BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFF037J22

Length=512
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_002271929.1|  PREDICTED: proteasome subunit alpha type-6         291   3e-96   Vitis vinifera
gb|KDP33929.1|  hypothetical protein JCGZ_07500                         290   5e-96   Jatropha curcas
ref|XP_008228175.1|  PREDICTED: proteasome subunit alpha type-6         290   5e-96   Prunus mume [ume]
gb|KJB65225.1|  hypothetical protein B456_010G089600                    290   6e-96   Gossypium raimondii
gb|KHG01950.1|  Proteasome subunit alpha type-6                         290   6e-96   Gossypium arboreum [tree cotton]
gb|KJB82986.1|  hypothetical protein B456_013G223200                    290   6e-96   Gossypium raimondii
gb|KJB65226.1|  hypothetical protein B456_010G089600                    290   7e-96   Gossypium raimondii
ref|XP_007215872.1|  hypothetical protein PRUPE_ppa010523mg             290   7e-96   Prunus persica
ref|XP_009797939.1|  PREDICTED: proteasome subunit alpha type-6         290   7e-96   Nicotiana sylvestris
gb|KJB82987.1|  hypothetical protein B456_013G223200                    290   8e-96   Gossypium raimondii
ref|XP_009631638.1|  PREDICTED: proteasome subunit alpha type-6         290   9e-96   Nicotiana tomentosiformis
ref|XP_007012615.1|  20S proteasome subunit PAA2 isoform 1              289   1e-95   Theobroma cacao [chocolate]
gb|KHG04433.1|  Proteasome subunit alpha type-6                         288   1e-95   Gossypium arboreum [tree cotton]
gb|EYU19318.1|  hypothetical protein MIMGU_mgv1a012555mg                288   2e-95   Erythranthe guttata [common monkey flower]
ref|XP_011099933.1|  PREDICTED: proteasome subunit alpha type-6-like    288   3e-95   Sesamum indicum [beniseed]
ref|XP_011098408.1|  PREDICTED: proteasome subunit alpha type-6         288   3e-95   Sesamum indicum [beniseed]
ref|XP_004251692.1|  PREDICTED: proteasome subunit alpha type-6         288   3e-95   Solanum lycopersicum
gb|ACJ11727.1|  20S proteasome subunit alpha-1                          288   4e-95   Gossypium hirsutum [American cotton]
gb|KDP45827.1|  hypothetical protein JCGZ_17434                         288   5e-95   Jatropha curcas
ref|XP_010269878.1|  PREDICTED: proteasome subunit alpha type-6-like    288   5e-95   Nelumbo nucifera [Indian lotus]
gb|ABK96399.1|  unknown                                                 287   5e-95   Populus trichocarpa x Populus deltoides
ref|XP_010541996.1|  PREDICTED: proteasome subunit alpha type-6-B       287   8e-95   Tarenaya hassleriana [spider flower]
ref|XP_009344472.1|  PREDICTED: proteasome subunit alpha type-6         287   9e-95   Pyrus x bretschneideri [bai li]
ref|XP_008391412.1|  PREDICTED: proteasome subunit alpha type-6         287   9e-95   Malus domestica [apple tree]
ref|XP_006381605.1|  hypothetical protein POPTR_0006s14260g             286   1e-94   Populus trichocarpa [western balsam poplar]
ref|XP_006592586.1|  PREDICTED: proteasome subunit alpha type-6-like    286   1e-94   Glycine max [soybeans]
ref|XP_007133143.1|  hypothetical protein PHAVU_011G155200g             286   1e-94   Phaseolus vulgaris [French bean]
ref|XP_010557672.1|  PREDICTED: proteasome subunit alpha type-6-B...    286   1e-94   Tarenaya hassleriana [spider flower]
gb|ACJ85916.1|  unknown                                                 286   2e-94   Medicago truncatula
ref|XP_004488480.1|  PREDICTED: proteasome subunit alpha type-6-l...    286   2e-94   Cicer arietinum [garbanzo]
ref|XP_010064020.1|  PREDICTED: proteasome subunit alpha type-6         286   3e-94   Eucalyptus grandis [rose gum]
gb|ACU24622.1|  unknown                                                 285   3e-94   Glycine max [soybeans]
emb|CDP03072.1|  unnamed protein product                                285   5e-94   Coffea canephora [robusta coffee]
gb|AFK47610.1|  unknown                                                 285   6e-94   Lotus japonicus
ref|XP_003595788.1|  Proteasome subunit alpha type                      285   8e-94   Medicago truncatula
gb|AFK46801.1|  unknown                                                 284   9e-94   Medicago truncatula
ref|XP_010441957.1|  PREDICTED: proteasome subunit alpha type-6-B...    284   1e-93   Camelina sativa [gold-of-pleasure]
ref|XP_009404175.1|  PREDICTED: proteasome subunit alpha type-6-like    283   2e-93   Musa acuminata subsp. malaccensis [pisang utan]
gb|ACB87915.1|  20S proteasome alpha subunit A1                         281   2e-93   Malus domestica [apple tree]
ref|XP_010533014.1|  PREDICTED: proteasome subunit alpha type-6-B...    283   2e-93   Tarenaya hassleriana [spider flower]
ref|XP_010274570.1|  PREDICTED: proteasome subunit alpha type-6         283   3e-93   Nelumbo nucifera [Indian lotus]
gb|ADJ95344.1|  PAA1                                                    283   3e-93   Carica papaya [mamon]
ref|XP_008462289.1|  PREDICTED: proteasome subunit alpha type-6         283   3e-93   Cucumis melo [Oriental melon]
ref|XP_002323091.1|  Proteasome subunit alpha type 6-1 family pro...    283   4e-93   Populus trichocarpa [western balsam poplar]
ref|NP_001238251.1|  proteasome subunit alpha type-6                    283   4e-93   
ref|XP_002532723.1|  proteasome subunit alpha type, putative            283   5e-93   Ricinus communis
ref|NP_001031340.1|  20S proteasome subunit PAA2                        281   5e-93   Arabidopsis thaliana [mouse-ear cress]
gb|ACJ85912.1|  unknown                                                 282   6e-93   Medicago truncatula
ref|XP_006465892.1|  PREDICTED: proteasome subunit alpha type-6-like    282   8e-93   Citrus sinensis [apfelsine]
ref|NP_178641.1|  20S proteasome subunit PAA2                           282   9e-93   Arabidopsis thaliana [mouse-ear cress]
ref|XP_011001657.1|  PREDICTED: proteasome subunit alpha type-6-like    281   1e-92   Populus euphratica
ref|XP_009380029.1|  PREDICTED: proteasome subunit alpha type-6         281   1e-92   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009102355.1|  PREDICTED: proteasome subunit alpha type-6-B       281   1e-92   Brassica rapa
ref|XP_010435443.1|  PREDICTED: proteasome subunit alpha type-6-A...    281   1e-92   Camelina sativa [gold-of-pleasure]
ref|XP_004141710.1|  PREDICTED: proteasome subunit alpha type-6-like    281   2e-92   Cucumis sativus [cucumbers]
ref|XP_002308263.1|  Proteasome subunit alpha type 6-1 family pro...    281   2e-92   Populus trichocarpa [western balsam poplar]
ref|XP_006282775.1|  hypothetical protein CARUB_v10006215mg             281   2e-92   Capsella rubella
ref|XP_010450390.1|  PREDICTED: proteasome subunit alpha type-6-A       281   2e-92   Camelina sativa [gold-of-pleasure]
ref|XP_008802476.1|  PREDICTED: proteasome subunit alpha type-6-like    281   2e-92   Phoenix dactylifera
ref|XP_010494382.1|  PREDICTED: proteasome subunit alpha type-6-B       281   2e-92   Camelina sativa [gold-of-pleasure]
gb|AFK44903.1|  unknown                                                 278   2e-92   Medicago truncatula
gb|KJB82988.1|  hypothetical protein B456_013G223200                    280   3e-92   Gossypium raimondii
gb|EPS63192.1|  proteasome subunit alpha type-6                         280   3e-92   Genlisea aurea
gb|KDO64978.1|  hypothetical protein CISIN_1g025897mg                   279   4e-92   Citrus sinensis [apfelsine]
ref|NP_198409.1|  proteasome alpha subunit A1                           280   4e-92   Arabidopsis thaliana [mouse-ear cress]
gb|AFK46380.1|  unknown                                                 280   5e-92   Lotus japonicus
ref|XP_006396131.1|  hypothetical protein EUTSA_v10002649mg             280   5e-92   Eutrema salsugineum [saltwater cress]
gb|AAC32054.1|  20S proteasome subunit PAA1                             280   5e-92   Arabidopsis thaliana [mouse-ear cress]
ref|XP_011018964.1|  PREDICTED: proteasome subunit alpha type-6-like    280   6e-92   Populus euphratica
ref|XP_010937324.1|  PREDICTED: proteasome subunit alpha type-6         280   7e-92   Elaeis guineensis
gb|KFK32243.1|  hypothetical protein AALP_AA6G216400                    279   8e-92   Arabis alpina [alpine rockcress]
gb|ABK95322.1|  unknown                                                 279   8e-92   Populus trichocarpa [western balsam poplar]
ref|XP_009136197.1|  PREDICTED: proteasome subunit alpha type-6-B...    279   1e-91   Brassica rapa
gb|ACN66752.1|  PAA1                                                    279   1e-91   Carica papaya [mamon]
ref|XP_004303706.1|  PREDICTED: proteasome subunit alpha type-6         279   1e-91   Fragaria vesca subsp. vesca
gb|AAM12968.1|  multicatalytic endopeptidase complex alpha subuni...    279   1e-91   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008782714.1|  PREDICTED: proteasome subunit alpha type-6         279   1e-91   Phoenix dactylifera
ref|XP_007012616.1|  20S proteasome subunit PAA2 isoform 2              276   2e-91   
ref|XP_002870436.1|  hypothetical protein ARALYDRAFT_493620             278   3e-91   
emb|CAA74025.1|  multicatalytic endopeptidase complex, proteasome...    278   3e-91   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006842706.1|  hypothetical protein AMTR_s00147p00090390          278   4e-91   Amborella trichopoda
gb|KHN46954.1|  Proteasome subunit alpha type-6                         288   4e-91   Glycine soja [wild soybean]
ref|XP_010666851.1|  PREDICTED: proteasome subunit alpha type-6         276   9e-91   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_006649499.1|  PREDICTED: proteasome subunit alpha type-6-like    276   2e-90   Oryza brachyantha
ref|XP_006474716.1|  PREDICTED: proteasome subunit alpha type-6-l...    276   2e-90   Citrus sinensis [apfelsine]
ref|XP_010939895.1|  PREDICTED: proteasome subunit alpha type-6-like    276   2e-90   Elaeis guineensis
ref|NP_001130062.1|  uncharacterized protein LOC100191154               275   4e-90   Zea mays [maize]
gb|AFW89473.1|  hypothetical protein ZEAMMB73_334376                    273   5e-90   
gb|KDO64981.1|  hypothetical protein CISIN_1g025897mg                   271   5e-90   Citrus sinensis [apfelsine]
gb|ACN33969.1|  unknown                                                 275   5e-90   Zea mays [maize]
ref|XP_004985490.1|  PREDICTED: proteasome subunit alpha type-6-like    274   8e-90   Setaria italica
ref|NP_001049162.1|  Os03g0180400                                       274   9e-90   
ref|XP_002465753.1|  hypothetical protein SORBIDRAFT_01g045210          273   2e-89   Sorghum bicolor [broomcorn]
ref|NP_001105138.1|  maize 20S proteasome alpha subunit                 273   3e-89   Zea mays [maize]
ref|XP_003558667.1|  PREDICTED: proteasome subunit alpha type-6         272   5e-89   Brachypodium distachyon [annual false brome]
emb|CDY50408.1|  BnaC03g45100D                                          271   8e-89   Brassica napus [oilseed rape]
ref|XP_002516258.1|  proteasome subunit alpha type, putative            271   1e-88   Ricinus communis
gb|ABK22399.1|  unknown                                                 270   3e-88   Picea sitchensis
emb|CDX93103.1|  BnaA03g38250D                                          270   6e-88   
gb|AGO97077.1|  20S proteasome alpha                                    269   1e-87   Saccharum hybrid cultivar GT28
gb|EMT09268.1|  Proteasome subunit alpha type-6                         268   2e-87   
dbj|BAJ85935.1|  predicted protein                                      268   2e-87   Hordeum vulgare subsp. vulgare [two-rowed barley]
tpg|DAA43694.1|  TPA: hypothetical protein ZEAMMB73_913533              264   4e-87   
ref|XP_006474717.1|  PREDICTED: proteasome subunit alpha type-6-l...    266   8e-87   
gb|KDO64977.1|  hypothetical protein CISIN_1g025897mg                   265   2e-86   Citrus sinensis [apfelsine]
ref|XP_006452821.1|  hypothetical protein CICLE_v10010323mg             265   2e-86   
ref|XP_001777426.1|  predicted protein                                  254   7e-82   
gb|ABF94306.1|  Proteasome subunit alpha type 6, putative, expressed    254   2e-81   Oryza sativa Japonica Group [Japonica rice]
ref|XP_001782615.1|  predicted protein                                  253   2e-81   
ref|XP_001768229.1|  predicted protein                                  252   3e-81   
ref|XP_002989745.1|  hypothetical protein SELMODRAFT_272088             248   2e-79   Selaginella moellendorffii
ref|XP_001751730.1|  predicted protein                                  240   1e-76   
ref|XP_008353690.1|  PREDICTED: proteasome subunit alpha type-6         234   8e-76   
ref|XP_004141815.1|  PREDICTED: proteasome subunit alpha type-6-like    232   1e-74   
ref|XP_010111992.1|  Proteasome subunit alpha type-6                    234   3e-73   
ref|XP_005648429.1|  proteasome subunit alpha type-6                    231   6e-73   Coccomyxa subellipsoidea C-169
gb|KDO64982.1|  hypothetical protein CISIN_1g025897mg                   230   9e-73   Citrus sinensis [apfelsine]
ref|XP_001691723.1|  20S proteasome alpha subunit A                     226   9e-71   Chlamydomonas reinhardtii
ref|XP_002949740.1|  20S proteasome alpha subunit A                     224   6e-70   Volvox carteri f. nagariensis
gb|KDD75255.1|  proteasome subunit protein                              222   3e-69   Helicosporidium sp. ATCC 50920
ref|XP_003059392.1|  predicted protein                                  217   2e-67   Micromonas pusilla CCMP1545
ref|XP_007513369.1|  predicted protein                                  213   5e-66   Bathycoccus prasinos
ref|XP_005717620.1|  20S core proteasome subunit alpha 1                214   5e-66   Chondrus crispus [carageen]
ref|XP_001418143.1|  predicted protein                                  212   2e-65   Ostreococcus lucimarinus CCE9901
ref|XP_005843942.1|  hypothetical protein CHLNCDRAFT_27583              209   2e-64   Chlorella variabilis
emb|CEF98211.1|  Proteasome A-type subunit                              209   2e-64   Ostreococcus tauri
ref|XP_006932865.1|  PREDICTED: proteasome subunit alpha type-6 i...    203   1e-62   Felis catus [cat]
gb|KIY96698.1|  20S proteasome subunit alpha 1                          206   1e-62   Monoraphidium neglectum
ref|XP_004436462.1|  PREDICTED: proteasome subunit alpha type-6 i...    204   2e-62   Ceratotherium simum simum [southern square-lipped rhinoceros]
ref|XP_009209663.1|  PREDICTED: proteasome subunit alpha type-6 i...    204   2e-62   
ref|XP_005865030.1|  PREDICTED: proteasome subunit alpha type-6         204   2e-62   Myotis brandtii
ref|XP_005656349.1|  PREDICTED: proteasome subunit alpha type-6 i...    204   2e-62   
gb|ABM86477.1|  proteasome (prosome, macropain) subunit, alpha ty...    204   2e-62   synthetic construct
ref|XP_004698589.1|  PREDICTED: proteasome subunit alpha type-6         204   2e-62   Echinops telfairi [lesser hedgehog tenrec]
ref|NP_058979.1|  proteasome subunit alpha type-6                       204   2e-62   Rattus norvegicus [brown rat]
gb|EDL36728.1|  proteasome (prosome, macropain) subunit, alpha ty...    204   2e-62   Mus musculus [mouse]
ref|XP_537412.2|  PREDICTED: proteasome subunit alpha type-6 isof...    204   2e-62   Canis lupus familiaris [dogs]
ref|XP_004649175.1|  PREDICTED: proteasome subunit alpha type-6         204   2e-62   Jaculus jaculus
ref|XP_007436765.1|  PREDICTED: proteasome subunit alpha type-6         204   2e-62   Python bivittatus
ref|XP_006172412.1|  PREDICTED: LOW QUALITY PROTEIN: proteasome (...    204   3e-62   Tupaia chinensis
emb|CDS07623.1|  Putative Proteasome subunit alpha type                 204   3e-62   Lichtheimia ramosa
ref|NP_036098.1|  proteasome subunit alpha type-6                       204   3e-62   Mus musculus [mouse]
ref|XP_006835407.1|  PREDICTED: proteasome subunit alpha type-6 i...    204   3e-62   Chrysochloris asiatica
ref|XP_003471921.1|  PREDICTED: proteasome subunit alpha type-6         204   3e-62   Cavia porcellus [guinea pig]
ref|XP_006793167.1|  PREDICTED: proteasome subunit alpha type-6-like    204   3e-62   Neolamprologus brichardi [lyretail cichlid]
ref|XP_004470220.1|  PREDICTED: proteasome subunit alpha type-6         204   3e-62   Dasypus novemcinctus
ref|XP_007180773.1|  PREDICTED: proteasome subunit alpha type-6         204   3e-62   Balaenoptera acutorostrata scammoni
gb|ERE72543.1|  proteasome subunit alpha type-6-like protein            204   3e-62   Cricetulus griseus [Chinese hamsters]
ref|XP_006985315.1|  PREDICTED: proteasome subunit alpha type-6         204   3e-62   Peromyscus maniculatus bairdii
ref|NP_001264372.1|  proteasome subunit alpha type-6                    204   3e-62   Gallus gallus [bantam]
ref|XP_009901279.1|  PREDICTED: proteasome subunit alpha type-6 i...    204   4e-62   Picoides pubescens
ref|XP_001363110.1|  PREDICTED: proteasome subunit alpha type-6         204   4e-62   Monodelphis domestica
ref|NP_001232198.1|  putative proteasome subunit alpha type 6           204   4e-62   Taeniopygia guttata
ref|XP_001095366.1|  PREDICTED: proteasome subunit alpha type-6-l...    204   4e-62   
ref|XP_006258805.1|  PREDICTED: proteasome subunit alpha type-6         203   4e-62   Alligator mississippiensis
gb|KFW08632.1|  Proteasome subunit alpha type-6                         203   4e-62   Eurypyga helias
ref|XP_010153544.1|  PREDICTED: proteasome subunit alpha type-6 i...    202   5e-62   Eurypyga helias
ref|NP_001132918.1|  proteasome subunit alpha type-6                    203   5e-62   Ovis aries [domestic sheep]
ref|XP_010153543.1|  PREDICTED: proteasome subunit alpha type-6 i...    203   6e-62   Eurypyga helias
ref|NP_001002589.1|  proteasome subunit alpha type-6                    203   6e-62   Danio rerio [leopard danio]
ref|XP_005285405.1|  PREDICTED: proteasome subunit alpha type-6 i...    203   7e-62   Chrysemys picta bellii
ref|NP_001088418.1|  uncharacterized protein LOC495277                  203   7e-62   Xenopus laevis [clawed frog]
ref|XP_005149366.1|  PREDICTED: proteasome subunit alpha type-6         202   8e-62   
emb|CDH55408.1|  proteasome subunit alpha type-6                        202   9e-62   Lichtheimia corymbifera JMRC:FSU:9682
ref|XP_003924255.1|  PREDICTED: proteasome subunit alpha type-6         204   9e-62   Saimiri boliviensis boliviensis
ref|NP_989113.1|  proteasome subunit alpha type-6                       202   1e-61   Xenopus tropicalis [western clawed frog]
ref|XP_007530301.1|  PREDICTED: proteasome subunit alpha type-6         202   1e-61   Erinaceus europaeus [common hedgehog]
gb|ACO08744.1|  Proteasome subunit alpha type 6                         200   1e-61   Oncorhynchus mykiss
emb|CEG74212.1|  Putative Proteasome subunit alpha type                 202   1e-61   Rhizopus microsporus
ref|XP_001511492.1|  PREDICTED: proteasome subunit alpha type-6 i...    202   1e-61   Ornithorhynchus anatinus [duck-billed platypus]
ref|NP_001132944.1|  proteasome subunit alpha type-6                    202   2e-61   Sus scrofa [pigs]
gb|EIE83838.1|  hypothetical protein RO3G_08543                         202   2e-61   Rhizopus delemar RA 99-880
gb|ETE73021.1|  Proteasome subunit alpha type-6                         203   2e-61   Ophiophagus hannah
ref|XP_002610620.1|  hypothetical protein BRAFLDRAFT_260512             202   2e-61   Branchiostoma floridae
ref|NP_001279159.1|  proteasome (prosome, macropain) subunit, alp...    202   2e-61   Callorhinchus milii [Australian ghost shark]
pdb|4R3O|A  Chain A, Human Constitutive 20s Proteasome                  202   2e-61   Homo sapiens [man]
ref|XP_006632201.1|  PREDICTED: proteasome subunit alpha type-6-like    202   2e-61   Lepisosteus oculatus
gb|ACI66289.1|  Proteasome subunit alpha type-6                         201   2e-61   Salmo salar
ref|XP_007569003.1|  PREDICTED: proteasome subunit alpha type-6         201   2e-61   Poecilia formosa
emb|CDQ90937.1|  unnamed protein product                                201   2e-61   Oncorhynchus mykiss
ref|XP_005810950.1|  PREDICTED: proteasome subunit alpha type-6-like    201   3e-61   Xiphophorus maculatus
ref|XP_008282309.1|  PREDICTED: proteasome subunit alpha type-6         201   3e-61   Stegastes partitus
ref|XP_008396439.1|  PREDICTED: proteasome subunit alpha type-6         201   3e-61   Poecilia reticulata
gb|EPB88050.1|  proteasome subunit alpha type-6                         201   3e-61   Mucor circinelloides f. circinelloides 1006PhL
emb|CAG00121.1|  unnamed protein product                                201   3e-61   Tetraodon nigroviridis
emb|CEP12966.1|  hypothetical protein                                   201   3e-61   Parasitella parasitica
ref|XP_003440740.1|  PREDICTED: proteasome subunit alpha type-6-like    201   3e-61   Oreochromis niloticus
ref|XP_004542308.1|  PREDICTED: proteasome subunit alpha type-6-like    201   3e-61   Maylandia zebra
ref|NP_001086785.1|  proteasome alpha 6 subunit                         201   3e-61   Xenopus laevis [clawed frog]
ref|XP_005158685.1|  PREDICTED: proteasome subunit alpha type-6 i...    201   3e-61   
gb|EDL36727.1|  proteasome (prosome, macropain) subunit, alpha ty...    197   3e-61   Mus musculus [mouse]
ref|XP_005798367.1|  PREDICTED: proteasome subunit alpha type-6-like    201   4e-61   Xiphophorus maculatus
ref|XP_005322784.1|  PREDICTED: proteasome subunit alpha type-6         200   4e-61   
ref|XP_004083706.1|  PREDICTED: proteasome subunit alpha type-6         201   4e-61   Oryzias latipes [Japanese rice fish]
ref|XP_004653726.1|  PREDICTED: proteasome subunit alpha type-6-like    201   4e-61   
ref|XP_005703510.1|  20S proteasome subunit alpha 1                     201   4e-61   Galdieria sulphuraria
emb|CDQ78135.1|  unnamed protein product                                201   5e-61   Oncorhynchus mykiss
ref|XP_007253022.1|  PREDICTED: proteasome subunit alpha type-6-l...    201   5e-61   Astyanax mexicanus [blind cave fish]
dbj|BAE36518.1|  unnamed protein product                                201   5e-61   Mus musculus [mouse]
ref|XP_010744453.1|  PREDICTED: proteasome subunit alpha type-6         201   6e-61   
dbj|GAN03133.1|  proteasome subunit alpha type-6                        201   6e-61   Mucor ambiguus
ref|XP_008300217.1|  PREDICTED: proteasome subunit alpha type-6         200   6e-61   Stegastes partitus
ref|XP_003971508.1|  PREDICTED: proteasome subunit alpha type-6-like    200   6e-61   Takifugu rubripes [tiger puffer]
ref|XP_004559366.1|  PREDICTED: proteasome subunit alpha type-6-like    200   7e-61   Maylandia zebra
ref|XP_003445487.1|  PREDICTED: proteasome subunit alpha type-6-like    200   7e-61   Oreochromis niloticus
ref|XP_010876681.1|  PREDICTED: proteasome subunit alpha type-6         200   7e-61   Esox lucius
ref|XP_005989234.1|  PREDICTED: proteasome subunit alpha type-6         200   7e-61   Latimeria chalumnae
ref|XP_010741287.1|  PREDICTED: proteasome subunit alpha type-6         200   7e-61   
gb|ACO51961.1|  Proteasome subunit alpha type-6                         200   8e-61   Rana catesbeiana [bullfrog]
ref|XP_008398058.1|  PREDICTED: proteasome subunit alpha type-6         200   8e-61   Poecilia reticulata
ref|XP_011419593.1|  PREDICTED: proteasome subunit alpha type-6         199   1e-60   Crassostrea gigas
gb|ESA18832.1|  hypothetical protein GLOINDRAFT_344383                  200   1e-60   
ref|XP_007576015.1|  PREDICTED: proteasome subunit alpha type-6         200   1e-60   Poecilia formosa
gb|ACQ58552.1|  Proteasome subunit alpha type-6                         200   1e-60   Anoplopoma fimbria
ref|XP_005562133.1|  PREDICTED: proteasome subunit alpha type-6-like    199   2e-60   
ref|XP_007253021.1|  PREDICTED: proteasome subunit alpha type-6-l...    200   2e-60   
ref|XP_002824717.1|  PREDICTED: proteasome subunit alpha type-6 i...    199   2e-60   
ref|XP_006015430.1|  PREDICTED: proteasome subunit alpha type-6         203   3e-60   
gb|ACH70968.1|  proteasome (prosome, macropain) subunit, alpha ty...    199   3e-60   Salmo salar
gb|ACH70967.1|  proteasome (prosome, macropain) subunit, alpha ty...    199   3e-60   Salmo salar
ref|XP_010876973.1|  PREDICTED: proteasome subunit alpha type-6         198   4e-60   Esox lucius
gb|ACO08806.1|  Proteasome subunit alpha type 6                         198   4e-60   Oncorhynchus mykiss
gb|ACM08640.1|  Proteasome subunit alpha type-6                         198   5e-60   Salmo salar
ref|XP_010777538.1|  PREDICTED: proteasome subunit alpha type-6         198   5e-60   Notothenia coriiceps [yellowbelly rockcod]
gb|AFK10987.1|  proteasome subunit alpha type-6-like protein            198   6e-60   Callorhinchus milii [Australian ghost shark]
ref|XP_005842332.1|  20S proteasome subunit alpha type 6                198   6e-60   Guillardia theta CCMP2712
ref|XP_002679314.1|  predicted protein                                  198   6e-60   Naegleria gruberi strain NEG-M
ref|NP_705941.1|  proteasome subunit alpha type-6                       197   8e-60   
gb|KFH62604.1|  proteasome subunit alpha type-6                         197   1e-59   Mortierella verticillata NRRL 6337
gb|ACI69778.1|  Proteasome subunit alpha type-6                         197   2e-59   Salmo salar
gb|ACI67177.1|  Proteasome subunit alpha type-6                         193   2e-59   Salmo salar
ref|XP_003706429.1|  PREDICTED: proteasome subunit alpha type-6-like    196   3e-59   Megachile rotundata
gb|ACO08382.1|  Proteasome subunit alpha type 6                         196   3e-59   Oncorhynchus mykiss
ref|XP_008311014.1|  PREDICTED: proteasome subunit alpha type-6         196   3e-59   Cynoglossus semilaevis [half-smooth tongue sole]
gb|ACI66670.1|  Proteasome subunit alpha type-6                         195   3e-59   Salmo salar
gb|ACI69799.1|  Proteasome subunit alpha type-6                         194   4e-59   Salmo salar
ref|XP_002127869.1|  PREDICTED: proteasome subunit alpha type-6-l...    196   5e-59   Ciona intestinalis [sea vase]
ref|XP_004637142.1|  PREDICTED: proteasome subunit alpha type-6         195   6e-59   Octodon degus
ref|XP_011314423.1|  PREDICTED: proteasome subunit alpha type-6-like    195   7e-59   Fopius arisanus
ref|XP_009019631.1|  hypothetical protein HELRODRAFT_106545             195   1e-58   Helobdella robusta
ref|XP_003393493.1|  PREDICTED: proteasome subunit alpha type-6-like    195   1e-58   Bombus terrestris [large earth bumblebee]
ref|XP_011151114.1|  PREDICTED: proteasome subunit alpha type-6-like    194   1e-58   Harpegnathos saltator
ref|XP_001843247.1|  proteasome subunit alpha type 6                    194   2e-58   Culex quinquefasciatus
ref|XP_009860960.1|  PREDICTED: proteasome subunit alpha type-6-l...    194   2e-58   Ciona intestinalis [sea vase]
ref|XP_007873808.1|  hypothetical protein PNEG_01835                    194   2e-58   Pneumocystis murina B123
ref|XP_001640650.1|  predicted protein                                  194   2e-58   Nematostella vectensis
ref|XP_003388491.1|  PREDICTED: proteasome subunit alpha type-6-like    194   2e-58   Amphimedon queenslandica
gb|ELW63324.1|  Proteasome subunit alpha type-6                         192   2e-58   Tupaia chinensis
ref|XP_968655.1|  PREDICTED: proteasome subunit alpha type-6            194   3e-58   Tribolium castaneum [rust-red flour beetle]
ref|XP_002500811.1|  predicted protein                                  195   3e-58   Micromonas commoda
ref|XP_003697298.1|  PREDICTED: proteasome subunit alpha type-6-like    193   3e-58   Apis florea [dwarf honeybee]
gb|ELU01128.1|  hypothetical protein CAPTEDRAFT_167909                  193   4e-58   Capitella teleta
gb|EFX71218.1|  proteasome subunit alpha type 6-like protein            193   4e-58   Daphnia pulex
emb|CDH55409.1|  proteasome subunit alpha type-6                        193   4e-58   Lichtheimia corymbifera JMRC:FSU:9682
ref|XP_001654091.1|  AAEL009898-PA                                      193   4e-58   Aedes aegypti
ref|XP_011494157.1|  PREDICTED: proteasome subunit alpha type-6-like    193   5e-58   Ceratosolen solmsi marchali
ref|XP_009063626.1|  hypothetical protein LOTGIDRAFT_229407             193   5e-58   Lottia gigantea
ref|XP_005350320.1|  PREDICTED: proteasome subunit alpha type-6-like    191   5e-58   
ref|XP_005762775.1|  hypothetical protein EMIHUDRAFT_446206             193   8e-58   Emiliania huxleyi CCMP1516
ref|XP_006608469.1|  PREDICTED: proteasome subunit alpha type-6-like    192   8e-58   Apis dorsata [rock honeybee]
gb|KFB46736.1|  AGAP003935-PA-like protein                              192   1e-57   Anopheles sinensis
ref|XP_318387.2|  AGAP003935-PA                                         192   1e-57   Anopheles gambiae str. PEST
ref|XP_004333676.1|  proteasome subunit alpha type6, putative           192   1e-57   Acanthamoeba castellanii str. Neff
ref|XP_011167410.1|  PREDICTED: proteasome subunit alpha type-6-like    192   1e-57   Solenopsis invicta [imported red fire ant]
ref|XP_011054784.1|  PREDICTED: proteasome subunit alpha type-6-like    192   1e-57   Acromyrmex echinatior
ref|XP_011329096.1|  PREDICTED: proteasome subunit alpha type-6-like    192   2e-57   Ooceraea biroi
ref|XP_005987928.1|  PREDICTED: proteasome subunit alpha type-6-l...    192   2e-57   Latimeria chalumnae
gb|ETN58251.1|  proteasome subunit alpha type 6                         191   2e-57   Anopheles darlingi [American malaria mosquito]
ref|XP_007068323.1|  PREDICTED: proteasome subunit alpha type-6-like    191   2e-57   Chelonia mydas [green seaturtle]
ref|XP_005293216.1|  PREDICTED: proteasome subunit alpha type-6-l...    191   3e-57   Chrysemys picta bellii
ref|XP_006065991.1|  PREDICTED: proteasome subunit alpha type-6-like    191   3e-57   
gb|EFZ13292.1|  hypothetical protein SINV_14495                         191   3e-57   
gb|ABM55423.1|  proteasome subunit alpha type 6-like protein            191   4e-57   Xenopsylla cheopis
gb|ABI13160.1|  putative proteasome alpha subunit                       191   4e-57   Emiliania huxleyi
gb|EIE87129.1|  hypothetical protein RO3G_11840                         191   6e-57   Rhizopus delemar RA 99-880
ref|XP_002113578.1|  hypothetical protein TRIADDRAFT_27191              190   7e-57   Trichoplax adhaerens
ref|XP_008993532.1|  PREDICTED: LOW QUALITY PROTEIN: proteasome s...    190   8e-57   Callithrix jacchus [common marmoset]
ref|XP_008543695.1|  PREDICTED: proteasome subunit alpha type-6-like    189   1e-56   Microplitis demolitor
gb|KFM81155.1|  Proteasome subunit alpha type-6                         189   1e-56   Stegodyphus mimosarum
ref|XP_001607854.1|  PREDICTED: proteasome subunit alpha type-6-like    189   1e-56   
ref|XP_007688022.1|  hypothetical protein COCMIDRAFT_5367               189   2e-56   
ref|XP_005804586.1|  PREDICTED: proteasome subunit alpha type-6-like    189   2e-56   
ref|XP_005099053.1|  PREDICTED: proteasome subunit alpha type-6-like    188   3e-56   
ref|XP_002741353.1|  PREDICTED: proteasome subunit alpha type-6-like    188   4e-56   
ref|XP_010739538.1|  PREDICTED: proteasome subunit alpha type-6-like    188   4e-56   
gb|AEE63435.1|  unknown                                                 187   6e-56   
ref|XP_003303796.1|  hypothetical protein PTT_16156                     188   6e-56   
ref|XP_005356606.1|  PREDICTED: proteasome subunit alpha type-6-like    187   6e-56   
ref|XP_001931683.1|  proteasome subunit alpha type-6                    188   6e-56   
ref|XP_007577895.1|  PREDICTED: proteasome subunit alpha type-6-like    187   6e-56   
ref|XP_008424335.1|  PREDICTED: proteasome subunit alpha type-6-like    187   7e-56   
ref|XP_004349345.1|  proteasome subunit iota                            187   7e-56   
ref|XP_006678757.1|  hypothetical protein BATDEDRAFT_88011              187   7e-56   
ref|XP_005177054.1|  PREDICTED: proteasome subunit alpha type-6         187   8e-56   
ref|XP_003449352.1|  PREDICTED: proteasome subunit alpha type-6-like    187   9e-56   
ref|XP_011259025.1|  PREDICTED: proteasome subunit alpha type-6-like    187   1e-55   
ref|XP_008712166.1|  hypothetical protein HMPREF1541_09269              187   1e-55   
ref|XP_006801196.1|  PREDICTED: proteasome subunit alpha type-6-l...    187   1e-55   
emb|CBN08618.1|  proteasome (prosome, macropain) subunit, alpha t...    186   2e-55   
gb|AGM32386.1|  proteasome subunit alpha type-6                         186   2e-55   
ref|XP_004075507.1|  PREDICTED: proteasome subunit alpha type-6-like    186   2e-55   
ref|XP_003740511.1|  PREDICTED: proteasome subunit alpha type-6-like    186   3e-55   
ref|XP_004562835.1|  PREDICTED: proteasome subunit alpha type-6-like    186   3e-55   
ref|XP_005751769.1|  PREDICTED: proteasome subunit alpha type-6-like    186   4e-55   
ref|XP_003844849.1|  similar to proteasome subunit alpha type-6         186   4e-55   
gb|EPE09739.1|  proteasome subunit alpha type 6                         186   4e-55   
ref|XP_008307633.1|  PREDICTED: proteasome subunit alpha type-6-like    185   5e-55   
ref|XP_002551204.1|  proteasome component C7-alpha                      186   6e-55   
ref|XP_456708.1|  DEHA2A08734p                                          185   8e-55   
gb|KDR14657.1|  Proteasome subunit alpha type-6                         185   8e-55   
emb|CCU98368.1|  unnamed protein product                                186   8e-55   
ref|XP_002841029.1|  hypothetical protein                               185   8e-55   
gb|EMF14550.1|  N-terminal nucleophile aminohydrolase                   185   9e-55   
emb|CDQ88726.1|  unnamed protein product                                184   9e-55   
gb|ACI70015.1|  Proteasome subunit alpha type-6                         184   9e-55   
ref|XP_002411749.1|  proteasome subunit alpha type, putative            184   1e-54   
emb|CDM30570.1|  Probable proteasome subunit alpha type-6               184   1e-54   
ref|XP_004535732.1|  PREDICTED: proteasome subunit alpha type-6-l...    184   1e-54   
ref|XP_002143952.1|  proteasome component Prs2, putative                184   1e-54   
gb|KIW08744.1|  hypothetical protein PV09_00682                         184   1e-54   
ref|XP_009649783.1|  proteasome subunit alpha type-6-A                  184   1e-54   
ref|XP_007731114.1|  proteasome subunit alpha type-6                    184   1e-54   
emb|CAG06433.1|  unnamed protein product                                184   1e-54   
gb|EFX02870.1|  proteasome subunit alpha type 6                         184   2e-54   
ref|XP_008290377.1|  PREDICTED: proteasome subunit alpha type-6-like    184   2e-54   
ref|XP_001383008.1|  hypothetical protein PICST_41423                   184   2e-54   
gb|ADO27866.1|  proteasome subunit alpha type-6                         184   2e-54   
tpe|CBF76587.1|  TPA: proteasome core alpha 1 component (Eurofung)      184   2e-54   
gb|EIF47110.1|  proteasome subunit alpha type-6                         180   2e-54   
ref|XP_006696698.1|  hypothetical protein CTHT_0063920                  184   2e-54   
gb|EPS29950.1|  hypothetical protein PDE_04900                          184   2e-54   
emb|CDQ77351.1|  unnamed protein product                                184   2e-54   
ref|NP_001187798.1|  proteasome subunit alpha type-6                    184   2e-54   
gb|ACM09335.1|  Proteasome subunit alpha type-6                         184   2e-54   
gb|KGO36960.1|  Proteasome A-type subunit                               184   2e-54   
ref|XP_011190787.1|  PREDICTED: proteasome subunit alpha type-6-like    183   3e-54   
ref|XP_002480335.1|  proteasome component Prs2, putative                184   3e-54   
ref|XP_717661.1|  hypothetical protein CaO19.12833                      183   3e-54   
ref|XP_011207521.1|  PREDICTED: proteasome subunit alpha type-6         183   3e-54   
gb|KGK38890.1|  hypothetical protein JL09_g1926                         184   3e-54   
gb|KGR10582.1|  20S proteasome subunit alpha 1                          183   3e-54   
ref|XP_001244388.1|  hypothetical protein CIMG_03829                    184   3e-54   
ref|XP_717755.1|  hypothetical protein CaO19.5378                       183   3e-54   
gb|KID80249.1|  proteasome subunit alpha type 6                         183   3e-54   
ref|XP_003968812.1|  PREDICTED: proteasome subunit alpha type-6-like    181   3e-54   
gb|EKG12338.1|  Proteasome alpha-subunit conserved site                 183   3e-54   
ref|XP_003216618.1|  PREDICTED: proteasome subunit alpha type-6         183   3e-54   
ref|XP_002419018.1|  alpha subunit of the 20S core complex of the...    183   3e-54   
gb|KHC64481.1|  20S proteasome subunit alpha 1                          183   3e-54   
ref|XP_007586723.1|  putative proteasome subunit alpha type-6 pro...    183   4e-54   
ref|XP_007821798.1|  Proteasome A-type subunit                          183   4e-54   
gb|KFG86753.1|  proteasome subunit alpha type 6                         183   4e-54   
ref|XP_004997606.1|  proteasome subunit alpha type-6                    183   4e-54   
ref|XP_007807465.1|  proteasome subunit alpha type 6                    183   5e-54   
ref|XP_002559377.1|  Pc13g09540                                         183   5e-54   
gb|EPQ67273.1|  hypothetical protein BGT96224_A21417                    183   5e-54   
ref|XP_001749972.1|  hypothetical protein                               182   5e-54   
gb|EEH39752.2|  proteasome component C7-alpha                           183   5e-54   
gb|KID99895.1|  proteasome subunit alpha type 6                         183   5e-54   
ref|XP_010755906.1|  hypothetical protein PADG_00615                    183   6e-54   
gb|AAK40123.1|AF354751_1  proteasome subunit alpha Type 6-B             182   6e-54   
ref|XP_003008821.1|  proteasome subunit alpha type-6-B                  182   7e-54   
gb|EMG46214.1|  Proteasome component C7-alpha                           182   7e-54   
ref|XP_009158794.1|  proteasome subunit alpha type-6                    182   7e-54   
gb|KHC80025.1|  20S proteasome subunit alpha 1                          182   7e-54   
dbj|GAD99016.1|  predicted protein                                      185   8e-54   
gb|KIW74909.1|  hypothetical protein Z517_11680                         182   8e-54   
ref|XP_001271130.1|  predicted protein                                  182   8e-54   
ref|XP_006117859.1|  PREDICTED: proteasome subunit alpha type-6         182   9e-54   
ref|XP_001730989.1|  hypothetical protein MGL_1988                      183   9e-54   
gb|KIW28395.1|  hypothetical protein PV07_08062                         182   1e-53   
ref|XP_501500.1|  YALI0C06039p                                          182   1e-53   
gb|KFA67907.1|  hypothetical protein S40285_04100                       182   1e-53   
ref|XP_008881328.1|  hypothetical protein H310_15130                    182   1e-53   
gb|EPS95905.1|  hypothetical protein FOMPIDRAFT_1131639                 182   1e-53   
gb|KDB16148.1|  proteasome subunit alpha type 6                         182   1e-53   
gb|EQL00512.1|  proteasome subunit alpha type 6                         182   1e-53   
ref|XP_009831249.1|  hypothetical protein H257_07425                    182   1e-53   
ref|XP_001361000.1|  GA15805                                            182   1e-53   
ref|XP_007295783.1|  proteasome subunit alpha type 6                    182   1e-53   
emb|CEJ93046.1|  Putative Proteasome subunit alpha type                 182   1e-53   
ref|XP_001796064.1|  hypothetical protein SNOG_05667                    182   1e-53   
ref|XP_003649967.1|  hypothetical protein THITE_2109162                 182   1e-53   
gb|KIL96483.1|  hypothetical protein FAVG1_01227                        182   1e-53   
emb|CCE29503.1|  probable SCL1-20S proteasome subunit YC7ALPHA/Y8...    182   1e-53   
gb|KDN66300.1|  putative proteasome A-type and B-type                   182   1e-53   
gb|EFQ28985.1|  proteasome A-type and B-type                            182   1e-53   
ref|XP_007796832.1|  putative proteasome subunit alpha type 6 pro...    182   1e-53   
gb|KIW87420.1|  hypothetical protein Z519_12056                         182   2e-53   
gb|KEQ85758.1|  proteasome core particle subunit alpha 1                182   2e-53   
ref|XP_003662349.1|  hypothetical protein MYCTH_2302907                 182   2e-53   
ref|XP_002553818.1|  KLTH0E07788p                                       181   2e-53   
ref|XP_001819832.1|  proteasome subunit alpha type-6                    182   2e-53   
ref|NP_001150310.1|  proteasome subunit alpha type 6                    182   2e-53   
gb|KDQ65121.1|  hypothetical protein JAAARDRAFT_28780                   182   2e-53   
gb|EGU87091.1|  hypothetical protein FOXB_02485                         182   2e-53   
ref|XP_009255010.1|  hypothetical protein FPSE_03616                    181   2e-53   
ref|XP_007741776.1|  20S proteasome subunit alpha 1                     182   2e-53   
gb|KIX01010.1|  hypothetical protein Z518_10076                         181   2e-53   
ref|XP_007719836.1|  proteasome subunit alpha type-6                    181   2e-53   
ref|XP_011319207.1|  proteasome component C7-alpha                      181   2e-53   
emb|CCD44572.1|  similar to proteasome subunit alpha type 6             180   2e-53   
ref|XP_002004197.1|  GI19734                                            181   2e-53   
gb|KFY28594.1|  hypothetical protein V493_02857                         181   2e-53   
ref|XP_001986319.1|  GH20588                                            181   2e-53   
gb|EHK16557.1|  hypothetical protein TRIVIDRAFT_75344                   181   2e-53   
ref|XP_007601883.1|  proteasome A-type and B-type                       181   2e-53   
emb|CCF38339.1|  proteasome A-type and B-type                           181   2e-53   
emb|CCC12323.1|  unnamed protein product                                181   2e-53   
ref|XP_006963196.1|  proteasome subunit alpha 6                         181   2e-53   
gb|KFY99093.1|  hypothetical protein V500_01465                         181   3e-53   
gb|EME46261.1|  hypothetical protein DOTSEDRAFT_70305                   181   3e-53   
gb|KIV96436.1|  hypothetical protein PV10_00308                         181   3e-53   
gb|KFY37296.1|  hypothetical protein V495_07258                         181   3e-53   
ref|XP_011120711.1|  hypothetical protein AOL_s00075g98                 181   3e-53   
gb|KIW69429.1|  hypothetical protein PV04_05306                         181   3e-53   
emb|CCE44074.1|  hypothetical protein CPAR2_502990                      181   3e-53   
ref|XP_001912148.1|  hypothetical protein                               181   3e-53   
ref|XP_008471137.1|  PREDICTED: proteasome subunit alpha type-6-like    179   4e-53   
ref|XP_003051118.1|  predicted protein                                  181   4e-53   
ref|XP_002623465.1|  proteasome component C7-alpha                      181   4e-53   
gb|KEQ92672.1|  hypothetical protein AUEXF2481DRAFT_31918               181   4e-53   
gb|KFY66093.1|  hypothetical protein V496_02185                         181   4e-53   
gb|KFY13879.1|  hypothetical protein V492_03002                         181   4e-53   
gb|KFX91072.1|  hypothetical protein V490_06088                         181   4e-53   
ref|XP_002427127.1|  proteasome subunit alpha type, putative            180   4e-53   
ref|XP_003869616.1|  Scl1 proteasome subunit YC7alpha                   180   4e-53   
gb|ERS99418.1|  hypothetical protein HMPREF1624_04618                   181   4e-53   
gb|KEQ62212.1|  proteasome core particle subunit alpha 1                181   5e-53   
ref|XP_001224606.1|  conserved hypothetical protein                     181   5e-53   
ref|XP_010896958.1|  PREDICTED: proteasome subunit alpha type-6-l...    180   5e-53   
ref|XP_002159995.1|  PREDICTED: proteasome subunit alpha type-6-like    180   5e-53   
ref|XP_009222727.1|  proteasome subunit alpha type-6                    181   5e-53   
gb|ELR02822.1|  20S proteasome subunit alpha 1                          180   5e-53   
gb|EQB51932.1|  proteasome A-type and B-type                            181   5e-53   
ref|XP_002059362.1|  GJ18434                                            180   5e-53   
gb|KFH45227.1|  Proteasome subunit alpha-like protein                   180   6e-53   
ref|XP_002796053.1|  proteasome component C7-alpha                      182   6e-53   
gb|EHK40697.1|  hypothetical protein TRIATDRAFT_301498                  180   6e-53   
ref|NP_001040459.1|  proteasome subunit alpha type 6-A                  180   6e-53   
emb|CEF75633.1|  unnamed protein product                                180   6e-53   
gb|KEQ76497.1|  proteasome core particle subunit alpha 1                180   7e-53   
gb|KIN06410.1|  hypothetical protein OIDMADRAFT_141988                  180   7e-53   
ref|XP_002470366.1|  predicted protein                                  179   7e-53   
ref|XP_008724612.1|  hypothetical protein G647_10399                    180   7e-53   
gb|ENH81729.1|  proteasome subunit alpha type 6                         180   7e-53   
ref|XP_007315239.1|  hypothetical protein SERLADRAFT_460060             180   7e-53   
ref|XP_002850566.1|  proteasome subunit alpha type 6                    180   7e-53   
ref|XP_007756206.1|  proteasome subunit alpha type-6                    180   7e-53   
ref|XP_007912348.1|  putative proteasome subunit alpha type 6 pro...    180   7e-53   
gb|KEY66092.1|  hypothetical protein S7711_09211                        181   8e-53   
ref|XP_002463176.1|  hypothetical protein SORBIDRAFT_02g039140          179   8e-53   
ref|XP_003857582.1|  proteasome core particle subunit alpha 1           180   8e-53   
gb|KFA73659.1|  hypothetical protein S40288_07644                       181   8e-53   
ref|XP_001548586.1|  conserved hypothetical protein                     180   9e-53   
gb|EEH04842.1|  proteasome subunit alpha                                180   9e-53   
gb|KII96075.1|  hypothetical protein PLICRDRAFT_35036                   180   1e-52   
ref|NP_986577.1|  AGL089Wp                                              179   1e-52   
ref|XP_957907.1|  proteasome subunit alpha type 6                       179   1e-52   
ref|XP_007926644.1|  hypothetical protein MYCFIDRAFT_188442             179   1e-52   
gb|KHJ35771.1|  putative proteasome subunit alpha type 6                179   1e-52   
ref|NP_571870.2|  proteasome alpha 6b subunit                           179   1e-52   
ref|XP_003323788.2|  proteasome subunit alpha type-6                    179   1e-52   
ref|XP_007833194.1|  Proteasome subunit alpha type-6                    179   1e-52   
ref|NP_001155664.1|  proteasome subunit alpha type 6-like               179   1e-52   
gb|AAR09773.1|  similar to Drosophila melanogaster Prosalpha6           177   2e-52   
gb|KIW43338.1|  hypothetical protein PV06_04450                         179   2e-52   
ref|XP_007003851.1|  hypothetical protein TREMEDRAFT_29712              179   2e-52   
ref|XP_007364473.1|  20S proteasome subunit                             179   2e-52   
ref|XP_003717769.1|  proteasome subunit alpha type-6                    179   2e-52   
emb|CDR38830.1|  CYFA0S02e06568g1_1                                     179   2e-52   
ref|XP_001841217.1|  proteasome subunit iota                            179   2e-52   
gb|ACQ58422.1|  Proteasome subunit alpha type-6                         179   2e-52   
ref|XP_007234010.1|  PREDICTED: proteasome subunit alpha type-6-like    179   2e-52   
ref|XP_007417761.1|  hypothetical protein MELLADRAFT_79569              179   2e-52   
dbj|BAM18567.1|  proteasome alpha1 subunit                              178   2e-52   
ref|XP_001960978.1|  GF11235                                            178   2e-52   
ref|XP_008599361.1|  proteasome A-type and B-type                       179   3e-52   
gb|ABY55470.1|  Prosalpha6                                              178   3e-52   
ref|NP_724614.1|  proteasome alpha1 subunit, isoform A                  178   3e-52   
ref|XP_002032815.1|  GM20751                                            178   3e-52   
gb|KGQ11560.1|  Proteasome subunit alpha type-6                         178   3e-52   
ref|XP_008608969.1|  proteasome subunit alpha type-6                    178   3e-52   
ref|XP_003026186.1|  hypothetical protein SCHCODRAFT_79949              179   3e-52   
gb|EMD31810.1|  20S proteasome subunit                                  179   3e-52   
ref|NP_595374.1|  20S proteasome component alpha 1 (predicted)          178   3e-52   
dbj|GAM85636.1|  hypothetical protein ANO11243_036430                   178   3e-52   
gb|KHN94324.1|  proteasome subunit alpha type 6                         179   4e-52   
ref|XP_002089534.1|  Prosalpha6                                         178   4e-52   
ref|XP_568975.1|  hypothetical protein                                  178   4e-52   
emb|CDO78061.1|  hypothetical protein BN946_scf184826.g6                178   4e-52   
gb|AFR93501.1|  20S proteasome subunit alpha 1                          178   5e-52   
ref|XP_003191167.1|  20S proteasome subunit alpha 1                     178   5e-52   
ref|XP_007861673.1|  hypothetical protein GLOTRDRAFT_33056              178   5e-52   
gb|KIR85438.1|  20S proteasome subunit alpha 1                          178   5e-52   
gb|KIR59797.1|  20S proteasome subunit alpha 1                          178   5e-52   
gb|KIM84053.1|  hypothetical protein PILCRDRAFT_6893                    178   5e-52   
emb|CDK28281.1|  unnamed protein product                                177   5e-52   
gb|KGB79631.1|  20S proteasome subunit                                  178   5e-52   
ref|XP_007381678.1|  20S proteasome subunit                             178   6e-52   



>ref|XP_002271929.1| PREDICTED: proteasome subunit alpha type-6 [Vitis vinifera]
 emb|CAN73517.1| hypothetical protein VITISV_005460 [Vitis vinifera]
 emb|CBI35851.3| unnamed protein product [Vitis vinifera]
Length=246

 Score =   291 bits (744),  Expect = 3e-96, Method: Compositional matrix adjust.
 Identities = 138/142 (97%), Positives = 142/142 (100%), Gaps = 0/142 (0%)
 Frame = +1

Query  85   MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL  264
            MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKA+GITSIGVRGKDSVCVVTQKKVPDKL
Sbjct  1    MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKASGITSIGVRGKDSVCVVTQKKVPDKL  60

Query  265  LDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYEMPVDVLARWIAD  444
            LDQTSVTHLFP+TK+LGLLATG+TADARTLVQQARNEAAEFRFRYGYEMPVDVLARWIAD
Sbjct  61   LDQTSVTHLFPITKFLGLLATGMTADARTLVQQARNEAAEFRFRYGYEMPVDVLARWIAD  120

Query  445  KSQVYTQHAYMRPLGVVAMILG  510
            KSQVYTQHAYMRPLGVVAMILG
Sbjct  121  KSQVYTQHAYMRPLGVVAMILG  142



>gb|KDP33929.1| hypothetical protein JCGZ_07500 [Jatropha curcas]
Length=246

 Score =   290 bits (742),  Expect = 5e-96, Method: Compositional matrix adjust.
 Identities = 137/142 (96%), Positives = 141/142 (99%), Gaps = 0/142 (0%)
 Frame = +1

Query  85   MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL  264
            MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAA ITSIGVRGKDSVCVVTQKKVPDKL
Sbjct  1    MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAAITSIGVRGKDSVCVVTQKKVPDKL  60

Query  265  LDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYEMPVDVLARWIAD  444
            LDQTSVTHLFP+TKYLGLLATG+TADARTLVQQARNEAAEFRFRYGYEMPVDVLA+WIAD
Sbjct  61   LDQTSVTHLFPITKYLGLLATGMTADARTLVQQARNEAAEFRFRYGYEMPVDVLAKWIAD  120

Query  445  KSQVYTQHAYMRPLGVVAMILG  510
            KSQVYTQHAYMRPLGVVAM+LG
Sbjct  121  KSQVYTQHAYMRPLGVVAMVLG  142



>ref|XP_008228175.1| PREDICTED: proteasome subunit alpha type-6 [Prunus mume]
Length=246

 Score =   290 bits (742),  Expect = 5e-96, Method: Compositional matrix adjust.
 Identities = 136/142 (96%), Positives = 142/142 (100%), Gaps = 0/142 (0%)
 Frame = +1

Query  85   MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL  264
            MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL
Sbjct  1    MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL  60

Query  265  LDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYEMPVDVLARWIAD  444
            LDQTSVTHLFP+TK+LGLLATG+TADARTLVQQARNEAAEFRF+YGYEMPVDVLARWIAD
Sbjct  61   LDQTSVTHLFPITKFLGLLATGMTADARTLVQQARNEAAEFRFKYGYEMPVDVLARWIAD  120

Query  445  KSQVYTQHAYMRPLGVVAMILG  510
            KSQ+YTQHAYMRPLGVVAM+LG
Sbjct  121  KSQIYTQHAYMRPLGVVAMVLG  142



>gb|KJB65225.1| hypothetical protein B456_010G089600 [Gossypium raimondii]
Length=247

 Score =   290 bits (742),  Expect = 6e-96, Method: Compositional matrix adjust.
 Identities = 136/142 (96%), Positives = 142/142 (100%), Gaps = 0/142 (0%)
 Frame = +1

Query  85   MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL  264
            MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL
Sbjct  1    MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL  60

Query  265  LDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYEMPVDVLARWIAD  444
            LDQTSVTHLFP+TK+LGLLATG+TADARTLVQQARNEAAEFRFRYGYEMPVDVL++WIAD
Sbjct  61   LDQTSVTHLFPITKFLGLLATGMTADARTLVQQARNEAAEFRFRYGYEMPVDVLSKWIAD  120

Query  445  KSQVYTQHAYMRPLGVVAMILG  510
            KSQVYTQHAYMRPLGVVAM+LG
Sbjct  121  KSQVYTQHAYMRPLGVVAMVLG  142



>gb|KHG01950.1| Proteasome subunit alpha type-6 [Gossypium arboreum]
Length=246

 Score =   290 bits (742),  Expect = 6e-96, Method: Compositional matrix adjust.
 Identities = 136/142 (96%), Positives = 142/142 (100%), Gaps = 0/142 (0%)
 Frame = +1

Query  85   MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL  264
            MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL
Sbjct  1    MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL  60

Query  265  LDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYEMPVDVLARWIAD  444
            LDQTSVTHLFP+TK+LGLLATG+TADARTLVQQARNEAAEFRFRYGYEMPVDVL++WIAD
Sbjct  61   LDQTSVTHLFPITKFLGLLATGMTADARTLVQQARNEAAEFRFRYGYEMPVDVLSKWIAD  120

Query  445  KSQVYTQHAYMRPLGVVAMILG  510
            KSQVYTQHAYMRPLGVVAM+LG
Sbjct  121  KSQVYTQHAYMRPLGVVAMVLG  142



>gb|KJB82986.1| hypothetical protein B456_013G223200 [Gossypium raimondii]
Length=246

 Score =   290 bits (742),  Expect = 6e-96, Method: Compositional matrix adjust.
 Identities = 136/142 (96%), Positives = 142/142 (100%), Gaps = 0/142 (0%)
 Frame = +1

Query  85   MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL  264
            MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL
Sbjct  1    MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL  60

Query  265  LDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYEMPVDVLARWIAD  444
            LDQTSVTHLFP+TK+LGLLATG+TADARTLVQQARNEAAEFRFRYGYEMPVDVL++WIAD
Sbjct  61   LDQTSVTHLFPITKFLGLLATGMTADARTLVQQARNEAAEFRFRYGYEMPVDVLSKWIAD  120

Query  445  KSQVYTQHAYMRPLGVVAMILG  510
            KSQVYTQHAYMRPLGVVAM+LG
Sbjct  121  KSQVYTQHAYMRPLGVVAMVLG  142



>gb|KJB65226.1| hypothetical protein B456_010G089600 [Gossypium raimondii]
Length=246

 Score =   290 bits (741),  Expect = 7e-96, Method: Compositional matrix adjust.
 Identities = 136/142 (96%), Positives = 142/142 (100%), Gaps = 0/142 (0%)
 Frame = +1

Query  85   MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL  264
            MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL
Sbjct  1    MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL  60

Query  265  LDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYEMPVDVLARWIAD  444
            LDQTSVTHLFP+TK+LGLLATG+TADARTLVQQARNEAAEFRFRYGYEMPVDVL++WIAD
Sbjct  61   LDQTSVTHLFPITKFLGLLATGMTADARTLVQQARNEAAEFRFRYGYEMPVDVLSKWIAD  120

Query  445  KSQVYTQHAYMRPLGVVAMILG  510
            KSQVYTQHAYMRPLGVVAM+LG
Sbjct  121  KSQVYTQHAYMRPLGVVAMVLG  142



>ref|XP_007215872.1| hypothetical protein PRUPE_ppa010523mg [Prunus persica]
 gb|EMJ17071.1| hypothetical protein PRUPE_ppa010523mg [Prunus persica]
Length=246

 Score =   290 bits (741),  Expect = 7e-96, Method: Compositional matrix adjust.
 Identities = 136/142 (96%), Positives = 142/142 (100%), Gaps = 0/142 (0%)
 Frame = +1

Query  85   MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL  264
            MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL
Sbjct  1    MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL  60

Query  265  LDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYEMPVDVLARWIAD  444
            LDQTSVTHLFP+TK+LGLLATG+TADARTLVQQARNEAAEFRF+YGYEMPVDVLARWIAD
Sbjct  61   LDQTSVTHLFPITKFLGLLATGMTADARTLVQQARNEAAEFRFKYGYEMPVDVLARWIAD  120

Query  445  KSQVYTQHAYMRPLGVVAMILG  510
            KSQ+YTQHAYMRPLGVVAM+LG
Sbjct  121  KSQIYTQHAYMRPLGVVAMVLG  142



>ref|XP_009797939.1| PREDICTED: proteasome subunit alpha type-6 [Nicotiana sylvestris]
 sp|Q9XG77.1|PSA6_TOBAC RecName: Full=Proteasome subunit alpha type-6; AltName: Full=20S 
proteasome alpha subunit A; AltName: Full=20S proteasome 
subunit alpha-1 [Nicotiana tabacum]
 emb|CAB39975.1| PRCI [Nicotiana tabacum]
Length=246

 Score =   290 bits (741),  Expect = 7e-96, Method: Compositional matrix adjust.
 Identities = 136/142 (96%), Positives = 142/142 (100%), Gaps = 0/142 (0%)
 Frame = +1

Query  85   MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL  264
            MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL
Sbjct  1    MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL  60

Query  265  LDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYEMPVDVLARWIAD  444
            LDQTSV+HLFP+TKYLGLLATG+TADARTLVQQARNEAAEFRF+YGYEMPVDVL++WIAD
Sbjct  61   LDQTSVSHLFPITKYLGLLATGMTADARTLVQQARNEAAEFRFKYGYEMPVDVLSKWIAD  120

Query  445  KSQVYTQHAYMRPLGVVAMILG  510
            KSQVYTQHAYMRPLGVVAMILG
Sbjct  121  KSQVYTQHAYMRPLGVVAMILG  142



>gb|KJB82987.1| hypothetical protein B456_013G223200 [Gossypium raimondii]
Length=247

 Score =   290 bits (741),  Expect = 8e-96, Method: Compositional matrix adjust.
 Identities = 136/142 (96%), Positives = 142/142 (100%), Gaps = 0/142 (0%)
 Frame = +1

Query  85   MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL  264
            MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL
Sbjct  1    MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL  60

Query  265  LDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYEMPVDVLARWIAD  444
            LDQTSVTHLFP+TK+LGLLATG+TADARTLVQQARNEAAEFRFRYGYEMPVDVL++WIAD
Sbjct  61   LDQTSVTHLFPITKFLGLLATGMTADARTLVQQARNEAAEFRFRYGYEMPVDVLSKWIAD  120

Query  445  KSQVYTQHAYMRPLGVVAMILG  510
            KSQVYTQHAYMRPLGVVAM+LG
Sbjct  121  KSQVYTQHAYMRPLGVVAMVLG  142



>ref|XP_009631638.1| PREDICTED: proteasome subunit alpha type-6 [Nicotiana tomentosiformis]
Length=246

 Score =   290 bits (741),  Expect = 9e-96, Method: Compositional matrix adjust.
 Identities = 136/142 (96%), Positives = 142/142 (100%), Gaps = 0/142 (0%)
 Frame = +1

Query  85   MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL  264
            MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL
Sbjct  1    MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL  60

Query  265  LDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYEMPVDVLARWIAD  444
            LDQTSV+HLFP+TKYLGLLATG+TADARTLVQQARNEAAEFRF+YGYEMPVDVL++WIAD
Sbjct  61   LDQTSVSHLFPITKYLGLLATGMTADARTLVQQARNEAAEFRFKYGYEMPVDVLSKWIAD  120

Query  445  KSQVYTQHAYMRPLGVVAMILG  510
            KSQVYTQHAYMRPLGVVAMILG
Sbjct  121  KSQVYTQHAYMRPLGVVAMILG  142



>ref|XP_007012615.1| 20S proteasome subunit PAA2 isoform 1 [Theobroma cacao]
 gb|EOY30234.1| 20S proteasome subunit PAA2 isoform 1 [Theobroma cacao]
Length=246

 Score =   289 bits (740),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 136/142 (96%), Positives = 142/142 (100%), Gaps = 0/142 (0%)
 Frame = +1

Query  85   MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL  264
            MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL
Sbjct  1    MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL  60

Query  265  LDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYEMPVDVLARWIAD  444
            LDQTSVTHLFP+TK+LGLLATG+TADARTLVQQARNEAAEFRFRYGYE+PVDVLA+WIAD
Sbjct  61   LDQTSVTHLFPITKFLGLLATGMTADARTLVQQARNEAAEFRFRYGYELPVDVLAKWIAD  120

Query  445  KSQVYTQHAYMRPLGVVAMILG  510
            KSQVYTQHAYMRPLGVVAM+LG
Sbjct  121  KSQVYTQHAYMRPLGVVAMVLG  142



>gb|KHG04433.1| Proteasome subunit alpha type-6 [Gossypium arboreum]
Length=226

 Score =   288 bits (738),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 136/142 (96%), Positives = 142/142 (100%), Gaps = 0/142 (0%)
 Frame = +1

Query  85   MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL  264
            MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL
Sbjct  1    MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL  60

Query  265  LDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYEMPVDVLARWIAD  444
            LDQTSVTHLFP+TK+LGLLATG+TADARTLVQQARNEAAEFRFRYGYEMPVDVL++WIAD
Sbjct  61   LDQTSVTHLFPITKFLGLLATGMTADARTLVQQARNEAAEFRFRYGYEMPVDVLSKWIAD  120

Query  445  KSQVYTQHAYMRPLGVVAMILG  510
            KSQVYTQHAYMRPLGVVAM+LG
Sbjct  121  KSQVYTQHAYMRPLGVVAMVLG  142



>gb|EYU19318.1| hypothetical protein MIMGU_mgv1a012555mg [Erythranthe guttata]
Length=246

 Score =   288 bits (738),  Expect = 2e-95, Method: Compositional matrix adjust.
 Identities = 137/142 (96%), Positives = 140/142 (99%), Gaps = 0/142 (0%)
 Frame = +1

Query  85   MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL  264
            MSRGSGGGYDRHITIFSPEGRL+QVEYAFKAVKAAGITSIGVRG DSVCVVTQKKVPDKL
Sbjct  1    MSRGSGGGYDRHITIFSPEGRLYQVEYAFKAVKAAGITSIGVRGADSVCVVTQKKVPDKL  60

Query  265  LDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYEMPVDVLARWIAD  444
            LDQTSVTHLFP+TKYLGLLATG+TADARTLVQQARNEAAEFRFRYGYEMP DVLARWIAD
Sbjct  61   LDQTSVTHLFPITKYLGLLATGMTADARTLVQQARNEAAEFRFRYGYEMPADVLARWIAD  120

Query  445  KSQVYTQHAYMRPLGVVAMILG  510
            KSQVYTQHAYMRPLGVVAMILG
Sbjct  121  KSQVYTQHAYMRPLGVVAMILG  142



>ref|XP_011099933.1| PREDICTED: proteasome subunit alpha type-6-like [Sesamum indicum]
Length=246

 Score =   288 bits (737),  Expect = 3e-95, Method: Compositional matrix adjust.
 Identities = 136/142 (96%), Positives = 140/142 (99%), Gaps = 0/142 (0%)
 Frame = +1

Query  85   MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL  264
            MSRGSGGGYDRHITIFSPEGRL+QVEYAFKAVKAAGITSIGVRG DSVCVVTQKKVPDKL
Sbjct  1    MSRGSGGGYDRHITIFSPEGRLYQVEYAFKAVKAAGITSIGVRGADSVCVVTQKKVPDKL  60

Query  265  LDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYEMPVDVLARWIAD  444
            LDQTS+THLFP+TKYLGLLATG+TADARTLVQQARNEAAEFRFRYGYEMPVD LARWIAD
Sbjct  61   LDQTSITHLFPITKYLGLLATGMTADARTLVQQARNEAAEFRFRYGYEMPVDALARWIAD  120

Query  445  KSQVYTQHAYMRPLGVVAMILG  510
            KSQVYTQHAYMRPLGVVAMILG
Sbjct  121  KSQVYTQHAYMRPLGVVAMILG  142



>ref|XP_011098408.1| PREDICTED: proteasome subunit alpha type-6 [Sesamum indicum]
Length=246

 Score =   288 bits (737),  Expect = 3e-95, Method: Compositional matrix adjust.
 Identities = 136/142 (96%), Positives = 140/142 (99%), Gaps = 0/142 (0%)
 Frame = +1

Query  85   MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL  264
            MSRGSGGGYDRHITIFSPEGRL+QVEYAFKAVKAAGITSIGVRG DSVCVVTQKKVPDKL
Sbjct  1    MSRGSGGGYDRHITIFSPEGRLYQVEYAFKAVKAAGITSIGVRGADSVCVVTQKKVPDKL  60

Query  265  LDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYEMPVDVLARWIAD  444
            LDQTS+THLFP+TKYLGLLATG+TADARTLVQQARNEAAEFRFRYGYEMPVD LARWIAD
Sbjct  61   LDQTSITHLFPITKYLGLLATGMTADARTLVQQARNEAAEFRFRYGYEMPVDALARWIAD  120

Query  445  KSQVYTQHAYMRPLGVVAMILG  510
            KSQVYTQHAYMRPLGVVAMILG
Sbjct  121  KSQVYTQHAYMRPLGVVAMILG  142



>ref|XP_004251692.1| PREDICTED: proteasome subunit alpha type-6 [Solanum lycopersicum]
 ref|XP_006345264.1| PREDICTED: proteasome subunit alpha type-6-like [Solanum tuberosum]
Length=246

 Score =   288 bits (737),  Expect = 3e-95, Method: Compositional matrix adjust.
 Identities = 135/142 (95%), Positives = 141/142 (99%), Gaps = 0/142 (0%)
 Frame = +1

Query  85   MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL  264
            MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL
Sbjct  1    MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL  60

Query  265  LDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYEMPVDVLARWIAD  444
            LDQTSV+HLFP+TKYLGLLATG+TADARTLVQQARNEAAEFRF+YGYEMP DVL++WIAD
Sbjct  61   LDQTSVSHLFPITKYLGLLATGMTADARTLVQQARNEAAEFRFKYGYEMPADVLSKWIAD  120

Query  445  KSQVYTQHAYMRPLGVVAMILG  510
            KSQVYTQHAYMRPLGVVAMILG
Sbjct  121  KSQVYTQHAYMRPLGVVAMILG  142



>gb|ACJ11727.1| 20S proteasome subunit alpha-1 [Gossypium hirsutum]
Length=246

 Score =   288 bits (736),  Expect = 4e-95, Method: Compositional matrix adjust.
 Identities = 135/142 (95%), Positives = 141/142 (99%), Gaps = 0/142 (0%)
 Frame = +1

Query  85   MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL  264
            MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVC VTQKKVPDKL
Sbjct  1    MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCFVTQKKVPDKL  60

Query  265  LDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYEMPVDVLARWIAD  444
            LDQTSVTHLFP+TK+LGLLATG+TADARTLVQQARNEAAEFRFRYGYEMPVDVL++WIAD
Sbjct  61   LDQTSVTHLFPITKFLGLLATGMTADARTLVQQARNEAAEFRFRYGYEMPVDVLSKWIAD  120

Query  445  KSQVYTQHAYMRPLGVVAMILG  510
            KSQVYTQHAYMRPLGVVAM+LG
Sbjct  121  KSQVYTQHAYMRPLGVVAMVLG  142



>gb|KDP45827.1| hypothetical protein JCGZ_17434 [Jatropha curcas]
Length=246

 Score =   288 bits (736),  Expect = 5e-95, Method: Compositional matrix adjust.
 Identities = 136/142 (96%), Positives = 141/142 (99%), Gaps = 0/142 (0%)
 Frame = +1

Query  85   MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL  264
            MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAA ITSIGVRGKDSVCVVTQKKVPDKL
Sbjct  1    MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAAITSIGVRGKDSVCVVTQKKVPDKL  60

Query  265  LDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYEMPVDVLARWIAD  444
            LDQTSVT+LFP+TKYLGLLATG+TADARTLVQQARNEAAEFRFRYGYEMPVDVLA+WIAD
Sbjct  61   LDQTSVTNLFPITKYLGLLATGMTADARTLVQQARNEAAEFRFRYGYEMPVDVLAKWIAD  120

Query  445  KSQVYTQHAYMRPLGVVAMILG  510
            KSQVYTQHAYMRPLGVVAM+LG
Sbjct  121  KSQVYTQHAYMRPLGVVAMVLG  142



>ref|XP_010269878.1| PREDICTED: proteasome subunit alpha type-6-like [Nelumbo nucifera]
Length=246

 Score =   288 bits (736),  Expect = 5e-95, Method: Compositional matrix adjust.
 Identities = 135/142 (95%), Positives = 140/142 (99%), Gaps = 0/142 (0%)
 Frame = +1

Query  85   MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL  264
            MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKA+GITSIGVRGKDSVCVVTQKKVPDKL
Sbjct  1    MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKASGITSIGVRGKDSVCVVTQKKVPDKL  60

Query  265  LDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYEMPVDVLARWIAD  444
            LDQTSVTHLFP+TKYLGLLATG+TADARTLVQQARNEAAEFRFRYGYEMPVDVLA+WIAD
Sbjct  61   LDQTSVTHLFPITKYLGLLATGMTADARTLVQQARNEAAEFRFRYGYEMPVDVLAKWIAD  120

Query  445  KSQVYTQHAYMRPLGVVAMILG  510
            KSQ+YTQHAYMRP GV AMILG
Sbjct  121  KSQIYTQHAYMRPFGVAAMILG  142



>gb|ABK96399.1| unknown [Populus trichocarpa x Populus deltoides]
Length=246

 Score =   287 bits (735),  Expect = 5e-95, Method: Compositional matrix adjust.
 Identities = 135/142 (95%), Positives = 138/142 (97%), Gaps = 0/142 (0%)
 Frame = +1

Query  85   MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL  264
            MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAA  TSIGVRGKDSVCVVTQKKVPDKL
Sbjct  1    MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAATTSIGVRGKDSVCVVTQKKVPDKL  60

Query  265  LDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYEMPVDVLARWIAD  444
            LDQTSVTHLFP+TKYLGLLATG+TADAR LVQQARNEAAEFRFRYGYEMPVD LARWIAD
Sbjct  61   LDQTSVTHLFPITKYLGLLATGMTADARNLVQQARNEAAEFRFRYGYEMPVDALARWIAD  120

Query  445  KSQVYTQHAYMRPLGVVAMILG  510
            KSQVYTQHAYMRPLGVVAM+LG
Sbjct  121  KSQVYTQHAYMRPLGVVAMVLG  142



>ref|XP_010541996.1| PREDICTED: proteasome subunit alpha type-6-B [Tarenaya hassleriana]
Length=246

 Score =   287 bits (734),  Expect = 8e-95, Method: Compositional matrix adjust.
 Identities = 134/142 (94%), Positives = 142/142 (100%), Gaps = 0/142 (0%)
 Frame = +1

Query  85   MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL  264
            MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL
Sbjct  1    MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL  60

Query  265  LDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYEMPVDVLARWIAD  444
            LDQ+SVTHLFP+TKYLGLLATG+TADAR+LVQQARNEAA+FRFRYGYEMPVD+LA+WIAD
Sbjct  61   LDQSSVTHLFPITKYLGLLATGMTADARSLVQQARNEAADFRFRYGYEMPVDILAKWIAD  120

Query  445  KSQVYTQHAYMRPLGVVAMILG  510
            KSQVYTQHAYMRPLGVVAM+LG
Sbjct  121  KSQVYTQHAYMRPLGVVAMVLG  142



>ref|XP_009344472.1| PREDICTED: proteasome subunit alpha type-6 [Pyrus x bretschneideri]
 ref|XP_009344473.1| PREDICTED: proteasome subunit alpha type-6 [Pyrus x bretschneideri]
Length=246

 Score =   287 bits (734),  Expect = 9e-95, Method: Compositional matrix adjust.
 Identities = 134/142 (94%), Positives = 141/142 (99%), Gaps = 0/142 (0%)
 Frame = +1

Query  85   MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL  264
            MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL
Sbjct  1    MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL  60

Query  265  LDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYEMPVDVLARWIAD  444
            LDQTSVTHLFP+TK+LGLLATG+TADARTLV QARNEAAEFRF+YGYEMPVDVLA+WIAD
Sbjct  61   LDQTSVTHLFPITKFLGLLATGMTADARTLVSQARNEAAEFRFKYGYEMPVDVLAKWIAD  120

Query  445  KSQVYTQHAYMRPLGVVAMILG  510
            KSQ+YTQHAYMRPLGVVAM+LG
Sbjct  121  KSQIYTQHAYMRPLGVVAMVLG  142



>ref|XP_008391412.1| PREDICTED: proteasome subunit alpha type-6 [Malus domestica]
Length=246

 Score =   287 bits (734),  Expect = 9e-95, Method: Compositional matrix adjust.
 Identities = 134/142 (94%), Positives = 141/142 (99%), Gaps = 0/142 (0%)
 Frame = +1

Query  85   MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL  264
            MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL
Sbjct  1    MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL  60

Query  265  LDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYEMPVDVLARWIAD  444
            LDQTSVTHLFP+TK+LGLLATG+TADARTLV QARNEAAEFRF+YGYEMPVDVLA+WIAD
Sbjct  61   LDQTSVTHLFPITKFLGLLATGMTADARTLVSQARNEAAEFRFKYGYEMPVDVLAKWIAD  120

Query  445  KSQVYTQHAYMRPLGVVAMILG  510
            KSQ+YTQHAYMRPLGVVAM+LG
Sbjct  121  KSQIYTQHAYMRPLGVVAMVLG  142



>ref|XP_006381605.1| hypothetical protein POPTR_0006s14260g [Populus trichocarpa]
 ref|XP_011039970.1| PREDICTED: proteasome subunit alpha type-6 [Populus euphratica]
 gb|ERP59402.1| hypothetical protein POPTR_0006s14260g [Populus trichocarpa]
Length=246

 Score =   286 bits (733),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 135/142 (95%), Positives = 138/142 (97%), Gaps = 0/142 (0%)
 Frame = +1

Query  85   MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL  264
            MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAA  TSIGVRGKDSVCVVTQKKVPDKL
Sbjct  1    MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAATTSIGVRGKDSVCVVTQKKVPDKL  60

Query  265  LDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYEMPVDVLARWIAD  444
            LDQTSVTHLFP+TKYLGLLATG+TADAR LVQQARNEAAEFRFRYGYEMPVD LARWIAD
Sbjct  61   LDQTSVTHLFPITKYLGLLATGMTADARNLVQQARNEAAEFRFRYGYEMPVDALARWIAD  120

Query  445  KSQVYTQHAYMRPLGVVAMILG  510
            KSQVYTQHAYMRPLGVVAM+LG
Sbjct  121  KSQVYTQHAYMRPLGVVAMVLG  142



>ref|XP_006592586.1| PREDICTED: proteasome subunit alpha type-6-like [Glycine max]
 gb|KHN16010.1| Proteasome subunit alpha type-6 [Glycine soja]
Length=246

 Score =   286 bits (733),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 135/142 (95%), Positives = 140/142 (99%), Gaps = 0/142 (0%)
 Frame = +1

Query  85   MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL  264
            MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDS+CVVTQKKVPDKL
Sbjct  1    MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSICVVTQKKVPDKL  60

Query  265  LDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYEMPVDVLARWIAD  444
            LD TSVTHLFP+TKYLGLLATG+TADARTLVQQARNEAAEFRF YGYEMPVDVLA+WIAD
Sbjct  61   LDNTSVTHLFPITKYLGLLATGMTADARTLVQQARNEAAEFRFTYGYEMPVDVLAKWIAD  120

Query  445  KSQVYTQHAYMRPLGVVAMILG  510
            KSQVYTQHAYMRPLGVVAM+LG
Sbjct  121  KSQVYTQHAYMRPLGVVAMVLG  142



>ref|XP_007133143.1| hypothetical protein PHAVU_011G155200g [Phaseolus vulgaris]
 gb|ESW05137.1| hypothetical protein PHAVU_011G155200g [Phaseolus vulgaris]
Length=246

 Score =   286 bits (732),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 136/142 (96%), Positives = 140/142 (99%), Gaps = 0/142 (0%)
 Frame = +1

Query  85   MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL  264
            MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDS+CVVTQKKVPDKL
Sbjct  1    MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSICVVTQKKVPDKL  60

Query  265  LDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYEMPVDVLARWIAD  444
            LDQTSVTHLFP+TKYLGLLATG+TADARTLVQQARNEAAEFRF  GYEMPVDVLARWIAD
Sbjct  61   LDQTSVTHLFPITKYLGLLATGMTADARTLVQQARNEAAEFRFTNGYEMPVDVLARWIAD  120

Query  445  KSQVYTQHAYMRPLGVVAMILG  510
            KSQVYTQHAYMRPLGVVAM+LG
Sbjct  121  KSQVYTQHAYMRPLGVVAMVLG  142



>ref|XP_010557672.1| PREDICTED: proteasome subunit alpha type-6-B-like [Tarenaya hassleriana]
 ref|XP_010557673.1| PREDICTED: proteasome subunit alpha type-6-B-like [Tarenaya hassleriana]
Length=246

 Score =   286 bits (732),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 133/142 (94%), Positives = 142/142 (100%), Gaps = 0/142 (0%)
 Frame = +1

Query  85   MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL  264
            MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL
Sbjct  1    MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL  60

Query  265  LDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYEMPVDVLARWIAD  444
            LDQ+SV+HLFP+TKYLGLLATG+TADAR+LVQQARNEAA+FRFRYGYEMPVD+LA+WIAD
Sbjct  61   LDQSSVSHLFPITKYLGLLATGMTADARSLVQQARNEAADFRFRYGYEMPVDILAKWIAD  120

Query  445  KSQVYTQHAYMRPLGVVAMILG  510
            KSQVYTQHAYMRPLGVVAM+LG
Sbjct  121  KSQVYTQHAYMRPLGVVAMVLG  142



>gb|ACJ85916.1| unknown [Medicago truncatula]
 gb|AFK46669.1| unknown [Medicago truncatula]
 gb|KEH19590.1| proteasome subunit alpha type-6-A protein [Medicago truncatula]
Length=246

 Score =   286 bits (732),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 134/142 (94%), Positives = 141/142 (99%), Gaps = 0/142 (0%)
 Frame = +1

Query  85   MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL  264
            MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVK+AGITSIGVRGKDSVCVVTQKKVPDKL
Sbjct  1    MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKSAGITSIGVRGKDSVCVVTQKKVPDKL  60

Query  265  LDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYEMPVDVLARWIAD  444
            LD TSVTHLFP+TKYLGLLATGITADARTLVQQARNEAAE+RFRYGYEMPVDVL++W+AD
Sbjct  61   LDHTSVTHLFPITKYLGLLATGITADARTLVQQARNEAAEYRFRYGYEMPVDVLSKWVAD  120

Query  445  KSQVYTQHAYMRPLGVVAMILG  510
            KSQVYTQHAYMRPLGVVAM+LG
Sbjct  121  KSQVYTQHAYMRPLGVVAMVLG  142



>ref|XP_004488480.1| PREDICTED: proteasome subunit alpha type-6-like isoform X1 [Cicer 
arietinum]
 ref|XP_004488481.1| PREDICTED: proteasome subunit alpha type-6-like isoform X2 [Cicer 
arietinum]
 ref|XP_004488482.1| PREDICTED: proteasome subunit alpha type-6-like isoform X3 [Cicer 
arietinum]
Length=246

 Score =   286 bits (732),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 135/142 (95%), Positives = 140/142 (99%), Gaps = 0/142 (0%)
 Frame = +1

Query  85   MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL  264
            MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRG DSVCVVTQKKVPDKL
Sbjct  1    MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGNDSVCVVTQKKVPDKL  60

Query  265  LDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYEMPVDVLARWIAD  444
            LDQTSVTHLFP+TKYLGLLATG+TADARTLVQQARNEAAEFR +YGYEMPVDVLA+WIAD
Sbjct  61   LDQTSVTHLFPITKYLGLLATGMTADARTLVQQARNEAAEFRHKYGYEMPVDVLAKWIAD  120

Query  445  KSQVYTQHAYMRPLGVVAMILG  510
            KSQVYTQHAYMRPLGVVAM+LG
Sbjct  121  KSQVYTQHAYMRPLGVVAMVLG  142



>ref|XP_010064020.1| PREDICTED: proteasome subunit alpha type-6 [Eucalyptus grandis]
 gb|KCW71315.1| hypothetical protein EUGRSUZ_F04398 [Eucalyptus grandis]
Length=246

 Score =   286 bits (731),  Expect = 3e-94, Method: Compositional matrix adjust.
 Identities = 134/142 (94%), Positives = 140/142 (99%), Gaps = 0/142 (0%)
 Frame = +1

Query  85   MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL  264
            MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL
Sbjct  1    MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL  60

Query  265  LDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYEMPVDVLARWIAD  444
            LDQTSVTHLFP+TK+LGLLATG+TADARTLVQQARNEAAEFRFR GYEMPVD LA+WIAD
Sbjct  61   LDQTSVTHLFPITKFLGLLATGMTADARTLVQQARNEAAEFRFRNGYEMPVDALAKWIAD  120

Query  445  KSQVYTQHAYMRPLGVVAMILG  510
            KSQ+YTQHAYMRPLGVVAM+LG
Sbjct  121  KSQIYTQHAYMRPLGVVAMVLG  142



>gb|ACU24622.1| unknown [Glycine max]
Length=246

 Score =   285 bits (730),  Expect = 3e-94, Method: Compositional matrix adjust.
 Identities = 134/142 (94%), Positives = 140/142 (99%), Gaps = 0/142 (0%)
 Frame = +1

Query  85   MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL  264
            MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDS+CVVTQKKVPDKL
Sbjct  1    MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSICVVTQKKVPDKL  60

Query  265  LDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYEMPVDVLARWIAD  444
            LD TSVTHLFP+TKYLGLLATG+TADARTLVQQARNEAAEFRF YGYE+PVDVLA+WIAD
Sbjct  61   LDNTSVTHLFPITKYLGLLATGMTADARTLVQQARNEAAEFRFTYGYEIPVDVLAKWIAD  120

Query  445  KSQVYTQHAYMRPLGVVAMILG  510
            KSQVYTQHAYMRPLGVVAM+LG
Sbjct  121  KSQVYTQHAYMRPLGVVAMVLG  142



>emb|CDP03072.1| unnamed protein product [Coffea canephora]
Length=247

 Score =   285 bits (729),  Expect = 5e-94, Method: Compositional matrix adjust.
 Identities = 134/141 (95%), Positives = 140/141 (99%), Gaps = 0/141 (0%)
 Frame = +1

Query  88   SRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKLL  267
            SRGSGGGYDRHITIFSPEGRL+QVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKLL
Sbjct  3    SRGSGGGYDRHITIFSPEGRLYQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKLL  62

Query  268  DQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYEMPVDVLARWIADK  447
            DQTSVTHLFP+TKYLGLLATG+TADARTLVQQARNEAAEFRF++GYEMPVD LA+WIADK
Sbjct  63   DQTSVTHLFPITKYLGLLATGMTADARTLVQQARNEAAEFRFKFGYEMPVDTLAKWIADK  122

Query  448  SQVYTQHAYMRPLGVVAMILG  510
            SQVYTQHAYMRPLGVVAMILG
Sbjct  123  SQVYTQHAYMRPLGVVAMILG  143



>gb|AFK47610.1| unknown [Lotus japonicus]
Length=246

 Score =   285 bits (728),  Expect = 6e-94, Method: Compositional matrix adjust.
 Identities = 134/142 (94%), Positives = 140/142 (99%), Gaps = 0/142 (0%)
 Frame = +1

Query  85   MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL  264
            MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDS+CVVTQKKVPDKL
Sbjct  1    MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSICVVTQKKVPDKL  60

Query  265  LDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYEMPVDVLARWIAD  444
            LDQTSV+HLFP+TKYLGLLATG+TADARTLVQQARNEAAEFR  YGYEMPVDVLA+WIAD
Sbjct  61   LDQTSVSHLFPITKYLGLLATGMTADARTLVQQARNEAAEFRHTYGYEMPVDVLAKWIAD  120

Query  445  KSQVYTQHAYMRPLGVVAMILG  510
            KSQVYTQHAYMRPLGVVAM+LG
Sbjct  121  KSQVYTQHAYMRPLGVVAMVLG  142



>ref|XP_003595788.1| Proteasome subunit alpha type [Medicago truncatula]
 gb|AES66039.1| proteasome subunit alpha type-6-A protein [Medicago truncatula]
 gb|AFK48993.1| unknown [Medicago truncatula]
Length=246

 Score =   285 bits (728),  Expect = 8e-94, Method: Compositional matrix adjust.
 Identities = 134/142 (94%), Positives = 140/142 (99%), Gaps = 0/142 (0%)
 Frame = +1

Query  85   MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL  264
            MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRG DSVCVVTQKKVPDKL
Sbjct  1    MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGNDSVCVVTQKKVPDKL  60

Query  265  LDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYEMPVDVLARWIAD  444
            LDQTSVTHLFP+TKYLGLLATG+TADARTLVQQARNEAAEFR ++GYEMPVDVLA+WIAD
Sbjct  61   LDQTSVTHLFPITKYLGLLATGMTADARTLVQQARNEAAEFRHKFGYEMPVDVLAKWIAD  120

Query  445  KSQVYTQHAYMRPLGVVAMILG  510
            KSQVYTQHAYMRPLGVVAM+LG
Sbjct  121  KSQVYTQHAYMRPLGVVAMVLG  142



>gb|AFK46801.1| unknown [Medicago truncatula]
Length=246

 Score =   284 bits (727),  Expect = 9e-94, Method: Compositional matrix adjust.
 Identities = 134/142 (94%), Positives = 140/142 (99%), Gaps = 0/142 (0%)
 Frame = +1

Query  85   MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL  264
            MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRG DSVCVVTQKKVPDKL
Sbjct  1    MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGNDSVCVVTQKKVPDKL  60

Query  265  LDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYEMPVDVLARWIAD  444
            LDQTSVTHLFP+TKYLGLLATG+TADARTLVQQARNEAAEFR ++GYEMPVDVLA+WIAD
Sbjct  61   LDQTSVTHLFPITKYLGLLATGMTADARTLVQQARNEAAEFRHKFGYEMPVDVLAKWIAD  120

Query  445  KSQVYTQHAYMRPLGVVAMILG  510
            KSQVYTQHAYMRPLGVVAM+LG
Sbjct  121  KSQVYTQHAYMRPLGVVAMVLG  142



>ref|XP_010441957.1| PREDICTED: proteasome subunit alpha type-6-B-like isoform X1 
[Camelina sativa]
 ref|XP_010441958.1| PREDICTED: proteasome subunit alpha type-6-B-like isoform X2 
[Camelina sativa]
Length=246

 Score =   284 bits (727),  Expect = 1e-93, Method: Compositional matrix adjust.
 Identities = 133/142 (94%), Positives = 140/142 (99%), Gaps = 0/142 (0%)
 Frame = +1

Query  85   MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL  264
            MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL
Sbjct  1    MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL  60

Query  265  LDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYEMPVDVLARWIAD  444
            LDQ+SVTHLFPVTKYLGLLATGITAD+R+LV QARNEAAEFRF+YGYEMP D+LA+WIAD
Sbjct  61   LDQSSVTHLFPVTKYLGLLATGITADSRSLVTQARNEAAEFRFQYGYEMPADILAKWIAD  120

Query  445  KSQVYTQHAYMRPLGVVAMILG  510
            KSQVYTQHAYMRPLGVVAM+LG
Sbjct  121  KSQVYTQHAYMRPLGVVAMVLG  142



>ref|XP_009404175.1| PREDICTED: proteasome subunit alpha type-6-like [Musa acuminata 
subsp. malaccensis]
Length=246

 Score =   283 bits (725),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 131/142 (92%), Positives = 141/142 (99%), Gaps = 0/142 (0%)
 Frame = +1

Query  85   MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL  264
            MSRG+G GYDRHITIFSPEGRL+QVEYAFKAVKA+GITSIGVRGKDSVCVVTQKKVPDKL
Sbjct  1    MSRGTGAGYDRHITIFSPEGRLYQVEYAFKAVKASGITSIGVRGKDSVCVVTQKKVPDKL  60

Query  265  LDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYEMPVDVLARWIAD  444
            LDQTSVTHLFP+TKYLGLLATGITADAR+LVQQARNEAAEFRF++GYEMPVDVLA+WIAD
Sbjct  61   LDQTSVTHLFPITKYLGLLATGITADARSLVQQARNEAAEFRFKWGYEMPVDVLAKWIAD  120

Query  445  KSQVYTQHAYMRPLGVVAMILG  510
            KSQ+YTQHAYMRPLG+VAMILG
Sbjct  121  KSQIYTQHAYMRPLGIVAMILG  142



>gb|ACB87915.1| 20S proteasome alpha subunit A1 [Malus domestica]
Length=187

 Score =   281 bits (719),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 133/142 (94%), Positives = 141/142 (99%), Gaps = 0/142 (0%)
 Frame = +1

Query  85   MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL  264
            MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL
Sbjct  1    MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL  60

Query  265  LDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYEMPVDVLARWIAD  444
            LDQTSVTHLFP+TK++GLLATG+TADARTLV QARNEAAEFRF+YGYEMPVDVLA+WIAD
Sbjct  61   LDQTSVTHLFPITKFVGLLATGMTADARTLVSQARNEAAEFRFKYGYEMPVDVLAKWIAD  120

Query  445  KSQVYTQHAYMRPLGVVAMILG  510
            KSQ+YTQHAYMRPLGVVAM+LG
Sbjct  121  KSQIYTQHAYMRPLGVVAMVLG  142



>ref|XP_010533014.1| PREDICTED: proteasome subunit alpha type-6-B-like [Tarenaya hassleriana]
Length=246

 Score =   283 bits (725),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 132/142 (93%), Positives = 141/142 (99%), Gaps = 0/142 (0%)
 Frame = +1

Query  85   MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL  264
            MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAG+TSIGVRGKDSVCVVTQKKVPDKL
Sbjct  1    MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGVTSIGVRGKDSVCVVTQKKVPDKL  60

Query  265  LDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYEMPVDVLARWIAD  444
            LDQ+SVTHLF +TKYLGLLATG+TADAR+LVQQARNEAA+FRFRYGYEMPVD+LA+WIAD
Sbjct  61   LDQSSVTHLFQITKYLGLLATGMTADARSLVQQARNEAADFRFRYGYEMPVDILAKWIAD  120

Query  445  KSQVYTQHAYMRPLGVVAMILG  510
            KSQVYTQHAYMRPLGVVAM+LG
Sbjct  121  KSQVYTQHAYMRPLGVVAMVLG  142



>ref|XP_010274570.1| PREDICTED: proteasome subunit alpha type-6 [Nelumbo nucifera]
Length=246

 Score =   283 bits (724),  Expect = 3e-93, Method: Compositional matrix adjust.
 Identities = 132/142 (93%), Positives = 139/142 (98%), Gaps = 0/142 (0%)
 Frame = +1

Query  85   MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL  264
            MSRGSG GYDRHITIFSPEGRLFQVEYAFKAVKA+GITSIGVRGKDSVCVVTQKKVPDKL
Sbjct  1    MSRGSGSGYDRHITIFSPEGRLFQVEYAFKAVKASGITSIGVRGKDSVCVVTQKKVPDKL  60

Query  265  LDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYEMPVDVLARWIAD  444
            LDQTSVTHLF +TKYLGLLATG+TADARTLVQQARNEAAEFRFRYGYEMPVDVL++WIAD
Sbjct  61   LDQTSVTHLFAITKYLGLLATGMTADARTLVQQARNEAAEFRFRYGYEMPVDVLSKWIAD  120

Query  445  KSQVYTQHAYMRPLGVVAMILG  510
            KSQ+YTQHAYMRPLGV AM+LG
Sbjct  121  KSQIYTQHAYMRPLGVAAMVLG  142



>gb|ADJ95344.1| PAA1 [Carica papaya]
Length=246

 Score =   283 bits (724),  Expect = 3e-93, Method: Compositional matrix adjust.
 Identities = 132/142 (93%), Positives = 139/142 (98%), Gaps = 0/142 (0%)
 Frame = +1

Query  85   MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL  264
            MSRGSGGGYDRHITIFSPEGRL+QVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL
Sbjct  1    MSRGSGGGYDRHITIFSPEGRLYQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL  60

Query  265  LDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYEMPVDVLARWIAD  444
            LDQ+SVTHLFP+T  LGLLATG+TADARTLVQQARNEAAEFRFRYGYEMPVD LA+WIAD
Sbjct  61   LDQSSVTHLFPITNLLGLLATGMTADARTLVQQARNEAAEFRFRYGYEMPVDALAKWIAD  120

Query  445  KSQVYTQHAYMRPLGVVAMILG  510
            KSQ+YTQHAYMRPLGVVAM+LG
Sbjct  121  KSQIYTQHAYMRPLGVVAMVLG  142



>ref|XP_008462289.1| PREDICTED: proteasome subunit alpha type-6 [Cucumis melo]
Length=246

 Score =   283 bits (723),  Expect = 3e-93, Method: Compositional matrix adjust.
 Identities = 133/142 (94%), Positives = 140/142 (99%), Gaps = 0/142 (0%)
 Frame = +1

Query  85   MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL  264
            MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVK+AG TSIGV+GKDSVCVVTQKKVPDKL
Sbjct  1    MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKSAGTTSIGVKGKDSVCVVTQKKVPDKL  60

Query  265  LDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYEMPVDVLARWIAD  444
            LDQTSVTHLF +TKYLGLLATGITADAR+LVQQARNEAA+FRFRYGYEMPVDVLA+WIAD
Sbjct  61   LDQTSVTHLFSITKYLGLLATGITADARSLVQQARNEAADFRFRYGYEMPVDVLAKWIAD  120

Query  445  KSQVYTQHAYMRPLGVVAMILG  510
            KSQVYTQHAYMRPLGVVAM+LG
Sbjct  121  KSQVYTQHAYMRPLGVVAMVLG  142



>ref|XP_002323091.1| Proteasome subunit alpha type 6-1 family protein [Populus trichocarpa]
 gb|ABK93034.1| unknown [Populus trichocarpa]
 gb|EEF04852.1| Proteasome subunit alpha type 6-1 family protein [Populus trichocarpa]
Length=246

 Score =   283 bits (723),  Expect = 4e-93, Method: Compositional matrix adjust.
 Identities = 134/142 (94%), Positives = 136/142 (96%), Gaps = 0/142 (0%)
 Frame = +1

Query  85   MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL  264
            MSRGSG GYDRHITIFSPEGRLFQVEYAFKAVKAA  TSIGVRG DSVCVVTQKKVPDKL
Sbjct  1    MSRGSGAGYDRHITIFSPEGRLFQVEYAFKAVKAASTTSIGVRGSDSVCVVTQKKVPDKL  60

Query  265  LDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYEMPVDVLARWIAD  444
            LDQTSVTHLFP+TK+LGLLATGITADAR LVQQARNEAAEFRFRYGYEMPVD LARWIAD
Sbjct  61   LDQTSVTHLFPITKFLGLLATGITADARNLVQQARNEAAEFRFRYGYEMPVDALARWIAD  120

Query  445  KSQVYTQHAYMRPLGVVAMILG  510
            KSQVYTQHAYMRPLGVVAMILG
Sbjct  121  KSQVYTQHAYMRPLGVVAMILG  142



>ref|NP_001238251.1| proteasome subunit alpha type-6 [Glycine max]
 sp|O48551.2|PSA6_SOYBN RecName: Full=Proteasome subunit alpha type-6; AltName: Full=20S 
proteasome alpha subunit A; AltName: Full=20S proteasome 
subunit alpha-1; AltName: Full=Proteasome iota subunit [Glycine 
max]
 gb|AAC28135.1| proteasome IOTA subunit [Glycine max]
Length=246

 Score =   283 bits (723),  Expect = 4e-93, Method: Compositional matrix adjust.
 Identities = 133/142 (94%), Positives = 139/142 (98%), Gaps = 0/142 (0%)
 Frame = +1

Query  85   MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL  264
            MSRGSGGGY+RHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDS+CVVT KKVPDKL
Sbjct  1    MSRGSGGGYNRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSICVVTHKKVPDKL  60

Query  265  LDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYEMPVDVLARWIAD  444
            LD TSVTHLFP+TKYLGLLATG+TADARTLVQQARNEAAEFRF YGYEMPVDVLA+WIAD
Sbjct  61   LDNTSVTHLFPITKYLGLLATGMTADARTLVQQARNEAAEFRFTYGYEMPVDVLAKWIAD  120

Query  445  KSQVYTQHAYMRPLGVVAMILG  510
            KSQVYTQHAYMRPLGVVAM+LG
Sbjct  121  KSQVYTQHAYMRPLGVVAMVLG  142



>ref|XP_002532723.1| proteasome subunit alpha type, putative [Ricinus communis]
 gb|EEF29654.1| proteasome subunit alpha type, putative [Ricinus communis]
Length=246

 Score =   283 bits (723),  Expect = 5e-93, Method: Compositional matrix adjust.
 Identities = 132/142 (93%), Positives = 140/142 (99%), Gaps = 0/142 (0%)
 Frame = +1

Query  85   MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL  264
            MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKA+G+TSIGV GKDSVCVVTQKKVPDKL
Sbjct  1    MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKASGVTSIGVCGKDSVCVVTQKKVPDKL  60

Query  265  LDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYEMPVDVLARWIAD  444
            LD TSVTHLFP+TKYLGLLATG+TADARTLVQQARNEAAEFRF+YGYEMPVDVLA+WIAD
Sbjct  61   LDHTSVTHLFPITKYLGLLATGMTADARTLVQQARNEAAEFRFKYGYEMPVDVLAKWIAD  120

Query  445  KSQVYTQHAYMRPLGVVAMILG  510
            KSQ+YTQHAYMRPLGVVAM+LG
Sbjct  121  KSQIYTQHAYMRPLGVVAMVLG  142



>ref|NP_001031340.1| 20S proteasome subunit PAA2 [Arabidopsis thaliana]
 gb|AEC05980.1| 20S proteasome subunit PAA2 [Arabidopsis thaliana]
Length=220

 Score =   281 bits (720),  Expect = 5e-93, Method: Compositional matrix adjust.
 Identities = 131/142 (92%), Positives = 140/142 (99%), Gaps = 0/142 (0%)
 Frame = +1

Query  85   MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL  264
            MSRGSG GYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL
Sbjct  1    MSRGSGAGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL  60

Query  265  LDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYEMPVDVLARWIAD  444
            LDQ+SV+HLFPVTKYLGLLATG+TAD+R+LVQQARNEAAEFRF+YGYEMP D+LA+WIAD
Sbjct  61   LDQSSVSHLFPVTKYLGLLATGMTADSRSLVQQARNEAAEFRFQYGYEMPADILAKWIAD  120

Query  445  KSQVYTQHAYMRPLGVVAMILG  510
            KSQVYTQHAYMRPLGVVAM+LG
Sbjct  121  KSQVYTQHAYMRPLGVVAMVLG  142



>gb|ACJ85912.1| unknown [Medicago truncatula]
Length=246

 Score =   282 bits (722),  Expect = 6e-93, Method: Compositional matrix adjust.
 Identities = 133/142 (94%), Positives = 139/142 (98%), Gaps = 0/142 (0%)
 Frame = +1

Query  85   MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL  264
            MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRG DSVCVVTQKKVPDKL
Sbjct  1    MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGNDSVCVVTQKKVPDKL  60

Query  265  LDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYEMPVDVLARWIAD  444
            LDQTSV HLFP+TKYLGLLATG+TADARTLVQQARNEAAEFR ++GYEMPVDVLA+WIAD
Sbjct  61   LDQTSVAHLFPITKYLGLLATGMTADARTLVQQARNEAAEFRHKFGYEMPVDVLAKWIAD  120

Query  445  KSQVYTQHAYMRPLGVVAMILG  510
            KSQVYTQHAYMRPLGVVAM+LG
Sbjct  121  KSQVYTQHAYMRPLGVVAMVLG  142



>ref|XP_006465892.1| PREDICTED: proteasome subunit alpha type-6-like [Citrus sinensis]
 gb|KDO64976.1| hypothetical protein CISIN_1g025897mg [Citrus sinensis]
Length=246

 Score =   282 bits (721),  Expect = 8e-93, Method: Compositional matrix adjust.
 Identities = 133/141 (94%), Positives = 139/141 (99%), Gaps = 0/141 (0%)
 Frame = +1

Query  85   MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL  264
            MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAG+TSIGVRGKDSVCVVTQKKVPDKL
Sbjct  1    MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGVTSIGVRGKDSVCVVTQKKVPDKL  60

Query  265  LDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYEMPVDVLARWIAD  444
            LD TSVTHLFP+TKYLGLLATG+TADARTLVQQAR EAAEFRF+YGYEMPVDVLA+WIAD
Sbjct  61   LDHTSVTHLFPITKYLGLLATGMTADARTLVQQARYEAAEFRFKYGYEMPVDVLAKWIAD  120

Query  445  KSQVYTQHAYMRPLGVVAMIL  507
            KSQVYTQHAYMRPLGVVAM+L
Sbjct  121  KSQVYTQHAYMRPLGVVAMVL  141



>ref|NP_178641.1| 20S proteasome subunit PAA2 [Arabidopsis thaliana]
 ref|XP_002883713.1| hypothetical protein ARALYDRAFT_899379 [Arabidopsis lyrata subsp. 
lyrata]
 sp|O81147.1|PSA6B_ARATH RecName: Full=Proteasome subunit alpha type-6-B; AltName: Full=20S 
proteasome subunit alpha A-2; AltName: Full=Proteasome 
subunit alpha type-1 [Arabidopsis thaliana]
 gb|AAC32055.1| 20S proteasome subunit PAA2 [Arabidopsis thaliana]
 gb|AAC95161.1| 20S proteasome alpha subunit A2 (PAA2) [Arabidopsis thaliana]
 gb|AAK96583.1| At2g05840/T6P5.4 [Arabidopsis thaliana]
 gb|AAN28768.1| At2g05840/T6P5.4 [Arabidopsis thaliana]
 gb|EFH59972.1| hypothetical protein ARALYDRAFT_899379 [Arabidopsis lyrata subsp. 
lyrata]
 gb|AEC05979.1| 20S proteasome subunit PAA2 [Arabidopsis thaliana]
Length=246

 Score =   282 bits (721),  Expect = 9e-93, Method: Compositional matrix adjust.
 Identities = 131/142 (92%), Positives = 140/142 (99%), Gaps = 0/142 (0%)
 Frame = +1

Query  85   MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL  264
            MSRGSG GYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL
Sbjct  1    MSRGSGAGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL  60

Query  265  LDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYEMPVDVLARWIAD  444
            LDQ+SV+HLFPVTKYLGLLATG+TAD+R+LVQQARNEAAEFRF+YGYEMP D+LA+WIAD
Sbjct  61   LDQSSVSHLFPVTKYLGLLATGMTADSRSLVQQARNEAAEFRFQYGYEMPADILAKWIAD  120

Query  445  KSQVYTQHAYMRPLGVVAMILG  510
            KSQVYTQHAYMRPLGVVAM+LG
Sbjct  121  KSQVYTQHAYMRPLGVVAMVLG  142



>ref|XP_011001657.1| PREDICTED: proteasome subunit alpha type-6-like [Populus euphratica]
 ref|XP_011015647.1| PREDICTED: proteasome subunit alpha type-6-like [Populus euphratica]
Length=246

 Score =   281 bits (720),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 133/142 (94%), Positives = 136/142 (96%), Gaps = 0/142 (0%)
 Frame = +1

Query  85   MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL  264
            MSRGSG GYDRHITIFSPEGRLFQVEYAFKAVKAA  TSIGVRG DSVCVVTQKKVPDKL
Sbjct  1    MSRGSGAGYDRHITIFSPEGRLFQVEYAFKAVKAASTTSIGVRGSDSVCVVTQKKVPDKL  60

Query  265  LDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYEMPVDVLARWIAD  444
            LDQTSVTHLFP+TK+LGLLATG+TADAR LVQQARNEAAEFRFRYGYEMPVD LARWIAD
Sbjct  61   LDQTSVTHLFPITKFLGLLATGMTADARNLVQQARNEAAEFRFRYGYEMPVDALARWIAD  120

Query  445  KSQVYTQHAYMRPLGVVAMILG  510
            KSQVYTQHAYMRPLGVVAMILG
Sbjct  121  KSQVYTQHAYMRPLGVVAMILG  142



>ref|XP_009380029.1| PREDICTED: proteasome subunit alpha type-6 [Musa acuminata subsp. 
malaccensis]
Length=246

 Score =   281 bits (720),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 130/142 (92%), Positives = 141/142 (99%), Gaps = 0/142 (0%)
 Frame = +1

Query  85   MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL  264
            MSRG+G GYDRHITIFSPEGRL+QVEYAFKAVKA+GITSIGVRGKDSVCVVTQKKVPDKL
Sbjct  1    MSRGTGAGYDRHITIFSPEGRLYQVEYAFKAVKASGITSIGVRGKDSVCVVTQKKVPDKL  60

Query  265  LDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYEMPVDVLARWIAD  444
            LDQTSVTHLFP+TKYLGLLATG+TADAR+LVQQARNEAAEFRF++GYEMPVDVLA+WIAD
Sbjct  61   LDQTSVTHLFPITKYLGLLATGMTADARSLVQQARNEAAEFRFKWGYEMPVDVLAKWIAD  120

Query  445  KSQVYTQHAYMRPLGVVAMILG  510
            KSQ+YTQHAYMRPLGVVAM+LG
Sbjct  121  KSQIYTQHAYMRPLGVVAMVLG  142



>ref|XP_009102355.1| PREDICTED: proteasome subunit alpha type-6-B [Brassica rapa]
 emb|CDY33398.1| BnaA07g04410D [Brassica napus]
 emb|CDY18045.1| BnaC07g04250D [Brassica napus]
Length=246

 Score =   281 bits (720),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 131/142 (92%), Positives = 140/142 (99%), Gaps = 0/142 (0%)
 Frame = +1

Query  85   MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL  264
            MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL
Sbjct  1    MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL  60

Query  265  LDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYEMPVDVLARWIAD  444
            LDQ+SV+HLFPVTKYLGLLATG+TAD+R+LV QARNEAAEFRF+YGYEMP D+LA+WIAD
Sbjct  61   LDQSSVSHLFPVTKYLGLLATGMTADSRSLVTQARNEAAEFRFQYGYEMPADILAKWIAD  120

Query  445  KSQVYTQHAYMRPLGVVAMILG  510
            KSQVYTQHAYMRPLGVVAM+LG
Sbjct  121  KSQVYTQHAYMRPLGVVAMVLG  142



>ref|XP_010435443.1| PREDICTED: proteasome subunit alpha type-6-A-like [Camelina sativa]
 ref|XP_010440739.1| PREDICTED: proteasome subunit alpha type-6-A-like [Camelina sativa]
Length=246

 Score =   281 bits (719),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 130/142 (92%), Positives = 139/142 (98%), Gaps = 0/142 (0%)
 Frame = +1

Query  85   MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL  264
            MSRGSG GYDRHITIFSPEGRLFQVEYAFKAVK +GITSIGVRGKDSVCVVTQKKVPDKL
Sbjct  1    MSRGSGAGYDRHITIFSPEGRLFQVEYAFKAVKTSGITSIGVRGKDSVCVVTQKKVPDKL  60

Query  265  LDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYEMPVDVLARWIAD  444
            LDQ+SVTHLFP+TKY+GL+ATGITADAR+LVQQARNEAAEFRF YGYEMPVD+LA+WIAD
Sbjct  61   LDQSSVTHLFPITKYIGLVATGITADARSLVQQARNEAAEFRFTYGYEMPVDILAKWIAD  120

Query  445  KSQVYTQHAYMRPLGVVAMILG  510
            KSQVYTQHAYMRPLGVVAM+LG
Sbjct  121  KSQVYTQHAYMRPLGVVAMVLG  142



>ref|XP_004141710.1| PREDICTED: proteasome subunit alpha type-6-like [Cucumis sativus]
 ref|XP_004155912.1| PREDICTED: proteasome subunit alpha type-6-like [Cucumis sativus]
 gb|KGN45477.1| hypothetical protein Csa_7G448880 [Cucumis sativus]
Length=246

 Score =   281 bits (719),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 132/142 (93%), Positives = 140/142 (99%), Gaps = 0/142 (0%)
 Frame = +1

Query  85   MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL  264
            MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVK+AG TSIGV+G+DSVCVVTQKKVPDKL
Sbjct  1    MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKSAGTTSIGVKGRDSVCVVTQKKVPDKL  60

Query  265  LDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYEMPVDVLARWIAD  444
            LDQTSVTHLF +TKYLGLLATGITADAR+LVQQARNEAAEFRF+YGYEMPVDVLA+WIAD
Sbjct  61   LDQTSVTHLFSITKYLGLLATGITADARSLVQQARNEAAEFRFQYGYEMPVDVLAKWIAD  120

Query  445  KSQVYTQHAYMRPLGVVAMILG  510
            KSQVYTQHAYMRPLGVVAM+LG
Sbjct  121  KSQVYTQHAYMRPLGVVAMVLG  142



>ref|XP_002308263.1| Proteasome subunit alpha type 6-1 family protein [Populus trichocarpa]
 gb|EEE91786.1| Proteasome subunit alpha type 6-1 family protein [Populus trichocarpa]
Length=246

 Score =   281 bits (718),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 133/142 (94%), Positives = 136/142 (96%), Gaps = 0/142 (0%)
 Frame = +1

Query  85   MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL  264
            MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAA  TSIGVRG DSVCVVTQKKVPDKL
Sbjct  1    MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAASTTSIGVRGSDSVCVVTQKKVPDKL  60

Query  265  LDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYEMPVDVLARWIAD  444
            LDQTSVTHLF +TK+LGLLATG+TADAR LVQQARNEAAEFRFRYGYEMPVD LARWIAD
Sbjct  61   LDQTSVTHLFSITKFLGLLATGMTADARNLVQQARNEAAEFRFRYGYEMPVDALARWIAD  120

Query  445  KSQVYTQHAYMRPLGVVAMILG  510
            KSQVYTQHAYMRPLGVVAMILG
Sbjct  121  KSQVYTQHAYMRPLGVVAMILG  142



>ref|XP_006282775.1| hypothetical protein CARUB_v10006215mg [Capsella rubella]
 gb|EOA15673.1| hypothetical protein CARUB_v10006215mg [Capsella rubella]
Length=246

 Score =   281 bits (718),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 129/142 (91%), Positives = 140/142 (99%), Gaps = 0/142 (0%)
 Frame = +1

Query  85   MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL  264
            MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVK +GITSIGVRGKDSVCVVTQKKVPDKL
Sbjct  1    MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKTSGITSIGVRGKDSVCVVTQKKVPDKL  60

Query  265  LDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYEMPVDVLARWIAD  444
            LDQ+SVTHLFP+TK++GL+ATGITADAR+LVQQARNEAAEFRF YGYEMPVD+LA+WIAD
Sbjct  61   LDQSSVTHLFPITKFIGLVATGITADARSLVQQARNEAAEFRFTYGYEMPVDILAKWIAD  120

Query  445  KSQVYTQHAYMRPLGVVAMILG  510
            KSQVYTQHAYMRPLGVVAM++G
Sbjct  121  KSQVYTQHAYMRPLGVVAMVMG  142



>ref|XP_010450390.1| PREDICTED: proteasome subunit alpha type-6-A [Camelina sativa]
Length=246

 Score =   281 bits (718),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 130/142 (92%), Positives = 139/142 (98%), Gaps = 0/142 (0%)
 Frame = +1

Query  85   MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL  264
            MSRGSG GYDRHITIFSPEGRLFQVEYAFKAVK +GITSIGVRGKDSVCVVTQKKVPDKL
Sbjct  1    MSRGSGAGYDRHITIFSPEGRLFQVEYAFKAVKTSGITSIGVRGKDSVCVVTQKKVPDKL  60

Query  265  LDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYEMPVDVLARWIAD  444
            LDQ+SVTHLFP+TKY+GL+ATGITADAR+LVQQARNEAAEFRF YGYEMPVD+LA+WIAD
Sbjct  61   LDQSSVTHLFPITKYVGLVATGITADARSLVQQARNEAAEFRFTYGYEMPVDILAKWIAD  120

Query  445  KSQVYTQHAYMRPLGVVAMILG  510
            KSQVYTQHAYMRPLGVVAM+LG
Sbjct  121  KSQVYTQHAYMRPLGVVAMVLG  142



>ref|XP_008802476.1| PREDICTED: proteasome subunit alpha type-6-like [Phoenix dactylifera]
Length=246

 Score =   281 bits (718),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 131/142 (92%), Positives = 140/142 (99%), Gaps = 0/142 (0%)
 Frame = +1

Query  85   MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL  264
            MSRG+G GYDRHITIFSPEGRL+QVEYAFKAVKA+GITSIGVRGKDSVCVVTQKKVPDKL
Sbjct  1    MSRGTGAGYDRHITIFSPEGRLYQVEYAFKAVKASGITSIGVRGKDSVCVVTQKKVPDKL  60

Query  265  LDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYEMPVDVLARWIAD  444
            LDQTSVTHLFP+TKYLGLLATG+TADAR+LV QARNEAAEFRF++GYEMPVDVLA+WIAD
Sbjct  61   LDQTSVTHLFPITKYLGLLATGMTADARSLVHQARNEAAEFRFKWGYEMPVDVLAKWIAD  120

Query  445  KSQVYTQHAYMRPLGVVAMILG  510
            KSQVYTQHAYMRPLGVVAMILG
Sbjct  121  KSQVYTQHAYMRPLGVVAMILG  142



>ref|XP_010494382.1| PREDICTED: proteasome subunit alpha type-6-B [Camelina sativa]
Length=246

 Score =   281 bits (718),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 131/142 (92%), Positives = 139/142 (98%), Gaps = 0/142 (0%)
 Frame = +1

Query  85   MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL  264
            MSRGSG GYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL
Sbjct  1    MSRGSGAGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL  60

Query  265  LDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYEMPVDVLARWIAD  444
            LDQ+SV+HLFPVTKYLGLLATGITAD+R+LV QARNEAAEFRF+YGYEMP D+LA+WIAD
Sbjct  61   LDQSSVSHLFPVTKYLGLLATGITADSRSLVTQARNEAAEFRFQYGYEMPADILAKWIAD  120

Query  445  KSQVYTQHAYMRPLGVVAMILG  510
            KSQVYTQHAYMRPLGVVAM+LG
Sbjct  121  KSQVYTQHAYMRPLGVVAMVLG  142



>gb|AFK44903.1| unknown [Medicago truncatula]
Length=176

 Score =   278 bits (711),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 133/142 (94%), Positives = 139/142 (98%), Gaps = 0/142 (0%)
 Frame = +1

Query  85   MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL  264
            MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRG DSVCVVTQKKVPDKL
Sbjct  1    MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGNDSVCVVTQKKVPDKL  60

Query  265  LDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYEMPVDVLARWIAD  444
            LDQTSVTHLFP+TKYLGLLATG+TADARTLVQQARNEAAEFR ++GYEM VDVLA+WIAD
Sbjct  61   LDQTSVTHLFPITKYLGLLATGMTADARTLVQQARNEAAEFRHKFGYEMLVDVLAKWIAD  120

Query  445  KSQVYTQHAYMRPLGVVAMILG  510
            KSQVYTQHAYMRPLGVVAM+LG
Sbjct  121  KSQVYTQHAYMRPLGVVAMVLG  142



>gb|KJB82988.1| hypothetical protein B456_013G223200 [Gossypium raimondii]
Length=244

 Score =   280 bits (717),  Expect = 3e-92, Method: Compositional matrix adjust.
 Identities = 134/142 (94%), Positives = 140/142 (99%), Gaps = 2/142 (1%)
 Frame = +1

Query  85   MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL  264
            MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKK  DKL
Sbjct  1    MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKK--DKL  58

Query  265  LDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYEMPVDVLARWIAD  444
            LDQTSVTHLFP+TK+LGLLATG+TADARTLVQQARNEAAEFRFRYGYEMPVDVL++WIAD
Sbjct  59   LDQTSVTHLFPITKFLGLLATGMTADARTLVQQARNEAAEFRFRYGYEMPVDVLSKWIAD  118

Query  445  KSQVYTQHAYMRPLGVVAMILG  510
            KSQVYTQHAYMRPLGVVAM+LG
Sbjct  119  KSQVYTQHAYMRPLGVVAMVLG  140



>gb|EPS63192.1| proteasome subunit alpha type-6 [Genlisea aurea]
Length=246

 Score =   280 bits (717),  Expect = 3e-92, Method: Compositional matrix adjust.
 Identities = 132/142 (93%), Positives = 139/142 (98%), Gaps = 0/142 (0%)
 Frame = +1

Query  85   MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL  264
            MSRGSGGGYDRHITIFSPEGRL+QVEYAFKAVKA+GITSIGVRG DSVCVVTQKKVPDKL
Sbjct  1    MSRGSGGGYDRHITIFSPEGRLYQVEYAFKAVKASGITSIGVRGADSVCVVTQKKVPDKL  60

Query  265  LDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYEMPVDVLARWIAD  444
            LDQTSVTHLF VTKYLGLL TGITADARTLVQQARN+AA+FRFRYGYEMPVDVLARWIAD
Sbjct  61   LDQTSVTHLFHVTKYLGLLTTGITADARTLVQQARNKAADFRFRYGYEMPVDVLARWIAD  120

Query  445  KSQVYTQHAYMRPLGVVAMILG  510
            KSQVYTQHAYMRPLG++AM+LG
Sbjct  121  KSQVYTQHAYMRPLGIIAMVLG  142



>gb|KDO64978.1| hypothetical protein CISIN_1g025897mg [Citrus sinensis]
 gb|KDO64979.1| hypothetical protein CISIN_1g025897mg [Citrus sinensis]
 gb|KDO64980.1| hypothetical protein CISIN_1g025897mg [Citrus sinensis]
Length=210

 Score =   279 bits (713),  Expect = 4e-92, Method: Compositional matrix adjust.
 Identities = 133/141 (94%), Positives = 139/141 (99%), Gaps = 0/141 (0%)
 Frame = +1

Query  85   MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL  264
            MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAG+TSIGVRGKDSVCVVTQKKVPDKL
Sbjct  1    MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGVTSIGVRGKDSVCVVTQKKVPDKL  60

Query  265  LDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYEMPVDVLARWIAD  444
            LD TSVTHLFP+TKYLGLLATG+TADARTLVQQAR EAAEFRF+YGYEMPVDVLA+WIAD
Sbjct  61   LDHTSVTHLFPITKYLGLLATGMTADARTLVQQARYEAAEFRFKYGYEMPVDVLAKWIAD  120

Query  445  KSQVYTQHAYMRPLGVVAMIL  507
            KSQVYTQHAYMRPLGVVAM+L
Sbjct  121  KSQVYTQHAYMRPLGVVAMVL  141



>ref|NP_198409.1| proteasome alpha subunit A1 [Arabidopsis thaliana]
 sp|O81146.2|PSA6A_ARATH RecName: Full=Proteasome subunit alpha type-6-A; AltName: Full=20S 
proteasome subunit alpha A-1; AltName: Full=Proteasome 
component 1; AltName: Full=Proteasome subunit alpha type-1 
[Arabidopsis thaliana]
 dbj|BAB09993.1| multicatalytic endopeptidase complex alpha subunit-like [Arabidopsis 
thaliana]
 dbj|BAF00393.1| multicatalytic endopeptidase complex alpha subunit-like [Arabidopsis 
thaliana]
 gb|AED93984.1| proteasome alpha subunit A1 [Arabidopsis thaliana]
Length=246

 Score =   280 bits (716),  Expect = 4e-92, Method: Compositional matrix adjust.
 Identities = 129/142 (91%), Positives = 139/142 (98%), Gaps = 0/142 (0%)
 Frame = +1

Query  85   MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL  264
            MSRGSG GYDRHITIFSPEGRLFQVEYAFKAVK AGITSIGVRGKDSVCVVTQKKVPDKL
Sbjct  1    MSRGSGAGYDRHITIFSPEGRLFQVEYAFKAVKTAGITSIGVRGKDSVCVVTQKKVPDKL  60

Query  265  LDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYEMPVDVLARWIAD  444
            LDQ+SVTHLFP+TKY+GL+ATGITADAR+LVQQARN+AAEFRF YGYEMPVD+LA+WIAD
Sbjct  61   LDQSSVTHLFPITKYIGLVATGITADARSLVQQARNQAAEFRFTYGYEMPVDILAKWIAD  120

Query  445  KSQVYTQHAYMRPLGVVAMILG  510
            KSQVYTQHAYMRPLGVVAM++G
Sbjct  121  KSQVYTQHAYMRPLGVVAMVMG  142



>gb|AFK46380.1| unknown [Lotus japonicus]
Length=246

 Score =   280 bits (716),  Expect = 5e-92, Method: Compositional matrix adjust.
 Identities = 132/142 (93%), Positives = 138/142 (97%), Gaps = 0/142 (0%)
 Frame = +1

Query  85   MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL  264
            MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGV GKDS+CVVTQKKVPDKL
Sbjct  1    MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVCGKDSICVVTQKKVPDKL  60

Query  265  LDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYEMPVDVLARWIAD  444
            LDQTSV+HLFP+TKYLGLLATG+TADARTL QQARNEAAEFR  YGYEMPVDVLA+WIAD
Sbjct  61   LDQTSVSHLFPITKYLGLLATGMTADARTLAQQARNEAAEFRHTYGYEMPVDVLAKWIAD  120

Query  445  KSQVYTQHAYMRPLGVVAMILG  510
            KSQVYTQHAYMRPLGVVAM+LG
Sbjct  121  KSQVYTQHAYMRPLGVVAMVLG  142



>ref|XP_006396131.1| hypothetical protein EUTSA_v10002649mg [Eutrema salsugineum]
 gb|ESQ36910.1| hypothetical protein EUTSA_v10002649mg [Eutrema salsugineum]
Length=246

 Score =   280 bits (716),  Expect = 5e-92, Method: Compositional matrix adjust.
 Identities = 130/142 (92%), Positives = 139/142 (98%), Gaps = 0/142 (0%)
 Frame = +1

Query  85   MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL  264
            MSRGSG GYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL
Sbjct  1    MSRGSGAGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL  60

Query  265  LDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYEMPVDVLARWIAD  444
            LDQ+SV+HLFPVTKYLGLLATG+TAD+R+LV QARNEAAEFRF+YGYEMP D+LA+WIAD
Sbjct  61   LDQSSVSHLFPVTKYLGLLATGMTADSRSLVTQARNEAAEFRFQYGYEMPADILAKWIAD  120

Query  445  KSQVYTQHAYMRPLGVVAMILG  510
            KSQVYTQHAYMRPLGVVAM+LG
Sbjct  121  KSQVYTQHAYMRPLGVVAMVLG  142



>gb|AAC32054.1| 20S proteasome subunit PAA1 [Arabidopsis thaliana]
Length=246

 Score =   280 bits (716),  Expect = 5e-92, Method: Compositional matrix adjust.
 Identities = 129/142 (91%), Positives = 139/142 (98%), Gaps = 0/142 (0%)
 Frame = +1

Query  85   MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL  264
            MSRGSG GYDRHITIFSPEGRLFQVEYAFKAVK AGITSIGVRGKDSVCVVTQKKVPDKL
Sbjct  1    MSRGSGAGYDRHITIFSPEGRLFQVEYAFKAVKTAGITSIGVRGKDSVCVVTQKKVPDKL  60

Query  265  LDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYEMPVDVLARWIAD  444
            LDQ+SVTHLFP+TKY+GL+ATGITADAR+LVQQARN+AAEFRF YGYEMPVD+LA+WIAD
Sbjct  61   LDQSSVTHLFPITKYIGLVATGITADARSLVQQARNQAAEFRFTYGYEMPVDILAKWIAD  120

Query  445  KSQVYTQHAYMRPLGVVAMILG  510
            KSQVYTQHAYMRPLGVVAM++G
Sbjct  121  KSQVYTQHAYMRPLGVVAMVMG  142



>ref|XP_011018964.1| PREDICTED: proteasome subunit alpha type-6-like [Populus euphratica]
Length=246

 Score =   280 bits (715),  Expect = 6e-92, Method: Compositional matrix adjust.
 Identities = 132/142 (93%), Positives = 136/142 (96%), Gaps = 0/142 (0%)
 Frame = +1

Query  85   MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL  264
            MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAA  TSIGVRG DSVCVVTQKKVPDKL
Sbjct  1    MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAASTTSIGVRGSDSVCVVTQKKVPDKL  60

Query  265  LDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYEMPVDVLARWIAD  444
            LDQTSV+HLF +TK+LGLLATG+TADAR LVQQARNEAAEFRFRYGYEMPVD LARWIAD
Sbjct  61   LDQTSVSHLFSITKFLGLLATGMTADARNLVQQARNEAAEFRFRYGYEMPVDALARWIAD  120

Query  445  KSQVYTQHAYMRPLGVVAMILG  510
            KSQVYTQHAYMRPLGVVAMILG
Sbjct  121  KSQVYTQHAYMRPLGVVAMILG  142



>ref|XP_010937324.1| PREDICTED: proteasome subunit alpha type-6 [Elaeis guineensis]
Length=246

 Score =   280 bits (715),  Expect = 7e-92, Method: Compositional matrix adjust.
 Identities = 130/142 (92%), Positives = 139/142 (98%), Gaps = 0/142 (0%)
 Frame = +1

Query  85   MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL  264
            MSRG+G GYDRHITIFSPEGRL+QVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL
Sbjct  1    MSRGTGAGYDRHITIFSPEGRLYQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL  60

Query  265  LDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYEMPVDVLARWIAD  444
            LDQTSVTHLFP+TKYLGLLATG+TADAR+LV QARNEAAEFRF++GYEMPVDVLA+WIAD
Sbjct  61   LDQTSVTHLFPITKYLGLLATGMTADARSLVHQARNEAAEFRFKWGYEMPVDVLAKWIAD  120

Query  445  KSQVYTQHAYMRPLGVVAMILG  510
            KSQ+YTQHAYMRPLGV AMILG
Sbjct  121  KSQIYTQHAYMRPLGVAAMILG  142



>gb|KFK32243.1| hypothetical protein AALP_AA6G216400 [Arabis alpina]
Length=246

 Score =   279 bits (714),  Expect = 8e-92, Method: Compositional matrix adjust.
 Identities = 129/142 (91%), Positives = 139/142 (98%), Gaps = 0/142 (0%)
 Frame = +1

Query  85   MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL  264
            MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVK +GITSIGVRGKDSVCVVTQKKVPDKL
Sbjct  1    MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKTSGITSIGVRGKDSVCVVTQKKVPDKL  60

Query  265  LDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYEMPVDVLARWIAD  444
            LD +SV+HLFP+TKY+GL+ATGITADAR+LVQQARNEAAEFRF YGYEMPVD+LA+WIAD
Sbjct  61   LDASSVSHLFPITKYIGLVATGITADARSLVQQARNEAAEFRFSYGYEMPVDILAKWIAD  120

Query  445  KSQVYTQHAYMRPLGVVAMILG  510
            KSQVYTQHAYMRPLGVVAM+LG
Sbjct  121  KSQVYTQHAYMRPLGVVAMVLG  142



>gb|ABK95322.1| unknown [Populus trichocarpa]
Length=246

 Score =   279 bits (714),  Expect = 8e-92, Method: Compositional matrix adjust.
 Identities = 133/142 (94%), Positives = 135/142 (95%), Gaps = 0/142 (0%)
 Frame = +1

Query  85   MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL  264
            MSRGSG GYDRHITIFSPEGRLFQVEYAFKAVKAA  TSIGVRG DSVCVVTQKKVPDKL
Sbjct  1    MSRGSGAGYDRHITIFSPEGRLFQVEYAFKAVKAASTTSIGVRGSDSVCVVTQKKVPDKL  60

Query  265  LDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYEMPVDVLARWIAD  444
            LDQTSVTHLFP+TK+LGLLATGITADAR LVQQARNEAAEFRFRY YEMPVD LARWIAD
Sbjct  61   LDQTSVTHLFPITKFLGLLATGITADARNLVQQARNEAAEFRFRYWYEMPVDALARWIAD  120

Query  445  KSQVYTQHAYMRPLGVVAMILG  510
            KSQVYTQHAYMRPLGVVAMILG
Sbjct  121  KSQVYTQHAYMRPLGVVAMILG  142



>ref|XP_009136197.1| PREDICTED: proteasome subunit alpha type-6-B-like [Brassica rapa]
Length=246

 Score =   279 bits (714),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 129/142 (91%), Positives = 140/142 (99%), Gaps = 0/142 (0%)
 Frame = +1

Query  85   MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL  264
            MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKA+GITSIGVRGKDSVCVVTQKKVPDKL
Sbjct  1    MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKASGITSIGVRGKDSVCVVTQKKVPDKL  60

Query  265  LDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYEMPVDVLARWIAD  444
            LD++SV+HLFPVTKYLGLLATG+TAD+R+LV QARNEAAEFRF+YGYEMP D+LA+WIAD
Sbjct  61   LDESSVSHLFPVTKYLGLLATGMTADSRSLVTQARNEAAEFRFQYGYEMPADILAKWIAD  120

Query  445  KSQVYTQHAYMRPLGVVAMILG  510
            KSQVYTQHAYMRPLGVVAM+LG
Sbjct  121  KSQVYTQHAYMRPLGVVAMVLG  142



>gb|ACN66752.1| PAA1 [Carica papaya]
Length=246

 Score =   279 bits (713),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 130/142 (92%), Positives = 137/142 (96%), Gaps = 0/142 (0%)
 Frame = +1

Query  85   MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL  264
            MSRGSGGGYDRHITIFSPEGRL+QVEYAFKAVKAAGITSIGVRGKDSVCVV QKKVPDKL
Sbjct  1    MSRGSGGGYDRHITIFSPEGRLYQVEYAFKAVKAAGITSIGVRGKDSVCVVPQKKVPDKL  60

Query  265  LDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYEMPVDVLARWIAD  444
            LDQ+SVTHLFP+T  LGLLATG+TADARTLVQQARNEA EFRFRYGYEMPVD LA+WIAD
Sbjct  61   LDQSSVTHLFPITNLLGLLATGMTADARTLVQQARNEATEFRFRYGYEMPVDALAKWIAD  120

Query  445  KSQVYTQHAYMRPLGVVAMILG  510
            KSQ+YTQHAYMRPLGVVAM+LG
Sbjct  121  KSQIYTQHAYMRPLGVVAMVLG  142



>ref|XP_004303706.1| PREDICTED: proteasome subunit alpha type-6 [Fragaria vesca subsp. 
vesca]
Length=246

 Score =   279 bits (713),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 130/142 (92%), Positives = 139/142 (98%), Gaps = 0/142 (0%)
 Frame = +1

Query  85   MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL  264
            MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVK+AGITSIGVRGKDSVCVVTQKKVPDKL
Sbjct  1    MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKSAGITSIGVRGKDSVCVVTQKKVPDKL  60

Query  265  LDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYEMPVDVLARWIAD  444
            LDQ+SVTHLFP+TK+LGLLATG+TADARTLV QARNEAA+FRF+ GYEMPVDVLA WIA+
Sbjct  61   LDQSSVTHLFPITKFLGLLATGMTADARTLVSQARNEAADFRFKNGYEMPVDVLANWIAN  120

Query  445  KSQVYTQHAYMRPLGVVAMILG  510
            KSQVYTQHAYMRPLGVVAM+LG
Sbjct  121  KSQVYTQHAYMRPLGVVAMVLG  142



>gb|AAM12968.1| multicatalytic endopeptidase complex alpha subunit-like [Arabidopsis 
thaliana]
 gb|AAM47883.1| multicatalytic endopeptidase complex alpha subunit-like [Arabidopsis 
thaliana]
Length=246

 Score =   279 bits (713),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 128/142 (90%), Positives = 139/142 (98%), Gaps = 0/142 (0%)
 Frame = +1

Query  85   MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL  264
            MSRGSG GYDRHITIFSPEGRLFQVEYAFKAVK AGITSIGVRGKDSVCVVTQK+VPDKL
Sbjct  1    MSRGSGAGYDRHITIFSPEGRLFQVEYAFKAVKTAGITSIGVRGKDSVCVVTQKEVPDKL  60

Query  265  LDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYEMPVDVLARWIAD  444
            LDQ+SVTHLFP+TKY+GL+ATGITADAR+LVQQARN+AAEFRF YGYEMPVD+LA+WIAD
Sbjct  61   LDQSSVTHLFPITKYIGLVATGITADARSLVQQARNQAAEFRFTYGYEMPVDILAKWIAD  120

Query  445  KSQVYTQHAYMRPLGVVAMILG  510
            KSQVYTQHAYMRPLGVVAM++G
Sbjct  121  KSQVYTQHAYMRPLGVVAMVMG  142



>ref|XP_008782714.1| PREDICTED: proteasome subunit alpha type-6 [Phoenix dactylifera]
Length=246

 Score =   279 bits (713),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 130/142 (92%), Positives = 139/142 (98%), Gaps = 0/142 (0%)
 Frame = +1

Query  85   MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL  264
            MSRG+G GYDRHITIFSPEGRL+QVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL
Sbjct  1    MSRGTGAGYDRHITIFSPEGRLYQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL  60

Query  265  LDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYEMPVDVLARWIAD  444
            LDQTSVTHLFP+TKYLGLLATG+TADAR+LV QARNEAAEFRF++GYEMPVDVLA+WIAD
Sbjct  61   LDQTSVTHLFPLTKYLGLLATGMTADARSLVHQARNEAAEFRFKWGYEMPVDVLAKWIAD  120

Query  445  KSQVYTQHAYMRPLGVVAMILG  510
            KSQ+YTQHAYMRPLGV AMILG
Sbjct  121  KSQIYTQHAYMRPLGVAAMILG  142



>ref|XP_007012616.1| 20S proteasome subunit PAA2 isoform 2 [Theobroma cacao]
 gb|EOY30235.1| 20S proteasome subunit PAA2 isoform 2 [Theobroma cacao]
Length=181

 Score =   276 bits (706),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 130/137 (95%), Positives = 137/137 (100%), Gaps = 0/137 (0%)
 Frame = +1

Query  85   MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL  264
            MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL
Sbjct  1    MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL  60

Query  265  LDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYEMPVDVLARWIAD  444
            LDQTSVTHLFP+TK+LGLLATG+TADARTLVQQARNEAAEFRFRYGYE+PVDVLA+WIAD
Sbjct  61   LDQTSVTHLFPITKFLGLLATGMTADARTLVQQARNEAAEFRFRYGYELPVDVLAKWIAD  120

Query  445  KSQVYTQHAYMRPLGVV  495
            KSQVYTQHAYMRPLG++
Sbjct  121  KSQVYTQHAYMRPLGLL  137



>ref|XP_002870436.1| hypothetical protein ARALYDRAFT_493620 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH46695.1| hypothetical protein ARALYDRAFT_493620 [Arabidopsis lyrata subsp. 
lyrata]
Length=246

 Score =   278 bits (710),  Expect = 3e-91, Method: Compositional matrix adjust.
 Identities = 129/142 (91%), Positives = 138/142 (97%), Gaps = 0/142 (0%)
 Frame = +1

Query  85   MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL  264
            MSRGSG GYDRHITIFSPEGRLFQVEYAFKAVK AGITSIGVRGKDSVCVVTQKKVPDKL
Sbjct  1    MSRGSGAGYDRHITIFSPEGRLFQVEYAFKAVKTAGITSIGVRGKDSVCVVTQKKVPDKL  60

Query  265  LDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYEMPVDVLARWIAD  444
            LDQ+SVTHLFP+TKY+GL+ATGITADAR+LVQQARN+AAEFRF YGYEMPVD+LA+WIAD
Sbjct  61   LDQSSVTHLFPITKYIGLVATGITADARSLVQQARNQAAEFRFTYGYEMPVDILAKWIAD  120

Query  445  KSQVYTQHAYMRPLGVVAMILG  510
            KSQVYTQHAYMRPLGV AM+LG
Sbjct  121  KSQVYTQHAYMRPLGVGAMVLG  142



>emb|CAA74025.1| multicatalytic endopeptidase complex, proteasome component, alpha 
subunit [Arabidopsis thaliana]
Length=245

 Score =   278 bits (710),  Expect = 3e-91, Method: Compositional matrix adjust.
 Identities = 128/141 (91%), Positives = 138/141 (98%), Gaps = 0/141 (0%)
 Frame = +1

Query  88   SRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKLL  267
            SRGSG GYDRHITIFSPEGRLFQVEYAFKAVK AGITSIGVRGKDSVCVVTQKKVPDKLL
Sbjct  1    SRGSGAGYDRHITIFSPEGRLFQVEYAFKAVKTAGITSIGVRGKDSVCVVTQKKVPDKLL  60

Query  268  DQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYEMPVDVLARWIADK  447
            DQ+SVTHLFP+TKY+GL+ATGITADAR+LVQQARN+AAEFRF YGYEMPVD+LA+WIADK
Sbjct  61   DQSSVTHLFPITKYIGLVATGITADARSLVQQARNQAAEFRFTYGYEMPVDILAKWIADK  120

Query  448  SQVYTQHAYMRPLGVVAMILG  510
            SQVYTQHAYMRPLGVVAM++G
Sbjct  121  SQVYTQHAYMRPLGVVAMVMG  141



>ref|XP_006842706.1| hypothetical protein AMTR_s00147p00090390 [Amborella trichopoda]
 gb|ERN04381.1| hypothetical protein AMTR_s00147p00090390 [Amborella trichopoda]
Length=246

 Score =   278 bits (710),  Expect = 4e-91, Method: Compositional matrix adjust.
 Identities = 127/142 (89%), Positives = 140/142 (99%), Gaps = 0/142 (0%)
 Frame = +1

Query  85   MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL  264
            MSRG+G GYDRHITIFSPEGRL+QVEYAFKAVKAAGITSIGVRGKDS+CVVTQKKVPDKL
Sbjct  1    MSRGTGAGYDRHITIFSPEGRLYQVEYAFKAVKAAGITSIGVRGKDSICVVTQKKVPDKL  60

Query  265  LDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYEMPVDVLARWIAD  444
            LDQTSVTHLFP+TKYLGLLATG+TADAR+LVQQAR+EAAEFRF++GYEMPVDVLA+WIAD
Sbjct  61   LDQTSVTHLFPITKYLGLLATGMTADARSLVQQARHEAAEFRFKWGYEMPVDVLAKWIAD  120

Query  445  KSQVYTQHAYMRPLGVVAMILG  510
            KSQ+YTQHAYMRPLG+ AM+LG
Sbjct  121  KSQIYTQHAYMRPLGIAAMVLG  142



>gb|KHN46954.1| Proteasome subunit alpha type-6 [Glycine soja]
Length=560

 Score =   288 bits (736),  Expect = 4e-91, Method: Compositional matrix adjust.
 Identities = 135/142 (95%), Positives = 140/142 (99%), Gaps = 0/142 (0%)
 Frame = +1

Query  85   MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL  264
            MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDS+CVVTQKKVPDKL
Sbjct  1    MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSICVVTQKKVPDKL  60

Query  265  LDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYEMPVDVLARWIAD  444
            LD TSVTHLFP+TKYLGLLATG+TADARTLVQQARNEAAEFRF YGYEMPVDVLA+WIAD
Sbjct  61   LDNTSVTHLFPITKYLGLLATGMTADARTLVQQARNEAAEFRFTYGYEMPVDVLAKWIAD  120

Query  445  KSQVYTQHAYMRPLGVVAMILG  510
            KSQVYTQHAYMRPLGVVAM+LG
Sbjct  121  KSQVYTQHAYMRPLGVVAMVLG  142



>ref|XP_010666851.1| PREDICTED: proteasome subunit alpha type-6 [Beta vulgaris subsp. 
vulgaris]
Length=246

 Score =   276 bits (707),  Expect = 9e-91, Method: Compositional matrix adjust.
 Identities = 131/142 (92%), Positives = 137/142 (96%), Gaps = 0/142 (0%)
 Frame = +1

Query  85   MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL  264
            MSRGSG GYDRHITIFSPEGRLFQVEYAFKAVK++GITSI VRGKDSVCVVTQKKVPDKL
Sbjct  1    MSRGSGAGYDRHITIFSPEGRLFQVEYAFKAVKSSGITSIAVRGKDSVCVVTQKKVPDKL  60

Query  265  LDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYEMPVDVLARWIAD  444
            LDQTSV+HLF VTKYLGLLATG+TADAR LVQQARNEAAEFR +YGYEMPVDVLARWIAD
Sbjct  61   LDQTSVSHLFQVTKYLGLLATGMTADARNLVQQARNEAAEFRHKYGYEMPVDVLARWIAD  120

Query  445  KSQVYTQHAYMRPLGVVAMILG  510
            KSQVYTQHAYMRPLGVVAM+LG
Sbjct  121  KSQVYTQHAYMRPLGVVAMVLG  142



>ref|XP_006649499.1| PREDICTED: proteasome subunit alpha type-6-like [Oryza brachyantha]
Length=246

 Score =   276 bits (706),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 127/142 (89%), Positives = 140/142 (99%), Gaps = 0/142 (0%)
 Frame = +1

Query  85   MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL  264
            MSRG+G GYDRHITIFSPEGRL+QVEYAFKAVK+AG+TSIGVRGKDSVCVVTQKKVPDKL
Sbjct  1    MSRGTGAGYDRHITIFSPEGRLYQVEYAFKAVKSAGVTSIGVRGKDSVCVVTQKKVPDKL  60

Query  265  LDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYEMPVDVLARWIAD  444
            LDQTSVTHLFP+TKY+GLLATG+TADAR+LV QARNEAAEFRF++GYEMPVDVLA+WIAD
Sbjct  61   LDQTSVTHLFPITKYVGLLATGLTADARSLVYQARNEAAEFRFKWGYEMPVDVLAKWIAD  120

Query  445  KSQVYTQHAYMRPLGVVAMILG  510
            K+QVYTQHAYMRPLGVVAM+LG
Sbjct  121  KAQVYTQHAYMRPLGVVAMVLG  142



>ref|XP_006474716.1| PREDICTED: proteasome subunit alpha type-6-like isoform X1 [Citrus 
sinensis]
 gb|KDO73881.1| hypothetical protein CISIN_1g025892mg [Citrus sinensis]
Length=246

 Score =   276 bits (706),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 129/142 (91%), Positives = 136/142 (96%), Gaps = 0/142 (0%)
 Frame = +1

Query  85   MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL  264
            MSRGSG GYDRHITIFSPEGRLFQVEYAFKAVKA  ITSIGVRGKDSVCVVTQKKVPDKL
Sbjct  1    MSRGSGAGYDRHITIFSPEGRLFQVEYAFKAVKATAITSIGVRGKDSVCVVTQKKVPDKL  60

Query  265  LDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYEMPVDVLARWIAD  444
            LDQT VTHLFP+TKYLGLLATG TADAR+LV QARNEAAE+RF++GYEMPVDVL+RWIAD
Sbjct  61   LDQTCVTHLFPITKYLGLLATGNTADARSLVHQARNEAAEYRFKFGYEMPVDVLSRWIAD  120

Query  445  KSQVYTQHAYMRPLGVVAMILG  510
            KSQVYTQHAYMRPLGVVAM+LG
Sbjct  121  KSQVYTQHAYMRPLGVVAMVLG  142



>ref|XP_010939895.1| PREDICTED: proteasome subunit alpha type-6-like [Elaeis guineensis]
Length=246

 Score =   276 bits (705),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 128/142 (90%), Positives = 138/142 (97%), Gaps = 0/142 (0%)
 Frame = +1

Query  85   MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL  264
            MSRG+G GYDRHITIFSPEGRL+QVEYAFKAVKA GITSIGVRGKDSVCVVTQKKVPDKL
Sbjct  1    MSRGTGAGYDRHITIFSPEGRLYQVEYAFKAVKATGITSIGVRGKDSVCVVTQKKVPDKL  60

Query  265  LDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYEMPVDVLARWIAD  444
            LDQTSVTHLFP+TKYLGLLATG+TADAR+LV QARNEAAEF F++GYEMPVDVLA+WIAD
Sbjct  61   LDQTSVTHLFPITKYLGLLATGMTADARSLVHQARNEAAEFHFKWGYEMPVDVLAKWIAD  120

Query  445  KSQVYTQHAYMRPLGVVAMILG  510
            KSQ+YTQHAYMRPLG+VAMILG
Sbjct  121  KSQIYTQHAYMRPLGLVAMILG  142



>ref|NP_001130062.1| uncharacterized protein LOC100191154 [Zea mays]
 gb|ACF78183.1| unknown [Zea mays]
 gb|ACG28463.1| proteasome subunit alpha type 6 [Zea mays]
 gb|ACG40310.1| proteasome subunit alpha type 6 [Zea mays]
 gb|ACL54338.1| unknown [Zea mays]
Length=246

 Score =   275 bits (703),  Expect = 4e-90, Method: Compositional matrix adjust.
 Identities = 126/142 (89%), Positives = 139/142 (98%), Gaps = 0/142 (0%)
 Frame = +1

Query  85   MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL  264
            MSRG+G GYDRHITIFSPEGRL+QVEYAFKAVK+AG+TSIGVRG DSVCVVTQKKVPDKL
Sbjct  1    MSRGTGAGYDRHITIFSPEGRLYQVEYAFKAVKSAGVTSIGVRGADSVCVVTQKKVPDKL  60

Query  265  LDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYEMPVDVLARWIAD  444
            LDQTSVTHLFP+TKY+GLLATG+TADAR+LV QARNEAAEFRF++GYEMPVDVLA+WIAD
Sbjct  61   LDQTSVTHLFPITKYVGLLATGLTADARSLVSQARNEAAEFRFKWGYEMPVDVLAKWIAD  120

Query  445  KSQVYTQHAYMRPLGVVAMILG  510
            K+QVYTQHAYMRPLGVVAM+LG
Sbjct  121  KAQVYTQHAYMRPLGVVAMVLG  142



>gb|AFW89473.1| hypothetical protein ZEAMMB73_334376 [Zea mays]
Length=214

 Score =   273 bits (699),  Expect = 5e-90, Method: Compositional matrix adjust.
 Identities = 126/142 (89%), Positives = 139/142 (98%), Gaps = 0/142 (0%)
 Frame = +1

Query  85   MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL  264
            MSRG+G GYDRHITIFSPEGRL+QVEYAFKAVK+AG+TSIGVRG DSVCVVTQKKVPDKL
Sbjct  1    MSRGTGAGYDRHITIFSPEGRLYQVEYAFKAVKSAGVTSIGVRGADSVCVVTQKKVPDKL  60

Query  265  LDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYEMPVDVLARWIAD  444
            LDQTSVTHLFP+TKY+GLLATG+TADAR+LV QARNEAAEFRF++GYEMPVDVLA+WIAD
Sbjct  61   LDQTSVTHLFPITKYVGLLATGLTADARSLVSQARNEAAEFRFKWGYEMPVDVLAKWIAD  120

Query  445  KSQVYTQHAYMRPLGVVAMILG  510
            K+QVYTQHAYMRPLGVVAM+LG
Sbjct  121  KAQVYTQHAYMRPLGVVAMVLG  142



>gb|KDO64981.1| hypothetical protein CISIN_1g025897mg [Citrus sinensis]
Length=149

 Score =   271 bits (693),  Expect = 5e-90, Method: Compositional matrix adjust.
 Identities = 129/136 (95%), Positives = 134/136 (99%), Gaps = 0/136 (0%)
 Frame = +1

Query  85   MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL  264
            MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAG+TSIGVRGKDSVCVVTQKKVPDKL
Sbjct  1    MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGVTSIGVRGKDSVCVVTQKKVPDKL  60

Query  265  LDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYEMPVDVLARWIAD  444
            LD TSVTHLFP+TKYLGLLATG+TADARTLVQQAR EAAEFRF+YGYEMPVDVLA+WIAD
Sbjct  61   LDHTSVTHLFPITKYLGLLATGMTADARTLVQQARYEAAEFRFKYGYEMPVDVLAKWIAD  120

Query  445  KSQVYTQHAYMRPLGV  492
            KSQVYTQHAYMRPLGV
Sbjct  121  KSQVYTQHAYMRPLGV  136



>gb|ACN33969.1| unknown [Zea mays]
 tpg|DAA43695.1| TPA: proteasome subunit alpha type [Zea mays]
Length=246

 Score =   275 bits (702),  Expect = 5e-90, Method: Compositional matrix adjust.
 Identities = 126/142 (89%), Positives = 139/142 (98%), Gaps = 0/142 (0%)
 Frame = +1

Query  85   MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL  264
            MSRG+G GYDRHITIFSPEGRL+QVEYAFKAVK+AG+TSIGVRG DSVCVVTQKKVPDKL
Sbjct  1    MSRGTGAGYDRHITIFSPEGRLYQVEYAFKAVKSAGVTSIGVRGADSVCVVTQKKVPDKL  60

Query  265  LDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYEMPVDVLARWIAD  444
            LDQTSVTHLFP+TKY+GLLATG+TADAR+LV QARNEAAEFRF++GYEMPVDVLA+WIAD
Sbjct  61   LDQTSVTHLFPITKYVGLLATGLTADARSLVSQARNEAAEFRFKWGYEMPVDVLAKWIAD  120

Query  445  KSQVYTQHAYMRPLGVVAMILG  510
            K+QVYTQHAYMRPLGVVAM+LG
Sbjct  121  KAQVYTQHAYMRPLGVVAMVLG  142



>ref|XP_004985490.1| PREDICTED: proteasome subunit alpha type-6-like [Setaria italica]
Length=246

 Score =   274 bits (701),  Expect = 8e-90, Method: Compositional matrix adjust.
 Identities = 126/142 (89%), Positives = 139/142 (98%), Gaps = 0/142 (0%)
 Frame = +1

Query  85   MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL  264
            MSRG+G GYDRHITIFSPEGRL+QVEYAFKAVK+AG+TSIGVRG DSVCVVTQKKVPDKL
Sbjct  1    MSRGTGAGYDRHITIFSPEGRLYQVEYAFKAVKSAGVTSIGVRGADSVCVVTQKKVPDKL  60

Query  265  LDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYEMPVDVLARWIAD  444
            LDQTSVTHLFP+TKY+GLLATG+TADAR+LV QARNEAAEFRF++GYEMPVDVLA+WIAD
Sbjct  61   LDQTSVTHLFPITKYIGLLATGLTADARSLVYQARNEAAEFRFKWGYEMPVDVLAKWIAD  120

Query  445  KSQVYTQHAYMRPLGVVAMILG  510
            K+QVYTQHAYMRPLGVVAM+LG
Sbjct  121  KAQVYTQHAYMRPLGVVAMVLG  142



>ref|NP_001049162.1| Os03g0180400 [Oryza sativa Japonica Group]
 sp|Q9LSU3.1|PSA6_ORYSJ RecName: Full=Proteasome subunit alpha type-6; AltName: Full=20S 
proteasome alpha subunit A; AltName: Full=20S proteasome 
subunit alpha-1 [Oryza sativa Japonica Group]
 dbj|BAA96829.1| alpha 1 subunit of 20S proteasome [Oryza sativa Japonica Group]
 gb|AAN65435.1| Putative alpha 1 subunit of 20S proteasome [Oryza sativa Japonica 
Group]
 gb|AAO13479.1| Putative alpha 1 subunit of 20S proteasome [Oryza sativa Japonica 
Group]
 gb|ABF94305.1| Proteasome subunit alpha type 6, putative, expressed [Oryza sativa 
Japonica Group]
 dbj|BAF11076.1| Os03g0180400 [Oryza sativa Japonica Group]
 gb|EAY88785.1| hypothetical protein OsI_10259 [Oryza sativa Indica Group]
 gb|EAZ25813.1| hypothetical protein OsJ_09653 [Oryza sativa Japonica Group]
 dbj|BAG94887.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG87220.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG87278.1| unnamed protein product [Oryza sativa Japonica Group]
Length=246

 Score =   274 bits (701),  Expect = 9e-90, Method: Compositional matrix adjust.
 Identities = 126/142 (89%), Positives = 139/142 (98%), Gaps = 0/142 (0%)
 Frame = +1

Query  85   MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL  264
            MSRG+G GYDRHITIFSPEGRL+QVEYAFKAVK+AG+TSIGVRGKDSVCVVTQKKVPDKL
Sbjct  1    MSRGTGAGYDRHITIFSPEGRLYQVEYAFKAVKSAGVTSIGVRGKDSVCVVTQKKVPDKL  60

Query  265  LDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYEMPVDVLARWIAD  444
            LD TSVTHLFP+TKY+GLLATG+TADAR+LV QARNEAAEFRF++GYEMPVDVLA+WIAD
Sbjct  61   LDHTSVTHLFPITKYIGLLATGLTADARSLVYQARNEAAEFRFKWGYEMPVDVLAKWIAD  120

Query  445  KSQVYTQHAYMRPLGVVAMILG  510
            K+QVYTQHAYMRPLGVVAM+LG
Sbjct  121  KAQVYTQHAYMRPLGVVAMVLG  142



>ref|XP_002465753.1| hypothetical protein SORBIDRAFT_01g045210 [Sorghum bicolor]
 gb|EER92751.1| hypothetical protein SORBIDRAFT_01g045210 [Sorghum bicolor]
Length=246

 Score =   273 bits (699),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 125/142 (88%), Positives = 139/142 (98%), Gaps = 0/142 (0%)
 Frame = +1

Query  85   MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL  264
            MSRG+G GYDRHITIFSPEGRL+QVEYAFKAVK+AG+TSIGVRG DSVCVVTQKKVPDKL
Sbjct  1    MSRGTGAGYDRHITIFSPEGRLYQVEYAFKAVKSAGVTSIGVRGADSVCVVTQKKVPDKL  60

Query  265  LDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYEMPVDVLARWIAD  444
            LDQTSVTHLFP+TK++GLLATG+TADAR+LV QARNEAAEFRF++GYEMPVDVLA+WIAD
Sbjct  61   LDQTSVTHLFPITKFVGLLATGLTADARSLVSQARNEAAEFRFKWGYEMPVDVLAKWIAD  120

Query  445  KSQVYTQHAYMRPLGVVAMILG  510
            K+QVYTQHAYMRPLGVVAM+LG
Sbjct  121  KAQVYTQHAYMRPLGVVAMVLG  142



>ref|NP_001105138.1| maize 20S proteasome alpha subunit [Zea mays]
 emb|CAC19494.1| maize 20S proteasome alpha subunit [Zea mays]
Length=246

 Score =   273 bits (697),  Expect = 3e-89, Method: Compositional matrix adjust.
 Identities = 125/142 (88%), Positives = 138/142 (97%), Gaps = 0/142 (0%)
 Frame = +1

Query  85   MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL  264
            MSRG+G GYDRHITIFSPEGRL+QVEYAFKAVK+AG+TSIGVRG DSVCVVTQKKVPDKL
Sbjct  1    MSRGTGAGYDRHITIFSPEGRLYQVEYAFKAVKSAGVTSIGVRGADSVCVVTQKKVPDKL  60

Query  265  LDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYEMPVDVLARWIAD  444
            LDQTSVTHLFP+TKY+GLLATG+TAD R+LV QARNEAAEFRF++GYEMPVDVLA+WIAD
Sbjct  61   LDQTSVTHLFPITKYVGLLATGLTADGRSLVSQARNEAAEFRFKWGYEMPVDVLAKWIAD  120

Query  445  KSQVYTQHAYMRPLGVVAMILG  510
            K+QVYTQHAYMRPLGVVAM+LG
Sbjct  121  KAQVYTQHAYMRPLGVVAMVLG  142



>ref|XP_003558667.1| PREDICTED: proteasome subunit alpha type-6 [Brachypodium distachyon]
Length=246

 Score =   272 bits (696),  Expect = 5e-89, Method: Compositional matrix adjust.
 Identities = 124/142 (87%), Positives = 139/142 (98%), Gaps = 0/142 (0%)
 Frame = +1

Query  85   MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL  264
            MSRGSG GYDRHITIFSPEGRL+QVEYAFKAVK+AG+TSIGVRGKDSVCVVTQKKVPDKL
Sbjct  1    MSRGSGAGYDRHITIFSPEGRLYQVEYAFKAVKSAGVTSIGVRGKDSVCVVTQKKVPDKL  60

Query  265  LDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYEMPVDVLARWIAD  444
            LD+TSVTHLFP+TKY+GLLATG+TADAR+LV QARNEAAE+R ++GYEMPVDVLA+WIAD
Sbjct  61   LDETSVTHLFPITKYIGLLATGLTADARSLVSQARNEAAEYRKKWGYEMPVDVLAKWIAD  120

Query  445  KSQVYTQHAYMRPLGVVAMILG  510
            K+Q+YTQHAYMRPLGVVAM+LG
Sbjct  121  KAQIYTQHAYMRPLGVVAMVLG  142



>emb|CDY50408.1| BnaC03g45100D [Brassica napus]
Length=244

 Score =   271 bits (694),  Expect = 8e-89, Method: Compositional matrix adjust.
 Identities = 128/142 (90%), Positives = 138/142 (97%), Gaps = 2/142 (1%)
 Frame = +1

Query  85   MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL  264
            MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL
Sbjct  1    MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL  60

Query  265  LDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYEMPVDVLARWIAD  444
            LD++SV+HLFPVTKYLGLLATG+TAD+R+LV QARNEAAEFRF+YGYEMP D+LA+WIAD
Sbjct  61   LDESSVSHLFPVTKYLGLLATGMTADSRSLVTQARNEAAEFRFQYGYEMPADILAKWIAD  120

Query  445  KSQVYTQHAYMRPLGVVAMILG  510
            KSQVYTQHAYMRPL  VAM+LG
Sbjct  121  KSQVYTQHAYMRPL--VAMVLG  140



>ref|XP_002516258.1| proteasome subunit alpha type, putative [Ricinus communis]
 gb|EEF46260.1| proteasome subunit alpha type, putative [Ricinus communis]
Length=246

 Score =   271 bits (693),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 136/142 (96%), Positives = 141/142 (99%), Gaps = 0/142 (0%)
 Frame = +1

Query  85   MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL  264
            MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAA +TSIGVRGKDSVCVVTQKKVPDKL
Sbjct  1    MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAAVTSIGVRGKDSVCVVTQKKVPDKL  60

Query  265  LDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYEMPVDVLARWIAD  444
            LDQTSVTHLFP+TKYLGLLATG+TADARTLVQQARNEAAEFRFRYGYEMPVDVLARWIAD
Sbjct  61   LDQTSVTHLFPITKYLGLLATGMTADARTLVQQARNEAAEFRFRYGYEMPVDVLARWIAD  120

Query  445  KSQVYTQHAYMRPLGVVAMILG  510
            KSQVYTQHAYMRPLGV+AM+LG
Sbjct  121  KSQVYTQHAYMRPLGVIAMVLG  142



>gb|ABK22399.1| unknown [Picea sitchensis]
 gb|ABK25916.1| unknown [Picea sitchensis]
Length=246

 Score =   270 bits (691),  Expect = 3e-88, Method: Compositional matrix adjust.
 Identities = 125/142 (88%), Positives = 138/142 (97%), Gaps = 0/142 (0%)
 Frame = +1

Query  85   MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL  264
            MSRG+G GYDRHITIFSPEGRL+QVEYAFKAVKAAGITSIGVRGKDS+CVVTQKKVPDKL
Sbjct  1    MSRGTGAGYDRHITIFSPEGRLYQVEYAFKAVKAAGITSIGVRGKDSICVVTQKKVPDKL  60

Query  265  LDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYEMPVDVLARWIAD  444
            LDQTSVTHLFP+TK++GLLATG+TADAR+LVQ ARNEAAEFRF++GYEMPVDVLAR +AD
Sbjct  61   LDQTSVTHLFPITKFIGLLATGMTADARSLVQHARNEAAEFRFKWGYEMPVDVLARRLAD  120

Query  445  KSQVYTQHAYMRPLGVVAMILG  510
            KSQVYTQHAYMRPLGV A++LG
Sbjct  121  KSQVYTQHAYMRPLGVAAIVLG  142



>emb|CDX93103.1| BnaA03g38250D [Brassica napus]
Length=263

 Score =   270 bits (690),  Expect = 6e-88, Method: Compositional matrix adjust.
 Identities = 126/136 (93%), Positives = 134/136 (99%), Gaps = 0/136 (0%)
 Frame = +1

Query  85   MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL  264
            MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL
Sbjct  1    MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL  60

Query  265  LDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYEMPVDVLARWIAD  444
            LD++SVTHLFPVTKYLGLLATG+TAD+R+LV QARNEAAEFRF+YGYEMP D+LA+WIAD
Sbjct  61   LDESSVTHLFPVTKYLGLLATGMTADSRSLVTQARNEAAEFRFQYGYEMPADILAKWIAD  120

Query  445  KSQVYTQHAYMRPLGV  492
            KSQVYTQHAYMRPLGV
Sbjct  121  KSQVYTQHAYMRPLGV  136



>gb|AGO97077.1| 20S proteasome alpha [Saccharum hybrid cultivar GT28]
Length=246

 Score =   269 bits (687),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 123/142 (87%), Positives = 137/142 (96%), Gaps = 0/142 (0%)
 Frame = +1

Query  85   MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL  264
            MSRG+G GYDRHITIFSPEG L+QVEYAFKAVK+AG+TSIGVRG DSVCVVTQKKVPDKL
Sbjct  1    MSRGTGAGYDRHITIFSPEGHLYQVEYAFKAVKSAGVTSIGVRGADSVCVVTQKKVPDKL  60

Query  265  LDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYEMPVDVLARWIAD  444
            LDQTSVTHL P+TK++GLLATG+TADAR+LV QARNEAAEFRF++GYEMPVDVLA+WIAD
Sbjct  61   LDQTSVTHLLPITKFVGLLATGLTADARSLVSQARNEAAEFRFKWGYEMPVDVLAKWIAD  120

Query  445  KSQVYTQHAYMRPLGVVAMILG  510
            K+QVYTQHAYMRPLGVVAM+LG
Sbjct  121  KAQVYTQHAYMRPLGVVAMVLG  142



>gb|EMT09268.1| Proteasome subunit alpha type-6 [Aegilops tauschii]
Length=246

 Score =   268 bits (686),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 123/142 (87%), Positives = 136/142 (96%), Gaps = 0/142 (0%)
 Frame = +1

Query  85   MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL  264
            MSRGSG GYDRHITIFSPEGRL+QVEYAFKAVK+AG+TSIGVRGKDSVCVVTQKKVPDKL
Sbjct  1    MSRGSGAGYDRHITIFSPEGRLYQVEYAFKAVKSAGVTSIGVRGKDSVCVVTQKKVPDKL  60

Query  265  LDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYEMPVDVLARWIAD  444
            LD TS+THLF +TKY GLLATG+TADAR+LV QARNEAAEFR ++GYEMPVDVLA+WIAD
Sbjct  61   LDDTSITHLFSITKYTGLLATGLTADARSLVSQARNEAAEFRKKWGYEMPVDVLAKWIAD  120

Query  445  KSQVYTQHAYMRPLGVVAMILG  510
            K+Q+YTQHAYMRPLGVVAM+LG
Sbjct  121  KAQIYTQHAYMRPLGVVAMVLG  142



>dbj|BAJ85935.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=246

 Score =   268 bits (686),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 123/142 (87%), Positives = 136/142 (96%), Gaps = 0/142 (0%)
 Frame = +1

Query  85   MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL  264
            MSRGSG GYDRHITIFSPEGRL+QVEYAFKAVK+AG+TSIGVRGKDSVCVVTQKKVPDKL
Sbjct  1    MSRGSGAGYDRHITIFSPEGRLYQVEYAFKAVKSAGVTSIGVRGKDSVCVVTQKKVPDKL  60

Query  265  LDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYEMPVDVLARWIAD  444
            LD TS+THLF +TKY GLLATG+TADAR+LV QARNEAAEFR ++GYEMPVDVLA+WIAD
Sbjct  61   LDDTSITHLFSITKYTGLLATGLTADARSLVSQARNEAAEFRKKWGYEMPVDVLAKWIAD  120

Query  445  KSQVYTQHAYMRPLGVVAMILG  510
            K+Q+YTQHAYMRPLGVVAM+LG
Sbjct  121  KAQIYTQHAYMRPLGVVAMVLG  142



>tpg|DAA43694.1| TPA: hypothetical protein ZEAMMB73_913533 [Zea mays]
Length=146

 Score =   264 bits (674),  Expect = 4e-87, Method: Compositional matrix adjust.
 Identities = 122/137 (89%), Positives = 134/137 (98%), Gaps = 0/137 (0%)
 Frame = +1

Query  85   MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL  264
            MSRG+G GYDRHITIFSPEGRL+QVEYAFKAVK+AG+TSIGVRG DSVCVVTQKKVPDKL
Sbjct  1    MSRGTGAGYDRHITIFSPEGRLYQVEYAFKAVKSAGVTSIGVRGADSVCVVTQKKVPDKL  60

Query  265  LDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYEMPVDVLARWIAD  444
            LDQTSVTHLFP+TKY+GLLATG+TADAR+LV QARNEAAEFRF++GYEMPVDVLA+WIAD
Sbjct  61   LDQTSVTHLFPITKYVGLLATGLTADARSLVSQARNEAAEFRFKWGYEMPVDVLAKWIAD  120

Query  445  KSQVYTQHAYMRPLGVV  495
            K+QVYTQHAYMRPLGVV
Sbjct  121  KAQVYTQHAYMRPLGVV  137



>ref|XP_006474717.1| PREDICTED: proteasome subunit alpha type-6-like isoform X2 [Citrus 
sinensis]
 gb|KDO73882.1| hypothetical protein CISIN_1g025892mg [Citrus sinensis]
Length=244

 Score =   266 bits (681),  Expect = 8e-87, Method: Compositional matrix adjust.
 Identities = 127/142 (89%), Positives = 134/142 (94%), Gaps = 2/142 (1%)
 Frame = +1

Query  85   MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL  264
            MSRGSG GYDRHITIFSPEGRLFQVEYAFKAVKA  ITSIGVRGKDSVCVVTQKK  DKL
Sbjct  1    MSRGSGAGYDRHITIFSPEGRLFQVEYAFKAVKATAITSIGVRGKDSVCVVTQKK--DKL  58

Query  265  LDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYEMPVDVLARWIAD  444
            LDQT VTHLFP+TKYLGLLATG TADAR+LV QARNEAAE+RF++GYEMPVDVL+RWIAD
Sbjct  59   LDQTCVTHLFPITKYLGLLATGNTADARSLVHQARNEAAEYRFKFGYEMPVDVLSRWIAD  118

Query  445  KSQVYTQHAYMRPLGVVAMILG  510
            KSQVYTQHAYMRPLGVVAM+LG
Sbjct  119  KSQVYTQHAYMRPLGVVAMVLG  140



>gb|KDO64977.1| hypothetical protein CISIN_1g025897mg [Citrus sinensis]
Length=241

 Score =   265 bits (678),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 128/141 (91%), Positives = 134/141 (95%), Gaps = 5/141 (4%)
 Frame = +1

Query  85   MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL  264
            MSRGSGGGYDRHITIFSPEGRLFQV     AVKAAG+TSIGVRGKDSVCVVTQKKVPDKL
Sbjct  1    MSRGSGGGYDRHITIFSPEGRLFQV-----AVKAAGVTSIGVRGKDSVCVVTQKKVPDKL  55

Query  265  LDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYEMPVDVLARWIAD  444
            LD TSVTHLFP+TKYLGLLATG+TADARTLVQQAR EAAEFRF+YGYEMPVDVLA+WIAD
Sbjct  56   LDHTSVTHLFPITKYLGLLATGMTADARTLVQQARYEAAEFRFKYGYEMPVDVLAKWIAD  115

Query  445  KSQVYTQHAYMRPLGVVAMIL  507
            KSQVYTQHAYMRPLGVVAM+L
Sbjct  116  KSQVYTQHAYMRPLGVVAMVL  136



>ref|XP_006452821.1| hypothetical protein CICLE_v10010323mg [Citrus clementina]
 gb|ESR66061.1| hypothetical protein CICLE_v10010323mg [Citrus clementina]
Length=235

 Score =   265 bits (677),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 124/136 (91%), Positives = 130/136 (96%), Gaps = 0/136 (0%)
 Frame = +1

Query  85   MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL  264
            MSRGSG GYDRHITIFSPEGRLFQVEYAFKAVKA  ITSIGVRGKDSVCVVTQKKVPDKL
Sbjct  1    MSRGSGAGYDRHITIFSPEGRLFQVEYAFKAVKATAITSIGVRGKDSVCVVTQKKVPDKL  60

Query  265  LDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYEMPVDVLARWIAD  444
            LDQT VTHLFP+TKYLGLLATG TADAR+LV QARNEAAE+RF++GYEMPVDVL+RWIAD
Sbjct  61   LDQTCVTHLFPITKYLGLLATGNTADARSLVHQARNEAAEYRFKFGYEMPVDVLSRWIAD  120

Query  445  KSQVYTQHAYMRPLGV  492
            KSQVYTQHAYMRPLGV
Sbjct  121  KSQVYTQHAYMRPLGV  136



>ref|XP_001777426.1| predicted protein [Physcomitrella patens]
 gb|EDQ57713.1| predicted protein [Physcomitrella patens]
Length=246

 Score =   254 bits (648),  Expect = 7e-82, Method: Compositional matrix adjust.
 Identities = 119/142 (84%), Positives = 132/142 (93%), Gaps = 0/142 (0%)
 Frame = +1

Query  85   MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL  264
            MSRGSG GYDRHITIFSPEGRL+QVEYAFKAVKAAGITSIGVRG DSVC VTQKKVPDKL
Sbjct  1    MSRGSGAGYDRHITIFSPEGRLYQVEYAFKAVKAAGITSIGVRGNDSVCFVTQKKVPDKL  60

Query  265  LDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYEMPVDVLARWIAD  444
            LDQTSVTHLF VTKY+GLLATG+TADA++L+  ARNEAAEF+F+ GYE+PVD LA+ +AD
Sbjct  61   LDQTSVTHLFAVTKYIGLLATGMTADAKSLLAHARNEAAEFKFKLGYEIPVDYLAKRLAD  120

Query  445  KSQVYTQHAYMRPLGVVAMILG  510
            KSQVYTQHAYMRPLGV AM++G
Sbjct  121  KSQVYTQHAYMRPLGVSAMLIG  142



>gb|ABF94306.1| Proteasome subunit alpha type 6, putative, expressed [Oryza sativa 
Japonica Group]
Length=286

 Score =   254 bits (650),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 126/182 (69%), Positives = 139/182 (76%), Gaps = 40/182 (22%)
 Frame = +1

Query  85   MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVP---  255
            MSRG+G GYDRHITIFSPEGRL+QVEYAFKAVK+AG+TSIGVRGKDSVCVVTQKKVP   
Sbjct  1    MSRGTGAGYDRHITIFSPEGRLYQVEYAFKAVKSAGVTSIGVRGKDSVCVVTQKKVPVSS  60

Query  256  -------------------------------------DKLLDQTSVTHLFPVTKYLGLLA  324
                                                 DKLLD TSVTHLFP+TKY+GLLA
Sbjct  61   LRFDLKRSRLYAVYTAIRDQERRLICLAPCDVILILQDKLLDHTSVTHLFPITKYIGLLA  120

Query  325  TGITADARTLVQQARNEAAEFRFRYGYEMPVDVLARWIADKSQVYTQHAYMRPLGVVAMI  504
            TG+TADAR+LV QARNEAAEFRF++GYEMPVDVLA+WIADK+QVYTQHAYMRPLGVVAM+
Sbjct  121  TGLTADARSLVYQARNEAAEFRFKWGYEMPVDVLAKWIADKAQVYTQHAYMRPLGVVAMV  180

Query  505  LG  510
            LG
Sbjct  181  LG  182



>ref|XP_001782615.1| predicted protein [Physcomitrella patens]
 gb|EDQ52604.1| predicted protein [Physcomitrella patens]
Length=246

 Score =   253 bits (646),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 118/142 (83%), Positives = 132/142 (93%), Gaps = 0/142 (0%)
 Frame = +1

Query  85   MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL  264
            MSRGSG GYDRHITIFSPEGRL+QVEYAFKAVKAAGITSIGVRGKDSVC VTQKKVPDKL
Sbjct  1    MSRGSGAGYDRHITIFSPEGRLYQVEYAFKAVKAAGITSIGVRGKDSVCFVTQKKVPDKL  60

Query  265  LDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYEMPVDVLARWIAD  444
            LDQ SVTHLF +TKY+GLLATG+TADA++LV  ARNEAAEF+F+ GYE+PVD LA+ +AD
Sbjct  61   LDQASVTHLFAITKYIGLLATGMTADAKSLVAHARNEAAEFKFKLGYEIPVDYLAKRLAD  120

Query  445  KSQVYTQHAYMRPLGVVAMILG  510
            +SQVYTQHAYMRPLGV AM++G
Sbjct  121  ESQVYTQHAYMRPLGVSAMLIG  142



>ref|XP_001768229.1| predicted protein [Physcomitrella patens]
 gb|EDQ66843.1| predicted protein [Physcomitrella patens]
Length=246

 Score =   252 bits (644),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 119/142 (84%), Positives = 131/142 (92%), Gaps = 0/142 (0%)
 Frame = +1

Query  85   MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL  264
            MSRGSG GYDRHITIFSPEGRL+QVEYAFKAVKAAGITSIGVRGKDSVC VTQKKVPDKL
Sbjct  1    MSRGSGAGYDRHITIFSPEGRLYQVEYAFKAVKAAGITSIGVRGKDSVCFVTQKKVPDKL  60

Query  265  LDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYEMPVDVLARWIAD  444
            LDQTSVTHLF VTK++GLLATG+TADA++L+  ARNEAA F+F  GYE+PVD LA+ IAD
Sbjct  61   LDQTSVTHLFAVTKFIGLLATGMTADAKSLIAHARNEAANFKFDLGYEIPVDYLAKRIAD  120

Query  445  KSQVYTQHAYMRPLGVVAMILG  510
            KSQVYTQHAYMRPLGV AM++G
Sbjct  121  KSQVYTQHAYMRPLGVSAMLIG  142



>ref|XP_002989745.1| hypothetical protein SELMODRAFT_272088 [Selaginella moellendorffii]
 ref|XP_002991751.1| hypothetical protein SELMODRAFT_272230 [Selaginella moellendorffii]
 gb|EFJ07155.1| hypothetical protein SELMODRAFT_272230 [Selaginella moellendorffii]
 gb|EFJ09222.1| hypothetical protein SELMODRAFT_272088 [Selaginella moellendorffii]
Length=246

 Score =   248 bits (632),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 115/142 (81%), Positives = 129/142 (91%), Gaps = 0/142 (0%)
 Frame = +1

Query  85   MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL  264
            MSRGSG GYDRHITIFSPEGRL+QVEYAFKA K+ GITSIGVRG DSVCVVTQKKVPDKL
Sbjct  1    MSRGSGAGYDRHITIFSPEGRLYQVEYAFKAAKSPGITSIGVRGADSVCVVTQKKVPDKL  60

Query  265  LDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYEMPVDVLARWIAD  444
            LDQ+SVTHL+ +T Y+GLLATG+TADAR+LVQ ARNEAAEFR + GYE+PVD L++ +AD
Sbjct  61   LDQSSVTHLYAITPYIGLLATGMTADARSLVQHARNEAAEFRHKNGYEIPVDFLSKRLAD  120

Query  445  KSQVYTQHAYMRPLGVVAMILG  510
            KSQVYTQHAYMRPLGV AMI+ 
Sbjct  121  KSQVYTQHAYMRPLGVAAMIIA  142



>ref|XP_001751730.1| predicted protein [Physcomitrella patens]
 gb|EDQ83165.1| predicted protein [Physcomitrella patens]
Length=246

 Score =   240 bits (613),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 114/142 (80%), Positives = 130/142 (92%), Gaps = 0/142 (0%)
 Frame = +1

Query  85   MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL  264
            MSRG+G GYDRHITIFSPEGRL+QVEYAFKAVK++GITSIGVRG+DSVCVVTQKKVPDKL
Sbjct  1    MSRGTGAGYDRHITIFSPEGRLYQVEYAFKAVKSSGITSIGVRGRDSVCVVTQKKVPDKL  60

Query  265  LDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYEMPVDVLARWIAD  444
            LD++SVTHLF VTK +GLLATG+T DA++LV  AR EAAEFRF+ GYE+PVD LA+ +AD
Sbjct  61   LDRSSVTHLFVVTKRIGLLATGMTGDAKSLVAGARAEAAEFRFKMGYEIPVDYLAKRLAD  120

Query  445  KSQVYTQHAYMRPLGVVAMILG  510
            KSQVYTQHAYMRPLGV AM +G
Sbjct  121  KSQVYTQHAYMRPLGVSAMFIG  142



>ref|XP_008353690.1| PREDICTED: proteasome subunit alpha type-6 [Malus domestica]
Length=117

 Score =   234 bits (597),  Expect = 8e-76, Method: Compositional matrix adjust.
 Identities = 110/117 (94%), Positives = 116/117 (99%), Gaps = 0/117 (0%)
 Frame = +1

Query  85   MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL  264
            MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL
Sbjct  1    MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL  60

Query  265  LDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYEMPVDVLARW  435
            LDQTSVTHLFP+TK++GLLATG+TADARTLV QARNEAAEFRF+YGYEMPVDVLA+W
Sbjct  61   LDQTSVTHLFPITKFVGLLATGMTADARTLVSQARNEAAEFRFKYGYEMPVDVLAKW  117



>ref|XP_004141815.1| PREDICTED: proteasome subunit alpha type-6-like [Cucumis sativus]
Length=130

 Score =   232 bits (591),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 109/120 (91%), Positives = 117/120 (98%), Gaps = 0/120 (0%)
 Frame = +1

Query  85   MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL  264
            MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVK+AG TSIGV+G+DSVCVVTQKKVPDKL
Sbjct  1    MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKSAGTTSIGVKGRDSVCVVTQKKVPDKL  60

Query  265  LDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYEMPVDVLARWIAD  444
            LDQTSVTHLF +TKYLGLLATGITADAR+LVQQARNEAAEFRF+YGYEMPVDVLA+W +D
Sbjct  61   LDQTSVTHLFSITKYLGLLATGITADARSLVQQARNEAAEFRFQYGYEMPVDVLAKWYSD  120



>ref|XP_010111992.1| Proteasome subunit alpha type-6 [Morus notabilis]
 gb|EXC32303.1| Proteasome subunit alpha type-6 [Morus notabilis]
Length=299

 Score =   234 bits (596),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 113/123 (92%), Positives = 119/123 (97%), Gaps = 0/123 (0%)
 Frame = +1

Query  142  GRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKLLDQTSVTHLFPVTKYLGLL  321
            GR    +YAFKAVKAAGITSIGV+GKDSVCVVTQKKVPDKLLDQTSVTHLFP+TKYLGLL
Sbjct  73   GRSSFPKYAFKAVKAAGITSIGVKGKDSVCVVTQKKVPDKLLDQTSVTHLFPITKYLGLL  132

Query  322  ATGITADARTLVQQARNEAAEFRFRYGYEMPVDVLARWIADKSQVYTQHAYMRPLGVVAM  501
            ATG+TADARTLVQQARNEAAEFRFRYGYEMPVDVLA+WIADKSQVYTQHAYMRPLGVVAM
Sbjct  133  ATGMTADARTLVQQARNEAAEFRFRYGYEMPVDVLAKWIADKSQVYTQHAYMRPLGVVAM  192

Query  502  ILG  510
            +LG
Sbjct  193  VLG  195



>ref|XP_005648429.1| proteasome subunit alpha type-6 [Coccomyxa subellipsoidea C-169]
 gb|EIE23885.1| proteasome subunit alpha type-6 [Coccomyxa subellipsoidea C-169]
Length=247

 Score =   231 bits (590),  Expect = 6e-73, Method: Compositional matrix adjust.
 Identities = 110/142 (77%), Positives = 127/142 (89%), Gaps = 0/142 (0%)
 Frame = +1

Query  85   MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL  264
            MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSI VRGKDSV VVTQKKVPDKL
Sbjct  1    MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIAVRGKDSVAVVTQKKVPDKL  60

Query  265  LDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYEMPVDVLARWIAD  444
            +D +SVTH+F +TK++G+LATG  ADAR+LVQ++R+ AAEFR  YGYE+PVD LA  +AD
Sbjct  61   IDPSSVTHMFKITKFIGMLATGQRADARSLVQKSRSIAAEFRHTYGYEIPVDYLAARLAD  120

Query  445  KSQVYTQHAYMRPLGVVAMILG  510
            ++QVYTQHAYMRPL VV ++ G
Sbjct  121  QAQVYTQHAYMRPLAVVLILAG  142



>gb|KDO64982.1| hypothetical protein CISIN_1g025897mg [Citrus sinensis]
Length=225

 Score =   230 bits (586),  Expect = 9e-73, Method: Compositional matrix adjust.
 Identities = 108/118 (92%), Positives = 115/118 (97%), Gaps = 0/118 (0%)
 Frame = +1

Query  157  VEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKLLDQTSVTHLFPVTKYLGLLATGIT  336
            +EYAFKAVKAAG+TSIGVRGKDSVCVVTQKKVPDKLLD TSVTHLFP+TKYLGLLATG+T
Sbjct  4    IEYAFKAVKAAGVTSIGVRGKDSVCVVTQKKVPDKLLDHTSVTHLFPITKYLGLLATGMT  63

Query  337  ADARTLVQQARNEAAEFRFRYGYEMPVDVLARWIADKSQVYTQHAYMRPLGVVAMILG  510
            ADARTLVQQAR EAAEFRF+YGYEMPVDVLA+WIADKSQVYTQHAYMRPLGVVAM+L 
Sbjct  64   ADARTLVQQARYEAAEFRFKYGYEMPVDVLAKWIADKSQVYTQHAYMRPLGVVAMVLS  121



>ref|XP_001691723.1| 20S proteasome alpha subunit A [Chlamydomonas reinhardtii]
 gb|EDP04831.1| 20S proteasome alpha subunit A [Chlamydomonas reinhardtii]
Length=249

 Score =   226 bits (575),  Expect = 9e-71, Method: Compositional matrix adjust.
 Identities = 106/142 (75%), Positives = 126/142 (89%), Gaps = 1/142 (1%)
 Frame = +1

Query  85   MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL  264
            MSRG G GYDRHITIFSPEGRLFQVEYAFKAV+ AG+TSIGVRGKDSV  VTQKKV DKL
Sbjct  1    MSRG-GSGYDRHITIFSPEGRLFQVEYAFKAVRTAGVTSIGVRGKDSVVFVTQKKVQDKL  59

Query  265  LDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYEMPVDVLARWIAD  444
            +D TSVT LF +TK++G+L TG+ AD R +VQQAR +AA+FRF++GYE+PVD LA+ +AD
Sbjct  60   IDPTSVTRLFKITKFIGMLVTGLPADTRAIVQQARQQAADFRFKFGYEVPVDYLAKVLAD  119

Query  445  KSQVYTQHAYMRPLGVVAMILG  510
            K+QVYTQHAYMRPLGVV+M++G
Sbjct  120  KAQVYTQHAYMRPLGVVSMLIG  141



>ref|XP_002949740.1| 20S proteasome alpha subunit A [Volvox carteri f. nagariensis]
 gb|EFJ49292.1| 20S proteasome alpha subunit A [Volvox carteri f. nagariensis]
Length=249

 Score =   224 bits (570),  Expect = 6e-70, Method: Compositional matrix adjust.
 Identities = 105/142 (74%), Positives = 125/142 (88%), Gaps = 1/142 (1%)
 Frame = +1

Query  85   MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL  264
            MSRG G GYDRHITIFSPEGRLFQVEYAFKAV+ AG+TSI VRGKDSV  VTQKKV DKL
Sbjct  1    MSRG-GSGYDRHITIFSPEGRLFQVEYAFKAVRTAGVTSIAVRGKDSVVFVTQKKVQDKL  59

Query  265  LDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYEMPVDVLARWIAD  444
            +D TSVT LF +TKY+G+L TG+ AD R +VQQAR +AA+FRF++GYE+PVD LA+ +AD
Sbjct  60   IDPTSVTRLFKITKYVGMLVTGLPADTRAIVQQARQQAADFRFKFGYEVPVDYLAKVLAD  119

Query  445  KSQVYTQHAYMRPLGVVAMILG  510
            K+QVYTQHAYMRPLGV++M++G
Sbjct  120  KAQVYTQHAYMRPLGVISMLIG  141



>gb|KDD75255.1| proteasome subunit protein [Helicosporidium sp. ATCC 50920]
Length=248

 Score =   222 bits (565),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 100/142 (70%), Positives = 124/142 (87%), Gaps = 0/142 (0%)
 Frame = +1

Query  85   MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL  264
            MSRGSG GYDRHITIFSPEGRL+QVEYAFKA K +G+TS+ VRG DSV  V+QKKVPDK+
Sbjct  1    MSRGSGAGYDRHITIFSPEGRLYQVEYAFKAAKTSGLTSVAVRGADSVVFVSQKKVPDKM  60

Query  265  LDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYEMPVDVLARWIAD  444
            +D +S+T+++ +T   GLL TG+  DAR+LV +AR+EAAEFRF+YGYEMPVDVLAR +AD
Sbjct  61   VDASSITNIYKITACTGLLVTGMHGDARSLVHKARSEAAEFRFKYGYEMPVDVLARVLAD  120

Query  445  KSQVYTQHAYMRPLGVVAMILG  510
            ++QV+TQHAYMRPLGV+A I+G
Sbjct  121  QAQVHTQHAYMRPLGVIATIIG  142



>ref|XP_003059392.1| predicted protein [Micromonas pusilla CCMP1545]
 gb|EEH56524.1| predicted protein [Micromonas pusilla CCMP1545]
Length=249

 Score =   217 bits (553),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 97/142 (68%), Positives = 120/142 (85%), Gaps = 0/142 (0%)
 Frame = +1

Query  85   MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL  264
            MSRGSG GYDRHITIFSPEGRL+QVEYAFKA+K+ G+TSIGVRGKDSVCVVTQKK+PDKL
Sbjct  1    MSRGSGSGYDRHITIFSPEGRLYQVEYAFKAIKSVGVTSIGVRGKDSVCVVTQKKIPDKL  60

Query  265  LDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYEMPVDVLARWIAD  444
            +D   VTH+F +TK +G+ ATG + D R +VQ+AR++AAEFR  +GYE+PVD L+  +AD
Sbjct  61   VDPADVTHMFKITKVIGMCATGKSPDIRNVVQKARHKAAEFRHEFGYEIPVDFLSTRMAD  120

Query  445  KSQVYTQHAYMRPLGVVAMILG  510
            + QVYTQHAYMRP+  + M +G
Sbjct  121  EFQVYTQHAYMRPMAAMCMFVG  142



>ref|XP_007513369.1| predicted protein [Bathycoccus prasinos]
 emb|CCO16927.1| predicted protein [Bathycoccus prasinos]
Length=247

 Score =   213 bits (543),  Expect = 5e-66, Method: Compositional matrix adjust.
 Identities = 97/142 (68%), Positives = 117/142 (82%), Gaps = 0/142 (0%)
 Frame = +1

Query  85   MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL  264
            MSRG+GGGYDRHITIFSPEGRL+QVEYAFKA+KA GI SI V+GKD V  VTQKK PD L
Sbjct  1    MSRGAGGGYDRHITIFSPEGRLYQVEYAFKAIKAVGINSIAVKGKDCVVAVTQKKCPDVL  60

Query  265  LDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYEMPVDVLARWIAD  444
            +DQ+++TH+F VTK LG+  TG   D R +VQ+AR +AAEFRF YGYE+PVDVLA  +AD
Sbjct  61   IDQSAMTHMFKVTKTLGMCMTGKDPDIRNVVQKARKQAAEFRFEYGYEIPVDVLANKMAD  120

Query  445  KSQVYTQHAYMRPLGVVAMILG  510
            + QVYTQHAYMRPL  + +++G
Sbjct  121  EFQVYTQHAYMRPLATMCILMG  142



>ref|XP_005717620.1| 20S core proteasome subunit alpha 1 [Chondrus crispus]
 emb|CDF37749.1| 20S core proteasome subunit alpha 1 [Chondrus crispus]
Length=251

 Score =   214 bits (544),  Expect = 5e-66, Method: Compositional matrix adjust.
 Identities = 98/142 (69%), Positives = 118/142 (83%), Gaps = 0/142 (0%)
 Frame = +1

Query  85   MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL  264
            MSRGS  GYDRHITIFSPEGRLFQVEYAFKAVK  GIT+I VRGKDSVC VTQKKVPDKL
Sbjct  1    MSRGSSAGYDRHITIFSPEGRLFQVEYAFKAVKGPGITAIAVRGKDSVCAVTQKKVPDKL  60

Query  265  LDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYEMPVDVLARWIAD  444
            +D +SV+  F +++  G +ATGI  DA+ +VQ+ R+EAAEF+F Y YE+PV+ LAR +AD
Sbjct  61   IDPSSVSSAFRLSENHGCIATGIITDAKAMVQRTRSEAAEFKFNYAYEIPVEYLARRVAD  120

Query  445  KSQVYTQHAYMRPLGVVAMILG  510
            ++Q+YTQHAYMRPLGV   I+G
Sbjct  121  ENQIYTQHAYMRPLGVSLTIIG  142



>ref|XP_001418143.1| predicted protein [Ostreococcus lucimarinus CCE9901]
 gb|ABO96436.1| predicted protein [Ostreococcus lucimarinus CCE9901]
Length=246

 Score =   212 bits (540),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 94/142 (66%), Positives = 121/142 (85%), Gaps = 0/142 (0%)
 Frame = +1

Query  85   MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL  264
            MSRG+G GYDRHIT+FSPEGRL+QVEYAFKA+K+ G+T+IGVRGKDSVCVVTQKK+PDKL
Sbjct  1    MSRGAGAGYDRHITVFSPEGRLYQVEYAFKAIKSVGVTTIGVRGKDSVCVVTQKKIPDKL  60

Query  265  LDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYEMPVDVLARWIAD  444
            +D + VTH++ +TK +G+ ATG   D R +VQ+AR +AA+F+  YGYE+PVDVLA  +AD
Sbjct  61   IDASDVTHMYKITKTVGMCATGKGPDIRDIVQKARRKAADFKQHYGYEVPVDVLANILAD  120

Query  445  KSQVYTQHAYMRPLGVVAMILG  510
            + QVYTQHAYMRPL V+ +++ 
Sbjct  121  EFQVYTQHAYMRPLAVMVILIA  142



>ref|XP_005843942.1| hypothetical protein CHLNCDRAFT_27583 [Chlorella variabilis]
 gb|EFN51840.1| hypothetical protein CHLNCDRAFT_27583 [Chlorella variabilis]
Length=246

 Score =   209 bits (533),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 97/141 (69%), Positives = 121/141 (86%), Gaps = 1/141 (1%)
 Frame = +1

Query  85   MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL  264
            MS GSGG YDRHITIFSPEGRL+QVEYAFKA K+ G+T+I VRG DSVC VTQ+KVPDKL
Sbjct  1    MSHGSGG-YDRHITIFSPEGRLYQVEYAFKAAKSNGLTAIAVRGTDSVCFVTQRKVPDKL  59

Query  265  LDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYEMPVDVLARWIAD  444
             D +SVT +  +TK +G+L TG+  DAR+L+Q+AR+EAAEFRF++GYEMPV  LAR +AD
Sbjct  60   TDPSSVTQIHSITKNIGMLLTGMHGDARSLMQKARSEAAEFRFKFGYEMPVHYLARVLAD  119

Query  445  KSQVYTQHAYMRPLGVVAMIL  507
            ++QVYTQHAYMRPLGV+ +++
Sbjct  120  QAQVYTQHAYMRPLGVIPILI  140



>emb|CEF98211.1| Proteasome A-type subunit [Ostreococcus tauri]
Length=246

 Score =   209 bits (533),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 94/141 (67%), Positives = 120/141 (85%), Gaps = 0/141 (0%)
 Frame = +1

Query  85   MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL  264
            MSRGS  GYDRHIT+FSP+GRL+QVEYAFKA+K+ G+TSIGVRGKDSVCVVTQKK+PDKL
Sbjct  1    MSRGSTAGYDRHITVFSPDGRLYQVEYAFKAIKSVGMTSIGVRGKDSVCVVTQKKIPDKL  60

Query  265  LDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYEMPVDVLARWIAD  444
            +D T VTH++ +TK +G+ ATG   D R +VQ+AR +AA+F+  YGY++PVDVLA  +AD
Sbjct  61   IDPTDVTHMYKITKTVGMCATGKGPDIRDIVQKARRKAADFKQNYGYDVPVDVLANILAD  120

Query  445  KSQVYTQHAYMRPLGVVAMIL  507
            + QVYTQHAYMRPL V+ +++
Sbjct  121  EFQVYTQHAYMRPLAVMVILV  141



>ref|XP_006932865.1| PREDICTED: proteasome subunit alpha type-6 isoform X2 [Felis 
catus]
Length=203

 Score =   203 bits (517),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 91/142 (64%), Positives = 118/142 (83%), Gaps = 0/142 (0%)
 Frame = +1

Query  85   MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL  264
            MSRGS  G+DRHITIFSPEGRL+QVEYAFKA+   G+TS+ VRGKD   +VTQKKVPDKL
Sbjct  1    MSRGSSAGFDRHITIFSPEGRLYQVEYAFKAINQGGLTSVAVRGKDCAVIVTQKKVPDKL  60

Query  265  LDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYEMPVDVLARWIAD  444
            LD ++VTHLF +T+ +G + TG+TAD+R+ VQ+AR EAA ++++YGYE+PVD+L + IAD
Sbjct  61   LDSSTVTHLFKITENIGCVMTGMTADSRSQVQRARYEAANWKYKYGYEIPVDMLCKRIAD  120

Query  445  KSQVYTQHAYMRPLGVVAMILG  510
             SQVYTQ+A MRPLG   +++G
Sbjct  121  ISQVYTQNAEMRPLGCCMILIG  142



>gb|KIY96698.1| 20S proteasome subunit alpha 1 [Monoraphidium neglectum]
Length=290

 Score =   206 bits (525),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 103/178 (58%), Positives = 125/178 (70%), Gaps = 37/178 (21%)
 Frame = +1

Query  85   MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL  264
            MSRGSG GYDRHITIFSPEGRLFQVEYAFKAV+ +GITSI +RGKD VC VTQKKV DKL
Sbjct  1    MSRGSGSGYDRHITIFSPEGRLFQVEYAFKAVRQSGITSIAIRGKDCVCFVTQKKVQDKL  60

Query  265  LDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYEMPVDVLARWIAD  444
            +D  +VT +F +TKY+G+L TG+ AD+R++VQQAR +AAEFRF YGYE+PVD LA+ +AD
Sbjct  61   IDPGTVTRIFKITKYIGMLVTGLPADSRSVVQQARQQAAEFRFTYGYEVPVDYLAKVLAD  120

Query  445  KSQVYT-------------------------------------QHAYMRPLGVVAMIL  507
            K+QVYT                                     QHAYMRPLGV++M++
Sbjct  121  KAQVYTQVGAGMLAGRGPPPADWGCPLTPPAGARWLAPPTALSQHAYMRPLGVISMLV  178



>ref|XP_004436462.1| PREDICTED: proteasome subunit alpha type-6 isoform 1 [Ceratotherium 
simum simum]
Length=246

 Score =   204 bits (520),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 92/142 (65%), Positives = 118/142 (83%), Gaps = 0/142 (0%)
 Frame = +1

Query  85   MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL  264
            MSRGS  G+DRHITIFSPEGRL+QVEYAFKA+   G+TS+ VRGKD   +VTQKKVPDKL
Sbjct  1    MSRGSSAGFDRHITIFSPEGRLYQVEYAFKAINQGGLTSVAVRGKDCAVIVTQKKVPDKL  60

Query  265  LDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYEMPVDVLARWIAD  444
            LD ++VTHLF VT+ +G + TG+TAD+R+ VQ+AR EAA ++++YGYE+PVD+L + IAD
Sbjct  61   LDSSTVTHLFKVTENIGCVMTGMTADSRSQVQRARYEAANWKYKYGYEIPVDMLCKRIAD  120

Query  445  KSQVYTQHAYMRPLGVVAMILG  510
             SQVYTQ+A MRPLG   +++G
Sbjct  121  ISQVYTQNAEMRPLGCCMILIG  142



>ref|XP_009209663.1| PREDICTED: proteasome subunit alpha type-6 isoform X1 [Papio 
anubis]
 gb|EFB18466.1| hypothetical protein PANDA_011892 [Ailuropoda melanoleuca]
Length=228

 Score =   204 bits (518),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 91/142 (64%), Positives = 118/142 (83%), Gaps = 0/142 (0%)
 Frame = +1

Query  85   MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL  264
            MSRGS  G+DRHITIFSPEGRL+QVEYAFKA+   G+TS+ VRGKD   +VTQKKVPDKL
Sbjct  1    MSRGSSAGFDRHITIFSPEGRLYQVEYAFKAINQGGLTSVAVRGKDCAVIVTQKKVPDKL  60

Query  265  LDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYEMPVDVLARWIAD  444
            LD ++VTHLF +T+ +G + TG+TAD+R+ VQ+AR EAA ++++YGYE+PVD+L + IAD
Sbjct  61   LDSSTVTHLFKITENIGCVMTGMTADSRSQVQRARYEAANWKYKYGYEIPVDMLCKRIAD  120

Query  445  KSQVYTQHAYMRPLGVVAMILG  510
             SQVYTQ+A MRPLG   +++G
Sbjct  121  ISQVYTQNAEMRPLGCCMILIG  142



>ref|XP_005865030.1| PREDICTED: proteasome subunit alpha type-6 [Myotis brandtii]
 gb|EPQ06979.1| Proteasome subunit alpha type-6 [Myotis brandtii]
Length=246

 Score =   204 bits (520),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 91/142 (64%), Positives = 118/142 (83%), Gaps = 0/142 (0%)
 Frame = +1

Query  85   MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL  264
            MSRGS  G+DRHITIFSPEGRL+QVEYAFKA+   G+TS+ VRGKD   +VTQKKVPDKL
Sbjct  1    MSRGSSAGFDRHITIFSPEGRLYQVEYAFKAINQGGLTSVAVRGKDCAVIVTQKKVPDKL  60

Query  265  LDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYEMPVDVLARWIAD  444
            LD ++VTHLF +T+ +G + TG+TAD+R+ VQ+AR EAA ++++YGYE+PVD+L + IAD
Sbjct  61   LDSSTVTHLFKITENIGCVMTGMTADSRSQVQRARYEAANWKYKYGYEIPVDMLCKRIAD  120

Query  445  KSQVYTQHAYMRPLGVVAMILG  510
             SQVYTQ+A MRPLG   +++G
Sbjct  121  ISQVYTQNAEMRPLGCCMILIG  142



>ref|XP_005656349.1| PREDICTED: proteasome subunit alpha type-6 isoform X1 [Sus scrofa]
Length=230

 Score =   204 bits (518),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 91/142 (64%), Positives = 118/142 (83%), Gaps = 0/142 (0%)
 Frame = +1

Query  85   MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL  264
            MSRGS  G+DRHITIFSPEGRL+QVEYAFKA+   G+TS+ VRGKD   +VTQKKVPDKL
Sbjct  1    MSRGSSAGFDRHITIFSPEGRLYQVEYAFKAINQGGLTSVAVRGKDCAVIVTQKKVPDKL  60

Query  265  LDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYEMPVDVLARWIAD  444
            LD ++VTHLF +T+ +G + TG+TAD+R+ VQ+AR EAA ++++YGYE+PVD+L + IAD
Sbjct  61   LDSSTVTHLFKITENIGCVMTGMTADSRSQVQRARYEAANWKYKYGYEIPVDMLCKRIAD  120

Query  445  KSQVYTQHAYMRPLGVVAMILG  510
             SQVYTQ+A MRPLG   +++G
Sbjct  121  ISQVYTQNAEMRPLGCCMILIG  142



>gb|ABM86477.1| proteasome (prosome, macropain) subunit, alpha type, 6 [synthetic 
construct]
Length=246

 Score =   204 bits (519),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 91/142 (64%), Positives = 118/142 (83%), Gaps = 0/142 (0%)
 Frame = +1

Query  85   MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL  264
            MSRGS  G+DRHITIFSPEGRL+QVEYAFKA+   G+TS+ VRGKD   +VTQKKVPDKL
Sbjct  1    MSRGSSAGFDRHITIFSPEGRLYQVEYAFKAINQGGLTSVAVRGKDCAVIVTQKKVPDKL  60

Query  265  LDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYEMPVDVLARWIAD  444
            LD ++VTHLF +T+ +G + TG+TAD+R+ VQ+AR EAA ++++YGYE+PVD+L + IAD
Sbjct  61   LDSSTVTHLFKITENIGCVMTGMTADSRSQVQRARYEAANWKYKYGYEIPVDMLCKRIAD  120

Query  445  KSQVYTQHAYMRPLGVVAMILG  510
             SQVYTQ+A MRPLG   +++G
Sbjct  121  ISQVYTQNAEMRPLGCCMILIG  142



>ref|XP_004698589.1| PREDICTED: proteasome subunit alpha type-6 [Echinops telfairi]
 ref|XP_006085896.1| PREDICTED: proteasome subunit alpha type-6 [Myotis lucifugus]
 ref|XP_006759764.1| PREDICTED: proteasome subunit alpha type-6 [Myotis davidii]
 ref|XP_008157203.1| PREDICTED: proteasome subunit alpha type-6 isoform X1 [Eptesicus 
fuscus]
 gb|ELK33263.1| Proteasome subunit alpha type-6 [Myotis davidii]
Length=246

 Score =   204 bits (519),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 91/142 (64%), Positives = 118/142 (83%), Gaps = 0/142 (0%)
 Frame = +1

Query  85   MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL  264
            MSRGS  G+DRHITIFSPEGRL+QVEYAFKA+   G+TS+ VRGKD   +VTQKKVPDKL
Sbjct  1    MSRGSSAGFDRHITIFSPEGRLYQVEYAFKAINQGGLTSVAVRGKDCAVIVTQKKVPDKL  60

Query  265  LDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYEMPVDVLARWIAD  444
            LD ++VTHLF +T+ +G + TG+TAD+R+ VQ+AR EAA ++++YGYE+PVD+L + IAD
Sbjct  61   LDSSTVTHLFKITENIGCVMTGMTADSRSQVQRARYEAANWKYKYGYEIPVDMLCKRIAD  120

Query  445  KSQVYTQHAYMRPLGVVAMILG  510
             SQVYTQ+A MRPLG   +++G
Sbjct  121  ISQVYTQNAEMRPLGCCMILIG  142



>ref|NP_058979.1| proteasome subunit alpha type-6 [Rattus norvegicus]
 ref|NP_002782.1| proteasome subunit alpha type-6 isoform a [Homo sapiens]
 ref|NP_001039427.1| proteasome subunit alpha type-6 [Bos taurus]
 ref|NP_001180482.1| proteasome subunit alpha type-6 [Macaca mulatta]
 ref|NP_001233586.1| proteasome subunit alpha type-6 [Pan troglodytes]
 ref|NP_001271993.1| uncharacterized protein LOC101866963 [Macaca fascicularis]
 ref|NP_001272627.1| proteasome (prosome, macropain) subunit, alpha type, 6 [Capra 
hircus]
 ref|XP_001491320.1| PREDICTED: proteasome subunit alpha type-6 isoform 1 [Equus caballus]
 ref|XP_002718187.1| PREDICTED: proteasome subunit alpha type-6 isoform X2 [Oryctolagus 
cuniculus]
 ref|XP_003408905.1| PREDICTED: proteasome subunit alpha type-6 [Loxodonta africana]
 ref|XP_003792017.1| PREDICTED: proteasome subunit alpha type-6 [Otolemur garnettii]
 ref|XP_003821244.1| PREDICTED: proteasome subunit alpha type-6 [Pan paniscus]
 ref|XP_003987590.1| PREDICTED: proteasome subunit alpha type-6 isoform X1 [Felis 
catus]
 ref|XP_004270016.1| PREDICTED: proteasome subunit alpha type-6 isoform 1 [Orcinus 
orca]
 ref|XP_004319607.1| PREDICTED: proteasome subunit alpha type-6 isoform 1 [Tursiops 
truncatus]
 ref|XP_004376568.1| PREDICTED: proteasome subunit alpha type-6 [Trichechus manatus 
latirostris]
 ref|XP_004681993.1| PREDICTED: proteasome subunit alpha type-6 isoform X1 [Condylura 
cristata]
 ref|XP_004884716.1| PREDICTED: proteasome subunit alpha type-6 [Heterocephalus glaber]
 ref|XP_004867614.1| PREDICTED: proteasome subunit alpha type-6 [Heterocephalus glaber]
 ref|XP_005376980.1| PREDICTED: proteasome subunit alpha type-6 isoform X1 [Chinchilla 
lanigera]
 ref|XP_005891864.1| PREDICTED: proteasome subunit alpha type-6 isoform X1 [Bos mutus]
 ref|XP_006186437.1| PREDICTED: proteasome subunit alpha type-6 isoform X1 [Camelus 
ferus]
 ref|XP_006212818.1| PREDICTED: proteasome subunit alpha type-6 isoform X1 [Vicugna 
pacos]
 ref|XP_006913536.1| PREDICTED: proteasome subunit alpha type-6 [Pteropus alecto]
 ref|XP_007073792.1| PREDICTED: proteasome subunit alpha type-6 [Panthera tigris altaica]
 ref|XP_007119012.1| PREDICTED: proteasome subunit alpha type-6 isoform X1 [Physeter 
catodon]
 ref|XP_006043909.1| PREDICTED: proteasome subunit alpha type-6 [Bubalus bubalis]
 ref|XP_007464884.1| PREDICTED: proteasome subunit alpha type-6 isoform X1 [Lipotes 
vexillifer]
 ref|XP_007936738.1| PREDICTED: proteasome subunit alpha type-6 isoform X1 [Orycteropus 
afer afer]
 ref|XP_007984674.1| PREDICTED: proteasome subunit alpha type-6 [Chlorocebus sabaeus]
 ref|XP_008069643.1| PREDICTED: proteasome subunit alpha type-6 [Tarsius syrichta]
 ref|XP_008511175.1| PREDICTED: proteasome subunit alpha type-6 [Equus przewalskii]
 ref|XP_008572098.1| PREDICTED: proteasome subunit alpha type-6 [Galeopterus variegatus]
 ref|XP_008831132.1| PREDICTED: proteasome subunit alpha type-6 [Nannospalax galili]
 ref|XP_010631915.1| PREDICTED: proteasome subunit alpha type-6 isoform X1 [Fukomys 
damarensis]
 ref|XP_010833601.1| PREDICTED: proteasome subunit alpha type-6 [Bison bison bison]
 ref|XP_010966161.1| PREDICTED: proteasome subunit alpha type-6 [Camelus bactrianus]
 ref|XP_010984427.1| PREDICTED: proteasome subunit alpha type-6 [Camelus dromedarius]
 ref|XP_011374978.1| PREDICTED: proteasome subunit alpha type-6 [Pteropus vampyrus]
 sp|P60901.1|PSA6_RAT RecName: Full=Proteasome subunit alpha type-6; AltName: Full=Macropain 
iota chain; AltName: Full=Multicatalytic endopeptidase 
complex iota chain; AltName: Full=Proteasome iota chain 
[Rattus norvegicus]
 sp|P60900.1|PSA6_HUMAN RecName: Full=Proteasome subunit alpha type-6; AltName: Full=27 
kDa prosomal protein; Short=PROS-27; Short=p27K; AltName: 
Full=Macropain iota chain; AltName: Full=Multicatalytic endopeptidase 
complex iota chain; AltName: Full=Proteasome iota 
chain [Homo sapiens]
 sp|Q2YDE4.1|PSA6_BOVIN RecName: Full=Proteasome subunit alpha type-6 [Bos taurus]
 pdb|1IRU|A Chain A, Crystal Structure Of The Mammalian 20s Proteasome At 
2.75 A Resolution
 pdb|1IRU|O Chain O, Crystal Structure Of The Mammalian 20s Proteasome At 
2.75 A Resolution
 emb|CAA42052.1| prosomal P27K protein [Homo sapiens]
 dbj|BAA01587.1| proteasome subunit R-IOTA [Rattus sp.]
 gb|AAH02979.1| Proteasome (prosome, macropain) subunit, alpha type, 6 [Homo 
sapiens]
 gb|AAH17882.1| Proteasome (prosome, macropain) subunit, alpha type, 6 [Homo 
sapiens]
 gb|AAH22354.1| Proteasome (prosome, macropain) subunit, alpha type, 6 [Homo 
sapiens]
 gb|AAH23659.1| Proteasome (prosome, macropain) subunit, alpha type, 6 [Homo 
sapiens]
 gb|AAH62232.1| Proteasome (prosome, macropain) subunit, alpha type 6 [Rattus 
norvegicus]
 gb|AAH70137.1| Proteasome (prosome, macropain) subunit, alpha type, 6 [Homo 
sapiens]
 emb|CAG33225.1| PSMA6 [Homo sapiens]
 dbj|BAE01337.1| unnamed protein product [Macaca fascicularis]
 gb|AAI10261.1| Proteasome (prosome, macropain) subunit, alpha type, 6 [Bos taurus]
 gb|EAW65877.1| proteasome (prosome, macropain) subunit, alpha type, 6, isoform 
CRA_b [Homo sapiens]
 gb|ABM83272.1| proteasome (prosome, macropain) subunit, alpha type, 6 [synthetic 
construct]
 gb|EDM03426.1| proteasome (prosome, macropain) subunit, alpha type 6 [Rattus 
norvegicus]
 dbj|BAG35846.1| unnamed protein product [Homo sapiens]
 gb|ACM47241.1| proteasome subunit alpha type 6 [Capra hircus]
 dbj|BAI46667.1| proteasome (prosome, macropain) subunit, alpha type, 6 [synthetic 
construct]
 tpg|DAA17455.1| TPA: proteasome subunit alpha type-6 [Bos taurus]
 dbj|BAK63685.1| proteasome subunit alpha type 6 [Pan troglodytes]
 gb|EHB02978.1| Proteasome subunit alpha type-6 [Heterocephalus glaber]
 gb|EHH27823.1| hypothetical protein EGK_18113 [Macaca mulatta]
 gb|EHH63557.1| hypothetical protein EGM_16549 [Macaca fascicularis]
 gb|ELK11320.1| Proteasome subunit alpha type-6 [Pteropus alecto]
 gb|ELR59203.1| Proteasome subunit alpha type-6 [Bos mutus]
 gb|AIC63124.1| PSMA6, partial [synthetic construct]
 gb|KFO29294.1| Proteasome subunit alpha type-6 [Fukomys damarensis]
 prf||1912298A prosomal RNA-binding protein p27K
Length=246

 Score =   204 bits (519),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 91/142 (64%), Positives = 118/142 (83%), Gaps = 0/142 (0%)
 Frame = +1

Query  85   MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL  264
            MSRGS  G+DRHITIFSPEGRL+QVEYAFKA+   G+TS+ VRGKD   +VTQKKVPDKL
Sbjct  1    MSRGSSAGFDRHITIFSPEGRLYQVEYAFKAINQGGLTSVAVRGKDCAVIVTQKKVPDKL  60

Query  265  LDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYEMPVDVLARWIAD  444
            LD ++VTHLF +T+ +G + TG+TAD+R+ VQ+AR EAA ++++YGYE+PVD+L + IAD
Sbjct  61   LDSSTVTHLFKITENIGCVMTGMTADSRSQVQRARYEAANWKYKYGYEIPVDMLCKRIAD  120

Query  445  KSQVYTQHAYMRPLGVVAMILG  510
             SQVYTQ+A MRPLG   +++G
Sbjct  121  ISQVYTQNAEMRPLGCCMILIG  142



>gb|EDL36728.1| proteasome (prosome, macropain) subunit, alpha type 6, isoform 
CRA_b [Mus musculus]
Length=251

 Score =   204 bits (519),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 91/142 (64%), Positives = 118/142 (83%), Gaps = 0/142 (0%)
 Frame = +1

Query  85   MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL  264
            MSRGS  G+DRHITIFSPEGRL+QVEYAFKA+   G+TS+ VRGKD   +VTQKKVPDKL
Sbjct  6    MSRGSSAGFDRHITIFSPEGRLYQVEYAFKAINQGGLTSVAVRGKDCAVIVTQKKVPDKL  65

Query  265  LDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYEMPVDVLARWIAD  444
            LD ++VTHLF +T+ +G + TG+TAD+R+ VQ+AR EAA ++++YGYE+PVD+L + IAD
Sbjct  66   LDSSTVTHLFKITESIGCVMTGMTADSRSQVQRARYEAANWKYKYGYEIPVDMLCKRIAD  125

Query  445  KSQVYTQHAYMRPLGVVAMILG  510
             SQVYTQ+A MRPLG   +++G
Sbjct  126  ISQVYTQNAEMRPLGCCMILIG  147



>ref|XP_537412.2| PREDICTED: proteasome subunit alpha type-6 isoformX2 [Canis lupus 
familiaris]
 ref|XP_002922862.1| PREDICTED: proteasome subunit alpha type-6 isoform X1 [Ailuropoda 
melanoleuca]
 ref|XP_004399857.1| PREDICTED: proteasome subunit alpha type-6 [Odobenus rosmarus 
divergens]
 ref|XP_004773396.1| PREDICTED: proteasome subunit alpha type-6 isoform X1 [Mustela 
putorius furo]
 ref|XP_004820513.1| PREDICTED: proteasome subunit alpha type-6 isoform X1 [Mustela 
putorius furo]
 ref|XP_005080563.1| PREDICTED: proteasome subunit alpha type-6 [Mesocricetus auratus]
 ref|XP_005343781.1| PREDICTED: proteasome subunit alpha type-6 [Microtus ochrogaster]
 ref|XP_006732281.1| PREDICTED: proteasome subunit alpha type-6 isoform X1 [Leptonychotes 
weddellii]
 ref|XP_006891612.1| PREDICTED: proteasome subunit alpha type-6 isoform X1 [Elephantulus 
edwardii]
 ref|XP_003509963.2| PREDICTED: proteasome subunit alpha type-6 isoform X1 [Cricetulus 
griseus]
 ref|XP_007632099.1| PREDICTED: proteasome subunit alpha type-6 isoform X2 [Cricetulus 
griseus]
 ref|XP_008692325.1| PREDICTED: proteasome subunit alpha type-6 isoform X1 [Ursus 
maritimus]
 gb|ERE72544.1| proteasome subunit alpha type-6-like protein [Cricetulus griseus]
Length=246

 Score =   204 bits (519),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 91/142 (64%), Positives = 118/142 (83%), Gaps = 0/142 (0%)
 Frame = +1

Query  85   MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL  264
            MSRGS  G+DRHITIFSPEGRL+QVEYAFKA+   G+TS+ VRGKD   +VTQKKVPDKL
Sbjct  1    MSRGSSAGFDRHITIFSPEGRLYQVEYAFKAINQGGLTSVAVRGKDCAVIVTQKKVPDKL  60

Query  265  LDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYEMPVDVLARWIAD  444
            LD ++VTHLF +T+ +G + TG+TAD+R+ VQ+AR EAA ++++YGYE+PVD+L + IAD
Sbjct  61   LDSSTVTHLFKITENIGCVMTGMTADSRSQVQRARYEAANWKYKYGYEIPVDMLCKRIAD  120

Query  445  KSQVYTQHAYMRPLGVVAMILG  510
             SQVYTQ+A MRPLG   +++G
Sbjct  121  ISQVYTQNAEMRPLGCCMILIG  142



>ref|XP_004649175.1| PREDICTED: proteasome subunit alpha type-6 [Jaculus jaculus]
Length=246

 Score =   204 bits (519),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 91/142 (64%), Positives = 118/142 (83%), Gaps = 0/142 (0%)
 Frame = +1

Query  85   MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL  264
            MSRGS  G+DRHITIFSPEGRL+QVEYAFKA+   G+TS+ VRGKD   +VTQKKVPDKL
Sbjct  1    MSRGSSAGFDRHITIFSPEGRLYQVEYAFKAINQGGLTSVAVRGKDCAVIVTQKKVPDKL  60

Query  265  LDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYEMPVDVLARWIAD  444
            LD ++VTHLF +T+ +G + TG+TAD+R+ VQ+AR EAA ++++YGYE+PVD+L + IAD
Sbjct  61   LDSSTVTHLFKITENIGCVMTGMTADSRSQVQRARYEAANWKYKYGYEIPVDMLCKRIAD  120

Query  445  KSQVYTQHAYMRPLGVVAMILG  510
             SQVYTQ+A MRPLG   +++G
Sbjct  121  ISQVYTQNAEMRPLGCCMILIG  142



>ref|XP_007436765.1| PREDICTED: proteasome subunit alpha type-6 [Python bivittatus]
Length=246

 Score =   204 bits (519),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 92/142 (65%), Positives = 118/142 (83%), Gaps = 0/142 (0%)
 Frame = +1

Query  85   MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL  264
            MSRGS  G+DRHITIFSPEGRL+QVEYAFKA+   G+TS+ VRGKD   VVTQKKVPDKL
Sbjct  1    MSRGSSAGFDRHITIFSPEGRLYQVEYAFKAINQGGLTSVAVRGKDCAVVVTQKKVPDKL  60

Query  265  LDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYEMPVDVLARWIAD  444
            LD ++VTHLF +T+ +G + TG+TAD+R+ VQ+AR EAA ++++YGYE+PVD+L + IAD
Sbjct  61   LDSSTVTHLFRITENIGCVMTGMTADSRSQVQRARYEAANWKYKYGYEIPVDMLCKRIAD  120

Query  445  KSQVYTQHAYMRPLGVVAMILG  510
             SQVYTQ+A MRPLG   +++G
Sbjct  121  ISQVYTQNAEMRPLGCCMIMIG  142



>ref|XP_006172412.1| PREDICTED: LOW QUALITY PROTEIN: proteasome (prosome, macropain) 
subunit, alpha type, 6 [Tupaia chinensis]
Length=246

 Score =   204 bits (519),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 91/142 (64%), Positives = 118/142 (83%), Gaps = 0/142 (0%)
 Frame = +1

Query  85   MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL  264
            MSRGS  G+DRHITIFSPEGRL+QVEYAFKA+   G+TS+ VRGKD   +VTQKKVPDKL
Sbjct  1    MSRGSSAGFDRHITIFSPEGRLYQVEYAFKAINQGGLTSVAVRGKDCAVIVTQKKVPDKL  60

Query  265  LDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYEMPVDVLARWIAD  444
            LD ++VTHLF +T+ +G + TG+TAD+R+ VQ+AR EAA ++++YGYE+PVD+L + IAD
Sbjct  61   LDSSTVTHLFKITENIGCVMTGMTADSRSQVQRARYEAANWKYKYGYEIPVDMLCKRIAD  120

Query  445  KSQVYTQHAYMRPLGVVAMILG  510
             SQVYTQ+A MRPLG   +++G
Sbjct  121  ISQVYTQNAEMRPLGCCMILIG  142



>emb|CDS07623.1| Putative Proteasome subunit alpha type [Absidia idahoensis var. 
thermophila]
Length=246

 Score =   204 bits (519),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 92/142 (65%), Positives = 118/142 (83%), Gaps = 0/142 (0%)
 Frame = +1

Query  85   MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL  264
            MSRGS  GYDRHITIFSPEGRL+QVEYAFKA+  +GITS+GVRGKD   +VTQKKVPDKL
Sbjct  1    MSRGSSAGYDRHITIFSPEGRLYQVEYAFKAISNSGITSVGVRGKDGCVIVTQKKVPDKL  60

Query  265  LDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYEMPVDVLARWIAD  444
            LD +++TH+F +T  +G + TG+ ADAR+ V +AR EAAEFR++YGYE+P D+LA+ +A+
Sbjct  61   LDPSTITHVFKLTPKIGCVMTGMIADARSQVTRARQEAAEFRYKYGYEIPADMLAKRVAN  120

Query  445  KSQVYTQHAYMRPLGVVAMILG  510
             +QVYTQ A MRPLGV  +++G
Sbjct  121  INQVYTQQAAMRPLGVSMILIG  142



>ref|NP_036098.1| proteasome subunit alpha type-6 [Mus musculus]
 ref|XP_010383847.1| PREDICTED: proteasome subunit alpha type-6 [Rhinopithecus roxellana]
 sp|Q9QUM9.1|PSA6_MOUSE RecName: Full=Proteasome subunit alpha type-6; AltName: Full=Macropain 
iota chain; AltName: Full=Multicatalytic endopeptidase 
complex iota chain; AltName: Full=Proteasome iota chain 
[Mus musculus]
 pdb|3UNB|G Chain G, Mouse Constitutive 20s Proteasome In Complex With Pr-957
 pdb|3UNB|U Chain U, Mouse Constitutive 20s Proteasome In Complex With Pr-957
 pdb|3UNB|II Chain i, Mouse Constitutive 20s Proteasome In Complex With Pr-957
 pdb|3UNB|WW Chain w, Mouse Constitutive 20s Proteasome In Complex With Pr-957
 pdb|3UNE|G Chain G, Mouse Constitutive 20s Proteasome
 pdb|3UNE|U Chain U, Mouse Constitutive 20s Proteasome
 pdb|3UNE|II Chain i, Mouse Constitutive 20s Proteasome
 pdb|3UNE|WW Chain w, Mouse Constitutive 20s Proteasome
 pdb|3UNF|G Chain G, Mouse 20s Immunoproteasome In Complex With Pr-957
 pdb|3UNF|U Chain U, Mouse 20s Immunoproteasome In Complex With Pr-957
 pdb|3UNH|G Chain G, Mouse 20s Immunoproteasome
 pdb|3UNH|U Chain U, Mouse 20s Immunoproteasome
 gb|AAD50532.1|AF060087_1 proteasome subunit iota [Mus musculus]
 gb|AAF21459.1|U60288_1 proteasome subunit iota [Mus musculus]
 dbj|BAC40169.1| unnamed protein product [Mus musculus]
 dbj|BAE31592.1| unnamed protein product [Mus musculus]
 gb|AAH86685.1| Proteasome (prosome, macropain) subunit, alpha type 6 [Mus musculus]
Length=246

 Score =   204 bits (519),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 91/142 (64%), Positives = 118/142 (83%), Gaps = 0/142 (0%)
 Frame = +1

Query  85   MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL  264
            MSRGS  G+DRHITIFSPEGRL+QVEYAFKA+   G+TS+ VRGKD   +VTQKKVPDKL
Sbjct  1    MSRGSSAGFDRHITIFSPEGRLYQVEYAFKAINQGGLTSVAVRGKDCAVIVTQKKVPDKL  60

Query  265  LDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYEMPVDVLARWIAD  444
            LD ++VTHLF +T+ +G + TG+TAD+R+ VQ+AR EAA ++++YGYE+PVD+L + IAD
Sbjct  61   LDSSTVTHLFKITESIGCVMTGMTADSRSQVQRARYEAANWKYKYGYEIPVDMLCKRIAD  120

Query  445  KSQVYTQHAYMRPLGVVAMILG  510
             SQVYTQ+A MRPLG   +++G
Sbjct  121  ISQVYTQNAEMRPLGCCMILIG  142



>ref|XP_006835407.1| PREDICTED: proteasome subunit alpha type-6 isoform X1 [Chrysochloris 
asiatica]
Length=246

 Score =   204 bits (519),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 91/142 (64%), Positives = 118/142 (83%), Gaps = 0/142 (0%)
 Frame = +1

Query  85   MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL  264
            MSRGS  G+DRHITIFSPEGRL+QVEYAFKA+   G+TS+ VRGKD   +VTQKKVPDKL
Sbjct  1    MSRGSSAGFDRHITIFSPEGRLYQVEYAFKAINQGGLTSVAVRGKDCAVIVTQKKVPDKL  60

Query  265  LDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYEMPVDVLARWIAD  444
            LD ++VTHLF +T+ +G + TG+TAD+R+ VQ+AR EAA ++++YGYE+PVD+L + IAD
Sbjct  61   LDSSTVTHLFKITENIGCVMTGMTADSRSQVQRARYEAANWKYKYGYEIPVDMLCKRIAD  120

Query  445  KSQVYTQHAYMRPLGVVAMILG  510
             SQVYTQ+A MRPLG   +++G
Sbjct  121  ISQVYTQNAEMRPLGCCMILIG  142



>ref|XP_003471921.1| PREDICTED: proteasome subunit alpha type-6 [Cavia porcellus]
Length=246

 Score =   204 bits (519),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 91/142 (64%), Positives = 118/142 (83%), Gaps = 0/142 (0%)
 Frame = +1

Query  85   MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL  264
            MSRGS  G+DRHITIFSPEGRL+QVEYAFKA+   G+TS+ VRGKD   +VTQKKVPDKL
Sbjct  1    MSRGSSAGFDRHITIFSPEGRLYQVEYAFKAINQGGLTSVAVRGKDCAVIVTQKKVPDKL  60

Query  265  LDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYEMPVDVLARWIAD  444
            LD ++VTHLF +T+ +G + TG+TAD+R+ VQ+AR EAA ++++YGYE+PVD+L + IAD
Sbjct  61   LDSSTVTHLFKITENIGCVMTGMTADSRSQVQRARYEAANWKYKYGYEIPVDMLCKRIAD  120

Query  445  KSQVYTQHAYMRPLGVVAMILG  510
             SQVYTQ+A MRPLG   +++G
Sbjct  121  ISQVYTQNAEMRPLGCCMILIG  142



>ref|XP_006793167.1| PREDICTED: proteasome subunit alpha type-6-like [Neolamprologus 
brichardi]
Length=234

 Score =   204 bits (518),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 92/143 (64%), Positives = 118/143 (83%), Gaps = 0/143 (0%)
 Frame = +1

Query  82   KMSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDK  261
            KMSRGS  G+DRHITIFSPEGRL+QVEYAFKA+   G+TS+ VRGKD   VVTQKKVPDK
Sbjct  36   KMSRGSSAGFDRHITIFSPEGRLYQVEYAFKAINQGGLTSVAVRGKDCAVVVTQKKVPDK  95

Query  262  LLDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYEMPVDVLARWIA  441
            LLD ++VTHLF +T  +G + +G+TAD+R+ VQ+AR EAA ++++YGYE+PVD+L + IA
Sbjct  96   LLDASTVTHLFRITDNIGCVMSGMTADSRSQVQRARYEAANWQYKYGYEIPVDMLCKRIA  155

Query  442  DKSQVYTQHAYMRPLGVVAMILG  510
            D SQVYTQ+A MRPLG   +++G
Sbjct  156  DISQVYTQNAEMRPLGCCMIVIG  178



>ref|XP_004470220.1| PREDICTED: proteasome subunit alpha type-6 [Dasypus novemcinctus]
Length=246

 Score =   204 bits (519),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 91/142 (64%), Positives = 118/142 (83%), Gaps = 0/142 (0%)
 Frame = +1

Query  85   MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL  264
            MSRGS  G+DRHITIFSPEGRL+QVEYAFKA+   G+TS+ VRGKD   +VTQKKVPDKL
Sbjct  1    MSRGSSAGFDRHITIFSPEGRLYQVEYAFKAINQGGLTSVAVRGKDCAVIVTQKKVPDKL  60

Query  265  LDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYEMPVDVLARWIAD  444
            LD ++VTHLF +T+ +G + TG+TAD+R+ VQ+AR EAA ++++YGYE+PVD+L + IAD
Sbjct  61   LDSSTVTHLFKITENIGCVMTGMTADSRSQVQRARYEAANWKYKYGYEIPVDMLCKRIAD  120

Query  445  KSQVYTQHAYMRPLGVVAMILG  510
             SQVYTQ+A MRPLG   +++G
Sbjct  121  ISQVYTQNAEMRPLGCCMILIG  142



>ref|XP_007180773.1| PREDICTED: proteasome subunit alpha type-6 [Balaenoptera acutorostrata 
scammoni]
Length=246

 Score =   204 bits (519),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 91/142 (64%), Positives = 118/142 (83%), Gaps = 0/142 (0%)
 Frame = +1

Query  85   MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL  264
            MSRGS  G+DRHITIFSPEGRL+QVEYAFKA+   G+TS+ VRGKD   +VTQKKVPDKL
Sbjct  1    MSRGSSAGFDRHITIFSPEGRLYQVEYAFKAINQGGLTSVAVRGKDCAVIVTQKKVPDKL  60

Query  265  LDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYEMPVDVLARWIAD  444
            LD ++VTHLF +T+ +G + TG+TAD+R+ VQ+AR EAA ++++YGYE+PVD+L + IAD
Sbjct  61   LDSSTVTHLFKITENIGCVMTGMTADSRSQVQRARYEAANWKYKYGYEIPVDMLCKRIAD  120

Query  445  KSQVYTQHAYMRPLGVVAMILG  510
             SQVYTQ+A MRPLG   +++G
Sbjct  121  ISQVYTQNAEMRPLGCCMILIG  142



>gb|ERE72543.1| proteasome subunit alpha type-6-like protein [Cricetulus griseus]
Length=250

 Score =   204 bits (519),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 91/142 (64%), Positives = 118/142 (83%), Gaps = 0/142 (0%)
 Frame = +1

Query  85   MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL  264
            MSRGS  G+DRHITIFSPEGRL+QVEYAFKA+   G+TS+ VRGKD   +VTQKKVPDKL
Sbjct  1    MSRGSSAGFDRHITIFSPEGRLYQVEYAFKAINQGGLTSVAVRGKDCAVIVTQKKVPDKL  60

Query  265  LDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYEMPVDVLARWIAD  444
            LD ++VTHLF +T+ +G + TG+TAD+R+ VQ+AR EAA ++++YGYE+PVD+L + IAD
Sbjct  61   LDSSTVTHLFKITENIGCVMTGMTADSRSQVQRARYEAANWKYKYGYEIPVDMLCKRIAD  120

Query  445  KSQVYTQHAYMRPLGVVAMILG  510
             SQVYTQ+A MRPLG   +++G
Sbjct  121  ISQVYTQNAEMRPLGCCMILIG  142



>ref|XP_006985315.1| PREDICTED: proteasome subunit alpha type-6 [Peromyscus maniculatus 
bairdii]
Length=246

 Score =   204 bits (518),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 91/142 (64%), Positives = 118/142 (83%), Gaps = 0/142 (0%)
 Frame = +1

Query  85   MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL  264
            MSRGS  G+DRHITIFSPEGRL+QVEYAFKA+   G+TS+ VRGKD   +VTQKKVPDKL
Sbjct  1    MSRGSSAGFDRHITIFSPEGRLYQVEYAFKAINQGGLTSVAVRGKDCAVIVTQKKVPDKL  60

Query  265  LDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYEMPVDVLARWIAD  444
            LD ++VTHLF +T+ +G + TG+TAD+R+ VQ+AR EAA ++++YGYE+PVD+L + IAD
Sbjct  61   LDSSTVTHLFKITENIGCVMTGMTADSRSQVQRARYEAANWKYKYGYEIPVDMLCKRIAD  120

Query  445  KSQVYTQHAYMRPLGVVAMILG  510
             SQVYTQ+A MRPLG   +++G
Sbjct  121  ISQVYTQNAEMRPLGCCMILIG  142



>ref|NP_001264372.1| proteasome subunit alpha type-6 [Gallus gallus]
 ref|XP_003206625.1| PREDICTED: proteasome subunit alpha type-6 [Meleagris gallopavo]
Length=246

 Score =   204 bits (518),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 91/142 (64%), Positives = 118/142 (83%), Gaps = 0/142 (0%)
 Frame = +1

Query  85   MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL  264
            MSRGS  G+DRHITIFSPEGRL+QVEYAFKA+   G+TS+ VRGKDS  +VTQKKVPDKL
Sbjct  1    MSRGSSAGFDRHITIFSPEGRLYQVEYAFKAINQGGLTSVAVRGKDSAVIVTQKKVPDKL  60

Query  265  LDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYEMPVDVLARWIAD  444
            LD  +VTHLF +T+ +G + TG+TAD+R+ VQ+AR EAA ++++YGY++PVD+L + IAD
Sbjct  61   LDSNTVTHLFSITENIGCVMTGMTADSRSQVQRARYEAANWKYKYGYDIPVDMLCKRIAD  120

Query  445  KSQVYTQHAYMRPLGVVAMILG  510
             SQVYTQ+A MRPLG   +++G
Sbjct  121  ISQVYTQNAEMRPLGCCMILIG  142



>ref|XP_009901279.1| PREDICTED: proteasome subunit alpha type-6 isoform X1 [Picoides 
pubescens]
 gb|KFV69230.1| Proteasome subunit alpha type-6 [Picoides pubescens]
Length=246

 Score =   204 bits (518),  Expect = 4e-62, Method: Compositional matrix adjust.
 Identities = 92/142 (65%), Positives = 118/142 (83%), Gaps = 0/142 (0%)
 Frame = +1

Query  85   MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL  264
            MSRGS  G+DRHITIFSPEGRL+QVEYAFKA+   G+TS+ VRGKDS  VVTQKKVPDKL
Sbjct  1    MSRGSSAGFDRHITIFSPEGRLYQVEYAFKAINQGGLTSVAVRGKDSAVVVTQKKVPDKL  60

Query  265  LDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYEMPVDVLARWIAD  444
            LD  +VTHLF +T+ +G + TG+TAD+R+ VQ+AR EAA ++++YGY++PVD+L + IAD
Sbjct  61   LDSNTVTHLFRITENIGCVMTGMTADSRSQVQRARYEAANWKYKYGYDIPVDMLCKRIAD  120

Query  445  KSQVYTQHAYMRPLGVVAMILG  510
             SQVYTQ+A MRPLG   +++G
Sbjct  121  ISQVYTQNAEMRPLGCCMILIG  142



>ref|XP_001363110.1| PREDICTED: proteasome subunit alpha type-6 [Monodelphis domestica]
Length=246

 Score =   204 bits (518),  Expect = 4e-62, Method: Compositional matrix adjust.
 Identities = 91/142 (64%), Positives = 118/142 (83%), Gaps = 0/142 (0%)
 Frame = +1

Query  85   MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL  264
            MSRGS  G+DRHITIFSPEGRL+QVEYAFKA+   G+TS+ VRGKD   +VTQKKVPDKL
Sbjct  1    MSRGSSAGFDRHITIFSPEGRLYQVEYAFKAINQGGLTSVAVRGKDCAVIVTQKKVPDKL  60

Query  265  LDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYEMPVDVLARWIAD  444
            LD ++VTHLF +T+ +G + TG+TAD+R+ VQ+AR EAA ++++YGYE+PVD+L + IAD
Sbjct  61   LDSSTVTHLFRITENIGCVMTGMTADSRSQVQRARYEAANWKYKYGYEIPVDMLCKRIAD  120

Query  445  KSQVYTQHAYMRPLGVVAMILG  510
             SQVYTQ+A MRPLG   +++G
Sbjct  121  ISQVYTQNAEMRPLGCCMILIG  142



>ref|NP_001232198.1| putative proteasome subunit alpha type 6 [Taeniopygia guttata]
 ref|XP_005479894.1| PREDICTED: proteasome subunit alpha type-6 [Zonotrichia albicollis]
 ref|XP_005520349.1| PREDICTED: proteasome subunit alpha type-6 isoform X1 [Pseudopodoces 
humilis]
 gb|ACH43691.1| putative proteasome subunit alpha type 6 [Taeniopygia guttata]
Length=246

 Score =   204 bits (518),  Expect = 4e-62, Method: Compositional matrix adjust.
 Identities = 91/142 (64%), Positives = 118/142 (83%), Gaps = 0/142 (0%)
 Frame = +1

Query  85   MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL  264
            MSRGS  G+DRHITIFSPEGRL+QVEYAFKA+   G+TS+ VRGKDS  +VTQKKVPDKL
Sbjct  1    MSRGSSAGFDRHITIFSPEGRLYQVEYAFKAINQGGLTSVAVRGKDSAVIVTQKKVPDKL  60

Query  265  LDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYEMPVDVLARWIAD  444
            LD  +VTHLF +T+ +G + TG+TAD+R+ VQ+AR EAA ++++YGY++PVD+L + IAD
Sbjct  61   LDSNTVTHLFKITENIGCVMTGMTADSRSQVQRARYEAANWKYKYGYDIPVDMLCKRIAD  120

Query  445  KSQVYTQHAYMRPLGVVAMILG  510
             SQVYTQ+A MRPLG   +++G
Sbjct  121  ISQVYTQNAEMRPLGCCMILIG  142



>ref|XP_001095366.1| PREDICTED: proteasome subunit alpha type-6-like isoform 1 [Macaca 
mulatta]
 ref|XP_001095483.1| PREDICTED: proteasome subunit alpha type-6-like isoform 2 [Macaca 
mulatta]
Length=246

 Score =   204 bits (518),  Expect = 4e-62, Method: Compositional matrix adjust.
 Identities = 90/142 (63%), Positives = 118/142 (83%), Gaps = 0/142 (0%)
 Frame = +1

Query  85   MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL  264
            MSRGS  G+DRHITIFSPEGRL+Q+EYAFKA+   G+TS+ VRGKD   +VTQKKVPDKL
Sbjct  1    MSRGSSAGFDRHITIFSPEGRLYQIEYAFKAINQGGLTSVAVRGKDCAVIVTQKKVPDKL  60

Query  265  LDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYEMPVDVLARWIAD  444
            LD ++VTHLF +T+ +G + TG+TAD+R+ VQ+AR EAA ++++YGYE+PVD+L + IAD
Sbjct  61   LDSSTVTHLFKITENIGCVMTGMTADSRSQVQRARYEAANWKYKYGYEIPVDMLCKRIAD  120

Query  445  KSQVYTQHAYMRPLGVVAMILG  510
             SQVYTQ+A MRPLG   +++G
Sbjct  121  ISQVYTQNAEMRPLGCCMILIG  142



>ref|XP_006258805.1| PREDICTED: proteasome subunit alpha type-6 [Alligator mississippiensis]
Length=246

 Score =   203 bits (517),  Expect = 4e-62, Method: Compositional matrix adjust.
 Identities = 91/142 (64%), Positives = 119/142 (84%), Gaps = 0/142 (0%)
 Frame = +1

Query  85   MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL  264
            MSRGS  G+DRHITIFSPEGRL+QVEYAFKA+   G+TS+ VRGKDS  +VTQKKVPDKL
Sbjct  1    MSRGSSAGFDRHITIFSPEGRLYQVEYAFKAINQGGLTSVAVRGKDSAVIVTQKKVPDKL  60

Query  265  LDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYEMPVDVLARWIAD  444
            LD ++VTHLF +T+ +G + TG+TAD+R+ VQ+AR EAA ++++YGY++PVD+L + IAD
Sbjct  61   LDSSTVTHLFRITENIGCVMTGMTADSRSQVQRARYEAANWKYKYGYDIPVDMLCKRIAD  120

Query  445  KSQVYTQHAYMRPLGVVAMILG  510
             SQVYTQ+A MRPLG   +++G
Sbjct  121  ISQVYTQNAEMRPLGCCMILIG  142



>gb|KFW08632.1| Proteasome subunit alpha type-6, partial [Eurypyga helias]
Length=229

 Score =   203 bits (516),  Expect = 4e-62, Method: Compositional matrix adjust.
 Identities = 91/142 (64%), Positives = 118/142 (83%), Gaps = 0/142 (0%)
 Frame = +1

Query  85   MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL  264
            MSRGS  G+DRHITIFSPEGRL+QVEYAFKA+   G+TS+ VRGKDS  +VTQKKVPDKL
Sbjct  2    MSRGSSAGFDRHITIFSPEGRLYQVEYAFKAINQGGLTSVAVRGKDSAVIVTQKKVPDKL  61

Query  265  LDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYEMPVDVLARWIAD  444
            LD  +VTHLF +T+ +G + TG+TAD+R+ VQ+AR EAA ++++YGY++PVD+L + IAD
Sbjct  62   LDSNTVTHLFRITENIGCVMTGMTADSRSQVQRARYEAANWKYKYGYDIPVDMLCKRIAD  121

Query  445  KSQVYTQHAYMRPLGVVAMILG  510
             SQVYTQ+A MRPLG   +++G
Sbjct  122  ISQVYTQNAEMRPLGCCMILIG  143



>ref|XP_010153544.1| PREDICTED: proteasome subunit alpha type-6 isoform X2 [Eurypyga 
helias]
Length=230

 Score =   202 bits (515),  Expect = 5e-62, Method: Compositional matrix adjust.
 Identities = 91/142 (64%), Positives = 118/142 (83%), Gaps = 0/142 (0%)
 Frame = +1

Query  85   MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL  264
            MSRGS  G+DRHITIFSPEGRL+QVEYAFKA+   G+TS+ VRGKDS  +VTQKKVPDKL
Sbjct  1    MSRGSSAGFDRHITIFSPEGRLYQVEYAFKAINQGGLTSVAVRGKDSAVIVTQKKVPDKL  60

Query  265  LDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYEMPVDVLARWIAD  444
            LD  +VTHLF +T+ +G + TG+TAD+R+ VQ+AR EAA ++++YGY++PVD+L + IAD
Sbjct  61   LDSNTVTHLFRITENIGCVMTGMTADSRSQVQRARYEAANWKYKYGYDIPVDMLCKRIAD  120

Query  445  KSQVYTQHAYMRPLGVVAMILG  510
             SQVYTQ+A MRPLG   +++G
Sbjct  121  ISQVYTQNAEMRPLGCCMILIG  142



>ref|NP_001132918.1| proteasome subunit alpha type-6 [Ovis aries]
 gb|ACI46679.1| proteasome subunit alpha type 6 [Ovis aries]
Length=246

 Score =   203 bits (517),  Expect = 5e-62, Method: Compositional matrix adjust.
 Identities = 91/142 (64%), Positives = 117/142 (82%), Gaps = 0/142 (0%)
 Frame = +1

Query  85   MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL  264
            MSRGS  G+DRHITIFSPEGRL+QVEYAFKA+   G+TS+ VRGKD   +VTQKKVPDKL
Sbjct  1    MSRGSSAGFDRHITIFSPEGRLYQVEYAFKAINQGGLTSVAVRGKDCAVIVTQKKVPDKL  60

Query  265  LDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYEMPVDVLARWIAD  444
            LD ++VTHLF +T+ +G + TG+TAD+R+ VQ+AR EAA ++++YGYE+PVD+L + IAD
Sbjct  61   LDSSTVTHLFKITENIGCVMTGMTADSRSQVQRARYEAANWKYKYGYEIPVDMLCKRIAD  120

Query  445  KSQVYTQHAYMRPLGVVAMILG  510
             SQVYTQ A MRPLG   +++G
Sbjct  121  ISQVYTQSAEMRPLGCCMILIG  142



>ref|XP_010153543.1| PREDICTED: proteasome subunit alpha type-6 isoform X1 [Eurypyga 
helias]
 ref|XP_010581956.1| PREDICTED: proteasome subunit alpha type-6 isoform X1 [Haliaeetus 
leucocephalus]
Length=246

 Score =   203 bits (516),  Expect = 6e-62, Method: Compositional matrix adjust.
 Identities = 91/142 (64%), Positives = 118/142 (83%), Gaps = 0/142 (0%)
 Frame = +1

Query  85   MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL  264
            MSRGS  G+DRHITIFSPEGRL+QVEYAFKA+   G+TS+ VRGKDS  +VTQKKVPDKL
Sbjct  1    MSRGSSAGFDRHITIFSPEGRLYQVEYAFKAINQGGLTSVAVRGKDSAVIVTQKKVPDKL  60

Query  265  LDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYEMPVDVLARWIAD  444
            LD  +VTHLF +T+ +G + TG+TAD+R+ VQ+AR EAA ++++YGY++PVD+L + IAD
Sbjct  61   LDSNTVTHLFRITENIGCVMTGMTADSRSQVQRARYEAANWKYKYGYDIPVDMLCKRIAD  120

Query  445  KSQVYTQHAYMRPLGVVAMILG  510
             SQVYTQ+A MRPLG   +++G
Sbjct  121  ISQVYTQNAEMRPLGCCMILIG  142



>ref|NP_001002589.1| proteasome subunit alpha type-6 [Danio rerio]
 gb|AAH76196.1| Zgc:92716 [Danio rerio]
Length=246

 Score =   203 bits (516),  Expect = 6e-62, Method: Compositional matrix adjust.
 Identities = 91/142 (64%), Positives = 118/142 (83%), Gaps = 0/142 (0%)
 Frame = +1

Query  85   MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL  264
            MSRGS  G+DRHITIFSPEGRL+QVEYAFKA+   G+TS+ VRGKD   VVTQKKVPDKL
Sbjct  1    MSRGSSAGFDRHITIFSPEGRLYQVEYAFKAINQGGLTSVAVRGKDCAIVVTQKKVPDKL  60

Query  265  LDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYEMPVDVLARWIAD  444
            LD ++VTHLF +T+ +G + +G+TAD+R+ VQ+AR EAA ++++YGYE+PVD+L + IAD
Sbjct  61   LDSSTVTHLFRITENIGCVMSGMTADSRSQVQRARYEAANWKYKYGYEIPVDMLCKRIAD  120

Query  445  KSQVYTQHAYMRPLGVVAMILG  510
             SQVYTQ+A MRPLG   +++G
Sbjct  121  ISQVYTQNAEMRPLGCCMIVIG  142



>ref|XP_005285405.1| PREDICTED: proteasome subunit alpha type-6 isoform X1 [Chrysemys 
picta bellii]
Length=246

 Score =   203 bits (516),  Expect = 7e-62, Method: Compositional matrix adjust.
 Identities = 91/142 (64%), Positives = 118/142 (83%), Gaps = 0/142 (0%)
 Frame = +1

Query  85   MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL  264
            MSRGS  G+DRHITIFSPEGRL+QVEYAFKA+   G+TS+ VRGKD   +VTQKKVPDKL
Sbjct  1    MSRGSSAGFDRHITIFSPEGRLYQVEYAFKAINQGGLTSVAVRGKDCAVIVTQKKVPDKL  60

Query  265  LDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYEMPVDVLARWIAD  444
            LD ++VTHLF +T+ +G + TG+TAD+R+ VQ+AR EAA ++++YGYE+PVD+L + IAD
Sbjct  61   LDSSTVTHLFRITETIGCVMTGMTADSRSQVQRARYEAANWKYKYGYEIPVDMLCKRIAD  120

Query  445  KSQVYTQHAYMRPLGVVAMILG  510
             SQVYTQ+A MRPLG   +++G
Sbjct  121  ISQVYTQNAEMRPLGCCMILIG  142



>ref|NP_001088418.1| uncharacterized protein LOC495277 [Xenopus laevis]
 gb|AAH84423.1| LOC495277 protein [Xenopus laevis]
Length=246

 Score =   203 bits (516),  Expect = 7e-62, Method: Compositional matrix adjust.
 Identities = 91/142 (64%), Positives = 117/142 (82%), Gaps = 0/142 (0%)
 Frame = +1

Query  85   MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL  264
            MSRGS  G+DRHITIFSPEGRL+QVEYAFKA+   G+TS+ VRGKD   VVTQ+KVPDKL
Sbjct  1    MSRGSSAGFDRHITIFSPEGRLYQVEYAFKAINQGGLTSVAVRGKDCAVVVTQRKVPDKL  60

Query  265  LDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYEMPVDVLARWIAD  444
            LD  +VTHLF +T+ +G + TG+TAD+R+ VQ+AR EAA ++++YGYE+PVD+L + IAD
Sbjct  61   LDSNTVTHLFKITENIGCVMTGMTADSRSQVQRARYEAANWKYKYGYEIPVDMLCKRIAD  120

Query  445  KSQVYTQHAYMRPLGVVAMILG  510
             SQVYTQ+A MRPLG   +++G
Sbjct  121  ISQVYTQNAEMRPLGCCMILIG  142



>ref|XP_005149366.1| PREDICTED: proteasome subunit alpha type-6 [Melopsittacus undulatus]
Length=246

 Score =   202 bits (515),  Expect = 8e-62, Method: Compositional matrix adjust.
 Identities = 91/142 (64%), Positives = 118/142 (83%), Gaps = 0/142 (0%)
 Frame = +1

Query  85   MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL  264
            MSRGS  G+DRHITIFSPEGRL+QVEYAFKA+   G+TS+ VRGKDS  +VTQKKVPDKL
Sbjct  1    MSRGSSAGFDRHITIFSPEGRLYQVEYAFKAINQGGLTSVAVRGKDSAVIVTQKKVPDKL  60

Query  265  LDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYEMPVDVLARWIAD  444
            LD  +VTHLF +T+ +G + TG+TAD+R+ VQ+AR EAA ++++YGY++PVD+L + IAD
Sbjct  61   LDSNTVTHLFRITENIGCVMTGMTADSRSQVQRARYEAANWKYKYGYDIPVDMLCKRIAD  120

Query  445  KSQVYTQHAYMRPLGVVAMILG  510
             SQVYTQ+A MRPLG   +++G
Sbjct  121  ISQVYTQNAEMRPLGCCMILIG  142



>emb|CDH55408.1| proteasome subunit alpha type-6 [Lichtheimia corymbifera JMRC:FSU:9682]
Length=246

 Score =   202 bits (515),  Expect = 9e-62, Method: Compositional matrix adjust.
 Identities = 91/142 (64%), Positives = 118/142 (83%), Gaps = 0/142 (0%)
 Frame = +1

Query  85   MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL  264
            MSRGS  GYDRHITIFSPEGRL+QVEYAFKA+  +GITS+GVRG+D   +VTQKKVPDKL
Sbjct  1    MSRGSSAGYDRHITIFSPEGRLYQVEYAFKAISNSGITSVGVRGQDGCVIVTQKKVPDKL  60

Query  265  LDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYEMPVDVLARWIAD  444
            LD +++TH+F +T  +G + TG+ ADAR+ V +AR EAAEFR++YGYE+P D+LA+ +A+
Sbjct  61   LDPSTITHVFKLTPKIGCVMTGMIADARSQVTRARQEAAEFRYKYGYEIPADMLAKRVAN  120

Query  445  KSQVYTQHAYMRPLGVVAMILG  510
             +QVYTQ A MRPLGV  +++G
Sbjct  121  INQVYTQQAAMRPLGVSMILIG  142



>ref|XP_003924255.1| PREDICTED: proteasome subunit alpha type-6 [Saimiri boliviensis 
boliviensis]
Length=283

 Score =   204 bits (518),  Expect = 9e-62, Method: Compositional matrix adjust.
 Identities = 91/143 (64%), Positives = 118/143 (83%), Gaps = 0/143 (0%)
 Frame = +1

Query  82   KMSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDK  261
             MSRGS  G+DRHITIFSPEGRL+QVEYAFKA+   G+TS+ VRGKD   +VTQKKVPDK
Sbjct  37   NMSRGSSAGFDRHITIFSPEGRLYQVEYAFKAINQGGLTSVAVRGKDCAVIVTQKKVPDK  96

Query  262  LLDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYEMPVDVLARWIA  441
            LLD ++VTHLF +T+ +G + TG+TAD+R+ VQ+AR EAA ++++YGYE+PVD+L + IA
Sbjct  97   LLDSSTVTHLFKITENIGCVMTGMTADSRSQVQRARYEAANWKYKYGYEIPVDMLCKRIA  156

Query  442  DKSQVYTQHAYMRPLGVVAMILG  510
            D SQVYTQ+A MRPLG   +++G
Sbjct  157  DISQVYTQNAEMRPLGCCMILIG  179



>ref|NP_989113.1| proteasome subunit alpha type-6 [Xenopus (Silurana) tropicalis]
 gb|AAH61438.1| proteasome (prosome, macropain) subunit, alpha type 6 [Xenopus 
(Silurana) tropicalis]
 emb|CAJ81265.1| proteasome (prosome macropain) subunit alpha type 6 [Xenopus 
(Silurana) tropicalis]
Length=246

 Score =   202 bits (515),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 91/142 (64%), Positives = 117/142 (82%), Gaps = 0/142 (0%)
 Frame = +1

Query  85   MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL  264
            MSRGS  G+DRHITIFSPEGRL+QVEYAFKA+   G+TS+ VRGKD   VVTQ+KVPDKL
Sbjct  1    MSRGSSAGFDRHITIFSPEGRLYQVEYAFKAINQGGLTSVAVRGKDCAVVVTQRKVPDKL  60

Query  265  LDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYEMPVDVLARWIAD  444
            LD  +VTHLF +T+ +G + TG+TAD+R+ VQ+AR EAA ++++YGYE+PVD+L + IAD
Sbjct  61   LDSNTVTHLFRITESIGCVMTGMTADSRSQVQRARYEAANWKYKYGYEIPVDMLCKRIAD  120

Query  445  KSQVYTQHAYMRPLGVVAMILG  510
             SQVYTQ+A MRPLG   +++G
Sbjct  121  ISQVYTQNAEMRPLGCCMILIG  142



>ref|XP_007530301.1| PREDICTED: proteasome subunit alpha type-6 [Erinaceus europaeus]
Length=246

 Score =   202 bits (514),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 90/142 (63%), Positives = 118/142 (83%), Gaps = 0/142 (0%)
 Frame = +1

Query  85   MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL  264
            MSRGS  G+DRHITIFSPEGRL+QVEYAFKA+   G+TS+ VRGKD   +VTQKKVPDKL
Sbjct  1    MSRGSSAGFDRHITIFSPEGRLYQVEYAFKAINQGGLTSVAVRGKDCAVIVTQKKVPDKL  60

Query  265  LDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYEMPVDVLARWIAD  444
            LD ++VTHLF +T+ +G + TG+TAD+R+ VQ+AR EAA +++++GYE+PVD+L + IAD
Sbjct  61   LDSSTVTHLFKITESIGCVMTGMTADSRSQVQRARYEAANWKYKFGYEIPVDMLCKRIAD  120

Query  445  KSQVYTQHAYMRPLGVVAMILG  510
             SQVYTQ+A MRPLG   +++G
Sbjct  121  ISQVYTQNAEMRPLGCCMILIG  142



>gb|ACO08744.1| Proteasome subunit alpha type 6 [Oncorhynchus mykiss]
Length=188

 Score =   200 bits (509),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 90/142 (63%), Positives = 116/142 (82%), Gaps = 0/142 (0%)
 Frame = +1

Query  85   MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL  264
            MSRGS  G+DRHITIFSPEGRL+QVEYAFKA+   G+TS+ VRGKD   VVTQKKVPDKL
Sbjct  1    MSRGSSAGFDRHITIFSPEGRLYQVEYAFKAINQGGLTSVAVRGKDCAVVVTQKKVPDKL  60

Query  265  LDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYEMPVDVLARWIAD  444
            LD ++VTHLF +T+ +G + +G+TAD ++ VQ+AR EAA + ++YGYE+PVD+L + IAD
Sbjct  61   LDSSTVTHLFRITENIGCVMSGMTADGKSQVQRARYEAANWNYKYGYEIPVDMLCKRIAD  120

Query  445  KSQVYTQHAYMRPLGVVAMILG  510
             SQVYTQ+A MRPLG   +++G
Sbjct  121  ISQVYTQNAEMRPLGCCMIVIG  142



>emb|CEG74212.1| Putative Proteasome subunit alpha type [Rhizopus microsporus]
 emb|CEJ00907.1| Putative Proteasome subunit alpha type [Rhizopus microsporus]
 emb|CEI93442.1| Putative Proteasome subunit alpha type [Rhizopus microsporus]
Length=246

 Score =   202 bits (514),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 90/142 (63%), Positives = 118/142 (83%), Gaps = 0/142 (0%)
 Frame = +1

Query  85   MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL  264
            MSRGSG GYDRHITIFSPEGRL+QVEYAFKA+  +GITS+GVRG+D   +VTQKK+PDKL
Sbjct  1    MSRGSGAGYDRHITIFSPEGRLYQVEYAFKAISNSGITSVGVRGRDGCVIVTQKKIPDKL  60

Query  265  LDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYEMPVDVLARWIAD  444
            LD +++TH+F +T  +G + TG+ ADAR+ V +AR EAAEFR++YGYE+P D+LA+ +A+
Sbjct  61   LDPSTITHVFKLTPKIGCVMTGMIADARSQVTRARQEAAEFRYKYGYEIPTDMLAKRVAN  120

Query  445  KSQVYTQHAYMRPLGVVAMILG  510
             +QVYTQ A MRP GV  +++G
Sbjct  121  INQVYTQQAAMRPYGVSMILIG  142



>ref|XP_001511492.1| PREDICTED: proteasome subunit alpha type-6 isoform X1 [Ornithorhynchus 
anatinus]
Length=246

 Score =   202 bits (514),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 90/142 (63%), Positives = 118/142 (83%), Gaps = 0/142 (0%)
 Frame = +1

Query  85   MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL  264
            MSRGS  G+DRHITIFSPEGRL+QVEYAFKA+   G+TS+ VRGKD   +VTQKKVPDKL
Sbjct  1    MSRGSSAGFDRHITIFSPEGRLYQVEYAFKAINQGGLTSVAVRGKDCAVIVTQKKVPDKL  60

Query  265  LDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYEMPVDVLARWIAD  444
            LD ++VTHLF +T+ +G + TG+TAD+++ VQ+AR EAA ++++YGYE+PVD+L + IAD
Sbjct  61   LDSSTVTHLFRITENIGCVMTGMTADSKSQVQRARYEAANWKYKYGYEIPVDMLCKRIAD  120

Query  445  KSQVYTQHAYMRPLGVVAMILG  510
             SQVYTQ+A MRPLG   +++G
Sbjct  121  ISQVYTQNAEMRPLGCCMILIG  142



>ref|NP_001132944.1| proteasome subunit alpha type-6 [Sus scrofa]
 gb|ACJ06406.1| proteasome subunit alpha type 6 [Sus scrofa]
Length=246

 Score =   202 bits (514),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 91/142 (64%), Positives = 117/142 (82%), Gaps = 0/142 (0%)
 Frame = +1

Query  85   MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL  264
            MSRGS  G DRHITIFSPEGRL+QVEYAFKA+   G+TS+ VRGKD   +VTQKKVPDKL
Sbjct  1    MSRGSSAGVDRHITIFSPEGRLYQVEYAFKAINQGGLTSVAVRGKDCAVIVTQKKVPDKL  60

Query  265  LDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYEMPVDVLARWIAD  444
            LD ++VTHLF +T+ +G + TG+TAD+R+ VQ+AR EAA ++++YGYE+PVD+L + IAD
Sbjct  61   LDSSTVTHLFKITENIGCVMTGMTADSRSQVQRARYEAANWKYKYGYEIPVDMLCKRIAD  120

Query  445  KSQVYTQHAYMRPLGVVAMILG  510
             SQVYTQ+A MRPLG   +++G
Sbjct  121  ISQVYTQNAEMRPLGCCMILIG  142



>gb|EIE83838.1| hypothetical protein RO3G_08543 [Rhizopus delemar RA 99-880]
Length=246

 Score =   202 bits (514),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 91/142 (64%), Positives = 117/142 (82%), Gaps = 0/142 (0%)
 Frame = +1

Query  85   MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL  264
            MSRGSG GYDRHITIFSPEGRL+QVEYAFKA+  +GITS+GVRG+D   +VTQ+KVPDKL
Sbjct  1    MSRGSGAGYDRHITIFSPEGRLYQVEYAFKAISNSGITSVGVRGRDGCVIVTQRKVPDKL  60

Query  265  LDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYEMPVDVLARWIAD  444
            LD +++TH+F +T  +G   TG+ ADAR+ V +AR EAAEFR++YGYE+P D+LAR +A+
Sbjct  61   LDPSTITHVFKLTPKIGCAMTGMIADARSQVTRARQEAAEFRYKYGYEIPTDMLARRVAN  120

Query  445  KSQVYTQHAYMRPLGVVAMILG  510
             +QVYTQ A MRP GV  +++G
Sbjct  121  INQVYTQQAAMRPYGVSMILIG  142



>gb|ETE73021.1| Proteasome subunit alpha type-6, partial [Ophiophagus hannah]
Length=279

 Score =   203 bits (516),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 92/142 (65%), Positives = 117/142 (82%), Gaps = 0/142 (0%)
 Frame = +1

Query  85   MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL  264
            MSRGS  G+DRHITIFSPEGRL+QVEYAFKA+   G+TS+ VRGKD   VVTQKKVPDKL
Sbjct  34   MSRGSSAGFDRHITIFSPEGRLYQVEYAFKAINQGGLTSVAVRGKDCAVVVTQKKVPDKL  93

Query  265  LDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYEMPVDVLARWIAD  444
            LD  +VTHLF +T+ +G + TG+TAD+R+ VQ+AR EAA ++++YGYE+PVD+L + IAD
Sbjct  94   LDSNTVTHLFRITENIGCVMTGMTADSRSQVQRARYEAANWKYKYGYEIPVDMLCKRIAD  153

Query  445  KSQVYTQHAYMRPLGVVAMILG  510
             SQVYTQ+A MRPLG   +++G
Sbjct  154  ISQVYTQNAEMRPLGCCMIMIG  175



>ref|XP_002610620.1| hypothetical protein BRAFLDRAFT_260512 [Branchiostoma floridae]
 gb|EEN66630.1| hypothetical protein BRAFLDRAFT_260512 [Branchiostoma floridae]
Length=246

 Score =   202 bits (513),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 91/142 (64%), Positives = 116/142 (82%), Gaps = 0/142 (0%)
 Frame = +1

Query  85   MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL  264
            MSRG+  G+DRHITIFSPEGRL+QVEYAFKAV   G+TS+ VRGKD   VVTQKKVPDKL
Sbjct  1    MSRGTSAGFDRHITIFSPEGRLYQVEYAFKAVNQGGLTSVAVRGKDCAVVVTQKKVPDKL  60

Query  265  LDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYEMPVDVLARWIAD  444
            LD  +VTH+F +T Y+G + TG+ AD+R+ VQ+AR EAA ++++YGYE+PVD+L + IAD
Sbjct  61   LDAETVTHIFQITDYIGCVMTGMIADSRSQVQRARYEAANWKYKYGYEIPVDMLCKRIAD  120

Query  445  KSQVYTQHAYMRPLGVVAMILG  510
             SQVYTQ+A MRPLG   +++G
Sbjct  121  ISQVYTQNAEMRPLGCCMILIG  142



>ref|NP_001279159.1| proteasome (prosome, macropain) subunit, alpha type, 6 [Callorhinchus 
milii]
 gb|AFM88302.1| proteasome subunit alpha type-6-like protein [Callorhinchus milii]
Length=246

 Score =   202 bits (513),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 91/142 (64%), Positives = 117/142 (82%), Gaps = 0/142 (0%)
 Frame = +1

Query  85   MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL  264
            MSRGS  G+DRHITIFSPEGRL+QVEYAFKA+   G+TS+ VRGKD   +VTQKKVPDKL
Sbjct  1    MSRGSSAGFDRHITIFSPEGRLYQVEYAFKAINQGGLTSVAVRGKDCAVIVTQKKVPDKL  60

Query  265  LDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYEMPVDVLARWIAD  444
            LD  +VTHLF +T+ +G + TG+TAD+R+ VQ+AR EAA ++++YGYE+PVD+L + IAD
Sbjct  61   LDANTVTHLFRITEKIGCVMTGMTADSRSQVQRARYEAANWKYKYGYEIPVDMLCKRIAD  120

Query  445  KSQVYTQHAYMRPLGVVAMILG  510
             SQVYTQ+A MRPLG   +++G
Sbjct  121  ISQVYTQNAEMRPLGCCMILVG  142



>pdb|4R3O|A Chain A, Human Constitutive 20s Proteasome
 pdb|4R3O|O Chain O, Human Constitutive 20s Proteasome
 pdb|4R67|A Chain A, Human Constitutive 20s Proteasome In Complex With Carfilzomib
 pdb|4R67|O Chain O, Human Constitutive 20s Proteasome In Complex With Carfilzomib
 pdb|4R67|CC Chain c, Human Constitutive 20s Proteasome In Complex With Carfilzomib
 pdb|4R67|QQ Chain q, Human Constitutive 20s Proteasome In Complex With Carfilzomib
Length=244

 Score =   202 bits (513),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 90/141 (64%), Positives = 117/141 (83%), Gaps = 0/141 (0%)
 Frame = +1

Query  88   SRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKLL  267
            SRGS  G+DRHITIFSPEGRL+QVEYAFKA+   G+TS+ VRGKD   +VTQKKVPDKLL
Sbjct  1    SRGSSAGFDRHITIFSPEGRLYQVEYAFKAINQGGLTSVAVRGKDCAVIVTQKKVPDKLL  60

Query  268  DQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYEMPVDVLARWIADK  447
            D ++VTHLF +T+ +G + TG+TAD+R+ VQ+AR EAA ++++YGYE+PVD+L + IAD 
Sbjct  61   DSSTVTHLFKITENIGCVMTGMTADSRSQVQRARYEAANWKYKYGYEIPVDMLCKRIADI  120

Query  448  SQVYTQHAYMRPLGVVAMILG  510
            SQVYTQ+A MRPLG   +++G
Sbjct  121  SQVYTQNAEMRPLGCCMILIG  141



>ref|XP_006632201.1| PREDICTED: proteasome subunit alpha type-6-like [Lepisosteus 
oculatus]
Length=246

 Score =   202 bits (513),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 91/142 (64%), Positives = 117/142 (82%), Gaps = 0/142 (0%)
 Frame = +1

Query  85   MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL  264
            MSRGS  G+DRHITIFSPEGRL+QVEYAFKA+   G+TS+ VRGKD   VVTQKKVPDKL
Sbjct  1    MSRGSSAGFDRHITIFSPEGRLYQVEYAFKAINQGGLTSVAVRGKDCAVVVTQKKVPDKL  60

Query  265  LDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYEMPVDVLARWIAD  444
            LD  +VTHLF +T+ +G + +G+TAD+R+ VQ+AR EAA ++++YGYE+PVD+L + IAD
Sbjct  61   LDSNTVTHLFRITETIGCVMSGMTADSRSQVQRARYEAANWKYKYGYEIPVDMLCKRIAD  120

Query  445  KSQVYTQHAYMRPLGVVAMILG  510
             SQVYTQ+A MRPLG   +++G
Sbjct  121  ISQVYTQNAEMRPLGCCMILIG  142



>gb|ACI66289.1| Proteasome subunit alpha type-6 [Salmo salar]
 gb|ADM16303.1| Proteasome subunit alpha type-6 [Salmo salar]
Length=246

 Score =   201 bits (512),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 90/142 (63%), Positives = 118/142 (83%), Gaps = 0/142 (0%)
 Frame = +1

Query  85   MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL  264
            MSRGS  G+DRHITIFSPEGRL+QVEYAFKA+   G+TS+ VRGKD   VVTQKKVPDKL
Sbjct  1    MSRGSSAGFDRHITIFSPEGRLYQVEYAFKAINQGGLTSVAVRGKDCAVVVTQKKVPDKL  60

Query  265  LDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYEMPVDVLARWIAD  444
            LD ++VTHLF +T+ +G + +G+TAD+++ VQ+AR EAA ++++YGYE+PVD+L + IAD
Sbjct  61   LDASTVTHLFRITENIGCVMSGMTADSKSQVQRARYEAANWKYKYGYEIPVDMLCKRIAD  120

Query  445  KSQVYTQHAYMRPLGVVAMILG  510
             SQVYTQ+A MRPLG   +++G
Sbjct  121  ISQVYTQNAEMRPLGCCMIVIG  142



>ref|XP_007569003.1| PREDICTED: proteasome subunit alpha type-6 [Poecilia formosa]
Length=246

 Score =   201 bits (512),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 91/142 (64%), Positives = 117/142 (82%), Gaps = 0/142 (0%)
 Frame = +1

Query  85   MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL  264
            MSRGS  G+DRHITIFSPEGRL+QVEYAFKA+   G+TS+ VRGKD   VVTQKKVPDKL
Sbjct  1    MSRGSSAGFDRHITIFSPEGRLYQVEYAFKAINQGGLTSVAVRGKDCAVVVTQKKVPDKL  60

Query  265  LDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYEMPVDVLARWIAD  444
            LD ++VTHLF +T  +G + +G+TAD+R+ VQ+AR EAA ++++YGYE+PVD+L + IAD
Sbjct  61   LDASTVTHLFRITDNIGCVMSGMTADSRSQVQRARYEAANWQYKYGYEIPVDMLCKRIAD  120

Query  445  KSQVYTQHAYMRPLGVVAMILG  510
             SQVYTQ+A MRPLG   +++G
Sbjct  121  ISQVYTQNAEMRPLGCCMIVIG  142



>emb|CDQ90937.1| unnamed protein product [Oncorhynchus mykiss]
Length=246

 Score =   201 bits (512),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 90/142 (63%), Positives = 118/142 (83%), Gaps = 0/142 (0%)
 Frame = +1

Query  85   MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL  264
            MSRGS  G+DRHITIFSPEGRL+QVEYAFKA+   G+TS+ VRGKD   VVTQKKVPDKL
Sbjct  1    MSRGSSAGFDRHITIFSPEGRLYQVEYAFKAINQGGLTSVAVRGKDCAVVVTQKKVPDKL  60

Query  265  LDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYEMPVDVLARWIAD  444
            LD ++VTHLF +T+ +G + +G+TAD+++ VQ+AR EAA ++++YGYE+PVD+L + IAD
Sbjct  61   LDASTVTHLFRITENIGCVMSGMTADSKSQVQRARYEAANWKYKYGYEIPVDMLCKRIAD  120

Query  445  KSQVYTQHAYMRPLGVVAMILG  510
             SQVYTQ+A MRPLG   +++G
Sbjct  121  ISQVYTQNAEMRPLGCCMIVIG  142



>ref|XP_005810950.1| PREDICTED: proteasome subunit alpha type-6-like [Xiphophorus 
maculatus]
Length=246

 Score =   201 bits (512),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 91/142 (64%), Positives = 117/142 (82%), Gaps = 0/142 (0%)
 Frame = +1

Query  85   MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL  264
            MSRGS  G+DRHITIFSPEGRL+QVEYAFKA+   G+TS+ VRGKD   VVTQKKVPDKL
Sbjct  1    MSRGSSAGFDRHITIFSPEGRLYQVEYAFKAINQGGLTSVAVRGKDCAVVVTQKKVPDKL  60

Query  265  LDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYEMPVDVLARWIAD  444
            LD ++VTHLF +T  +G + +G+TAD+R+ VQ+AR EAA ++++YGYE+PVD+L + IAD
Sbjct  61   LDASTVTHLFRITDNIGCVMSGMTADSRSQVQRARYEAANWQYKYGYEIPVDMLCKRIAD  120

Query  445  KSQVYTQHAYMRPLGVVAMILG  510
             SQVYTQ+A MRPLG   +++G
Sbjct  121  ISQVYTQNAEMRPLGCCMIVIG  142



>ref|XP_008282309.1| PREDICTED: proteasome subunit alpha type-6 [Stegastes partitus]
Length=246

 Score =   201 bits (512),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 91/142 (64%), Positives = 117/142 (82%), Gaps = 0/142 (0%)
 Frame = +1

Query  85   MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL  264
            MSRGS  G+DRHITIFSPEGRL+QVEYAFKA+   G+TS+ VRGKD   VVTQKKVPDKL
Sbjct  1    MSRGSSAGFDRHITIFSPEGRLYQVEYAFKAINQGGLTSVAVRGKDCAVVVTQKKVPDKL  60

Query  265  LDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYEMPVDVLARWIAD  444
            LD ++VTHLF +T  +G + +G+TAD+R+ VQ+AR EAA ++++YGYE+PVD+L + IAD
Sbjct  61   LDASTVTHLFRITDNIGCVMSGMTADSRSQVQRARYEAANWQYKYGYEIPVDMLCKRIAD  120

Query  445  KSQVYTQHAYMRPLGVVAMILG  510
             SQVYTQ+A MRPLG   +++G
Sbjct  121  ISQVYTQNAEMRPLGCCMIVIG  142



>ref|XP_008396439.1| PREDICTED: proteasome subunit alpha type-6 [Poecilia reticulata]
Length=246

 Score =   201 bits (512),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 91/142 (64%), Positives = 117/142 (82%), Gaps = 0/142 (0%)
 Frame = +1

Query  85   MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL  264
            MSRGS  G+DRHITIFSPEGRL+QVEYAFKA+   G+TS+ VRGKD   VVTQKKVPDKL
Sbjct  1    MSRGSSAGFDRHITIFSPEGRLYQVEYAFKAINQGGLTSVAVRGKDCAVVVTQKKVPDKL  60

Query  265  LDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYEMPVDVLARWIAD  444
            LD ++VTHLF +T  +G + +G+TAD+R+ VQ+AR EAA ++++YGYE+PVD+L + IAD
Sbjct  61   LDASTVTHLFRITDNIGCVMSGMTADSRSQVQRARYEAANWQYKYGYEIPVDMLCKRIAD  120

Query  445  KSQVYTQHAYMRPLGVVAMILG  510
             SQVYTQ+A MRPLG   +++G
Sbjct  121  ISQVYTQNAEMRPLGCCMIVIG  142



>gb|EPB88050.1| proteasome subunit alpha type-6 [Mucor circinelloides f. circinelloides 
1006PhL]
Length=246

 Score =   201 bits (512),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 90/142 (63%), Positives = 118/142 (83%), Gaps = 0/142 (0%)
 Frame = +1

Query  85   MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL  264
            MSRGSG GYDRHITIFSPEGRL+QVEYAFKA+  +GITS+GVRG+D   +VTQ+KVPDKL
Sbjct  1    MSRGSGAGYDRHITIFSPEGRLYQVEYAFKAISNSGITSVGVRGRDGCVIVTQRKVPDKL  60

Query  265  LDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYEMPVDVLARWIAD  444
            LD +++TH+F +T  +G + TG+ ADAR+ V +AR EAAEFR++YGYE+P D+LA+ +A+
Sbjct  61   LDPSTITHVFKLTPKIGCVMTGMIADARSQVTRARQEAAEFRYKYGYEIPTDMLAKRVAN  120

Query  445  KSQVYTQHAYMRPLGVVAMILG  510
             +QVYTQ A MRP GV  +++G
Sbjct  121  INQVYTQQAAMRPYGVSMILIG  142



>emb|CAG00121.1| unnamed protein product, partial [Tetraodon nigroviridis]
Length=246

 Score =   201 bits (512),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 91/142 (64%), Positives = 117/142 (82%), Gaps = 0/142 (0%)
 Frame = +1

Query  85   MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL  264
            MSRGS  G+DRHITIFSPEGRL+QVEYAFKA+   G+TS+ VRGKD   VVTQKKVPDKL
Sbjct  1    MSRGSSAGFDRHITIFSPEGRLYQVEYAFKAINQGGLTSVAVRGKDCAVVVTQKKVPDKL  60

Query  265  LDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYEMPVDVLARWIAD  444
            LD ++VTHLF +T  +G + +G+TAD+R+ VQ+AR EAA ++++YGYE+PVD+L + IAD
Sbjct  61   LDASTVTHLFRITDNIGCVMSGMTADSRSQVQRARYEAANWQYKYGYEIPVDMLCKRIAD  120

Query  445  KSQVYTQHAYMRPLGVVAMILG  510
             SQVYTQ+A MRPLG   +++G
Sbjct  121  ISQVYTQNAEMRPLGCCMIVIG  142



>emb|CEP12966.1| hypothetical protein [Parasitella parasitica]
Length=246

 Score =   201 bits (512),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 90/142 (63%), Positives = 118/142 (83%), Gaps = 0/142 (0%)
 Frame = +1

Query  85   MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL  264
            MSRGSG GYDRHITIFSPEGRL+QVEYAFKA+  +GITS+GVRG+D   +VTQ+KVPDKL
Sbjct  1    MSRGSGAGYDRHITIFSPEGRLYQVEYAFKAISNSGITSVGVRGRDGCVIVTQRKVPDKL  60

Query  265  LDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYEMPVDVLARWIAD  444
            LD +++TH+F +T  +G + TG+ ADAR+ V +AR EAAEFR++YGYE+P D+LA+ +A+
Sbjct  61   LDPSTITHVFKLTPKIGCVMTGMIADARSQVTRARQEAAEFRYKYGYEIPTDMLAKRVAN  120

Query  445  KSQVYTQHAYMRPLGVVAMILG  510
             +QVYTQ A MRP GV  +++G
Sbjct  121  INQVYTQQAAMRPYGVSMILIG  142



>ref|XP_003440740.1| PREDICTED: proteasome subunit alpha type-6-like [Oreochromis 
niloticus]
Length=246

 Score =   201 bits (512),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 91/142 (64%), Positives = 117/142 (82%), Gaps = 0/142 (0%)
 Frame = +1

Query  85   MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL  264
            MSRGS  G+DRHITIFSPEGRL+QVEYAFKA+   G+TS+ VRGKD   VVTQKKVPDKL
Sbjct  1    MSRGSSAGFDRHITIFSPEGRLYQVEYAFKAINQGGLTSVAVRGKDCAVVVTQKKVPDKL  60

Query  265  LDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYEMPVDVLARWIAD  444
            LD ++VTHLF +T  +G + +G+TAD+R+ VQ+AR EAA ++++YGYE+PVD+L + IAD
Sbjct  61   LDASTVTHLFRITDNIGCVMSGMTADSRSQVQRARYEAANWQYKYGYEIPVDMLCKRIAD  120

Query  445  KSQVYTQHAYMRPLGVVAMILG  510
             SQVYTQ+A MRPLG   +++G
Sbjct  121  ISQVYTQNAEMRPLGCCMIVIG  142



>ref|XP_004542308.1| PREDICTED: proteasome subunit alpha type-6-like [Maylandia zebra]
 ref|XP_005724902.1| PREDICTED: proteasome subunit alpha type-6-like [Pundamilia nyererei]
 ref|XP_005917154.1| PREDICTED: proteasome subunit alpha type-6-like [Haplochromis 
burtoni]
Length=246

 Score =   201 bits (512),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 91/142 (64%), Positives = 117/142 (82%), Gaps = 0/142 (0%)
 Frame = +1

Query  85   MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL  264
            MSRGS  G+DRHITIFSPEGRL+QVEYAFKA+   G+TS+ VRGKD   VVTQKKVPDKL
Sbjct  1    MSRGSSAGFDRHITIFSPEGRLYQVEYAFKAINQGGLTSVAVRGKDCAVVVTQKKVPDKL  60

Query  265  LDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYEMPVDVLARWIAD  444
            LD ++VTHLF +T  +G + +G+TAD+R+ VQ+AR EAA ++++YGYE+PVD+L + IAD
Sbjct  61   LDASTVTHLFRITDNIGCVMSGMTADSRSQVQRARYEAANWQYKYGYEIPVDMLCKRIAD  120

Query  445  KSQVYTQHAYMRPLGVVAMILG  510
             SQVYTQ+A MRPLG   +++G
Sbjct  121  ISQVYTQNAEMRPLGCCMIVIG  142



>ref|NP_001086785.1| proteasome alpha 6 subunit [Xenopus laevis]
 gb|AAH77442.1| Psma6-prov protein [Xenopus laevis]
 dbj|BAD42870.1| 20S proteasome alpha1 subunit [Xenopus laevis]
Length=246

 Score =   201 bits (512),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 90/142 (63%), Positives = 117/142 (82%), Gaps = 0/142 (0%)
 Frame = +1

Query  85   MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL  264
            MSRGS  G+DRHITIFSPEGRL+QVEYAFKA+   G+TS+ VRGKD   VVTQ+KVPDKL
Sbjct  1    MSRGSSAGFDRHITIFSPEGRLYQVEYAFKAINQGGLTSVAVRGKDCAVVVTQRKVPDKL  60

Query  265  LDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYEMPVDVLARWIAD  444
            LD  +VTHLF +T+ +G + TG+TAD+R+ VQ+AR EAA ++++YGYE+PVD+L + +AD
Sbjct  61   LDSNTVTHLFRITENIGCVMTGMTADSRSQVQRARYEAANWKYKYGYEIPVDMLCKRMAD  120

Query  445  KSQVYTQHAYMRPLGVVAMILG  510
             SQVYTQ+A MRPLG   +++G
Sbjct  121  ISQVYTQNAEMRPLGCCMILIG  142



>ref|XP_005158685.1| PREDICTED: proteasome subunit alpha type-6 isoform X1 [Danio 
rerio]
 gb|AAH55520.1| Psma6a protein [Danio rerio]
 gb|AAI64827.1| Psma6a protein [Danio rerio]
Length=246

 Score =   201 bits (511),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 89/142 (63%), Positives = 118/142 (83%), Gaps = 0/142 (0%)
 Frame = +1

Query  85   MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL  264
            MSRGS  G+DRHITIFSPEGRL+QVEYAFKA+   G+TS+ VRGKD   V+TQ+KVPDKL
Sbjct  1    MSRGSSAGFDRHITIFSPEGRLYQVEYAFKAINQGGLTSVAVRGKDCAVVITQRKVPDKL  60

Query  265  LDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYEMPVDVLARWIAD  444
            LD ++VTHLF +T+ +G + +G+TAD+R+ VQ+AR EAA ++++YGYE+PVD+L + IAD
Sbjct  61   LDSSTVTHLFRITENIGCVMSGMTADSRSQVQRARYEAANWKYKYGYEIPVDMLCKRIAD  120

Query  445  KSQVYTQHAYMRPLGVVAMILG  510
             SQVYTQ+A MRPLG   +++G
Sbjct  121  ISQVYTQNAEMRPLGCCMIVVG  142



>gb|EDL36727.1| proteasome (prosome, macropain) subunit, alpha type 6, isoform 
CRA_a [Mus musculus]
Length=144

 Score =   197 bits (502),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 90/136 (66%), Positives = 114/136 (84%), Gaps = 0/136 (0%)
 Frame = +1

Query  85   MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL  264
            MSRGS  G+DRHITIFSPEGRL+QVEYAFKA+   G+TS+ VRGKD   +VTQKKVPDKL
Sbjct  6    MSRGSSAGFDRHITIFSPEGRLYQVEYAFKAINQGGLTSVAVRGKDCAVIVTQKKVPDKL  65

Query  265  LDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYEMPVDVLARWIAD  444
            LD ++VTHLF +T+ +G + TG+TAD+R+ VQ+AR EAA ++++YGYE+PVD+L + IAD
Sbjct  66   LDSSTVTHLFKITESIGCVMTGMTADSRSQVQRARYEAANWKYKYGYEIPVDMLCKRIAD  125

Query  445  KSQVYTQHAYMRPLGV  492
             SQVYTQ+A MRPL V
Sbjct  126  ISQVYTQNAEMRPLVV  141



>ref|XP_005798367.1| PREDICTED: proteasome subunit alpha type-6-like [Xiphophorus 
maculatus]
Length=246

 Score =   201 bits (511),  Expect = 4e-61, Method: Compositional matrix adjust.
 Identities = 91/142 (64%), Positives = 116/142 (82%), Gaps = 0/142 (0%)
 Frame = +1

Query  85   MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL  264
            MSRGS  G+DRHITIFSPEGRL+QVEYAFKA+   G+TS+G+RGKD   VVTQKKVPDKL
Sbjct  1    MSRGSSAGFDRHITIFSPEGRLYQVEYAFKAINQGGMTSVGIRGKDCAVVVTQKKVPDKL  60

Query  265  LDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYEMPVDVLARWIAD  444
            LD T+VT LF +T  +G + TG+TAD+R+ VQ+AR EAA + ++YGYE+PVD+L + +AD
Sbjct  61   LDDTTVTQLFRITDNIGCVMTGMTADSRSQVQRARYEAANWNYKYGYEVPVDMLCKRMAD  120

Query  445  KSQVYTQHAYMRPLGVVAMILG  510
             SQVYTQ+A MRPLG   +++G
Sbjct  121  ISQVYTQNAEMRPLGCCMVVIG  142



>ref|XP_005322784.1| PREDICTED: proteasome subunit alpha type-6 [Ictidomys tridecemlineatus]
Length=214

 Score =   200 bits (508),  Expect = 4e-61, Method: Compositional matrix adjust.
 Identities = 90/137 (66%), Positives = 114/137 (83%), Gaps = 0/137 (0%)
 Frame = +1

Query  85   MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL  264
            MSRGS  G+DRHITIFSPEGRL+QVEYAFKA+   G+TS+ VRGKD   +VTQKKVPDKL
Sbjct  1    MSRGSSAGFDRHITIFSPEGRLYQVEYAFKAINQGGLTSVAVRGKDCAVIVTQKKVPDKL  60

Query  265  LDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYEMPVDVLARWIAD  444
            LD ++VTHLF +T+ +G + TG+TAD+R+ VQ+AR EAA ++++YGYE+PVD+L + IAD
Sbjct  61   LDSSTVTHLFKITENIGCVMTGMTADSRSQVQRARYEAANWKYKYGYEIPVDMLCKRIAD  120

Query  445  KSQVYTQHAYMRPLGVV  495
             SQVYTQ+A MRPLG  
Sbjct  121  ISQVYTQNAEMRPLGCC  137



>ref|XP_004083706.1| PREDICTED: proteasome subunit alpha type-6 [Oryzias latipes]
Length=246

 Score =   201 bits (511),  Expect = 4e-61, Method: Compositional matrix adjust.
 Identities = 91/142 (64%), Positives = 117/142 (82%), Gaps = 0/142 (0%)
 Frame = +1

Query  85   MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL  264
            MSRGS  G+DRHITIFSPEGRL+QVEYAFKA+   G+TS+ VRGKD   VVTQKKVPDKL
Sbjct  1    MSRGSSAGFDRHITIFSPEGRLYQVEYAFKAINQGGLTSVAVRGKDCAVVVTQKKVPDKL  60

Query  265  LDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYEMPVDVLARWIAD  444
            LD ++VTHLF +T  +G + +G+TAD+R+ VQ+AR EAA ++++YGYE+PVD+L + IAD
Sbjct  61   LDASTVTHLFRITDNIGCVMSGMTADSRSQVQRARYEAANWQYKYGYEVPVDMLCKRIAD  120

Query  445  KSQVYTQHAYMRPLGVVAMILG  510
             SQVYTQ+A MRPLG   +++G
Sbjct  121  ISQVYTQNAEMRPLGCCMIVIG  142



>ref|XP_004653726.1| PREDICTED: proteasome subunit alpha type-6-like [Jaculus jaculus]
Length=246

 Score =   201 bits (511),  Expect = 4e-61, Method: Compositional matrix adjust.
 Identities = 89/142 (63%), Positives = 116/142 (82%), Gaps = 0/142 (0%)
 Frame = +1

Query  85   MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL  264
            MSRGS  G+DRHITIFSPEGRL+Q EYAFKA+   G+TS+ VRGKD   +VTQKKVPDKL
Sbjct  1    MSRGSSAGFDRHITIFSPEGRLYQAEYAFKAINQGGLTSVAVRGKDCAVIVTQKKVPDKL  60

Query  265  LDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYEMPVDVLARWIAD  444
            LD ++VTHLF +T+ +G + TG+TAD+R+ VQ+AR EAA ++++YGYE+PVD+L + IAD
Sbjct  61   LDSSTVTHLFKITENIGCVMTGMTADSRSQVQRARYEAANWKYKYGYEIPVDMLCKRIAD  120

Query  445  KSQVYTQHAYMRPLGVVAMILG  510
             SQVYTQ+  MRPLG   +++G
Sbjct  121  ISQVYTQNTEMRPLGCCMILIG  142



>ref|XP_005703510.1| 20S proteasome subunit alpha 1 [Galdieria sulphuraria]
 gb|EME26990.1| 20S proteasome subunit alpha 1 [Galdieria sulphuraria]
Length=247

 Score =   201 bits (511),  Expect = 4e-61, Method: Compositional matrix adjust.
 Identities = 92/142 (65%), Positives = 118/142 (83%), Gaps = 0/142 (0%)
 Frame = +1

Query  85   MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL  264
            MSRGS  GYDRHITIFSPEGRL+QVEYAFKAVK+ GIT++ V+G DSVC VTQKKVPDKL
Sbjct  1    MSRGSSAGYDRHITIFSPEGRLYQVEYAFKAVKSVGITTVAVKGVDSVCGVTQKKVPDKL  60

Query  265  LDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYEMPVDVLARWIAD  444
            +D  SVT++F V+ + G + TG+  DAR  +Q+ R+EAA+F+F++GYE+PVD +A+ +AD
Sbjct  61   IDPKSVTNVFRVSDHHGCIFTGLATDARAQLQRTRSEAADFKFKFGYEIPVDQIAKRLAD  120

Query  445  KSQVYTQHAYMRPLGVVAMILG  510
             +QVYTQHAYMRPLGV  + +G
Sbjct  121  INQVYTQHAYMRPLGVSLIFIG  142



>emb|CDQ78135.1| unnamed protein product [Oncorhynchus mykiss]
Length=246

 Score =   201 bits (510),  Expect = 5e-61, Method: Compositional matrix adjust.
 Identities = 90/142 (63%), Positives = 116/142 (82%), Gaps = 0/142 (0%)
 Frame = +1

Query  85   MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL  264
            MSRGS  G+DRHITIFSPEGRL+QVEYAFKA+   G+TS+ VRGKD   VVTQKKVPDKL
Sbjct  1    MSRGSSAGFDRHITIFSPEGRLYQVEYAFKAINQGGLTSVAVRGKDCAVVVTQKKVPDKL  60

Query  265  LDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYEMPVDVLARWIAD  444
            LD ++VTHLF +T+ +G + +G+TAD ++ VQ+AR EAA + ++YGYE+PVD+L + IAD
Sbjct  61   LDSSTVTHLFRITENIGCVMSGMTADGKSQVQRARYEAANWNYKYGYEIPVDMLCKRIAD  120

Query  445  KSQVYTQHAYMRPLGVVAMILG  510
             SQVYTQ+A MRPLG   +++G
Sbjct  121  ISQVYTQNAEMRPLGCCMIVIG  142



>ref|XP_007253022.1| PREDICTED: proteasome subunit alpha type-6-like isoform X2 [Astyanax 
mexicanus]
Length=246

 Score =   201 bits (510),  Expect = 5e-61, Method: Compositional matrix adjust.
 Identities = 90/142 (63%), Positives = 118/142 (83%), Gaps = 0/142 (0%)
 Frame = +1

Query  85   MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL  264
            MSRGS  G+DRHITIFSPEGRL+QVEYAFKA+   G+TS+ VRGKD   VVTQKKVPDKL
Sbjct  1    MSRGSSAGFDRHITIFSPEGRLYQVEYAFKAINQGGLTSVAVRGKDCAVVVTQKKVPDKL  60

Query  265  LDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYEMPVDVLARWIAD  444
            LD ++VTHLF +T+ +G + +G+TAD+R+ VQ+AR EAA ++++YG+E+PVD+L + IAD
Sbjct  61   LDSSTVTHLFRITESIGCVMSGMTADSRSQVQRARYEAANWQYKYGFEIPVDMLCKRIAD  120

Query  445  KSQVYTQHAYMRPLGVVAMILG  510
             SQVYTQ+A MRPLG   +++G
Sbjct  121  ISQVYTQNAEMRPLGCCMIVIG  142



>dbj|BAE36518.1| unnamed protein product [Mus musculus]
Length=246

 Score =   201 bits (510),  Expect = 5e-61, Method: Compositional matrix adjust.
 Identities = 90/142 (63%), Positives = 117/142 (82%), Gaps = 0/142 (0%)
 Frame = +1

Query  85   MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL  264
            MSRGS  G+DRHITIFSPEGRL+QVEYAFKA+   G+TS+ VRGKD   +VTQKKVPDKL
Sbjct  1    MSRGSSAGFDRHITIFSPEGRLYQVEYAFKAINQGGLTSVAVRGKDCAVIVTQKKVPDKL  60

Query  265  LDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYEMPVDVLARWIAD  444
            LD ++VTHLF +T+ +G + TG+TAD+R+ VQ+AR EAA ++++YGYE+PVD+L + IAD
Sbjct  61   LDSSTVTHLFKITESIGCVMTGMTADSRSQVQRARYEAANWKYKYGYEIPVDMLCKRIAD  120

Query  445  KSQVYTQHAYMRPLGVVAMILG  510
             SQVYTQ+A MR LG   +++G
Sbjct  121  ISQVYTQNAEMRTLGCCMILIG  142



>ref|XP_010744453.1| PREDICTED: proteasome subunit alpha type-6 [Larimichthys crocea]
Length=246

 Score =   201 bits (510),  Expect = 6e-61, Method: Compositional matrix adjust.
 Identities = 91/142 (64%), Positives = 116/142 (82%), Gaps = 0/142 (0%)
 Frame = +1

Query  85   MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL  264
            MSRGS  G+DRHITIFSPEGRL+QVEYAFKA+   G+TS+ VRGKD   VVTQKKVPDKL
Sbjct  1    MSRGSSAGFDRHITIFSPEGRLYQVEYAFKAINQGGLTSVAVRGKDCAVVVTQKKVPDKL  60

Query  265  LDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYEMPVDVLARWIAD  444
            LD  +VTHLF +T  +G + +G+TAD+R+ VQ+AR EAA ++++YGYE+PVD+L + IAD
Sbjct  61   LDAATVTHLFRITDNIGCVMSGMTADSRSQVQRARYEAANWQYKYGYEIPVDMLCKRIAD  120

Query  445  KSQVYTQHAYMRPLGVVAMILG  510
             SQVYTQ+A MRPLG   +++G
Sbjct  121  ISQVYTQNAEMRPLGCCMIVIG  142



>dbj|GAN03133.1| proteasome subunit alpha type-6 [Mucor ambiguus]
Length=246

 Score =   201 bits (510),  Expect = 6e-61, Method: Compositional matrix adjust.
 Identities = 90/142 (63%), Positives = 117/142 (82%), Gaps = 0/142 (0%)
 Frame = +1

Query  85   MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL  264
            MSRGSG GYDRHITIFSPEGRL+QVEYAFKA+  +GITS+GVRG+D   +VTQ+KVPDKL
Sbjct  1    MSRGSGAGYDRHITIFSPEGRLYQVEYAFKAISNSGITSVGVRGRDGCVIVTQRKVPDKL  60

Query  265  LDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYEMPVDVLARWIAD  444
            LD +++TH+F +T  +G + TG+ ADAR  V +AR EAAEFR++YGYE+P D+LA+ +A+
Sbjct  61   LDPSTITHVFKLTPKIGCVMTGMIADARAQVTKARQEAAEFRYKYGYEIPTDMLAKRVAN  120

Query  445  KSQVYTQHAYMRPLGVVAMILG  510
             +QVYTQ A MRP GV  +++G
Sbjct  121  INQVYTQQAAMRPYGVSMILVG  142



>ref|XP_008300217.1| PREDICTED: proteasome subunit alpha type-6 [Stegastes partitus]
Length=246

 Score =   200 bits (509),  Expect = 6e-61, Method: Compositional matrix adjust.
 Identities = 90/142 (63%), Positives = 117/142 (82%), Gaps = 0/142 (0%)
 Frame = +1

Query  85   MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL  264
            MSRGS  G+DRHITIFSPEGRL+QVEYAFKA+   G+TS+ VRGKD V +VTQKKVPDKL
Sbjct  1    MSRGSSAGFDRHITIFSPEGRLYQVEYAFKAINQGGLTSVAVRGKDCVVIVTQKKVPDKL  60

Query  265  LDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYEMPVDVLARWIAD  444
            LD  +VTHLF +T+ +G + TG+TAD R+ VQ+AR EAA ++++YGY++PVD+L + +AD
Sbjct  61   LDAMTVTHLFRITESIGCVMTGMTADGRSQVQRARYEAANWKYKYGYDIPVDMLCKRMAD  120

Query  445  KSQVYTQHAYMRPLGVVAMILG  510
             SQVYTQ+A MRPLG   +++G
Sbjct  121  ISQVYTQNAEMRPLGCCMIVVG  142



>ref|XP_003971508.1| PREDICTED: proteasome subunit alpha type-6-like [Takifugu rubripes]
Length=246

 Score =   200 bits (509),  Expect = 6e-61, Method: Compositional matrix adjust.
 Identities = 91/142 (64%), Positives = 116/142 (82%), Gaps = 0/142 (0%)
 Frame = +1

Query  85   MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL  264
            MSRGS  G+DRHITIFSPEGRL+QVEYAFKA+   G+TS+ VRGKD   VVTQKKVPDKL
Sbjct  1    MSRGSSAGFDRHITIFSPEGRLYQVEYAFKAINQGGLTSVAVRGKDCAVVVTQKKVPDKL  60

Query  265  LDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYEMPVDVLARWIAD  444
            LD  +VTHLF +T  +G + +G+TAD+R+ VQ+AR EAA ++++YGYE+PVD+L + IAD
Sbjct  61   LDAATVTHLFRITDNIGCVMSGMTADSRSQVQRARYEAANWQYKYGYEIPVDMLCKRIAD  120

Query  445  KSQVYTQHAYMRPLGVVAMILG  510
             SQVYTQ+A MRPLG   +++G
Sbjct  121  ISQVYTQNAEMRPLGCCMIVIG  142



>ref|XP_004559366.1| PREDICTED: proteasome subunit alpha type-6-like [Maylandia zebra]
Length=246

 Score =   200 bits (509),  Expect = 7e-61, Method: Compositional matrix adjust.
 Identities = 91/142 (64%), Positives = 115/142 (81%), Gaps = 0/142 (0%)
 Frame = +1

Query  85   MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL  264
            MSRGS  G+DRHITIFSPEGRL+QVEYAFKA+   G+TS+ VRGKD   VVTQKKVPDKL
Sbjct  1    MSRGSSAGFDRHITIFSPEGRLYQVEYAFKAINQGGLTSVAVRGKDCAVVVTQKKVPDKL  60

Query  265  LDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYEMPVDVLARWIAD  444
            LD  +VTHLF +T+ +G + TG+TAD R+ VQ+AR EAA + ++YGYE+PVD+L + +AD
Sbjct  61   LDAATVTHLFKITENIGCVMTGMTADGRSQVQRARYEAANWMYKYGYEVPVDMLCKRMAD  120

Query  445  KSQVYTQHAYMRPLGVVAMILG  510
             SQVYTQ+A MRPLG   +++G
Sbjct  121  ISQVYTQNAEMRPLGCCMIVIG  142



>ref|XP_003445487.1| PREDICTED: proteasome subunit alpha type-6-like [Oreochromis 
niloticus]
 ref|XP_005738779.1| PREDICTED: proteasome subunit alpha type-6-like [Pundamilia nyererei]
 ref|XP_005933943.1| PREDICTED: proteasome subunit alpha type-6-like [Haplochromis 
burtoni]
 ref|XP_006799416.1| PREDICTED: proteasome subunit alpha type-6-like [Neolamprologus 
brichardi]
Length=246

 Score =   200 bits (509),  Expect = 7e-61, Method: Compositional matrix adjust.
 Identities = 91/142 (64%), Positives = 115/142 (81%), Gaps = 0/142 (0%)
 Frame = +1

Query  85   MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL  264
            MSRGS  G+DRHITIFSPEGRL+QVEYAFKA+   G+TS+ VRGKD   VVTQKKVPDKL
Sbjct  1    MSRGSSAGFDRHITIFSPEGRLYQVEYAFKAINQGGLTSVAVRGKDCAVVVTQKKVPDKL  60

Query  265  LDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYEMPVDVLARWIAD  444
            LD  +VTHLF +T+ +G + TG+TAD R+ VQ+AR EAA + ++YGYE+PVD+L + +AD
Sbjct  61   LDAATVTHLFKITENIGCVMTGMTADGRSQVQRARYEAANWMYKYGYEVPVDMLCKRMAD  120

Query  445  KSQVYTQHAYMRPLGVVAMILG  510
             SQVYTQ+A MRPLG   +++G
Sbjct  121  ISQVYTQNAEMRPLGCCMIVIG  142



>ref|XP_010876681.1| PREDICTED: proteasome subunit alpha type-6 [Esox lucius]
Length=246

 Score =   200 bits (509),  Expect = 7e-61, Method: Compositional matrix adjust.
 Identities = 89/142 (63%), Positives = 118/142 (83%), Gaps = 0/142 (0%)
 Frame = +1

Query  85   MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL  264
            MSRGS  G+DRHITIFSPEGRL+QVEYAFKA+   G+TS+ VRGKD   VVTQKKVPDKL
Sbjct  1    MSRGSSAGFDRHITIFSPEGRLYQVEYAFKAINQGGLTSVAVRGKDCAVVVTQKKVPDKL  60

Query  265  LDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYEMPVDVLARWIAD  444
            LD ++VTHLF +T+ +G + +G+TAD+++ VQ+AR EAA ++++YGYE+PVD+L + +AD
Sbjct  61   LDASTVTHLFRITENIGCVMSGMTADSKSQVQRARYEAANWKYKYGYEIPVDMLCKRMAD  120

Query  445  KSQVYTQHAYMRPLGVVAMILG  510
             SQVYTQ+A MRPLG   +++G
Sbjct  121  ISQVYTQNAEMRPLGCCMIVIG  142



>ref|XP_005989234.1| PREDICTED: proteasome subunit alpha type-6 [Latimeria chalumnae]
Length=246

 Score =   200 bits (509),  Expect = 7e-61, Method: Compositional matrix adjust.
 Identities = 92/142 (65%), Positives = 117/142 (82%), Gaps = 0/142 (0%)
 Frame = +1

Query  85   MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL  264
            MSRGS  G+DRHITIFSPEGRL+QVEYAFKA+   G+TS+ VRGKD   VVTQKKVPDKL
Sbjct  1    MSRGSSAGFDRHITIFSPEGRLYQVEYAFKAINQGGLTSVAVRGKDCAVVVTQKKVPDKL  60

Query  265  LDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYEMPVDVLARWIAD  444
            LD  +VTHLF VT+ +G + TG+TAD+++ VQ+AR EAA ++++YGYE+PVD+L + IAD
Sbjct  61   LDAGTVTHLFRVTENIGCVMTGMTADSKSQVQRARYEAANWKYKYGYEIPVDMLCKRIAD  120

Query  445  KSQVYTQHAYMRPLGVVAMILG  510
             SQVYTQ+A MRPLG   +++G
Sbjct  121  ISQVYTQNAEMRPLGCCMILVG  142



>ref|XP_010741287.1| PREDICTED: proteasome subunit alpha type-6 [Larimichthys crocea]
Length=246

 Score =   200 bits (509),  Expect = 7e-61, Method: Compositional matrix adjust.
 Identities = 91/142 (64%), Positives = 116/142 (82%), Gaps = 0/142 (0%)
 Frame = +1

Query  85   MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL  264
            MSRGS  G+DRHITIFSPEGRL+QVEYAFKA+   G+TS+ VRGKD V VVTQKKVPDKL
Sbjct  1    MSRGSSAGFDRHITIFSPEGRLYQVEYAFKAINQGGLTSVAVRGKDCVVVVTQKKVPDKL  60

Query  265  LDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYEMPVDVLARWIAD  444
            LD  +VTHLF +T  +G + TG+TAD+++ VQ+AR EAA + ++YGYE+PVD+L + +AD
Sbjct  61   LDALTVTHLFRITDNIGCVMTGMTADSKSQVQRARYEAANWMYKYGYEIPVDMLCKRMAD  120

Query  445  KSQVYTQHAYMRPLGVVAMILG  510
             SQVYTQ+A MRPLG   +++G
Sbjct  121  ISQVYTQNAEMRPLGCCMIVIG  142



>gb|ACO51961.1| Proteasome subunit alpha type-6 [Rana catesbeiana]
Length=246

 Score =   200 bits (509),  Expect = 8e-61, Method: Compositional matrix adjust.
 Identities = 90/142 (63%), Positives = 117/142 (82%), Gaps = 0/142 (0%)
 Frame = +1

Query  85   MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL  264
            MSRGS  G+DRHITIFSPEGRL+QVEYAFKA+   G+TS+ VRGKD   VVTQKKVPDK 
Sbjct  1    MSRGSSAGFDRHITIFSPEGRLYQVEYAFKAINQGGLTSVAVRGKDCAIVVTQKKVPDKS  60

Query  265  LDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYEMPVDVLARWIAD  444
            LD ++V+HLF +T+ +G + TG+TAD+R+ VQ+AR EAA ++++YGYE+PVD+L + IAD
Sbjct  61   LDNSTVSHLFRITENIGCVMTGMTADSRSQVQRARYEAANWKYKYGYEIPVDMLCKRIAD  120

Query  445  KSQVYTQHAYMRPLGVVAMILG  510
             SQVYTQ+A MRPLG   +++G
Sbjct  121  ISQVYTQNAEMRPLGCCMILIG  142



>ref|XP_008398058.1| PREDICTED: proteasome subunit alpha type-6 [Poecilia reticulata]
Length=246

 Score =   200 bits (509),  Expect = 8e-61, Method: Compositional matrix adjust.
 Identities = 89/142 (63%), Positives = 116/142 (82%), Gaps = 0/142 (0%)
 Frame = +1

Query  85   MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL  264
            MSRGS  G+DRHITIFSPEGRL+QVEYAFKA+   G+TS+G+RGKD   +VTQKKVPDKL
Sbjct  1    MSRGSSAGFDRHITIFSPEGRLYQVEYAFKAINQGGMTSVGIRGKDCAVIVTQKKVPDKL  60

Query  265  LDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYEMPVDVLARWIAD  444
            LD ++VT LF +T  +G + TG+TAD+R+ VQ+AR EAA + ++YGYE+PVD+L + +AD
Sbjct  61   LDASTVTQLFKITDNIGCVMTGMTADSRSQVQRARYEAANWNYKYGYEIPVDMLCKRMAD  120

Query  445  KSQVYTQHAYMRPLGVVAMILG  510
             SQVYTQ+A MRPLG   +++G
Sbjct  121  ISQVYTQNAEMRPLGCCMVVIG  142



>ref|XP_011419593.1| PREDICTED: proteasome subunit alpha type-6 [Crassostrea gigas]
 gb|EKC40404.1| Proteasome subunit alpha type-6 [Crassostrea gigas]
Length=228

 Score =   199 bits (506),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 92/142 (65%), Positives = 115/142 (81%), Gaps = 0/142 (0%)
 Frame = +1

Query  85   MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL  264
            MSRGS  G+DRHITIFSPEGRL+QVEYAFKA+   G+TS+ +RGKD   VVTQKKVPDKL
Sbjct  1    MSRGSSAGFDRHITIFSPEGRLYQVEYAFKAINQGGLTSVAIRGKDCAVVVTQKKVPDKL  60

Query  265  LDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYEMPVDVLARWIAD  444
            LD  +VTHLF +T+ LG + TG+ AD+R+ VQ+AR EAA++++ YGYE+PVDVL + IAD
Sbjct  61   LDADTVTHLFQLTENLGCVMTGMVADSRSQVQRARYEAAKWKYNYGYEIPVDVLCKRIAD  120

Query  445  KSQVYTQHAYMRPLGVVAMILG  510
             SQVYTQ A MRPLG   +++G
Sbjct  121  ISQVYTQSAEMRPLGCSMIMVG  142



>gb|ESA18832.1| hypothetical protein GLOINDRAFT_344383 [Rhizophagus irregularis 
DAOM 181602]
 gb|EXX71315.1| proteasome core particle subunit alpha 1 [Rhizophagus irregularis 
DAOM 197198w]
Length=245

 Score =   200 bits (508),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 91/142 (64%), Positives = 119/142 (84%), Gaps = 1/142 (1%)
 Frame = +1

Query  85   MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL  264
            M+R S G YDRHITIFSPEGRL+QVEYAFKA+  +G+TS+GVRGKDSV +VTQKK+PDKL
Sbjct  1    MNRSSAG-YDRHITIFSPEGRLYQVEYAFKAISNSGVTSVGVRGKDSVVIVTQKKIPDKL  59

Query  265  LDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYEMPVDVLARWIAD  444
            LD ++VTH+F ++ Y+G + TG+ ADAR  V +AR EAAEFR+++GY MP D+LA+ +A+
Sbjct  60   LDPSTVTHMFQLSPYVGCVMTGLIADARAQVTRARQEAAEFRYKFGYYMPSDMLAKRVAN  119

Query  445  KSQVYTQHAYMRPLGVVAMILG  510
             +QVYTQHA MRPLGV  +++G
Sbjct  120  INQVYTQHAAMRPLGVSMILIG  141



>ref|XP_007576015.1| PREDICTED: proteasome subunit alpha type-6 [Poecilia formosa]
Length=246

 Score =   200 bits (508),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 90/142 (63%), Positives = 116/142 (82%), Gaps = 0/142 (0%)
 Frame = +1

Query  85   MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL  264
            MSRGS  G+DRHITIFSPEGRL+QVEYAFKA+   G+TS+G+RGKD   VVTQKKVPDKL
Sbjct  1    MSRGSSAGFDRHITIFSPEGRLYQVEYAFKAINQGGMTSVGIRGKDCAVVVTQKKVPDKL  60

Query  265  LDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYEMPVDVLARWIAD  444
            LD ++VT LF +T  +G + TG+TAD+R+ VQ+AR EAA + ++YGYE+PVD+L + +AD
Sbjct  61   LDASTVTQLFRITDNIGCVMTGMTADSRSQVQRARYEAANWNYKYGYEIPVDMLCKRMAD  120

Query  445  KSQVYTQHAYMRPLGVVAMILG  510
             SQVYTQ+A MRPLG   +++G
Sbjct  121  ISQVYTQNAEMRPLGCCMVVIG  142



>gb|ACQ58552.1| Proteasome subunit alpha type-6 [Anoplopoma fimbria]
Length=246

 Score =   200 bits (508),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 90/142 (63%), Positives = 116/142 (82%), Gaps = 0/142 (0%)
 Frame = +1

Query  85   MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL  264
            MSRGS  G+DRHITIFSPEGRL+QVEYAFKA+   G+TS+ VRGKD   VVTQKKVPDKL
Sbjct  1    MSRGSSAGFDRHITIFSPEGRLYQVEYAFKAINQGGLTSVAVRGKDCAIVVTQKKVPDKL  60

Query  265  LDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYEMPVDVLARWIAD  444
            LD  +VTHLF +T  +G + +G+TAD+R+ VQ+AR EAA ++++YGYE+PVD+L + +AD
Sbjct  61   LDSATVTHLFRITDNIGCVMSGMTADSRSQVQRARYEAANWKYKYGYEIPVDMLCKRLAD  120

Query  445  KSQVYTQHAYMRPLGVVAMILG  510
             SQVYTQ+A MRPLG   +++G
Sbjct  121  ISQVYTQNAEMRPLGCCMIMIG  142



>ref|XP_005562133.1| PREDICTED: proteasome subunit alpha type-6-like [Macaca fascicularis]
Length=245

 Score =   199 bits (506),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 91/142 (64%), Positives = 117/142 (82%), Gaps = 1/142 (1%)
 Frame = +1

Query  85   MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL  264
            MSRGS  G+DRHITIFSPEGRL+QVEYAFKA+   G+TS+ VRGKD   +VTQKKVPDKL
Sbjct  1    MSRGSSAGFDRHITIFSPEGRLYQVEYAFKAINQGGLTSVAVRGKDCAVIVTQKKVPDKL  60

Query  265  LDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYEMPVDVLARWIAD  444
            LD ++VTHLF +T+ +G + TG+TAD R+ VQ+AR EAA ++++YGYE+PVD+L + IAD
Sbjct  61   LDSSTVTHLFKITENIGCVMTGMTAD-RSQVQRARYEAANWKYKYGYEIPVDMLCKRIAD  119

Query  445  KSQVYTQHAYMRPLGVVAMILG  510
             SQVYTQ+A MRPLG   +++G
Sbjct  120  ISQVYTQNAEMRPLGCCMILIG  141



>ref|XP_007253021.1| PREDICTED: proteasome subunit alpha type-6-like isoform X1 [Astyanax 
mexicanus]
Length=288

 Score =   200 bits (509),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 90/142 (63%), Positives = 118/142 (83%), Gaps = 0/142 (0%)
 Frame = +1

Query  85   MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL  264
            MSRGS  G+DRHITIFSPEGRL+QVEYAFKA+   G+TS+ VRGKD   VVTQKKVPDKL
Sbjct  1    MSRGSSAGFDRHITIFSPEGRLYQVEYAFKAINQGGLTSVAVRGKDCAVVVTQKKVPDKL  60

Query  265  LDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYEMPVDVLARWIAD  444
            LD ++VTHLF +T+ +G + +G+TAD+R+ VQ+AR EAA ++++YG+E+PVD+L + IAD
Sbjct  61   LDSSTVTHLFRITESIGCVMSGMTADSRSQVQRARYEAANWQYKYGFEIPVDMLCKRIAD  120

Query  445  KSQVYTQHAYMRPLGVVAMILG  510
             SQVYTQ+A MRPLG   +++G
Sbjct  121  ISQVYTQNAEMRPLGCCMIVIG  142



>ref|XP_002824717.1| PREDICTED: proteasome subunit alpha type-6 isoform X2 [Pongo 
abelii]
Length=246

 Score =   199 bits (506),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 87/142 (61%), Positives = 117/142 (82%), Gaps = 0/142 (0%)
 Frame = +1

Query  85   MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL  264
            MSRGS  G+DRHITIFSPEGRL+QV+Y F+++   G+TS+ VRGKD   +VTQKKVPDKL
Sbjct  1    MSRGSSAGFDRHITIFSPEGRLYQVDYCFQSINQGGLTSVAVRGKDCAVIVTQKKVPDKL  60

Query  265  LDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYEMPVDVLARWIAD  444
            LD ++VTHLF +T+ +G + TG+TAD+R+ VQ+AR EAA ++++YGYE+PVD+L + IAD
Sbjct  61   LDSSTVTHLFKITENIGCVMTGMTADSRSQVQRARYEAANWKYKYGYEIPVDMLCKRIAD  120

Query  445  KSQVYTQHAYMRPLGVVAMILG  510
             SQVYTQ+A MRPLG   +++G
Sbjct  121  ISQVYTQNAEMRPLGCCMILIG  142



>ref|XP_006015430.1| PREDICTED: proteasome subunit alpha type-6 [Alligator sinensis]
Length=382

 Score =   203 bits (516),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 91/142 (64%), Positives = 119/142 (84%), Gaps = 0/142 (0%)
 Frame = +1

Query  85   MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL  264
            MSRGS  G+DRHITIFSPEGRL+QVEYAFKA+   G+TS+ VRGKDS  +VTQKKVPDKL
Sbjct  137  MSRGSSAGFDRHITIFSPEGRLYQVEYAFKAINQGGLTSVAVRGKDSAVIVTQKKVPDKL  196

Query  265  LDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYEMPVDVLARWIAD  444
            LD ++VTHLF +T+ +G + TG+TAD+R+ VQ+AR EAA ++++YGY++PVD+L + IAD
Sbjct  197  LDSSTVTHLFRITENIGCVMTGMTADSRSQVQRARYEAANWKYKYGYDIPVDMLCKRIAD  256

Query  445  KSQVYTQHAYMRPLGVVAMILG  510
             SQVYTQ+A MRPLG   +++G
Sbjct  257  ISQVYTQNAEMRPLGCCMILIG  278



>gb|ACH70968.1| proteasome (prosome, macropain) subunit, alpha type 6-2 [Salmo 
salar]
Length=246

 Score =   199 bits (505),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 89/142 (63%), Positives = 115/142 (81%), Gaps = 0/142 (0%)
 Frame = +1

Query  85   MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL  264
            MSRGS  G+DRHITIFSPEGRL+QVEYAFKA+   G+TS+ VRGKD   VVTQKKVPD L
Sbjct  1    MSRGSSAGFDRHITIFSPEGRLYQVEYAFKAINQGGLTSVAVRGKDCAVVVTQKKVPDTL  60

Query  265  LDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYEMPVDVLARWIAD  444
            LD ++VTHLF +T+ +G + +G+TAD ++ VQ+AR EAA + ++YGYE+PVD+L + IAD
Sbjct  61   LDSSTVTHLFRITENIGCVMSGMTADGKSQVQRARYEAANWNYKYGYEIPVDMLCKRIAD  120

Query  445  KSQVYTQHAYMRPLGVVAMILG  510
             SQVYTQ+A MRPLG   +++G
Sbjct  121  ISQVYTQNAEMRPLGCCMIVIG  142



>gb|ACH70967.1| proteasome (prosome, macropain) subunit, alpha type 6-1 [Salmo 
salar]
 gb|ACI66033.1| Proteasome subunit alpha type-6 [Salmo salar]
 gb|ACI70006.1| Proteasome subunit alpha type-6 [Salmo salar]
 emb|CDQ70650.1| unnamed protein product [Oncorhynchus mykiss]
Length=246

 Score =   199 bits (505),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 87/142 (61%), Positives = 118/142 (83%), Gaps = 0/142 (0%)
 Frame = +1

Query  85   MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL  264
            MSRGS  G+DRHITIFSPEGRL+QVEYAFKA+   G+TS+ +RG+D   VVTQKKVPDKL
Sbjct  1    MSRGSSAGFDRHITIFSPEGRLYQVEYAFKAINQGGLTSLAIRGQDCAVVVTQKKVPDKL  60

Query  265  LDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYEMPVDVLARWIAD  444
            LD ++VTHLF +T+ +G + +G+TAD+++ VQ+AR EAA ++++YGYE+PVD+L + +AD
Sbjct  61   LDASTVTHLFKITENIGCVMSGMTADSKSQVQRARYEAANWKYKYGYEIPVDMLCKRMAD  120

Query  445  KSQVYTQHAYMRPLGVVAMILG  510
             SQVYTQ+A MRPLG   +++G
Sbjct  121  ISQVYTQNAEMRPLGCCMIVIG  142



>ref|XP_010876973.1| PREDICTED: proteasome subunit alpha type-6 [Esox lucius]
Length=246

 Score =   198 bits (504),  Expect = 4e-60, Method: Compositional matrix adjust.
 Identities = 87/142 (61%), Positives = 118/142 (83%), Gaps = 0/142 (0%)
 Frame = +1

Query  85   MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL  264
            MSRGS  G+DRHITIFSPEGRL+QVEYAFKA+   G+TS+ +RG+D   VVTQKKVPDKL
Sbjct  1    MSRGSSAGFDRHITIFSPEGRLYQVEYAFKAINQGGLTSVAIRGQDCAVVVTQKKVPDKL  60

Query  265  LDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYEMPVDVLARWIAD  444
            LD ++VTHLF +T+ +G + +G+TAD+++ VQ+AR EAA ++++YGYE+PVD+L + +AD
Sbjct  61   LDASTVTHLFRITENIGCVMSGMTADSKSQVQRARYEAANWKYKYGYEIPVDMLCKRMAD  120

Query  445  KSQVYTQHAYMRPLGVVAMILG  510
             SQVYTQ+A MRPLG   +++G
Sbjct  121  ISQVYTQNAEMRPLGCCMIVIG  142



>gb|ACO08806.1| Proteasome subunit alpha type 6 [Oncorhynchus mykiss]
Length=246

 Score =   198 bits (504),  Expect = 4e-60, Method: Compositional matrix adjust.
 Identities = 87/142 (61%), Positives = 117/142 (82%), Gaps = 0/142 (0%)
 Frame = +1

Query  85   MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL  264
            MSRGS  G+DRHITIFSPEGRL+QVEYAFKA+   G+TS+ +RG+D   VVTQKKVPDKL
Sbjct  1    MSRGSSAGFDRHITIFSPEGRLYQVEYAFKAINQGGLTSLAIRGQDCAVVVTQKKVPDKL  60

Query  265  LDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYEMPVDVLARWIAD  444
            LD ++VTHLF  T+ +G + +G+TAD+++ VQ+AR EAA ++++YGYE+PVD+L + +AD
Sbjct  61   LDASTVTHLFKTTENIGCVMSGMTADSKSQVQRARCEAANWKYKYGYEIPVDMLCKRMAD  120

Query  445  KSQVYTQHAYMRPLGVVAMILG  510
             SQVYTQ+A MRPLG   +++G
Sbjct  121  ISQVYTQNAEMRPLGCCMIVIG  142



>gb|ACM08640.1| Proteasome subunit alpha type-6 [Salmo salar]
Length=246

 Score =   198 bits (504),  Expect = 5e-60, Method: Compositional matrix adjust.
 Identities = 89/142 (63%), Positives = 117/142 (82%), Gaps = 0/142 (0%)
 Frame = +1

Query  85   MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL  264
            MSRGS  G+DRHITIFSPEGRL+QVEYAFKA+   G+TS+ VRGKD   VVTQKKVPDK 
Sbjct  1    MSRGSSAGFDRHITIFSPEGRLYQVEYAFKAINQGGLTSVAVRGKDCAVVVTQKKVPDKP  60

Query  265  LDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYEMPVDVLARWIAD  444
            LD ++VTHLF +T+ +G + +G+TAD+++ VQ+AR EAA ++++YGYE+PVD+L + IAD
Sbjct  61   LDASTVTHLFRITENIGCVMSGMTADSKSQVQRARYEAANWKYKYGYEIPVDMLCKRIAD  120

Query  445  KSQVYTQHAYMRPLGVVAMILG  510
             SQVYTQ+A MRPLG   +++G
Sbjct  121  ISQVYTQNAEMRPLGCCMIVIG  142



>ref|XP_010777538.1| PREDICTED: proteasome subunit alpha type-6 [Notothenia coriiceps]
Length=246

 Score =   198 bits (504),  Expect = 5e-60, Method: Compositional matrix adjust.
 Identities = 89/142 (63%), Positives = 117/142 (82%), Gaps = 0/142 (0%)
 Frame = +1

Query  85   MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL  264
            MSRGS  G+DRHITIFSPEGRL+QVEYAFKA+   G+TS+ +RGKD   VVTQKKVPDKL
Sbjct  1    MSRGSSAGFDRHITIFSPEGRLYQVEYAFKAINQGGLTSVAIRGKDCAIVVTQKKVPDKL  60

Query  265  LDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYEMPVDVLARWIAD  444
            LD  +VTHLF +T ++G + +G+TAD+R+ VQ+AR EAA ++++YGYE+PVD+L + +AD
Sbjct  61   LDAGTVTHLFRITDHIGCVMSGMTADSRSQVQRARYEAANWQYKYGYEIPVDMLCKRLAD  120

Query  445  KSQVYTQHAYMRPLGVVAMILG  510
             SQVYTQ+A MRPLG   +++G
Sbjct  121  ISQVYTQNAEMRPLGCCMIMIG  142



>gb|AFK10987.1| proteasome subunit alpha type-6-like protein [Callorhinchus milii]
Length=246

 Score =   198 bits (503),  Expect = 6e-60, Method: Compositional matrix adjust.
 Identities = 89/142 (63%), Positives = 116/142 (82%), Gaps = 0/142 (0%)
 Frame = +1

Query  85   MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL  264
            MSRGS  G+DRHITIFSPEGRL+QVEYAFKA+   G+TS+ VRGKD   +VTQKKVPD+L
Sbjct  1    MSRGSSAGFDRHITIFSPEGRLYQVEYAFKAINQGGLTSVAVRGKDCAVIVTQKKVPDEL  60

Query  265  LDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYEMPVDVLARWIAD  444
            LD  +VTHLF +T+ +G + TG+TAD+R+ VQ+AR EAA ++++YGYE+PVD+L + IAD
Sbjct  61   LDANTVTHLFRITEKIGCVMTGMTADSRSQVQRARYEAANWKYKYGYEIPVDMLCKRIAD  120

Query  445  KSQVYTQHAYMRPLGVVAMILG  510
             SQVY Q+A MRPLG   +++G
Sbjct  121  ISQVYMQNAEMRPLGCCMILVG  142



>ref|XP_005842332.1| 20S proteasome subunit alpha type 6 [Guillardia theta CCMP2712]
 gb|EKX55352.1| 20S proteasome subunit alpha type 6 [Guillardia theta CCMP2712]
Length=252

 Score =   198 bits (503),  Expect = 6e-60, Method: Compositional matrix adjust.
 Identities = 94/147 (64%), Positives = 117/147 (80%), Gaps = 5/147 (3%)
 Frame = +1

Query  85   MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVP---  255
            MSR S  GYDR IT+FSPEGRL+Q+EYAFKAVKAAGIT++GVRG DSVC+VTQKKV    
Sbjct  1    MSRNSSSGYDRLITVFSPEGRLYQIEYAFKAVKAAGITTVGVRGADSVCIVTQKKVAQGH  60

Query  256  --DKLLDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYEMPVDVLA  429
              DKLLD +SVTH++ VT+ +G + TG  ADAR  +Q+ R EAA+FR++YGY+MP +VLA
Sbjct  61   SQDKLLDPSSVTHMYRVTETIGCVQTGHQADARAQIQRVRQEAAQFRYKYGYDMPPEVLA  120

Query  430  RWIADKSQVYTQHAYMRPLGVVAMILG  510
            + +AD +QVYTQHA MRP GV  M+ G
Sbjct  121  KRVADMNQVYTQHAGMRPYGVTMMLCG  147



>ref|XP_002679314.1| predicted protein [Naegleria gruberi]
 gb|EFC46570.1| predicted protein [Naegleria gruberi]
Length=255

 Score =   198 bits (504),  Expect = 6e-60, Method: Compositional matrix adjust.
 Identities = 93/142 (65%), Positives = 114/142 (80%), Gaps = 0/142 (0%)
 Frame = +1

Query  85   MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL  264
            MSRGS  GYDR IT+FSPEGRL+QVEYAFKAVK  GIT+IGVRGKDS C+VTQKKVPDKL
Sbjct  1    MSRGSSSGYDRFITVFSPEGRLYQVEYAFKAVKTPGITTIGVRGKDSCCIVTQKKVPDKL  60

Query  265  LDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYEMPVDVLARWIAD  444
            L   SVTH+F +T  +G + TG  ADAR  VQ+AR EAA F F++GYE+PV  LA+ +AD
Sbjct  61   LKAESVTHVFKITDRIGCVMTGRIADARVNVQRARYEAASFHFKFGYEIPVSYLAKRMAD  120

Query  445  KSQVYTQHAYMRPLGVVAMILG  510
             +Q++TQ+A +RP GVV M++G
Sbjct  121  NAQLFTQYAGIRPQGVVMMLIG  142



>ref|NP_705941.1| proteasome subunit alpha type-6 [Danio rerio]
 gb|AAK40122.1|AF354750_1 proteasome subunit alpha Type 6-A [Danio rerio]
Length=233

 Score =   197 bits (501),  Expect = 8e-60, Method: Compositional matrix adjust.
 Identities = 88/142 (62%), Positives = 117/142 (82%), Gaps = 0/142 (0%)
 Frame = +1

Query  85   MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL  264
            MSRGS  G+DRHITIFSPEGRL+QVEYAFKA+   G+TS+ VRGKD   V+TQ+KVPDKL
Sbjct  1    MSRGSSAGFDRHITIFSPEGRLYQVEYAFKAINQGGLTSVAVRGKDCAVVITQRKVPDKL  60

Query  265  LDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYEMPVDVLARWIAD  444
            LD ++VTHLF +T+ +G + +G+TAD+R+ VQ+AR EAA ++++YGYE+PV +L + IAD
Sbjct  61   LDSSTVTHLFRITENIGCVMSGMTADSRSQVQRARYEAANWKYKYGYEIPVGMLCKRIAD  120

Query  445  KSQVYTQHAYMRPLGVVAMILG  510
             SQVYTQ+A MRPLG   +++G
Sbjct  121  ISQVYTQNAEMRPLGCCMIVVG  142



>gb|KFH62604.1| proteasome subunit alpha type-6 [Mortierella verticillata NRRL 
6337]
Length=244

 Score =   197 bits (501),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 89/142 (63%), Positives = 120/142 (85%), Gaps = 2/142 (1%)
 Frame = +1

Query  85   MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL  264
            MSRG+G  YDRHIT+FSPEGRL+QVEYAFKA+  +GITSIGVRGKDS  +VTQ KVPDKL
Sbjct  1    MSRGAG--YDRHITVFSPEGRLYQVEYAFKAISNSGITSIGVRGKDSCVIVTQHKVPDKL  58

Query  265  LDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYEMPVDVLARWIAD  444
            LD +++ H++P+T  +G + TG+  DAR+ VQ+A++EAAEFR+++GYE+P D+LA+ +A+
Sbjct  59   LDASTIKHIYPLTPKIGCVMTGLVPDARSAVQRAQSEAAEFRYKFGYEIPPDMLAKRMAN  118

Query  445  KSQVYTQHAYMRPLGVVAMILG  510
             +QVYTQHA MRPLGV  +++G
Sbjct  119  INQVYTQHAAMRPLGVSMILIG  140



>gb|ACI69778.1| Proteasome subunit alpha type-6 [Salmo salar]
Length=246

 Score =   197 bits (500),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 86/142 (61%), Positives = 117/142 (82%), Gaps = 0/142 (0%)
 Frame = +1

Query  85   MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL  264
            MSRGS  G+DRHITIFSPEGRL+QVEYAFKA+   G+TS+ +RG+D   VVTQKKVPDKL
Sbjct  1    MSRGSSAGFDRHITIFSPEGRLYQVEYAFKAINQGGLTSLAIRGQDCAVVVTQKKVPDKL  60

Query  265  LDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYEMPVDVLARWIAD  444
            LD ++VTHLF +T+ +G + +G+ AD+++ VQ+AR EAA ++++YGYE+PVD+L + +AD
Sbjct  61   LDASTVTHLFKITENIGCVMSGMAADSKSQVQRARYEAANWKYKYGYEIPVDMLCKRMAD  120

Query  445  KSQVYTQHAYMRPLGVVAMILG  510
             SQVYTQ+A MRPLG   +++G
Sbjct  121  VSQVYTQNAEMRPLGCCMIVIG  142



>gb|ACI67177.1| Proteasome subunit alpha type-6 [Salmo salar]
Length=149

 Score =   193 bits (491),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 88/141 (62%), Positives = 112/141 (79%), Gaps = 0/141 (0%)
 Frame = +1

Query  85   MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL  264
            MSRGS  G+DRHITIFSPEGRL+QVEYAFKA+   G+TS+ VRGKD   VVTQKKVPD L
Sbjct  1    MSRGSSAGFDRHITIFSPEGRLYQVEYAFKAINQGGLTSVAVRGKDCAVVVTQKKVPDTL  60

Query  265  LDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYEMPVDVLARWIAD  444
            LD ++VTHLF +T+ +G + +G+TAD ++ VQ+AR EAA + ++YGYE+PVD+L + IAD
Sbjct  61   LDSSTVTHLFRITENIGCVMSGMTADGKSQVQRARYEAANWNYKYGYEIPVDMLCKRIAD  120

Query  445  KSQVYTQHAYMRPLGVVAMIL  507
             SQVYTQ+A MRPLG    + 
Sbjct  121  ISQVYTQNAEMRPLGCCKCMF  141



>ref|XP_003706429.1| PREDICTED: proteasome subunit alpha type-6-like [Megachile rotundata]
Length=246

 Score =   196 bits (499),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 89/142 (63%), Positives = 114/142 (80%), Gaps = 0/142 (0%)
 Frame = +1

Query  85   MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL  264
            M+RGS  G+DRHITIFSPEGRL+QVEYAFKA+  +G+TS+ V+G D+    TQKKVPDKL
Sbjct  1    MARGSSAGFDRHITIFSPEGRLYQVEYAFKAINQSGLTSVAVKGVDTAVFATQKKVPDKL  60

Query  265  LDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYEMPVDVLARWIAD  444
            LD +SVTH+F +T+++G L TG+ AD R+ VQ+AR EAA F+++Y YE+PVDVL R IAD
Sbjct  61   LDASSVTHIFQLTEHIGCLMTGMIADGRSQVQRARYEAANFKYKYEYEIPVDVLCRRIAD  120

Query  445  KSQVYTQHAYMRPLGVVAMILG  510
             SQVYTQ+A MRPLG   M++ 
Sbjct  121  ISQVYTQNAEMRPLGCSMMLIS  142



>gb|ACO08382.1| Proteasome subunit alpha type 6 [Oncorhynchus mykiss]
Length=246

 Score =   196 bits (499),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 86/142 (61%), Positives = 116/142 (82%), Gaps = 0/142 (0%)
 Frame = +1

Query  85   MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL  264
            MSRGS  G+DRHITIFSPEGRL+QVEYAFKA+   G+TS+ +RG+D   V TQKKVPDKL
Sbjct  1    MSRGSSAGFDRHITIFSPEGRLYQVEYAFKAINQGGLTSLAIRGQDCAVVATQKKVPDKL  60

Query  265  LDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYEMPVDVLARWIAD  444
            LD ++VTHLF +T+ +G + +G+TAD ++ VQ+AR EAA ++++YGYE+PVD+L + +AD
Sbjct  61   LDASTVTHLFKITENIGCVMSGMTADNKSQVQRARYEAANWKYKYGYEIPVDMLCKRMAD  120

Query  445  KSQVYTQHAYMRPLGVVAMILG  510
             SQVYTQ+A MRPLG   +++G
Sbjct  121  ISQVYTQNAEMRPLGCCMIVIG  142



>ref|XP_008311014.1| PREDICTED: proteasome subunit alpha type-6 [Cynoglossus semilaevis]
Length=246

 Score =   196 bits (499),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 89/142 (63%), Positives = 115/142 (81%), Gaps = 0/142 (0%)
 Frame = +1

Query  85   MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL  264
            MSRGS  G+DRHITIFSPEGRL+QVEYAFKA+   G+TS+ VRGKD   VVTQKKVPDKL
Sbjct  1    MSRGSSAGFDRHITIFSPEGRLYQVEYAFKAINQGGLTSVAVRGKDCAVVVTQKKVPDKL  60

Query  265  LDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYEMPVDVLARWIAD  444
            LD ++VTHLF +T  +G + +G+TAD+R+ VQ+AR EAA ++++YGYE+PVD+L + IAD
Sbjct  61   LDASTVTHLFRITDNIGCVMSGMTADSRSQVQRARYEAANWKYKYGYEIPVDMLCKRIAD  120

Query  445  KSQVYTQHAYMRPLGVVAMILG  510
             SQVYTQ+A  RPLG   +++ 
Sbjct  121  ISQVYTQNADKRPLGCCMIVIS  142



>gb|ACI66670.1| Proteasome subunit alpha type-6 [Salmo salar]
Length=208

 Score =   195 bits (495),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 86/142 (61%), Positives = 116/142 (82%), Gaps = 0/142 (0%)
 Frame = +1

Query  85   MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL  264
            MSRGS  G+DRHITIF PEGRL+QVEYAFKA    G+TS+ +RG+D   VVTQKKVPDKL
Sbjct  1    MSRGSSAGFDRHITIFPPEGRLYQVEYAFKATNQGGLTSLAIRGQDCAVVVTQKKVPDKL  60

Query  265  LDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYEMPVDVLARWIAD  444
            LD ++VTHLF +T+ +G + +G+TAD+++ VQ+AR EAA ++++YGYE+PVD+L + +AD
Sbjct  61   LDASTVTHLFKITENIGCVMSGMTADSKSQVQRARYEAANWKYKYGYEIPVDMLCKRMAD  120

Query  445  KSQVYTQHAYMRPLGVVAMILG  510
             SQVYTQ+A MRPLG   +++G
Sbjct  121  ISQVYTQNAEMRPLGCCMIVIG  142



>gb|ACI69799.1| Proteasome subunit alpha type-6 [Salmo salar]
Length=208

 Score =   194 bits (494),  Expect = 4e-59, Method: Compositional matrix adjust.
 Identities = 85/142 (60%), Positives = 117/142 (82%), Gaps = 0/142 (0%)
 Frame = +1

Query  85   MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL  264
            MSRGS  G+DRHITIFSPE RL+QVEYAFKA+   G+TS+ +RG++   VVTQKKVPDKL
Sbjct  1    MSRGSSAGFDRHITIFSPESRLYQVEYAFKAINQGGLTSLAIRGQECAVVVTQKKVPDKL  60

Query  265  LDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYEMPVDVLARWIAD  444
            LD ++VTHLF +T+ +G + +G+TAD+++ VQ+AR EAA ++++YGYE+PVD+L + +AD
Sbjct  61   LDASTVTHLFKITENIGCVMSGMTADSKSQVQRARYEAANWKYKYGYEIPVDMLCKRMAD  120

Query  445  KSQVYTQHAYMRPLGVVAMILG  510
             SQVYTQ+A MRPLG   +++G
Sbjct  121  ISQVYTQNAEMRPLGCCMIVIG  142



>ref|XP_002127869.1| PREDICTED: proteasome subunit alpha type-6-like isoform X1 [Ciona 
intestinalis]
Length=264

 Score =   196 bits (498),  Expect = 5e-59, Method: Compositional matrix adjust.
 Identities = 85/143 (59%), Positives = 116/143 (81%), Gaps = 0/143 (0%)
 Frame = +1

Query  82   KMSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDK  261
            KMSRGS  G+DRHITIFSPEGRL+QVEYAFKA+  +G+TS+GVRG +   ++TQKKVPDK
Sbjct  15   KMSRGSSAGFDRHITIFSPEGRLYQVEYAFKAINQSGLTSVGVRGDECCVLITQKKVPDK  74

Query  262  LLDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYEMPVDVLARWIA  441
            L+D T++TH+F +T  +G + TGI  D+++ VQ+ARNEA  ++++YGYE+PVD L + +A
Sbjct  75   LIDVTTITHMFQLTPNIGCMMTGIMGDSQSQVQRARNEATNWKYKYGYEIPVDALCKRMA  134

Query  442  DKSQVYTQHAYMRPLGVVAMILG  510
            D SQVYTQ+A MRPLG   +++G
Sbjct  135  DISQVYTQNAEMRPLGCSMILMG  157



>ref|XP_004637142.1| PREDICTED: proteasome subunit alpha type-6 [Octodon degus]
Length=244

 Score =   195 bits (496),  Expect = 6e-59, Method: Compositional matrix adjust.
 Identities = 90/142 (63%), Positives = 115/142 (81%), Gaps = 2/142 (1%)
 Frame = +1

Query  85   MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL  264
            MSRGS  G+DRHITIFSPEGRL+QVEYAFKA+   G+TS+ VRGKD   +VTQKKVPDKL
Sbjct  1    MSRGSSAGFDRHITIFSPEGRLYQVEYAFKAINQGGLTSVAVRGKDCAVIVTQKKVPDKL  60

Query  265  LDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYEMPVDVLARWIAD  444
            LD ++VTHLF +T+ +G + TG+TAD+R+ VQ+AR EAA   ++Y YE+PVD+L + IAD
Sbjct  61   LDSSTVTHLFKITENIGCVMTGMTADSRSQVQRARYEAA--NWKYNYEIPVDMLCKRIAD  118

Query  445  KSQVYTQHAYMRPLGVVAMILG  510
             SQVYTQ+A MRPLG   +++G
Sbjct  119  ISQVYTQNAEMRPLGCCMILIG  140



>ref|XP_011314423.1| PREDICTED: proteasome subunit alpha type-6-like [Fopius arisanus]
Length=246

 Score =   195 bits (496),  Expect = 7e-59, Method: Compositional matrix adjust.
 Identities = 89/141 (63%), Positives = 115/141 (82%), Gaps = 1/141 (1%)
 Frame = +1

Query  85   MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL  264
            M+RGS  G+DRHITIFSPEGRL+QVEYAFKA+   G+TS+ V+G D+    TQKKVPDKL
Sbjct  1    MARGSSAGFDRHITIFSPEGRLYQVEYAFKAINQGGLTSVAVKGCDTAVFATQKKVPDKL  60

Query  265  LDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYEMPVDVLARWIAD  444
            LD +SVTH+F +T+Y+G + TG+ AD+++ VQ+AR EAA F+++YGYE+P+D L R IAD
Sbjct  61   LDASSVTHVFQLTEYIGCVMTGMIADSKSQVQRARYEAANFKYKYGYEIPIDTLCRRIAD  120

Query  445  KSQVYTQHAYMRPLGVVAMIL  507
             SQVYTQ+A MRPLG  +MIL
Sbjct  121  ISQVYTQNAEMRPLG-CSMIL  140



>ref|XP_009019631.1| hypothetical protein HELRODRAFT_106545 [Helobdella robusta]
 gb|ESO02223.1| hypothetical protein HELRODRAFT_106545 [Helobdella robusta]
Length=247

 Score =   195 bits (495),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 87/142 (61%), Positives = 116/142 (82%), Gaps = 0/142 (0%)
 Frame = +1

Query  85   MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL  264
            MSRG+  G+DRHITIFSPEGRL+QVEYAFKA+  AG+TS+ +RG DS  VV+QKK+PDKL
Sbjct  1    MSRGNSAGFDRHITIFSPEGRLYQVEYAFKAINQAGMTSVAIRGVDSAVVVSQKKIPDKL  60

Query  265  LDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYEMPVDVLARWIAD  444
            LD ++VTHLF +T+ +G + TG+ AD++  VQ+AR EAA ++++YGY++PVD+L + IAD
Sbjct  61   LDPSTVTHLFTLTETIGCVMTGMLADSKYQVQRARYEAANWKYKYGYDIPVDMLCKRIAD  120

Query  445  KSQVYTQHAYMRPLGVVAMILG  510
             SQVYTQ A MRPLG   M++G
Sbjct  121  ISQVYTQSAEMRPLGCTMMLIG  142



>ref|XP_003393493.1| PREDICTED: proteasome subunit alpha type-6-like [Bombus terrestris]
 ref|XP_003489017.1| PREDICTED: proteasome subunit alpha type-6-like [Bombus impatiens]
Length=246

 Score =   195 bits (495),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 88/142 (62%), Positives = 113/142 (80%), Gaps = 0/142 (0%)
 Frame = +1

Query  85   MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL  264
            M+RGS  G+DRHITIFSPEGRL+QVEYAFKA+   G+TS+ V+G D+    TQKKVPDKL
Sbjct  1    MARGSSAGFDRHITIFSPEGRLYQVEYAFKAINQGGLTSVAVKGVDTAVFATQKKVPDKL  60

Query  265  LDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYEMPVDVLARWIAD  444
            LD +SVTH+F +T+++G L TG+ AD+R+ VQ+AR EAA F+++Y YE+PVD L R IAD
Sbjct  61   LDASSVTHIFQLTEHIGCLVTGMIADSRSQVQRARYEAAHFKYKYEYEIPVDALCRRIAD  120

Query  445  KSQVYTQHAYMRPLGVVAMILG  510
             SQVYTQ+A MRPLG   M++ 
Sbjct  121  ISQVYTQNAEMRPLGCSMMLIS  142



>ref|XP_011151114.1| PREDICTED: proteasome subunit alpha type-6-like [Harpegnathos 
saltator]
 gb|EFN76820.1| Proteasome subunit alpha type-6 [Harpegnathos saltator]
Length=246

 Score =   194 bits (494),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 87/142 (61%), Positives = 114/142 (80%), Gaps = 0/142 (0%)
 Frame = +1

Query  85   MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL  264
            M+RGS  G+DRHITIFSPEGRL+QVEYAFKA+   G+TS+ V+G D+    TQKKVPDKL
Sbjct  1    MARGSSAGFDRHITIFSPEGRLYQVEYAFKAINQGGLTSVAVKGVDTAVFATQKKVPDKL  60

Query  265  LDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYEMPVDVLARWIAD  444
            LD +SVTH+F +T+Y+G + TG+ AD+R+ VQ+AR EAA F+++YGYE+PVD L + +AD
Sbjct  61   LDASSVTHVFHLTEYIGCVMTGMIADSRSQVQRARYEAAHFKYKYGYEIPVDALCQRVAD  120

Query  445  KSQVYTQHAYMRPLGVVAMILG  510
             SQVYTQ+A MRPLG   M++ 
Sbjct  121  ISQVYTQNAEMRPLGCSMMLIA  142



>ref|XP_001843247.1| proteasome subunit alpha type 6 [Culex quinquefasciatus]
 gb|EDS31306.1| proteasome subunit alpha type 6 [Culex quinquefasciatus]
Length=246

 Score =   194 bits (493),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 88/142 (62%), Positives = 114/142 (80%), Gaps = 0/142 (0%)
 Frame = +1

Query  85   MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL  264
            MSRGS  G+DRHITIFSPEGRL+QVEYAFKA+   G+TSI ++GKD   V TQKK+PDKL
Sbjct  1    MSRGSSAGFDRHITIFSPEGRLYQVEYAFKAINQEGLTSIAMKGKDVAVVATQKKIPDKL  60

Query  265  LDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYEMPVDVLARWIAD  444
            +D ++VTHL+ +T+ +G + TG  AD+++ VQ+AR EAA +R++YGYEMPVDVL R +AD
Sbjct  61   IDPSTVTHLYRLTRNIGCVMTGRIADSKSQVQRARYEAANWRYKYGYEMPVDVLCRRMAD  120

Query  445  KSQVYTQHAYMRPLGVVAMILG  510
             SQVYTQ+A MRPLG   M++ 
Sbjct  121  ISQVYTQNAEMRPLGCSMMLIA  142



>ref|XP_009860960.1| PREDICTED: proteasome subunit alpha type-6-like isoform X2 [Ciona 
intestinalis]
Length=249

 Score =   194 bits (494),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 84/142 (59%), Positives = 115/142 (81%), Gaps = 0/142 (0%)
 Frame = +1

Query  85   MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL  264
            MSRGS  G+DRHITIFSPEGRL+QVEYAFKA+  +G+TS+GVRG +   ++TQKKVPDKL
Sbjct  1    MSRGSSAGFDRHITIFSPEGRLYQVEYAFKAINQSGLTSVGVRGDECCVLITQKKVPDKL  60

Query  265  LDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYEMPVDVLARWIAD  444
            +D T++TH+F +T  +G + TGI  D+++ VQ+ARNEA  ++++YGYE+PVD L + +AD
Sbjct  61   IDVTTITHMFQLTPNIGCMMTGIMGDSQSQVQRARNEATNWKYKYGYEIPVDALCKRMAD  120

Query  445  KSQVYTQHAYMRPLGVVAMILG  510
             SQVYTQ+A MRPLG   +++G
Sbjct  121  ISQVYTQNAEMRPLGCSMILMG  142



>ref|XP_007873808.1| hypothetical protein PNEG_01835 [Pneumocystis murina B123]
 gb|EMR10086.1| hypothetical protein PNEG_01835 [Pneumocystis murina B123]
Length=254

 Score =   194 bits (494),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 88/142 (62%), Positives = 116/142 (82%), Gaps = 0/142 (0%)
 Frame = +1

Query  85   MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL  264
            MSRGS  GYDRHITIFSPEGRL+QVEYAFK+V + GITS+ ++GKDSV  ++QKKVPDKL
Sbjct  1    MSRGSSTGYDRHITIFSPEGRLYQVEYAFKSVNSTGITSVAIKGKDSVVFISQKKVPDKL  60

Query  265  LDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYEMPVDVLARWIAD  444
            +DQ SV+++F +T+ +G L TG  ADAR  V +AR EAA+F+++YGYE+PVDVLA+ IA+
Sbjct  61   IDQDSVSYIFRITENIGCLVTGQIADARASVNRARVEAADFKYKYGYEIPVDVLAKRIAN  120

Query  445  KSQVYTQHAYMRPLGVVAMILG  510
             +QV TQ A MRPLG+ ++ + 
Sbjct  121  INQVCTQRAAMRPLGISSIFIA  142



>ref|XP_001640650.1| predicted protein [Nematostella vectensis]
 gb|EDO48587.1| predicted protein [Nematostella vectensis]
Length=246

 Score =   194 bits (493),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 87/142 (61%), Positives = 116/142 (82%), Gaps = 0/142 (0%)
 Frame = +1

Query  85   MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL  264
            MSRG+  G+DRHITIFSPEGRL+QVEYAFKA+   G+TS+G+RG DS  VVTQKKVPDKL
Sbjct  1    MSRGTSAGFDRHITIFSPEGRLYQVEYAFKAINQGGLTSVGIRGADSAVVVTQKKVPDKL  60

Query  265  LDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYEMPVDVLARWIAD  444
            LD  +VT LF +++ +G + TG+ AD+R+ VQ+AR EAA +++++GYE+PVD+L + IAD
Sbjct  61   LDSNTVTQLFELSERIGCVMTGMVADSRSQVQRARYEAANWKYKFGYEIPVDMLCKRIAD  120

Query  445  KSQVYTQHAYMRPLGVVAMILG  510
             SQVYTQ+A MRPLG   +++G
Sbjct  121  ISQVYTQNAEMRPLGCGMILIG  142



>ref|XP_003388491.1| PREDICTED: proteasome subunit alpha type-6-like [Amphimedon queenslandica]
Length=246

 Score =   194 bits (493),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 87/142 (61%), Positives = 115/142 (81%), Gaps = 0/142 (0%)
 Frame = +1

Query  85   MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL  264
            MSRGS  G+DR ITIFSPEGRL+QVEYAFKA+   G TSIGV+G +S  V+TQKKVPDKL
Sbjct  1    MSRGSSAGFDRFITIFSPEGRLYQVEYAFKAIAQTGSTSIGVKGTNSAVVITQKKVPDKL  60

Query  265  LDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYEMPVDVLARWIAD  444
            LD  S+THLF +T  +G + TG+TAD+R  V++AR+EAAEF++RYGY+MPVD + + +AD
Sbjct  61   LDPDSITHLFKITDTVGCVMTGMTADSRAQVKRARHEAAEFKYRYGYDMPVDAVCKRMAD  120

Query  445  KSQVYTQHAYMRPLGVVAMILG  510
             +Q+YTQ+A+MRP G   +++G
Sbjct  121  IAQIYTQNAFMRPYGCSMILIG  142



>gb|ELW63324.1| Proteasome subunit alpha type-6 [Tupaia chinensis]
Length=179

 Score =   192 bits (487),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 87/142 (61%), Positives = 113/142 (80%), Gaps = 0/142 (0%)
 Frame = +1

Query  85   MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL  264
            MSRGS  G+DRHI IFSPEG L+QVEY FKA    G+TS+ VRGKD   +VTQKKVPDKL
Sbjct  1    MSRGSSAGFDRHIAIFSPEGWLYQVEYVFKATNQGGLTSVAVRGKDCAVIVTQKKVPDKL  60

Query  265  LDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYEMPVDVLARWIAD  444
            LD ++VTHLF +T+ +G + TG+TAD+R+ VQ+AR EAA ++++YGYE+PVD+L + IAD
Sbjct  61   LDSSTVTHLFKITENIGSVMTGMTADSRSQVQRARYEAANWKYKYGYEIPVDMLCKRIAD  120

Query  445  KSQVYTQHAYMRPLGVVAMILG  510
             S VYTQ+A MRPLG   +++G
Sbjct  121  ISHVYTQNAEMRPLGCCMILIG  142



>ref|XP_968655.1| PREDICTED: proteasome subunit alpha type-6 [Tribolium castaneum]
 gb|EEZ98185.1| hypothetical protein TcasGA2_TC000614 [Tribolium castaneum]
Length=246

 Score =   194 bits (492),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 85/142 (60%), Positives = 115/142 (81%), Gaps = 0/142 (0%)
 Frame = +1

Query  85   MSRGSGGGYDRHITIFSPEGRLFQVEYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKL  264
            MSRGS  G+DRHITIFSPEGRL+QVEYAFKA+  AG+TS+ ++G DS   VTQ+K+PDKL
Sbjct  1    MSRGSSAGFDRHITIFSPEGRLYQVEYAFKAINQAGLTSVALKGVDSAVCVTQRKIPDKL  60

Query  265  LDQTSVTHLFPVTKYLGLLATGITADARTLVQQARNEAAEFRFRYGYEMPVDVLARWIAD  444
            +D  ++THLF +T+  G + TG+ AD+++ VQ+AR EAA+F+++YGYEMP+D L R +AD
Sbjct  61   IDAATITHLFQLTESSGCVMTGMIADSKSQVQRARYEAAQFKYKYGYEMPIDSLCRRVAD  120

Query  445  KSQVYTQHAYMRPLGVVAMILG  510
             SQVYTQ+A MRPLG   +++G
Sbjct  121  ISQVYTQNAEMRPLGCSMVLIG  142



>ref|XP_002500811.1| predicted protein [Micromonas sp. RCC299]
 gb|ACO62069.1| predicted protein [Micromonas sp. RCC299]
Length=291

 Score =   195 bits (496),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 100/184 (54%), Positives = 118/184 (64%), Gaps = 42/184 (23%)
 Frame = +1

Query  85   MSRGSGGGYDRHITIFSPEGRLFQV-----------------------------------  159
            MSRGSG GYDRHITIFSPEGRL+QV                                   
Sbjct  1    MSRGSGAGYDRHITIFSPEGRLYQVGASRPEPAWRRRPNPPRPIIPSLFTPARIARLTGD  60

Query  160  -------EYAFKAVKAAGITSIGVRGKDSVCVVTQKKVPDKLLDQTSVTHLFPVTKYLGL  318
                   EYAFKA+K+ G+TSIGVRGKDSVCVVTQKK+PDKLLD T +TH+F +TK +GL
Sbjct  61   PVPFPPSEYAFKAIKSVGVTSIGVRGKDSVCVVTQKKIPDKLLDPTDITHMFKITKTIGL  120

Query  319  LATGITADARTLVQQARNEAAEFRFRYGYEMPVDVLARWIADKSQVYTQHAYMRPLGVVA  498
             ATG   D R +VQ+AR+ AAEFR  YGYE+PVD L+  +AD  QVYTQHAYMRP+  + 
Sbjct  121  CATGKLPDIRNVVQKARHTAAEFRHEYGYEIPVDYLSCKLADWFQVYTQHAYMRPMAAMC  180

Query  499  MILG  510
            M +G
Sbjct  181  MFVG  184



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 557408213115