%)
 Frame = +3

Query  357  VGVRRLMRQLNNMPSSVISSHTMHLGVLATASHAINTRTLFSVFYRPR  500
            VGVRRLMRQLNNMPSSVISSH+MHLGVLATASHA++T TLFSVFY+PR
Sbjct  224  VGVRRLMRQLNNMPSSVISSHSMHLGVLATASHAVSTGTLFSVFYKPR  271


 Score = 52.4 bits (124),  Expect(2) = 4e-26, Method: Composition-based stats.
 Identities = 25/35 (71%), Positives = 31/35 (89%), Gaps = 1/35 (3%)
 Frame = +1

Query  472  LFSLFFTGQGTSRSEFIVSVNKYIEAQNH*LSVGM  576
            LFS+F+  + TSRSEFI+SVNKY+EA+NH LSVGM
Sbjct  263  LFSVFYKPR-TSRSEFIISVNKYLEAKNHKLSVGM  296



>gb|ACN31160.1| unknown [Zea mays]
 gb|AFU81655.1| ARF-type transcription factor, partial [Zea mays subsp. mays]
 gb|AFW71834.1| auxin response factor 1 [Zea mays]
Length=677

 Score = 93.2 bits (230),  Expect(2) = 5e-26, Method: Composition-based stats.
 Identities = 44/48 (92%), Positives = 47/48 (98%), Gaps = 0/48 (0%)
 Frame = +3

Query  357  VGVRRLMRQLNNMPSSVISSHTMHLGVLATASHAINTRTLFSVFYRPR  500
            VGVRRLMRQLNNMPSSVISSH+MHLGVLATASHAI+T TLFSVFY+PR
Sbjct  218  VGVRRLMRQLNNMPSSVISSHSMHLGVLATASHAISTGTLFSVFYKPR  265


 Score = 51.6 bits (122),  Expect(2) = 5e-26, Method: Composition-based stats.
 Identities = 24/35 (69%), Positives = 31/35 (89%), Gaps = 1/35 (3%)
 Frame = +1

Query  472  LFSLFFTGQGTSRSEFIVSVNKYIEAQNH*LSVGM  576
            LFS+F+  + TSRSEF+VSVNKY+EA+NH +SVGM
Sbjct  257  LFSVFYKPR-TSRSEFVVSVNKYLEAKNHKMSVGM  290



>ref|XP_010252371.1| PREDICTED: auxin response factor 1 [Nelumbo nucifera]
Length=681

 Score = 92.0 bits (227),  Expect(2) = 5e-26, Method: Compositional matrix adjust.
 Identities = 44/48 (92%), Positives = 46/48 (96%), Gaps = 0/48 (0%)
 Frame = +3

Query  357  VGVRRLMRQLNNMPSSVISSHTMHLGVLATASHAINTRTLFSVFYRPR  500
            VGVRRLMRQLNNMPSSVISSH+MHLGVLATASHAI T TLFSVFY+PR
Sbjct  223  VGVRRLMRQLNNMPSSVISSHSMHLGVLATASHAIATGTLFSVFYKPR  270


 Score = 52.4 bits (124),  Expect(2) = 5e-26, Method: Composition-based stats.
 Identities = 25/35 (71%), Positives = 31/35 (89%), Gaps = 1/35 (3%)
 Frame = +1

Query  472  LFSLFFTGQGTSRSEFIVSVNKYIEAQNH*LSVGM  576
            LFS+F+  + TSRSEFI+SVNKY+EA+NH LSVGM
Sbjct  262  LFSVFYKPR-TSRSEFIISVNKYLEARNHKLSVGM  295



>ref|XP_008786460.1| PREDICTED: auxin response factor 7-like [Phoenix dactylifera]
Length=683

 Score = 92.0 bits (227),  Expect(2) = 5e-26, Method: Composition-based stats.
 Identities = 43/48 (90%), Positives = 47/48 (98%), Gaps = 0/48 (0%)
 Frame = +3

Query  357  VGVRRLMRQLNNMPSSVISSHTMHLGVLATASHAINTRTLFSVFYRPR  500
            VGVRRLMRQLNNMPSSVISSH+MHLGVLATASHA++T TLFSVFY+PR
Sbjct  220  VGVRRLMRQLNNMPSSVISSHSMHLGVLATASHAVSTGTLFSVFYKPR  267


 Score = 52.4 bits (124),  Expect(2) = 5e-26, Method: Composition-based stats.
 Identities = 25/35 (71%), Positives = 31/35 (89%), Gaps = 1/35 (3%)
 Frame = +1

Query  472  LFSLFFTGQGTSRSEFIVSVNKYIEAQNH*LSVGM  576
            LFS+F+  + TSRSEFI+SVNKY+EA+NH LSVGM
Sbjct  259  LFSVFYKPR-TSRSEFIISVNKYLEAKNHKLSVGM  292



>ref|NP_001152338.1| LOC100285977 [Zea mays]
 gb|ACG47111.1| auxin response factor 1 [Zea mays]
Length=676

 Score = 92.8 bits (229),  Expect(2) = 6e-26, Method: Composition-based stats.
 Identities = 44/48 (92%), Positives = 47/48 (98%), Gaps = 0/48 (0%)
 Frame = +3

Query  357  VGVRRLMRQLNNMPSSVISSHTMHLGVLATASHAINTRTLFSVFYRPR  500
            VGVRRLMRQLNNMPSSVISSH+MHLGVLATASHAI+T TLFSVFY+PR
Sbjct  217  VGVRRLMRQLNNMPSSVISSHSMHLGVLATASHAISTGTLFSVFYKPR  264


 Score = 51.6 bits (122),  Expect(2) = 6e-26, Method: Composition-based stats.
 Identities = 24/35 (69%), Positives = 31/35 (89%), Gaps = 1/35 (3%)
 Frame = +1

Query  472  LFSLFFTGQGTSRSEFIVSVNKYIEAQNH*LSVGM  576
            LFS+F+  + TSRSEF+VSVNKY+EA+NH +SVGM
Sbjct  256  LFSVFYKPR-TSRSEFVVSVNKYLEAKNHKMSVGM  289



>ref|XP_002453992.1| hypothetical protein SORBIDRAFT_04g022830 [Sorghum bicolor]
 gb|EES06968.1| hypothetical protein SORBIDRAFT_04g022830 [Sorghum bicolor]
Length=672

 Score = 92.8 bits (229),  Expect(2) = 6e-26, Method: Composition-based stats.
 Identities = 44/48 (92%), Positives = 47/48 (98%), Gaps = 0/48 (0%)
 Frame = +3

Query  357  VGVRRLMRQLNNMPSSVISSHTMHLGVLATASHAINTRTLFSVFYRPR  500
            VGVRRLMRQLNNMPSSVISSH+MHLGVLATASHAI+T TLFSVFY+PR
Sbjct  218  VGVRRLMRQLNNMPSSVISSHSMHLGVLATASHAISTGTLFSVFYKPR  265


 Score = 51.6 bits (122),  Expect(2) = 6e-26, Method: Composition-based stats.
 Identities = 24/35 (69%), Positives = 31/35 (89%), Gaps = 1/35 (3%)
 Frame = +1

Query  472  LFSLFFTGQGTSRSEFIVSVNKYIEAQNH*LSVGM  576
            LFS+F+  + TSRSEF+VSVNKY+EA+NH +SVGM
Sbjct  257  LFSVFYKPR-TSRSEFVVSVNKYLEAKNHKMSVGM  290



>ref|XP_006349280.1| PREDICTED: auxin response factor 1-like isoform X1 [Solanum tuberosum]
 ref|XP_006349281.1| PREDICTED: auxin response factor 1-like isoform X2 [Solanum tuberosum]
 ref|XP_006349282.1| PREDICTED: auxin response factor 1-like isoform X3 [Solanum tuberosum]
Length=654

 Score = 92.8 bits (229),  Expect(2) = 8e-26, Method: Composition-based stats.
 Identities = 44/48 (92%), Positives = 47/48 (98%), Gaps = 0/48 (0%)
 Frame = +3

Query  357  VGVRRLMRQLNNMPSSVISSHTMHLGVLATASHAINTRTLFSVFYRPR  500
            VGVRRLMRQLNNMPSSVISSH+MHLGVLATASHAI+T TLFSVFY+PR
Sbjct  224  VGVRRLMRQLNNMPSSVISSHSMHLGVLATASHAISTGTLFSVFYKPR  271


 Score = 50.8 bits (120),  Expect(2) = 8e-26, Method: Composition-based stats.
 Identities = 25/35 (71%), Positives = 31/35 (89%), Gaps = 1/35 (3%)
 Frame = +1

Query  472  LFSLFFTGQGTSRSEFIVSVNKYIEAQNH*LSVGM  576
            LFS+F+  + TS+SEFIVSVNKY+EA+NH LSVGM
Sbjct  263  LFSVFYKPR-TSQSEFIVSVNKYLEARNHKLSVGM  296



>gb|ADG43148.1| auxin response factor 14 [Zea mays]
Length=672

 Score = 92.4 bits (228),  Expect(2) = 1e-25, Method: Composition-based stats.
 Identities = 44/48 (92%), Positives = 46/48 (96%), Gaps = 0/48 (0%)
 Frame = +3

Query  357  VGVRRLMRQLNNMPSSVISSHTMHLGVLATASHAINTRTLFSVFYRPR  500
            VGVRRLMRQLNNMPSSVISSH MHLGVLATASHAI+T TLFSVFY+PR
Sbjct  218  VGVRRLMRQLNNMPSSVISSHNMHLGVLATASHAISTGTLFSVFYKPR  265


 Score = 50.8 bits (120),  Expect(2) = 1e-25, Method: Composition-based stats.
 Identities = 24/35 (69%), Positives = 31/35 (89%), Gaps = 1/35 (3%)
 Frame = +1

Query  472  LFSLFFTGQGTSRSEFIVSVNKYIEAQNH*LSVGM  576
            LFS+F+  + TSRSEF+VSVNKY+EA+NH +SVGM
Sbjct  257  LFSVFYKPR-TSRSEFVVSVNKYLEAKNHKVSVGM  290



>ref|XP_010657917.1| PREDICTED: auxin response factor 1 isoform X2 [Vitis vinifera]
 emb|CBI29640.3| unnamed protein product [Vitis vinifera]
Length=678

 Score = 91.7 bits (226),  Expect(2) = 1e-25, Method: Composition-based stats.
 Identities = 43/48 (90%), Positives = 47/48 (98%), Gaps = 0/48 (0%)
 Frame = +3

Query  357  VGVRRLMRQLNNMPSSVISSHTMHLGVLATASHAINTRTLFSVFYRPR  500
            VGVRRLMRQL+NMPSSVISSH+MHLGVLATASHAI+T TLFSVFY+PR
Sbjct  224  VGVRRLMRQLSNMPSSVISSHSMHLGVLATASHAISTGTLFSVFYKPR  271


 Score = 51.6 bits (122),  Expect(2) = 1e-25, Method: Composition-based stats.
 Identities = 25/35 (71%), Positives = 31/35 (89%), Gaps = 1/35 (3%)
 Frame = +1

Query  472  LFSLFFTGQGTSRSEFIVSVNKYIEAQNH*LSVGM  576
            LFS+F+  + TSRSEFIVS+NKY+EA+NH LSVGM
Sbjct  263  LFSVFYKPR-TSRSEFIVSLNKYLEARNHKLSVGM  296



>ref|XP_002268348.2| PREDICTED: auxin response factor 1 isoform X1 [Vitis vinifera]
Length=678

 Score = 91.7 bits (226),  Expect(2) = 1e-25, Method: Composition-based stats.
 Identities = 43/48 (90%), Positives = 47/48 (98%), Gaps = 0/48 (0%)
 Frame = +3

Query  357  VGVRRLMRQLNNMPSSVISSHTMHLGVLATASHAINTRTLFSVFYRPR  500
            VGVRRLMRQL+NMPSSVISSH+MHLGVLATASHAI+T TLFSVFY+PR
Sbjct  224  VGVRRLMRQLSNMPSSVISSHSMHLGVLATASHAISTGTLFSVFYKPR  271


 Score = 51.6 bits (122),  Expect(2) = 1e-25, Method: Composition-based stats.
 Identities = 25/35 (71%), Positives = 31/35 (89%), Gaps = 1/35 (3%)
 Frame = +1

Query  472  LFSLFFTGQGTSRSEFIVSVNKYIEAQNH*LSVGM  576
            LFS+F+  + TSRSEFIVS+NKY+EA+NH LSVGM
Sbjct  263  LFSVFYKPR-TSRSEFIVSLNKYLEARNHKLSVGM  296



>ref|NP_001183800.1| hypothetical protein [Zea mays]
 gb|ACR38344.1| unknown [Zea mays]
 gb|AFT82693.1| ARF14 ARF type transcription factor, partial [Zea mays subsp. 
mays]
 gb|AFW62635.1| hypothetical protein ZEAMMB73_114282 [Zea mays]
Length=511

 Score = 92.0 bits (227),  Expect(2) = 1e-25, Method: Compositional matrix adjust.
 Identities = 44/48 (92%), Positives = 46/48 (96%), Gaps = 0/48 (0%)
 Frame = +3

Query  357  VGVRRLMRQLNNMPSSVISSHTMHLGVLATASHAINTRTLFSVFYRPR  500
            VGVRRLMRQLNNMPSSVISSH MHLGVLATASHAI+T TLFSVFY+PR
Sbjct  218  VGVRRLMRQLNNMPSSVISSHNMHLGVLATASHAISTGTLFSVFYKPR  265


 Score = 51.2 bits (121),  Expect(2) = 1e-25, Method: Compositional matrix adjust.
 Identities = 24/35 (69%), Positives = 31/35 (89%), Gaps = 1/35 (3%)
 Frame = +1

Query  472  LFSLFFTGQGTSRSEFIVSVNKYIEAQNH*LSVGM  576
            LFS+F+  + TSRSEF+VSVNKY+EA+NH +SVGM
Sbjct  257  LFSVFYKPR-TSRSEFVVSVNKYLEAKNHKVSVGM  290



>ref|XP_008460595.1| PREDICTED: auxin response factor 1 [Cucumis melo]
Length=675

 Score = 93.2 bits (230),  Expect(2) = 1e-25, Method: Compositional matrix adjust.
 Identities = 44/48 (92%), Positives = 47/48 (98%), Gaps = 0/48 (0%)
 Frame = +3

Query  357  VGVRRLMRQLNNMPSSVISSHTMHLGVLATASHAINTRTLFSVFYRPR  500
            VGVRRLMRQLNNMPSSVISSH+MHLGVLATASHAI+T TLFSVFY+PR
Sbjct  224  VGVRRLMRQLNNMPSSVISSHSMHLGVLATASHAISTGTLFSVFYKPR  271


 Score = 50.1 bits (118),  Expect(2) = 1e-25, Method: Composition-based stats.
 Identities = 24/35 (69%), Positives = 30/35 (86%), Gaps = 1/35 (3%)
 Frame = +1

Query  472  LFSLFFTGQGTSRSEFIVSVNKYIEAQNH*LSVGM  576
            LFS+F+  + TSRS F+VS+NKY+EAQNH LSVGM
Sbjct  263  LFSVFYKPR-TSRSTFLVSLNKYLEAQNHKLSVGM  296



>ref|XP_010323707.1| PREDICTED: auxin response factor 1 isoform X1 [Solanum lycopersicum]
Length=654

 Score = 92.0 bits (227),  Expect(2) = 2e-25, Method: Composition-based stats.
 Identities = 44/48 (92%), Positives = 46/48 (96%), Gaps = 0/48 (0%)
 Frame = +3

Query  357  VGVRRLMRQLNNMPSSVISSHTMHLGVLATASHAINTRTLFSVFYRPR  500
            VGVRRLMRQLNNMPSSVISSH+MHLGVLATASHAI T TLFSVFY+PR
Sbjct  224  VGVRRLMRQLNNMPSSVISSHSMHLGVLATASHAIMTGTLFSVFYKPR  271


 Score = 50.8 bits (120),  Expect(2) = 2e-25, Method: Composition-based stats.
 Identities = 25/35 (71%), Positives = 31/35 (89%), Gaps = 1/35 (3%)
 Frame = +1

Query  472  LFSLFFTGQGTSRSEFIVSVNKYIEAQNH*LSVGM  576
            LFS+F+  + TS+SEFIVSVNKY+EA+NH LSVGM
Sbjct  263  LFSVFYKPR-TSQSEFIVSVNKYLEARNHKLSVGM  296



>ref|NP_001234871.1| auxin response factor 1 [Solanum lycopersicum]
 gb|ADJ10892.1| auxin response factor 1 [Solanum lycopersicum]
Length=654

 Score = 92.0 bits (227),  Expect(2) = 2e-25, Method: Composition-based stats.
 Identities = 44/48 (92%), Positives = 46/48 (96%), Gaps = 0/48 (0%)
 Frame = +3

Query  357  VGVRRLMRQLNNMPSSVISSHTMHLGVLATASHAINTRTLFSVFYRPR  500
            VGVRRLMRQLNNMPSSVISSH+MHLGVLATASHAI T TLFSVFY+PR
Sbjct  224  VGVRRLMRQLNNMPSSVISSHSMHLGVLATASHAIMTGTLFSVFYKPR  271


 Score = 50.8 bits (120),  Expect(2) = 2e-25, Method: Composition-based stats.
 Identities = 25/35 (71%), Positives = 31/35 (89%), Gaps = 1/35 (3%)
 Frame = +1

Query  472  LFSLFFTGQGTSRSEFIVSVNKYIEAQNH*LSVGM  576
            LFS+F+  + TS+SEFIVSVNKY+EA+NH LSVGM
Sbjct  263  LFSVFYKPR-TSQSEFIVSVNKYLEARNHKLSVGM  296



>ref|XP_004142338.1| PREDICTED: auxin response factor 1-like [Cucumis sativus]
Length=739

 Score = 92.8 bits (229),  Expect(2) = 2e-25, Method: Compositional matrix adjust.
 Identities = 44/48 (92%), Positives = 47/48 (98%), Gaps = 0/48 (0%)
 Frame = +3

Query  357  VGVRRLMRQLNNMPSSVISSHTMHLGVLATASHAINTRTLFSVFYRPR  500
            VGVRRLMRQLNNMPSSVISSH+MHLGVLATASHAI+T TLFSVFY+PR
Sbjct  285  VGVRRLMRQLNNMPSSVISSHSMHLGVLATASHAISTGTLFSVFYKPR  332


 Score = 50.1 bits (118),  Expect(2) = 2e-25, Method: Composition-based stats.
 Identities = 24/35 (69%), Positives = 30/35 (86%), Gaps = 1/35 (3%)
 Frame = +1

Query  472  LFSLFFTGQGTSRSEFIVSVNKYIEAQNH*LSVGM  576
            LFS+F+  + TSRS F+VS+NKY+EAQNH LSVGM
Sbjct  324  LFSVFYKPR-TSRSTFLVSLNKYLEAQNHKLSVGM  357



>ref|XP_003575147.1| PREDICTED: auxin response factor 7-like [Brachypodium distachyon]
 ref|XP_010235548.1| PREDICTED: auxin response factor 7-like [Brachypodium distachyon]
Length=672

 Score = 94.0 bits (232),  Expect(2) = 2e-25, Method: Composition-based stats.
 Identities = 44/48 (92%), Positives = 47/48 (98%), Gaps = 0/48 (0%)
 Frame = +3

Query  357  VGVRRLMRQLNNMPSSVISSHTMHLGVLATASHAINTRTLFSVFYRPR  500
            VGVRRLMRQLNNMPSSVISSH+MHLGVLATASHAI+T TLFSVFY+PR
Sbjct  218  VGVRRLMRQLNNMPSSVISSHSMHLGVLATASHAISTGTLFSVFYKPR  265


 Score = 48.5 bits (114),  Expect(2) = 2e-25, Method: Composition-based stats.
 Identities = 23/35 (66%), Positives = 31/35 (89%), Gaps = 1/35 (3%)
 Frame = +1

Query  472  LFSLFFTGQGTSRSEFIVSVNKYIEAQNH*LSVGM  576
            LFS+F+  + TSRSEF+VSVNKY+EA+N+ +SVGM
Sbjct  257  LFSVFYKPR-TSRSEFVVSVNKYLEAKNNKMSVGM  290



>gb|KGN49710.1| hypothetical protein Csa_5G077780 [Cucumis sativus]
Length=678

 Score = 92.4 bits (228),  Expect(2) = 2e-25, Method: Composition-based stats.
 Identities = 44/48 (92%), Positives = 47/48 (98%), Gaps = 0/48 (0%)
 Frame = +3

Query  357  VGVRRLMRQLNNMPSSVISSHTMHLGVLATASHAINTRTLFSVFYRPR  500
            VGVRRLMRQLNNMPSSVISSH+MHLGVLATASHAI+T TLFSVFY+PR
Sbjct  224  VGVRRLMRQLNNMPSSVISSHSMHLGVLATASHAISTGTLFSVFYKPR  271


 Score = 50.1 bits (118),  Expect(2) = 2e-25, Method: Composition-based stats.
 Identities = 24/35 (69%), Positives = 30/35 (86%), Gaps = 1/35 (3%)
 Frame = +1

Query  472  LFSLFFTGQGTSRSEFIVSVNKYIEAQNH*LSVGM  576
            LFS+F+  + TSRS F+VS+NKY+EAQNH LSVGM
Sbjct  263  LFSVFYKPR-TSRSTFLVSLNKYLEAQNHKLSVGM  296



>ref|XP_006653437.1| PREDICTED: auxin response factor 9-like [Oryza brachyantha]
Length=673

 Score = 94.7 bits (234),  Expect(2) = 3e-25, Method: Composition-based stats.
 Identities = 44/48 (92%), Positives = 48/48 (100%), Gaps = 0/48 (0%)
 Frame = +3

Query  357  VGVRRLMRQLNNMPSSVISSHTMHLGVLATASHAINTRTLFSVFYRPR  500
            VGVRRLMRQ+NNMPSSVISSH+MHLGVLATASHAI+TRTLFSVFY+PR
Sbjct  223  VGVRRLMRQVNNMPSSVISSHSMHLGVLATASHAISTRTLFSVFYKPR  270


 Score = 47.0 bits (110),  Expect(2) = 3e-25, Method: Composition-based stats.
 Identities = 23/35 (66%), Positives = 29/35 (83%), Gaps = 1/35 (3%)
 Frame = +1

Query  472  LFSLFFTGQGTSRSEFIVSVNKYIEAQNH*LSVGM  576
            LFS+F+  + TSRSEF+VSVNKY+EA+   LSVGM
Sbjct  262  LFSVFYKPR-TSRSEFVVSVNKYLEAKKQNLSVGM  295



>ref|XP_004952778.1| PREDICTED: auxin response factor 7-like isoform X1 [Setaria italica]
 ref|XP_004952779.1| PREDICTED: auxin response factor 7-like isoform X2 [Setaria italica]
Length=673

 Score = 90.1 bits (222),  Expect(2) = 3e-25, Method: Composition-based stats.
 Identities = 43/48 (90%), Positives = 46/48 (96%), Gaps = 0/48 (0%)
 Frame = +3

Query  357  VGVRRLMRQLNNMPSSVISSHTMHLGVLATASHAINTRTLFSVFYRPR  500
            VGVRRLMRQL NMPSSVISSH+MHLGVLATASHAI+T TLFSVFY+PR
Sbjct  219  VGVRRLMRQLTNMPSSVISSHSMHLGVLATASHAISTGTLFSVFYKPR  266


 Score = 51.6 bits (122),  Expect(2) = 3e-25, Method: Composition-based stats.
 Identities = 24/35 (69%), Positives = 31/35 (89%), Gaps = 1/35 (3%)
 Frame = +1

Query  472  LFSLFFTGQGTSRSEFIVSVNKYIEAQNH*LSVGM  576
            LFS+F+  + TSRSEF+VSVNKY+EA+NH +SVGM
Sbjct  258  LFSVFYKPR-TSRSEFVVSVNKYLEAKNHKMSVGM  291



>ref|XP_004485416.1| PREDICTED: auxin response factor 1-like isoform X1 [Cicer arietinum]
 ref|XP_004485417.1| PREDICTED: auxin response factor 1-like isoform X2 [Cicer arietinum]
Length=670

 Score = 89.0 bits (219),  Expect(2) = 3e-25, Method: Composition-based stats.
 Identities = 42/48 (88%), Positives = 46/48 (96%), Gaps = 0/48 (0%)
 Frame = +3

Query  357  VGVRRLMRQLNNMPSSVISSHTMHLGVLATASHAINTRTLFSVFYRPR  500
            VGVRRLMRQ +NMPSSVISSH+MHLGVLATASHAI+T TLFSVFY+PR
Sbjct  220  VGVRRLMRQQSNMPSSVISSHSMHLGVLATASHAISTGTLFSVFYKPR  267


 Score = 52.8 bits (125),  Expect(2) = 3e-25, Method: Composition-based stats.
 Identities = 26/35 (74%), Positives = 31/35 (89%), Gaps = 1/35 (3%)
 Frame = +1

Query  472  LFSLFFTGQGTSRSEFIVSVNKYIEAQNH*LSVGM  576
            LFS+F+  + TSRSEFIVSVNKY+EA+NH LSVGM
Sbjct  259  LFSVFYKPR-TSRSEFIVSVNKYLEARNHKLSVGM  292



>ref|XP_010682136.1| PREDICTED: auxin response factor 1 [Beta vulgaris subsp. vulgaris]
Length=659

 Score = 92.0 bits (227),  Expect(2) = 3e-25, Method: Composition-based stats.
 Identities = 43/48 (90%), Positives = 46/48 (96%), Gaps = 0/48 (0%)
 Frame = +3

Query  357  VGVRRLMRQLNNMPSSVISSHTMHLGVLATASHAINTRTLFSVFYRPR  500
            VGVRRLMRQLNNMPSSVISSH+MHLGVLATA+HAI T TLFSVFY+PR
Sbjct  219  VGVRRLMRQLNNMPSSVISSHSMHLGVLATAAHAIQTGTLFSVFYKPR  266


 Score = 49.7 bits (117),  Expect(2) = 3e-25, Method: Composition-based stats.
 Identities = 24/35 (69%), Positives = 31/35 (89%), Gaps = 1/35 (3%)
 Frame = +1

Query  472  LFSLFFTGQGTSRSEFIVSVNKYIEAQNH*LSVGM  576
            LFS+F+  + TSRSEF+VSVNKY+EA++H LSVGM
Sbjct  258  LFSVFYKPR-TSRSEFLVSVNKYLEAKSHKLSVGM  291



>ref|XP_009627009.1| PREDICTED: auxin response factor 1 [Nicotiana tomentosiformis]
 ref|XP_009627014.1| PREDICTED: auxin response factor 1 [Nicotiana tomentosiformis]
 ref|XP_009627020.1| PREDICTED: auxin response factor 1 [Nicotiana tomentosiformis]
 ref|XP_009627027.1| PREDICTED: auxin response factor 1 [Nicotiana tomentosiformis]
Length=654

 Score = 92.0 bits (227),  Expect(2) = 3e-25, Method: Composition-based stats.
 Identities = 43/48 (90%), Positives = 47/48 (98%), Gaps = 0/48 (0%)
 Frame = +3

Query  357  VGVRRLMRQLNNMPSSVISSHTMHLGVLATASHAINTRTLFSVFYRPR  500
            VGVRRLMRQLNNMPSSVISSH+MHLGVLATASHAI+T TLFSV+Y+PR
Sbjct  223  VGVRRLMRQLNNMPSSVISSHSMHLGVLATASHAISTGTLFSVYYKPR  270


 Score = 49.7 bits (117),  Expect(2) = 3e-25, Method: Composition-based stats.
 Identities = 24/35 (69%), Positives = 31/35 (89%), Gaps = 1/35 (3%)
 Frame = +1

Query  472  LFSLFFTGQGTSRSEFIVSVNKYIEAQNH*LSVGM  576
            LFS+++  + TS+SEFIVSVNKY+EA+NH LSVGM
Sbjct  262  LFSVYYKPR-TSQSEFIVSVNKYLEARNHKLSVGM  295



>ref|XP_009786487.1| PREDICTED: auxin response factor 1 [Nicotiana sylvestris]
 ref|XP_009786488.1| PREDICTED: auxin response factor 1 [Nicotiana sylvestris]
 ref|XP_009786489.1| PREDICTED: auxin response factor 1 [Nicotiana sylvestris]
 ref|XP_009786490.1| PREDICTED: auxin response factor 1 [Nicotiana sylvestris]
Length=653

 Score = 92.0 bits (227),  Expect(2) = 4e-25, Method: Composition-based stats.
 Identities = 43/48 (90%), Positives = 47/48 (98%), Gaps = 0/48 (0%)
 Frame = +3

Query  357  VGVRRLMRQLNNMPSSVISSHTMHLGVLATASHAINTRTLFSVFYRPR  500
            VGVRRLMRQLNNMPSSVISSH+MHLGVLATASHAI+T TLFSV+Y+PR
Sbjct  223  VGVRRLMRQLNNMPSSVISSHSMHLGVLATASHAISTGTLFSVYYKPR  270


 Score = 49.7 bits (117),  Expect(2) = 4e-25, Method: Composition-based stats.
 Identities = 24/35 (69%), Positives = 31/35 (89%), Gaps = 1/35 (3%)
 Frame = +1

Query  472  LFSLFFTGQGTSRSEFIVSVNKYIEAQNH*LSVGM  576
            LFS+++  + TS+SEFIVSVNKY+EA+NH LSVGM
Sbjct  262  LFSVYYKPR-TSQSEFIVSVNKYLEARNHKLSVGM  295



>gb|ABO80473.1| AUX/IAA protein; Transcriptional factor B3; Auxin response factor 
[Medicago truncatula]
Length=670

 Score = 89.0 bits (219),  Expect(2) = 5e-25, Method: Composition-based stats.
 Identities = 42/48 (88%), Positives = 46/48 (96%), Gaps = 0/48 (0%)
 Frame = +3

Query  357  VGVRRLMRQLNNMPSSVISSHTMHLGVLATASHAINTRTLFSVFYRPR  500
            VGVRRLMRQ +NMPSSVISSH+MHLGVLATASHAI+T TLFSVFY+PR
Sbjct  220  VGVRRLMRQQSNMPSSVISSHSMHLGVLATASHAISTGTLFSVFYKPR  267


 Score = 52.4 bits (124),  Expect(2) = 5e-25, Method: Composition-based stats.
 Identities = 25/35 (71%), Positives = 31/35 (89%), Gaps = 1/35 (3%)
 Frame = +1

Query  472  LFSLFFTGQGTSRSEFIVSVNKYIEAQNH*LSVGM  576
            LFS+F+  + TSRSEFIVS+NKY+EA+NH LSVGM
Sbjct  259  LFSVFYKPR-TSRSEFIVSINKYLEARNHKLSVGM  292



>ref|XP_007148592.1| hypothetical protein PHAVU_006G221500g [Phaseolus vulgaris]
 gb|ESW20586.1| hypothetical protein PHAVU_006G221500g [Phaseolus vulgaris]
Length=664

 Score = 88.6 bits (218),  Expect(2) = 6e-25, Method: Composition-based stats.
 Identities = 42/48 (88%), Positives = 45/48 (94%), Gaps = 0/48 (0%)
 Frame = +3

Query  357  VGVRRLMRQLNNMPSSVISSHTMHLGVLATASHAINTRTLFSVFYRPR  500
            VGVRRLMRQ +NMPSSVISSH+MHLGVLATASHAI T TLFSVFY+PR
Sbjct  214  VGVRRLMRQQSNMPSSVISSHSMHLGVLATASHAIATGTLFSVFYKPR  261


 Score = 52.4 bits (124),  Expect(2) = 6e-25, Method: Composition-based stats.
 Identities = 26/35 (74%), Positives = 31/35 (89%), Gaps = 1/35 (3%)
 Frame = +1

Query  472  LFSLFFTGQGTSRSEFIVSVNKYIEAQNH*LSVGM  576
            LFS+F+  + TSRSEFIVSVNKY+EAQ+H LSVGM
Sbjct  253  LFSVFYKPR-TSRSEFIVSVNKYLEAQSHKLSVGM  286



>ref|XP_003592874.1| Auxin response factor [Medicago truncatula]
 gb|AES63125.1| auxin response factor 2 [Medicago truncatula]
Length=671

 Score = 88.6 bits (218),  Expect(2) = 7e-25, Method: Composition-based stats.
 Identities = 42/48 (88%), Positives = 46/48 (96%), Gaps = 0/48 (0%)
 Frame = +3

Query  357  VGVRRLMRQLNNMPSSVISSHTMHLGVLATASHAINTRTLFSVFYRPR  500
            VGVRRLMRQ +NMPSSVISSH+MHLGVLATASHAI+T TLFSVFY+PR
Sbjct  221  VGVRRLMRQQSNMPSSVISSHSMHLGVLATASHAISTGTLFSVFYKPR  268


 Score = 52.4 bits (124),  Expect(2) = 7e-25, Method: Composition-based stats.
 Identities = 25/35 (71%), Positives = 31/35 (89%), Gaps = 1/35 (3%)
 Frame = +1

Query  472  LFSLFFTGQGTSRSEFIVSVNKYIEAQNH*LSVGM  576
            LFS+F+  + TSRSEFIVS+NKY+EA+NH LSVGM
Sbjct  260  LFSVFYKPR-TSRSEFIVSINKYLEARNHKLSVGM  293



>ref|XP_004172315.1| PREDICTED: auxin response factor 1-like, partial [Cucumis sativus]
Length=335

 Score = 92.0 bits (227),  Expect(2) = 7e-25, Method: Compositional matrix adjust.
 Identities = 44/48 (92%), Positives = 47/48 (98%), Gaps = 0/48 (0%)
 Frame = +3

Query  357  VGVRRLMRQLNNMPSSVISSHTMHLGVLATASHAINTRTLFSVFYRPR  500
            VGVRRLMRQLNNMPSSVISSH+MHLGVLATASHAI+T TLFSVFY+PR
Sbjct  223  VGVRRLMRQLNNMPSSVISSHSMHLGVLATASHAISTGTLFSVFYKPR  270


 Score = 48.9 bits (115),  Expect(2) = 7e-25, Method: Compositional matrix adjust.
 Identities = 24/35 (69%), Positives = 30/35 (86%), Gaps = 1/35 (3%)
 Frame = +1

Query  472  LFSLFFTGQGTSRSEFIVSVNKYIEAQNH*LSVGM  576
            LFS+F+  + TSRS F+VS+NKY+EAQNH LSVGM
Sbjct  262  LFSVFYKPR-TSRSTFLVSLNKYLEAQNHKLSVGM  295



>ref|XP_003548301.1| PREDICTED: auxin response factor 1-like isoform X1 [Glycine max]
Length=665

 Score = 88.2 bits (217),  Expect(2) = 8e-25, Method: Composition-based stats.
 Identities = 42/48 (88%), Positives = 45/48 (94%), Gaps = 0/48 (0%)
 Frame = +3

Query  357  VGVRRLMRQLNNMPSSVISSHTMHLGVLATASHAINTRTLFSVFYRPR  500
            VGVRRLMRQ +NMPSSVISSH+MHLGVLATASHAI T TLFSVFY+PR
Sbjct  214  VGVRRLMRQHSNMPSSVISSHSMHLGVLATASHAIATGTLFSVFYKPR  261


 Score = 52.4 bits (124),  Expect(2) = 8e-25, Method: Composition-based stats.
 Identities = 26/35 (74%), Positives = 31/35 (89%), Gaps = 1/35 (3%)
 Frame = +1

Query  472  LFSLFFTGQGTSRSEFIVSVNKYIEAQNH*LSVGM  576
            LFS+F+  + TSRSEFIVSVNKY+EAQ+H LSVGM
Sbjct  253  LFSVFYKPR-TSRSEFIVSVNKYLEAQSHKLSVGM  286



>gb|KHN11044.1| Auxin response factor 1 [Glycine soja]
Length=669

 Score = 88.2 bits (217),  Expect(2) = 8e-25, Method: Composition-based stats.
 Identities = 42/48 (88%), Positives = 45/48 (94%), Gaps = 0/48 (0%)
 Frame = +3

Query  357  VGVRRLMRQLNNMPSSVISSHTMHLGVLATASHAINTRTLFSVFYRPR  500
            VGVRRLMRQ +NMPSSVISSH+MHLGVLATASHAI T TLFSVFY+PR
Sbjct  218  VGVRRLMRQQSNMPSSVISSHSMHLGVLATASHAIATGTLFSVFYKPR  265


 Score = 52.4 bits (124),  Expect(2) = 8e-25, Method: Composition-based stats.
 Identities = 26/35 (74%), Positives = 31/35 (89%), Gaps = 1/35 (3%)
 Frame = +1

Query  472  LFSLFFTGQGTSRSEFIVSVNKYIEAQNH*LSVGM  576
            LFS+F+  + TSRSEFIVSVNKY+EAQ+H LSVGM
Sbjct  257  LFSVFYKPR-TSRSEFIVSVNKYLEAQSHKLSVGM  290



>ref|XP_006598778.1| PREDICTED: auxin response factor 1-like isoform X2 [Glycine max]
Length=639

 Score = 87.8 bits (216),  Expect(2) = 8e-25, Method: Composition-based stats.
 Identities = 42/48 (88%), Positives = 45/48 (94%), Gaps = 0/48 (0%)
 Frame = +3

Query  357  VGVRRLMRQLNNMPSSVISSHTMHLGVLATASHAINTRTLFSVFYRPR  500
            VGVRRLMRQ +NMPSSVISSH+MHLGVLATASHAI T TLFSVFY+PR
Sbjct  214  VGVRRLMRQHSNMPSSVISSHSMHLGVLATASHAIATGTLFSVFYKPR  261


 Score = 52.4 bits (124),  Expect(2) = 8e-25, Method: Composition-based stats.
 Identities = 26/35 (74%), Positives = 31/35 (89%), Gaps = 1/35 (3%)
 Frame = +1

Query  472  LFSLFFTGQGTSRSEFIVSVNKYIEAQNH*LSVGM  576
            LFS+F+  + TSRSEFIVSVNKY+EAQ+H LSVGM
Sbjct  253  LFSVFYKPR-TSRSEFIVSVNKYLEAQSHKLSVGM  286



>ref|XP_006598779.1| PREDICTED: auxin response factor 1-like isoform X3 [Glycine max]
Length=616

 Score = 87.8 bits (216),  Expect(2) = 9e-25, Method: Composition-based stats.
 Identities = 42/48 (88%), Positives = 45/48 (94%), Gaps = 0/48 (0%)
 Frame = +3

Query  357  VGVRRLMRQLNNMPSSVISSHTMHLGVLATASHAINTRTLFSVFYRPR  500
            VGVRRLMRQ +NMPSSVISSH+MHLGVLATASHAI T TLFSVFY+PR
Sbjct  165  VGVRRLMRQHSNMPSSVISSHSMHLGVLATASHAIATGTLFSVFYKPR  212


 Score = 52.4 bits (124),  Expect(2) = 9e-25, Method: Composition-based stats.
 Identities = 26/35 (74%), Positives = 31/35 (89%), Gaps = 1/35 (3%)
 Frame = +1

Query  472  LFSLFFTGQGTSRSEFIVSVNKYIEAQNH*LSVGM  576
            LFS+F+  + TSRSEFIVSVNKY+EAQ+H LSVGM
Sbjct  204  LFSVFYKPR-TSRSEFIVSVNKYLEAQSHKLSVGM  237



>emb|CAE02512.1| P0076O17.10 [Oryza sativa Japonica Group]
Length=1673

 Score = 92.8 bits (229),  Expect(2) = 1e-24, Method: Composition-based stats.
 Identities = 43/48 (90%), Positives = 47/48 (98%), Gaps = 0/48 (0%)
 Frame = +3

Query  357  VGVRRLMRQLNNMPSSVISSHTMHLGVLATASHAINTRTLFSVFYRPR  500
            VGVRRLMRQ+NNMPSSVISSH+MHLGVLATASHAI+T TLFSVFY+PR
Sbjct  218  VGVRRLMRQVNNMPSSVISSHSMHLGVLATASHAISTGTLFSVFYKPR  265


 Score = 47.0 bits (110),  Expect(2) = 1e-24, Method: Composition-based stats.
 Identities = 23/35 (66%), Positives = 29/35 (83%), Gaps = 1/35 (3%)
 Frame = +1

Query  472  LFSLFFTGQGTSRSEFIVSVNKYIEAQNH*LSVGM  576
            LFS+F+  + TSRSEF+VSVNKY+EA+   LSVGM
Sbjct  257  LFSVFYKPR-TSRSEFVVSVNKYLEAKKQNLSVGM  290



>ref|XP_009404302.1| PREDICTED: auxin response factor 7-like [Musa acuminata subsp. 
malaccensis]
 ref|XP_009404304.1| PREDICTED: auxin response factor 7-like [Musa acuminata subsp. 
malaccensis]
 ref|XP_009404305.1| PREDICTED: auxin response factor 7-like [Musa acuminata subsp. 
malaccensis]
Length=696

 Score = 93.2 bits (230),  Expect(2) = 1e-24, Method: Composition-based stats.
 Identities = 44/48 (92%), Positives = 46/48 (96%), Gaps = 0/48 (0%)
 Frame = +3

Query  357  VGVRRLMRQLNNMPSSVISSHTMHLGVLATASHAINTRTLFSVFYRPR  500
            VGVRRLMRQLNNMPSSVISSH+MHLGVLATASHAI T TLFSVFY+PR
Sbjct  218  VGVRRLMRQLNNMPSSVISSHSMHLGVLATASHAITTGTLFSVFYKPR  265


 Score = 46.6 bits (109),  Expect(2) = 1e-24, Method: Composition-based stats.
 Identities = 22/35 (63%), Positives = 29/35 (83%), Gaps = 1/35 (3%)
 Frame = +1

Query  472  LFSLFFTGQGTSRSEFIVSVNKYIEAQNH*LSVGM  576
            LFS+F+  +  SRSEFI+S+NKYIEA++H  SVGM
Sbjct  257  LFSVFYKPRA-SRSEFIISLNKYIEAKSHKFSVGM  290



>gb|EEC77345.1| hypothetical protein OsI_16025 [Oryza sativa Indica Group]
Length=660

 Score = 92.4 bits (228),  Expect(2) = 2e-24, Method: Composition-based stats.
 Identities = 43/48 (90%), Positives = 47/48 (98%), Gaps = 0/48 (0%)
 Frame = +3

Query  357  VGVRRLMRQLNNMPSSVISSHTMHLGVLATASHAINTRTLFSVFYRPR  500
            VGVRRLMRQ+NNMPSSVISSH+MHLGVLATASHAI+T TLFSVFY+PR
Sbjct  218  VGVRRLMRQVNNMPSSVISSHSMHLGVLATASHAISTGTLFSVFYKPR  265


 Score = 47.0 bits (110),  Expect(2) = 2e-24, Method: Composition-based stats.
 Identities = 23/35 (66%), Positives = 29/35 (83%), Gaps = 1/35 (3%)
 Frame = +1

Query  472  LFSLFFTGQGTSRSEFIVSVNKYIEAQNH*LSVGM  576
            LFS+F+  + TSRSEF+VSVNKY+EA+   LSVGM
Sbjct  257  LFSVFYKPR-TSRSEFVVSVNKYLEAKKQNLSVGM  290



>ref|XP_009406473.1| PREDICTED: auxin response factor 7-like isoform X1 [Musa acuminata 
subsp. malaccensis]
Length=682

 Score = 92.0 bits (227),  Expect(2) = 2e-24, Method: Composition-based stats.
 Identities = 43/48 (90%), Positives = 45/48 (94%), Gaps = 0/48 (0%)
 Frame = +3

Query  357  VGVRRLMRQLNNMPSSVISSHTMHLGVLATASHAINTRTLFSVFYRPR  500
            VGVRRLMRQ NNMPSSVISSH+MHLGVLATASHAI T TLFSVFY+PR
Sbjct  223  VGVRRLMRQPNNMPSSVISSHSMHLGVLATASHAIATGTLFSVFYKPR  270


 Score = 47.0 bits (110),  Expect(2) = 2e-24, Method: Composition-based stats.
 Identities = 22/35 (63%), Positives = 30/35 (86%), Gaps = 1/35 (3%)
 Frame = +1

Query  472  LFSLFFTGQGTSRSEFIVSVNKYIEAQNH*LSVGM  576
            LFS+F+  + TSRS+FI+SVNKY+EA+N+  SVGM
Sbjct  262  LFSVFYKPR-TSRSDFIISVNKYLEAKNYKFSVGM  295



>ref|NP_001052879.1| Os04g0442000 [Oryza sativa Japonica Group]
 sp|Q0JCZ4.1|ARFI_ORYSJ RecName: Full=Auxin response factor 9 [Oryza sativa Japonica 
Group]
 dbj|BAF14793.1| Os04g0442000 [Oryza sativa Japonica Group]
Length=673

 Score = 92.0 bits (227),  Expect(2) = 2e-24, Method: Composition-based stats.
 Identities = 43/48 (90%), Positives = 47/48 (98%), Gaps = 0/48 (0%)
 Frame = +3

Query  357  VGVRRLMRQLNNMPSSVISSHTMHLGVLATASHAINTRTLFSVFYRPR  500
            VGVRRLMRQ+NNMPSSVISSH+MHLGVLATASHAI+T TLFSVFY+PR
Sbjct  222  VGVRRLMRQVNNMPSSVISSHSMHLGVLATASHAISTGTLFSVFYKPR  269


 Score = 47.0 bits (110),  Expect(2) = 2e-24, Method: Composition-based stats.
 Identities = 23/35 (66%), Positives = 29/35 (83%), Gaps = 1/35 (3%)
 Frame = +1

Query  472  LFSLFFTGQGTSRSEFIVSVNKYIEAQNH*LSVGM  576
            LFS+F+  + TSRSEF+VSVNKY+EA+   LSVGM
Sbjct  261  LFSVFYKPR-TSRSEFVVSVNKYLEAKKQNLSVGM  294



>emb|CAE04227.2| OSJNBa0064D20.11 [Oryza sativa Japonica Group]
 gb|EEE61062.1| hypothetical protein OsJ_14920 [Oryza sativa Japonica Group]
Length=669

 Score = 92.0 bits (227),  Expect(2) = 2e-24, Method: Composition-based stats.
 Identities = 43/48 (90%), Positives = 47/48 (98%), Gaps = 0/48 (0%)
 Frame = +3

Query  357  VGVRRLMRQLNNMPSSVISSHTMHLGVLATASHAINTRTLFSVFYRPR  500
            VGVRRLMRQ+NNMPSSVISSH+MHLGVLATASHAI+T TLFSVFY+PR
Sbjct  218  VGVRRLMRQVNNMPSSVISSHSMHLGVLATASHAISTGTLFSVFYKPR  265


 Score = 47.0 bits (110),  Expect(2) = 2e-24, Method: Composition-based stats.
 Identities = 23/35 (66%), Positives = 29/35 (83%), Gaps = 1/35 (3%)
 Frame = +1

Query  472  LFSLFFTGQGTSRSEFIVSVNKYIEAQNH*LSVGM  576
            LFS+F+  + TSRSEF+VSVNKY+EA+   LSVGM
Sbjct  257  LFSVFYKPR-TSRSEFVVSVNKYLEAKKQNLSVGM  290



>ref|XP_011003708.1| PREDICTED: auxin response factor 1-like [Populus euphratica]
 ref|XP_011003709.1| PREDICTED: auxin response factor 1-like [Populus euphratica]
Length=660

 Score = 85.9 bits (211),  Expect(2) = 3e-24, Method: Composition-based stats.
 Identities = 41/48 (85%), Positives = 44/48 (92%), Gaps = 0/48 (0%)
 Frame = +3

Query  357  VGVRRLMRQLNNMPSSVISSHTMHLGVLATASHAINTRTLFSVFYRPR  500
            VGVRRLMRQ  NMPSSVISS +MHLGVLATASHAI+T TLFSVFY+PR
Sbjct  219  VGVRRLMRQQTNMPSSVISSQSMHLGVLATASHAISTGTLFSVFYKPR  266


 Score = 53.1 bits (126),  Expect(2) = 3e-24, Method: Composition-based stats.
 Identities = 26/35 (74%), Positives = 31/35 (89%), Gaps = 1/35 (3%)
 Frame = +1

Query  472  LFSLFFTGQGTSRSEFIVSVNKYIEAQNH*LSVGM  576
            LFS+F+  + TSRSEFIV++NKYIEAQNH LSVGM
Sbjct  258  LFSVFYKPR-TSRSEFIVNLNKYIEAQNHKLSVGM  291



>ref|XP_003540131.1| PREDICTED: auxin response factor 1-like [Glycine max]
Length=665

 Score = 87.8 bits (216),  Expect(2) = 3e-24, Method: Composition-based stats.
 Identities = 42/48 (88%), Positives = 45/48 (94%), Gaps = 0/48 (0%)
 Frame = +3

Query  357  VGVRRLMRQLNNMPSSVISSHTMHLGVLATASHAINTRTLFSVFYRPR  500
            VGVRRLMRQ +NMPSSVISSH+MHLGVLATASHAI T TLFSVFY+PR
Sbjct  214  VGVRRLMRQQSNMPSSVISSHSMHLGVLATASHAIATGTLFSVFYKPR  261


 Score = 50.8 bits (120),  Expect(2) = 3e-24, Method: Composition-based stats.
 Identities = 25/35 (71%), Positives = 31/35 (89%), Gaps = 1/35 (3%)
 Frame = +1

Query  472  LFSLFFTGQGTSRSEFIVSVNKYIEAQNH*LSVGM  576
            LFS+F+  + TSRSEFIVSVNKY+EA++H LSVGM
Sbjct  253  LFSVFYKPR-TSRSEFIVSVNKYLEARSHKLSVGM  286



>ref|XP_011092260.1| PREDICTED: auxin response factor 1 isoform X1 [Sesamum indicum]
Length=667

 Score = 89.4 bits (220),  Expect(2) = 3e-24, Method: Composition-based stats.
 Identities = 42/48 (88%), Positives = 46/48 (96%), Gaps = 0/48 (0%)
 Frame = +3

Query  357  VGVRRLMRQLNNMPSSVISSHTMHLGVLATASHAINTRTLFSVFYRPR  500
            VGVRR MRQLNNMP+SVISSH+MHLGVLATASHAI+T TLFSVFY+PR
Sbjct  223  VGVRRHMRQLNNMPTSVISSHSMHLGVLATASHAISTGTLFSVFYKPR  270


 Score = 48.9 bits (115),  Expect(2) = 3e-24, Method: Composition-based stats.
 Identities = 23/35 (66%), Positives = 30/35 (86%), Gaps = 1/35 (3%)
 Frame = +1

Query  472  LFSLFFTGQGTSRSEFIVSVNKYIEAQNH*LSVGM  576
            LFS+F+  + TSRSEF+VS+NKY+EA+NH L VGM
Sbjct  262  LFSVFYKPR-TSRSEFVVSLNKYLEAKNHKLPVGM  295



>gb|EPS68815.1| auxin response factor 1 [Genlisea aurea]
Length=428

 Score = 90.1 bits (222),  Expect(2) = 3e-24, Method: Compositional matrix adjust.
 Identities = 43/48 (90%), Positives = 45/48 (94%), Gaps = 0/48 (0%)
 Frame = +3

Query  357  VGVRRLMRQLNNMPSSVISSHTMHLGVLATASHAINTRTLFSVFYRPR  500
            VGVRRLMRQLNNMPSSVISSH MH+GVLATASHAI T TLFSVFY+PR
Sbjct  239  VGVRRLMRQLNNMPSSVISSHNMHVGVLATASHAITTGTLFSVFYKPR  286


 Score = 48.5 bits (114),  Expect(2) = 3e-24, Method: Compositional matrix adjust.
 Identities = 22/35 (63%), Positives = 31/35 (89%), Gaps = 1/35 (3%)
 Frame = +1

Query  472  LFSLFFTGQGTSRSEFIVSVNKYIEAQNH*LSVGM  576
            LFS+F+  + +S+SEF++SVNKY++AQNH LSVGM
Sbjct  278  LFSVFYKPR-SSQSEFVISVNKYLDAQNHKLSVGM  311



>ref|XP_009379878.1| PREDICTED: auxin response factor 7-like [Musa acuminata subsp. 
malaccensis]
 ref|XP_009379879.1| PREDICTED: auxin response factor 7-like [Musa acuminata subsp. 
malaccensis]
Length=674

 Score = 94.7 bits (234),  Expect(2) = 3e-24, Method: Composition-based stats.
 Identities = 44/48 (92%), Positives = 46/48 (96%), Gaps = 0/48 (0%)
 Frame = +3

Query  357  VGVRRLMRQLNNMPSSVISSHTMHLGVLATASHAINTRTLFSVFYRPR  500
            VGVRRLMRQLNNMPSSVISSH+MHLGVLATASHAI T TLFSVFY+PR
Sbjct  220  VGVRRLMRQLNNMPSSVISSHSMHLGVLATASHAITTGTLFSVFYKPR  267


 Score = 43.5 bits (101),  Expect(2) = 3e-24, Method: Composition-based stats.
 Identities = 20/35 (57%), Positives = 30/35 (86%), Gaps = 1/35 (3%)
 Frame = +1

Query  472  LFSLFFTGQGTSRSEFIVSVNKYIEAQNH*LSVGM  576
            LFS+F+  +  SRSEF++S+NKY+EA+++ LSVGM
Sbjct  259  LFSVFYKPRA-SRSEFLISLNKYLEAKSYKLSVGM  292



>ref|XP_011092261.1| PREDICTED: auxin response factor 1 isoform X2 [Sesamum indicum]
Length=661

 Score = 89.4 bits (220),  Expect(2) = 4e-24, Method: Composition-based stats.
 Identities = 42/48 (88%), Positives = 46/48 (96%), Gaps = 0/48 (0%)
 Frame = +3

Query  357  VGVRRLMRQLNNMPSSVISSHTMHLGVLATASHAINTRTLFSVFYRPR  500
            VGVRR MRQLNNMP+SVISSH+MHLGVLATASHAI+T TLFSVFY+PR
Sbjct  223  VGVRRHMRQLNNMPTSVISSHSMHLGVLATASHAISTGTLFSVFYKPR  270


 Score = 48.9 bits (115),  Expect(2) = 4e-24, Method: Composition-based stats.
 Identities = 23/35 (66%), Positives = 30/35 (86%), Gaps = 1/35 (3%)
 Frame = +1

Query  472  LFSLFFTGQGTSRSEFIVSVNKYIEAQNH*LSVGM  576
            LFS+F+  + TSRSEF+VS+NKY+EA+NH L VGM
Sbjct  262  LFSVFYKPR-TSRSEFVVSLNKYLEAKNHKLPVGM  295



>ref|XP_010099783.1| Auxin response factor 1 [Morus notabilis]
 gb|EXB80401.1| Auxin response factor 1 [Morus notabilis]
Length=666

 Score = 88.6 bits (218),  Expect(2) = 4e-24, Method: Composition-based stats.
 Identities = 42/48 (88%), Positives = 46/48 (96%), Gaps = 0/48 (0%)
 Frame = +3

Query  357  VGVRRLMRQLNNMPSSVISSHTMHLGVLATASHAINTRTLFSVFYRPR  500
            VGVRRLMRQ +NMPSSVISSH+MHLGVLATASHAI+T TLFSVFY+PR
Sbjct  216  VGVRRLMRQPSNMPSSVISSHSMHLGVLATASHAISTGTLFSVFYKPR  263


 Score = 49.7 bits (117),  Expect(2) = 4e-24, Method: Composition-based stats.
 Identities = 24/35 (69%), Positives = 31/35 (89%), Gaps = 1/35 (3%)
 Frame = +1

Query  472  LFSLFFTGQGTSRSEFIVSVNKYIEAQNH*LSVGM  576
            LFS+F+  + TSRSEF+VSVNKY+EA++H LSVGM
Sbjct  255  LFSVFYKPR-TSRSEFLVSVNKYLEARSHKLSVGM  288



>gb|AIR95657.1| auxin response factor 1 family protein [Populus davidiana x Populus 
alba var. pyramidalis]
Length=660

 Score = 85.1 bits (209),  Expect(2) = 4e-24, Method: Composition-based stats.
 Identities = 41/48 (85%), Positives = 43/48 (90%), Gaps = 0/48 (0%)
 Frame = +3

Query  357  VGVRRLMRQLNNMPSSVISSHTMHLGVLATASHAINTRTLFSVFYRPR  500
            VGVRRLMRQ  NMPSSVISS +MHLGVLATASHAI T TLFSVFY+PR
Sbjct  219  VGVRRLMRQQTNMPSSVISSQSMHLGVLATASHAIATGTLFSVFYKPR  266


 Score = 53.1 bits (126),  Expect(2) = 4e-24, Method: Composition-based stats.
 Identities = 26/35 (74%), Positives = 31/35 (89%), Gaps = 1/35 (3%)
 Frame = +1

Query  472  LFSLFFTGQGTSRSEFIVSVNKYIEAQNH*LSVGM  576
            LFS+F+  + TSRSEFIV++NKYIEAQNH LSVGM
Sbjct  258  LFSVFYKPR-TSRSEFIVNLNKYIEAQNHKLSVGM  291



>ref|XP_004975691.1| PREDICTED: auxin response factor 9-like [Setaria italica]
Length=663

 Score = 92.8 bits (229),  Expect(2) = 4e-24, Method: Composition-based stats.
 Identities = 43/48 (90%), Positives = 47/48 (98%), Gaps = 0/48 (0%)
 Frame = +3

Query  357  VGVRRLMRQLNNMPSSVISSHTMHLGVLATASHAINTRTLFSVFYRPR  500
            VGVRRLMRQ+NNMPSSVISSH+MHLGVLATASHAI+T TLFSVFY+PR
Sbjct  224  VGVRRLMRQVNNMPSSVISSHSMHLGVLATASHAISTGTLFSVFYKPR  271


 Score = 45.1 bits (105),  Expect(2) = 4e-24, Method: Composition-based stats.
 Identities = 22/35 (63%), Positives = 29/35 (83%), Gaps = 1/35 (3%)
 Frame = +1

Query  472  LFSLFFTGQGTSRSEFIVSVNKYIEAQNH*LSVGM  576
            LFS+F+  + TSRS+FIVSVNKY+EA+   +SVGM
Sbjct  263  LFSVFYKPR-TSRSDFIVSVNKYLEAKKQKISVGM  296



>gb|KDP42510.1| hypothetical protein JCGZ_00307 [Jatropha curcas]
Length=680

 Score = 84.7 bits (208),  Expect(2) = 5e-24, Method: Composition-based stats.
 Identities = 41/48 (85%), Positives = 43/48 (90%), Gaps = 0/48 (0%)
 Frame = +3

Query  357  VGVRRLMRQLNNMPSSVISSHTMHLGVLATASHAINTRTLFSVFYRPR  500
            VGVRRLMRQ  NMPSSVISS +MHLGVLATASHAI T TLFSVFY+PR
Sbjct  224  VGVRRLMRQQTNMPSSVISSQSMHLGVLATASHAIATGTLFSVFYKPR  271


 Score = 52.8 bits (125),  Expect(2) = 5e-24, Method: Composition-based stats.
 Identities = 26/35 (74%), Positives = 31/35 (89%), Gaps = 1/35 (3%)
 Frame = +1

Query  472  LFSLFFTGQGTSRSEFIVSVNKYIEAQNH*LSVGM  576
            LFS+F+  + TSRSEFIVSVNKY+EA+NH LSVGM
Sbjct  263  LFSVFYKPR-TSRSEFIVSVNKYLEARNHKLSVGM  296



>ref|XP_006648743.1| PREDICTED: auxin response factor 7-like [Oryza brachyantha]
Length=674

 Score = 92.8 bits (229),  Expect(2) = 6e-24, Method: Composition-based stats.
 Identities = 44/48 (92%), Positives = 47/48 (98%), Gaps = 0/48 (0%)
 Frame = +3

Query  357  VGVRRLMRQLNNMPSSVISSHTMHLGVLATASHAINTRTLFSVFYRPR  500
            VGVRRLMRQLNNMPSSVISSH+MHLGVLATASHAI+T TLFSVFY+PR
Sbjct  221  VGVRRLMRQLNNMPSSVISSHSMHLGVLATASHAISTGTLFSVFYKPR  268


 Score = 44.7 bits (104),  Expect(2) = 6e-24, Method: Composition-based stats.
 Identities = 21/35 (60%), Positives = 30/35 (86%), Gaps = 1/35 (3%)
 Frame = +1

Query  472  LFSLFFTGQGTSRSEFIVSVNKYIEAQNH*LSVGM  576
            LFS+F+  + TS+SEF+VS+NKY+EA+N  +SVGM
Sbjct  260  LFSVFYKPR-TSQSEFVVSLNKYLEAKNSKISVGM  293



>gb|EEC73404.1| hypothetical protein OsI_07659 [Oryza sativa Indica Group]
Length=678

 Score = 93.2 bits (230),  Expect(2) = 6e-24, Method: Composition-based stats.
 Identities = 44/48 (92%), Positives = 47/48 (98%), Gaps = 0/48 (0%)
 Frame = +3

Query  357  VGVRRLMRQLNNMPSSVISSHTMHLGVLATASHAINTRTLFSVFYRPR  500
            VGVRRLMRQLNNMPSSVISSH+MHLGVLATASHAI+T TLFSVFY+PR
Sbjct  224  VGVRRLMRQLNNMPSSVISSHSMHLGVLATASHAISTGTLFSVFYKPR  271


 Score = 44.3 bits (103),  Expect(2) = 6e-24, Method: Composition-based stats.
 Identities = 21/35 (60%), Positives = 29/35 (83%), Gaps = 1/35 (3%)
 Frame = +1

Query  472  LFSLFFTGQGTSRSEFIVSVNKYIEAQNH*LSVGM  576
            LFS+F+  + TS+SEF+VS NKY+EA+N  +SVGM
Sbjct  263  LFSVFYKPR-TSQSEFVVSANKYLEAKNSKISVGM  296



>ref|NP_001047137.1| Os02g0557200 [Oryza sativa Japonica Group]
 sp|Q6YVY0.1|ARFG_ORYSJ RecName: Full=Auxin response factor 7 [Oryza sativa Japonica 
Group]
 dbj|BAD16420.1| putative auxin-responsive factor (ARF1) [Oryza sativa Japonica 
Group]
 dbj|BAF09051.1| Os02g0557200 [Oryza sativa Japonica Group]
 gb|EEE57194.1| hypothetical protein OsJ_07141 [Oryza sativa Japonica Group]
Length=678

 Score = 93.2 bits (230),  Expect(2) = 6e-24, Method: Composition-based stats.
 Identities = 44/48 (92%), Positives = 47/48 (98%), Gaps = 0/48 (0%)
 Frame = +3

Query  357  VGVRRLMRQLNNMPSSVISSHTMHLGVLATASHAINTRTLFSVFYRPR  500
            VGVRRLMRQLNNMPSSVISSH+MHLGVLATASHAI+T TLFSVFY+PR
Sbjct  224  VGVRRLMRQLNNMPSSVISSHSMHLGVLATASHAISTGTLFSVFYKPR  271


 Score = 44.3 bits (103),  Expect(2) = 6e-24, Method: Composition-based stats.
 Identities = 21/35 (60%), Positives = 29/35 (83%), Gaps = 1/35 (3%)
 Frame = +1

Query  472  LFSLFFTGQGTSRSEFIVSVNKYIEAQNH*LSVGM  576
            LFS+F+  + TS+SEF+VS NKY+EA+N  +SVGM
Sbjct  263  LFSVFYKPR-TSQSEFVVSANKYLEAKNSKISVGM  296



>ref|XP_010548428.1| PREDICTED: auxin response factor 1 [Tarenaya hassleriana]
 ref|XP_010548436.1| PREDICTED: auxin response factor 1 [Tarenaya hassleriana]
 ref|XP_010548444.1| PREDICTED: auxin response factor 1 [Tarenaya hassleriana]
 ref|XP_010548451.1| PREDICTED: auxin response factor 1 [Tarenaya hassleriana]
 ref|XP_010548460.1| PREDICTED: auxin response factor 1 [Tarenaya hassleriana]
 ref|XP_010548467.1| PREDICTED: auxin response factor 1 [Tarenaya hassleriana]
Length=654

 Score = 86.3 bits (212),  Expect(2) = 8e-24, Method: Composition-based stats.
 Identities = 40/48 (83%), Positives = 44/48 (92%), Gaps = 0/48 (0%)
 Frame = +3

Query  357  VGVRRLMRQLNNMPSSVISSHTMHLGVLATASHAINTRTLFSVFYRPR  500
            VGVRR MRQL NMPSSVISSH+MHLGVLATASHA+ T T+FSVFY+PR
Sbjct  222  VGVRRHMRQLTNMPSSVISSHSMHLGVLATASHAMTTGTIFSVFYKPR  269


 Score = 50.4 bits (119),  Expect(2) = 8e-24, Method: Composition-based stats.
 Identities = 24/35 (69%), Positives = 31/35 (89%), Gaps = 1/35 (3%)
 Frame = +1

Query  472  LFSLFFTGQGTSRSEFIVSVNKYIEAQNH*LSVGM  576
            +FS+F+  + TSRSEFIVSVN+Y+EA+NH LSVGM
Sbjct  261  IFSVFYKPR-TSRSEFIVSVNRYLEAKNHKLSVGM  294



>ref|XP_009406475.1| PREDICTED: auxin response factor 7-like isoform X3 [Musa acuminata 
subsp. malaccensis]
Length=542

 Score = 90.5 bits (223),  Expect(2) = 8e-24, Method: Compositional matrix adjust.
 Identities = 43/48 (90%), Positives = 45/48 (94%), Gaps = 0/48 (0%)
 Frame = +3

Query  357  VGVRRLMRQLNNMPSSVISSHTMHLGVLATASHAINTRTLFSVFYRPR  500
            VGVRRLMRQ NNMPSSVISSH+MHLGVLATASHAI T TLFSVFY+PR
Sbjct  83   VGVRRLMRQPNNMPSSVISSHSMHLGVLATASHAIATGTLFSVFYKPR  130


 Score = 46.2 bits (108),  Expect(2) = 8e-24, Method: Compositional matrix adjust.
 Identities = 22/35 (63%), Positives = 30/35 (86%), Gaps = 1/35 (3%)
 Frame = +1

Query  472  LFSLFFTGQGTSRSEFIVSVNKYIEAQNH*LSVGM  576
            LFS+F+  + TSRS+FI+SVNKY+EA+N+  SVGM
Sbjct  122  LFSVFYKPR-TSRSDFIISVNKYLEAKNYKFSVGM  155



>ref|XP_006385188.1| auxin response factor 1 family protein [Populus trichocarpa]
 gb|ERP62985.1| auxin response factor 1 family protein [Populus trichocarpa]
Length=660

 Score = 84.0 bits (206),  Expect(2) = 9e-24, Method: Composition-based stats.
 Identities = 41/48 (85%), Positives = 43/48 (90%), Gaps = 0/48 (0%)
 Frame = +3

Query  357  VGVRRLMRQLNNMPSSVISSHTMHLGVLATASHAINTRTLFSVFYRPR  500
            VGVRRLMRQ  NMPSSVISS +MHLGVLATASHAI T TLFSVFY+PR
Sbjct  219  VGVRRLMRQQTNMPSSVISSQSMHLGVLATASHAIVTGTLFSVFYKPR  266


 Score = 53.1 bits (126),  Expect(2) = 9e-24, Method: Composition-based stats.
 Identities = 26/35 (74%), Positives = 31/35 (89%), Gaps = 1/35 (3%)
 Frame = +1

Query  472  LFSLFFTGQGTSRSEFIVSVNKYIEAQNH*LSVGM  576
            LFS+F+  + TSRSEFIV++NKYIEAQNH LSVGM
Sbjct  258  LFSVFYKPR-TSRSEFIVNLNKYIEAQNHKLSVGM  291



>emb|CBA11999.1| putative auxin response factor 1 [Illicium parviflorum]
Length=684

 Score = 87.8 bits (216),  Expect(2) = 9e-24, Method: Composition-based stats.
 Identities = 42/48 (88%), Positives = 46/48 (96%), Gaps = 0/48 (0%)
 Frame = +3

Query  357  VGVRRLMRQLNNMPSSVISSHTMHLGVLATASHAINTRTLFSVFYRPR  500
            VGVRRLMRQ +NMPSSVISSH+MHLGVLATASHAI+T TLFSVFY+PR
Sbjct  223  VGVRRLMRQPSNMPSSVISSHSMHLGVLATASHAISTGTLFSVFYKPR  270


 Score = 49.3 bits (116),  Expect(2) = 9e-24, Method: Composition-based stats.
 Identities = 23/35 (66%), Positives = 31/35 (89%), Gaps = 1/35 (3%)
 Frame = +1

Query  472  LFSLFFTGQGTSRSEFIVSVNKYIEAQNH*LSVGM  576
            LFS+F+  + TS+SEFI+S+NKY+EA+NH LSVGM
Sbjct  262  LFSVFYKPR-TSQSEFIISLNKYLEAKNHKLSVGM  295



>ref|XP_008218645.1| PREDICTED: auxin response factor 1 [Prunus mume]
 ref|XP_008218646.1| PREDICTED: auxin response factor 1 [Prunus mume]
Length=678

 Score = 87.4 bits (215),  Expect(2) = 9e-24, Method: Composition-based stats.
 Identities = 42/48 (88%), Positives = 45/48 (94%), Gaps = 0/48 (0%)
 Frame = +3

Query  357  VGVRRLMRQLNNMPSSVISSHTMHLGVLATASHAINTRTLFSVFYRPR  500
            VGVRRLMRQ +NMPSSVISSH+MHLGVLATASHAI T TLFSVFY+PR
Sbjct  223  VGVRRLMRQPSNMPSSVISSHSMHLGVLATASHAIATGTLFSVFYKPR  270


 Score = 49.3 bits (116),  Expect(2) = 9e-24, Method: Composition-based stats.
 Identities = 24/35 (69%), Positives = 30/35 (86%), Gaps = 1/35 (3%)
 Frame = +1

Query  472  LFSLFFTGQGTSRSEFIVSVNKYIEAQNH*LSVGM  576
            LFS+F+  + TSRSEF+VSVNKY+EA +H LSVGM
Sbjct  262  LFSVFYKPR-TSRSEFLVSVNKYLEAHSHKLSVGM  295



>ref|XP_007225153.1| hypothetical protein PRUPE_ppa002394mg [Prunus persica]
 gb|EMJ26352.1| hypothetical protein PRUPE_ppa002394mg [Prunus persica]
Length=678

 Score = 87.4 bits (215),  Expect(2) = 9e-24, Method: Composition-based stats.
 Identities = 42/48 (88%), Positives = 45/48 (94%), Gaps = 0/48 (0%)
 Frame = +3

Query  357  VGVRRLMRQLNNMPSSVISSHTMHLGVLATASHAINTRTLFSVFYRPR  500
            VGVRRLMRQ +NMPSSVISSH+MHLGVLATASHAI T TLFSVFY+PR
Sbjct  223  VGVRRLMRQPSNMPSSVISSHSMHLGVLATASHAIATGTLFSVFYKPR  270


 Score = 49.3 bits (116),  Expect(2) = 9e-24, Method: Composition-based stats.
 Identities = 24/35 (69%), Positives = 30/35 (86%), Gaps = 1/35 (3%)
 Frame = +1

Query  472  LFSLFFTGQGTSRSEFIVSVNKYIEAQNH*LSVGM  576
            LFS+F+  + TSRSEF+VSVNKY+EA +H LSVGM
Sbjct  262  LFSVFYKPR-TSRSEFLVSVNKYLEAHSHKLSVGM  295



>gb|KHG03459.1| Auxin response factor 1 -like protein [Gossypium arboreum]
Length=667

 Score = 89.4 bits (220),  Expect(2) = 1e-23, Method: Composition-based stats.
 Identities = 39/48 (81%), Positives = 46/48 (96%), Gaps = 0/48 (0%)
 Frame = +3

Query  357  VGVRRLMRQLNNMPSSVISSHTMHLGVLATASHAINTRTLFSVFYRPR  500
            VGVRRLMRQ  NMPSSVISSH+MHLGVLATASHA++TR++FS+FY+PR
Sbjct  214  VGVRRLMRQQANMPSSVISSHSMHLGVLATASHALSTRSMFSIFYKPR  261


 Score = 47.4 bits (111),  Expect(2) = 1e-23, Method: Composition-based stats.
 Identities = 23/35 (66%), Positives = 30/35 (86%), Gaps = 1/35 (3%)
 Frame = +1

Query  472  LFSLFFTGQGTSRSEFIVSVNKYIEAQNH*LSVGM  576
            +FS+F+  + TS SEFIVSVNK++EAQ+H LSVGM
Sbjct  253  MFSIFYKPR-TSLSEFIVSVNKFLEAQSHKLSVGM  286



>ref|XP_010065238.1| PREDICTED: auxin response factor 1 isoform X1 [Eucalyptus grandis]
 ref|XP_010065239.1| PREDICTED: auxin response factor 1 isoform X1 [Eucalyptus grandis]
 gb|KCW62581.1| hypothetical protein EUGRSUZ_G00076 [Eucalyptus grandis]
Length=675

 Score = 88.6 bits (218),  Expect(2) = 1e-23, Method: Composition-based stats.
 Identities = 42/48 (88%), Positives = 45/48 (94%), Gaps = 0/48 (0%)
 Frame = +3

Query  357  VGVRRLMRQLNNMPSSVISSHTMHLGVLATASHAINTRTLFSVFYRPR  500
            VGVRRLMRQ +NMPSSVISSH+MHLGVLATASHAI T TLFSVFY+PR
Sbjct  223  VGVRRLMRQQSNMPSSVISSHSMHLGVLATASHAIATGTLFSVFYKPR  270


 Score = 48.1 bits (113),  Expect(2) = 1e-23, Method: Composition-based stats.
 Identities = 23/35 (66%), Positives = 30/35 (86%), Gaps = 1/35 (3%)
 Frame = +1

Query  472  LFSLFFTGQGTSRSEFIVSVNKYIEAQNH*LSVGM  576
            LFS+F+  + TSRSEFIVS+NKY+EA+ H LS+GM
Sbjct  262  LFSVFYKPR-TSRSEFIVSLNKYLEARAHKLSIGM  295



>ref|XP_002446522.1| hypothetical protein SORBIDRAFT_06g017490 [Sorghum bicolor]
 gb|EES10850.1| hypothetical protein SORBIDRAFT_06g017490 [Sorghum bicolor]
Length=661

 Score = 91.3 bits (225),  Expect(2) = 1e-23, Method: Composition-based stats.
 Identities = 42/48 (88%), Positives = 47/48 (98%), Gaps = 0/48 (0%)
 Frame = +3

Query  357  VGVRRLMRQLNNMPSSVISSHTMHLGVLATASHAINTRTLFSVFYRPR  500
            VGVRRLMRQ+N+MPSSVISSH+MHLGVLATASHAI+T TLFSVFY+PR
Sbjct  225  VGVRRLMRQVNSMPSSVISSHSMHLGVLATASHAISTGTLFSVFYKPR  272


 Score = 45.1 bits (105),  Expect(2) = 1e-23, Method: Composition-based stats.
 Identities = 22/35 (63%), Positives = 29/35 (83%), Gaps = 1/35 (3%)
 Frame = +1

Query  472  LFSLFFTGQGTSRSEFIVSVNKYIEAQNH*LSVGM  576
            LFS+F+  + TSRS+FIVSVNKY+EA+   +SVGM
Sbjct  264  LFSVFYKPR-TSRSDFIVSVNKYLEAKKQKISVGM  297



>ref|XP_008669376.1| PREDICTED: auxin response factor 9-like isoform X2 [Zea mays]
Length=618

 Score = 91.3 bits (225),  Expect(2) = 1e-23, Method: Composition-based stats.
 Identities = 42/48 (88%), Positives = 47/48 (98%), Gaps = 0/48 (0%)
 Frame = +3

Query  357  VGVRRLMRQLNNMPSSVISSHTMHLGVLATASHAINTRTLFSVFYRPR  500
            VGVRRLMRQ+N+MPSSVISSH+MHLGVLATASHAI+T TLFSVFY+PR
Sbjct  225  VGVRRLMRQVNSMPSSVISSHSMHLGVLATASHAISTGTLFSVFYKPR  272


 Score = 45.1 bits (105),  Expect(2) = 1e-23, Method: Composition-based stats.
 Identities = 22/35 (63%), Positives = 29/35 (83%), Gaps = 1/35 (3%)
 Frame = +1

Query  472  LFSLFFTGQGTSRSEFIVSVNKYIEAQNH*LSVGM  576
            LFS+F+  + TSRS+FIVSVNKY+EA+   +SVGM
Sbjct  264  LFSVFYKPR-TSRSDFIVSVNKYLEAKKQKISVGM  297



>gb|KCW62583.1| hypothetical protein EUGRSUZ_G00076 [Eucalyptus grandis]
Length=649

 Score = 88.2 bits (217),  Expect(2) = 1e-23, Method: Composition-based stats.
 Identities = 42/48 (88%), Positives = 45/48 (94%), Gaps = 0/48 (0%)
 Frame = +3

Query  357  VGVRRLMRQLNNMPSSVISSHTMHLGVLATASHAINTRTLFSVFYRPR  500
            VGVRRLMRQ +NMPSSVISSH+MHLGVLATASHAI T TLFSVFY+PR
Sbjct  223  VGVRRLMRQQSNMPSSVISSHSMHLGVLATASHAIATGTLFSVFYKPR  270


 Score = 48.1 bits (113),  Expect(2) = 1e-23, Method: Composition-based stats.
 Identities = 23/35 (66%), Positives = 30/35 (86%), Gaps = 1/35 (3%)
 Frame = +1

Query  472  LFSLFFTGQGTSRSEFIVSVNKYIEAQNH*LSVGM  576
            LFS+F+  + TSRSEFIVS+NKY+EA+ H LS+GM
Sbjct  262  LFSVFYKPR-TSRSEFIVSLNKYLEARAHKLSIGM  295



>ref|XP_007153915.1| hypothetical protein PHAVU_003G075800g [Phaseolus vulgaris]
 gb|ESW25909.1| hypothetical protein PHAVU_003G075800g [Phaseolus vulgaris]
Length=653

 Score = 85.5 bits (210),  Expect(2) = 1e-23, Method: Composition-based stats.
 Identities = 40/48 (83%), Positives = 45/48 (94%), Gaps = 0/48 (0%)
 Frame = +3

Query  357  VGVRRLMRQLNNMPSSVISSHTMHLGVLATASHAINTRTLFSVFYRPR  500
            VGVRR+MRQ +N+PSSVISSH+MHLGVLATASHAI T TLFSVFY+PR
Sbjct  223  VGVRRVMRQQSNVPSSVISSHSMHLGVLATASHAIATGTLFSVFYKPR  270


 Score = 50.8 bits (120),  Expect(2) = 1e-23, Method: Composition-based stats.
 Identities = 25/35 (71%), Positives = 31/35 (89%), Gaps = 1/35 (3%)
 Frame = +1

Query  472  LFSLFFTGQGTSRSEFIVSVNKYIEAQNH*LSVGM  576
            LFS+F+  + TSRSEFIVSVNKY+EA++H LSVGM
Sbjct  262  LFSVFYKPR-TSRSEFIVSVNKYLEAKSHKLSVGM  295



>gb|KCW62582.1| hypothetical protein EUGRSUZ_G00076 [Eucalyptus grandis]
Length=671

 Score = 88.2 bits (217),  Expect(2) = 2e-23, Method: Composition-based stats.
 Identities = 42/48 (88%), Positives = 45/48 (94%), Gaps = 0/48 (0%)
 Frame = +3

Query  357  VGVRRLMRQLNNMPSSVISSHTMHLGVLATASHAINTRTLFSVFYRPR  500
            VGVRRLMRQ +NMPSSVISSH+MHLGVLATASHAI T TLFSVFY+PR
Sbjct  223  VGVRRLMRQQSNMPSSVISSHSMHLGVLATASHAIATGTLFSVFYKPR  270


 Score = 48.1 bits (113),  Expect(2) = 2e-23, Method: Composition-based stats.
 Identities = 23/35 (66%), Positives = 30/35 (86%), Gaps = 1/35 (3%)
 Frame = +1

Query  472  LFSLFFTGQGTSRSEFIVSVNKYIEAQNH*LSVGM  576
            LFS+F+  + TSRSEFIVS+NKY+EA+ H LS+GM
Sbjct  262  LFSVFYKPR-TSRSEFIVSLNKYLEARAHKLSIGM  295



>gb|KJB70781.1| hypothetical protein B456_011G091100 [Gossypium raimondii]
 gb|KJB70782.1| hypothetical protein B456_011G091100 [Gossypium raimondii]
 gb|KJB70783.1| hypothetical protein B456_011G091100 [Gossypium raimondii]
 gb|KJB70784.1| hypothetical protein B456_011G091100 [Gossypium raimondii]
 gb|KJB70785.1| hypothetical protein B456_011G091100 [Gossypium raimondii]
Length=673

 Score = 89.0 bits (219),  Expect(2) = 2e-23, Method: Composition-based stats.
 Identities = 39/48 (81%), Positives = 46/48 (96%), Gaps = 0/48 (0%)
 Frame = +3

Query  357  VGVRRLMRQLNNMPSSVISSHTMHLGVLATASHAINTRTLFSVFYRPR  500
            VGVRRLMRQ  NMPSSVISSH+MHLGVLATASHA++TR++FS+FY+PR
Sbjct  220  VGVRRLMRQQANMPSSVISSHSMHLGVLATASHALSTRSMFSIFYKPR  267


 Score = 47.0 bits (110),  Expect(2) = 2e-23, Method: Composition-based stats.
 Identities = 23/35 (66%), Positives = 30/35 (86%), Gaps = 1/35 (3%)
 Frame = +1

Query  472  LFSLFFTGQGTSRSEFIVSVNKYIEAQNH*LSVGM  576
            +FS+F+  + TS SEFIVSVNKY+EA++H LSVGM
Sbjct  259  MFSIFYKPR-TSLSEFIVSVNKYLEARSHKLSVGM  292



>gb|ADG43140.1| auxin response factor 6 [Zea mays]
 tpg|DAA37677.1| TPA: hypothetical protein ZEAMMB73_822305 [Zea mays]
Length=657

 Score = 90.9 bits (224),  Expect(2) = 2e-23, Method: Composition-based stats.
 Identities = 42/48 (88%), Positives = 47/48 (98%), Gaps = 0/48 (0%)
 Frame = +3

Query  357  VGVRRLMRQLNNMPSSVISSHTMHLGVLATASHAINTRTLFSVFYRPR  500
            VGVRRLMRQ+N+MPSSVISSH+MHLGVLATASHAI+T TLFSVFY+PR
Sbjct  221  VGVRRLMRQVNSMPSSVISSHSMHLGVLATASHAISTGTLFSVFYKPR  268


 Score = 45.1 bits (105),  Expect(2) = 2e-23, Method: Composition-based stats.
 Identities = 22/35 (63%), Positives = 29/35 (83%), Gaps = 1/35 (3%)
 Frame = +1

Query  472  LFSLFFTGQGTSRSEFIVSVNKYIEAQNH*LSVGM  576
            LFS+F+  + TSRS+FIVSVNKY+EA+   +SVGM
Sbjct  260  LFSVFYKPR-TSRSDFIVSVNKYLEAKKQKISVGM  293



>ref|XP_006470826.1| PREDICTED: auxin response factor 1-like isoform X5 [Citrus sinensis]
Length=640

 Score = 85.5 bits (210),  Expect(2) = 2e-23, Method: Composition-based stats.
 Identities = 40/48 (83%), Positives = 43/48 (90%), Gaps = 0/48 (0%)
 Frame = +3

Query  357  VGVRRLMRQLNNMPSSVISSHTMHLGVLATASHAINTRTLFSVFYRPR  500
            VGVRR MRQ  NMPSSVISSH+MHLGVLATASHAI T TLFS+FY+PR
Sbjct  227  VGVRRHMRQQTNMPSSVISSHSMHLGVLATASHAIATGTLFSIFYKPR  274


 Score = 50.8 bits (120),  Expect(2) = 2e-23, Method: Composition-based stats.
 Identities = 25/35 (71%), Positives = 30/35 (86%), Gaps = 1/35 (3%)
 Frame = +1

Query  472  LFSLFFTGQGTSRSEFIVSVNKYIEAQNH*LSVGM  576
            LFS+F+  + TSRSEFIVSVNKY+EA+ H LSVGM
Sbjct  266  LFSIFYKPR-TSRSEFIVSVNKYLEAKRHKLSVGM  299



>ref|XP_008669375.1| PREDICTED: auxin response factor 9-like isoform X1 [Zea mays]
Length=661

 Score = 90.9 bits (224),  Expect(2) = 2e-23, Method: Composition-based stats.
 Identities = 42/48 (88%), Positives = 47/48 (98%), Gaps = 0/48 (0%)
 Frame = +3

Query  357  VGVRRLMRQLNNMPSSVISSHTMHLGVLATASHAINTRTLFSVFYRPR  500
            VGVRRLMRQ+N+MPSSVISSH+MHLGVLATASHAI+T TLFSVFY+PR
Sbjct  225  VGVRRLMRQVNSMPSSVISSHSMHLGVLATASHAISTGTLFSVFYKPR  272


 Score = 45.1 bits (105),  Expect(2) = 2e-23, Method: Composition-based stats.
 Identities = 22/35 (63%), Positives = 29/35 (83%), Gaps = 1/35 (3%)
 Frame = +1

Query  472  LFSLFFTGQGTSRSEFIVSVNKYIEAQNH*LSVGM  576
            LFS+F+  + TSRS+FIVSVNKY+EA+   +SVGM
Sbjct  264  LFSVFYKPR-TSRSDFIVSVNKYLEAKKQKISVGM  297



>gb|KHN40198.1| Auxin response factor 1 [Glycine soja]
Length=675

 Score = 85.1 bits (209),  Expect(2) = 2e-23, Method: Composition-based stats.
 Identities = 40/48 (83%), Positives = 45/48 (94%), Gaps = 0/48 (0%)
 Frame = +3

Query  357  VGVRRLMRQLNNMPSSVISSHTMHLGVLATASHAINTRTLFSVFYRPR  500
            VGVRR+MRQ +N+PSSVISSH+MHLGVLATASHAI T TLFSVFY+PR
Sbjct  221  VGVRRVMRQQSNVPSSVISSHSMHLGVLATASHAIATGTLFSVFYKPR  268


 Score = 50.8 bits (120),  Expect(2) = 2e-23, Method: Composition-based stats.
 Identities = 25/35 (71%), Positives = 30/35 (86%), Gaps = 1/35 (3%)
 Frame = +1

Query  472  LFSLFFTGQGTSRSEFIVSVNKYIEAQNH*LSVGM  576
            LFS+F+  + TSRSEFIVSVNKY+E Q+H LSVGM
Sbjct  260  LFSVFYKPR-TSRSEFIVSVNKYLEVQSHKLSVGM  293



>ref|XP_003528726.1| PREDICTED: auxin response factor 1-like [Glycine max]
Length=674

 Score = 85.1 bits (209),  Expect(2) = 2e-23, Method: Composition-based stats.
 Identities = 40/48 (83%), Positives = 45/48 (94%), Gaps = 0/48 (0%)
 Frame = +3

Query  357  VGVRRLMRQLNNMPSSVISSHTMHLGVLATASHAINTRTLFSVFYRPR  500
            VGVRR+MRQ +N+PSSVISSH+MHLGVLATASHAI T TLFSVFY+PR
Sbjct  220  VGVRRVMRQQSNVPSSVISSHSMHLGVLATASHAIATGTLFSVFYKPR  267


 Score = 50.8 bits (120),  Expect(2) = 2e-23, Method: Composition-based stats.
 Identities = 25/35 (71%), Positives = 30/35 (86%), Gaps = 1/35 (3%)
 Frame = +1

Query  472  LFSLFFTGQGTSRSEFIVSVNKYIEAQNH*LSVGM  576
            LFS+F+  + TSRSEFIVSVNKY+E Q+H LSVGM
Sbjct  259  LFSVFYKPR-TSRSEFIVSVNKYLEVQSHKLSVGM  292



>ref|XP_006470825.1| PREDICTED: auxin response factor 1-like isoform X4 [Citrus sinensis]
Length=650

 Score = 85.5 bits (210),  Expect(2) = 2e-23, Method: Composition-based stats.
 Identities = 40/48 (83%), Positives = 43/48 (90%), Gaps = 0/48 (0%)
 Frame = +3

Query  357  VGVRRLMRQLNNMPSSVISSHTMHLGVLATASHAINTRTLFSVFYRPR  500
            VGVRR MRQ  NMPSSVISSH+MHLGVLATASHAI T TLFS+FY+PR
Sbjct  227  VGVRRHMRQQTNMPSSVISSHSMHLGVLATASHAIATGTLFSIFYKPR  274


 Score = 50.8 bits (120),  Expect(2) = 2e-23, Method: Composition-based stats.
 Identities = 25/35 (71%), Positives = 30/35 (86%), Gaps = 1/35 (3%)
 Frame = +1

Query  472  LFSLFFTGQGTSRSEFIVSVNKYIEAQNH*LSVGM  576
            LFS+F+  + TSRSEFIVSVNKY+EA+ H LSVGM
Sbjct  266  LFSIFYKPR-TSRSEFIVSVNKYLEAKRHKLSVGM  299



>ref|XP_006431443.1| hypothetical protein CICLE_v10000491mg [Citrus clementina]
 gb|ESR44683.1| hypothetical protein CICLE_v10000491mg [Citrus clementina]
Length=682

 Score = 85.1 bits (209),  Expect(2) = 2e-23, Method: Composition-based stats.
 Identities = 40/48 (83%), Positives = 43/48 (90%), Gaps = 0/48 (0%)
 Frame = +3

Query  357  VGVRRLMRQLNNMPSSVISSHTMHLGVLATASHAINTRTLFSVFYRPR  500
            VGVRR MRQ  NMPSSVISSH+MHLGVLATASHAI T TLFS+FY+PR
Sbjct  227  VGVRRHMRQQTNMPSSVISSHSMHLGVLATASHAIATGTLFSIFYKPR  274


 Score = 50.8 bits (120),  Expect(2) = 2e-23, Method: Composition-based stats.
 Identities = 25/35 (71%), Positives = 30/35 (86%), Gaps = 1/35 (3%)
 Frame = +1

Query  472  LFSLFFTGQGTSRSEFIVSVNKYIEAQNH*LSVGM  576
            LFS+F+  + TSRSEFIVSVNKY+EA+ H LSVGM
Sbjct  266  LFSIFYKPR-TSRSEFIVSVNKYLEAKRHKLSVGM  299



>emb|CBI16989.3| unnamed protein product [Vitis vinifera]
Length=643

 Score = 89.4 bits (220),  Expect(2) = 2e-23, Method: Composition-based stats.
 Identities = 42/48 (88%), Positives = 45/48 (94%), Gaps = 0/48 (0%)
 Frame = +3

Query  357  VGVRRLMRQLNNMPSSVISSHTMHLGVLATASHAINTRTLFSVFYRPR  500
            VGVRRLMRQLNN+P SVISSH+MHLGVLATASHAI T TLFSVFY+PR
Sbjct  221  VGVRRLMRQLNNVPPSVISSHSMHLGVLATASHAITTGTLFSVFYKPR  268


 Score = 46.6 bits (109),  Expect(2) = 2e-23, Method: Composition-based stats.
 Identities = 23/35 (66%), Positives = 29/35 (83%), Gaps = 1/35 (3%)
 Frame = +1

Query  472  LFSLFFTGQGTSRSEFIVSVNKYIEAQNH*LSVGM  576
            LFS+F+  +  S SEFIVSVNKY+EA+NH +SVGM
Sbjct  260  LFSVFYKPRA-SPSEFIVSVNKYLEARNHKVSVGM  293



>ref|XP_006470824.1| PREDICTED: auxin response factor 1-like isoform X3 [Citrus sinensis]
Length=678

 Score = 85.1 bits (209),  Expect(2) = 2e-23, Method: Composition-based stats.
 Identities = 40/48 (83%), Positives = 43/48 (90%), Gaps = 0/48 (0%)
 Frame = +3

Query  357  VGVRRLMRQLNNMPSSVISSHTMHLGVLATASHAINTRTLFSVFYRPR  500
            VGVRR MRQ  NMPSSVISSH+MHLGVLATASHAI T TLFS+FY+PR
Sbjct  227  VGVRRHMRQQTNMPSSVISSHSMHLGVLATASHAIATGTLFSIFYKPR  274


 Score = 50.8 bits (120),  Expect(2) = 2e-23, Method: Composition-based stats.
 Identities = 25/35 (71%), Positives = 30/35 (86%), Gaps = 1/35 (3%)
 Frame = +1

Query  472  LFSLFFTGQGTSRSEFIVSVNKYIEAQNH*LSVGM  576
            LFS+F+  + TSRSEFIVSVNKY+EA+ H LSVGM
Sbjct  266  LFSIFYKPR-TSRSEFIVSVNKYLEAKRHKLSVGM  299



>ref|XP_002527835.1| Auxin response factor, putative [Ricinus communis]
 gb|EEF34538.1| Auxin response factor, putative [Ricinus communis]
Length=671

 Score = 85.1 bits (209),  Expect(2) = 2e-23, Method: Composition-based stats.
 Identities = 41/48 (85%), Positives = 43/48 (90%), Gaps = 0/48 (0%)
 Frame = +3

Query  357  VGVRRLMRQLNNMPSSVISSHTMHLGVLATASHAINTRTLFSVFYRPR  500
            VGVRRLMRQ  NMPSSVISS +MHLGVLATASHAI T TLFSVFY+PR
Sbjct  216  VGVRRLMRQQTNMPSSVISSQSMHLGVLATASHAIATGTLFSVFYKPR  263


 Score = 50.8 bits (120),  Expect(2) = 2e-23, Method: Composition-based stats.
 Identities = 25/35 (71%), Positives = 31/35 (89%), Gaps = 1/35 (3%)
 Frame = +1

Query  472  LFSLFFTGQGTSRSEFIVSVNKYIEAQNH*LSVGM  576
            LFS+F+  + TSRSEFIVSVNKY+EA++H LSVGM
Sbjct  255  LFSVFYKPR-TSRSEFIVSVNKYLEARSHKLSVGM  288



>ref|XP_006470822.1| PREDICTED: auxin response factor 1-like isoform X1 [Citrus sinensis]
 ref|XP_006470823.1| PREDICTED: auxin response factor 1-like isoform X2 [Citrus sinensis]
Length=688

 Score = 85.1 bits (209),  Expect(2) = 2e-23, Method: Composition-based stats.
 Identities = 40/48 (83%), Positives = 43/48 (90%), Gaps = 0/48 (0%)
 Frame = +3

Query  357  VGVRRLMRQLNNMPSSVISSHTMHLGVLATASHAINTRTLFSVFYRPR  500
            VGVRR MRQ  NMPSSVISSH+MHLGVLATASHAI T TLFS+FY+PR
Sbjct  227  VGVRRHMRQQTNMPSSVISSHSMHLGVLATASHAIATGTLFSIFYKPR  274


 Score = 50.8 bits (120),  Expect(2) = 2e-23, Method: Composition-based stats.
 Identities = 25/35 (71%), Positives = 30/35 (86%), Gaps = 1/35 (3%)
 Frame = +1

Query  472  LFSLFFTGQGTSRSEFIVSVNKYIEAQNH*LSVGM  576
            LFS+F+  + TSRSEFIVSVNKY+EA+ H LSVGM
Sbjct  266  LFSIFYKPR-TSRSEFIVSVNKYLEAKRHKLSVGM  299



>ref|XP_002266947.1| PREDICTED: auxin response factor 1-like [Vitis vinifera]
Length=645

 Score = 89.4 bits (220),  Expect(2) = 2e-23, Method: Composition-based stats.
 Identities = 42/48 (88%), Positives = 45/48 (94%), Gaps = 0/48 (0%)
 Frame = +3

Query  357  VGVRRLMRQLNNMPSSVISSHTMHLGVLATASHAINTRTLFSVFYRPR  500
            VGVRRLMRQLNN+P SVISSH+MHLGVLATASHAI T TLFSVFY+PR
Sbjct  223  VGVRRLMRQLNNVPPSVISSHSMHLGVLATASHAITTGTLFSVFYKPR  270


 Score = 46.6 bits (109),  Expect(2) = 2e-23, Method: Composition-based stats.
 Identities = 23/35 (66%), Positives = 29/35 (83%), Gaps = 1/35 (3%)
 Frame = +1

Query  472  LFSLFFTGQGTSRSEFIVSVNKYIEAQNH*LSVGM  576
            LFS+F+  +  S SEFIVSVNKY+EA+NH +SVGM
Sbjct  262  LFSVFYKPRA-SPSEFIVSVNKYLEARNHKVSVGM  295



>ref|XP_007023118.1| Auxin response factor 1 isoform 1 [Theobroma cacao]
 gb|EOY25740.1| Auxin response factor 1 isoform 1 [Theobroma cacao]
Length=671

 Score = 85.5 bits (210),  Expect(2) = 2e-23, Method: Composition-based stats.
 Identities = 40/48 (83%), Positives = 44/48 (92%), Gaps = 0/48 (0%)
 Frame = +3

Query  357  VGVRRLMRQLNNMPSSVISSHTMHLGVLATASHAINTRTLFSVFYRPR  500
            VGVRRLMRQ  NMPSSVISSH+MHLGVLATASHAI T ++FSVFY+PR
Sbjct  220  VGVRRLMRQQTNMPSSVISSHSMHLGVLATASHAIATGSMFSVFYKPR  267


 Score = 50.1 bits (118),  Expect(2) = 2e-23, Method: Composition-based stats.
 Identities = 24/35 (69%), Positives = 31/35 (89%), Gaps = 1/35 (3%)
 Frame = +1

Query  472  LFSLFFTGQGTSRSEFIVSVNKYIEAQNH*LSVGM  576
            +FS+F+  + TSRSEFIVSVNKY+EA++H LSVGM
Sbjct  259  MFSVFYKPR-TSRSEFIVSVNKYLEARSHKLSVGM  292



>ref|XP_010239942.1| PREDICTED: auxin response factor 9-like [Brachypodium distachyon]
Length=646

 Score = 89.4 bits (220),  Expect(2) = 2e-23, Method: Composition-based stats.
 Identities = 42/48 (88%), Positives = 46/48 (96%), Gaps = 0/48 (0%)
 Frame = +3

Query  357  VGVRRLMRQLNNMPSSVISSHTMHLGVLATASHAINTRTLFSVFYRPR  500
            VGVRR MRQ+NNMPSSVISSH+MHLGVLATASHAI+T TLFSVFY+PR
Sbjct  224  VGVRRHMRQVNNMPSSVISSHSMHLGVLATASHAISTGTLFSVFYKPR  271


 Score = 46.2 bits (108),  Expect(2) = 2e-23, Method: Composition-based stats.
 Identities = 22/35 (63%), Positives = 29/35 (83%), Gaps = 1/35 (3%)
 Frame = +1

Query  472  LFSLFFTGQGTSRSEFIVSVNKYIEAQNH*LSVGM  576
            LFS+F+  + TSRSEF+VSVNKY+EA+   +SVGM
Sbjct  263  LFSVFYKPR-TSRSEFVVSVNKYLEAKKQNMSVGM  296



>ref|XP_008378943.1| PREDICTED: auxin response factor 1 [Malus domestica]
 ref|XP_008378944.1| PREDICTED: auxin response factor 1 [Malus domestica]
Length=677

 Score = 87.8 bits (216),  Expect(2) = 2e-23, Method: Composition-based stats.
 Identities = 42/48 (88%), Positives = 45/48 (94%), Gaps = 0/48 (0%)
 Frame = +3

Query  357  VGVRRLMRQLNNMPSSVISSHTMHLGVLATASHAINTRTLFSVFYRPR  500
            VGVRRLMRQ +NMPSSVISSH+MHLGVLATASHAI T TLFSVFY+PR
Sbjct  223  VGVRRLMRQPSNMPSSVISSHSMHLGVLATASHAIATGTLFSVFYKPR  270


 Score = 47.8 bits (112),  Expect(2) = 2e-23, Method: Composition-based stats.
 Identities = 24/35 (69%), Positives = 30/35 (86%), Gaps = 1/35 (3%)
 Frame = +1

Query  472  LFSLFFTGQGTSRSEFIVSVNKYIEAQNH*LSVGM  576
            LFS+F+  + TSRSEF+VSVNKYIEA++  LSVGM
Sbjct  262  LFSVFYKPR-TSRSEFLVSVNKYIEARSQKLSVGM  295



>ref|XP_010065240.1| PREDICTED: auxin response factor 1 isoform X2 [Eucalyptus grandis]
 gb|KCW62584.1| hypothetical protein EUGRSUZ_G00076 [Eucalyptus grandis]
Length=565

 Score = 87.8 bits (216),  Expect(2) = 3e-23, Method: Compositional matrix adjust.
 Identities = 42/48 (88%), Positives = 45/48 (94%), Gaps = 0/48 (0%)
 Frame = +3

Query  357  VGVRRLMRQLNNMPSSVISSHTMHLGVLATASHAINTRTLFSVFYRPR  500
            VGVRRLMRQ +NMPSSVISSH+MHLGVLATASHAI T TLFSVFY+PR
Sbjct  223  VGVRRLMRQQSNMPSSVISSHSMHLGVLATASHAIATGTLFSVFYKPR  270


 Score = 47.8 bits (112),  Expect(2) = 3e-23, Method: Compositional matrix adjust.
 Identities = 23/35 (66%), Positives = 30/35 (86%), Gaps = 1/35 (3%)
 Frame = +1

Query  472  LFSLFFTGQGTSRSEFIVSVNKYIEAQNH*LSVGM  576
            LFS+F+  + TSRSEFIVS+NKY+EA+ H LS+GM
Sbjct  262  LFSVFYKPR-TSRSEFIVSLNKYLEARAHKLSIGM  295



>ref|XP_009416967.1| PREDICTED: auxin response factor 7-like, partial [Musa acuminata 
subsp. malaccensis]
Length=588

 Score = 87.4 bits (215),  Expect(2) = 3e-23, Method: Composition-based stats.
 Identities = 42/48 (88%), Positives = 46/48 (96%), Gaps = 0/48 (0%)
 Frame = +3

Query  357  VGVRRLMRQLNNMPSSVISSHTMHLGVLATASHAINTRTLFSVFYRPR  500
            VGVRRLMRQLN+MPSSVISSH+MHLGVLATASHA+ T TLFSVFY+PR
Sbjct  223  VGVRRLMRQLNSMPSSVISSHSMHLGVLATASHALATGTLFSVFYKPR  270


 Score = 48.1 bits (113),  Expect(2) = 3e-23, Method: Composition-based stats.
 Identities = 23/35 (66%), Positives = 30/35 (86%), Gaps = 1/35 (3%)
 Frame = +1

Query  472  LFSLFFTGQGTSRSEFIVSVNKYIEAQNH*LSVGM  576
            LFS+F+  + TSRSEFI+SVNKY+EA+N+  SVGM
Sbjct  262  LFSVFYKPR-TSRSEFIISVNKYLEAKNNKFSVGM  295



>ref|XP_009355376.1| PREDICTED: auxin response factor 1 [Pyrus x bretschneideri]
Length=677

 Score = 87.4 bits (215),  Expect(2) = 3e-23, Method: Composition-based stats.
 Identities = 42/48 (88%), Positives = 45/48 (94%), Gaps = 0/48 (0%)
 Frame = +3

Query  357  VGVRRLMRQLNNMPSSVISSHTMHLGVLATASHAINTRTLFSVFYRPR  500
            VGVRRLMRQ +NMPSSVISSH+MHLGVLATASHAI T TLFSVFY+PR
Sbjct  223  VGVRRLMRQPSNMPSSVISSHSMHLGVLATASHAIATGTLFSVFYKPR  270


 Score = 47.8 bits (112),  Expect(2) = 3e-23, Method: Composition-based stats.
 Identities = 24/35 (69%), Positives = 30/35 (86%), Gaps = 1/35 (3%)
 Frame = +1

Query  472  LFSLFFTGQGTSRSEFIVSVNKYIEAQNH*LSVGM  576
            LFS+F+  + TSRSEF+VSVNKYIEA++  LSVGM
Sbjct  262  LFSVFYKPR-TSRSEFLVSVNKYIEARSQKLSVGM  295



>gb|ACX68650.3| auxin response factor [Dimocarpus longan]
Length=681

 Score = 84.0 bits (206),  Expect(2) = 4e-23, Method: Composition-based stats.
 Identities = 40/48 (83%), Positives = 43/48 (90%), Gaps = 0/48 (0%)
 Frame = +3

Query  357  VGVRRLMRQLNNMPSSVISSHTMHLGVLATASHAINTRTLFSVFYRPR  500
            VGVRR MRQ  NMPSSVISSH+MHLGVLATASHAI T TLFS+FY+PR
Sbjct  228  VGVRRHMRQQTNMPSSVISSHSMHLGVLATASHAIATGTLFSIFYKPR  275


 Score = 50.4 bits (119),  Expect(2) = 4e-23, Method: Composition-based stats.
 Identities = 25/35 (71%), Positives = 30/35 (86%), Gaps = 1/35 (3%)
 Frame = +1

Query  472  LFSLFFTGQGTSRSEFIVSVNKYIEAQNH*LSVGM  576
            LFS+F+  + TSRSEFIVSVNKY+EA+ H LSVGM
Sbjct  267  LFSIFYKPR-TSRSEFIVSVNKYLEARKHKLSVGM  300



>ref|XP_006385086.1| hypothetical protein POPTR_0004s23770g [Populus trichocarpa]
 ref|XP_006385087.1| auxin response factor 1 family protein [Populus trichocarpa]
 gb|ERP62883.1| hypothetical protein POPTR_0004s23770g [Populus trichocarpa]
 gb|ERP62884.1| auxin response factor 1 family protein [Populus trichocarpa]
Length=662

 Score = 85.1 bits (209),  Expect(2) = 4e-23, Method: Compositional matrix adjust.
 Identities = 41/48 (85%), Positives = 43/48 (90%), Gaps = 0/48 (0%)
 Frame = +3

Query  357  VGVRRLMRQLNNMPSSVISSHTMHLGVLATASHAINTRTLFSVFYRPR  500
            VGVRRLMRQ  NMPSSVISS +MHLGVLATASHAI T TLFSVFY+PR
Sbjct  224  VGVRRLMRQQTNMPSSVISSQSMHLGVLATASHAIATGTLFSVFYKPR  271


 Score = 49.7 bits (117),  Expect(2) = 4e-23, Method: Composition-based stats.
 Identities = 24/35 (69%), Positives = 30/35 (86%), Gaps = 1/35 (3%)
 Frame = +1

Query  472  LFSLFFTGQGTSRSEFIVSVNKYIEAQNH*LSVGM  576
            LFS+F+  + TSRSEFIVS+NKY+E +NH LSVGM
Sbjct  263  LFSVFYKPR-TSRSEFIVSLNKYLEVRNHKLSVGM  296



>ref|XP_007023119.1| Auxin response factor 1 isoform 2, partial [Theobroma cacao]
 gb|EOY25741.1| Auxin response factor 1 isoform 2, partial [Theobroma cacao]
Length=503

 Score = 85.1 bits (209),  Expect(2) = 4e-23, Method: Compositional matrix adjust.
 Identities = 40/48 (83%), Positives = 44/48 (92%), Gaps = 0/48 (0%)
 Frame = +3

Query  357  VGVRRLMRQLNNMPSSVISSHTMHLGVLATASHAINTRTLFSVFYRPR  500
            VGVRRLMRQ  NMPSSVISSH+MHLGVLATASHAI T ++FSVFY+PR
Sbjct  220  VGVRRLMRQQTNMPSSVISSHSMHLGVLATASHAIATGSMFSVFYKPR  267


 Score = 49.7 bits (117),  Expect(2) = 4e-23, Method: Compositional matrix adjust.
 Identities = 24/35 (69%), Positives = 31/35 (89%), Gaps = 1/35 (3%)
 Frame = +1

Query  472  LFSLFFTGQGTSRSEFIVSVNKYIEAQNH*LSVGM  576
            +FS+F+  + TSRSEFIVSVNKY+EA++H LSVGM
Sbjct  259  MFSVFYKPR-TSRSEFIVSVNKYLEARSHKLSVGM  292



>ref|XP_004300014.1| PREDICTED: auxin response factor 1 [Fragaria vesca subsp. vesca]
 ref|XP_011464939.1| PREDICTED: auxin response factor 1 [Fragaria vesca subsp. vesca]
Length=675

 Score = 87.0 bits (214),  Expect(2) = 4e-23, Method: Composition-based stats.
 Identities = 42/48 (88%), Positives = 45/48 (94%), Gaps = 0/48 (0%)
 Frame = +3

Query  357  VGVRRLMRQLNNMPSSVISSHTMHLGVLATASHAINTRTLFSVFYRPR  500
            VGVRRLMRQ +NMPSSVISSH+MHLGVLATASHAI T TLFSVFY+PR
Sbjct  222  VGVRRLMRQPSNMPSSVISSHSMHLGVLATASHAIATGTLFSVFYKPR  269


 Score = 47.8 bits (112),  Expect(2) = 4e-23, Method: Composition-based stats.
 Identities = 23/35 (66%), Positives = 31/35 (89%), Gaps = 1/35 (3%)
 Frame = +1

Query  472  LFSLFFTGQGTSRSEFIVSVNKYIEAQNH*LSVGM  576
            LFS+F+  + TS+SEF+VSVNKY+EA++H LSVGM
Sbjct  261  LFSVFYKPR-TSQSEFLVSVNKYLEARSHKLSVGM  294



>ref|XP_011028402.1| PREDICTED: auxin response factor 1 [Populus euphratica]
 ref|XP_011028403.1| PREDICTED: auxin response factor 1 [Populus euphratica]
 ref|XP_011028404.1| PREDICTED: auxin response factor 1 [Populus euphratica]
Length=662

 Score = 84.3 bits (207),  Expect(2) = 6e-23, Method: Composition-based stats.
 Identities = 41/48 (85%), Positives = 43/48 (90%), Gaps = 0/48 (0%)
 Frame = +3

Query  357  VGVRRLMRQLNNMPSSVISSHTMHLGVLATASHAINTRTLFSVFYRPR  500
            VGVRRLMRQ  NMPSSVISS +MHLGVLATASHAI T TLFSVFY+PR
Sbjct  224  VGVRRLMRQQTNMPSSVISSQSMHLGVLATASHAIATGTLFSVFYKPR  271


 Score = 49.7 bits (117),  Expect(2) = 6e-23, Method: Composition-based stats.
 Identities = 24/35 (69%), Positives = 30/35 (86%), Gaps = 1/35 (3%)
 Frame = +1

Query  472  LFSLFFTGQGTSRSEFIVSVNKYIEAQNH*LSVGM  576
            LFS+F+  + TSRSEFIVS+NKY+E +NH LSVGM
Sbjct  263  LFSVFYKPR-TSRSEFIVSLNKYLEVRNHKLSVGM  296



>gb|AAZ81521.1| auxin response factor 1 [Gossypium barbadense]
Length=673

 Score = 87.0 bits (214),  Expect(2) = 6e-23, Method: Composition-based stats.
 Identities = 38/48 (79%), Positives = 46/48 (96%), Gaps = 0/48 (0%)
 Frame = +3

Query  357  VGVRRLMRQLNNMPSSVISSHTMHLGVLATASHAINTRTLFSVFYRPR  500
            VGVRRLMRQ  NMPSSVISSH+MHLGVLATAS+A++TR++FS+FY+PR
Sbjct  220  VGVRRLMRQQANMPSSVISSHSMHLGVLATASYALSTRSMFSIFYKPR  267


 Score = 47.0 bits (110),  Expect(2) = 6e-23, Method: Composition-based stats.
 Identities = 23/35 (66%), Positives = 30/35 (86%), Gaps = 1/35 (3%)
 Frame = +1

Query  472  LFSLFFTGQGTSRSEFIVSVNKYIEAQNH*LSVGM  576
            +FS+F+  + TS SEFIVSVNKY+EA++H LSVGM
Sbjct  259  MFSIFYKPR-TSLSEFIVSVNKYLEARSHKLSVGM  292



>gb|EMT27061.1| Auxin response factor 9 [Aegilops tauschii]
Length=637

 Score = 89.7 bits (221),  Expect(2) = 8e-23, Method: Composition-based stats.
 Identities = 42/48 (88%), Positives = 46/48 (96%), Gaps = 0/48 (0%)
 Frame = +3

Query  357  VGVRRLMRQLNNMPSSVISSHTMHLGVLATASHAINTRTLFSVFYRPR  500
            VGVRR MRQ+NNMPSSVISSH+MHLGVLATASHAI+T TLFSVFY+PR
Sbjct  169  VGVRRHMRQVNNMPSSVISSHSMHLGVLATASHAISTGTLFSVFYKPR  216


 Score = 43.9 bits (102),  Expect(2) = 8e-23, Method: Composition-based stats.
 Identities = 21/35 (60%), Positives = 29/35 (83%), Gaps = 1/35 (3%)
 Frame = +1

Query  472  LFSLFFTGQGTSRSEFIVSVNKYIEAQNH*LSVGM  576
            LFS+F+  + TS+SEF+VSVNKY+EA+   +SVGM
Sbjct  208  LFSVFYKPR-TSQSEFVVSVNKYLEAKKQNISVGM  241



>ref|XP_006431458.1| hypothetical protein CICLE_v10003317mg, partial [Citrus clementina]
 gb|ESR44698.1| hypothetical protein CICLE_v10003317mg, partial [Citrus clementina]
Length=547

 Score = 82.0 bits (201),  Expect(2) = 1e-22, Method: Compositional matrix adjust.
 Identities = 39/48 (81%), Positives = 42/48 (88%), Gaps = 0/48 (0%)
 Frame = +3

Query  357  VGVRRLMRQLNNMPSSVISSHTMHLGVLATASHAINTRTLFSVFYRPR  500
            VGVRR MRQ  NMPSSVISSH+MHLGVLA ASHAI T TLFS+FY+PR
Sbjct  223  VGVRRHMRQQTNMPSSVISSHSMHLGVLAIASHAIATGTLFSIFYKPR  270


 Score = 51.6 bits (122),  Expect(2) = 1e-22, Method: Compositional matrix adjust.
 Identities = 25/35 (71%), Positives = 30/35 (86%), Gaps = 1/35 (3%)
 Frame = +1

Query  472  LFSLFFTGQGTSRSEFIVSVNKYIEAQNH*LSVGM  576
            LFS+F+  + TSRSEFIVSVNKY+EA+ H LSVGM
Sbjct  262  LFSIFYKPR-TSRSEFIVSVNKYLEAKKHKLSVGM  295



>emb|CDO97653.1| unnamed protein product [Coffea canephora]
Length=433

 Score = 77.8 bits (190),  Expect(2) = 8e-22, Method: Compositional matrix adjust.
 Identities = 36/42 (86%), Positives = 40/42 (95%), Gaps = 0/42 (0%)
 Frame = +3

Query  375  MRQLNNMPSSVISSHTMHLGVLATASHAINTRTLFSVFYRPR  500
            MRQ +NMPSSVISSH+MHLGVLATASHAI+T TLFSVFY+PR
Sbjct  1    MRQQSNMPSSVISSHSMHLGVLATASHAISTGTLFSVFYKPR  42


 Score = 52.8 bits (125),  Expect(2) = 8e-22, Method: Compositional matrix adjust.
 Identities = 26/35 (74%), Positives = 31/35 (89%), Gaps = 1/35 (3%)
 Frame = +1

Query  472  LFSLFFTGQGTSRSEFIVSVNKYIEAQNH*LSVGM  576
            LFS+F+  + TSRSEFIVSVNKY+EAQ+H LSVGM
Sbjct  34   LFSVFYKPR-TSRSEFIVSVNKYLEAQSHKLSVGM  67



>ref|XP_006392241.1| hypothetical protein EUTSA_v10023326mg [Eutrema salsugineum]
 ref|XP_006392242.1| hypothetical protein EUTSA_v10023326mg [Eutrema salsugineum]
 gb|ESQ29527.1| hypothetical protein EUTSA_v10023326mg [Eutrema salsugineum]
 gb|ESQ29528.1| hypothetical protein EUTSA_v10023326mg [Eutrema salsugineum]
Length=667

 Score = 81.6 bits (200),  Expect(2) = 1e-21, Method: Composition-based stats.
 Identities = 37/48 (77%), Positives = 43/48 (90%), Gaps = 0/48 (0%)
 Frame = +3

Query  357  VGVRRLMRQLNNMPSSVISSHTMHLGVLATASHAINTRTLFSVFYRPR  500
            VGVRR MRQ  N+PSSVISSH+MH+GVLATA+HAI T T+FSVFY+PR
Sbjct  224  VGVRRHMRQQTNIPSSVISSHSMHIGVLATAAHAITTGTIFSVFYKPR  271


 Score = 47.8 bits (112),  Expect(2) = 1e-21, Method: Composition-based stats.
 Identities = 23/35 (66%), Positives = 30/35 (86%), Gaps = 1/35 (3%)
 Frame = +1

Query  472  LFSLFFTGQGTSRSEFIVSVNKYIEAQNH*LSVGM  576
            +FS+F+  + TSRSEFIVSVN+Y+EA+N  LSVGM
Sbjct  263  IFSVFYKPR-TSRSEFIVSVNRYLEAKNQKLSVGM  296



>emb|CDY27291.1| BnaC04g18710D [Brassica napus]
Length=619

 Score = 80.5 bits (197),  Expect(2) = 3e-21, Method: Composition-based stats.
 Identities = 37/48 (77%), Positives = 43/48 (90%), Gaps = 0/48 (0%)
 Frame = +3

Query  357  VGVRRLMRQLNNMPSSVISSHTMHLGVLATASHAINTRTLFSVFYRPR  500
            VGVRR MRQ  N+PSSVISSH+MH+GVLATA+HAI T T+FSVFY+PR
Sbjct  223  VGVRRHMRQQTNIPSSVISSHSMHIGVLATAAHAITTGTIFSVFYKPR  270


 Score = 48.1 bits (113),  Expect(2) = 3e-21, Method: Composition-based stats.
 Identities = 23/35 (66%), Positives = 30/35 (86%), Gaps = 1/35 (3%)
 Frame = +1

Query  472  LFSLFFTGQGTSRSEFIVSVNKYIEAQNH*LSVGM  576
            +FS+F+  + TSRSEFIVSVN+Y+EA+N  LSVGM
Sbjct  262  IFSVFYKPR-TSRSEFIVSVNRYLEAKNQKLSVGM  295



>ref|XP_009103121.1| PREDICTED: auxin response factor 1 isoform X1 [Brassica rapa]
 ref|XP_009103129.1| PREDICTED: auxin response factor 1 isoform X1 [Brassica rapa]
 ref|XP_009103136.1| PREDICTED: auxin response factor 1 isoform X1 [Brassica rapa]
 gb|AFD01292.1| auxin response factor 1 [Brassica rapa subsp. pekinensis]
Length=665

 Score = 81.3 bits (199),  Expect(2) = 4e-21, Method: Composition-based stats.
 Identities = 37/48 (77%), Positives = 43/48 (90%), Gaps = 0/48 (0%)
 Frame = +3

Query  357  VGVRRLMRQLNNMPSSVISSHTMHLGVLATASHAINTRTLFSVFYRPR  500
            VGVRR MRQ  N+PSSVISSH+MH+GVLATA+HAI T T+FSVFY+PR
Sbjct  220  VGVRRHMRQQTNIPSSVISSHSMHIGVLATAAHAITTGTIFSVFYKPR  267


 Score = 47.0 bits (110),  Expect(2) = 4e-21, Method: Composition-based stats.
 Identities = 22/35 (63%), Positives = 30/35 (86%), Gaps = 1/35 (3%)
 Frame = +1

Query  472  LFSLFFTGQGTSRSEFIVSVNKYIEAQNH*LSVGM  576
            +FS+F+  + TSRSEFIVSVN+Y+EA+N  L+VGM
Sbjct  259  IFSVFYKPR-TSRSEFIVSVNRYLEAKNQKLAVGM  292



>ref|XP_009103143.1| PREDICTED: auxin response factor 1 isoform X2 [Brassica rapa]
Length=662

 Score = 81.3 bits (199),  Expect(2) = 4e-21, Method: Composition-based stats.
 Identities = 37/48 (77%), Positives = 43/48 (90%), Gaps = 0/48 (0%)
 Frame = +3

Query  357  VGVRRLMRQLNNMPSSVISSHTMHLGVLATASHAINTRTLFSVFYRPR  500
            VGVRR MRQ  N+PSSVISSH+MH+GVLATA+HAI T T+FSVFY+PR
Sbjct  220  VGVRRHMRQQTNIPSSVISSHSMHIGVLATAAHAITTGTIFSVFYKPR  267


 Score = 47.0 bits (110),  Expect(2) = 4e-21, Method: Composition-based stats.
 Identities = 22/35 (63%), Positives = 30/35 (86%), Gaps = 1/35 (3%)
 Frame = +1

Query  472  LFSLFFTGQGTSRSEFIVSVNKYIEAQNH*LSVGM  576
            +FS+F+  + TSRSEFIVSVN+Y+EA+N  L+VGM
Sbjct  259  IFSVFYKPR-TSRSEFIVSVNRYLEAKNQKLAVGM  292



>emb|CDY33603.1| BnaC01g28340D [Brassica napus]
Length=661

 Score = 81.3 bits (199),  Expect(2) = 4e-21, Method: Composition-based stats.
 Identities = 37/48 (77%), Positives = 43/48 (90%), Gaps = 0/48 (0%)
 Frame = +3

Query  357  VGVRRLMRQLNNMPSSVISSHTMHLGVLATASHAINTRTLFSVFYRPR  500
            VGVRR MRQ  N+PSSVISSH+MH+GVLATA+HAI T T+FSVFY+PR
Sbjct  219  VGVRRHMRQQTNIPSSVISSHSMHIGVLATAAHAITTGTIFSVFYKPR  266


 Score = 47.0 bits (110),  Expect(2) = 4e-21, Method: Composition-based stats.
 Identities = 22/35 (63%), Positives = 30/35 (86%), Gaps = 1/35 (3%)
 Frame = +1

Query  472  LFSLFFTGQGTSRSEFIVSVNKYIEAQNH*LSVGM  576
            +FS+F+  + TSRSEFIVSVN+Y+EA+N  L+VGM
Sbjct  258  IFSVFYKPR-TSRSEFIVSVNRYLEAKNQKLAVGM  291



>emb|CDY65065.1| BnaA01g35830D [Brassica napus]
Length=661

 Score = 80.9 bits (198),  Expect(2) = 4e-21, Method: Composition-based stats.
 Identities = 37/48 (77%), Positives = 43/48 (90%), Gaps = 0/48 (0%)
 Frame = +3

Query  357  VGVRRLMRQLNNMPSSVISSHTMHLGVLATASHAINTRTLFSVFYRPR  500
            VGVRR MRQ  N+PSSVISSH+MH+GVLATA+HAI T T+FSVFY+PR
Sbjct  219  VGVRRHMRQQTNIPSSVISSHSMHIGVLATAAHAITTGTIFSVFYKPR  266


 Score = 47.0 bits (110),  Expect(2) = 4e-21, Method: Composition-based stats.
 Identities = 22/35 (63%), Positives = 30/35 (86%), Gaps = 1/35 (3%)
 Frame = +1

Query  472  LFSLFFTGQGTSRSEFIVSVNKYIEAQNH*LSVGM  576
            +FS+F+  + TSRSEFIVSVN+Y+EA+N  L+VGM
Sbjct  258  IFSVFYKPR-TSRSEFIVSVNRYLEAKNQKLAVGM  291



>gb|AAM91657.1| auxin response factor 1 [Arabidopsis thaliana]
Length=662

 Score = 82.0 bits (201),  Expect(2) = 6e-21, Method: Composition-based stats.
 Identities = 37/48 (77%), Positives = 43/48 (90%), Gaps = 0/48 (0%)
 Frame = +3

Query  357  VGVRRLMRQLNNMPSSVISSHTMHLGVLATASHAINTRTLFSVFYRPR  500
            VGVRR MRQ  N+PSSVISSH+MH+GVLATA+HAI T T+FSVFY+PR
Sbjct  220  VGVRRHMRQQTNIPSSVISSHSMHIGVLATAAHAITTGTIFSVFYKPR  267


 Score = 45.4 bits (106),  Expect(2) = 6e-21, Method: Composition-based stats.
 Identities = 22/35 (63%), Positives = 29/35 (83%), Gaps = 1/35 (3%)
 Frame = +1

Query  472  LFSLFFTGQGTSRSEFIVSVNKYIEAQNH*LSVGM  576
            +FS+F+  + TSRSEFIVSVN+Y+EA+   LSVGM
Sbjct  259  IFSVFYKPR-TSRSEFIVSVNRYLEAKTQKLSVGM  292



>ref|NP_849830.1| auxin response factor 1 [Arabidopsis thaliana]
 gb|AEE33613.1| auxin response factor 1 [Arabidopsis thaliana]
Length=662

 Score = 81.6 bits (200),  Expect(2) = 7e-21, Method: Composition-based stats.
 Identities = 37/48 (77%), Positives = 43/48 (90%), Gaps = 0/48 (0%)
 Frame = +3

Query  357  VGVRRLMRQLNNMPSSVISSHTMHLGVLATASHAINTRTLFSVFYRPR  500
            VGVRR MRQ  N+PSSVISSH+MH+GVLATA+HAI T T+FSVFY+PR
Sbjct  220  VGVRRHMRQQTNIPSSVISSHSMHIGVLATAAHAITTGTIFSVFYKPR  267


 Score = 45.4 bits (106),  Expect(2) = 7e-21, Method: Composition-based stats.
 Identities = 22/35 (63%), Positives = 29/35 (83%), Gaps = 1/35 (3%)
 Frame = +1

Query  472  LFSLFFTGQGTSRSEFIVSVNKYIEAQNH*LSVGM  576
            +FS+F+  + TSRSEFIVSVN+Y+EA+   LSVGM
Sbjct  259  IFSVFYKPR-TSRSEFIVSVNRYLEAKTQKLSVGM  292



>ref|NP_176184.1| auxin response factor 1 [Arabidopsis thaliana]
 ref|NP_001031208.1| auxin response factor 1 [Arabidopsis thaliana]
 sp|Q8L7G0.2|ARFA_ARATH RecName: Full=Auxin response factor 1 [Arabidopsis thaliana]
 gb|AAD39318.1|AC007258_7 auxin response factor 1 [Arabidopsis thaliana]
 gb|AAC49751.1| auxin response factor 1 [Arabidopsis thaliana]
 gb|AAO22577.1| auxin response factor 1 [Arabidopsis thaliana]
 dbj|BAH19896.1| AT1G59750 [Arabidopsis thaliana]
 gb|AEE33612.1| auxin response factor 1 [Arabidopsis thaliana]
 gb|AEE33614.1| auxin response factor 1 [Arabidopsis thaliana]
Length=665

 Score = 81.6 bits (200),  Expect(2) = 7e-21, Method: Composition-based stats.
 Identities = 37/48 (77%), Positives = 43/48 (90%), Gaps = 0/48 (0%)
 Frame = +3

Query  357  VGVRRLMRQLNNMPSSVISSHTMHLGVLATASHAINTRTLFSVFYRPR  500
            VGVRR MRQ  N+PSSVISSH+MH+GVLATA+HAI T T+FSVFY+PR
Sbjct  220  VGVRRHMRQQTNIPSSVISSHSMHIGVLATAAHAITTGTIFSVFYKPR  267


 Score = 45.4 bits (106),  Expect(2) = 7e-21, Method: Composition-based stats.
 Identities = 22/35 (63%), Positives = 29/35 (83%), Gaps = 1/35 (3%)
 Frame = +1

Query  472  LFSLFFTGQGTSRSEFIVSVNKYIEAQNH*LSVGM  576
            +FS+F+  + TSRSEFIVSVN+Y+EA+   LSVGM
Sbjct  259  IFSVFYKPR-TSRSEFIVSVNRYLEAKTQKLSVGM  292



>ref|NP_001185266.1| auxin response factor 1 [Arabidopsis thaliana]
 gb|AEE33615.1| auxin response factor 1 [Arabidopsis thaliana]
Length=660

 Score = 81.6 bits (200),  Expect(2) = 7e-21, Method: Composition-based stats.
 Identities = 37/48 (77%), Positives = 43/48 (90%), Gaps = 0/48 (0%)
 Frame = +3

Query  357  VGVRRLMRQLNNMPSSVISSHTMHLGVLATASHAINTRTLFSVFYRPR  500
            VGVRR MRQ  N+PSSVISSH+MH+GVLATA+HAI T T+FSVFY+PR
Sbjct  220  VGVRRHMRQQTNIPSSVISSHSMHIGVLATAAHAITTGTIFSVFYKPR  267


 Score = 45.4 bits (106),  Expect(2) = 7e-21, Method: Composition-based stats.
 Identities = 22/35 (63%), Positives = 29/35 (83%), Gaps = 1/35 (3%)
 Frame = +1

Query  472  LFSLFFTGQGTSRSEFIVSVNKYIEAQNH*LSVGM  576
            +FS+F+  + TSRSEFIVSVN+Y+EA+   LSVGM
Sbjct  259  IFSVFYKPR-TSRSEFIVSVNRYLEAKTQKLSVGM  292



>ref|XP_006300434.1| hypothetical protein CARUB_v10022415mg [Capsella rubella]
 gb|EOA33332.1| hypothetical protein CARUB_v10022415mg [Capsella rubella]
Length=665

 Score = 81.3 bits (199),  Expect(2) = 8e-21, Method: Composition-based stats.
 Identities = 37/48 (77%), Positives = 43/48 (90%), Gaps = 0/48 (0%)
 Frame = +3

Query  357  VGVRRLMRQLNNMPSSVISSHTMHLGVLATASHAINTRTLFSVFYRPR  500
            VGVRR MRQ  N+PSSVISSH+MH+GVLATA+HAI T T+FSVFY+PR
Sbjct  220  VGVRRHMRQQTNVPSSVISSHSMHIGVLATAAHAITTGTIFSVFYKPR  267


 Score = 45.4 bits (106),  Expect(2) = 8e-21, Method: Composition-based stats.
 Identities = 22/35 (63%), Positives = 29/35 (83%), Gaps = 1/35 (3%)
 Frame = +1

Query  472  LFSLFFTGQGTSRSEFIVSVNKYIEAQNH*LSVGM  576
            +FS+F+  + TSRSEFIVSVN+Y+EA+   LSVGM
Sbjct  259  IFSVFYKPR-TSRSEFIVSVNRYLEAKTQKLSVGM  292



>ref|XP_002888184.1| hypothetical protein ARALYDRAFT_475338 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH64443.1| hypothetical protein ARALYDRAFT_475338 [Arabidopsis lyrata subsp. 
lyrata]
Length=665

 Score = 81.3 bits (199),  Expect(2) = 9e-21, Method: Composition-based stats.
 Identities = 37/48 (77%), Positives = 43/48 (90%), Gaps = 0/48 (0%)
 Frame = +3

Query  357  VGVRRLMRQLNNMPSSVISSHTMHLGVLATASHAINTRTLFSVFYRPR  500
            VGVRR MRQ  N+PSSVISSH+MH+GVLATA+HAI T T+FSVFY+PR
Sbjct  220  VGVRRHMRQQTNIPSSVISSHSMHIGVLATAAHAITTGTIFSVFYKPR  267


 Score = 45.4 bits (106),  Expect(2) = 9e-21, Method: Composition-based stats.
 Identities = 22/35 (63%), Positives = 29/35 (83%), Gaps = 1/35 (3%)
 Frame = +1

Query  472  LFSLFFTGQGTSRSEFIVSVNKYIEAQNH*LSVGM  576
            +FS+F+  + TSRSEFIVSVN+Y+EA+   LSVGM
Sbjct  259  IFSVFYKPR-TSRSEFIVSVNRYLEAKTQKLSVGM  292



>ref|XP_010414657.1| PREDICTED: auxin response factor 1-like isoform X2 [Camelina 
sativa]
Length=662

 Score = 80.5 bits (197),  Expect(2) = 1e-20, Method: Composition-based stats.
 Identities = 37/48 (77%), Positives = 43/48 (90%), Gaps = 0/48 (0%)
 Frame = +3

Query  357  VGVRRLMRQLNNMPSSVISSHTMHLGVLATASHAINTRTLFSVFYRPR  500
            VGVRR MRQ  N+PSSVISSH+MH+GVLATA+HAI T T+FSVFY+PR
Sbjct  220  VGVRRHMRQQMNIPSSVISSHSMHIGVLATAAHAITTGTIFSVFYKPR  267


 Score = 45.4 bits (106),  Expect(2) = 1e-20, Method: Composition-based stats.
 Identities = 22/35 (63%), Positives = 29/35 (83%), Gaps = 1/35 (3%)
 Frame = +1

Query  472  LFSLFFTGQGTSRSEFIVSVNKYIEAQNH*LSVGM  576
            +FS+F+  + TSRSEFIVSVN+Y+EA+   LSVGM
Sbjct  259  IFSVFYKPR-TSRSEFIVSVNRYLEAKTQKLSVGM  292



>ref|XP_010414655.1| PREDICTED: auxin response factor 1-like isoform X1 [Camelina 
sativa]
 ref|XP_010414656.1| PREDICTED: auxin response factor 1-like isoform X1 [Camelina 
sativa]
Length=665

 Score = 80.5 bits (197),  Expect(2) = 1e-20, Method: Composition-based stats.
 Identities = 37/48 (77%), Positives = 43/48 (90%), Gaps = 0/48 (0%)
 Frame = +3

Query  357  VGVRRLMRQLNNMPSSVISSHTMHLGVLATASHAINTRTLFSVFYRPR  500
            VGVRR MRQ  N+PSSVISSH+MH+GVLATA+HAI T T+FSVFY+PR
Sbjct  220  VGVRRHMRQQMNIPSSVISSHSMHIGVLATAAHAITTGTIFSVFYKPR  267


 Score = 45.4 bits (106),  Expect(2) = 1e-20, Method: Composition-based stats.
 Identities = 22/35 (63%), Positives = 29/35 (83%), Gaps = 1/35 (3%)
 Frame = +1

Query  472  LFSLFFTGQGTSRSEFIVSVNKYIEAQNH*LSVGM  576
            +FS+F+  + TSRSEFIVSVN+Y+EA+   LSVGM
Sbjct  259  IFSVFYKPR-TSRSEFIVSVNRYLEAKTQKLSVGM  292



>ref|XP_010470201.1| PREDICTED: auxin response factor 1-like isoform X2 [Camelina 
sativa]
Length=663

 Score = 80.5 bits (197),  Expect(2) = 1e-20, Method: Composition-based stats.
 Identities = 37/48 (77%), Positives = 43/48 (90%), Gaps = 0/48 (0%)
 Frame = +3

Query  357  VGVRRLMRQLNNMPSSVISSHTMHLGVLATASHAINTRTLFSVFYRPR  500
            VGVRR MRQ  N+PSSVISSH+MH+GVLATA+HAI T T+FSVFY+PR
Sbjct  220  VGVRRHMRQQMNIPSSVISSHSMHIGVLATAAHAITTGTIFSVFYKPR  267


 Score = 45.4 bits (106),  Expect(2) = 1e-20, Method: Composition-based stats.
 Identities = 22/35 (63%), Positives = 29/35 (83%), Gaps = 1/35 (3%)
 Frame = +1

Query  472  LFSLFFTGQGTSRSEFIVSVNKYIEAQNH*LSVGM  576
            +FS+F+  + TSRSEFIVSVN+Y+EA+   LSVGM
Sbjct  259  IFSVFYKPR-TSRSEFIVSVNRYLEAKTQKLSVGM  292



>ref|XP_010511014.1| PREDICTED: auxin response factor 1 isoform X2 [Camelina sativa]
Length=662

 Score = 80.5 bits (197),  Expect(2) = 1e-20, Method: Composition-based stats.
 Identities = 37/48 (77%), Positives = 43/48 (90%), Gaps = 0/48 (0%)
 Frame = +3

Query  357  VGVRRLMRQLNNMPSSVISSHTMHLGVLATASHAINTRTLFSVFYRPR  500
            VGVRR MRQ  N+PSSVISSH+MH+GVLATA+HAI T T+FSVFY+PR
Sbjct  220  VGVRRHMRQQMNIPSSVISSHSMHIGVLATAAHAITTGTIFSVFYKPR  267


 Score = 45.4 bits (106),  Expect(2) = 1e-20, Method: Composition-based stats.
 Identities = 22/35 (63%), Positives = 29/35 (83%), Gaps = 1/35 (3%)
 Frame = +1

Query  472  LFSLFFTGQGTSRSEFIVSVNKYIEAQNH*LSVGM  576
            +FS+F+  + TSRSEFIVSVN+Y+EA+   LSVGM
Sbjct  259  IFSVFYKPR-TSRSEFIVSVNRYLEAKTQKLSVGM  292



>ref|XP_010470197.1| PREDICTED: auxin response factor 1-like isoform X1 [Camelina 
sativa]
 ref|XP_010470198.1| PREDICTED: auxin response factor 1-like isoform X1 [Camelina 
sativa]
 ref|XP_010470199.1| PREDICTED: auxin response factor 1-like isoform X1 [Camelina 
sativa]
 ref|XP_010470200.1| PREDICTED: auxin response factor 1-like isoform X1 [Camelina 
sativa]
Length=666

 Score = 80.5 bits (197),  Expect(2) = 2e-20, Method: Composition-based stats.
 Identities = 37/48 (77%), Positives = 43/48 (90%), Gaps = 0/48 (0%)
 Frame = +3

Query  357  VGVRRLMRQLNNMPSSVISSHTMHLGVLATASHAINTRTLFSVFYRPR  500
            VGVRR MRQ  N+PSSVISSH+MH+GVLATA+HAI T T+FSVFY+PR
Sbjct  220  VGVRRHMRQQMNIPSSVISSHSMHIGVLATAAHAITTGTIFSVFYKPR  267


 Score = 45.4 bits (106),  Expect(2) = 2e-20, Method: Composition-based stats.
 Identities = 22/35 (63%), Positives = 29/35 (83%), Gaps = 1/35 (3%)
 Frame = +1

Query  472  LFSLFFTGQGTSRSEFIVSVNKYIEAQNH*LSVGM  576
            +FS+F+  + TSRSEFIVSVN+Y+EA+   LSVGM
Sbjct  259  IFSVFYKPR-TSRSEFIVSVNRYLEAKTQKLSVGM  292



>ref|XP_010511012.1| PREDICTED: auxin response factor 1 isoform X1 [Camelina sativa]
 ref|XP_010511013.1| PREDICTED: auxin response factor 1 isoform X1 [Camelina sativa]
Length=665

 Score = 80.5 bits (197),  Expect(2) = 2e-20, Method: Composition-based stats.
 Identities = 37/48 (77%), Positives = 43/48 (90%), Gaps = 0/48 (0%)
 Frame = +3

Query  357  VGVRRLMRQLNNMPSSVISSHTMHLGVLATASHAINTRTLFSVFYRPR  500
            VGVRR MRQ  N+PSSVISSH+MH+GVLATA+HAI T T+FSVFY+PR
Sbjct  220  VGVRRHMRQQMNIPSSVISSHSMHIGVLATAAHAITTGTIFSVFYKPR  267


 Score = 45.4 bits (106),  Expect(2) = 2e-20, Method: Composition-based stats.
 Identities = 22/35 (63%), Positives = 29/35 (83%), Gaps = 1/35 (3%)
 Frame = +1

Query  472  LFSLFFTGQGTSRSEFIVSVNKYIEAQNH*LSVGM  576
            +FS+F+  + TSRSEFIVSVN+Y+EA+   LSVGM
Sbjct  259  IFSVFYKPR-TSRSEFIVSVNRYLEAKTQKLSVGM  292



>ref|XP_009403719.1| PREDICTED: auxin response factor 7-like [Musa acuminata subsp. 
malaccensis]
Length=653

 Score = 84.3 bits (207),  Expect(2) = 2e-20, Method: Compositional matrix adjust.
 Identities = 42/68 (62%), Positives = 52/68 (76%), Gaps = 4/68 (6%)
 Frame = +3

Query  309  KQMVESEPLL----EMSWI*VGVRRLMRQLNNMPSSVISSHTMHLGVLATASHAINTRTL  476
            KQ+V  +  +    E   + VGVRRLM+Q NNMPSSVISSH+MH+GVLATA+HA +T T 
Sbjct  199  KQLVAGDAFIFLRGENGELRVGVRRLMKQQNNMPSSVISSHSMHVGVLATAAHAFSTGTR  258

Query  477  FSVFYRPR  500
            FSVFY+PR
Sbjct  259  FSVFYKPR  266


 Score = 41.6 bits (96),  Expect(2) = 2e-20, Method: Composition-based stats.
 Identities = 18/34 (53%), Positives = 28/34 (82%), Gaps = 1/34 (3%)
 Frame = +1

Query  475  FSLFFTGQGTSRSEFIVSVNKYIEAQNH*LSVGM  576
            FS+F+  + T+RSEF++SVNKY+E +N  +S+GM
Sbjct  259  FSVFYKPR-TNRSEFVISVNKYLEGKNKKISMGM  291



>pdb|4LDX|A Chain A, Crystal Structure Of The Dna Binding Domain Of Arabidopsis 
Thaliana Auxin Response Factor 1 (arf1) In Complex With 
Protomor-like Sequence Er7
 pdb|4LDX|B Chain B, Crystal Structure Of The Dna Binding Domain Of Arabidopsis 
Thaliana Auxin Response Factor 1 (arf1) In Complex With 
Protomor-like Sequence Er7
Length=363

 Score = 80.1 bits (196),  Expect(2) = 3e-20, Method: Compositional matrix adjust.
 Identities = 37/48 (77%), Positives = 43/48 (90%), Gaps = 0/48 (0%)
 Frame = +3

Query  357  VGVRRLMRQLNNMPSSVISSHTMHLGVLATASHAINTRTLFSVFYRPR  500
            VGVRR MRQ  N+PSSVISSH+MH+GVLATA+HAI T T+FSVFY+PR
Sbjct  220  VGVRRHMRQQTNIPSSVISSHSMHIGVLATAAHAITTGTIFSVFYKPR  267


 Score = 45.1 bits (105),  Expect(2) = 3e-20, Method: Compositional matrix adjust.
 Identities = 22/35 (63%), Positives = 29/35 (83%), Gaps = 1/35 (3%)
 Frame = +1

Query  472  LFSLFFTGQGTSRSEFIVSVNKYIEAQNH*LSVGM  576
            +FS+F+  + TSRSEFIVSVN+Y+EA+   LSVGM
Sbjct  259  IFSVFYKPR-TSRSEFIVSVNRYLEAKTQKLSVGM  292



>pdb|4LDV|A Chain A, Crystal Structure Of The Dna Binding Domain Of A. Thailana 
Auxin Response Factor 1
 pdb|4LDW|A Chain A, Crystal Structure Of The Dna Binding Domain Of Arabidopsis 
Thaliana Auxin Response Factor 1, P21 Structure
 pdb|4LDW|B Chain B, Crystal Structure Of The Dna Binding Domain Of Arabidopsis 
Thaliana Auxin Response Factor 1, P21 Structure
Length=362

 Score = 80.1 bits (196),  Expect(2) = 3e-20, Method: Compositional matrix adjust.
 Identities = 37/48 (77%), Positives = 43/48 (90%), Gaps = 0/48 (0%)
 Frame = +3

Query  357  VGVRRLMRQLNNMPSSVISSHTMHLGVLATASHAINTRTLFSVFYRPR  500
            VGVRR MRQ  N+PSSVISSH+MH+GVLATA+HAI T T+FSVFY+PR
Sbjct  220  VGVRRHMRQQTNIPSSVISSHSMHIGVLATAAHAITTGTIFSVFYKPR  267


 Score = 45.1 bits (105),  Expect(2) = 3e-20, Method: Compositional matrix adjust.
 Identities = 22/35 (63%), Positives = 29/35 (83%), Gaps = 1/35 (3%)
 Frame = +1

Query  472  LFSLFFTGQGTSRSEFIVSVNKYIEAQNH*LSVGM  576
            +FS+F+  + TSRSEFIVSVN+Y+EA+   LSVGM
Sbjct  259  IFSVFYKPR-TSRSEFIVSVNRYLEAKTQKLSVGM  292



>ref|XP_010418847.1| PREDICTED: auxin response factor 1-like, partial [Camelina sativa]
Length=477

 Score = 79.7 bits (195),  Expect(2) = 3e-20, Method: Compositional matrix adjust.
 Identities = 37/48 (77%), Positives = 43/48 (90%), Gaps = 0/48 (0%)
 Frame = +3

Query  357  VGVRRLMRQLNNMPSSVISSHTMHLGVLATASHAINTRTLFSVFYRPR  500
            VGVRR MRQ  N+PSSVISSH+MH+GVLATA+HAI T T+FSVFY+PR
Sbjct  31   VGVRRHMRQQMNIPSSVISSHSMHIGVLATAAHAITTGTIFSVFYKPR  78


 Score = 45.4 bits (106),  Expect(2) = 3e-20, Method: Compositional matrix adjust.
 Identities = 22/35 (63%), Positives = 29/35 (83%), Gaps = 1/35 (3%)
 Frame = +1

Query  472  LFSLFFTGQGTSRSEFIVSVNKYIEAQNH*LSVGM  576
            +FS+F+  + TSRSEFIVSVN+Y+EA+   LSVGM
Sbjct  70   IFSVFYKPR-TSRSEFIVSVNRYLEAKTQKLSVGM  103



>pdb|4LDY|A Chain A, Crystal Structure Of The Dna Binding Domain Of The G245a 
Mutant Of Arabidopsis Thaliana Auxin Reponse Factor 1
 pdb|4LDY|B Chain B, Crystal Structure Of The Dna Binding Domain Of The G245a 
Mutant Of Arabidopsis Thaliana Auxin Reponse Factor 1
Length=362

 Score = 77.8 bits (190),  Expect(2) = 2e-19, Method: Compositional matrix adjust.
 Identities = 36/48 (75%), Positives = 42/48 (88%), Gaps = 0/48 (0%)
 Frame = +3

Query  357  VGVRRLMRQLNNMPSSVISSHTMHLGVLATASHAINTRTLFSVFYRPR  500
            VGVRR MRQ  N+PSSVISSH+MH+ VLATA+HAI T T+FSVFY+PR
Sbjct  220  VGVRRHMRQQTNIPSSVISSHSMHIAVLATAAHAITTGTIFSVFYKPR  267


 Score = 45.1 bits (105),  Expect(2) = 2e-19, Method: Compositional matrix adjust.
 Identities = 22/35 (63%), Positives = 29/35 (83%), Gaps = 1/35 (3%)
 Frame = +1

Query  472  LFSLFFTGQGTSRSEFIVSVNKYIEAQNH*LSVGM  576
            +FS+F+  + TSRSEFIVSVN+Y+EA+   LSVGM
Sbjct  259  IFSVFYKPR-TSRSEFIVSVNRYLEAKTQKLSVGM  292



>ref|XP_009406474.1| PREDICTED: auxin response factor 7-like isoform X2 [Musa acuminata 
subsp. malaccensis]
Length=642

 Score = 92.4 bits (228),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 49/76 (64%), Positives = 56/76 (74%), Gaps = 2/76 (3%)
 Frame = +3

Query  357  VGVRRLMRQLNNMPSSVISSHTMHLGVLATASHAINTRTLFSVFYRPRDKSV*VHCECE*  536
            VGVRRLMRQ NNMPSSVISSH+MHLGVLATASHAI T TLFSVFY+PR     V  +   
Sbjct  223  VGVRRLMRQPNNMPSSVISSHSMHLGVLATASHAIATGTLFSVFYKPRFSGTIVGVDTTS  282

Query  537  IY*SS--KSLALSWDE  578
             +  S  ++L + WDE
Sbjct  283  QWAGSEWRTLKVQWDE  298



>ref|XP_010523816.1| PREDICTED: auxin response factor 18-like isoform X2 [Tarenaya 
hassleriana]
Length=616

 Score = 84.0 bits (206),  Expect(2) = 5e-18, Method: Composition-based stats.
 Identities = 39/48 (81%), Positives = 43/48 (90%), Gaps = 0/48 (0%)
 Frame = +3

Query  357  VGVRRLMRQLNNMPSSVISSHTMHLGVLATASHAINTRTLFSVFYRPR  500
            VGVRRL RQ + MPSSVISS +MHLGVLATASHA+NTRTLF VFY+PR
Sbjct  226  VGVRRLARQQSTMPSSVISSQSMHLGVLATASHAVNTRTLFVVFYKPR  273


 Score = 33.5 bits (75),  Expect(2) = 5e-18, Method: Composition-based stats.
 Identities = 17/35 (49%), Positives = 23/35 (66%), Gaps = 3/35 (9%)
 Frame = +1

Query  472  LFSLFFTGQGTSRSEFIVSVNKYIEAQNH*LSVGM  576
            LF +F+  +    S+FI+ VNKY+EA  H  SVGM
Sbjct  265  LFVVFYKPR---ISQFIIGVNKYMEAVKHGFSVGM  296



>ref|XP_010523815.1| PREDICTED: auxin response factor 18-like isoform X1 [Tarenaya 
hassleriana]
Length=618

 Score = 84.0 bits (206),  Expect(2) = 5e-18, Method: Composition-based stats.
 Identities = 39/48 (81%), Positives = 43/48 (90%), Gaps = 0/48 (0%)
 Frame = +3

Query  357  VGVRRLMRQLNNMPSSVISSHTMHLGVLATASHAINTRTLFSVFYRPR  500
            VGVRRL RQ + MPSSVISS +MHLGVLATASHA+NTRTLF VFY+PR
Sbjct  226  VGVRRLARQQSTMPSSVISSQSMHLGVLATASHAVNTRTLFVVFYKPR  273


 Score = 33.5 bits (75),  Expect(2) = 5e-18, Method: Composition-based stats.
 Identities = 17/35 (49%), Positives = 23/35 (66%), Gaps = 3/35 (9%)
 Frame = +1

Query  472  LFSLFFTGQGTSRSEFIVSVNKYIEAQNH*LSVGM  576
            LF +F+  +    S+FI+ VNKY+EA  H  SVGM
Sbjct  265  LFVVFYKPR---ISQFIIGVNKYMEAVKHGFSVGM  296



>tpg|DAA37676.1| TPA: hypothetical protein ZEAMMB73_822305 [Zea mays]
Length=285

 Score = 89.0 bits (219),  Expect = 7e-18, Method: Compositional matrix adjust.
 Identities = 42/48 (88%), Positives = 47/48 (98%), Gaps = 0/48 (0%)
 Frame = +3

Query  357  VGVRRLMRQLNNMPSSVISSHTMHLGVLATASHAINTRTLFSVFYRPR  500
            VGVRRLMRQ+N+MPSSVISSH+MHLGVLATASHAI+T TLFSVFY+PR
Sbjct  221  VGVRRLMRQVNSMPSSVISSHSMHLGVLATASHAISTGTLFSVFYKPR  268



>ref|XP_010924913.1| PREDICTED: LOW QUALITY PROTEIN: auxin response factor 18-like 
[Elaeis guineensis]
Length=712

 Score = 81.3 bits (199),  Expect(2) = 1e-17, Method: Composition-based stats.
 Identities = 36/48 (75%), Positives = 44/48 (92%), Gaps = 0/48 (0%)
 Frame = +3

Query  357  VGVRRLMRQLNNMPSSVISSHTMHLGVLATASHAINTRTLFSVFYRPR  500
            VGVRRL+RQ N +PSSVISS +MHLGVLATASHA++T +LF+VFY+PR
Sbjct  226  VGVRRLVRQQNTIPSSVISSQSMHLGVLATASHAVSTHSLFTVFYKPR  273


 Score = 35.0 bits (79),  Expect(2) = 1e-17, Method: Composition-based stats.
 Identities = 17/35 (49%), Positives = 24/35 (69%), Gaps = 3/35 (9%)
 Frame = +1

Query  472  LFSLFFTGQGTSRSEFIVSVNKYIEAQNH*LSVGM  576
            LF++F+  +    S+FIV VNKY+EA  H  +VGM
Sbjct  265  LFTVFYKPR---TSQFIVRVNKYLEAVKHGFAVGM  296



>ref|XP_010544846.1| PREDICTED: auxin response factor 18 [Tarenaya hassleriana]
Length=633

 Score = 80.5 bits (197),  Expect(2) = 4e-17, Method: Composition-based stats.
 Identities = 37/48 (77%), Positives = 43/48 (90%), Gaps = 0/48 (0%)
 Frame = +3

Query  357  VGVRRLMRQLNNMPSSVISSHTMHLGVLATASHAINTRTLFSVFYRPR  500
            VGVRRL RQ + MPSSVISS +MHLGVLATASHA++T+TLF VFY+PR
Sbjct  226  VGVRRLARQQSTMPSSVISSQSMHLGVLATASHAVSTKTLFVVFYKPR  273


 Score = 34.3 bits (77),  Expect(2) = 4e-17, Method: Composition-based stats.
 Identities = 18/35 (51%), Positives = 23/35 (66%), Gaps = 3/35 (9%)
 Frame = +1

Query  472  LFSLFFTGQGTSRSEFIVSVNKYIEAQNH*LSVGM  576
            LF +F+  +    S+FIV VNKY+EA  H  SVGM
Sbjct  265  LFVVFYKPR---ISQFIVGVNKYMEAVKHCFSVGM  296



>ref|XP_006852604.1| hypothetical protein AMTR_s00021p00221770 [Amborella trichopoda]
 gb|ERN14071.1| hypothetical protein AMTR_s00021p00221770 [Amborella trichopoda]
Length=739

 Score = 72.4 bits (176),  Expect(2) = 6e-17, Method: Composition-based stats.
 Identities = 32/48 (67%), Positives = 43/48 (90%), Gaps = 0/48 (0%)
 Frame = +3

Query  357  VGVRRLMRQLNNMPSSVISSHTMHLGVLATASHAINTRTLFSVFYRPR  500
            VG+RRL+RQ + MPSSVISS +MHLGVLATA+ AI+ ++LF+V+Y+PR
Sbjct  240  VGIRRLLRQQSTMPSSVISSDSMHLGVLATATRAISFQSLFTVYYKPR  287


 Score = 41.6 bits (96),  Expect(2) = 6e-17, Method: Composition-based stats.
 Identities = 20/35 (57%), Positives = 27/35 (77%), Gaps = 1/35 (3%)
 Frame = +1

Query  472  LFSLFFTGQGTSRSEFIVSVNKYIEAQNH*LSVGM  576
            LF++++  + TS S FI+ VNKY+EA NH LSVGM
Sbjct  279  LFTVYYKPR-TSPSGFIIGVNKYLEAMNHRLSVGM  312



>emb|CBA11993.1| putative auxin response factor 2 [Amborella trichopoda]
Length=737

 Score = 83.6 bits (205),  Expect(2) = 1e-16, Method: Composition-based stats.
 Identities = 38/48 (79%), Positives = 43/48 (90%), Gaps = 0/48 (0%)
 Frame = +3

Query  357  VGVRRLMRQLNNMPSSVISSHTMHLGVLATASHAINTRTLFSVFYRPR  500
            VGVRR +RQ NNMP+SVISSH+MHLGVLATA HA +T T+FSVFYRPR
Sbjct  244  VGVRRALRQQNNMPTSVISSHSMHLGVLATAMHAFSTGTMFSVFYRPR  291


 Score = 29.6 bits (65),  Expect(2) = 1e-16, Method: Composition-based stats.
 Identities = 13/35 (37%), Positives = 25/35 (71%), Gaps = 1/35 (3%)
 Frame = +1

Query  472  LFSLFFTGQGTSRSEFIVSVNKYIEAQNH*LSVGM  576
            +FS+F+  + TS SEF++  ++Y+E+  +  S+GM
Sbjct  283  MFSVFYRPR-TSPSEFVIPYDQYMESVKNNYSIGM  316



>gb|ADW11246.1| putative auxin response factor [Gossypium hirsutum]
Length=672

 Score = 65.9 bits (159),  Expect(2) = 1e-16, Method: Composition-based stats.
 Identities = 36/48 (75%), Positives = 45/48 (94%), Gaps = 0/48 (0%)
 Frame = +3

Query  357  VGVRRLMRQLNNMPSSVISSHTMHLGVLATASHAINTRTLFSVFYRPR  500
            VGVRRLMRQ  NMPSSVISSH++ LGVLATAS+A++TR++FS+FY+PR
Sbjct  220  VGVRRLMRQQANMPSSVISSHSIILGVLATASYALSTRSMFSIFYKPR  267


 Score = 47.0 bits (110),  Expect(2) = 1e-16, Method: Composition-based stats.
 Identities = 23/35 (66%), Positives = 30/35 (86%), Gaps = 1/35 (3%)
 Frame = +1

Query  472  LFSLFFTGQGTSRSEFIVSVNKYIEAQNH*LSVGM  576
            +FS+F+  + TS SEFIVSVNKY+EA++H LSVGM
Sbjct  259  MFSIFYKPR-TSLSEFIVSVNKYLEARSHKLSVGM  292



>gb|EMT17168.1| Auxin response factor 4 [Aegilops tauschii]
Length=910

 Score = 82.4 bits (202),  Expect(2) = 1e-16, Method: Composition-based stats.
 Identities = 37/48 (77%), Positives = 45/48 (94%), Gaps = 0/48 (0%)
 Frame = +3

Query  357  VGVRRLMRQLNNMPSSVISSHTMHLGVLATASHAINTRTLFSVFYRPR  500
            VGVRR MRQL+N+ SSVISSH+MHLGVLATA HAINT+T+F+V+Y+PR
Sbjct  229  VGVRRAMRQLSNIASSVISSHSMHLGVLATAWHAINTKTMFTVYYKPR  276


 Score = 30.4 bits (67),  Expect(2) = 1e-16, Method: Composition-based stats.
 Identities = 13/34 (38%), Positives = 25/34 (74%), Gaps = 1/34 (3%)
 Frame = +1

Query  472  LFSLFFTGQGTSRSEFIVSVNKYIEAQNH*LSVG  573
            +F++++  + TSRSEFI+  +KY+E+  +  S+G
Sbjct  268  MFTVYYKPR-TSRSEFIIPYDKYMESVKNIYSIG  300



>ref|XP_009421032.1| PREDICTED: auxin response factor 24-like isoform X2 [Musa acuminata 
subsp. malaccensis]
Length=875

 Score = 84.0 bits (206),  Expect(2) = 2e-16, Method: Composition-based stats.
 Identities = 37/48 (77%), Positives = 44/48 (92%), Gaps = 0/48 (0%)
 Frame = +3

Query  357  VGVRRLMRQLNNMPSSVISSHTMHLGVLATASHAINTRTLFSVFYRPR  500
            VGVRR MRQ NN+PSSVISSH+MHLGVLATA HA+NT T+F+V+Y+PR
Sbjct  259  VGVRRAMRQQNNVPSSVISSHSMHLGVLATAWHAVNTGTMFTVYYKPR  306


 Score = 28.5 bits (62),  Expect(2) = 2e-16, Method: Composition-based stats.
 Identities = 16/37 (43%), Positives = 27/37 (73%), Gaps = 5/37 (14%)
 Frame = +1

Query  472  LFSLFFTGQGTSRSEFIVSVNKYIEA--QNH*LSVGM  576
            +F++++  + TS SEFIV  ++Y+E+  +NH  SVGM
Sbjct  298  MFTVYYKPR-TSPSEFIVPFDQYVESIKRNH--SVGM  331



>ref|XP_009421031.1| PREDICTED: auxin response factor 24-like isoform X1 [Musa acuminata 
subsp. malaccensis]
Length=880

 Score = 84.0 bits (206),  Expect(2) = 2e-16, Method: Composition-based stats.
 Identities = 37/48 (77%), Positives = 44/48 (92%), Gaps = 0/48 (0%)
 Frame = +3

Query  357  VGVRRLMRQLNNMPSSVISSHTMHLGVLATASHAINTRTLFSVFYRPR  500
            VGVRR MRQ NN+PSSVISSH+MHLGVLATA HA+NT T+F+V+Y+PR
Sbjct  264  VGVRRAMRQQNNVPSSVISSHSMHLGVLATAWHAVNTGTMFTVYYKPR  311


 Score = 28.5 bits (62),  Expect(2) = 2e-16, Method: Composition-based stats.
 Identities = 16/37 (43%), Positives = 27/37 (73%), Gaps = 5/37 (14%)
 Frame = +1

Query  472  LFSLFFTGQGTSRSEFIVSVNKYIEA--QNH*LSVGM  576
            +F++++  + TS SEFIV  ++Y+E+  +NH  SVGM
Sbjct  303  MFTVYYKPR-TSPSEFIVPFDQYVESIKRNH--SVGM  336



>ref|XP_009116845.1| PREDICTED: auxin response factor 18 [Brassica rapa]
Length=559

 Score = 79.7 bits (195),  Expect(2) = 2e-16, Method: Compositional matrix adjust.
 Identities = 36/48 (75%), Positives = 42/48 (88%), Gaps = 0/48 (0%)
 Frame = +3

Query  357  VGVRRLMRQLNNMPSSVISSHTMHLGVLATASHAINTRTLFSVFYRPR  500
            VGVRRL R  N MP+SVISS +MHLGVLATASHA+NT+T+F VFY+PR
Sbjct  223  VGVRRLARHQNTMPASVISSQSMHLGVLATASHAVNTQTMFLVFYKPR  270


 Score = 32.3 bits (72),  Expect(2) = 2e-16, Method: Compositional matrix adjust.
 Identities = 14/21 (67%), Positives = 17/21 (81%), Gaps = 0/21 (0%)
 Frame = +1

Query  511  SEFIVSVNKYIEAQNH*LSVG  573
            S+FIVSVNKY+EA  H  S+G
Sbjct  272  SQFIVSVNKYMEAMKHGFSLG  292



>gb|EMT09779.1| Auxin response factor 4 [Aegilops tauschii]
Length=830

 Score = 84.0 bits (206),  Expect(2) = 2e-16, Method: Composition-based stats.
 Identities = 37/48 (77%), Positives = 46/48 (96%), Gaps = 0/48 (0%)
 Frame = +3

Query  357  VGVRRLMRQLNNMPSSVISSHTMHLGVLATASHAINTRTLFSVFYRPR  500
            VGVRR MRQL+N+PSSVISSH+MHLGVLATA HAINT+++F+V+Y+PR
Sbjct  256  VGVRRAMRQLSNVPSSVISSHSMHLGVLATAWHAINTKSMFTVYYKPR  303


 Score = 28.1 bits (61),  Expect(2) = 2e-16, Method: Composition-based stats.
 Identities = 12/35 (34%), Positives = 25/35 (71%), Gaps = 1/35 (3%)
 Frame = +1

Query  472  LFSLFFTGQGTSRSEFIVSVNKYIEAQNH*LSVGM  576
            +F++++  + TS SEFI+  ++Y+E+  +  S+GM
Sbjct  295  MFTVYYKPR-TSPSEFIIPYDQYMESVKNNYSIGM  328



>gb|EMS58454.1| Auxin response factor 4 [Triticum urartu]
Length=766

 Score = 81.6 bits (200),  Expect(2) = 2e-16, Method: Composition-based stats.
 Identities = 37/48 (77%), Positives = 45/48 (94%), Gaps = 0/48 (0%)
 Frame = +3

Query  357  VGVRRLMRQLNNMPSSVISSHTMHLGVLATASHAINTRTLFSVFYRPR  500
            VGVRR MRQL+N+ SSVISSH+MHLGVLATA HAINT+T+F+V+Y+PR
Sbjct  169  VGVRRAMRQLSNIASSVISSHSMHLGVLATAWHAINTKTMFTVYYKPR  216


 Score = 30.4 bits (67),  Expect(2) = 2e-16, Method: Composition-based stats.
 Identities = 13/34 (38%), Positives = 25/34 (74%), Gaps = 1/34 (3%)
 Frame = +1

Query  472  LFSLFFTGQGTSRSEFIVSVNKYIEAQNH*LSVG  573
            +F++++  + TSRSEFI+  +KY+E+  +  S+G
Sbjct  208  MFTVYYKPR-TSRSEFIIPYDKYMESVKNIYSIG  240



>ref|XP_008806441.1| PREDICTED: auxin response factor 18-like isoform X1 [Phoenix 
dactylifera]
 ref|XP_008806451.1| PREDICTED: auxin response factor 18-like isoform X1 [Phoenix 
dactylifera]
 ref|XP_008806461.1| PREDICTED: auxin response factor 18-like isoform X1 [Phoenix 
dactylifera]
Length=713

 Score = 80.9 bits (198),  Expect(2) = 3e-16, Method: Composition-based stats.
 Identities = 36/48 (75%), Positives = 43/48 (90%), Gaps = 0/48 (0%)
 Frame = +3

Query  357  VGVRRLMRQLNNMPSSVISSHTMHLGVLATASHAINTRTLFSVFYRPR  500
            VGVRRL RQ N +PSSVISS +MHLGVLATASHA++T +LF+VFY+PR
Sbjct  226  VGVRRLARQQNTIPSSVISSQSMHLGVLATASHAVSTHSLFTVFYKPR  273


 Score = 30.8 bits (68),  Expect(2) = 3e-16, Method: Composition-based stats.
 Identities = 16/35 (46%), Positives = 24/35 (69%), Gaps = 3/35 (9%)
 Frame = +1

Query  472  LFSLFFTGQGTSRSEFIVSVNKYIEAQNH*LSVGM  576
            LF++F+  +    S+FIV VNKY+EA  +  +VGM
Sbjct  265  LFTVFYKPR---ISQFIVRVNKYLEAFKNGFAVGM  296



>dbj|BAK03995.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=826

 Score = 82.0 bits (201),  Expect(2) = 3e-16, Method: Composition-based stats.
 Identities = 37/48 (77%), Positives = 45/48 (94%), Gaps = 0/48 (0%)
 Frame = +3

Query  357  VGVRRLMRQLNNMPSSVISSHTMHLGVLATASHAINTRTLFSVFYRPR  500
            VGVRR MRQL+N+ SSVISSH+MHLGVLATA HAINT+T+F+V+Y+PR
Sbjct  230  VGVRRAMRQLSNIASSVISSHSMHLGVLATAWHAINTKTMFTVYYKPR  277


 Score = 29.6 bits (65),  Expect(2) = 3e-16, Method: Composition-based stats.
 Identities = 13/34 (38%), Positives = 24/34 (71%), Gaps = 1/34 (3%)
 Frame = +1

Query  472  LFSLFFTGQGTSRSEFIVSVNKYIEAQNH*LSVG  573
            +F++++  + TSRSEFI+  +KY E+  +  S+G
Sbjct  269  MFTVYYKPR-TSRSEFIIPYDKYTESVKNIYSIG  301



>gb|AFD01315.1| auxin response factor 18-1 [Brassica rapa subsp. pekinensis]
Length=1055

 Score = 78.6 bits (192),  Expect(2) = 3e-16, Method: Composition-based stats.
 Identities = 36/48 (75%), Positives = 42/48 (88%), Gaps = 0/48 (0%)
 Frame = +3

Query  357  VGVRRLMRQLNNMPSSVISSHTMHLGVLATASHAINTRTLFSVFYRPR  500
            VGVRRL R  N MP+SVISS +MHLGVLATASHA+NT+T+F VFY+PR
Sbjct  223  VGVRRLARHQNTMPASVISSQSMHLGVLATASHAVNTQTMFLVFYKPR  270


 Score = 33.1 bits (74),  Expect(2) = 3e-16, Method: Composition-based stats.
 Identities = 14/21 (67%), Positives = 17/21 (81%), Gaps = 0/21 (0%)
 Frame = +1

Query  511  SEFIVSVNKYIEAQNH*LSVG  573
            S+FIVSVNKY+EA  H  S+G
Sbjct  272  SQFIVSVNKYMEAMKHGFSLG  292



>ref|XP_008806468.1| PREDICTED: auxin response factor 18-like isoform X2 [Phoenix 
dactylifera]
Length=656

 Score = 80.5 bits (197),  Expect(2) = 4e-16, Method: Composition-based stats.
 Identities = 36/48 (75%), Positives = 43/48 (90%), Gaps = 0/48 (0%)
 Frame = +3

Query  357  VGVRRLMRQLNNMPSSVISSHTMHLGVLATASHAINTRTLFSVFYRPR  500
            VGVRRL RQ N +PSSVISS +MHLGVLATASHA++T +LF+VFY+PR
Sbjct  226  VGVRRLARQQNTIPSSVISSQSMHLGVLATASHAVSTHSLFTVFYKPR  273


 Score = 30.8 bits (68),  Expect(2) = 4e-16, Method: Composition-based stats.
 Identities = 16/35 (46%), Positives = 24/35 (69%), Gaps = 3/35 (9%)
 Frame = +1

Query  472  LFSLFFTGQGTSRSEFIVSVNKYIEAQNH*LSVGM  576
            LF++F+  +    S+FIV VNKY+EA  +  +VGM
Sbjct  265  LFTVFYKPR---ISQFIVRVNKYLEAFKNGFAVGM  296



>ref|XP_010696146.1| PREDICTED: auxin response factor 18-like [Beta vulgaris subsp. 
vulgaris]
Length=668

 Score = 78.6 bits (192),  Expect(2) = 4e-16, Method: Composition-based stats.
 Identities = 35/48 (73%), Positives = 42/48 (88%), Gaps = 0/48 (0%)
 Frame = +3

Query  357  VGVRRLMRQLNNMPSSVISSHTMHLGVLATASHAINTRTLFSVFYRPR  500
            VGVRRL+RQ   MPSSVISS +MHLGVLATA HA+NT T+F+V+Y+PR
Sbjct  222  VGVRRLVRQQAPMPSSVISSQSMHLGVLATARHAVNTSTMFTVYYKPR  269


 Score = 32.7 bits (73),  Expect(2) = 4e-16, Method: Composition-based stats.
 Identities = 14/35 (40%), Positives = 24/35 (69%), Gaps = 3/35 (9%)
 Frame = +1

Query  472  LFSLFFTGQGTSRSEFIVSVNKYIEAQNH*LSVGM  576
            +F++++  +    S+FIV V K++EA NH  S+GM
Sbjct  261  MFTVYYKPRS---SQFIVGVKKFLEAVNHRFSIGM  292



>gb|KFK28953.1| hypothetical protein AALP_AA7G070000 [Arabis alpina]
Length=641

 Score = 79.3 bits (194),  Expect(2) = 4e-16, Method: Composition-based stats.
 Identities = 36/48 (75%), Positives = 42/48 (88%), Gaps = 0/48 (0%)
 Frame = +3

Query  357  VGVRRLMRQLNNMPSSVISSHTMHLGVLATASHAINTRTLFSVFYRPR  500
            VGVRR  RQ N+MPSSVISSH+MHLGVLATA HA  TRT+F+V+Y+PR
Sbjct  217  VGVRRANRQQNSMPSSVISSHSMHLGVLATACHATQTRTMFTVYYKPR  264


 Score = 31.6 bits (70),  Expect(2) = 4e-16, Method: Composition-based stats.
 Identities = 14/35 (40%), Positives = 26/35 (74%), Gaps = 3/35 (9%)
 Frame = +1

Query  472  LFSLFFTGQGTSRSEFIVSVNKYIEAQNH*LSVGM  576
            +F++++  +    S+FI+S+NKY+EA ++  SVGM
Sbjct  256  MFTVYYKPR---TSQFIISLNKYLEAVSNKFSVGM  287



>dbj|BAJ96055.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ99988.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=801

 Score = 82.8 bits (203),  Expect(2) = 5e-16, Method: Composition-based stats.
 Identities = 37/48 (77%), Positives = 46/48 (96%), Gaps = 0/48 (0%)
 Frame = +3

Query  357  VGVRRLMRQLNNMPSSVISSHTMHLGVLATASHAINTRTLFSVFYRPR  500
            VGVRR MRQL+N+PSSVISSH+MHLGVLATA HAINT+++F+V+Y+PR
Sbjct  222  VGVRRAMRQLSNVPSSVISSHSMHLGVLATAWHAINTKSMFTVYYKPR  269


 Score = 28.1 bits (61),  Expect(2) = 5e-16, Method: Composition-based stats.
 Identities = 12/35 (34%), Positives = 25/35 (71%), Gaps = 1/35 (3%)
 Frame = +1

Query  472  LFSLFFTGQGTSRSEFIVSVNKYIEAQNH*LSVGM  576
            +F++++  + TS SEFI+  ++Y+E+  +  S+GM
Sbjct  261  MFTVYYKPR-TSPSEFIIPYDQYMESVKNNYSIGM  294



>gb|EMS47784.1| Auxin response factor 4 [Triticum urartu]
Length=788

 Score = 82.8 bits (203),  Expect(2) = 5e-16, Method: Composition-based stats.
 Identities = 37/48 (77%), Positives = 46/48 (96%), Gaps = 0/48 (0%)
 Frame = +3

Query  357  VGVRRLMRQLNNMPSSVISSHTMHLGVLATASHAINTRTLFSVFYRPR  500
            VGVRR MRQL+N+PSSVISSH+MHLGVLATA HAINT+++F+V+Y+PR
Sbjct  229  VGVRRAMRQLSNVPSSVISSHSMHLGVLATAWHAINTKSMFTVYYKPR  276


 Score = 28.1 bits (61),  Expect(2) = 5e-16, Method: Composition-based stats.
 Identities = 12/35 (34%), Positives = 25/35 (71%), Gaps = 1/35 (3%)
 Frame = +1

Query  472  LFSLFFTGQGTSRSEFIVSVNKYIEAQNH*LSVGM  576
            +F++++  + TS SEFI+  ++Y+E+  +  S+GM
Sbjct  268  MFTVYYKPR-TSPSEFIIPYDQYMESVKNNYSIGM  301



>ref|XP_006855394.1| hypothetical protein AMTR_s00057p00141830 [Amborella trichopoda]
 gb|ERN16861.1| hypothetical protein AMTR_s00057p00141830 [Amborella trichopoda]
Length=734

 Score = 82.4 bits (202),  Expect(2) = 5e-16, Method: Composition-based stats.
 Identities = 37/48 (77%), Positives = 43/48 (90%), Gaps = 0/48 (0%)
 Frame = +3

Query  357  VGVRRLMRQLNNMPSSVISSHTMHLGVLATASHAINTRTLFSVFYRPR  500
            VGVRR +RQ NNMP+SVISSH+MHLGVLATA HA +T T+FSV+YRPR
Sbjct  244  VGVRRALRQQNNMPTSVISSHSMHLGVLATAMHAFSTGTMFSVYYRPR  291


 Score = 28.5 bits (62),  Expect(2) = 5e-16, Method: Composition-based stats.
 Identities = 12/35 (34%), Positives = 25/35 (71%), Gaps = 1/35 (3%)
 Frame = +1

Query  472  LFSLFFTGQGTSRSEFIVSVNKYIEAQNH*LSVGM  576
            +FS+++  + TS SEF++  ++Y+E+  +  S+GM
Sbjct  283  MFSVYYRPR-TSPSEFVIPYDQYMESVKNNYSIGM  316



>ref|XP_003564986.1| PREDICTED: auxin response factor 4-like [Brachypodium distachyon]
Length=814

 Score = 84.0 bits (206),  Expect(2) = 8e-16, Method: Composition-based stats.
 Identities = 37/48 (77%), Positives = 46/48 (96%), Gaps = 0/48 (0%)
 Frame = +3

Query  357  VGVRRLMRQLNNMPSSVISSHTMHLGVLATASHAINTRTLFSVFYRPR  500
            VGVRR MRQL+N+PSSVISSH+MHLGVLATA HAINT+++F+V+Y+PR
Sbjct  223  VGVRRAMRQLSNVPSSVISSHSMHLGVLATAWHAINTKSMFTVYYKPR  270


 Score = 26.2 bits (56),  Expect(2) = 8e-16, Method: Composition-based stats.
 Identities = 11/35 (31%), Positives = 25/35 (71%), Gaps = 1/35 (3%)
 Frame = +1

Query  472  LFSLFFTGQGTSRSEFIVSVNKYIEAQNH*LSVGM  576
            +F++++  + TS SEFI+  ++Y+E+  +  S+G+
Sbjct  262  MFTVYYKPR-TSPSEFIIPYDQYMESVKNNYSIGV  295



>gb|AAW82475.1| auxin response factor 2 [Triticum aestivum]
Length=202

 Score = 81.3 bits (199),  Expect(2) = 8e-16, Method: Compositional matrix adjust.
 Identities = 37/48 (77%), Positives = 45/48 (94%), Gaps = 0/48 (0%)
 Frame = +3

Query  357  VGVRRLMRQLNNMPSSVISSHTMHLGVLATASHAINTRTLFSVFYRPR  500
            VGVRR MRQL+N+ SSVISSH+MHLGVLATA HAINT+T+F+V+Y+PR
Sbjct  91   VGVRRAMRQLSNIASSVISSHSMHLGVLATAWHAINTKTMFTVYYKPR  138


 Score = 28.9 bits (63),  Expect(2) = 8e-16, Method: Compositional matrix adjust.
 Identities = 12/34 (35%), Positives = 25/34 (74%), Gaps = 1/34 (3%)
 Frame = +1

Query  472  LFSLFFTGQGTSRSEFIVSVNKYIEAQNH*LSVG  573
            +F++++  + TSRSEFI+  +KY+++  +  S+G
Sbjct  130  MFTVYYKPR-TSRSEFIIPYDKYMDSVKNIYSIG  162



>gb|KFK35371.1| hypothetical protein AALP_AA5G276400 [Arabis alpina]
Length=583

 Score = 78.2 bits (191),  Expect(2) = 8e-16, Method: Composition-based stats.
 Identities = 35/48 (73%), Positives = 42/48 (88%), Gaps = 0/48 (0%)
 Frame = +3

Query  357  VGVRRLMRQLNNMPSSVISSHTMHLGVLATASHAINTRTLFSVFYRPR  500
            VGVRRL R  + MP+SVISS +MHLGVLATASHA++T+TLF VFY+PR
Sbjct  216  VGVRRLARHQSTMPTSVISSQSMHLGVLATASHAVSTKTLFVVFYKPR  263


 Score = 32.0 bits (71),  Expect(2) = 8e-16, Method: Composition-based stats.
 Identities = 16/35 (46%), Positives = 23/35 (66%), Gaps = 3/35 (9%)
 Frame = +1

Query  472  LFSLFFTGQGTSRSEFIVSVNKYIEAQNH*LSVGM  576
            LF +F+  +    S+FIV VNKY+EA  H  S+G+
Sbjct  255  LFVVFYKPR---ISQFIVGVNKYMEAMKHGFSLGI  286



>emb|CDM85878.1| unnamed protein product [Triticum aestivum]
Length=796

 Score = 82.0 bits (201),  Expect(2) = 9e-16, Method: Composition-based stats.
 Identities = 37/48 (77%), Positives = 45/48 (94%), Gaps = 0/48 (0%)
 Frame = +3

Query  357  VGVRRLMRQLNNMPSSVISSHTMHLGVLATASHAINTRTLFSVFYRPR  500
            VGVRR MRQL N+PSSVISSH+MHLGVLATA HAINT+++F+V+Y+PR
Sbjct  222  VGVRRAMRQLPNVPSSVISSHSMHLGVLATAWHAINTKSMFTVYYKPR  269


 Score = 28.1 bits (61),  Expect(2) = 9e-16, Method: Composition-based stats.
 Identities = 12/35 (34%), Positives = 25/35 (71%), Gaps = 1/35 (3%)
 Frame = +1

Query  472  LFSLFFTGQGTSRSEFIVSVNKYIEAQNH*LSVGM  576
            +F++++  + TS SEFI+  ++Y+E+  +  S+GM
Sbjct  261  MFTVYYKPR-TSPSEFIIPYDQYMESVKNNYSIGM  294



>ref|XP_008811924.1| PREDICTED: auxin response factor 23-like [Phoenix dactylifera]
Length=866

 Score = 79.7 bits (195),  Expect(2) = 9e-16, Method: Composition-based stats.
 Identities = 36/48 (75%), Positives = 43/48 (90%), Gaps = 0/48 (0%)
 Frame = +3

Query  357  VGVRRLMRQLNNMPSSVISSHTMHLGVLATASHAINTRTLFSVFYRPR  500
            VGVRR MRQ  N+PSSVISSH+MHLGVLATA HA+NT T+F+V+Y+PR
Sbjct  255  VGVRRAMRQQTNVPSSVISSHSMHLGVLATAWHAVNTGTMFTVYYKPR  302


 Score = 30.4 bits (67),  Expect(2) = 9e-16, Method: Composition-based stats.
 Identities = 15/35 (43%), Positives = 26/35 (74%), Gaps = 1/35 (3%)
 Frame = +1

Query  472  LFSLFFTGQGTSRSEFIVSVNKYIEAQNH*LSVGM  576
            +F++++  + TS SEFIVS ++Y+E+  +  SVGM
Sbjct  294  MFTVYYKPR-TSPSEFIVSYDQYMESLKNNHSVGM  327



>ref|XP_006844540.1| hypothetical protein AMTR_s00016p00168950 [Amborella trichopoda]
 gb|ERN06215.1| hypothetical protein AMTR_s00016p00168950 [Amborella trichopoda]
Length=838

 Score = 80.1 bits (196),  Expect(2) = 1e-15, Method: Composition-based stats.
 Identities = 35/48 (73%), Positives = 44/48 (92%), Gaps = 0/48 (0%)
 Frame = +3

Query  357  VGVRRLMRQLNNMPSSVISSHTMHLGVLATASHAINTRTLFSVFYRPR  500
            VGVRR M+Q +N+PSSVISSH+MHLGVLATA HAI+T T+F+V+Y+PR
Sbjct  239  VGVRRAMKQQSNVPSSVISSHSMHLGVLATAMHAISTGTMFTVYYKPR  286


 Score = 29.6 bits (65),  Expect(2) = 1e-15, Method: Composition-based stats.
 Identities = 14/35 (40%), Positives = 23/35 (66%), Gaps = 1/35 (3%)
 Frame = +1

Query  472  LFSLFFTGQGTSRSEFIVSVNKYIEAQNH*LSVGM  576
            +F++++  +  S SEFIV  N+Y+EA     S+GM
Sbjct  278  MFTVYYKPR-ISPSEFIVPCNQYLEALKQNYSIGM  311



>tpg|DAA56015.1| TPA: hypothetical protein ZEAMMB73_705793 [Zea mays]
Length=822

 Score = 81.6 bits (200),  Expect(2) = 1e-15, Method: Composition-based stats.
 Identities = 36/48 (75%), Positives = 45/48 (94%), Gaps = 0/48 (0%)
 Frame = +3

Query  357  VGVRRLMRQLNNMPSSVISSHTMHLGVLATASHAINTRTLFSVFYRPR  500
            VGVRR MRQL+N+PSSVISS +MHLGVLATA HAINT+++F+V+Y+PR
Sbjct  224  VGVRRAMRQLSNVPSSVISSQSMHLGVLATAWHAINTKSMFTVYYKPR  271


 Score = 28.1 bits (61),  Expect(2) = 1e-15, Method: Composition-based stats.
 Identities = 12/35 (34%), Positives = 25/35 (71%), Gaps = 1/35 (3%)
 Frame = +1

Query  472  LFSLFFTGQGTSRSEFIVSVNKYIEAQNH*LSVGM  576
            +F++++  + TS SEFI+  ++Y+E+  +  S+GM
Sbjct  263  MFTVYYKPR-TSPSEFIIPYDQYMESVKNNYSIGM  296



>ref|XP_002456888.1| hypothetical protein SORBIDRAFT_03g044630 [Sorghum bicolor]
 gb|EES02008.1| hypothetical protein SORBIDRAFT_03g044630 [Sorghum bicolor]
Length=704

 Score = 81.6 bits (200),  Expect(2) = 1e-15, Method: Compositional matrix adjust.
 Identities = 36/48 (75%), Positives = 45/48 (94%), Gaps = 0/48 (0%)
 Frame = +3

Query  357  VGVRRLMRQLNNMPSSVISSHTMHLGVLATASHAINTRTLFSVFYRPR  500
            VGVRR MRQL+N+PSSVISS +MHLGVLATA HAINT+++F+V+Y+PR
Sbjct  224  VGVRRAMRQLSNVPSSVISSQSMHLGVLATAWHAINTKSMFTVYYKPR  271


 Score = 28.1 bits (61),  Expect(2) = 1e-15, Method: Composition-based stats.
 Identities = 12/35 (34%), Positives = 25/35 (71%), Gaps = 1/35 (3%)
 Frame = +1

Query  472  LFSLFFTGQGTSRSEFIVSVNKYIEAQNH*LSVGM  576
            +F++++  + TS SEFI+  ++Y+E+  +  S+GM
Sbjct  263  MFTVYYKPR-TSPSEFIIPYDQYMESVKNNYSIGM  296



>gb|EYU21819.1| hypothetical protein MIMGU_mgv1a001371mg [Erythranthe guttata]
Length=832

 Score = 80.5 bits (197),  Expect(2) = 1e-15, Method: Composition-based stats.
 Identities = 36/48 (75%), Positives = 42/48 (88%), Gaps = 0/48 (0%)
 Frame = +3

Query  357  VGVRRLMRQLNNMPSSVISSHTMHLGVLATASHAINTRTLFSVFYRPR  500
            VGVRR MRQ  N PSSVISSH+MHLGVLATA HAI T+T+F+V+Y+PR
Sbjct  239  VGVRRAMRQQGNAPSSVISSHSMHLGVLATAWHAIQTKTMFTVYYKPR  286


 Score = 29.3 bits (64),  Expect(2) = 1e-15, Method: Composition-based stats.
 Identities = 13/35 (37%), Positives = 26/35 (74%), Gaps = 1/35 (3%)
 Frame = +1

Query  472  LFSLFFTGQGTSRSEFIVSVNKYIEAQNH*LSVGM  576
            +F++++  + TS +EFIVS ++Y+E+  +  S+GM
Sbjct  278  MFTVYYKPR-TSPAEFIVSYDQYMESVKNNYSIGM  311



>gb|EYU21820.1| hypothetical protein MIMGU_mgv1a001371mg [Erythranthe guttata]
Length=773

 Score = 80.1 bits (196),  Expect(2) = 1e-15, Method: Composition-based stats.
 Identities = 36/48 (75%), Positives = 42/48 (88%), Gaps = 0/48 (0%)
 Frame = +3

Query  357  VGVRRLMRQLNNMPSSVISSHTMHLGVLATASHAINTRTLFSVFYRPR  500
            VGVRR MRQ  N PSSVISSH+MHLGVLATA HAI T+T+F+V+Y+PR
Sbjct  239  VGVRRAMRQQGNAPSSVISSHSMHLGVLATAWHAIQTKTMFTVYYKPR  286


 Score = 29.3 bits (64),  Expect(2) = 1e-15, Method: Composition-based stats.
 Identities = 13/35 (37%), Positives = 26/35 (74%), Gaps = 1/35 (3%)
 Frame = +1

Query  472  LFSLFFTGQGTSRSEFIVSVNKYIEAQNH*LSVGM  576
            +F++++  + TS +EFIVS ++Y+E+  +  S+GM
Sbjct  278  MFTVYYKPR-TSPAEFIVSYDQYMESVKNNYSIGM  311



>gb|AFW84065.1| hypothetical protein ZEAMMB73_313624 [Zea mays]
Length=728

 Score = 81.6 bits (200),  Expect(2) = 1e-15, Method: Compositional matrix adjust.
 Identities = 36/48 (75%), Positives = 45/48 (94%), Gaps = 0/48 (0%)
 Frame = +3

Query  357  VGVRRLMRQLNNMPSSVISSHTMHLGVLATASHAINTRTLFSVFYRPR  500
            VGVRR MRQL+N+PSSVISS +MHLGVLATA HAINT+++F+V+Y+PR
Sbjct  223  VGVRRAMRQLSNVPSSVISSQSMHLGVLATAWHAINTKSMFTVYYKPR  270


 Score = 28.1 bits (61),  Expect(2) = 1e-15, Method: Composition-based stats.
 Identities = 12/35 (34%), Positives = 25/35 (71%), Gaps = 1/35 (3%)
 Frame = +1

Query  472  LFSLFFTGQGTSRSEFIVSVNKYIEAQNH*LSVGM  576
            +F++++  + TS SEFI+  ++Y+E+  +  S+GM
Sbjct  262  MFTVYYKPR-TSPSEFIIPYDQYMESVKNNYSIGM  295



>ref|XP_004971147.1| PREDICTED: auxin response factor 4-like isoform X1 [Setaria italica]
Length=809

 Score = 81.3 bits (199),  Expect(2) = 1e-15, Method: Composition-based stats.
 Identities = 36/48 (75%), Positives = 45/48 (94%), Gaps = 0/48 (0%)
 Frame = +3

Query  357  VGVRRLMRQLNNMPSSVISSHTMHLGVLATASHAINTRTLFSVFYRPR  500
            VGVRR MRQL+N+PSSVISS +MHLGVLATA HAINT+++F+V+Y+PR
Sbjct  225  VGVRRAMRQLSNIPSSVISSQSMHLGVLATAWHAINTKSMFTVYYKPR  272


 Score = 28.1 bits (61),  Expect(2) = 1e-15, Method: Composition-based stats.
 Identities = 12/35 (34%), Positives = 25/35 (71%), Gaps = 1/35 (3%)
 Frame = +1

Query  472  LFSLFFTGQGTSRSEFIVSVNKYIEAQNH*LSVGM  576
            +F++++  + TS SEFI+  ++Y+E+  +  S+GM
Sbjct  264  MFTVYYKPR-TSPSEFIIPYDQYMESLKNNYSIGM  297



>gb|ADG43144.1| auxin response factor 10 [Zea mays]
Length=799

 Score = 81.3 bits (199),  Expect(2) = 1e-15, Method: Composition-based stats.
 Identities = 36/48 (75%), Positives = 45/48 (94%), Gaps = 0/48 (0%)
 Frame = +3

Query  357  VGVRRLMRQLNNMPSSVISSHTMHLGVLATASHAINTRTLFSVFYRPR  500
            VGVRR MRQL+N+PSSVISS +MHLGVLATA HAINT+++F+V+Y+PR
Sbjct  218  VGVRRAMRQLSNVPSSVISSQSMHLGVLATAWHAINTKSMFTVYYKPR  265


 Score = 28.1 bits (61),  Expect(2) = 1e-15, Method: Composition-based stats.
 Identities = 12/35 (34%), Positives = 25/35 (71%), Gaps = 1/35 (3%)
 Frame = +1

Query  472  LFSLFFTGQGTSRSEFIVSVNKYIEAQNH*LSVGM  576
            +F++++  + TS SEFI+  ++Y+E+  +  S+GM
Sbjct  257  MFTVYYKPR-TSPSEFIIPYDQYMESVKNNYSIGM  290



>ref|XP_004971148.1| PREDICTED: auxin response factor 4-like isoform X2 [Setaria italica]
Length=808

 Score = 80.9 bits (198),  Expect(2) = 2e-15, Method: Composition-based stats.
 Identities = 36/48 (75%), Positives = 45/48 (94%), Gaps = 0/48 (0%)
 Frame = +3

Query  357  VGVRRLMRQLNNMPSSVISSHTMHLGVLATASHAINTRTLFSVFYRPR  500
            VGVRR MRQL+N+PSSVISS +MHLGVLATA HAINT+++F+V+Y+PR
Sbjct  224  VGVRRAMRQLSNIPSSVISSQSMHLGVLATAWHAINTKSMFTVYYKPR  271


 Score = 28.1 bits (61),  Expect(2) = 2e-15, Method: Composition-based stats.
 Identities = 12/35 (34%), Positives = 25/35 (71%), Gaps = 1/35 (3%)
 Frame = +1

Query  472  LFSLFFTGQGTSRSEFIVSVNKYIEAQNH*LSVGM  576
            +F++++  + TS SEFI+  ++Y+E+  +  S+GM
Sbjct  263  MFTVYYKPR-TSPSEFIIPYDQYMESLKNNYSIGM  296



>gb|KHG18665.1| Auxin response factor 18 -like protein [Gossypium arboreum]
Length=691

 Score = 74.3 bits (181),  Expect(2) = 2e-15, Method: Composition-based stats.
 Identities = 34/47 (72%), Positives = 40/47 (85%), Gaps = 0/47 (0%)
 Frame = +3

Query  357  VGVRRLMRQLNNMPSSVISSHTMHLGVLATASHAINTRTLFSVFYRP  497
            VGVRRL RQ + MPSSVISS +MHLGVLATA+HA+ T TLF V+Y+P
Sbjct  225  VGVRRLARQQSTMPSSVISSQSMHLGVLATAAHAVTTHTLFVVYYKP  271


 Score = 34.7 bits (78),  Expect(2) = 2e-15, Method: Composition-based stats.
 Identities = 17/33 (52%), Positives = 22/33 (67%), Gaps = 0/33 (0%)
 Frame = +1

Query  478  SLFFTGQGTSRSEFIVSVNKYIEAQNH*LSVGM  576
            +LF      S S+FI+ VNKY+EA N+  SVGM
Sbjct  263  TLFVVYYKPSTSQFIIGVNKYLEAINNGFSVGM  295



>ref|XP_008672541.1| PREDICTED: uncharacterized protein LOC100274571 isoform X1 [Zea 
mays]
 tpg|DAA56016.1| TPA: hypothetical protein ZEAMMB73_705793 [Zea mays]
Length=805

 Score = 80.9 bits (198),  Expect(2) = 2e-15, Method: Composition-based stats.
 Identities = 36/48 (75%), Positives = 45/48 (94%), Gaps = 0/48 (0%)
 Frame = +3

Query  357  VGVRRLMRQLNNMPSSVISSHTMHLGVLATASHAINTRTLFSVFYRPR  500
            VGVRR MRQL+N+PSSVISS +MHLGVLATA HAINT+++F+V+Y+PR
Sbjct  224  VGVRRAMRQLSNVPSSVISSQSMHLGVLATAWHAINTKSMFTVYYKPR  271


 Score = 28.1 bits (61),  Expect(2) = 2e-15, Method: Composition-based stats.
 Identities = 12/35 (34%), Positives = 25/35 (71%), Gaps = 1/35 (3%)
 Frame = +1

Query  472  LFSLFFTGQGTSRSEFIVSVNKYIEAQNH*LSVGM  576
            +F++++  + TS SEFI+  ++Y+E+  +  S+GM
Sbjct  263  MFTVYYKPR-TSPSEFIIPYDQYMESVKNNYSIGM  296



>ref|XP_006646638.1| PREDICTED: auxin response factor 4-like [Oryza brachyantha]
Length=738

 Score = 80.1 bits (196),  Expect(2) = 2e-15, Method: Composition-based stats.
 Identities = 36/48 (75%), Positives = 45/48 (94%), Gaps = 0/48 (0%)
 Frame = +3

Query  357  VGVRRLMRQLNNMPSSVISSHTMHLGVLATASHAINTRTLFSVFYRPR  500
            VGVRR MRQL+N+PSSVISS +MHLGVLATA HAINT+++F+V+Y+PR
Sbjct  155  VGVRRAMRQLSNVPSSVISSQSMHLGVLATAWHAINTKSMFTVYYKPR  202


 Score = 28.9 bits (63),  Expect(2) = 2e-15, Method: Composition-based stats.
 Identities = 13/35 (37%), Positives = 25/35 (71%), Gaps = 1/35 (3%)
 Frame = +1

Query  472  LFSLFFTGQGTSRSEFIVSVNKYIEAQNH*LSVGM  576
            +F++++  + TS SEFI+  ++Y+E+  +  SVGM
Sbjct  194  MFTVYYKPR-TSPSEFIIPYDQYMESAKNNYSVGM  227



>ref|XP_006346635.1| PREDICTED: auxin response factor 2-like [Solanum tuberosum]
Length=829

 Score = 80.9 bits (198),  Expect(2) = 2e-15, Method: Composition-based stats.
 Identities = 37/48 (77%), Positives = 42/48 (88%), Gaps = 0/48 (0%)
 Frame = +3

Query  357  VGVRRLMRQLNNMPSSVISSHTMHLGVLATASHAINTRTLFSVFYRPR  500
            VGVRR MRQ  N PSSVISSH+MHLGVLATA HAI T+TLF+V+Y+PR
Sbjct  224  VGVRRAMRQQGNAPSSVISSHSMHLGVLATAWHAIQTKTLFTVYYKPR  271


 Score = 28.1 bits (61),  Expect(2) = 2e-15, Method: Composition-based stats.
 Identities = 13/35 (37%), Positives = 25/35 (71%), Gaps = 1/35 (3%)
 Frame = +1

Query  472  LFSLFFTGQGTSRSEFIVSVNKYIEAQNH*LSVGM  576
            LF++++  + TS +EFIV  ++Y+E+  +  S+GM
Sbjct  263  LFTVYYKPR-TSPAEFIVPYDQYMESLKNNYSIGM  296



>dbj|BAB85913.1| auxin response factor 2 [Oryza sativa]
Length=791

 Score = 80.5 bits (197),  Expect(2) = 2e-15, Method: Composition-based stats.
 Identities = 36/48 (75%), Positives = 45/48 (94%), Gaps = 0/48 (0%)
 Frame = +3

Query  357  VGVRRLMRQLNNMPSSVISSHTMHLGVLATASHAINTRTLFSVFYRPR  500
            VGVRR MRQL+N+PSSVISS +MHLGVLATA HAINT+++F+V+Y+PR
Sbjct  208  VGVRRAMRQLSNVPSSVISSQSMHLGVLATAWHAINTKSMFTVYYKPR  255


 Score = 28.5 bits (62),  Expect(2) = 2e-15, Method: Composition-based stats.
 Identities = 13/35 (37%), Positives = 25/35 (71%), Gaps = 1/35 (3%)
 Frame = +1

Query  472  LFSLFFTGQGTSRSEFIVSVNKYIEAQNH*LSVGM  576
            +F++++  + TS SEFI+  ++Y+E+  +  SVGM
Sbjct  247  MFTVYYKPR-TSPSEFIIPYDQYMESVKNNYSVGM  280



>ref|NP_001045270.1| Os01g0927600 [Oryza sativa Japonica Group]
 sp|Q5JK20.1|ARFD_ORYSJ RecName: Full=Auxin response factor 4; AltName: Full=OsARF2 [Oryza 
sativa Japonica Group]
 dbj|BAD88200.1| putative auxin response factor [Oryza sativa Japonica Group]
 dbj|BAF07184.1| Os01g0927600 [Oryza sativa Japonica Group]
Length=808

 Score = 80.5 bits (197),  Expect(2) = 2e-15, Method: Composition-based stats.
 Identities = 36/48 (75%), Positives = 45/48 (94%), Gaps = 0/48 (0%)
 Frame = +3

Query  357  VGVRRLMRQLNNMPSSVISSHTMHLGVLATASHAINTRTLFSVFYRPR  500
            VGVRR MRQL+N+PSSVISS +MHLGVLATA HAINT+++F+V+Y+PR
Sbjct  225  VGVRRAMRQLSNVPSSVISSQSMHLGVLATAWHAINTKSMFTVYYKPR  272


 Score = 28.5 bits (62),  Expect(2) = 2e-15, Method: Composition-based stats.
 Identities = 13/35 (37%), Positives = 25/35 (71%), Gaps = 1/35 (3%)
 Frame = +1

Query  472  LFSLFFTGQGTSRSEFIVSVNKYIEAQNH*LSVGM  576
            +F++++  + TS SEFI+  ++Y+E+  +  SVGM
Sbjct  264  MFTVYYKPR-TSPSEFIIPYDQYMESVKNNYSVGM  297



>gb|EEC72083.1| hypothetical protein OsI_05027 [Oryza sativa Indica Group]
Length=803

 Score = 80.1 bits (196),  Expect(2) = 2e-15, Method: Composition-based stats.
 Identities = 36/48 (75%), Positives = 45/48 (94%), Gaps = 0/48 (0%)
 Frame = +3

Query  357  VGVRRLMRQLNNMPSSVISSHTMHLGVLATASHAINTRTLFSVFYRPR  500
            VGVRR MRQL+N+PSSVISS +MHLGVLATA HAINT+++F+V+Y+PR
Sbjct  220  VGVRRAMRQLSNVPSSVISSQSMHLGVLATAWHAINTKSMFTVYYKPR  267


 Score = 28.5 bits (62),  Expect(2) = 2e-15, Method: Composition-based stats.
 Identities = 13/35 (37%), Positives = 25/35 (71%), Gaps = 1/35 (3%)
 Frame = +1

Query  472  LFSLFFTGQGTSRSEFIVSVNKYIEAQNH*LSVGM  576
            +F++++  + TS SEFI+  ++Y+E+  +  SVGM
Sbjct  259  MFTVYYKPR-TSPSEFIIPYDQYMESVKNNYSVGM  292



>ref|XP_010044876.1| PREDICTED: auxin response factor 2-like [Eucalyptus grandis]
 gb|KCW86992.1| hypothetical protein EUGRSUZ_B03551 [Eucalyptus grandis]
Length=787

 Score = 79.3 bits (194),  Expect(2) = 2e-15, Method: Composition-based stats.
 Identities = 34/48 (71%), Positives = 44/48 (92%), Gaps = 0/48 (0%)
 Frame = +3

Query  357  VGVRRLMRQLNNMPSSVISSHTMHLGVLATASHAINTRTLFSVFYRPR  500
            VGVRR MRQLNN+PSS++ SH+MH+GVLATA HAI+T T+F+V+Y+PR
Sbjct  227  VGVRRAMRQLNNVPSSIMPSHSMHIGVLATAWHAISTGTMFTVYYKPR  274


 Score = 29.3 bits (64),  Expect(2) = 2e-15, Method: Composition-based stats.
 Identities = 13/35 (37%), Positives = 24/35 (69%), Gaps = 1/35 (3%)
 Frame = +1

Query  472  LFSLFFTGQGTSRSEFIVSVNKYIEAQNH*LSVGM  576
            +F++++  + TS +EFI+  +KYIE+     S+GM
Sbjct  266  MFTVYYKPR-TSPAEFIIPFDKYIESAKFDYSIGM  299



>emb|CBA11996.1| putative auxin response factor 2 [Cabomba aquatica]
Length=782

 Score = 81.3 bits (199),  Expect(2) = 2e-15, Method: Composition-based stats.
 Identities = 37/48 (77%), Positives = 44/48 (92%), Gaps = 0/48 (0%)
 Frame = +3

Query  357  VGVRRLMRQLNNMPSSVISSHTMHLGVLATASHAINTRTLFSVFYRPR  500
            VGVRR MRQ +N+PSSVISSH+MHLGVLATASHAI T T+F+V+Y+PR
Sbjct  257  VGVRRAMRQQSNVPSSVISSHSMHLGVLATASHAIQTGTMFTVYYKPR  304


 Score = 27.3 bits (59),  Expect(2) = 2e-15, Method: Composition-based stats.
 Identities = 13/35 (37%), Positives = 23/35 (66%), Gaps = 1/35 (3%)
 Frame = +1

Query  472  LFSLFFTGQGTSRSEFIVSVNKYIEAQNH*LSVGM  576
            +F++++  + TS SEFIV   +Y+E+     S+GM
Sbjct  296  MFTVYYKPR-TSPSEFIVPFAQYVESIKKNYSIGM  329



>gb|ADG43159.1| auxin response factor 25 [Zea mays]
Length=801

 Score = 80.5 bits (197),  Expect(2) = 2e-15, Method: Composition-based stats.
 Identities = 36/48 (75%), Positives = 45/48 (94%), Gaps = 0/48 (0%)
 Frame = +3

Query  357  VGVRRLMRQLNNMPSSVISSHTMHLGVLATASHAINTRTLFSVFYRPR  500
            VGVRR MRQL+N+PSSVISS +MHLGVLATA HAINT+++F+V+Y+PR
Sbjct  218  VGVRRAMRQLSNVPSSVISSQSMHLGVLATAWHAINTKSMFTVYYKPR  265


 Score = 28.1 bits (61),  Expect(2) = 2e-15, Method: Composition-based stats.
 Identities = 12/35 (34%), Positives = 25/35 (71%), Gaps = 1/35 (3%)
 Frame = +1

Query  472  LFSLFFTGQGTSRSEFIVSVNKYIEAQNH*LSVGM  576
            +F++++  + TS SEFI+  ++Y+E+  +  S+GM
Sbjct  257  MFTVYYKPR-TSPSEFIIPYDQYMESVKNNYSIGM  290



>gb|ACN34502.1| unknown [Zea mays]
 gb|AFW84066.1| hypothetical protein ZEAMMB73_313624 [Zea mays]
 gb|AIB04306.1| ARF transcription factor, partial [Zea mays]
Length=806

 Score = 80.5 bits (197),  Expect(2) = 2e-15, Method: Composition-based stats.
 Identities = 36/48 (75%), Positives = 45/48 (94%), Gaps = 0/48 (0%)
 Frame = +3

Query  357  VGVRRLMRQLNNMPSSVISSHTMHLGVLATASHAINTRTLFSVFYRPR  500
            VGVRR MRQL+N+PSSVISS +MHLGVLATA HAINT+++F+V+Y+PR
Sbjct  223  VGVRRAMRQLSNVPSSVISSQSMHLGVLATAWHAINTKSMFTVYYKPR  270


 Score = 28.1 bits (61),  Expect(2) = 2e-15, Method: Composition-based stats.
 Identities = 12/35 (34%), Positives = 25/35 (71%), Gaps = 1/35 (3%)
 Frame = +1

Query  472  LFSLFFTGQGTSRSEFIVSVNKYIEAQNH*LSVGM  576
            +F++++  + TS SEFI+  ++Y+E+  +  S+GM
Sbjct  262  MFTVYYKPR-TSPSEFIIPYDQYMESVKNNYSIGM  295



>ref|XP_011073189.1| PREDICTED: auxin response factor 2-like [Sesamum indicum]
Length=845

 Score = 80.1 bits (196),  Expect(2) = 2e-15, Method: Composition-based stats.
 Identities = 36/48 (75%), Positives = 42/48 (88%), Gaps = 0/48 (0%)
 Frame = +3

Query  357  VGVRRLMRQLNNMPSSVISSHTMHLGVLATASHAINTRTLFSVFYRPR  500
            VGVRR MRQ  N PSSVISSH+MHLGVLATA HAI T+T+F+V+Y+PR
Sbjct  240  VGVRRAMRQQGNAPSSVISSHSMHLGVLATAWHAIQTKTMFTVYYKPR  287


 Score = 28.5 bits (62),  Expect(2) = 2e-15, Method: Composition-based stats.
 Identities = 13/35 (37%), Positives = 25/35 (71%), Gaps = 1/35 (3%)
 Frame = +1

Query  472  LFSLFFTGQGTSRSEFIVSVNKYIEAQNH*LSVGM  576
            +F++++  + TS SEFIV  ++Y+E+  +  S+GM
Sbjct  279  MFTVYYKPR-TSPSEFIVPYDQYMESVKNNYSIGM  312



>ref|XP_008656904.1| PREDICTED: auxin response factor 4 [Zea mays]
Length=894

 Score = 80.5 bits (197),  Expect(2) = 2e-15, Method: Composition-based stats.
 Identities = 36/48 (75%), Positives = 45/48 (94%), Gaps = 0/48 (0%)
 Frame = +3

Query  357  VGVRRLMRQLNNMPSSVISSHTMHLGVLATASHAINTRTLFSVFYRPR  500
            VGVRR MRQL+N+PSSVISS +MHLGVLATA HAINT+++F+V+Y+PR
Sbjct  311  VGVRRAMRQLSNVPSSVISSQSMHLGVLATAWHAINTKSMFTVYYKPR  358


 Score = 28.1 bits (61),  Expect(2) = 2e-15, Method: Composition-based stats.
 Identities = 12/35 (34%), Positives = 25/35 (71%), Gaps = 1/35 (3%)
 Frame = +1

Query  472  LFSLFFTGQGTSRSEFIVSVNKYIEAQNH*LSVGM  576
            +F++++  + TS SEFI+  ++Y+E+  +  S+GM
Sbjct  350  MFTVYYKPR-TSPSEFIIPYDQYMESVKNNYSIGM  383



>gb|AFW84067.1| hypothetical protein ZEAMMB73_313624 [Zea mays]
 gb|AFW84068.1| hypothetical protein ZEAMMB73_313624 [Zea mays]
Length=812

 Score = 80.5 bits (197),  Expect(2) = 2e-15, Method: Composition-based stats.
 Identities = 36/48 (75%), Positives = 45/48 (94%), Gaps = 0/48 (0%)
 Frame = +3

Query  357  VGVRRLMRQLNNMPSSVISSHTMHLGVLATASHAINTRTLFSVFYRPR  500
            VGVRR MRQL+N+PSSVISS +MHLGVLATA HAINT+++F+V+Y+PR
Sbjct  223  VGVRRAMRQLSNVPSSVISSQSMHLGVLATAWHAINTKSMFTVYYKPR  270


 Score = 28.1 bits (61),  Expect(2) = 2e-15, Method: Composition-based stats.
 Identities = 12/35 (34%), Positives = 25/35 (71%), Gaps = 1/35 (3%)
 Frame = +1

Query  472  LFSLFFTGQGTSRSEFIVSVNKYIEAQNH*LSVGM  576
            +F++++  + TS SEFI+  ++Y+E+  +  S+GM
Sbjct  262  MFTVYYKPR-TSPSEFIIPYDQYMESVKNNYSIGM  295



>gb|EEE55935.1| hypothetical protein OsJ_04626 [Oryza sativa Japonica Group]
Length=856

 Score = 79.7 bits (195),  Expect(2) = 3e-15, Method: Composition-based stats.
 Identities = 36/48 (75%), Positives = 45/48 (94%), Gaps = 0/48 (0%)
 Frame = +3

Query  357  VGVRRLMRQLNNMPSSVISSHTMHLGVLATASHAINTRTLFSVFYRPR  500
            VGVRR MRQL+N+PSSVISS +MHLGVLATA HAINT+++F+V+Y+PR
Sbjct  222  VGVRRAMRQLSNVPSSVISSQSMHLGVLATAWHAINTKSMFTVYYKPR  269


 Score = 28.5 bits (62),  Expect(2) = 3e-15, Method: Composition-based stats.
 Identities = 13/35 (37%), Positives = 25/35 (71%), Gaps = 1/35 (3%)
 Frame = +1

Query  472  LFSLFFTGQGTSRSEFIVSVNKYIEAQNH*LSVGM  576
            +F++++  + TS SEFI+  ++Y+E+  +  SVGM
Sbjct  261  MFTVYYKPR-TSPSEFIIPYDQYMESVKNNYSVGM  294



>emb|CAC83756.1| auxin response factor 1 [Oryza sativa Japonica Group]
Length=836

 Score = 81.3 bits (199),  Expect(2) = 3e-15, Method: Composition-based stats.
 Identities = 36/48 (75%), Positives = 43/48 (90%), Gaps = 0/48 (0%)
 Frame = +3

Query  357  VGVRRLMRQLNNMPSSVISSHTMHLGVLATASHAINTRTLFSVFYRPR  500
            VGVRR MRQ  N+PSSVISSH+MHLGVLATA HA+NT T+F+V+Y+PR
Sbjct  228  VGVRRAMRQQTNVPSSVISSHSMHLGVLATAWHAVNTGTMFTVYYKPR  275


 Score = 26.9 bits (58),  Expect(2) = 3e-15, Method: Composition-based stats.
 Identities = 11/35 (31%), Positives = 24/35 (69%), Gaps = 1/35 (3%)
 Frame = +1

Query  472  LFSLFFTGQGTSRSEFIVSVNKYIEAQNH*LSVGM  576
            +F++++  + TS +EF+V  ++Y+E+     S+GM
Sbjct  267  MFTVYYKPR-TSPAEFVVPYDRYMESLKQNYSIGM  300



>ref|XP_009625132.1| PREDICTED: auxin response factor 2-like isoform X2 [Nicotiana 
tomentosiformis]
Length=799

 Score = 80.9 bits (198),  Expect(2) = 3e-15, Method: Composition-based stats.
 Identities = 36/48 (75%), Positives = 42/48 (88%), Gaps = 0/48 (0%)
 Frame = +3

Query  357  VGVRRLMRQLNNMPSSVISSHTMHLGVLATASHAINTRTLFSVFYRPR  500
            VGVRR MRQ  N PSSVISSH+MHLGVLATA HAI T+T+F+V+Y+PR
Sbjct  190  VGVRRAMRQQGNAPSSVISSHSMHLGVLATAWHAIQTKTMFTVYYKPR  237


 Score = 27.3 bits (59),  Expect(2) = 3e-15, Method: Composition-based stats.
 Identities = 12/35 (34%), Positives = 25/35 (71%), Gaps = 1/35 (3%)
 Frame = +1

Query  472  LFSLFFTGQGTSRSEFIVSVNKYIEAQNH*LSVGM  576
            +F++++  + TS +EFIV  ++Y+E+  +  S+GM
Sbjct  229  MFTVYYKPR-TSPTEFIVPYDQYMESVKNNYSIGM  262



>ref|XP_006402437.1| hypothetical protein EUTSA_v10005857mg [Eutrema salsugineum]
 gb|ESQ43890.1| hypothetical protein EUTSA_v10005857mg [Eutrema salsugineum]
Length=584

 Score = 77.0 bits (188),  Expect(2) = 3e-15, Method: Composition-based stats.
 Identities = 35/48 (73%), Positives = 41/48 (85%), Gaps = 0/48 (0%)
 Frame = +3

Query  357  VGVRRLMRQLNNMPSSVISSHTMHLGVLATASHAINTRTLFSVFYRPR  500
            VGVRRL R  + MP+SVISS +MHLGVLATASHA+ T+TLF VFY+PR
Sbjct  219  VGVRRLARHQSTMPTSVISSQSMHLGVLATASHAVRTQTLFVVFYKPR  266


 Score = 31.6 bits (70),  Expect(2) = 3e-15, Method: Composition-based stats.
 Identities = 16/34 (47%), Positives = 22/34 (65%), Gaps = 3/34 (9%)
 Frame = +1

Query  472  LFSLFFTGQGTSRSEFIVSVNKYIEAQNH*LSVG  573
            LF +F+  +    S+FIV VNKY+EA  H  S+G
Sbjct  258  LFVVFYKPR---ISQFIVGVNKYMEAMKHGFSLG  288



>ref|XP_009769543.1| PREDICTED: auxin response factor 2-like isoform X2 [Nicotiana 
sylvestris]
Length=799

 Score = 80.9 bits (198),  Expect(2) = 3e-15, Method: Composition-based stats.
 Identities = 36/48 (75%), Positives = 42/48 (88%), Gaps = 0/48 (0%)
 Frame = +3

Query  357  VGVRRLMRQLNNMPSSVISSHTMHLGVLATASHAINTRTLFSVFYRPR  500
            VGVRR MRQ  N PSSVISSH+MHLGVLATA HAI T+T+F+V+Y+PR
Sbjct  190  VGVRRAMRQQGNAPSSVISSHSMHLGVLATAWHAIQTKTMFTVYYKPR  237


 Score = 27.3 bits (59),  Expect(2) = 3e-15, Method: Composition-based stats.
 Identities = 12/35 (34%), Positives = 25/35 (71%), Gaps = 1/35 (3%)
 Frame = +1

Query  472  LFSLFFTGQGTSRSEFIVSVNKYIEAQNH*LSVGM  576
            +F++++  + TS +EFIV  ++Y+E+  +  S+GM
Sbjct  229  MFTVYYKPR-TSPAEFIVPYDQYMESVKNNYSIGM  262



>gb|KEH18629.1| auxin response factor 2 [Medicago truncatula]
Length=677

 Score = 76.6 bits (187),  Expect(2) = 3e-15, Method: Composition-based stats.
 Identities = 34/48 (71%), Positives = 42/48 (88%), Gaps = 0/48 (0%)
 Frame = +3

Query  357  VGVRRLMRQLNNMPSSVISSHTMHLGVLATASHAINTRTLFSVFYRPR  500
            VGVRR+ +Q + MPSSVISS +MHLGVLATASHA+ TRT+F V+Y+PR
Sbjct  227  VGVRRIAKQHSPMPSSVISSQSMHLGVLATASHAVMTRTMFVVYYKPR  274


 Score = 31.6 bits (70),  Expect(2) = 3e-15, Method: Composition-based stats.
 Identities = 15/23 (65%), Positives = 18/23 (78%), Gaps = 1/23 (4%)
 Frame = +1

Query  511  SEFIVSVNKYIEA-QNH*LSVGM  576
            S+FIV +NKY+EA  NH  SVGM
Sbjct  276  SQFIVGLNKYLEAVNNHKFSVGM  298



>sp|Q2R3F5.2|ARFW_ORYSJ RecName: Full=Auxin response factor 23; AltName: Full=OsARF1 
[Oryza sativa Japonica Group]
 gb|ABA93992.2| Auxin response factor 2, putative, expressed [Oryza sativa Japonica 
Group]
 gb|EEE52194.1| hypothetical protein OsJ_34072 [Oryza sativa Japonica Group]
Length=853

 Score = 80.9 bits (198),  Expect(2) = 3e-15, Method: Composition-based stats.
 Identities = 36/48 (75%), Positives = 43/48 (90%), Gaps = 0/48 (0%)
 Frame = +3

Query  357  VGVRRLMRQLNNMPSSVISSHTMHLGVLATASHAINTRTLFSVFYRPR  500
            VGVRR MRQ  N+PSSVISSH+MHLGVLATA HA+NT T+F+V+Y+PR
Sbjct  245  VGVRRAMRQQTNVPSSVISSHSMHLGVLATAWHAVNTGTMFTVYYKPR  292


 Score = 26.9 bits (58),  Expect(2) = 3e-15, Method: Composition-based stats.
 Identities = 11/35 (31%), Positives = 24/35 (69%), Gaps = 1/35 (3%)
 Frame = +1

Query  472  LFSLFFTGQGTSRSEFIVSVNKYIEAQNH*LSVGM  576
            +F++++  + TS +EF+V  ++Y+E+     S+GM
Sbjct  284  MFTVYYKPR-TSPAEFVVPYDRYMESLKQNYSIGM  317



>ref|NP_001067988.1| Os11g0523800 [Oryza sativa Japonica Group]
 gb|ABG22498.1| Auxin response factor 2, putative, expressed [Oryza sativa Japonica 
Group]
 gb|ABG22499.1| Auxin response factor 2, putative, expressed [Oryza sativa Japonica 
Group]
 dbj|BAF28351.1| Os11g0523800 [Oryza sativa Japonica Group]
Length=852

 Score = 80.9 bits (198),  Expect(2) = 3e-15, Method: Composition-based stats.
 Identities = 36/48 (75%), Positives = 43/48 (90%), Gaps = 0/48 (0%)
 Frame = +3

Query  357  VGVRRLMRQLNNMPSSVISSHTMHLGVLATASHAINTRTLFSVFYRPR  500
            VGVRR MRQ  N+PSSVISSH+MHLGVLATA HA+NT T+F+V+Y+PR
Sbjct  244  VGVRRAMRQQTNVPSSVISSHSMHLGVLATAWHAVNTGTMFTVYYKPR  291


 Score = 26.9 bits (58),  Expect(2) = 3e-15, Method: Composition-based stats.
 Identities = 11/35 (31%), Positives = 24/35 (69%), Gaps = 1/35 (3%)
 Frame = +1

Query  472  LFSLFFTGQGTSRSEFIVSVNKYIEAQNH*LSVGM  576
            +F++++  + TS +EF+V  ++Y+E+     S+GM
Sbjct  283  MFTVYYKPR-TSPAEFVVPYDRYMESLKQNYSIGM  316



>ref|XP_007038118.1| Auxin response factor-like protein isoform 1 [Theobroma cacao]
 gb|EOY22619.1| Auxin response factor-like protein isoform 1 [Theobroma cacao]
Length=856

 Score = 80.1 bits (196),  Expect(2) = 3e-15, Method: Composition-based stats.
 Identities = 36/48 (75%), Positives = 43/48 (90%), Gaps = 0/48 (0%)
 Frame = +3

Query  357  VGVRRLMRQLNNMPSSVISSHTMHLGVLATASHAINTRTLFSVFYRPR  500
            VGVRR MRQ +N+PSSVISSH+MHLGVLATA HA  TRT+F+V+Y+PR
Sbjct  256  VGVRRAMRQQSNVPSSVISSHSMHLGVLATAWHAYTTRTIFTVYYKPR  303


 Score = 28.1 bits (61),  Expect(2) = 3e-15, Method: Composition-based stats.
 Identities = 12/35 (34%), Positives = 25/35 (71%), Gaps = 1/35 (3%)
 Frame = +1

Query  472  LFSLFFTGQGTSRSEFIVSVNKYIEAQNH*LSVGM  576
            +F++++  + TS +EFIV  ++Y+E+  +  S+GM
Sbjct  295  IFTVYYKPR-TSPAEFIVPFDQYVESVKNNYSIGM  328



>gb|ABG22497.1| Auxin response factor 2, putative, expressed [Oryza sativa Japonica 
Group]
Length=771

 Score = 80.9 bits (198),  Expect(2) = 3e-15, Method: Composition-based stats.
 Identities = 36/48 (75%), Positives = 43/48 (90%), Gaps = 0/48 (0%)
 Frame = +3

Query  357  VGVRRLMRQLNNMPSSVISSHTMHLGVLATASHAINTRTLFSVFYRPR  500
            VGVRR MRQ  N+PSSVISSH+MHLGVLATA HA+NT T+F+V+Y+PR
Sbjct  163  VGVRRAMRQQTNVPSSVISSHSMHLGVLATAWHAVNTGTMFTVYYKPR  210


 Score = 26.9 bits (58),  Expect(2) = 3e-15, Method: Composition-based stats.
 Identities = 11/35 (31%), Positives = 24/35 (69%), Gaps = 1/35 (3%)
 Frame = +1

Query  472  LFSLFFTGQGTSRSEFIVSVNKYIEAQNH*LSVGM  576
            +F++++  + TS +EF+V  ++Y+E+     S+GM
Sbjct  202  MFTVYYKPR-TSPAEFVVPYDRYMESLKQNYSIGM  235



>ref|XP_009404739.1| PREDICTED: auxin response factor 23-like isoform X1 [Musa acuminata 
subsp. malaccensis]
Length=884

 Score = 79.7 bits (195),  Expect(2) = 4e-15, Method: Composition-based stats.
 Identities = 36/48 (75%), Positives = 43/48 (90%), Gaps = 0/48 (0%)
 Frame = +3

Query  357  VGVRRLMRQLNNMPSSVISSHTMHLGVLATASHAINTRTLFSVFYRPR  500
            VGVRR MRQ  N+PSSVISSH+MHLGVLATA HA+NT T+F+V+Y+PR
Sbjct  268  VGVRRAMRQQANVPSSVISSHSMHLGVLATAWHAVNTGTMFTVYYKPR  315


 Score = 28.1 bits (61),  Expect(2) = 4e-15, Method: Composition-based stats.
 Identities = 14/35 (40%), Positives = 24/35 (69%), Gaps = 1/35 (3%)
 Frame = +1

Query  472  LFSLFFTGQGTSRSEFIVSVNKYIEAQNH*LSVGM  576
            +F++++  + TS SEFIV  ++Y+E+     SVGM
Sbjct  307  MFTVYYKPR-TSPSEFIVPFDQYVESIKSNHSVGM  340



>ref|XP_009404741.1| PREDICTED: auxin response factor 23-like isoform X3 [Musa acuminata 
subsp. malaccensis]
Length=876

 Score = 79.7 bits (195),  Expect(2) = 4e-15, Method: Composition-based stats.
 Identities = 36/48 (75%), Positives = 43/48 (90%), Gaps = 0/48 (0%)
 Frame = +3

Query  357  VGVRRLMRQLNNMPSSVISSHTMHLGVLATASHAINTRTLFSVFYRPR  500
            VGVRR MRQ  N+PSSVISSH+MHLGVLATA HA+NT T+F+V+Y+PR
Sbjct  268  VGVRRAMRQQANVPSSVISSHSMHLGVLATAWHAVNTGTMFTVYYKPR  315


 Score = 28.1 bits (61),  Expect(2) = 4e-15, Method: Composition-based stats.
 Identities = 14/35 (40%), Positives = 24/35 (69%), Gaps = 1/35 (3%)
 Frame = +1

Query  472  LFSLFFTGQGTSRSEFIVSVNKYIEAQNH*LSVGM  576
            +F++++  + TS SEFIV  ++Y+E+     SVGM
Sbjct  307  MFTVYYKPR-TSPSEFIVPFDQYVESIKSNHSVGM  340



>sp|A2ZET6.1|ARFW_ORYSI RecName: Full=Auxin response factor 23; AltName: Full=OsARF1 
[Oryza sativa Indica Group]
 gb|EAY81120.1| hypothetical protein OsI_36300 [Oryza sativa Indica Group]
Length=853

 Score = 80.9 bits (198),  Expect(2) = 4e-15, Method: Composition-based stats.
 Identities = 36/48 (75%), Positives = 43/48 (90%), Gaps = 0/48 (0%)
 Frame = +3

Query  357  VGVRRLMRQLNNMPSSVISSHTMHLGVLATASHAINTRTLFSVFYRPR  500
            VGVRR MRQ  N+PSSVISSH+MHLGVLATA HA+NT T+F+V+Y+PR
Sbjct  245  VGVRRAMRQQTNVPSSVISSHSMHLGVLATAWHAVNTGTMFTVYYKPR  292


 Score = 26.9 bits (58),  Expect(2) = 4e-15, Method: Composition-based stats.
 Identities = 11/35 (31%), Positives = 24/35 (69%), Gaps = 1/35 (3%)
 Frame = +1

Query  472  LFSLFFTGQGTSRSEFIVSVNKYIEAQNH*LSVGM  576
            +F++++  + TS +EF+V  ++Y+E+     S+GM
Sbjct  284  MFTVYYKPR-TSPAEFVVPYDRYMESLKRNYSIGM  317



>ref|XP_009404740.1| PREDICTED: auxin response factor 23-like isoform X2 [Musa acuminata 
subsp. malaccensis]
Length=879

 Score = 79.7 bits (195),  Expect(2) = 4e-15, Method: Composition-based stats.
 Identities = 36/48 (75%), Positives = 43/48 (90%), Gaps = 0/48 (0%)
 Frame = +3

Query  357  VGVRRLMRQLNNMPSSVISSHTMHLGVLATASHAINTRTLFSVFYRPR  500
            VGVRR MRQ  N+PSSVISSH+MHLGVLATA HA+NT T+F+V+Y+PR
Sbjct  268  VGVRRAMRQQANVPSSVISSHSMHLGVLATAWHAVNTGTMFTVYYKPR  315


 Score = 28.1 bits (61),  Expect(2) = 4e-15, Method: Composition-based stats.
 Identities = 14/35 (40%), Positives = 24/35 (69%), Gaps = 1/35 (3%)
 Frame = +1

Query  472  LFSLFFTGQGTSRSEFIVSVNKYIEAQNH*LSVGM  576
            +F++++  + TS SEFIV  ++Y+E+     SVGM
Sbjct  307  MFTVYYKPR-TSPSEFIVPFDQYVESIKSNHSVGM  340



>gb|AAG43286.2|AF140228_1 putative auxin response factor 1 [Oryza sativa Indica Group]
Length=857

 Score = 80.9 bits (198),  Expect(2) = 4e-15, Method: Composition-based stats.
 Identities = 36/48 (75%), Positives = 43/48 (90%), Gaps = 0/48 (0%)
 Frame = +3

Query  357  VGVRRLMRQLNNMPSSVISSHTMHLGVLATASHAINTRTLFSVFYRPR  500
            VGVRR MRQ  N+PSSVISSH+MHLGVLATA HA+NT T+F+V+Y+PR
Sbjct  244  VGVRRAMRQQTNVPSSVISSHSMHLGVLATAWHAVNTGTMFTVYYKPR  291


 Score = 26.9 bits (58),  Expect(2) = 4e-15, Method: Composition-based stats.
 Identities = 11/35 (31%), Positives = 24/35 (69%), Gaps = 1/35 (3%)
 Frame = +1

Query  472  LFSLFFTGQGTSRSEFIVSVNKYIEAQNH*LSVGM  576
            +F++++  + TS +EF+V  ++Y+E+     S+GM
Sbjct  283  MFTVYYKPR-TSPAEFVVPYDRYMESLKRNYSIGM  316



>ref|XP_006279989.1| hypothetical protein CARUB_v10025860mg [Capsella rubella]
 gb|EOA12887.1| hypothetical protein CARUB_v10025860mg [Capsella rubella]
Length=875

 Score = 79.0 bits (193),  Expect(2) = 4e-15, Method: Composition-based stats.
 Identities = 36/48 (75%), Positives = 43/48 (90%), Gaps = 0/48 (0%)
 Frame = +3

Query  357  VGVRRLMRQLNNMPSSVISSHTMHLGVLATASHAINTRTLFSVFYRPR  500
            VGVRR MRQ  N+PSSVISSH+MHLGVLATA HAI+T T+F+V+Y+PR
Sbjct  260  VGVRRAMRQQGNVPSSVISSHSMHLGVLATAWHAISTGTMFTVYYKPR  307


 Score = 28.9 bits (63),  Expect(2) = 4e-15, Method: Composition-based stats.
 Identities = 13/35 (37%), Positives = 25/35 (71%), Gaps = 1/35 (3%)
 Frame = +1

Query  472  LFSLFFTGQGTSRSEFIVSVNKYIEAQNH*LSVGM  576
            +F++++  + TS SEFIV  ++Y+E+  +  S+GM
Sbjct  299  MFTVYYKPR-TSPSEFIVPFDQYMESVKNNYSIGM  332



>emb|CDY00245.1| BnaA06g21460D [Brassica napus]
Length=851

 Score = 79.0 bits (193),  Expect(2) = 4e-15, Method: Composition-based stats.
 Identities = 36/48 (75%), Positives = 43/48 (90%), Gaps = 0/48 (0%)
 Frame = +3

Query  357  VGVRRLMRQLNNMPSSVISSHTMHLGVLATASHAINTRTLFSVFYRPR  500
            VGVRR MRQ  N+PSSVISSH+MHLGVLATA HAI+T T+F+V+Y+PR
Sbjct  256  VGVRRAMRQQGNVPSSVISSHSMHLGVLATAWHAISTGTMFTVYYKPR  303


 Score = 28.9 bits (63),  Expect(2) = 4e-15, Method: Composition-based stats.
 Identities = 13/35 (37%), Positives = 25/35 (71%), Gaps = 1/35 (3%)
 Frame = +1

Query  472  LFSLFFTGQGTSRSEFIVSVNKYIEAQNH*LSVGM  576
            +F++++  + TS SEFIV  ++Y+E+  +  S+GM
Sbjct  295  MFTVYYKPR-TSPSEFIVPFDQYMESVKNNYSIGM  328



>ref|XP_009151321.1| PREDICTED: auxin response factor 2 [Brassica rapa]
 gb|AFD01294.1| auxin response factor 2-2 [Brassica rapa subsp. pekinensis]
Length=851

 Score = 79.0 bits (193),  Expect(2) = 4e-15, Method: Composition-based stats.
 Identities = 36/48 (75%), Positives = 43/48 (90%), Gaps = 0/48 (0%)
 Frame = +3

Query  357  VGVRRLMRQLNNMPSSVISSHTMHLGVLATASHAINTRTLFSVFYRPR  500
            VGVRR MRQ  N+PSSVISSH+MHLGVLATA HAI+T T+F+V+Y+PR
Sbjct  256  VGVRRAMRQQGNVPSSVISSHSMHLGVLATAWHAISTGTMFTVYYKPR  303


 Score = 28.9 bits (63),  Expect(2) = 4e-15, Method: Composition-based stats.
 Identities = 13/35 (37%), Positives = 25/35 (71%), Gaps = 1/35 (3%)
 Frame = +1

Query  472  LFSLFFTGQGTSRSEFIVSVNKYIEAQNH*LSVGM  576
            +F++++  + TS SEFIV  ++Y+E+  +  S+GM
Sbjct  295  MFTVYYKPR-TSPSEFIVPFDQYMESVKNNYSIGM  328



>ref|XP_004252281.1| PREDICTED: auxin response factor 2-like [Solanum lycopersicum]
Length=828

 Score = 80.9 bits (198),  Expect(2) = 4e-15, Method: Composition-based stats.
 Identities = 37/48 (77%), Positives = 42/48 (88%), Gaps = 0/48 (0%)
 Frame = +3

Query  357  VGVRRLMRQLNNMPSSVISSHTMHLGVLATASHAINTRTLFSVFYRPR  500
            VGVRR MRQ  N PSSVISSH+MHLGVLATA HAI T+TLF+V+Y+PR
Sbjct  224  VGVRRAMRQQGNAPSSVISSHSMHLGVLATAWHAIQTKTLFTVYYKPR  271


 Score = 26.9 bits (58),  Expect(2) = 4e-15, Method: Composition-based stats.
 Identities = 12/35 (34%), Positives = 25/35 (71%), Gaps = 1/35 (3%)
 Frame = +1

Query  472  LFSLFFTGQGTSRSEFIVSVNKYIEAQNH*LSVGM  576
            LF++++  + TS ++FIV  ++Y+E+  +  S+GM
Sbjct  263  LFTVYYKPR-TSPADFIVPYDQYMESLKNNYSIGM  296



>ref|XP_002268849.1| PREDICTED: auxin response factor 2-like [Vitis vinifera]
 ref|XP_010656858.1| PREDICTED: auxin response factor 2-like [Vitis vinifera]
Length=769

 Score = 79.7 bits (195),  Expect(2) = 4e-15, Method: Composition-based stats.
 Identities = 36/48 (75%), Positives = 44/48 (92%), Gaps = 0/48 (0%)
 Frame = +3

Query  357  VGVRRLMRQLNNMPSSVISSHTMHLGVLATASHAINTRTLFSVFYRPR  500
            VGVRR MRQL+N PSSVISSH+MHLGVLATA HA++T T+F+V+Y+PR
Sbjct  212  VGVRRAMRQLSNGPSSVISSHSMHLGVLATAWHAVSTGTIFTVYYKPR  259


 Score = 28.1 bits (61),  Expect(2) = 4e-15, Method: Composition-based stats.
 Identities = 12/35 (34%), Positives = 25/35 (71%), Gaps = 1/35 (3%)
 Frame = +1

Query  472  LFSLFFTGQGTSRSEFIVSVNKYIEAQNH*LSVGM  576
            +F++++  + TS +EFI+  ++Y+EA  +  S+GM
Sbjct  251  IFTVYYKPR-TSPAEFIIPFDQYMEAVKNHYSIGM  284



>ref|XP_009625131.1| PREDICTED: auxin response factor 2-like isoform X1 [Nicotiana 
tomentosiformis]
Length=851

 Score = 80.1 bits (196),  Expect(2) = 4e-15, Method: Composition-based stats.
 Identities = 36/48 (75%), Positives = 42/48 (88%), Gaps = 0/48 (0%)
 Frame = +3

Query  357  VGVRRLMRQLNNMPSSVISSHTMHLGVLATASHAINTRTLFSVFYRPR  500
            VGVRR MRQ  N PSSVISSH+MHLGVLATA HAI T+T+F+V+Y+PR
Sbjct  242  VGVRRAMRQQGNAPSSVISSHSMHLGVLATAWHAIQTKTMFTVYYKPR  289


 Score = 27.3 bits (59),  Expect(2) = 4e-15, Method: Composition-based stats.
 Identities = 12/35 (34%), Positives = 25/35 (71%), Gaps = 1/35 (3%)
 Frame = +1

Query  472  LFSLFFTGQGTSRSEFIVSVNKYIEAQNH*LSVGM  576
            +F++++  + TS +EFIV  ++Y+E+  +  S+GM
Sbjct  281  MFTVYYKPR-TSPTEFIVPYDQYMESVKNNYSIGM  314



>ref|XP_011083049.1| PREDICTED: auxin response factor 2 [Sesamum indicum]
Length=839

 Score = 80.5 bits (197),  Expect(2) = 4e-15, Method: Composition-based stats.
 Identities = 36/48 (75%), Positives = 43/48 (90%), Gaps = 0/48 (0%)
 Frame = +3

Query  357  VGVRRLMRQLNNMPSSVISSHTMHLGVLATASHAINTRTLFSVFYRPR  500
            VGVRR MRQ +N PSSVISSH+MHLGVLATA HAI T+T+F+V+Y+PR
Sbjct  239  VGVRRAMRQQSNAPSSVISSHSMHLGVLATAWHAIQTKTMFTVYYKPR  286


 Score = 27.3 bits (59),  Expect(2) = 4e-15, Method: Composition-based stats.
 Identities = 12/35 (34%), Positives = 25/35 (71%), Gaps = 1/35 (3%)
 Frame = +1

Query  472  LFSLFFTGQGTSRSEFIVSVNKYIEAQNH*LSVGM  576
            +F++++  + TS +EFIV  ++Y+E+  +  S+GM
Sbjct  278  MFTVYYKPR-TSPAEFIVPYDQYMESVKNNYSIGM  311



>ref|XP_009769542.1| PREDICTED: auxin response factor 2-like isoform X1 [Nicotiana 
sylvestris]
Length=851

 Score = 80.1 bits (196),  Expect(2) = 4e-15, Method: Composition-based stats.
 Identities = 36/48 (75%), Positives = 42/48 (88%), Gaps = 0/48 (0%)
 Frame = +3

Query  357  VGVRRLMRQLNNMPSSVISSHTMHLGVLATASHAINTRTLFSVFYRPR  500
            VGVRR MRQ  N PSSVISSH+MHLGVLATA HAI T+T+F+V+Y+PR
Sbjct  242  VGVRRAMRQQGNAPSSVISSHSMHLGVLATAWHAIQTKTMFTVYYKPR  289


 Score = 27.3 bits (59),  Expect(2) = 4e-15, Method: Composition-based stats.
 Identities = 12/35 (34%), Positives = 25/35 (71%), Gaps = 1/35 (3%)
 Frame = +1

Query  472  LFSLFFTGQGTSRSEFIVSVNKYIEAQNH*LSVGM  576
            +F++++  + TS +EFIV  ++Y+E+  +  S+GM
Sbjct  281  MFTVYYKPR-TSPAEFIVPYDQYMESVKNNYSIGM  314



>ref|XP_003520877.1| PREDICTED: auxin response factor 9-like isoform X1 [Glycine max]
Length=662

 Score = 72.8 bits (177),  Expect(2) = 5e-15, Method: Composition-based stats.
 Identities = 34/48 (71%), Positives = 40/48 (83%), Gaps = 0/48 (0%)
 Frame = +3

Query  357  VGVRRLMRQLNNMPSSVISSHTMHLGVLATASHAINTRTLFSVFYRPR  500
            VGVRR+ RQ + MPSSVISS +MHLGVLATASHA  T T+F V+Y+PR
Sbjct  210  VGVRRVARQQSPMPSSVISSQSMHLGVLATASHAFLTSTMFVVYYKPR  257


 Score = 35.0 bits (79),  Expect(2) = 5e-15, Method: Composition-based stats.
 Identities = 14/22 (64%), Positives = 19/22 (86%), Gaps = 0/22 (0%)
 Frame = +1

Query  511  SEFIVSVNKYIEAQNH*LSVGM  576
            S+FI+ VNKY+EA+N+  SVGM
Sbjct  259  SQFIIGVNKYLEAENNKFSVGM  280



>ref|XP_010237689.1| PREDICTED: auxin response factor 23-like isoform X1 [Brachypodium 
distachyon]
 ref|XP_010237690.1| PREDICTED: auxin response factor 23-like isoform X1 [Brachypodium 
distachyon]
 ref|XP_010237691.1| PREDICTED: auxin response factor 23-like isoform X1 [Brachypodium 
distachyon]
Length=851

 Score = 80.9 bits (198),  Expect(2) = 5e-15, Method: Composition-based stats.
 Identities = 36/48 (75%), Positives = 43/48 (90%), Gaps = 0/48 (0%)
 Frame = +3

Query  357  VGVRRLMRQLNNMPSSVISSHTMHLGVLATASHAINTRTLFSVFYRPR  500
            VGVRR MRQ  N+PSSVISSH+MHLGVLATA HA+NT T+F+V+Y+PR
Sbjct  242  VGVRRAMRQQTNVPSSVISSHSMHLGVLATAWHAVNTGTMFTVYYKPR  289


 Score = 26.9 bits (58),  Expect(2) = 5e-15, Method: Composition-based stats.
 Identities = 11/35 (31%), Positives = 24/35 (69%), Gaps = 1/35 (3%)
 Frame = +1

Query  472  LFSLFFTGQGTSRSEFIVSVNKYIEAQNH*LSVGM  576
            +F++++  + TS +EF+V  ++Y+E+     S+GM
Sbjct  281  MFTVYYKPR-TSPAEFVVPYDRYMESLKRNYSIGM  314



>ref|XP_010237692.1| PREDICTED: auxin response factor 23-like isoform X2 [Brachypodium 
distachyon]
Length=850

 Score = 80.9 bits (198),  Expect(2) = 5e-15, Method: Composition-based stats.
 Identities = 36/48 (75%), Positives = 43/48 (90%), Gaps = 0/48 (0%)
 Frame = +3

Query  357  VGVRRLMRQLNNMPSSVISSHTMHLGVLATASHAINTRTLFSVFYRPR  500
            VGVRR MRQ  N+PSSVISSH+MHLGVLATA HA+NT T+F+V+Y+PR
Sbjct  241  VGVRRAMRQQTNVPSSVISSHSMHLGVLATAWHAVNTGTMFTVYYKPR  288


 Score = 26.9 bits (58),  Expect(2) = 5e-15, Method: Composition-based stats.
 Identities = 11/35 (31%), Positives = 24/35 (69%), Gaps = 1/35 (3%)
 Frame = +1

Query  472  LFSLFFTGQGTSRSEFIVSVNKYIEAQNH*LSVGM  576
            +F++++  + TS +EF+V  ++Y+E+     S+GM
Sbjct  280  MFTVYYKPR-TSPAEFVVPYDRYMESLKRNYSIGM  313



>gb|KHN16426.1| Auxin response factor 18 [Glycine soja]
Length=662

 Score = 72.8 bits (177),  Expect(2) = 5e-15, Method: Composition-based stats.
 Identities = 34/48 (71%), Positives = 40/48 (83%), Gaps = 0/48 (0%)
 Frame = +3

Query  357  VGVRRLMRQLNNMPSSVISSHTMHLGVLATASHAINTRTLFSVFYRPR  500
            VGVRR+ RQ + MPSSVISS +MHLGVLATASHA  T T+F V+Y+PR
Sbjct  210  VGVRRVARQQSPMPSSVISSQSMHLGVLATASHAFLTSTMFVVYYKPR  257


 Score = 35.0 bits (79),  Expect(2) = 5e-15, Method: Composition-based stats.
 Identities = 14/22 (64%), Positives = 19/22 (86%), Gaps = 0/22 (0%)
 Frame = +1

Query  511  SEFIVSVNKYIEAQNH*LSVGM  576
            S+FI+ VNKY+EA+N+  SVGM
Sbjct  259  SQFIIGVNKYLEAENNKFSVGM  280



>ref|XP_010100721.1| Auxin response factor 18 [Morus notabilis]
 gb|EXB83883.1| Auxin response factor 18 [Morus notabilis]
Length=695

 Score = 74.7 bits (182),  Expect(2) = 5e-15, Method: Composition-based stats.
 Identities = 35/48 (73%), Positives = 42/48 (88%), Gaps = 0/48 (0%)
 Frame = +3

Query  357  VGVRRLMRQLNNMPSSVISSHTMHLGVLATASHAINTRTLFSVFYRPR  500
            VGVRR  RQ + MPSSVISSH+MHLGVLATA+HAI T+T+F V+Y+PR
Sbjct  225  VGVRRSARQQSLMPSSVISSHSMHLGVLATAAHAITTQTIFIVYYKPR  272


 Score = 32.7 bits (73),  Expect(2) = 5e-15, Method: Composition-based stats.
 Identities = 14/24 (58%), Positives = 18/24 (75%), Gaps = 0/24 (0%)
 Frame = +1

Query  505  SRSEFIVSVNKYIEAQNH*LSVGM  576
            +  +F+V VNKYIEA +H  SVGM
Sbjct  273  TNHQFLVGVNKYIEAVSHNFSVGM  296



>gb|KHG08457.1| Auxin response factor 2 -like protein [Gossypium arboreum]
Length=869

 Score = 78.2 bits (191),  Expect(2) = 5e-15, Method: Composition-based stats.
 Identities = 35/48 (73%), Positives = 42/48 (88%), Gaps = 0/48 (0%)
 Frame = +3

Query  357  VGVRRLMRQLNNMPSSVISSHTMHLGVLATASHAINTRTLFSVFYRPR  500
            VGVRR +RQ  N+PSSVISSH+MHLGVLATA HA  TRT+F+V+Y+PR
Sbjct  259  VGVRRALRQQGNVPSSVISSHSMHLGVLATAWHAYTTRTIFTVYYKPR  306


 Score = 29.3 bits (64),  Expect(2) = 5e-15, Method: Composition-based stats.
 Identities = 13/35 (37%), Positives = 25/35 (71%), Gaps = 1/35 (3%)
 Frame = +1

Query  472  LFSLFFTGQGTSRSEFIVSVNKYIEAQNH*LSVGM  576
            +F++++  + TS +EFIV  N+Y+E+  +  S+GM
Sbjct  298  IFTVYYKPR-TSPAEFIVPFNQYMESVKNNYSIGM  331



>ref|XP_006394444.1| hypothetical protein EUTSA_v10003641mg [Eutrema salsugineum]
 gb|ESQ31730.1| hypothetical protein EUTSA_v10003641mg [Eutrema salsugineum]
Length=854

 Score = 78.6 bits (192),  Expect(2) = 5e-15, Method: Composition-based stats.
 Identities = 36/48 (75%), Positives = 43/48 (90%), Gaps = 0/48 (0%)
 Frame = +3

Query  357  VGVRRLMRQLNNMPSSVISSHTMHLGVLATASHAINTRTLFSVFYRPR  500
            VGVRR MRQ  N+PSSVISSH+MHLGVLATA HAI+T T+F+V+Y+PR
Sbjct  260  VGVRRAMRQQGNVPSSVISSHSMHLGVLATAWHAISTGTMFTVYYKPR  307


 Score = 28.9 bits (63),  Expect(2) = 5e-15, Method: Composition-based stats.
 Identities = 13/35 (37%), Positives = 25/35 (71%), Gaps = 1/35 (3%)
 Frame = +1

Query  472  LFSLFFTGQGTSRSEFIVSVNKYIEAQNH*LSVGM  576
            +F++++  + TS SEFIV  ++Y+E+  +  S+GM
Sbjct  299  MFTVYYKPR-TSPSEFIVPFDQYMESVKNNYSIGM  332



>ref|XP_009410807.1| PREDICTED: auxin response factor 18-like isoform X1 [Musa acuminata 
subsp. malaccensis]
Length=666

 Score = 77.4 bits (189),  Expect(2) = 5e-15, Method: Composition-based stats.
 Identities = 34/48 (71%), Positives = 42/48 (88%), Gaps = 0/48 (0%)
 Frame = +3

Query  357  VGVRRLMRQLNNMPSSVISSHTMHLGVLATASHAINTRTLFSVFYRPR  500
            VGVRRL R  N +P+SVISSH+MH+G+LATASHAI+T TLF V+Y+PR
Sbjct  209  VGVRRLARCQNTLPTSVISSHSMHVGLLATASHAISTHTLFMVYYKPR  256


 Score = 29.6 bits (65),  Expect(2) = 5e-15, Method: Composition-based stats.
 Identities = 12/22 (55%), Positives = 18/22 (82%), Gaps = 0/22 (0%)
 Frame = +1

Query  511  SEFIVSVNKYIEAQNH*LSVGM  576
            ++FIVS+NKY+EA  +  +VGM
Sbjct  258  NQFIVSLNKYLEATKNEFAVGM  279



>ref|XP_002864764.1| hypothetical protein ARALYDRAFT_919450 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH41023.1| hypothetical protein ARALYDRAFT_919450 [Arabidopsis lyrata subsp. 
lyrata]
Length=858

 Score = 78.6 bits (192),  Expect(2) = 5e-15, Method: Composition-based stats.
 Identities = 36/48 (75%), Positives = 43/48 (90%), Gaps = 0/48 (0%)
 Frame = +3

Query  357  VGVRRLMRQLNNMPSSVISSHTMHLGVLATASHAINTRTLFSVFYRPR  500
            VGVRR MRQ  N+PSSVISSH+MHLGVLATA HAI+T T+F+V+Y+PR
Sbjct  256  VGVRRAMRQQGNVPSSVISSHSMHLGVLATAWHAISTGTMFTVYYKPR  303


 Score = 28.9 bits (63),  Expect(2) = 5e-15, Method: Composition-based stats.
 Identities = 13/35 (37%), Positives = 25/35 (71%), Gaps = 1/35 (3%)
 Frame = +1

Query  472  LFSLFFTGQGTSRSEFIVSVNKYIEAQNH*LSVGM  576
            +F++++  + TS SEFIV  ++Y+E+  +  S+GM
Sbjct  295  MFTVYYKPR-TSPSEFIVPFDQYMESVKNNYSIGM  328



>gb|KJB40059.1| hypothetical protein B456_007G044900 [Gossypium raimondii]
Length=862

 Score = 78.2 bits (191),  Expect(2) = 5e-15, Method: Composition-based stats.
 Identities = 35/48 (73%), Positives = 42/48 (88%), Gaps = 0/48 (0%)
 Frame = +3

Query  357  VGVRRLMRQLNNMPSSVISSHTMHLGVLATASHAINTRTLFSVFYRPR  500
            VGVRR +RQ  N+PSSVISSH+MHLGVLATA HA  TRT+F+V+Y+PR
Sbjct  259  VGVRRALRQQGNVPSSVISSHSMHLGVLATAWHAYTTRTIFTVYYKPR  306


 Score = 29.3 bits (64),  Expect(2) = 5e-15, Method: Composition-based stats.
 Identities = 13/35 (37%), Positives = 25/35 (71%), Gaps = 1/35 (3%)
 Frame = +1

Query  472  LFSLFFTGQGTSRSEFIVSVNKYIEAQNH*LSVGM  576
            +F++++  + TS +EFIV  N+Y+E+  +  S+GM
Sbjct  298  IFTVYYKPR-TSPAEFIVPFNQYMESVKNNYSIGM  331



>dbj|BAJ34183.1| unnamed protein product [Thellungiella halophila]
Length=854

 Score = 78.6 bits (192),  Expect(2) = 5e-15, Method: Composition-based stats.
 Identities = 36/48 (75%), Positives = 43/48 (90%), Gaps = 0/48 (0%)
 Frame = +3

Query  357  VGVRRLMRQLNNMPSSVISSHTMHLGVLATASHAINTRTLFSVFYRPR  500
            VGVRR MRQ  N+PSSVISSH+MHLGVLATA HAI+T T+F+V+Y+PR
Sbjct  260  VGVRRAMRQQGNVPSSVISSHSMHLGVLATAWHAISTGTMFTVYYKPR  307


 Score = 28.9 bits (63),  Expect(2) = 5e-15, Method: Composition-based stats.
 Identities = 13/35 (37%), Positives = 25/35 (71%), Gaps = 1/35 (3%)
 Frame = +1

Query  472  LFSLFFTGQGTSRSEFIVSVNKYIEAQNH*LSVGM  576
            +F++++  + TS SEFIV  ++Y+E+  +  S+GM
Sbjct  299  MFTVYYKPR-TSPSEFIVPFDQYMESVKNNYSIGM  332



>ref|XP_010324457.1| PREDICTED: auxin response factor 12 isoform X2 [Solanum lycopersicum]
Length=683

 Score = 75.5 bits (184),  Expect(2) = 5e-15, Method: Composition-based stats.
 Identities = 32/48 (67%), Positives = 42/48 (88%), Gaps = 0/48 (0%)
 Frame = +3

Query  357  VGVRRLMRQLNNMPSSVISSHTMHLGVLATASHAINTRTLFSVFYRPR  500
            +G+RRL RQ ++MP SVISS +MHLGVLATASHA+ T+T+F V+Y+PR
Sbjct  227  IGIRRLARQPSSMPQSVISSQSMHLGVLATASHAVTTQTMFVVYYKPR  274


 Score = 32.0 bits (71),  Expect(2) = 5e-15, Method: Composition-based stats.
 Identities = 13/22 (59%), Positives = 17/22 (77%), Gaps = 0/22 (0%)
 Frame = +1

Query  511  SEFIVSVNKYIEAQNH*LSVGM  576
            S+FI+ +NKY+EA  H  SVGM
Sbjct  276  SQFIIGLNKYLEAVKHRYSVGM  297



>ref|NP_001190591.1| auxin response factor 2 [Arabidopsis thaliana]
 gb|AED97551.1| auxin response factor 2 [Arabidopsis thaliana]
Length=853

 Score = 78.6 bits (192),  Expect(2) = 5e-15, Method: Composition-based stats.
 Identities = 36/48 (75%), Positives = 43/48 (90%), Gaps = 0/48 (0%)
 Frame = +3

Query  357  VGVRRLMRQLNNMPSSVISSHTMHLGVLATASHAINTRTLFSVFYRPR  500
            VGVRR MRQ  N+PSSVISSH+MHLGVLATA HAI+T T+F+V+Y+PR
Sbjct  260  VGVRRAMRQQGNVPSSVISSHSMHLGVLATAWHAISTGTMFTVYYKPR  307


 Score = 28.9 bits (63),  Expect(2) = 5e-15, Method: Composition-based stats.
 Identities = 13/35 (37%), Positives = 25/35 (71%), Gaps = 1/35 (3%)
 Frame = +1

Query  472  LFSLFFTGQGTSRSEFIVSVNKYIEAQNH*LSVGM  576
            +F++++  + TS SEFIV  ++Y+E+  +  S+GM
Sbjct  299  MFTVYYKPR-TSPSEFIVPFDQYMESVKNNYSIGM  332



>dbj|BAD93968.1| ARF1-binding protein [Arabidopsis thaliana]
Length=859

 Score = 78.6 bits (192),  Expect(2) = 5e-15, Method: Composition-based stats.
 Identities = 36/48 (75%), Positives = 43/48 (90%), Gaps = 0/48 (0%)
 Frame = +3

Query  357  VGVRRLMRQLNNMPSSVISSHTMHLGVLATASHAINTRTLFSVFYRPR  500
            VGVRR MRQ  N+PSSVISSH+MHLGVLATA HAI+T T+F+V+Y+PR
Sbjct  260  VGVRRAMRQQGNVPSSVISSHSMHLGVLATAWHAISTGTMFTVYYKPR  307


 Score = 28.9 bits (63),  Expect(2) = 5e-15, Method: Composition-based stats.
 Identities = 13/35 (37%), Positives = 25/35 (71%), Gaps = 1/35 (3%)
 Frame = +1

Query  472  LFSLFFTGQGTSRSEFIVSVNKYIEAQNH*LSVGM  576
            +F++++  + TS SEFIV  ++Y+E+  +  S+GM
Sbjct  299  MFTVYYKPR-TSPSEFIVPFDQYMESVKNNYSIGM  332



>ref|XP_010483894.1| PREDICTED: auxin response factor 2 [Camelina sativa]
Length=856

 Score = 78.6 bits (192),  Expect(2) = 5e-15, Method: Composition-based stats.
 Identities = 36/48 (75%), Positives = 43/48 (90%), Gaps = 0/48 (0%)
 Frame = +3

Query  357  VGVRRLMRQLNNMPSSVISSHTMHLGVLATASHAINTRTLFSVFYRPR  500
            VGVRR MRQ  N+PSSVISSH+MHLGVLATA HAI+T T+F+V+Y+PR
Sbjct  257  VGVRRAMRQQGNVPSSVISSHSMHLGVLATAWHAISTGTMFTVYYKPR  304


 Score = 28.9 bits (63),  Expect(2) = 5e-15, Method: Composition-based stats.
 Identities = 13/35 (37%), Positives = 25/35 (71%), Gaps = 1/35 (3%)
 Frame = +1

Query  472  LFSLFFTGQGTSRSEFIVSVNKYIEAQNH*LSVGM  576
            +F++++  + TS SEFIV  ++Y+E+  +  S+GM
Sbjct  296  MFTVYYKPR-TSPSEFIVPFDQYMESVKNNYSIGM  329



>emb|CBI35669.3| unnamed protein product [Vitis vinifera]
Length=767

 Score = 79.3 bits (194),  Expect(2) = 5e-15, Method: Composition-based stats.
 Identities = 36/48 (75%), Positives = 44/48 (92%), Gaps = 0/48 (0%)
 Frame = +3

Query  357  VGVRRLMRQLNNMPSSVISSHTMHLGVLATASHAINTRTLFSVFYRPR  500
            VGVRR MRQL+N PSSVISSH+MHLGVLATA HA++T T+F+V+Y+PR
Sbjct  212  VGVRRAMRQLSNGPSSVISSHSMHLGVLATAWHAVSTGTIFTVYYKPR  259


 Score = 28.1 bits (61),  Expect(2) = 5e-15, Method: Composition-based stats.
 Identities = 12/35 (34%), Positives = 25/35 (71%), Gaps = 1/35 (3%)
 Frame = +1

Query  472  LFSLFFTGQGTSRSEFIVSVNKYIEAQNH*LSVGM  576
            +F++++  + TS +EFI+  ++Y+EA  +  S+GM
Sbjct  251  IFTVYYKPR-TSPAEFIIPFDQYMEAVKNHYSIGM  284



>ref|NP_851244.1| auxin response factor 2 [Arabidopsis thaliana]
 ref|NP_201006.2| auxin response factor 2 [Arabidopsis thaliana]
 ref|NP_974980.1| auxin response factor 2 [Arabidopsis thaliana]
 sp|Q94JM3.2|ARFB_ARATH RecName: Full=Auxin response factor 2; AltName: Full=ARF1-binding 
protein; Short=ARF1-BP; AltName: Full=Protein MEGAINTEGUMENTA 
[Arabidopsis thaliana]
 dbj|BAB10162.1| auxin response factor-like protein [Arabidopsis thaliana]
 gb|AAN31923.1| auxin response factor [Arabidopsis thaliana]
 gb|AAT67071.1| ARF2 [Arabidopsis thaliana]
 dbj|BAD93985.1| ARF1-binding protein [Arabidopsis thaliana]
 dbj|BAD94058.1| ARF1-binding protein [Arabidopsis thaliana]
 gb|AED97548.1| auxin response factor 2 [Arabidopsis thaliana]
 gb|AED97549.1| auxin response factor 2 [Arabidopsis thaliana]
 gb|AED97550.1| auxin response factor 2 [Arabidopsis thaliana]
Length=859

 Score = 78.6 bits (192),  Expect(2) = 6e-15, Method: Composition-based stats.
 Identities = 36/48 (75%), Positives = 43/48 (90%), Gaps = 0/48 (0%)
 Frame = +3

Query  357  VGVRRLMRQLNNMPSSVISSHTMHLGVLATASHAINTRTLFSVFYRPR  500
            VGVRR MRQ  N+PSSVISSH+MHLGVLATA HAI+T T+F+V+Y+PR
Sbjct  260  VGVRRAMRQQGNVPSSVISSHSMHLGVLATAWHAISTGTMFTVYYKPR  307


 Score = 28.9 bits (63),  Expect(2) = 6e-15, Method: Composition-based stats.
 Identities = 13/35 (37%), Positives = 25/35 (71%), Gaps = 1/35 (3%)
 Frame = +1

Query  472  LFSLFFTGQGTSRSEFIVSVNKYIEAQNH*LSVGM  576
            +F++++  + TS SEFIV  ++Y+E+  +  S+GM
Sbjct  299  MFTVYYKPR-TSPSEFIVPFDQYMESVKNNYSIGM  332



>dbj|BAD93891.1| ARF1-binding protein [Arabidopsis thaliana]
 dbj|BAD93897.1| ARF1-binding protein [Arabidopsis thaliana]
 dbj|BAD93959.1| ARF1-binding protein [Arabidopsis thaliana]
Length=859

 Score = 78.6 bits (192),  Expect(2) = 6e-15, Method: Composition-based stats.
 Identities = 36/48 (75%), Positives = 43/48 (90%), Gaps = 0/48 (0%)
 Frame = +3

Query  357  VGVRRLMRQLNNMPSSVISSHTMHLGVLATASHAINTRTLFSVFYRPR  500
            VGVRR MRQ  N+PSSVISSH+MHLGVLATA HAI+T T+F+V+Y+PR
Sbjct  260  VGVRRAMRQQGNVPSSVISSHSMHLGVLATAWHAISTGTMFTVYYKPR  307


 Score = 28.9 bits (63),  Expect(2) = 6e-15, Method: Composition-based stats.
 Identities = 13/35 (37%), Positives = 25/35 (71%), Gaps = 1/35 (3%)
 Frame = +1

Query  472  LFSLFFTGQGTSRSEFIVSVNKYIEAQNH*LSVGM  576
            +F++++  + TS SEFIV  ++Y+E+  +  S+GM
Sbjct  299  MFTVYYKPR-TSPSEFIVPFDQYMESVKNNYSIGM  332



>ref|XP_002322300.1| auxin response factor 2 family protein [Populus trichocarpa]
 gb|EEF06427.1| auxin response factor 2 family protein [Populus trichocarpa]
Length=852

 Score = 79.0 bits (193),  Expect(2) = 6e-15, Method: Composition-based stats.
 Identities = 36/48 (75%), Positives = 43/48 (90%), Gaps = 0/48 (0%)
 Frame = +3

Query  357  VGVRRLMRQLNNMPSSVISSHTMHLGVLATASHAINTRTLFSVFYRPR  500
            VGVRR MRQ  N+PSSVISSH+MHLGVLATA HA++T TLF+V+Y+PR
Sbjct  254  VGVRRAMRQQGNVPSSVISSHSMHLGVLATAWHAVSTGTLFTVYYKPR  301


 Score = 28.1 bits (61),  Expect(2) = 6e-15, Method: Composition-based stats.
 Identities = 13/35 (37%), Positives = 25/35 (71%), Gaps = 1/35 (3%)
 Frame = +1

Query  472  LFSLFFTGQGTSRSEFIVSVNKYIEAQNH*LSVGM  576
            LF++++  + TS +EFIV  ++Y+E+  +  S+GM
Sbjct  293  LFTVYYKPR-TSPAEFIVPFDQYMESVKNNYSIGM  326



>ref|XP_010458051.1| PREDICTED: auxin response factor 2-like isoform X2 [Camelina 
sativa]
Length=852

 Score = 78.6 bits (192),  Expect(2) = 6e-15, Method: Composition-based stats.
 Identities = 36/48 (75%), Positives = 43/48 (90%), Gaps = 0/48 (0%)
 Frame = +3

Query  357  VGVRRLMRQLNNMPSSVISSHTMHLGVLATASHAINTRTLFSVFYRPR  500
            VGVRR MRQ  N+PSSVISSH+MHLGVLATA HAI+T T+F+V+Y+PR
Sbjct  258  VGVRRAMRQQGNVPSSVISSHSMHLGVLATAWHAISTGTMFTVYYKPR  305


 Score = 28.9 bits (63),  Expect(2) = 6e-15, Method: Composition-based stats.
 Identities = 13/35 (37%), Positives = 25/35 (71%), Gaps = 1/35 (3%)
 Frame = +1

Query  472  LFSLFFTGQGTSRSEFIVSVNKYIEAQNH*LSVGM  576
            +F++++  + TS SEFIV  ++Y+E+  +  S+GM
Sbjct  297  MFTVYYKPR-TSPSEFIVPFDQYMESVKNNYSIGM  330



>ref|XP_010324454.1| PREDICTED: auxin response factor 12 isoform X1 [Solanum lycopersicum]
 ref|XP_010324455.1| PREDICTED: auxin response factor 12 isoform X1 [Solanum lycopersicum]
 ref|XP_010324456.1| PREDICTED: auxin response factor 12 isoform X1 [Solanum lycopersicum]
Length=685

 Score = 75.5 bits (184),  Expect(2) = 6e-15, Method: Composition-based stats.
 Identities = 32/48 (67%), Positives = 42/48 (88%), Gaps = 0/48 (0%)
 Frame = +3

Query  357  VGVRRLMRQLNNMPSSVISSHTMHLGVLATASHAINTRTLFSVFYRPR  500
            +G+RRL RQ ++MP SVISS +MHLGVLATASHA+ T+T+F V+Y+PR
Sbjct  229  IGIRRLARQPSSMPQSVISSQSMHLGVLATASHAVTTQTMFVVYYKPR  276


 Score = 32.0 bits (71),  Expect(2) = 6e-15, Method: Composition-based stats.
 Identities = 13/22 (59%), Positives = 17/22 (77%), Gaps = 0/22 (0%)
 Frame = +1

Query  511  SEFIVSVNKYIEAQNH*LSVGM  576
            S+FI+ +NKY+EA  H  SVGM
Sbjct  278  SQFIIGLNKYLEAVKHRYSVGM  299



>gb|KFK37437.1| auxin response factor 11 [Arabis alpina]
Length=581

 Score = 77.0 bits (188),  Expect(2) = 6e-15, Method: Composition-based stats.
 Identities = 35/48 (73%), Positives = 42/48 (88%), Gaps = 0/48 (0%)
 Frame = +3

Query  357  VGVRRLMRQLNNMPSSVISSHTMHLGVLATASHAINTRTLFSVFYRPR  500
            VGVRRL +Q + MP+SVISS +MHLGVLATASHA+ T+TLF VFY+PR
Sbjct  217  VGVRRLAKQQSTMPASVISSQSMHLGVLATASHAVTTKTLFVVFYKPR  264


 Score = 30.4 bits (67),  Expect(2) = 6e-15, Method: Composition-based stats.
 Identities = 15/35 (43%), Positives = 23/35 (66%), Gaps = 3/35 (9%)
 Frame = +1

Query  472  LFSLFFTGQGTSRSEFIVSVNKYIEAQNH*LSVGM  576
            LF +F+  +    S+FI+SVNKY+ A  +  S+GM
Sbjct  256  LFVVFYKPR---ISQFIISVNKYMAAMKNGFSIGM  287



>ref|XP_010458034.1| PREDICTED: auxin response factor 2-like isoform X1 [Camelina 
sativa]
 ref|XP_010458044.1| PREDICTED: auxin response factor 2-like isoform X1 [Camelina 
sativa]
Length=859

 Score = 78.6 bits (192),  Expect(2) = 6e-15, Method: Composition-based stats.
 Identities = 36/48 (75%), Positives = 43/48 (90%), Gaps = 0/48 (0%)
 Frame = +3

Query  357  VGVRRLMRQLNNMPSSVISSHTMHLGVLATASHAINTRTLFSVFYRPR  500
            VGVRR MRQ  N+PSSVISSH+MHLGVLATA HAI+T T+F+V+Y+PR
Sbjct  258  VGVRRAMRQQGNVPSSVISSHSMHLGVLATAWHAISTGTMFTVYYKPR  305


 Score = 28.9 bits (63),  Expect(2) = 6e-15, Method: Composition-based stats.
 Identities = 13/35 (37%), Positives = 25/35 (71%), Gaps = 1/35 (3%)
 Frame = +1

Query  472  LFSLFFTGQGTSRSEFIVSVNKYIEAQNH*LSVGM  576
            +F++++  + TS SEFIV  ++Y+E+  +  S+GM
Sbjct  297  MFTVYYKPR-TSPSEFIVPFDQYMESVKNNYSIGM  330



>ref|XP_006436945.1| hypothetical protein CICLE_v10030696mg [Citrus clementina]
 gb|ESR50185.1| hypothetical protein CICLE_v10030696mg [Citrus clementina]
Length=846

 Score = 78.6 bits (192),  Expect(2) = 6e-15, Method: Composition-based stats.
 Identities = 35/48 (73%), Positives = 43/48 (90%), Gaps = 0/48 (0%)
 Frame = +3

Query  357  VGVRRLMRQLNNMPSSVISSHTMHLGVLATASHAINTRTLFSVFYRPR  500
            VGVRR MRQ  N+PSSVISSH+MHLGVLATA HA++T T+F+V+Y+PR
Sbjct  247  VGVRRAMRQQGNVPSSVISSHSMHLGVLATAWHAVSTGTMFTVYYKPR  294


 Score = 28.5 bits (62),  Expect(2) = 6e-15, Method: Composition-based stats.
 Identities = 13/35 (37%), Positives = 25/35 (71%), Gaps = 1/35 (3%)
 Frame = +1

Query  472  LFSLFFTGQGTSRSEFIVSVNKYIEAQNH*LSVGM  576
            +F++++  + TS SEFIV  ++Y+E+  +  S+GM
Sbjct  286  MFTVYYKPR-TSPSEFIVPYDQYMESIKNNYSIGM  319



>emb|CDX86939.1| BnaC03g52090D [Brassica napus]
Length=850

 Score = 79.0 bits (193),  Expect(2) = 7e-15, Method: Composition-based stats.
 Identities = 36/48 (75%), Positives = 43/48 (90%), Gaps = 0/48 (0%)
 Frame = +3

Query  357  VGVRRLMRQLNNMPSSVISSHTMHLGVLATASHAINTRTLFSVFYRPR  500
            VGVRR MRQ  N+PSSVISSH+MHLGVLATA HAI+T T+F+V+Y+PR
Sbjct  255  VGVRRAMRQQGNVPSSVISSHSMHLGVLATAWHAISTGTMFTVYYKPR  302


 Score = 28.1 bits (61),  Expect(2) = 7e-15, Method: Composition-based stats.
 Identities = 13/35 (37%), Positives = 24/35 (69%), Gaps = 1/35 (3%)
 Frame = +1

Query  472  LFSLFFTGQGTSRSEFIVSVNKYIEAQNH*LSVGM  576
            +F++++  + TS SEFIV  ++Y E+  +  S+GM
Sbjct  294  MFTVYYKPR-TSPSEFIVPFDQYTESVKNNYSIGM  327



>ref|NP_001275789.1| auxin-response factor [Citrus sinensis]
 gb|AEV43357.1| auxin-response factor [Citrus sinensis]
Length=846

 Score = 78.6 bits (192),  Expect(2) = 7e-15, Method: Composition-based stats.
 Identities = 35/48 (73%), Positives = 43/48 (90%), Gaps = 0/48 (0%)
 Frame = +3

Query  357  VGVRRLMRQLNNMPSSVISSHTMHLGVLATASHAINTRTLFSVFYRPR  500
            VGVRR MRQ  N+PSSVISSH+MHLGVLATA HA++T T+F+V+Y+PR
Sbjct  247  VGVRRAMRQQGNVPSSVISSHSMHLGVLATAWHAVSTGTMFTVYYKPR  294


 Score = 28.5 bits (62),  Expect(2) = 7e-15, Method: Composition-based stats.
 Identities = 13/35 (37%), Positives = 25/35 (71%), Gaps = 1/35 (3%)
 Frame = +1

Query  472  LFSLFFTGQGTSRSEFIVSVNKYIEAQNH*LSVGM  576
            +F++++  + TS SEFIV  ++Y+E+  +  S+GM
Sbjct  286  MFTVYYKPR-TSPSEFIVPYDQYMESIKNNYSIGM  319



>ref|XP_009130187.1| PREDICTED: auxin response factor 2-like [Brassica rapa]
Length=853

 Score = 78.2 bits (191),  Expect(2) = 7e-15, Method: Composition-based stats.
 Identities = 36/48 (75%), Positives = 43/48 (90%), Gaps = 0/48 (0%)
 Frame = +3

Query  357  VGVRRLMRQLNNMPSSVISSHTMHLGVLATASHAINTRTLFSVFYRPR  500
            VGVRR MRQ  N+PSSVISSH+MHLGVLATA HAI+T T+F+V+Y+PR
Sbjct  243  VGVRRAMRQQGNVPSSVISSHSMHLGVLATAWHAISTGTMFTVYYKPR  290


 Score = 28.9 bits (63),  Expect(2) = 7e-15, Method: Composition-based stats.
 Identities = 13/35 (37%), Positives = 25/35 (71%), Gaps = 1/35 (3%)
 Frame = +1

Query  472  LFSLFFTGQGTSRSEFIVSVNKYIEAQNH*LSVGM  576
            +F++++  + TS SEFIV  ++Y+E+  +  S+GM
Sbjct  282  MFTVYYKPR-TSPSEFIVPFDQYMESVKNNYSIGM  315



>ref|XP_006436944.1| hypothetical protein CICLE_v10030696mg [Citrus clementina]
 gb|ESR50184.1| hypothetical protein CICLE_v10030696mg [Citrus clementina]
Length=665

 Score = 78.6 bits (192),  Expect(2) = 7e-15, Method: Composition-based stats.
 Identities = 35/48 (73%), Positives = 43/48 (90%), Gaps = 0/48 (0%)
 Frame = +3

Query  357  VGVRRLMRQLNNMPSSVISSHTMHLGVLATASHAINTRTLFSVFYRPR  500
            VGVRR MRQ  N+PSSVISSH+MHLGVLATA HA++T T+F+V+Y+PR
Sbjct  66   VGVRRAMRQQGNVPSSVISSHSMHLGVLATAWHAVSTGTMFTVYYKPR  113


 Score = 28.5 bits (62),  Expect(2) = 7e-15, Method: Composition-based stats.
 Identities = 13/35 (37%), Positives = 25/35 (71%), Gaps = 1/35 (3%)
 Frame = +1

Query  472  LFSLFFTGQGTSRSEFIVSVNKYIEAQNH*LSVGM  576
            +F++++  + TS SEFIV  ++Y+E+  +  S+GM
Sbjct  105  MFTVYYKPR-TSPSEFIVPYDQYMESIKNNYSIGM  138



>ref|XP_008791039.1| PREDICTED: auxin response factor 23-like isoform X1 [Phoenix 
dactylifera]
Length=863

 Score = 77.8 bits (190),  Expect(2) = 7e-15, Method: Composition-based stats.
 Identities = 34/48 (71%), Positives = 43/48 (90%), Gaps = 0/48 (0%)
 Frame = +3

Query  357  VGVRRLMRQLNNMPSSVISSHTMHLGVLATASHAINTRTLFSVFYRPR  500
            VGVRR +RQ  N+PSSVISSH+MHLG+LATA HA+NT T+F+V+Y+PR
Sbjct  254  VGVRRALRQQTNIPSSVISSHSMHLGILATAWHAVNTGTMFTVYYKPR  301


 Score = 29.3 bits (64),  Expect(2) = 7e-15, Method: Composition-based stats.
 Identities = 14/35 (40%), Positives = 24/35 (69%), Gaps = 1/35 (3%)
 Frame = +1

Query  472  LFSLFFTGQGTSRSEFIVSVNKYIEAQNH*LSVGM  576
            +F++++  + TS SEFIV  N+Y+E+     S+GM
Sbjct  293  MFTVYYKPR-TSPSEFIVPYNQYMESLKSNHSIGM  326



>ref|XP_008791040.1| PREDICTED: auxin response factor 23-like isoform X2 [Phoenix 
dactylifera]
Length=859

 Score = 77.8 bits (190),  Expect(2) = 7e-15, Method: Composition-based stats.
 Identities = 34/48 (71%), Positives = 43/48 (90%), Gaps = 0/48 (0%)
 Frame = +3

Query  357  VGVRRLMRQLNNMPSSVISSHTMHLGVLATASHAINTRTLFSVFYRPR  500
            VGVRR +RQ  N+PSSVISSH+MHLG+LATA HA+NT T+F+V+Y+PR
Sbjct  254  VGVRRALRQQTNIPSSVISSHSMHLGILATAWHAVNTGTMFTVYYKPR  301


 Score = 29.3 bits (64),  Expect(2) = 7e-15, Method: Composition-based stats.
 Identities = 14/35 (40%), Positives = 24/35 (69%), Gaps = 1/35 (3%)
 Frame = +1

Query  472  LFSLFFTGQGTSRSEFIVSVNKYIEAQNH*LSVGM  576
            +F++++  + TS SEFIV  N+Y+E+     S+GM
Sbjct  293  MFTVYYKPR-TSPSEFIVPYNQYMESLKSNHSIGM  326



>ref|XP_010318417.1| PREDICTED: auxin response factor 2 isoform X2 [Solanum lycopersicum]
Length=837

 Score = 80.5 bits (197),  Expect(2) = 7e-15, Method: Composition-based stats.
 Identities = 36/48 (75%), Positives = 42/48 (88%), Gaps = 0/48 (0%)
 Frame = +3

Query  357  VGVRRLMRQLNNMPSSVISSHTMHLGVLATASHAINTRTLFSVFYRPR  500
            VGVRR MRQ  N PSSVISSH+MHLGVLATA HAI T+T+F+V+Y+PR
Sbjct  233  VGVRRAMRQQGNAPSSVISSHSMHLGVLATAWHAIQTKTMFTVYYKPR  280


 Score = 26.6 bits (57),  Expect(2) = 7e-15, Method: Composition-based stats.
 Identities = 12/35 (34%), Positives = 24/35 (69%), Gaps = 1/35 (3%)
 Frame = +1

Query  472  LFSLFFTGQGTSRSEFIVSVNKYIEAQNH*LSVGM  576
            +F++++  + TS +EFIV  + Y+E+  +  S+GM
Sbjct  272  MFTVYYKPR-TSPAEFIVPYDHYMESVKNNYSIGM  305



>gb|KJB40060.1| hypothetical protein B456_007G044900 [Gossypium raimondii]
Length=749

 Score = 77.8 bits (190),  Expect(2) = 7e-15, Method: Compositional matrix adjust.
 Identities = 35/48 (73%), Positives = 42/48 (88%), Gaps = 0/48 (0%)
 Frame = +3

Query  357  VGVRRLMRQLNNMPSSVISSHTMHLGVLATASHAINTRTLFSVFYRPR  500
            VGVRR +RQ  N+PSSVISSH+MHLGVLATA HA  TRT+F+V+Y+PR
Sbjct  259  VGVRRALRQQGNVPSSVISSHSMHLGVLATAWHAYTTRTIFTVYYKPR  306


 Score = 29.3 bits (64),  Expect(2) = 7e-15, Method: Composition-based stats.
 Identities = 13/35 (37%), Positives = 25/35 (71%), Gaps = 1/35 (3%)
 Frame = +1

Query  472  LFSLFFTGQGTSRSEFIVSVNKYIEAQNH*LSVGM  576
            +F++++  + TS +EFIV  N+Y+E+  +  S+GM
Sbjct  298  IFTVYYKPR-TSPAEFIVPFNQYMESVKNNYSIGM  331



>ref|NP_001233765.1| auxin response factor 2 [Solanum lycopersicum]
 ref|XP_010318416.1| PREDICTED: auxin response factor 2 isoform X1 [Solanum lycopersicum]
 gb|ABC69711.1| auxin response factor 2 [Solanum lycopersicum]
Length=846

 Score = 80.1 bits (196),  Expect(2) = 8e-15, Method: Composition-based stats.
 Identities = 36/48 (75%), Positives = 42/48 (88%), Gaps = 0/48 (0%)
 Frame = +3

Query  357  VGVRRLMRQLNNMPSSVISSHTMHLGVLATASHAINTRTLFSVFYRPR  500
            VGVRR MRQ  N PSSVISSH+MHLGVLATA HAI T+T+F+V+Y+PR
Sbjct  242  VGVRRAMRQQGNAPSSVISSHSMHLGVLATAWHAIQTKTMFTVYYKPR  289


 Score = 26.6 bits (57),  Expect(2) = 8e-15, Method: Composition-based stats.
 Identities = 12/35 (34%), Positives = 24/35 (69%), Gaps = 1/35 (3%)
 Frame = +1

Query  472  LFSLFFTGQGTSRSEFIVSVNKYIEAQNH*LSVGM  576
            +F++++  + TS +EFIV  + Y+E+  +  S+GM
Sbjct  281  MFTVYYKPR-TSPAEFIVPYDHYMESVKNNYSIGM  314



>gb|KJB40061.1| hypothetical protein B456_007G044900 [Gossypium raimondii]
Length=805

 Score = 77.8 bits (190),  Expect(2) = 8e-15, Method: Composition-based stats.
 Identities = 35/48 (73%), Positives = 42/48 (88%), Gaps = 0/48 (0%)
 Frame = +3

Query  357  VGVRRLMRQLNNMPSSVISSHTMHLGVLATASHAINTRTLFSVFYRPR  500
            VGVRR +RQ  N+PSSVISSH+MHLGVLATA HA  TRT+F+V+Y+PR
Sbjct  259  VGVRRALRQQGNVPSSVISSHSMHLGVLATAWHAYTTRTIFTVYYKPR  306


 Score = 29.3 bits (64),  Expect(2) = 8e-15, Method: Composition-based stats.
 Identities = 13/35 (37%), Positives = 25/35 (71%), Gaps = 1/35 (3%)
 Frame = +1

Query  472  LFSLFFTGQGTSRSEFIVSVNKYIEAQNH*LSVGM  576
            +F++++  + TS +EFIV  N+Y+E+  +  S+GM
Sbjct  298  IFTVYYKPR-TSPAEFIVPFNQYMESVKNNYSIGM  331



>ref|XP_006341482.1| PREDICTED: auxin response factor 2-like [Solanum tuberosum]
Length=845

 Score = 80.1 bits (196),  Expect(2) = 8e-15, Method: Composition-based stats.
 Identities = 36/48 (75%), Positives = 42/48 (88%), Gaps = 0/48 (0%)
 Frame = +3

Query  357  VGVRRLMRQLNNMPSSVISSHTMHLGVLATASHAINTRTLFSVFYRPR  500
            VGVRR MRQ  N PSSVISSH+MHLGVLATA HAI T+T+F+V+Y+PR
Sbjct  242  VGVRRAMRQQGNAPSSVISSHSMHLGVLATAWHAIQTKTMFTVYYKPR  289


 Score = 26.6 bits (57),  Expect(2) = 8e-15, Method: Composition-based stats.
 Identities = 12/35 (34%), Positives = 24/35 (69%), Gaps = 1/35 (3%)
 Frame = +1

Query  472  LFSLFFTGQGTSRSEFIVSVNKYIEAQNH*LSVGM  576
            +F++++  + TS +EFIV  + Y+E+  +  S+GM
Sbjct  281  MFTVYYKPR-TSPTEFIVPYDHYMESVKNNYSIGM  314



>ref|XP_010942377.1| PREDICTED: auxin response factor 23-like [Elaeis guineensis]
 ref|XP_010942378.1| PREDICTED: auxin response factor 23-like [Elaeis guineensis]
Length=866

 Score = 80.1 bits (196),  Expect(2) = 8e-15, Method: Composition-based stats.
 Identities = 36/48 (75%), Positives = 43/48 (90%), Gaps = 0/48 (0%)
 Frame = +3

Query  357  VGVRRLMRQLNNMPSSVISSHTMHLGVLATASHAINTRTLFSVFYRPR  500
            VGVRR MRQ  N+PSSVISSH+MHLGVLATA HA+NT T+F+V+Y+PR
Sbjct  255  VGVRRAMRQQTNVPSSVISSHSMHLGVLATAWHAVNTGTMFTVYYKPR  302


 Score = 26.6 bits (57),  Expect(2) = 8e-15, Method: Composition-based stats.
 Identities = 12/35 (34%), Positives = 25/35 (71%), Gaps = 1/35 (3%)
 Frame = +1

Query  472  LFSLFFTGQGTSRSEFIVSVNKYIEAQNH*LSVGM  576
            +F++++  + TS S+FIV  ++Y+E+  +  S+GM
Sbjct  294  MFTVYYKPR-TSPSDFIVPCDQYMESLKNNHSIGM  327



>ref|XP_004297494.1| PREDICTED: auxin response factor 2 [Fragaria vesca subsp. vesca]
Length=843

 Score = 79.0 bits (193),  Expect(2) = 8e-15, Method: Composition-based stats.
 Identities = 36/48 (75%), Positives = 42/48 (88%), Gaps = 0/48 (0%)
 Frame = +3

Query  357  VGVRRLMRQLNNMPSSVISSHTMHLGVLATASHAINTRTLFSVFYRPR  500
            VGVRR MRQ  N+PSSVISSH+MHLGVLATA HAI T T+F+V+Y+PR
Sbjct  263  VGVRRAMRQQGNVPSSVISSHSMHLGVLATAWHAIKTGTMFTVYYKPR  310


 Score = 27.7 bits (60),  Expect(2) = 8e-15, Method: Composition-based stats.
 Identities = 12/35 (34%), Positives = 25/35 (71%), Gaps = 1/35 (3%)
 Frame = +1

Query  472  LFSLFFTGQGTSRSEFIVSVNKYIEAQNH*LSVGM  576
            +F++++  + TS +EFIV  ++Y+E+  +  S+GM
Sbjct  302  MFTVYYKPR-TSPAEFIVPFDQYMESVKNNYSIGM  335



>gb|KJB07943.1| hypothetical protein B456_001G054600 [Gossypium raimondii]
 gb|KJB07944.1| hypothetical protein B456_001G054600 [Gossypium raimondii]
Length=860

 Score = 78.6 bits (192),  Expect(2) = 9e-15, Method: Composition-based stats.
 Identities = 35/48 (73%), Positives = 42/48 (88%), Gaps = 0/48 (0%)
 Frame = +3

Query  357  VGVRRLMRQLNNMPSSVISSHTMHLGVLATASHAINTRTLFSVFYRPR  500
            VGVRR MRQ  N+PSSVISSH+MHLGVLATA HA  T+T+F+V+Y+PR
Sbjct  258  VGVRRAMRQQGNVPSSVISSHSMHLGVLATAWHAYTTKTIFTVYYKPR  305


 Score = 28.1 bits (61),  Expect(2) = 9e-15, Method: Composition-based stats.
 Identities = 12/35 (34%), Positives = 25/35 (71%), Gaps = 1/35 (3%)
 Frame = +1

Query  472  LFSLFFTGQGTSRSEFIVSVNKYIEAQNH*LSVGM  576
            +F++++  + TS +EFIV  ++Y+E+  +  S+GM
Sbjct  297  IFTVYYKPR-TSPAEFIVPFDQYMESMKNNYSIGM  330



>gb|KDO51288.1| hypothetical protein CISIN_1g004792mg [Citrus sinensis]
Length=560

 Score = 77.8 bits (190),  Expect(2) = 1e-14, Method: Compositional matrix adjust.
 Identities = 35/48 (73%), Positives = 43/48 (90%), Gaps = 0/48 (0%)
 Frame = +3

Query  357  VGVRRLMRQLNNMPSSVISSHTMHLGVLATASHAINTRTLFSVFYRPR  500
            VGVRR MRQ  N+PSSVISSH+MHLGVLATA HA++T T+F+V+Y+PR
Sbjct  77   VGVRRAMRQQGNVPSSVISSHSMHLGVLATAWHAVSTGTMFTVYYKPR  124


 Score = 28.5 bits (62),  Expect(2) = 1e-14, Method: Compositional matrix adjust.
 Identities = 13/35 (37%), Positives = 25/35 (71%), Gaps = 1/35 (3%)
 Frame = +1

Query  472  LFSLFFTGQGTSRSEFIVSVNKYIEAQNH*LSVGM  576
            +F++++  + TS SEFIV  ++Y+E+  +  S+GM
Sbjct  116  MFTVYYKPR-TSPSEFIVPYDQYMESIKNNYSIGM  149



>ref|XP_004138020.1| PREDICTED: auxin response factor 2-like [Cucumis sativus]
 gb|KGN63434.1| hypothetical protein Csa_1G000580 [Cucumis sativus]
Length=839

 Score = 79.0 bits (193),  Expect(2) = 1e-14, Method: Composition-based stats.
 Identities = 37/48 (77%), Positives = 43/48 (90%), Gaps = 0/48 (0%)
 Frame = +3

Query  357  VGVRRLMRQLNNMPSSVISSHTMHLGVLATASHAINTRTLFSVFYRPR  500
            VGVRR MRQ  N+PSSVISSH+MHLGVLATA HAI+T TLF+V+Y+PR
Sbjct  243  VGVRRAMRQHGNVPSSVISSHSMHLGVLATAWHAISTGTLFTVYYKPR  290


 Score = 27.3 bits (59),  Expect(2) = 1e-14, Method: Composition-based stats.
 Identities = 13/35 (37%), Positives = 24/35 (69%), Gaps = 1/35 (3%)
 Frame = +1

Query  472  LFSLFFTGQGTSRSEFIVSVNKYIEAQNH*LSVGM  576
            LF++++  + TS SEFIV  ++Y+E+     ++GM
Sbjct  282  LFTVYYKPR-TSPSEFIVPYDQYMESIKKSYTIGM  315



>ref|XP_004172696.1| PREDICTED: auxin response factor 2-like, partial [Cucumis sativus]
Length=718

 Score = 79.0 bits (193),  Expect(2) = 1e-14, Method: Compositional matrix adjust.
 Identities = 37/48 (77%), Positives = 43/48 (90%), Gaps = 0/48 (0%)
 Frame = +3

Query  357  VGVRRLMRQLNNMPSSVISSHTMHLGVLATASHAINTRTLFSVFYRPR  500
            VGVRR MRQ  N+PSSVISSH+MHLGVLATA HAI+T TLF+V+Y+PR
Sbjct  243  VGVRRAMRQHGNVPSSVISSHSMHLGVLATAWHAISTGTLFTVYYKPR  290


 Score = 27.3 bits (59),  Expect(2) = 1e-14, Method: Composition-based stats.
 Identities = 13/35 (37%), Positives = 24/35 (69%), Gaps = 1/35 (3%)
 Frame = +1

Query  472  LFSLFFTGQGTSRSEFIVSVNKYIEAQNH*LSVGM  576
            LF++++  + TS SEFIV  ++Y+E+     ++GM
Sbjct  282  LFTVYYKPR-TSPSEFIVPYDQYMESIKKSYTIGM  315



>ref|XP_006339725.1| PREDICTED: auxin response factor 9-like isoform X3 [Solanum tuberosum]
Length=695

 Score = 73.2 bits (178),  Expect(2) = 1e-14, Method: Composition-based stats.
 Identities = 34/48 (71%), Positives = 40/48 (83%), Gaps = 0/48 (0%)
 Frame = +3

Query  357  VGVRRLMRQLNNMPSSVISSHTMHLGVLATASHAINTRTLFSVFYRPR  500
            VGVRRL RQ + +P SVISS +MHLGVLATASHAI T+T F V+Y+PR
Sbjct  217  VGVRRLARQQSPIPQSVISSQSMHLGVLATASHAITTQTRFVVYYKPR  264


 Score = 33.1 bits (74),  Expect(2) = 1e-14, Method: Composition-based stats.
 Identities = 14/22 (64%), Positives = 18/22 (82%), Gaps = 0/22 (0%)
 Frame = +1

Query  511  SEFIVSVNKYIEAQNH*LSVGM  576
            S+FIV +NKY+EA +H  SVGM
Sbjct  266  SQFIVGLNKYLEAVSHGFSVGM  287



>gb|AFW60884.1| auxin response factor [Zea mays]
Length=817

 Score = 81.3 bits (199),  Expect(2) = 1e-14, Method: Composition-based stats.
 Identities = 36/48 (75%), Positives = 43/48 (90%), Gaps = 0/48 (0%)
 Frame = +3

Query  357  VGVRRLMRQLNNMPSSVISSHTMHLGVLATASHAINTRTLFSVFYRPR  500
            VGVRR MRQ  N+PSSVISSH+MHLGVLATA HA+NT T+F+V+Y+PR
Sbjct  277  VGVRRAMRQQANVPSSVISSHSMHLGVLATAWHAVNTGTMFTVYYKPR  324


 Score = 25.0 bits (53),  Expect(2) = 1e-14, Method: Composition-based stats.
 Identities = 10/35 (29%), Positives = 23/35 (66%), Gaps = 1/35 (3%)
 Frame = +1

Query  472  LFSLFFTGQGTSRSEFIVSVNKYIEAQNH*LSVGM  576
            +F++++  + TS +EF+V  ++Y+E+      +GM
Sbjct  316  MFTVYYKPR-TSPAEFVVPCDRYMESLKRNYPIGM  349



>ref|XP_010327130.1| PREDICTED: auxin response factor 18 [Solanum lycopersicum]
 ref|XP_010327133.1| PREDICTED: auxin response factor 18 [Solanum lycopersicum]
 ref|XP_010327135.1| PREDICTED: auxin response factor 18 [Solanum lycopersicum]
 ref|XP_010327139.1| PREDICTED: auxin response factor 18 [Solanum lycopersicum]
Length=685

 Score = 73.2 bits (178),  Expect(2) = 1e-14, Method: Composition-based stats.
 Identities = 34/48 (71%), Positives = 40/48 (83%), Gaps = 0/48 (0%)
 Frame = +3

Query  357  VGVRRLMRQLNNMPSSVISSHTMHLGVLATASHAINTRTLFSVFYRPR  500
            VGVRRL RQ + +P SVISS +MHLGVLATASHAI T+T F V+Y+PR
Sbjct  207  VGVRRLARQQSPIPQSVISSQSMHLGVLATASHAITTQTRFVVYYKPR  254


 Score = 33.1 bits (74),  Expect(2) = 1e-14, Method: Composition-based stats.
 Identities = 14/22 (64%), Positives = 18/22 (82%), Gaps = 0/22 (0%)
 Frame = +1

Query  511  SEFIVSVNKYIEAQNH*LSVGM  576
            S+FIV +NKY+EA +H  SVGM
Sbjct  256  SQFIVGLNKYLEAVSHGFSVGM  277



>ref|XP_010250544.1| PREDICTED: auxin response factor 2-like isoform X1 [Nelumbo nucifera]
Length=859

 Score = 79.0 bits (193),  Expect(2) = 1e-14, Method: Composition-based stats.
 Identities = 35/48 (73%), Positives = 44/48 (92%), Gaps = 0/48 (0%)
 Frame = +3

Query  357  VGVRRLMRQLNNMPSSVISSHTMHLGVLATASHAINTRTLFSVFYRPR  500
            VGVRR MRQ +N+PSSVISSH+MHLGVLATA HA++T T+F+V+Y+PR
Sbjct  253  VGVRRAMRQQSNVPSSVISSHSMHLGVLATAWHAVSTGTMFTVYYKPR  300


 Score = 27.7 bits (60),  Expect(2) = 1e-14, Method: Composition-based stats.
 Identities = 12/35 (34%), Positives = 25/35 (71%), Gaps = 1/35 (3%)
 Frame = +1

Query  472  LFSLFFTGQGTSRSEFIVSVNKYIEAQNH*LSVGM  576
            +F++++  + TS +EFIV  ++Y+E+  +  S+GM
Sbjct  292  MFTVYYKPR-TSPAEFIVPFDQYMESVKNNYSIGM  325



>gb|AAK55665.1|AF378862_1 AT5g62000/mtg10_20 [Arabidopsis thaliana]
 gb|AAN46837.1| At5g62000/mtg10_20 [Arabidopsis thaliana]
Length=678

 Score = 77.8 bits (190),  Expect(2) = 1e-14, Method: Composition-based stats.
 Identities = 36/48 (75%), Positives = 43/48 (90%), Gaps = 0/48 (0%)
 Frame = +3

Query  357  VGVRRLMRQLNNMPSSVISSHTMHLGVLATASHAINTRTLFSVFYRPR  500
            VGVRR MRQ  N+PSSVISSH+MHLGVLATA HAI+T T+F+V+Y+PR
Sbjct  260  VGVRRAMRQQGNVPSSVISSHSMHLGVLATAWHAISTGTMFTVYYKPR  307


 Score = 28.9 bits (63),  Expect(2) = 1e-14, Method: Composition-based stats.
 Identities = 13/35 (37%), Positives = 25/35 (71%), Gaps = 1/35 (3%)
 Frame = +1

Query  472  LFSLFFTGQGTSRSEFIVSVNKYIEAQNH*LSVGM  576
            +F++++  + TS SEFIV  ++Y+E+  +  S+GM
Sbjct  299  MFTVYYKPR-TSPSEFIVPFDQYMESVKNNYSIGM  332



>ref|XP_006397845.1| hypothetical protein EUTSA_v10001365mg [Eutrema salsugineum]
 gb|ESQ39298.1| hypothetical protein EUTSA_v10001365mg [Eutrema salsugineum]
Length=598

 Score = 81.3 bits (199),  Expect(2) = 1e-14, Method: Composition-based stats.
 Identities = 37/48 (77%), Positives = 43/48 (90%), Gaps = 0/48 (0%)
 Frame = +3

Query  357  VGVRRLMRQLNNMPSSVISSHTMHLGVLATASHAINTRTLFSVFYRPR  500
            VGVRRL RQ + MP+SVISS +MHLGVLATASHA+NT+TLF VFY+PR
Sbjct  220  VGVRRLARQQSTMPASVISSQSMHLGVLATASHAVNTKTLFVVFYKPR  267


 Score = 25.0 bits (53),  Expect(2) = 1e-14, Method: Composition-based stats.
 Identities = 13/35 (37%), Positives = 20/35 (57%), Gaps = 3/35 (9%)
 Frame = +1

Query  472  LFSLFFTGQGTSRSEFIVSVNKYIEAQNH*LSVGM  576
            LF +F+  +    S+FI+ VNKY+ A      +GM
Sbjct  259  LFVVFYKPR---ISQFIIGVNKYMAAMKIGFPIGM  290



>gb|KDP22546.1| hypothetical protein JCGZ_26377 [Jatropha curcas]
Length=854

 Score = 77.4 bits (189),  Expect(2) = 1e-14, Method: Composition-based stats.
 Identities = 35/48 (73%), Positives = 43/48 (90%), Gaps = 0/48 (0%)
 Frame = +3

Query  357  VGVRRLMRQLNNMPSSVISSHTMHLGVLATASHAINTRTLFSVFYRPR  500
            VGVRR MRQ  N+PSSVISSH+MHLGVLATA HA++T T+F+V+Y+PR
Sbjct  252  VGVRRAMRQQGNVPSSVISSHSMHLGVLATAWHAVSTGTMFTVYYKPR  299


 Score = 28.9 bits (63),  Expect(2) = 1e-14, Method: Composition-based stats.
 Identities = 13/35 (37%), Positives = 25/35 (71%), Gaps = 1/35 (3%)
 Frame = +1

Query  472  LFSLFFTGQGTSRSEFIVSVNKYIEAQNH*LSVGM  576
            +F++++  + TS SEFIV  ++Y+E+  +  S+GM
Sbjct  291  MFTVYYKPR-TSPSEFIVPYDRYMESVKNNYSIGM  324



>gb|KDO51287.1| hypothetical protein CISIN_1g004792mg [Citrus sinensis]
Length=641

 Score = 77.8 bits (190),  Expect(2) = 1e-14, Method: Compositional matrix adjust.
 Identities = 35/48 (73%), Positives = 43/48 (90%), Gaps = 0/48 (0%)
 Frame = +3

Query  357  VGVRRLMRQLNNMPSSVISSHTMHLGVLATASHAINTRTLFSVFYRPR  500
            VGVRR MRQ  N+PSSVISSH+MHLGVLATA HA++T T+F+V+Y+PR
Sbjct  158  VGVRRAMRQQGNVPSSVISSHSMHLGVLATAWHAVSTGTMFTVYYKPR  205


 Score = 28.5 bits (62),  Expect(2) = 1e-14, Method: Composition-based stats.
 Identities = 13/35 (37%), Positives = 25/35 (71%), Gaps = 1/35 (3%)
 Frame = +1

Query  472  LFSLFFTGQGTSRSEFIVSVNKYIEAQNH*LSVGM  576
            +F++++  + TS SEFIV  ++Y+E+  +  S+GM
Sbjct  197  MFTVYYKPR-TSPSEFIVPYDQYMESIKNNYSIGM  230



>emb|CDP19763.1| unnamed protein product [Coffea canephora]
Length=852

 Score = 78.2 bits (191),  Expect(2) = 1e-14, Method: Composition-based stats.
 Identities = 36/48 (75%), Positives = 40/48 (83%), Gaps = 0/48 (0%)
 Frame = +3

Query  357  VGVRRLMRQLNNMPSSVISSHTMHLGVLATASHAINTRTLFSVFYRPR  500
            VGVRR MRQ  N PSSVISSH+MHLGVLATA HAI T T F+V+Y+PR
Sbjct  242  VGVRRAMRQQGNAPSSVISSHSMHLGVLATAWHAIQTNTFFTVYYKPR  289


 Score = 27.7 bits (60),  Expect(2) = 1e-14, Method: Composition-based stats.
 Identities = 13/35 (37%), Positives = 24/35 (69%), Gaps = 1/35 (3%)
 Frame = +1

Query  472  LFSLFFTGQGTSRSEFIVSVNKYIEAQNH*LSVGM  576
             F++++  + TS SEFIV  ++Y+E+  +  S+GM
Sbjct  281  FFTVYYKPR-TSPSEFIVPFDQYMESVKNSYSIGM  314



>ref|XP_006339723.1| PREDICTED: auxin response factor 9-like isoform X1 [Solanum tuberosum]
Length=708

 Score = 72.8 bits (177),  Expect(2) = 1e-14, Method: Composition-based stats.
 Identities = 34/48 (71%), Positives = 40/48 (83%), Gaps = 0/48 (0%)
 Frame = +3

Query  357  VGVRRLMRQLNNMPSSVISSHTMHLGVLATASHAINTRTLFSVFYRPR  500
            VGVRRL RQ + +P SVISS +MHLGVLATASHAI T+T F V+Y+PR
Sbjct  230  VGVRRLARQQSPIPQSVISSQSMHLGVLATASHAITTQTRFVVYYKPR  277


 Score = 33.1 bits (74),  Expect(2) = 1e-14, Method: Composition-based stats.
 Identities = 14/22 (64%), Positives = 18/22 (82%), Gaps = 0/22 (0%)
 Frame = +1

Query  511  SEFIVSVNKYIEAQNH*LSVGM  576
            S+FIV +NKY+EA +H  SVGM
Sbjct  279  SQFIVGLNKYLEAVSHGFSVGM  300



>dbj|BAJ34449.1| unnamed protein product [Thellungiella halophila]
Length=559

 Score = 81.6 bits (200),  Expect(2) = 1e-14, Method: Compositional matrix adjust.
 Identities = 37/48 (77%), Positives = 43/48 (90%), Gaps = 0/48 (0%)
 Frame = +3

Query  357  VGVRRLMRQLNNMPSSVISSHTMHLGVLATASHAINTRTLFSVFYRPR  500
            VGVRRL RQ + MP+SVISS +MHLGVLATASHA+NT+TLF VFY+PR
Sbjct  220  VGVRRLARQQSTMPASVISSQSMHLGVLATASHAVNTKTLFVVFYKPR  267


 Score = 24.6 bits (52),  Expect(2) = 1e-14, Method: Compositional matrix adjust.
 Identities = 10/22 (45%), Positives = 14/22 (64%), Gaps = 0/22 (0%)
 Frame = +1

Query  511  SEFIVSVNKYIEAQNH*LSVGM  576
            S+FI+ VNKY+ A      +GM
Sbjct  269  SQFIIGVNKYMAAMKIGFPIGM  290



>ref|XP_007038119.1| Auxin response factor-like protein isoform 2 [Theobroma cacao]
 gb|EOY22620.1| Auxin response factor-like protein isoform 2 [Theobroma cacao]
Length=744

 Score = 78.2 bits (191),  Expect(2) = 1e-14, Method: Composition-based stats.
 Identities = 36/48 (75%), Positives = 43/48 (90%), Gaps = 0/48 (0%)
 Frame = +3

Query  357  VGVRRLMRQLNNMPSSVISSHTMHLGVLATASHAINTRTLFSVFYRPR  500
            VGVRR MRQ +N+PSSVISSH+MHLGVLATA HA  TRT+F+V+Y+PR
Sbjct  256  VGVRRAMRQQSNVPSSVISSHSMHLGVLATAWHAYTTRTIFTVYYKPR  303


 Score = 28.1 bits (61),  Expect(2) = 1e-14, Method: Composition-based stats.
 Identities = 12/35 (34%), Positives = 25/35 (71%), Gaps = 1/35 (3%)
 Frame = +1

Query  472  LFSLFFTGQGTSRSEFIVSVNKYIEAQNH*LSVGM  576
            +F++++  + TS +EFIV  ++Y+E+  +  S+GM
Sbjct  295  IFTVYYKPR-TSPAEFIVPFDQYVESVKNNYSIGM  328



>ref|XP_008790699.1| PREDICTED: auxin response factor 4-like isoform X3 [Phoenix dactylifera]
Length=851

 Score = 77.4 bits (189),  Expect(2) = 1e-14, Method: Composition-based stats.
 Identities = 35/48 (73%), Positives = 42/48 (88%), Gaps = 0/48 (0%)
 Frame = +3

Query  357  VGVRRLMRQLNNMPSSVISSHTMHLGVLATASHAINTRTLFSVFYRPR  500
            VGVRR MRQ  N+PSSVISSH+MHLGVLATA HA+ T T+F+V+Y+PR
Sbjct  250  VGVRRAMRQQTNVPSSVISSHSMHLGVLATAWHAVTTGTIFTVYYKPR  297


 Score = 28.9 bits (63),  Expect(2) = 1e-14, Method: Composition-based stats.
 Identities = 13/35 (37%), Positives = 25/35 (71%), Gaps = 1/35 (3%)
 Frame = +1

Query  472  LFSLFFTGQGTSRSEFIVSVNKYIEAQNH*LSVGM  576
            +F++++  + TS SEFIV  ++Y+E+  +  S+GM
Sbjct  289  IFTVYYKPR-TSPSEFIVPYDRYMESLKNNYSIGM  322



>ref|XP_006339724.1| PREDICTED: auxin response factor 9-like isoform X2 [Solanum tuberosum]
Length=705

 Score = 72.8 bits (177),  Expect(2) = 1e-14, Method: Composition-based stats.
 Identities = 34/48 (71%), Positives = 40/48 (83%), Gaps = 0/48 (0%)
 Frame = +3

Query  357  VGVRRLMRQLNNMPSSVISSHTMHLGVLATASHAINTRTLFSVFYRPR  500
            VGVRRL RQ + +P SVISS +MHLGVLATASHAI T+T F V+Y+PR
Sbjct  230  VGVRRLARQQSPIPQSVISSQSMHLGVLATASHAITTQTRFVVYYKPR  277


 Score = 33.1 bits (74),  Expect(2) = 1e-14, Method: Composition-based stats.
 Identities = 14/22 (64%), Positives = 18/22 (82%), Gaps = 0/22 (0%)
 Frame = +1

Query  511  SEFIVSVNKYIEAQNH*LSVGM  576
            S+FIV +NKY+EA +H  SVGM
Sbjct  279  SQFIVGLNKYLEAVSHGFSVGM  300



>ref|XP_006352241.1| PREDICTED: auxin response factor 9-like isoform X2 [Solanum tuberosum]
Length=683

 Score = 73.6 bits (179),  Expect(2) = 1e-14, Method: Composition-based stats.
 Identities = 31/48 (65%), Positives = 42/48 (88%), Gaps = 0/48 (0%)
 Frame = +3

Query  357  VGVRRLMRQLNNMPSSVISSHTMHLGVLATASHAINTRTLFSVFYRPR  500
            +G+RRL RQ ++MP SVIS+ +MHLGVLATASHA+ T+T+F V+Y+PR
Sbjct  228  IGIRRLARQPSSMPQSVISNQSMHLGVLATASHAVTTQTMFVVYYKPR  275


 Score = 32.3 bits (72),  Expect(2) = 1e-14, Method: Composition-based stats.
 Identities = 14/22 (64%), Positives = 17/22 (77%), Gaps = 0/22 (0%)
 Frame = +1

Query  511  SEFIVSVNKYIEAQNH*LSVGM  576
            S+FIV +NKY+EA  H  SVGM
Sbjct  277  SQFIVGLNKYLEAVKHRYSVGM  298



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 696633491985