BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFF037J19

Length=534
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_010102341.1|  2-oxoglutarate/malate translocator                 125   3e-30   Morus notabilis
ref|XP_009609674.1|  PREDICTED: dicarboxylate transporter 1, chlo...    125   3e-30   Nicotiana tomentosiformis
ref|XP_006361749.1|  PREDICTED: dicarboxylate transporter 1, chlo...    124   9e-30   Solanum tuberosum [potatoes]
ref|XP_004250945.1|  PREDICTED: dicarboxylate transporter 1, chlo...    124   9e-30   Solanum lycopersicum
gb|EYU31365.1|  hypothetical protein MIMGU_mgv1a003738mg                123   1e-29   Erythranthe guttata [common monkey flower]
ref|XP_009777235.1|  PREDICTED: dicarboxylate transporter 1, chlo...    122   2e-29   Nicotiana sylvestris
gb|EYU46260.1|  hypothetical protein MIMGU_mgv1a003794mg                122   3e-29   Erythranthe guttata [common monkey flower]
ref|XP_002282809.1|  PREDICTED: dicarboxylate transporter 1, chlo...    122   3e-29   Vitis vinifera
ref|XP_004162089.1|  PREDICTED: dicarboxylate transporter 1, chlo...    122   3e-29   
ref|XP_004142115.1|  PREDICTED: dicarboxylate transporter 1, chlo...    122   4e-29   Cucumis sativus [cucumbers]
ref|XP_007015045.1|  Dicarboxylate transporter 1 isoform 1              122   4e-29   
ref|XP_008449718.1|  PREDICTED: dicarboxylate transporter 1, chlo...    122   5e-29   Cucumis melo [Oriental melon]
gb|KJB35803.1|  hypothetical protein B456_006G129000                    121   6e-29   Gossypium raimondii
gb|KHG21220.1|  2-oxoglutarate/malate translocator, chloroplastic       121   6e-29   Gossypium arboreum [tree cotton]
ref|XP_010536081.1|  PREDICTED: dicarboxylate transporter 1, chlo...    121   6e-29   
ref|NP_001119216.1|  dicarboxylate transporter 1                        121   8e-29   Arabidopsis thaliana [mouse-ear cress]
ref|NP_568283.2|  dicarboxylate transporter 1                           121   8e-29   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009375074.1|  PREDICTED: dicarboxylate transporter 1, chlo...    122   8e-29   
ref|XP_008363620.1|  PREDICTED: dicarboxylate transporter 1, chlo...    121   1e-28   
ref|XP_009343722.1|  PREDICTED: dicarboxylate transporter 1, chlo...    121   1e-28   Pyrus x bretschneideri [bai li]
ref|XP_010031793.1|  PREDICTED: dicarboxylate transporter 1, chlo...    121   1e-28   
ref|XP_008227299.1|  PREDICTED: dicarboxylate transporter 1, chlo...    120   1e-28   Prunus mume [ume]
ref|XP_007211882.1|  hypothetical protein PRUPE_ppa003549mg             120   1e-28   Prunus persica
gb|KDP22090.1|  hypothetical protein JCGZ_25921                         120   1e-28   Jatropha curcas
ref|XP_006399771.1|  hypothetical protein EUTSA_v10013154mg             120   2e-28   Eutrema salsugineum [saltwater cress]
ref|XP_007015047.1|  Dicarboxylate transporter 1 isoform 3              119   2e-28   
ref|XP_010257247.1|  PREDICTED: dicarboxylate transporter 1, chlo...    120   2e-28   Nelumbo nucifera [Indian lotus]
ref|XP_011080429.1|  PREDICTED: dicarboxylate transporter 1, chlo...    119   2e-28   Sesamum indicum [beniseed]
sp|Q41364.1|DIT1_SPIOL  RecName: Full=Dicarboxylate transporter 1...    120   3e-28   Spinacia oleracea
ref|XP_002873582.1|  hypothetical protein ARALYDRAFT_909232             119   3e-28   Arabidopsis lyrata subsp. lyrata
ref|XP_004291789.1|  PREDICTED: dicarboxylate transporter 1, chlo...    120   3e-28   Fragaria vesca subsp. vesca
ref|XP_006287403.1|  hypothetical protein CARUB_v10000609mg             119   3e-28   Capsella rubella
ref|XP_009394734.1|  PREDICTED: dicarboxylate transporter 1, chlo...    119   5e-28   Musa acuminata subsp. malaccensis [pisang utan]
gb|KFK25523.1|  hypothetical protein AALP_AA8G126300                    119   5e-28   Arabis alpina [alpine rockcress]
emb|CDP12268.1|  unnamed protein product                                119   8e-28   Coffea canephora [robusta coffee]
ref|XP_011025529.1|  PREDICTED: dicarboxylate transporter 1, chlo...    118   9e-28   Populus euphratica
gb|EPS73843.1|  hypothetical protein M569_00906                         117   9e-28   Genlisea aurea
ref|XP_010419844.1|  PREDICTED: dicarboxylate transporter 1, chlo...    118   1e-27   Camelina sativa [gold-of-pleasure]
ref|XP_010453336.1|  PREDICTED: dicarboxylate transporter 1, chlo...    118   1e-27   Camelina sativa [gold-of-pleasure]
dbj|BAK00367.1|  predicted protein                                      118   1e-27   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_010453335.1|  PREDICTED: dicarboxylate transporter 1, chlo...    118   1e-27   Camelina sativa [gold-of-pleasure]
ref|XP_002513507.1|  2-oxoglutarate/malate translocator, chloropl...    118   1e-27   Ricinus communis
ref|XP_009348953.1|  PREDICTED: dicarboxylate transporter 1, chlo...    118   1e-27   Pyrus x bretschneideri [bai li]
ref|XP_010492022.1|  PREDICTED: dicarboxylate transporter 1, chlo...    118   1e-27   Camelina sativa [gold-of-pleasure]
emb|CDY53969.1|  BnaA10g30010D                                          117   2e-27   Brassica napus [oilseed rape]
ref|XP_009121830.1|  PREDICTED: dicarboxylate transporter 1, chlo...    117   2e-27   Brassica rapa
ref|XP_009366121.1|  PREDICTED: dicarboxylate transporter 1, chlo...    118   2e-27   
emb|CDX97208.1|  BnaC09g44170D                                          117   2e-27   
ref|XP_002313335.2|  hypothetical protein POPTR_0009s05850g             115   2e-27   
ref|XP_006446115.1|  hypothetical protein CICLE_v10014769mg             117   3e-27   Citrus clementina [clementine]
ref|XP_004507091.1|  PREDICTED: dicarboxylate transporter 1, chlo...    116   4e-27   Cicer arietinum [garbanzo]
ref|XP_011045437.1|  PREDICTED: dicarboxylate transporter 1, chlo...    116   5e-27   Populus euphratica
ref|XP_008801951.1|  PREDICTED: dicarboxylate transporter 1, chlo...    115   1e-26   Phoenix dactylifera
ref|XP_009411283.1|  PREDICTED: dicarboxylate transporter 1, chlo...    115   1e-26   Musa acuminata subsp. malaccensis [pisang utan]
ref|NP_001066885.1|  Os12g0515400                                       114   2e-26   
ref|XP_010931014.1|  PREDICTED: LOW QUALITY PROTEIN: dicarboxylat...    114   3e-26   
ref|XP_007132020.1|  hypothetical protein PHAVU_011G059900g             114   3e-26   Phaseolus vulgaris [French bean]
ref|XP_002442229.1|  hypothetical protein SORBIDRAFT_08g016630          114   3e-26   Sorghum bicolor [broomcorn]
ref|XP_002299910.2|  hypothetical protein POPTR_0001s26580g             114   3e-26   Populus trichocarpa [western balsam poplar]
gb|KEH30210.1|  2-oxoglutarate/malate translocator                      114   4e-26   Medicago truncatula
ref|XP_011006198.1|  PREDICTED: dicarboxylate transporter 1, chlo...    114   5e-26   Populus euphratica
ref|XP_008344435.1|  PREDICTED: LOW QUALITY PROTEIN: dicarboxylat...    112   6e-26   
ref|XP_007015046.1|  Dicarboxylate transporter 1 isoform 2              112   7e-26   
ref|NP_001105570.1|  LOC542560                                          113   8e-26   Zea mays [maize]
ref|XP_003537966.1|  PREDICTED: dicarboxylate transporter 1, chlo...    113   8e-26   Glycine max [soybeans]
ref|XP_003575954.1|  PREDICTED: LOW QUALITY PROTEIN: dicarboxylat...    113   8e-26   
gb|ABK24751.1|  unknown                                                 112   1e-25   Picea sitchensis
emb|CAX65044.1|  plastidic 2-oxoglutarate/malate translocator           109   6e-25   Pisum sativum [garden pea]
ref|XP_010673637.1|  PREDICTED: dicarboxylate transporter 1, chlo...    110   1e-24   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_003539493.1|  PREDICTED: dicarboxylate transporter 1, chlo...    108   4e-24   Glycine max [soybeans]
ref|XP_004964101.1|  PREDICTED: dicarboxylate transporter 1, chlo...    100   2e-21   
emb|CAN74406.1|  hypothetical protein VITISV_043636                   97.4    6e-21   Vitis vinifera
ref|XP_001700411.1|  chloroplast oxoglutarate-malate translocator     84.0    2e-15   Chlamydomonas reinhardtii
ref|XP_001700410.1|  oxoglutarate:malate antiporter                   83.6    2e-15   Chlamydomonas reinhardtii
ref|XP_005650106.1|  oxoglutarate:malate antiporter                   82.4    4e-15   Coccomyxa subellipsoidea C-169
ref|XP_002507903.1|  divalent Anion:Na+ symporter family              81.6    1e-14   Micromonas commoda
ref|WP_038563803.1|  2-oxoglutarate translocator                      80.9    2e-14   Terribacillus goriensis
ref|XP_005843613.1|  hypothetical protein CHLNCDRAFT_140201           79.7    4e-14   Chlorella variabilis
ref|XP_007512423.1|  2-oxoglutarate/malate translocator               79.3    7e-14   Bathycoccus prasinos
ref|WP_025601890.1|  hypothetical protein                             73.9    8e-14   
ref|XP_002955862.1|  hypothetical protein VOLCADRAFT_106989           78.6    1e-13   Volvox carteri f. nagariensis
ref|WP_032858509.1|  2-oxoglutarate translocator                      77.8    2e-13   Bacillus
ref|WP_015417012.1|  MULTISPECIES: 2-oxoglutarate/malate transporter  77.8    2e-13   Bacillales
ref|WP_013351349.1|  MULTISPECIES: 2-oxoglutarate translocator        77.8    2e-13   Bacillus subtilis group
ref|WP_007408966.1|  MULTISPECIES: 2-oxoglutarate translocator        77.8    2e-13   Bacillus
ref|WP_042634956.1|  2-oxoglutarate translocator                      77.4    2e-13   Bacillus amyloliquefaciens
ref|WP_003155645.1|  MULTISPECIES: 2-oxoglutarate translocator        77.4    2e-13   Bacillus
ref|WP_038829541.1|  2-oxoglutarate translocator                      77.4    2e-13   Bacillus subtilis
ref|XP_009774993.1|  PREDICTED: dicarboxylate transporter 2.1, ch...  77.8    2e-13   Nicotiana sylvestris
ref|XP_009624586.1|  PREDICTED: dicarboxylate transporter 2.1, ch...  77.8    2e-13   Nicotiana tomentosiformis
ref|WP_036800605.1|  2-oxoglutarate translocator                      77.0    3e-13   
ref|WP_010333359.1|  2-oxoglutarate translocator                      77.0    3e-13   Bacillus mojavensis
ref|WP_024572847.1|  2-oxoglutarate translocator                      77.0    3e-13   Bacillus
ref|WP_015383080.1|  MULTISPECIES: 2-oxoglutarate/malate transporter  77.0    3e-13   Bacillus
ref|WP_013390434.1|  MULTISPECIES: 2-oxoglutarate translocator        77.0    3e-13   Bacillus subtilis group
ref|WP_010787924.1|  2-oxoglutarate/malate translocator               77.0    3e-13   Bacillus atrophaeus
ref|WP_041057032.1|  2-oxoglutarate translocator                      77.0    3e-13   Bacillus subtilis
gb|KIN32538.1|  hypothetical protein B4069_0846                       77.0    3e-13   Bacillus subtilis
ref|WP_039076181.1|  2-oxoglutarate translocator                      77.0    3e-13   Bacillus
ref|WP_041906771.1|  MULTISPECIES: 2-oxoglutarate translocator        77.0    3e-13   Bacillus subtilis
ref|WP_019713597.1|  2-oxoglutarate translocator                      77.0    3e-13   Bacillus subtilis
ref|WP_044163592.1|  2-oxoglutarate translocator                      77.0    3e-13   Bacillus halotolerans
ref|WP_010330322.1|  2-oxoglutarate translocator                      77.0    3e-13   Bacillus vallismortis
ref|WP_024120552.1|  2-oxoglutarate translocator                      77.0    3e-13   Bacillus
ref|WP_014113016.1|  2-oxoglutarate translocator                      77.0    4e-13   Bacillus
ref|WP_024715768.1|  2-oxoglutarate translocator                      76.6    4e-13   Bacillus tequilensis
ref|WP_003233725.1|  2-oxoglutarate translocator                      76.6    4e-13   Bacillales
ref|WP_003239908.1|  hypothetical protein                             76.6    4e-13   Bacillus subtilis
ref|WP_040083848.1|  2-oxoglutarate translocator                      76.6    4e-13   Bacillus
ref|WP_019257759.1|  2-oxoglutarate translocator                      76.6    4e-13   Bacillus
ref|WP_014663179.1|  2-oxoglutarate translocator                      76.6    4e-13   Bacillus sp. JS
ref|WP_003328331.1|  2-oxoglutarate translocator                      76.6    4e-13   Bacillus atrophaeus
ref|XP_011087921.1|  PREDICTED: dicarboxylate transporter 2.1, ch...  76.6    5e-13   Sesamum indicum [beniseed]
ref|WP_042744509.1|  2-oxoglutarate translocator                      73.2    5e-13   
ref|XP_003078785.1|  2-oxoglutarate/malate translocator (ISS)         76.6    6e-13   Ostreococcus tauri
gb|EYU18451.1|  hypothetical protein MIMGU_mgv1a003725mg              76.6    6e-13   Erythranthe guttata [common monkey flower]
ref|WP_025752426.1|  2-oxoglutarate translocator                      76.3    6e-13   Bacillus
gb|KGH77071.1|  2-oxoglutarate translocator                           73.2    7e-13   Oenococcus oeni IOEB_9304
gb|KFM93392.1|  transporter, divalent anion:Na+ symporter family ...  73.9    9e-13   Bacillus paralicheniformis
ref|XP_010315125.1|  PREDICTED: LOW QUALITY PROTEIN: dicarboxylat...  75.9    9e-13   Solanum lycopersicum
ref|XP_006351757.1|  PREDICTED: dicarboxylate transporter 2.1, ch...  75.9    1e-12   Solanum tuberosum [potatoes]
ref|XP_004485598.1|  PREDICTED: dicarboxylate transporter 2.1, ch...  75.9    1e-12   Cicer arietinum [garbanzo]
ref|XP_010266911.1|  PREDICTED: dicarboxylate transporter 2.1, ch...  75.5    1e-12   Nelumbo nucifera [Indian lotus]
ref|WP_019392157.1|  MULTISPECIES: 2-oxoglutarate translocator        75.1    1e-12   Bacillus
ref|XP_002866607.1|  DCT/DIT2.1                                       75.5    1e-12   Arabidopsis lyrata subsp. lyrata
ref|NP_201234.1|  dicarboxylate transport 2.1                         75.5    1e-12   Arabidopsis thaliana [mouse-ear cress]
ref|WP_043977584.1|  2-oxoglutarate translocator                      74.7    2e-12   Bacillus megaterium
ref|WP_034648188.1|  2-oxoglutarate translocator                      74.7    2e-12   Bacillus megaterium
ref|WP_028409745.1|  2-oxoglutarate translocator                      74.3    2e-12   Bacillus
ref|WP_013085539.1|  2-oxoglutarate translocator                      74.3    2e-12   Bacillus megaterium
ref|WP_016765975.1|  2-oxoglutarate translocator                      74.3    2e-12   Bacillus megaterium
emb|CDY18717.1|  BnaA09g06780D                                        74.7    2e-12   Brassica napus [oilseed rape]
ref|XP_010272978.1|  PREDICTED: dicarboxylate transporter 2.1, ch...  74.7    3e-12   Nelumbo nucifera [Indian lotus]
ref|XP_009112126.1|  PREDICTED: dicarboxylate transporter 2.1, ch...  74.7    3e-12   Brassica rapa
ref|WP_028402895.1|  2-oxoglutarate translocator                      74.3    3e-12   Bacillus panaciterrae
ref|XP_010520862.1|  PREDICTED: dicarboxylate transporter 2.1, ch...  74.3    3e-12   Tarenaya hassleriana [spider flower]
ref|WP_029319476.1|  2-oxoglutarate translocator                      73.9    3e-12   Bacillus
ref|WP_013059892.1|  2-oxoglutarate translocator                      73.9    3e-12   Bacillus
ref|XP_007148387.1|  hypothetical protein PHAVU_006G204300g           74.3    3e-12   Phaseolus vulgaris [French bean]
ref|WP_014457694.1|  2-oxoglutarate translocator                      73.9    4e-12   Bacillus megaterium
ref|WP_028411930.1|  MULTISPECIES: 2-oxoglutarate translocator        73.9    4e-12   Bacillus
ref|XP_010108404.1|  2-oxoglutarate/malate translocator               73.9    4e-12   Morus notabilis
ref|XP_003593234.1|  2-oxoglutarate/malate translocator               73.9    4e-12   Medicago truncatula
gb|EPS71302.1|  glutamate/malate translocator                         73.9    4e-12   Genlisea aurea
ref|WP_020450525.1|  MULTISPECIES: 2-oxoglutarate/malate transpor...  73.6    5e-12   Bacillus subtilis group
ref|XP_010546344.1|  PREDICTED: dicarboxylate transporter 2.1, ch...  73.6    5e-12   Tarenaya hassleriana [spider flower]
ref|WP_021797818.1|  transporter, DASS family                         73.6    5e-12   Propionibacterium acidifaciens
ref|XP_009381487.1|  PREDICTED: dicarboxylate transporter 2.1, ch...  73.6    5e-12   Musa acuminata subsp. malaccensis [pisang utan]
ref|WP_039073282.1|  MULTISPECIES: 2-oxoglutarate translocator        73.6    5e-12   Bacillales
ref|XP_009381486.1|  PREDICTED: dicarboxylate transporter 2.1, ch...  73.6    6e-12   Musa acuminata subsp. malaccensis [pisang utan]
ref|WP_043151211.1|  permease                                         73.2    6e-12   
ref|XP_002323748.1|  putative oxoglutarate-malate-translocase fam...  73.6    6e-12   Populus trichocarpa [western balsam poplar]
ref|WP_043925701.1|  2-oxoglutarate translocator                      73.2    6e-12   Bacillus haynesii
gb|KFK28120.1|  hypothetical protein AALP_AA8G475200                  73.6    6e-12   Arabis alpina [alpine rockcress]
ref|WP_003223030.1|  2-oxoglutarate translocator                      73.2    7e-12   Bacillus subtilis
ref|WP_041581256.1|  2-oxoglutarate translocator                      72.8    8e-12   
ref|WP_003179716.1|  MULTISPECIES: 2-oxoglutarate translocator        72.8    8e-12   Bacillus
gb|AGK55800.1|  divalent anion:Na+ symporter (DASS) family transp...  72.8    8e-12   Bacillus sp. 1NLA3E
ref|WP_011197641.1|  2-oxoglutarate translocator                      72.8    8e-12   Bacillus
ref|XP_006827969.1|  hypothetical protein AMTR_s00008p00213760        73.2    9e-12   Amborella trichopoda
gb|EYU39124.1|  hypothetical protein MIMGU_mgv1a003844mg              73.2    9e-12   Erythranthe guttata [common monkey flower]
ref|XP_010461628.1|  PREDICTED: dicarboxylate transporter 2.1, ch...  72.8    1e-11   Camelina sativa [gold-of-pleasure]
ref|XP_010484204.1|  PREDICTED: dicarboxylate transporter 2.1, ch...  72.8    1e-11   Camelina sativa [gold-of-pleasure]
ref|WP_026578902.1|  2-oxoglutarate translocator                      72.4    1e-11   Bacillus sp. SB47
gb|AFK44505.1|  unknown                                               70.5    1e-11   Medicago truncatula
ref|WP_026589611.1|  2-oxoglutarate translocator                      72.4    1e-11   Bacillus
emb|CDO97413.1|  unnamed protein product                              72.4    1e-11   Coffea canephora [robusta coffee]
ref|WP_018712252.1|  hypothetical protein                             72.0    1e-11   Campylobacter ureolyticus
emb|CDY43805.1|  BnaA06g23410D                                        72.4    1e-11   Brassica napus [oilseed rape]
ref|WP_018664356.1|  hypothetical protein                             68.9    2e-11   
ref|XP_010444361.1|  PREDICTED: dicarboxylate transporter 2.1, ch...  72.0    2e-11   Camelina sativa [gold-of-pleasure]
ref|WP_036200998.1|  2-oxoglutarate translocator                      71.6    2e-11   
ref|XP_011043103.1|  PREDICTED: dicarboxylate transporter 2.1, ch...  71.6    2e-11   Populus euphratica
ref|XP_010942614.1|  PREDICTED: dicarboxylate transporter 2.1, ch...  71.6    3e-11   Elaeis guineensis
emb|CDX81219.1|  BnaC09g06300D                                        71.6    3e-11   
ref|XP_006280257.1|  hypothetical protein CARUB_v10026173mg           71.2    3e-11   Capsella rubella
ref|XP_006394170.1|  hypothetical protein EUTSA_v10003922mg           71.2    3e-11   Eutrema salsugineum [saltwater cress]
ref|WP_006637412.1|  sodium/sulfate symporter YflS                    71.2    3e-11   Bacillus sonorensis
ref|XP_006492620.1|  PREDICTED: dicarboxylate transporter 2.1, ch...  71.2    3e-11   Citrus sinensis [apfelsine]
ref|XP_006423815.1|  hypothetical protein CICLE_v10028114mg           71.2    3e-11   Citrus clementina [clementine]
ref|WP_010299206.1|  2-oxoglutarate translocator                      70.9    3e-11   Candidatus Odyssella thessalonicensis
ref|XP_009150500.1|  PREDICTED: dicarboxylate transporter 2.1, ch...  71.2    3e-11   Brassica rapa
ref|WP_042357669.1|  2-oxoglutarate translocator                      70.9    4e-11   Bacillus rubiinfantis
gb|ABO87605.1|  chloroplast glutamate/malate translocator             71.2    4e-11   Pisum sativum [garden pea]
ref|WP_016645858.1|  divalent anion:Na+ symporter (DASS) family t...  70.9    4e-11   Campylobacter ureolyticus
ref|XP_009366350.1|  PREDICTED: dicarboxylate transporter 2, chlo...  70.9    4e-11   Pyrus x bretschneideri [bai li]
ref|XP_003574657.1|  PREDICTED: dicarboxylate transporter 2.1, ch...  70.9    5e-11   
ref|WP_025553155.1|  hypothetical protein                             68.2    5e-11   
ref|XP_002445990.1|  hypothetical protein SORBIDRAFT_07g029170        70.5    5e-11   Sorghum bicolor [broomcorn]
ref|XP_009401226.1|  PREDICTED: dicarboxylate transporter 2.1, ch...  70.5    5e-11   Musa acuminata subsp. malaccensis [pisang utan]
dbj|BAK44253.1|  dicarboxylate transporter                            70.5    6e-11   Eggerthella sp. YY7918
ref|XP_003547089.1|  PREDICTED: dicarboxylate transporter 2.1, ch...  70.5    6e-11   Glycine max [soybeans]
sp|Q8L7Z9.1|DIT2_SPIOL  RecName: Full=Dicarboxylate transporter 2...  70.5    6e-11   Spinacia oleracea
ref|WP_006555548.1|  divalent anion:Na+ symporter (DASS) family t...  70.5    6e-11   Veillonella seminalis
ref|XP_010690536.1|  PREDICTED: dicarboxylate transporter 2, chlo...  70.5    6e-11   Beta vulgaris subsp. vulgaris [field beet]
ref|WP_023385002.1|  divalent anion:Na+ symporter (DASS) family p...  70.1    6e-11   Campylobacter fetus
ref|WP_041690951.1|  2-oxoglutarate translocator                      70.1    6e-11   
ref|XP_009381488.1|  PREDICTED: dicarboxylate transporter 2.1, ch...  70.5    6e-11   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_008805911.1|  PREDICTED: dicarboxylate transporter 2.1, ch...  70.5    7e-11   
emb|CAN78375.1|  hypothetical protein VITISV_000698                   70.1    7e-11   Vitis vinifera
ref|WP_041017059.1|  2-oxoglutarate translocator                      70.1    8e-11   Criblamydia sequanensis
emb|CDX84512.1|  BnaC03g49880D                                        70.1    8e-11   
ref|XP_010648147.1|  PREDICTED: dicarboxylate transporter 2.1, ch...  70.1    9e-11   Vitis vinifera
ref|XP_008382044.1|  PREDICTED: dicarboxylate transporter 2, chlo...  69.7    1e-10   
gb|KDP40929.1|  hypothetical protein JCGZ_24928                       69.7    1e-10   Jatropha curcas
gb|KJB32094.1|  hypothetical protein B456_005G223500                  69.3    1e-10   Gossypium raimondii
gb|EAZ09443.1|  hypothetical protein OsI_31717                        69.3    2e-10   Oryza sativa Indica Group [Indian rice]
ref|XP_003057697.1|  divalent Anion:Na+ symporter family              69.3    2e-10   Micromonas pusilla CCMP1545
gb|ACN34632.1|  unknown                                               69.3    2e-10   Zea mays [maize]
ref|NP_001104868.1|  plastidic general dicarboxylate transporter      69.3    2e-10   
dbj|BAD19756.1|  putative plastidic general dicarboxylate transpo...  69.3    2e-10   Oryza sativa Japonica Group [Japonica rice]
ref|WP_029859134.1|  hypothetical protein                             66.2    2e-10   
dbj|BAD06222.1|  plastidic general dicarboxylate transporter          69.3    2e-10   Zea mays [maize]
dbj|BAK03702.1|  predicted protein                                    69.3    2e-10   Hordeum vulgare subsp. vulgare [two-rowed barley]
dbj|BAJ99052.1|  predicted protein                                    69.3    2e-10   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_004984114.1|  PREDICTED: dicarboxylate transporter 2.1, ch...  68.9    2e-10   Setaria italica
ref|NP_001104869.1|  plastidic general dicarboxylate transporter      68.9    2e-10   Zea mays [maize]
ref|WP_036802812.1|  2-oxoglutarate translocator                      68.9    2e-10   
ref|XP_007199747.1|  hypothetical protein PRUPE_ppa003588mg           68.9    2e-10   Prunus persica
ref|WP_033543815.1|  2-oxoglutarate translocator                      68.6    2e-10   Planococcus sp. CAU13
ref|XP_004290424.1|  PREDICTED: dicarboxylate transporter 2.1, ch...  68.9    2e-10   Fragaria vesca subsp. vesca
ref|XP_007042895.1|  Dicarboxylate transport 2.1                      68.9    2e-10   
gb|KIY93848.1|  hypothetical protein MNEG_14114                       64.3    2e-10   Monoraphidium neglectum
ref|WP_000493040.1|  2-oxoglutarate translocator                      68.6    2e-10   Vibrio cholerae
gb|ETP70180.1|  2-oxoglutarate translocator                           68.6    2e-10   Planomicrobium glaciei CHR43
ref|WP_000493041.1|  2-oxoglutarate translocator                      68.6    2e-10   Vibrio cholerae
ref|XP_007511000.1|  2-oxoglutarate/malate translocator               68.9    2e-10   Bathycoccus prasinos
ref|XP_008346519.1|  PREDICTED: dicarboxylate transporter 2, chlo...  67.0    2e-10   
ref|WP_000493042.1|  2-oxoglutarate translocator                      68.6    2e-10   Vibrio cholerae
ref|WP_031828591.1|  2-oxoglutarate translocator                      65.9    3e-10   
ref|XP_003531538.1|  PREDICTED: dicarboxylate transporter 2.1, ch...  68.6    3e-10   Glycine max [soybeans]
ref|WP_042479679.1|  2-oxoglutarate translocator                      68.2    3e-10   
emb|CEG93672.1|  Anion transporter                                    68.2    3e-10   Propionibacterium freudenreichii
ref|WP_025518842.1|  hypothetical protein                             65.9    3e-10   
ref|XP_008237290.1|  PREDICTED: dicarboxylate transporter 2.1, ch...  68.6    3e-10   Prunus mume [ume]
ref|WP_036154823.1|  2-oxoglutarate translocator                      68.2    3e-10   Lysinibacillus odysseyi
ref|WP_010372129.1|  2-oxoglutarate translocator                      68.2    3e-10   Weissella
ref|WP_000493039.1|  2-oxoglutarate translocator                      68.2    3e-10   Vibrio cholerae
ref|WP_033930314.1|  2-oxoglutarate translocator                      68.2    3e-10   Vibrio cholerae
ref|XP_004957073.1|  PREDICTED: dicarboxylate transporter 2.1, ch...  68.2    3e-10   Setaria italica
ref|WP_029810646.1|  2-oxoglutarate translocator                      65.5    3e-10   
ref|WP_029862441.1|  2-oxoglutarate translocator                      65.5    3e-10   
ref|WP_043498342.1|  2-oxoglutarate translocator                      67.8    4e-10   
ref|WP_008510084.1|  2-oxoglutarate translocator                      67.8    4e-10   Mucilaginibacter paludis
ref|WP_014425790.1|  2-oxoglutarate translocator                      67.4    5e-10   Selenomonas ruminantium
ref|WP_029285914.1|  2-oxoglutarate translocator                      67.4    5e-10   Pedobacter sp. R20-19
ref|WP_037354028.1|  2-oxoglutarate translocator                      67.4    5e-10   Selenomonas sp. FC4001
ref|WP_026759724.1|  2-oxoglutarate translocator                      67.4    5e-10   Selenomonas ruminantium
ref|WP_029095534.1|  2-oxoglutarate translocator                      67.4    5e-10   Budvicia aquatica
ref|XP_002866606.1|  DIT2.2                                           67.8    5e-10   Arabidopsis lyrata subsp. lyrata
ref|WP_014097116.1|  2-oxoglutarate translocator                      67.4    5e-10   Bacillus coagulans
ref|XP_002460379.1|  hypothetical protein SORBIDRAFT_02g027290        67.4    6e-10   Sorghum bicolor [broomcorn]
ref|WP_032092298.1|  2-oxoglutarate translocator                      67.4    6e-10   
emb|CEG00699.1|  Sodium/sulphate symporter                            67.4    6e-10   Ostreococcus tauri
ref|XP_003578268.1|  PREDICTED: dicarboxylate transporter 2.1, ch...  67.4    6e-10   Brachypodium distachyon [annual false brome]
gb|KFK28119.1|  hypothetical protein AALP_AA8G475100                  67.4    7e-10   Arabis alpina [alpine rockcress]
ref|XP_010461605.1|  PREDICTED: dicarboxylate transporter 2.2, ch...  67.4    7e-10   Camelina sativa [gold-of-pleasure]
ref|XP_003064395.1|  divalent Anion:Na+ symporter family              67.4    7e-10   Micromonas pusilla CCMP1545
gb|EMT05118.1|  2-oxoglutarate/malate translocator, chloroplastic     65.5    7e-10   
ref|WP_037441920.1|  2-oxoglutarate translocator                      67.0    8e-10   Shewanella mangrovi
gb|ERL04006.1|  putative 2-oxoglutarate/malate translocator           67.0    8e-10   Mitsuokella sp. oral taxon 131 str. W9106
ref|WP_040637569.1|  2-oxoglutarate translocator                      66.6    8e-10   
ref|WP_026766662.1|  2-oxoglutarate translocator                      66.6    9e-10   Selenomonas ruminantium
ref|WP_028129304.1|  2-oxoglutarate translocator                      66.6    9e-10   Selenomonas sp. AE3005
ref|NP_201233.1|  dicarboxylate transporter 2.2                       67.0    9e-10   Arabidopsis thaliana [mouse-ear cress]
ref|XP_003084104.1|  glutamate/malate translocator (ISS)              67.0    1e-09   
ref|WP_005203922.1|  2-oxoglutarate translocator                      66.6    1e-09   Gordonia sputi
ref|WP_031780455.1|  2-oxoglutarate translocator                      66.6    1e-09   Vibrio diabolicus
ref|WP_025533190.1|  2-oxoglutarate translocator                      66.2    1e-09   Vibrio parahaemolyticus
gb|EMD78885.1|  putative 2-oxoglutarate/malate translocator           66.2    1e-09   Vibrio diabolicus E0666
ref|XP_010484203.1|  PREDICTED: dicarboxylate transporter 2.2, ch...  66.6    1e-09   Camelina sativa [gold-of-pleasure]
dbj|BAJ86680.1|  predicted protein                                    66.6    1e-09   Hordeum vulgare subsp. vulgare [two-rowed barley]
emb|CDY31328.1|  BnaA02g34130D                                        66.6    1e-09   Brassica napus [oilseed rape]
ref|WP_019878601.1|  hypothetical protein                             66.2    1e-09   Succinispira mobilis
ref|WP_025535261.1|  2-oxoglutarate translocator                      66.2    1e-09   Vibrio parahaemolyticus
ref|WP_025543159.1|  2-oxoglutarate translocator                      65.9    1e-09   Vibrio parahaemolyticus
ref|WP_011960208.1|  C4-dicarboxylate ABC transporter                 66.2    1e-09   Psychrobacter sp. PRwf-1
ref|WP_029845759.1|  2-oxoglutarate translocator                      65.9    1e-09   Vibrio parahaemolyticus
ref|WP_029841903.1|  2-oxoglutarate translocator                      65.9    1e-09   
gb|AII14882.1|  DASS family sodium/dicarboxylate symporter            66.2    1e-09   
ref|WP_010619226.1|  2-oxoglutarate translocator                      66.2    1e-09   
ref|WP_025519096.1|  2-oxoglutarate translocator                      65.9    1e-09   
ref|XP_009130447.1|  PREDICTED: dicarboxylate transporter 2.2, ch...  66.2    1e-09   
ref|WP_029863307.1|  2-oxoglutarate translocator                      65.9    1e-09   
ref|WP_038455621.1|  2-oxoglutarate translocator                      65.9    1e-09   
ref|XP_004250120.1|  PREDICTED: dicarboxylate transporter 2.1, ch...  66.2    2e-09   
ref|WP_020835222.1|  2-oxoglutarate translocator                      65.9    2e-09   
ref|WP_029800088.1|  2-oxoglutarate translocator                      65.5    2e-09   
emb|CDP01518.1|  unnamed protein product                              66.2    2e-09   
ref|WP_039471791.1|  2-oxoglutarate translocator                      65.9    2e-09   
ref|WP_027275760.1|  2-oxoglutarate translocator                      65.9    2e-09   
ref|WP_036378649.1|  2-oxoglutarate translocator                      65.9    2e-09   
ref|WP_029815021.1|  2-oxoglutarate translocator                      65.9    2e-09   
ref|WP_025630129.1|  2-oxoglutarate translocator                      65.9    2e-09   
ref|XP_006660729.1|  PREDICTED: dicarboxylate transporter 2.1, ch...  65.9    2e-09   
ref|WP_025547571.1|  2-oxoglutarate translocator                      65.9    2e-09   
ref|WP_025787668.1|  2-oxoglutarate translocator                      65.5    2e-09   
ref|WP_025636275.1|  2-oxoglutarate translocator                      65.5    2e-09   
ref|WP_026684112.1|  2-oxoglutarate translocator                      65.5    2e-09   
ref|WP_005498683.1|  2-oxoglutarate translocator                      65.5    2e-09   
gb|KHF07152.1|  2-oxoglutarate translocator                           65.5    2e-09   
ref|WP_025795900.1|  2-oxoglutarate translocator                      65.5    2e-09   
ref|WP_025611302.1|  2-oxoglutarate translocator                      65.5    2e-09   
ref|WP_031413129.1|  2-oxoglutarate translocator                      65.5    2e-09   
ref|WP_031778702.1|  2-oxoglutarate translocator                      65.5    2e-09   
ref|WP_025504977.1|  2-oxoglutarate translocator                      65.5    2e-09   
ref|WP_043037281.1|  2-oxoglutarate translocator                      65.5    2e-09   
ref|WP_031381798.1|  2-oxoglutarate translocator                      65.5    2e-09   
ref|WP_031846587.1|  2-oxoglutarate translocator                      65.5    2e-09   
ref|WP_021448447.1|  na+ symporter family protein                     65.5    2e-09   
ref|WP_017447632.1|  2-oxoglutarate translocator                      65.5    2e-09   
ref|WP_011462350.1|  2-oxoglutarate translocator                      65.5    2e-09   
ref|XP_002974927.1|  hypothetical protein SELMODRAFT_267817           65.9    2e-09   
ref|WP_029805577.1|  2-oxoglutarate translocator                      65.5    2e-09   
ref|XP_009380879.1|  PREDICTED: dicarboxylate transporter 2.1, ch...  65.9    2e-09   
ref|WP_024701309.1|  2-oxoglutarate translocator                      65.5    2e-09   
ref|XP_004973727.1|  PREDICTED: dicarboxylate transporter 2.1, ch...  65.9    2e-09   
ref|WP_025604554.1|  2-oxoglutarate translocator                      65.5    2e-09   
ref|WP_025554538.1|  2-oxoglutarate translocator                      65.5    2e-09   
ref|WP_042771187.1|  2-oxoglutarate translocator                      65.5    2e-09   
ref|WP_025626170.1|  2-oxoglutarate translocator                      65.5    2e-09   
ref|WP_025576307.1|  2-oxoglutarate translocator                      65.5    2e-09   
ref|WP_039013855.1|  2-oxoglutarate translocator                      62.4    2e-09   
ref|WP_031841362.1|  2-oxoglutarate translocator                      65.5    2e-09   
ref|WP_033908116.1|  2-oxoglutarate translocator                      65.5    2e-09   
ref|XP_002988946.1|  hypothetical protein SELMODRAFT_129026           65.5    3e-09   
ref|WP_029804741.1|  2-oxoglutarate translocator                      65.5    3e-09   
ref|WP_029825684.1|  2-oxoglutarate translocator                      65.1    3e-09   
ref|WP_005454276.1|  2-oxoglutarate translocator                      65.1    3e-09   
ref|WP_036486051.1|  2-oxoglutarate translocator                      65.1    3e-09   
gb|EFO36829.1|  2-oxoglutarate/malate translocator                    65.1    3e-09   
gb|AGB12076.1|  putative translocator                                 65.1    3e-09   
ref|WP_008918345.1|  2-oxoglutarate translocator                      65.1    3e-09   
ref|WP_002471714.1|  2-oxoglutarate translocator                      65.1    3e-09   
ref|WP_025624265.1|  2-oxoglutarate translocator                      65.1    3e-09   
ref|XP_005652072.1|  Sodium/sulfate symporter                         65.5    3e-09   
ref|WP_038205893.1|  2-oxoglutarate translocator                      65.1    4e-09   
gb|ETJ00105.1|  hypothetical protein Q611_LSC00146G0002               62.0    4e-09   
ref|WP_039069533.1|  2-oxoglutarate translocator                      64.7    4e-09   
ref|WP_027378953.1|  2-oxoglutarate translocator                      64.7    4e-09   
ref|WP_038464208.1|  2-oxoglutarate translocator                      64.7    5e-09   
ref|WP_026201391.1|  hypothetical protein                             60.1    5e-09   
dbj|BAD09285.1|  putative glutamate/malate translocator               64.7    5e-09   
ref|WP_031812541.1|  2-oxoglutarate translocator                      64.3    5e-09   
gb|EQC65418.1|  2-oxoglutarate/malate translocator                    62.8    5e-09   
ref|WP_020334774.1|  2-oxoglutarate translocator                      64.3    5e-09   
ref|WP_014234103.1|  2-oxoglutarate translocator                      64.3    5e-09   
gb|EFW11377.1|  putative transporter, divalent anion:Na+ symporte...  64.7    5e-09   
ref|XP_008462877.1|  PREDICTED: dicarboxylate transporter 2.1, ch...  64.7    5e-09   
ref|WP_018137065.1|  hypothetical protein                             64.3    6e-09   
gb|EME76704.1|  anion transporter                                     64.3    6e-09   
ref|WP_032822294.1|  2-oxoglutarate translocator                      64.3    6e-09   
emb|CDS55553.1|  putative malate transporter YflS                     64.3    6e-09   
emb|CDY46791.1|  BnaC02g42990D                                        64.7    6e-09   
ref|XP_004137158.1|  PREDICTED: dicarboxylate transporter 2.1, ch...  64.3    6e-09   
tpg|DAA47747.1|  TPA: hypothetical protein ZEAMMB73_941040            64.3    6e-09   
ref|XP_001696590.1|  2-oxoglutarate/malate translocator               64.3    6e-09   
ref|WP_034326331.1|  2-oxoglutarate translocator                      64.3    6e-09   
ref|WP_042740292.1|  2-oxoglutarate translocator                      64.3    6e-09   
ref|XP_006280266.1|  hypothetical protein CARUB_v10026187mg           64.3    7e-09   
ref|XP_010520855.1|  PREDICTED: dicarboxylate transporter 2.2, ch...  64.3    7e-09   
ref|WP_017531615.1|  MULTISPECIES: 2-oxoglutarate translocator        63.9    7e-09   
ref|WP_026073362.1|  2-oxoglutarate translocator                      63.9    7e-09   
ref|WP_040347794.1|  2-oxoglutarate translocator                      63.9    7e-09   
ref|WP_040543388.1|  2-oxoglutarate translocator                      63.9    7e-09   
ref|XP_006394171.1|  hypothetical protein EUTSA_v10003941mg           64.3    7e-09   
gb|EIW19355.1|  anion transporter                                     63.9    7e-09   
ref|WP_029861249.1|  2-oxoglutarate translocator                      63.9    7e-09   
ref|WP_000493055.1|  2-oxoglutarate translocator                      63.9    8e-09   
ref|WP_007236687.1|  2-oxoglutarate translocator                      63.9    8e-09   
ref|WP_039367064.1|  2-oxoglutarate translocator                      63.9    8e-09   
gb|KED43475.1|  2-oxoglutarate translocator                           63.9    8e-09   
ref|XP_002445989.1|  hypothetical protein SORBIDRAFT_07g029165        63.9    8e-09   
gb|ACL52604.1|  unknown                                               63.9    8e-09   
gb|KJB79626.1|  hypothetical protein B456_013G059600                  63.9    8e-09   
gb|EIW32183.1|  anion transporter                                     63.9    8e-09   
ref|WP_007393752.1|  C4-dicarboxylate ABC transporter                 63.9    8e-09   
gb|KJB79624.1|  hypothetical protein B456_013G059600                  63.9    8e-09   
ref|WP_034674881.1|  2-oxoglutarate translocator                      63.9    8e-09   
gb|KHG19166.1|  2-oxoglutarate/malate translocator, chloroplastic     63.9    9e-09   
ref|WP_004096030.1|  2-oxoglutarate translocator                      63.5    9e-09   
ref|WP_035825773.1|  2-oxoglutarate translocator                      63.9    9e-09   
ref|WP_025626594.1|  2-oxoglutarate translocator                      63.5    1e-08   
ref|WP_013957038.1|  2-oxoglutarate translocator                      63.5    1e-08   
ref|WP_019072567.1|  hypothetical protein                             63.5    1e-08   
ref|WP_004692973.1|  2-oxoglutarate translocator                      63.5    1e-08   
ref|WP_012864229.1|  2-oxoglutarate translocator                      63.5    1e-08   
ref|WP_008600725.1|  MULTISPECIES: 2-oxoglutarate translocator        63.5    1e-08   
ref|WP_004697146.1|  2-oxoglutarate translocator                      63.5    1e-08   
ref|WP_000493056.1|  MULTISPECIES: 2-oxoglutarate translocator        63.5    1e-08   
gb|EGQ75149.1|  DASS family divalent anion:sodium (Na+) symporter     63.5    1e-08   
ref|XP_011397588.1|  Dicarboxylate transporter 1, chloroplastic       63.2    1e-08   
ref|WP_005386905.1|  2-oxoglutarate translocator                      63.2    1e-08   
ref|WP_038174908.1|  2-oxoglutarate translocator                      63.2    1e-08   
ref|WP_029047214.1|  2-oxoglutarate translocator                      63.2    1e-08   
ref|WP_000493054.1|  2-oxoglutarate translocator                      63.2    1e-08   
ref|WP_031502137.1|  2-oxoglutarate translocator                      63.2    1e-08   
ref|WP_016475465.1|  divalent anion:Na+ symporter (DASS) family t...  63.2    1e-08   
gb|KIY93412.1|  2-oxoglutarate/malate translocator Flags: Precursor   61.2    1e-08   
ref|WP_039476182.1|  2-oxoglutarate translocator                      63.2    2e-08   
ref|WP_043042510.1|  2-oxoglutarate translocator                      63.2    2e-08   
ref|WP_022538560.1|  2-oxoglutarate translocator                      63.2    2e-08   
ref|WP_009660890.1|  2-oxoglutarate translocator                      62.8    2e-08   
ref|XP_002451514.1|  hypothetical protein SORBIDRAFT_04g003080        63.2    2e-08   
ref|XP_009589933.1|  PREDICTED: dicarboxylate transporter 2.1, ch...  63.2    2e-08   
ref|WP_018424839.1|  2-oxoglutarate translocator                      63.2    2e-08   
ref|WP_025589928.1|  2-oxoglutarate translocator                      62.8    2e-08   
ref|WP_018433575.1|  2-oxoglutarate translocator                      62.8    2e-08   
ref|WP_038114652.1|  2-oxoglutarate translocator                      62.8    2e-08   
ref|WP_009372098.1|  2-oxoglutarate translocator                      62.8    2e-08   
ref|WP_034618246.1|  2-oxoglutarate translocator                      62.8    2e-08   
ref|WP_014243176.1|  2-oxoglutarate translocator                      62.8    2e-08   
ref|WP_029292431.1|  2-oxoglutarate translocator                      62.8    2e-08   
ref|WP_040528959.1|  2-oxoglutarate translocator                      62.8    2e-08   
ref|WP_038139950.1|  2-oxoglutarate translocator                      62.8    2e-08   
gb|EEY72062.1|  putative 2-oxoglutarate/malate translocator           62.8    2e-08   
ref|WP_025527212.1|  2-oxoglutarate translocator                      62.8    2e-08   
ref|WP_013091337.1|  2-oxoglutarate translocator                      62.8    2e-08   
ref|WP_038189804.1|  MULTISPECIES: 2-oxoglutarate translocator        62.8    2e-08   
ref|WP_043886829.1|  2-oxoglutarate translocator                      62.8    2e-08   
ref|WP_035879535.1|  2-oxoglutarate translocator                      62.8    2e-08   
ref|WP_011672928.1|  2-oxoglutarate translocator                      62.4    2e-08   
ref|WP_026707155.1|  2-oxoglutarate translocator                      62.4    2e-08   
ref|WP_035045532.1|  2-oxoglutarate translocator                      62.0    2e-08   
gb|AAM89395.1|  glutamate/malate translocator                         62.4    2e-08   
gb|EBA01087.1|  C4-dicarboxylate transporter                          58.5    3e-08   
ref|WP_029729830.1|  2-oxoglutarate translocator                      62.0    3e-08   
gb|KEQ31373.1|  2-oxoglutarate translocator                           62.4    3e-08   
ref|WP_037438221.1|  2-oxoglutarate translocator                      62.4    3e-08   
ref|WP_022635390.1|  2-oxoglutarate/malate transporter                62.0    3e-08   
ref|WP_037741046.1|  2-oxoglutarate translocator                      62.0    3e-08   
ref|WP_008713765.1|  2-oxoglutarate translocator                      62.0    3e-08   
gb|EEJ76106.1|  hypothetical protein HMPREF0492_1262                  59.7    3e-08   
ref|XP_005848004.1|  hypothetical protein CHLNCDRAFT_56149            62.0    3e-08   
ref|WP_038663887.1|  2-oxoglutarate translocator                      62.0    3e-08   
ref|WP_029378255.1|  2-oxoglutarate translocator                      62.0    3e-08   
ref|WP_034989265.1|  2-oxoglutarate translocator                      62.0    3e-08   
ref|WP_014360991.1|  2-oxoglutarate translocator                      62.0    3e-08   
ref|WP_005842841.1|  2-oxoglutarate translocator                      62.0    3e-08   
dbj|GAJ26897.1|  2-oxoglutarate/malate translocator                   62.0    3e-08   
ref|WP_032113068.1|  2-oxoglutarate translocator                      62.0    3e-08   
ref|WP_021842417.1|  transporter DASS family                          58.9    3e-08   
ref|WP_000458310.1|  2-oxoglutarate translocator                      62.0    3e-08   
ref|WP_039691949.1|  2-oxoglutarate translocator                      62.0    3e-08   
ref|WP_042861716.1|  2-oxoglutarate translocator                      62.0    4e-08   
ref|WP_038920685.1|  2-oxoglutarate translocator                      62.0    4e-08   
gb|KDO14330.1|  2-oxoglutarate translocator                           62.0    4e-08   
ref|WP_015004188.1|  2-oxoglutarate translocator                      62.0    4e-08   
ref|WP_036376936.1|  2-oxoglutarate translocator                      62.0    4e-08   
gb|EIJ69146.1|  sodium:sulfate symporter transmembrane region dom...  59.7    4e-08   
ref|WP_017867632.1|  2-oxoglutarate translocator                      62.0    4e-08   
ref|WP_034988937.1|  2-oxoglutarate translocator                      61.6    4e-08   
dbj|BAP32937.1|  DASS family divalent anion:sodium (Na+) symporter    61.6    4e-08   
ref|WP_004902093.1|  2-oxoglutarate translocator                      61.6    4e-08   
ref|WP_000493045.1|  2-oxoglutarate translocator                      61.6    4e-08   
ref|WP_012305442.1|  2-oxoglutarate translocator                      61.6    4e-08   
emb|CEG99635.1|  divalent anion:Na+ symporter 2.A.47.3.x              61.6    4e-08   
ref|WP_012882766.1|  2-oxoglutarate translocator                      61.6    4e-08   
ref|WP_024104070.1|  MULTISPECIES: 2-oxoglutarate translocator        61.6    4e-08   
gb|KFF75424.1|  2-oxoglutarate translocator                           61.6    4e-08   
ref|XP_001422207.1|  DASS family transporter: 2-oxoglutarate/malate   61.6    4e-08   
ref|WP_033112163.1|  2-oxoglutarate translocator                      61.6    4e-08   
ref|WP_033111496.1|  2-oxoglutarate translocator                      61.6    4e-08   
gb|ADN00696.1|  2-oxoglutarate/malate translocator                    61.6    5e-08   
ref|WP_034699340.1|  2-oxoglutarate translocator                      61.6    5e-08   
ref|WP_038921269.1|  2-oxoglutarate translocator                      61.6    5e-08   
ref|WP_038924367.1|  2-oxoglutarate translocator                      61.6    5e-08   
ref|WP_038912322.1|  2-oxoglutarate translocator                      61.6    5e-08   
ref|WP_038902446.1|  2-oxoglutarate translocator                      61.6    5e-08   
ref|WP_022631547.1|  2-oxoglutarate/malate translocator               61.6    5e-08   
gb|ADM96308.1|  2-oxoglutarate/malate translocator                    61.6    5e-08   
ref|WP_002977415.1|  2-oxoglutarate translocator                      61.6    5e-08   
gb|AEC01024.1|  anion transporter                                     61.6    5e-08   
ref|XP_010520600.1|  PREDICTED: dicarboxylate transporter 2.1, ch...  61.6    5e-08   
ref|WP_028977160.1|  2-oxoglutarate translocator                      61.2    5e-08   
gb|EEX76061.1|  transporter, DASS family                              61.6    5e-08   
ref|WP_028982962.1|  2-oxoglutarate translocator                      61.2    5e-08   
gb|AIF49710.1|  anion transporter                                     61.2    5e-08   
ref|XP_001773473.1|  predicted protein                                61.2    6e-08   
ref|WP_038674799.1|  2-oxoglutarate translocator                      61.2    6e-08   
gb|EED27286.1|  di- and tricarboxylate transporter                    61.2    6e-08   
ref|WP_010026829.1|  2-oxoglutarate translocator                      61.2    6e-08   
ref|WP_044658263.1|  permease                                         61.2    6e-08   
ref|WP_009442264.1|  2-oxoglutarate translocator                      61.2    6e-08   
ref|WP_006689683.1|  2-oxoglutarate translocator                      61.2    6e-08   
emb|CEP27020.1|  DASS family divalent anion:sodium (Na+) symporter    61.2    6e-08   
ref|WP_042858137.1|  2-oxoglutarate translocator                      61.2    6e-08   
ref|WP_021841065.1|  putative 2-oxoglutarate/malate translocator      58.9    6e-08   
ref|XP_002300194.2|  putative oxoglutarate-malate-translocase fam...  61.2    7e-08   
ref|XP_011045725.1|  PREDICTED: dicarboxylate transporter 2.1, ch...  61.2    7e-08   
ref|WP_014125753.1|  2-oxoglutarate translocator                      60.8    7e-08   
ref|WP_009645759.1|  2-oxoglutarate translocator                      60.8    7e-08   
ref|WP_026349007.1|  C4-dicarboxylate ABC transporter                 60.8    7e-08   
ref|WP_037367928.1|  2-oxoglutarate translocator                      60.8    8e-08   
dbj|GAF36487.1|  2-oxoglutarate/malate translocator                   59.3    8e-08   
ref|WP_040683231.1|  2-oxoglutarate translocator                      60.8    8e-08   
gb|EAX47424.1|  anion transporter                                     60.8    8e-08   
emb|CDF67698.1|  DASS family divalent anion:sodium (Na+) symporter    60.1    8e-08   
gb|AHJ13832.1|  2-oxoglutarate/malate antiporter                      60.8    8e-08   
ref|WP_038668023.1|  2-oxoglutarate translocator                      60.8    8e-08   



>ref|XP_010102341.1| 2-oxoglutarate/malate translocator [Morus notabilis]
 gb|EXB93302.1| 2-oxoglutarate/malate translocator [Morus notabilis]
Length=565

 Score =   125 bits (314),  Expect = 3e-30, Method: Composition-based stats.
 Identities = 61/66 (92%), Positives = 63/66 (95%), Gaps = 0/66 (0%)
 Frame = +2

Query  335  IKPLLASIATGVILWFVPQPGGVSRNAWQLLSIFLATIVGIITQPLPLGAVALMGLGACV  514
            IKPLLASIATG+ILWFVP P GVSRNAWQLL+IFLATIVGIITQPLPLGAVALMGLGA V
Sbjct  100  IKPLLASIATGIILWFVPMPSGVSRNAWQLLAIFLATIVGIITQPLPLGAVALMGLGASV  159

Query  515  LTKTLT  532
            LTKTLT
Sbjct  160  LTKTLT  165



>ref|XP_009609674.1| PREDICTED: dicarboxylate transporter 1, chloroplastic [Nicotiana 
tomentosiformis]
Length=561

 Score =   125 bits (314),  Expect = 3e-30, Method: Composition-based stats.
 Identities = 58/66 (88%), Positives = 64/66 (97%), Gaps = 0/66 (0%)
 Frame = +2

Query  335  IKPLLASIATGVILWFVPQPGGVSRNAWQLLSIFLATIVGIITQPLPLGAVALMGLGACV  514
            IKPL+ASIATG+ILWF+P P GV++NAWQLL+IFLATIVGIITQPLPLGAVALMGLGACV
Sbjct  96   IKPLIASIATGIILWFIPAPAGVTKNAWQLLAIFLATIVGIITQPLPLGAVALMGLGACV  155

Query  515  LTKTLT  532
            LTKTLT
Sbjct  156  LTKTLT  161



>ref|XP_006361749.1| PREDICTED: dicarboxylate transporter 1, chloroplastic-like [Solanum 
tuberosum]
Length=554

 Score =   124 bits (310),  Expect = 9e-30, Method: Composition-based stats.
 Identities = 58/66 (88%), Positives = 64/66 (97%), Gaps = 0/66 (0%)
 Frame = +2

Query  335  IKPLLASIATGVILWFVPQPGGVSRNAWQLLSIFLATIVGIITQPLPLGAVALMGLGACV  514
            +KPL+ASIATGVILWF+P P GV++NAWQLL+IFLATIVGIITQPLPLGAVALMGLGACV
Sbjct  89   MKPLIASIATGVILWFIPAPAGVTKNAWQLLAIFLATIVGIITQPLPLGAVALMGLGACV  148

Query  515  LTKTLT  532
            LTKTLT
Sbjct  149  LTKTLT  154



>ref|XP_004250945.1| PREDICTED: dicarboxylate transporter 1, chloroplastic [Solanum 
lycopersicum]
Length=555

 Score =   124 bits (310),  Expect = 9e-30, Method: Composition-based stats.
 Identities = 58/66 (88%), Positives = 64/66 (97%), Gaps = 0/66 (0%)
 Frame = +2

Query  335  IKPLLASIATGVILWFVPQPGGVSRNAWQLLSIFLATIVGIITQPLPLGAVALMGLGACV  514
            +KPL+ASIATGVILWF+P P GV++NAWQLL+IFLATIVGIITQPLPLGAVALMGLGACV
Sbjct  90   MKPLIASIATGVILWFIPAPAGVTKNAWQLLAIFLATIVGIITQPLPLGAVALMGLGACV  149

Query  515  LTKTLT  532
            LTKTLT
Sbjct  150  LTKTLT  155



>gb|EYU31365.1| hypothetical protein MIMGU_mgv1a003738mg [Erythranthe guttata]
Length=567

 Score =   123 bits (309),  Expect = 1e-29, Method: Composition-based stats.
 Identities = 60/66 (91%), Positives = 62/66 (94%), Gaps = 0/66 (0%)
 Frame = +2

Query  335  IKPLLASIATGVILWFVPQPGGVSRNAWQLLSIFLATIVGIITQPLPLGAVALMGLGACV  514
            IKPL+ASIA GVILWF+P P GVSR AWQLLSIFLATIVGIITQPLPLGAVALMGLGACV
Sbjct  102  IKPLVASIAVGVILWFIPAPNGVSRIAWQLLSIFLATIVGIITQPLPLGAVALMGLGACV  161

Query  515  LTKTLT  532
            LTKTLT
Sbjct  162  LTKTLT  167



>ref|XP_009777235.1| PREDICTED: dicarboxylate transporter 1, chloroplastic [Nicotiana 
sylvestris]
Length=561

 Score =   122 bits (307),  Expect = 2e-29, Method: Composition-based stats.
 Identities = 57/66 (86%), Positives = 63/66 (95%), Gaps = 0/66 (0%)
 Frame = +2

Query  335  IKPLLASIATGVILWFVPQPGGVSRNAWQLLSIFLATIVGIITQPLPLGAVALMGLGACV  514
            IKPL+ASIATG+ILW +P P GV++NAWQLL+IFLATIVGIITQPLPLGAVALMGLGACV
Sbjct  96   IKPLIASIATGIILWLIPAPAGVTKNAWQLLAIFLATIVGIITQPLPLGAVALMGLGACV  155

Query  515  LTKTLT  532
            LTKTLT
Sbjct  156  LTKTLT  161



>gb|EYU46260.1| hypothetical protein MIMGU_mgv1a003794mg [Erythranthe guttata]
Length=564

 Score =   122 bits (306),  Expect = 3e-29, Method: Composition-based stats.
 Identities = 60/66 (91%), Positives = 63/66 (95%), Gaps = 0/66 (0%)
 Frame = +2

Query  335  IKPLLASIATGVILWFVPQPGGVSRNAWQLLSIFLATIVGIITQPLPLGAVALMGLGACV  514
            +KPL+ASIATGVILWF+P P GVSR AWQLLSIFLATIVGIITQPLPLGAVALMGLGACV
Sbjct  99   MKPLIASIATGVILWFLPAPEGVSRVAWQLLSIFLATIVGIITQPLPLGAVALMGLGACV  158

Query  515  LTKTLT  532
            LTKTLT
Sbjct  159  LTKTLT  164



>ref|XP_002282809.1| PREDICTED: dicarboxylate transporter 1, chloroplastic [Vitis 
vinifera]
Length=559

 Score =   122 bits (306),  Expect = 3e-29, Method: Composition-based stats.
 Identities = 59/66 (89%), Positives = 63/66 (95%), Gaps = 0/66 (0%)
 Frame = +2

Query  335  IKPLLASIATGVILWFVPQPGGVSRNAWQLLSIFLATIVGIITQPLPLGAVALMGLGACV  514
            +KPL A+IATGVILWFVPQP GVSRNAWQLL+IFLATIVGIITQPLPLGAVAL+GLGA V
Sbjct  94   LKPLAAAIATGVILWFVPQPAGVSRNAWQLLAIFLATIVGIITQPLPLGAVALLGLGASV  153

Query  515  LTKTLT  532
            LTKTLT
Sbjct  154  LTKTLT  159



>ref|XP_004162089.1| PREDICTED: dicarboxylate transporter 1, chloroplastic-like [Cucumis 
sativus]
Length=572

 Score =   122 bits (306),  Expect = 3e-29, Method: Composition-based stats.
 Identities = 59/66 (89%), Positives = 63/66 (95%), Gaps = 0/66 (0%)
 Frame = +2

Query  335  IKPLLASIATGVILWFVPQPGGVSRNAWQLLSIFLATIVGIITQPLPLGAVALMGLGACV  514
            IKPL+ASIATG+ILWFVP P GVSRNAWQLL+IFLATIVGIITQPLPLGAVAL+GLGA V
Sbjct  107  IKPLIASIATGIILWFVPVPSGVSRNAWQLLAIFLATIVGIITQPLPLGAVALLGLGASV  166

Query  515  LTKTLT  532
            LTKTLT
Sbjct  167  LTKTLT  172



>ref|XP_004142115.1| PREDICTED: dicarboxylate transporter 1, chloroplastic-like [Cucumis 
sativus]
 gb|KGN54177.1| 2-oxoglutarate/malate translocator [Cucumis sativus]
Length=572

 Score =   122 bits (306),  Expect = 4e-29, Method: Composition-based stats.
 Identities = 59/66 (89%), Positives = 63/66 (95%), Gaps = 0/66 (0%)
 Frame = +2

Query  335  IKPLLASIATGVILWFVPQPGGVSRNAWQLLSIFLATIVGIITQPLPLGAVALMGLGACV  514
            IKPL+ASIATG+ILWFVP P GVSRNAWQLL+IFLATIVGIITQPLPLGAVAL+GLGA V
Sbjct  107  IKPLIASIATGIILWFVPVPSGVSRNAWQLLAIFLATIVGIITQPLPLGAVALLGLGASV  166

Query  515  LTKTLT  532
            LTKTLT
Sbjct  167  LTKTLT  172



>ref|XP_007015045.1| Dicarboxylate transporter 1 isoform 1 [Theobroma cacao]
 gb|EOY32664.1| Dicarboxylate transporter 1 isoform 1 [Theobroma cacao]
Length=559

 Score =   122 bits (305),  Expect = 4e-29, Method: Composition-based stats.
 Identities = 60/66 (91%), Positives = 63/66 (95%), Gaps = 0/66 (0%)
 Frame = +2

Query  335  IKPLLASIATGVILWFVPQPGGVSRNAWQLLSIFLATIVGIITQPLPLGAVALMGLGACV  514
            +KPL+ASIATGVILWFVP P GVSRNAWQLLSIFLATIVGIITQPLPLGAVAL+GLGA V
Sbjct  94   LKPLMASIATGVILWFVPVPSGVSRNAWQLLSIFLATIVGIITQPLPLGAVALLGLGASV  153

Query  515  LTKTLT  532
            LTKTLT
Sbjct  154  LTKTLT  159



>ref|XP_008449718.1| PREDICTED: dicarboxylate transporter 1, chloroplastic [Cucumis 
melo]
Length=573

 Score =   122 bits (305),  Expect = 5e-29, Method: Composition-based stats.
 Identities = 59/66 (89%), Positives = 63/66 (95%), Gaps = 0/66 (0%)
 Frame = +2

Query  335  IKPLLASIATGVILWFVPQPGGVSRNAWQLLSIFLATIVGIITQPLPLGAVALMGLGACV  514
            IKPL+ASIATG+ILWFVP P GVSRNAWQLL+IFLATIVGIITQPLPLGAVAL+GLGA V
Sbjct  108  IKPLIASIATGIILWFVPVPSGVSRNAWQLLAIFLATIVGIITQPLPLGAVALLGLGASV  167

Query  515  LTKTLT  532
            LTKTLT
Sbjct  168  LTKTLT  173



>gb|KJB35803.1| hypothetical protein B456_006G129000 [Gossypium raimondii]
Length=559

 Score =   121 bits (304),  Expect = 6e-29, Method: Composition-based stats.
 Identities = 59/66 (89%), Positives = 63/66 (95%), Gaps = 0/66 (0%)
 Frame = +2

Query  335  IKPLLASIATGVILWFVPQPGGVSRNAWQLLSIFLATIVGIITQPLPLGAVALMGLGACV  514
            +KPL+ASIATGVILWF+P P GVSRNAWQLLSIFLATIVGIITQPLPLGAVAL+GLGA V
Sbjct  94   LKPLIASIATGVILWFLPVPSGVSRNAWQLLSIFLATIVGIITQPLPLGAVALLGLGASV  153

Query  515  LTKTLT  532
            LTKTLT
Sbjct  154  LTKTLT  159



>gb|KHG21220.1| 2-oxoglutarate/malate translocator, chloroplastic [Gossypium 
arboreum]
Length=559

 Score =   121 bits (304),  Expect = 6e-29, Method: Composition-based stats.
 Identities = 59/66 (89%), Positives = 63/66 (95%), Gaps = 0/66 (0%)
 Frame = +2

Query  335  IKPLLASIATGVILWFVPQPGGVSRNAWQLLSIFLATIVGIITQPLPLGAVALMGLGACV  514
            +KPL+ASIATGVILWF+P P GVSRNAWQLLSIFLATIVGIITQPLPLGAVAL+GLGA V
Sbjct  94   LKPLIASIATGVILWFLPVPSGVSRNAWQLLSIFLATIVGIITQPLPLGAVALLGLGASV  153

Query  515  LTKTLT  532
            LTKTLT
Sbjct  154  LTKTLT  159



>ref|XP_010536081.1| PREDICTED: dicarboxylate transporter 1, chloroplastic isoform 
X2 [Tarenaya hassleriana]
Length=560

 Score =   121 bits (304),  Expect = 6e-29, Method: Composition-based stats.
 Identities = 60/66 (91%), Positives = 63/66 (95%), Gaps = 0/66 (0%)
 Frame = +2

Query  335  IKPLLASIATGVILWFVPQPGGVSRNAWQLLSIFLATIVGIITQPLPLGAVALMGLGACV  514
            IKPL+ASIATGVILWFVP P GVSR+AWQLL+IFLATIVGIITQPLPLGAVALMGLGA V
Sbjct  95   IKPLIASIATGVILWFVPVPDGVSRSAWQLLAIFLATIVGIITQPLPLGAVALMGLGASV  154

Query  515  LTKTLT  532
            LTKTLT
Sbjct  155  LTKTLT  160



>ref|NP_001119216.1| dicarboxylate transporter 1 [Arabidopsis thaliana]
 gb|AED91823.1| dicarboxylate transporter 1 [Arabidopsis thaliana]
Length=556

 Score =   121 bits (303),  Expect = 8e-29, Method: Composition-based stats.
 Identities = 60/66 (91%), Positives = 63/66 (95%), Gaps = 0/66 (0%)
 Frame = +2

Query  335  IKPLLASIATGVILWFVPQPGGVSRNAWQLLSIFLATIVGIITQPLPLGAVALMGLGACV  514
            IKPLLASIATG+ILWFVP P GV+RNAWQLL+IFLATIVGIITQPLPLGAVALMGLGA V
Sbjct  92   IKPLLASIATGLILWFVPVPEGVTRNAWQLLAIFLATIVGIITQPLPLGAVALMGLGASV  151

Query  515  LTKTLT  532
            LTKTLT
Sbjct  152  LTKTLT  157



>ref|NP_568283.2| dicarboxylate transporter 1 [Arabidopsis thaliana]
 sp|Q9LXV3.1|DIT1_ARATH RecName: Full=Dicarboxylate transporter 1, chloroplastic; AltName: 
Full=2-oxoglutarate/malate translocator 1; Short=AtpOMT1; 
Flags: Precursor [Arabidopsis thaliana]
 emb|CAB88250.1| 2-oxoglutarate/malate translocator precursor-like protein [Arabidopsis 
thaliana]
 gb|AED91822.1| dicarboxylate transporter 1 [Arabidopsis thaliana]
Length=557

 Score =   121 bits (303),  Expect = 8e-29, Method: Composition-based stats.
 Identities = 60/66 (91%), Positives = 63/66 (95%), Gaps = 0/66 (0%)
 Frame = +2

Query  335  IKPLLASIATGVILWFVPQPGGVSRNAWQLLSIFLATIVGIITQPLPLGAVALMGLGACV  514
            IKPLLASIATG+ILWFVP P GV+RNAWQLL+IFLATIVGIITQPLPLGAVALMGLGA V
Sbjct  92   IKPLLASIATGLILWFVPVPEGVTRNAWQLLAIFLATIVGIITQPLPLGAVALMGLGASV  151

Query  515  LTKTLT  532
            LTKTLT
Sbjct  152  LTKTLT  157



>ref|XP_009375074.1| PREDICTED: dicarboxylate transporter 1, chloroplastic-like [Pyrus 
x bretschneideri]
Length=623

 Score =   122 bits (305),  Expect = 8e-29, Method: Composition-based stats.
 Identities = 58/66 (88%), Positives = 63/66 (95%), Gaps = 0/66 (0%)
 Frame = +2

Query  335  IKPLLASIATGVILWFVPQPGGVSRNAWQLLSIFLATIVGIITQPLPLGAVALMGLGACV  514
            +KPL+ASIATGVILWFVP P GV++NAWQLLSIFLATIVGIITQPLPLGAVAL+GLGA V
Sbjct  158  MKPLIASIATGVILWFVPTPAGVTKNAWQLLSIFLATIVGIITQPLPLGAVALLGLGASV  217

Query  515  LTKTLT  532
            LTKTLT
Sbjct  218  LTKTLT  223



>ref|XP_008363620.1| PREDICTED: dicarboxylate transporter 1, chloroplastic [Malus 
domestica]
Length=569

 Score =   121 bits (303),  Expect = 1e-28, Method: Composition-based stats.
 Identities = 58/66 (88%), Positives = 63/66 (95%), Gaps = 0/66 (0%)
 Frame = +2

Query  335  IKPLLASIATGVILWFVPQPGGVSRNAWQLLSIFLATIVGIITQPLPLGAVALMGLGACV  514
            +KPL+ASIATGVILWFVP P GV++NAWQLLSIFLATIVGIITQPLPLGAVAL+GLGA V
Sbjct  104  MKPLIASIATGVILWFVPTPAGVTKNAWQLLSIFLATIVGIITQPLPLGAVALLGLGASV  163

Query  515  LTKTLT  532
            LTKTLT
Sbjct  164  LTKTLT  169



>ref|XP_009343722.1| PREDICTED: dicarboxylate transporter 1, chloroplastic-like [Pyrus 
x bretschneideri]
 ref|XP_009343726.1| PREDICTED: dicarboxylate transporter 1, chloroplastic-like [Pyrus 
x bretschneideri]
Length=569

 Score =   121 bits (303),  Expect = 1e-28, Method: Composition-based stats.
 Identities = 58/66 (88%), Positives = 63/66 (95%), Gaps = 0/66 (0%)
 Frame = +2

Query  335  IKPLLASIATGVILWFVPQPGGVSRNAWQLLSIFLATIVGIITQPLPLGAVALMGLGACV  514
            +KPL+ASIATGVILWFVP P GV++NAWQLLSIFLATIVGIITQPLPLGAVAL+GLGA V
Sbjct  104  MKPLIASIATGVILWFVPTPAGVTKNAWQLLSIFLATIVGIITQPLPLGAVALLGLGASV  163

Query  515  LTKTLT  532
            LTKTLT
Sbjct  164  LTKTLT  169



>ref|XP_010031793.1| PREDICTED: dicarboxylate transporter 1, chloroplastic [Eucalyptus 
grandis]
 gb|KCW51183.1| hypothetical protein EUGRSUZ_J00769 [Eucalyptus grandis]
Length=571

 Score =   121 bits (303),  Expect = 1e-28, Method: Composition-based stats.
 Identities = 60/64 (94%), Positives = 61/64 (95%), Gaps = 0/64 (0%)
 Frame = +2

Query  341  PLLASIATGVILWFVPQPGGVSRNAWQLLSIFLATIVGIITQPLPLGAVALMGLGACVLT  520
            PLLASIATGVILWFVP P GVSRNAWQLL+IFLATIVGIITQPLPLGAVALMGLGA VLT
Sbjct  108  PLLASIATGVILWFVPVPAGVSRNAWQLLAIFLATIVGIITQPLPLGAVALMGLGAAVLT  167

Query  521  KTLT  532
            KTLT
Sbjct  168  KTLT  171



>ref|XP_008227299.1| PREDICTED: dicarboxylate transporter 1, chloroplastic [Prunus 
mume]
Length=566

 Score =   120 bits (302),  Expect = 1e-28, Method: Composition-based stats.
 Identities = 58/66 (88%), Positives = 63/66 (95%), Gaps = 0/66 (0%)
 Frame = +2

Query  335  IKPLLASIATGVILWFVPQPGGVSRNAWQLLSIFLATIVGIITQPLPLGAVALMGLGACV  514
            +KPLLASIATGVILWFVP P GV++NAWQLL+IFLATIVGIITQPLPLGAVAL+GLGA V
Sbjct  101  MKPLLASIATGVILWFVPTPAGVTKNAWQLLAIFLATIVGIITQPLPLGAVALLGLGASV  160

Query  515  LTKTLT  532
            LTKTLT
Sbjct  161  LTKTLT  166



>ref|XP_007211882.1| hypothetical protein PRUPE_ppa003549mg [Prunus persica]
 gb|EMJ13081.1| hypothetical protein PRUPE_ppa003549mg [Prunus persica]
Length=566

 Score =   120 bits (302),  Expect = 1e-28, Method: Composition-based stats.
 Identities = 58/66 (88%), Positives = 63/66 (95%), Gaps = 0/66 (0%)
 Frame = +2

Query  335  IKPLLASIATGVILWFVPQPGGVSRNAWQLLSIFLATIVGIITQPLPLGAVALMGLGACV  514
            +KPLLASIATGVILWFVP P GV++NAWQLL+IFLATIVGIITQPLPLGAVAL+GLGA V
Sbjct  101  MKPLLASIATGVILWFVPTPAGVTKNAWQLLAIFLATIVGIITQPLPLGAVALLGLGASV  160

Query  515  LTKTLT  532
            LTKTLT
Sbjct  161  LTKTLT  166



>gb|KDP22090.1| hypothetical protein JCGZ_25921 [Jatropha curcas]
Length=571

 Score =   120 bits (302),  Expect = 1e-28, Method: Composition-based stats.
 Identities = 60/66 (91%), Positives = 62/66 (94%), Gaps = 0/66 (0%)
 Frame = +2

Query  335  IKPLLASIATGVILWFVPQPGGVSRNAWQLLSIFLATIVGIITQPLPLGAVALMGLGACV  514
            +KPLLASIATGVILWFVP P GVSR AWQLL+IFLATIVGIITQPLPLGAVALMGLGA V
Sbjct  106  MKPLLASIATGVILWFVPVPSGVSRPAWQLLAIFLATIVGIITQPLPLGAVALMGLGASV  165

Query  515  LTKTLT  532
            LTKTLT
Sbjct  166  LTKTLT  171



>ref|XP_006399771.1| hypothetical protein EUTSA_v10013154mg [Eutrema salsugineum]
 dbj|BAJ33726.1| unnamed protein product [Thellungiella halophila]
 gb|ESQ41224.1| hypothetical protein EUTSA_v10013154mg [Eutrema salsugineum]
Length=555

 Score =   120 bits (301),  Expect = 2e-28, Method: Composition-based stats.
 Identities = 59/66 (89%), Positives = 63/66 (95%), Gaps = 0/66 (0%)
 Frame = +2

Query  335  IKPLLASIATGVILWFVPQPGGVSRNAWQLLSIFLATIVGIITQPLPLGAVALMGLGACV  514
            IKPLLASIATG+ILWFVP P GV+RNAWQLL+IFLATIVGIITQPLPLGAVAL+GLGA V
Sbjct  90   IKPLLASIATGLILWFVPVPEGVTRNAWQLLAIFLATIVGIITQPLPLGAVALLGLGASV  149

Query  515  LTKTLT  532
            LTKTLT
Sbjct  150  LTKTLT  155



>ref|XP_007015047.1| Dicarboxylate transporter 1 isoform 3 [Theobroma cacao]
 gb|EOY32666.1| Dicarboxylate transporter 1 isoform 3 [Theobroma cacao]
Length=377

 Score =   119 bits (297),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 60/66 (91%), Positives = 63/66 (95%), Gaps = 0/66 (0%)
 Frame = +2

Query  335  IKPLLASIATGVILWFVPQPGGVSRNAWQLLSIFLATIVGIITQPLPLGAVALMGLGACV  514
            +KPL+ASIATGVILWFVP P GVSRNAWQLLSIFLATIVGIITQPLPLGAVAL+GLGA V
Sbjct  94   LKPLMASIATGVILWFVPVPSGVSRNAWQLLSIFLATIVGIITQPLPLGAVALLGLGASV  153

Query  515  LTKTLT  532
            LTKTLT
Sbjct  154  LTKTLT  159



>ref|XP_010257247.1| PREDICTED: dicarboxylate transporter 1, chloroplastic [Nelumbo 
nucifera]
Length=571

 Score =   120 bits (301),  Expect = 2e-28, Method: Composition-based stats.
 Identities = 57/66 (86%), Positives = 63/66 (95%), Gaps = 0/66 (0%)
 Frame = +2

Query  335  IKPLLASIATGVILWFVPQPGGVSRNAWQLLSIFLATIVGIITQPLPLGAVALMGLGACV  514
            +KPL+ASIATGVILWF+P P GV++NAWQLL+IFLATIVGIITQPLPLGAVALMGLGA V
Sbjct  106  LKPLMASIATGVILWFLPVPSGVTKNAWQLLAIFLATIVGIITQPLPLGAVALMGLGASV  165

Query  515  LTKTLT  532
            LTKTLT
Sbjct  166  LTKTLT  171



>ref|XP_011080429.1| PREDICTED: dicarboxylate transporter 1, chloroplastic-like [Sesamum 
indicum]
Length=482

 Score =   119 bits (298),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 60/66 (91%), Positives = 63/66 (95%), Gaps = 0/66 (0%)
 Frame = +2

Query  335  IKPLLASIATGVILWFVPQPGGVSRNAWQLLSIFLATIVGIITQPLPLGAVALMGLGACV  514
            +KPLLASIATGVI+WF+P P GVSR AWQLLSIFLATIVGIITQPLPLGAVALMGLGACV
Sbjct  17   MKPLLASIATGVIIWFLPAPDGVSRIAWQLLSIFLATIVGIITQPLPLGAVALMGLGACV  76

Query  515  LTKTLT  532
            LTKTLT
Sbjct  77   LTKTLT  82



>sp|Q41364.1|DIT1_SPIOL RecName: Full=Dicarboxylate transporter 1, chloroplastic; Short=SODIT1; 
AltName: Full=2-oxoglutarate/malate translocator; 
Flags: Precursor [Spinacia oleracea]
 gb|AAA68148.1| 2-oxoglutarate/malate translocator [Spinacia oleracea]
Length=569

 Score =   120 bits (300),  Expect = 3e-28, Method: Composition-based stats.
 Identities = 58/66 (88%), Positives = 62/66 (94%), Gaps = 0/66 (0%)
 Frame = +2

Query  335  IKPLLASIATGVILWFVPQPGGVSRNAWQLLSIFLATIVGIITQPLPLGAVALMGLGACV  514
            IKPLLASI TGVI+WF+P P GVSRNAWQLL+IFL+TIVGIITQPLPLGAVALMGLGA V
Sbjct  104  IKPLLASILTGVIIWFIPTPEGVSRNAWQLLAIFLSTIVGIITQPLPLGAVALMGLGASV  163

Query  515  LTKTLT  532
            LTKTLT
Sbjct  164  LTKTLT  169



>ref|XP_002873582.1| hypothetical protein ARALYDRAFT_909232 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH49841.1| hypothetical protein ARALYDRAFT_909232 [Arabidopsis lyrata subsp. 
lyrata]
Length=554

 Score =   119 bits (299),  Expect = 3e-28, Method: Composition-based stats.
 Identities = 58/66 (88%), Positives = 63/66 (95%), Gaps = 0/66 (0%)
 Frame = +2

Query  335  IKPLLASIATGVILWFVPQPGGVSRNAWQLLSIFLATIVGIITQPLPLGAVALMGLGACV  514
            IKPL+ASIATG+ILWFVP P GV+RNAWQLL+IFLATIVGIITQPLPLGAVAL+GLGA V
Sbjct  89   IKPLIASIATGLILWFVPVPEGVTRNAWQLLAIFLATIVGIITQPLPLGAVALLGLGASV  148

Query  515  LTKTLT  532
            LTKTLT
Sbjct  149  LTKTLT  154



>ref|XP_004291789.1| PREDICTED: dicarboxylate transporter 1, chloroplastic [Fragaria 
vesca subsp. vesca]
Length=568

 Score =   120 bits (300),  Expect = 3e-28, Method: Composition-based stats.
 Identities = 57/66 (86%), Positives = 63/66 (95%), Gaps = 0/66 (0%)
 Frame = +2

Query  335  IKPLLASIATGVILWFVPQPGGVSRNAWQLLSIFLATIVGIITQPLPLGAVALMGLGACV  514
            +KPL+ASIATGVILWFVP P GV++NAWQLL+IFLATIVGIITQPLPLGAVAL+GLGA V
Sbjct  103  MKPLIASIATGVILWFVPTPAGVTKNAWQLLAIFLATIVGIITQPLPLGAVALLGLGASV  162

Query  515  LTKTLT  532
            LTKTLT
Sbjct  163  LTKTLT  168



>ref|XP_006287403.1| hypothetical protein CARUB_v10000609mg [Capsella rubella]
 gb|EOA20301.1| hypothetical protein CARUB_v10000609mg [Capsella rubella]
Length=557

 Score =   119 bits (299),  Expect = 3e-28, Method: Composition-based stats.
 Identities = 58/66 (88%), Positives = 63/66 (95%), Gaps = 0/66 (0%)
 Frame = +2

Query  335  IKPLLASIATGVILWFVPQPGGVSRNAWQLLSIFLATIVGIITQPLPLGAVALMGLGACV  514
            IKPL+ASIATG+ILWFVP P GV+RNAWQLL+IFLATIVGIITQPLPLGAVAL+GLGA V
Sbjct  92   IKPLIASIATGLILWFVPVPEGVTRNAWQLLAIFLATIVGIITQPLPLGAVALLGLGASV  151

Query  515  LTKTLT  532
            LTKTLT
Sbjct  152  LTKTLT  157



>ref|XP_009394734.1| PREDICTED: dicarboxylate transporter 1, chloroplastic-like [Musa 
acuminata subsp. malaccensis]
Length=561

 Score =   119 bits (298),  Expect = 5e-28, Method: Composition-based stats.
 Identities = 57/65 (88%), Positives = 61/65 (94%), Gaps = 0/65 (0%)
 Frame = +2

Query  335  IKPLLASIATGVILWFVPQPGGVSRNAWQLLSIFLATIVGIITQPLPLGAVALMGLGACV  514
            +KPL ASIATGV+LWFVP P GVSRNAWQLL+IFLATI+GIITQPLPLGAVALMGLGA V
Sbjct  96   LKPLAASIATGVLLWFVPAPSGVSRNAWQLLAIFLATIIGIITQPLPLGAVALMGLGASV  155

Query  515  LTKTL  529
            LTKTL
Sbjct  156  LTKTL  160



>gb|KFK25523.1| hypothetical protein AALP_AA8G126300 [Arabis alpina]
Length=556

 Score =   119 bits (297),  Expect = 5e-28, Method: Composition-based stats.
 Identities = 58/66 (88%), Positives = 63/66 (95%), Gaps = 0/66 (0%)
 Frame = +2

Query  335  IKPLLASIATGVILWFVPQPGGVSRNAWQLLSIFLATIVGIITQPLPLGAVALMGLGACV  514
            IKPL+ASIATG+ILWFVP P GV+RNAWQLL+IFLATIVGIITQPLPLGAVAL+GLGA V
Sbjct  91   IKPLIASIATGLILWFVPVPEGVTRNAWQLLAIFLATIVGIITQPLPLGAVALLGLGASV  150

Query  515  LTKTLT  532
            LTKTLT
Sbjct  151  LTKTLT  156



>emb|CDP12268.1| unnamed protein product [Coffea canephora]
Length=573

 Score =   119 bits (297),  Expect = 8e-28, Method: Composition-based stats.
 Identities = 56/66 (85%), Positives = 62/66 (94%), Gaps = 0/66 (0%)
 Frame = +2

Query  335  IKPLLASIATGVILWFVPQPGGVSRNAWQLLSIFLATIVGIITQPLPLGAVALMGLGACV  514
            +KPL+ASIATGV+LW VP P GVSRNAWQLL+IFLATI+GIITQPLPLGAVAL+GLGA V
Sbjct  108  MKPLIASIATGVLLWLVPAPAGVSRNAWQLLAIFLATIIGIITQPLPLGAVALLGLGASV  167

Query  515  LTKTLT  532
            LTKTLT
Sbjct  168  LTKTLT  173



>ref|XP_011025529.1| PREDICTED: dicarboxylate transporter 1, chloroplastic-like [Populus 
euphratica]
Length=565

 Score =   118 bits (296),  Expect = 9e-28, Method: Composition-based stats.
 Identities = 58/66 (88%), Positives = 62/66 (94%), Gaps = 0/66 (0%)
 Frame = +2

Query  335  IKPLLASIATGVILWFVPQPGGVSRNAWQLLSIFLATIVGIITQPLPLGAVALMGLGACV  514
            +KPLLASIATGVILWFVP P GV++ AWQLL+IFLATIVGIITQPLPLGAVALMGLGA V
Sbjct  100  MKPLLASIATGVILWFVPVPAGVTKPAWQLLAIFLATIVGIITQPLPLGAVALMGLGASV  159

Query  515  LTKTLT  532
            LTKTLT
Sbjct  160  LTKTLT  165



>gb|EPS73843.1| hypothetical protein M569_00906, partial [Genlisea aurea]
Length=448

 Score =   117 bits (293),  Expect = 9e-28, Method: Compositional matrix adjust.
 Identities = 58/66 (88%), Positives = 63/66 (95%), Gaps = 0/66 (0%)
 Frame = +2

Query  335  IKPLLASIATGVILWFVPQPGGVSRNAWQLLSIFLATIVGIITQPLPLGAVALMGLGACV  514
            IKPL+ASIATGVI+WF+P P GVSRNAWQLLSIFLATIVGII+QPLPLGAVAL+GLGA V
Sbjct  7    IKPLIASIATGVIIWFIPAPQGVSRNAWQLLSIFLATIVGIISQPLPLGAVALLGLGASV  66

Query  515  LTKTLT  532
            LTKTLT
Sbjct  67   LTKTLT  72



>ref|XP_010419844.1| PREDICTED: dicarboxylate transporter 1, chloroplastic [Camelina 
sativa]
Length=559

 Score =   118 bits (296),  Expect = 1e-27, Method: Composition-based stats.
 Identities = 57/66 (86%), Positives = 63/66 (95%), Gaps = 0/66 (0%)
 Frame = +2

Query  335  IKPLLASIATGVILWFVPQPGGVSRNAWQLLSIFLATIVGIITQPLPLGAVALMGLGACV  514
            IKPL+AS+ATG+ILWFVP P GV+RNAWQLL+IFLATIVGIITQPLPLGAVAL+GLGA V
Sbjct  94   IKPLIASLATGLILWFVPVPEGVTRNAWQLLAIFLATIVGIITQPLPLGAVALLGLGATV  153

Query  515  LTKTLT  532
            LTKTLT
Sbjct  154  LTKTLT  159



>ref|XP_010453336.1| PREDICTED: dicarboxylate transporter 1, chloroplastic-like isoform 
X2 [Camelina sativa]
Length=560

 Score =   118 bits (296),  Expect = 1e-27, Method: Composition-based stats.
 Identities = 57/66 (86%), Positives = 63/66 (95%), Gaps = 0/66 (0%)
 Frame = +2

Query  335  IKPLLASIATGVILWFVPQPGGVSRNAWQLLSIFLATIVGIITQPLPLGAVALMGLGACV  514
            IKPL+AS+ATG+ILWFVP P GV+RNAWQLL+IFLATIVGIITQPLPLGAVAL+GLGA V
Sbjct  94   IKPLIASLATGLILWFVPVPEGVTRNAWQLLAIFLATIVGIITQPLPLGAVALLGLGATV  153

Query  515  LTKTLT  532
            LTKTLT
Sbjct  154  LTKTLT  159



>dbj|BAK00367.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=559

 Score =   118 bits (295),  Expect = 1e-27, Method: Composition-based stats.
 Identities = 55/66 (83%), Positives = 63/66 (95%), Gaps = 0/66 (0%)
 Frame = +2

Query  335  IKPLLASIATGVILWFVPQPGGVSRNAWQLLSIFLATIVGIITQPLPLGAVALMGLGACV  514
            +KPLLASIATGVI+WF+P P GV+RNAWQLL++FLATIVGIITQPLPLGAVAL+GLGA V
Sbjct  94   LKPLLASIATGVIIWFIPAPAGVARNAWQLLAVFLATIVGIITQPLPLGAVALLGLGAAV  153

Query  515  LTKTLT  532
            LT+TLT
Sbjct  154  LTRTLT  159



>ref|XP_010453335.1| PREDICTED: dicarboxylate transporter 1, chloroplastic-like isoform 
X1 [Camelina sativa]
Length=559

 Score =   118 bits (295),  Expect = 1e-27, Method: Composition-based stats.
 Identities = 57/66 (86%), Positives = 63/66 (95%), Gaps = 0/66 (0%)
 Frame = +2

Query  335  IKPLLASIATGVILWFVPQPGGVSRNAWQLLSIFLATIVGIITQPLPLGAVALMGLGACV  514
            IKPL+AS+ATG+ILWFVP P GV+RNAWQLL+IFLATIVGIITQPLPLGAVAL+GLGA V
Sbjct  94   IKPLIASLATGLILWFVPVPEGVTRNAWQLLAIFLATIVGIITQPLPLGAVALLGLGATV  153

Query  515  LTKTLT  532
            LTKTLT
Sbjct  154  LTKTLT  159



>ref|XP_002513507.1| 2-oxoglutarate/malate translocator, chloroplast precursor, putative 
[Ricinus communis]
 gb|EEF48910.1| 2-oxoglutarate/malate translocator, chloroplast precursor, putative 
[Ricinus communis]
Length=561

 Score =   118 bits (295),  Expect = 1e-27, Method: Composition-based stats.
 Identities = 58/66 (88%), Positives = 62/66 (94%), Gaps = 0/66 (0%)
 Frame = +2

Query  335  IKPLLASIATGVILWFVPQPGGVSRNAWQLLSIFLATIVGIITQPLPLGAVALMGLGACV  514
            IKPLLASIATGVI+WFVP P GV++ AWQLL+IFLATIVGIITQPLPLGAVALMGLGA V
Sbjct  96   IKPLLASIATGVIIWFVPVPTGVTKPAWQLLAIFLATIVGIITQPLPLGAVALMGLGASV  155

Query  515  LTKTLT  532
            LTKTLT
Sbjct  156  LTKTLT  161



>ref|XP_009348953.1| PREDICTED: dicarboxylate transporter 1, chloroplastic-like [Pyrus 
x bretschneideri]
Length=563

 Score =   118 bits (295),  Expect = 1e-27, Method: Composition-based stats.
 Identities = 56/66 (85%), Positives = 62/66 (94%), Gaps = 0/66 (0%)
 Frame = +2

Query  335  IKPLLASIATGVILWFVPQPGGVSRNAWQLLSIFLATIVGIITQPLPLGAVALMGLGACV  514
            + PL+ASIATG+ILWFVP P GV++NAWQLLSIFLATIVGIITQPLPLGAVAL+GLGA V
Sbjct  98   MTPLIASIATGLILWFVPTPAGVTKNAWQLLSIFLATIVGIITQPLPLGAVALLGLGASV  157

Query  515  LTKTLT  532
            LTKTLT
Sbjct  158  LTKTLT  163



>ref|XP_010492022.1| PREDICTED: dicarboxylate transporter 1, chloroplastic-like [Camelina 
sativa]
Length=557

 Score =   118 bits (295),  Expect = 1e-27, Method: Composition-based stats.
 Identities = 57/66 (86%), Positives = 63/66 (95%), Gaps = 0/66 (0%)
 Frame = +2

Query  335  IKPLLASIATGVILWFVPQPGGVSRNAWQLLSIFLATIVGIITQPLPLGAVALMGLGACV  514
            IKPL+AS+ATG+ILWFVP P GV+RNAWQLL+IFLATIVGIITQPLPLGAVAL+GLGA V
Sbjct  92   IKPLIASLATGLILWFVPVPEGVTRNAWQLLAIFLATIVGIITQPLPLGAVALLGLGATV  151

Query  515  LTKTLT  532
            LTKTLT
Sbjct  152  LTKTLT  157



>emb|CDY53969.1| BnaA10g30010D [Brassica napus]
Length=552

 Score =   117 bits (294),  Expect = 2e-27, Method: Composition-based stats.
 Identities = 57/66 (86%), Positives = 63/66 (95%), Gaps = 0/66 (0%)
 Frame = +2

Query  335  IKPLLASIATGVILWFVPQPGGVSRNAWQLLSIFLATIVGIITQPLPLGAVALMGLGACV  514
            IKPLLASIATGVI+WF+P P GV+R+AWQLL+IFLATIVGIITQPLPLGAVAL+GLGA V
Sbjct  87   IKPLLASIATGVIIWFLPVPEGVTRSAWQLLAIFLATIVGIITQPLPLGAVALLGLGASV  146

Query  515  LTKTLT  532
            LTKTLT
Sbjct  147  LTKTLT  152



>ref|XP_009121830.1| PREDICTED: dicarboxylate transporter 1, chloroplastic [Brassica 
rapa]
Length=548

 Score =   117 bits (294),  Expect = 2e-27, Method: Composition-based stats.
 Identities = 57/66 (86%), Positives = 63/66 (95%), Gaps = 0/66 (0%)
 Frame = +2

Query  335  IKPLLASIATGVILWFVPQPGGVSRNAWQLLSIFLATIVGIITQPLPLGAVALMGLGACV  514
            IKPLLASIATGVI+WF+P P GV+R+AWQLL+IFLATIVGIITQPLPLGAVAL+GLGA V
Sbjct  83   IKPLLASIATGVIIWFLPVPEGVTRSAWQLLAIFLATIVGIITQPLPLGAVALLGLGASV  142

Query  515  LTKTLT  532
            LTKTLT
Sbjct  143  LTKTLT  148



>ref|XP_009366121.1| PREDICTED: dicarboxylate transporter 1, chloroplastic-like [Pyrus 
x bretschneideri]
Length=588

 Score =   118 bits (295),  Expect = 2e-27, Method: Composition-based stats.
 Identities = 56/66 (85%), Positives = 62/66 (94%), Gaps = 0/66 (0%)
 Frame = +2

Query  335  IKPLLASIATGVILWFVPQPGGVSRNAWQLLSIFLATIVGIITQPLPLGAVALMGLGACV  514
            + PL+ASIATG+ILWFVP P GV++NAWQLLSIFLATIVGIITQPLPLGAVAL+GLGA V
Sbjct  123  MTPLIASIATGLILWFVPTPAGVTKNAWQLLSIFLATIVGIITQPLPLGAVALLGLGASV  182

Query  515  LTKTLT  532
            LTKTLT
Sbjct  183  LTKTLT  188



>emb|CDX97208.1| BnaC09g44170D [Brassica napus]
Length=569

 Score =   117 bits (294),  Expect = 2e-27, Method: Composition-based stats.
 Identities = 57/66 (86%), Positives = 63/66 (95%), Gaps = 0/66 (0%)
 Frame = +2

Query  335  IKPLLASIATGVILWFVPQPGGVSRNAWQLLSIFLATIVGIITQPLPLGAVALMGLGACV  514
            IKPLLASIATGVI+WF+P P GV+R+AWQLL+IFLATIVGIITQPLPLGAVAL+GLGA V
Sbjct  104  IKPLLASIATGVIIWFLPVPEGVTRSAWQLLAIFLATIVGIITQPLPLGAVALLGLGASV  163

Query  515  LTKTLT  532
            LTKTLT
Sbjct  164  LTKTLT  169



>ref|XP_002313335.2| hypothetical protein POPTR_0009s05850g, partial [Populus trichocarpa]
 gb|EEE87290.2| hypothetical protein POPTR_0009s05850g, partial [Populus trichocarpa]
Length=300

 Score =   115 bits (287),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 58/66 (88%), Positives = 62/66 (94%), Gaps = 0/66 (0%)
 Frame = +2

Query  335  IKPLLASIATGVILWFVPQPGGVSRNAWQLLSIFLATIVGIITQPLPLGAVALMGLGACV  514
            +KPLLASIATGVILWFVP P GV++ AWQLL+IFLATIVGIITQPLPLGAVALMGLGA V
Sbjct  28   MKPLLASIATGVILWFVPVPAGVTKPAWQLLAIFLATIVGIITQPLPLGAVALMGLGASV  87

Query  515  LTKTLT  532
            LTKTLT
Sbjct  88   LTKTLT  93



>ref|XP_006446115.1| hypothetical protein CICLE_v10014769mg [Citrus clementina]
 ref|XP_006470607.1| PREDICTED: dicarboxylate transporter 1, chloroplastic-like [Citrus 
sinensis]
 gb|ESR59355.1| hypothetical protein CICLE_v10014769mg [Citrus clementina]
 gb|KDO61260.1| hypothetical protein CISIN_1g008538mg [Citrus sinensis]
Length=562

 Score =   117 bits (293),  Expect = 3e-27, Method: Composition-based stats.
 Identities = 56/66 (85%), Positives = 62/66 (94%), Gaps = 0/66 (0%)
 Frame = +2

Query  335  IKPLLASIATGVILWFVPQPGGVSRNAWQLLSIFLATIVGIITQPLPLGAVALMGLGACV  514
            +KPL+ASIATG+ILWFVP P GVS+NAWQLL+IFLATIVGII QPLPLGAVAL+GLGA V
Sbjct  97   LKPLIASIATGLILWFVPVPSGVSKNAWQLLAIFLATIVGIIAQPLPLGAVALLGLGASV  156

Query  515  LTKTLT  532
            LTKTLT
Sbjct  157  LTKTLT  162



>ref|XP_004507091.1| PREDICTED: dicarboxylate transporter 1, chloroplastic-like [Cicer 
arietinum]
Length=557

 Score =   116 bits (291),  Expect = 4e-27, Method: Composition-based stats.
 Identities = 57/65 (88%), Positives = 60/65 (92%), Gaps = 0/65 (0%)
 Frame = +2

Query  335  IKPLLASIATGVILWFVPQPGGVSRNAWQLLSIFLATIVGIITQPLPLGAVALMGLGACV  514
            IKPLLASIATGVILWFVP P GVSRNAWQLL+IFL TIVGIITQPLPLGAVA++GLG  V
Sbjct  92   IKPLLASIATGVILWFVPVPEGVSRNAWQLLAIFLGTIVGIITQPLPLGAVAILGLGVSV  151

Query  515  LTKTL  529
            LTKTL
Sbjct  152  LTKTL  156



>ref|XP_011045437.1| PREDICTED: dicarboxylate transporter 1, chloroplastic-like [Populus 
euphratica]
Length=560

 Score =   116 bits (291),  Expect = 5e-27, Method: Composition-based stats.
 Identities = 57/65 (88%), Positives = 61/65 (94%), Gaps = 0/65 (0%)
 Frame = +2

Query  335  IKPLLASIATGVILWFVPQPGGVSRNAWQLLSIFLATIVGIITQPLPLGAVALMGLGACV  514
            +KPLLASIATGVILWFVP P GV++ AWQLL+IFLATIVGIITQPLPLGAVALMGLGA V
Sbjct  95   MKPLLASIATGVILWFVPVPAGVTKPAWQLLAIFLATIVGIITQPLPLGAVALMGLGASV  154

Query  515  LTKTL  529
            LTKTL
Sbjct  155  LTKTL  159



>ref|XP_008801951.1| PREDICTED: dicarboxylate transporter 1, chloroplastic [Phoenix 
dactylifera]
Length=558

 Score =   115 bits (288),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 57/65 (88%), Positives = 62/65 (95%), Gaps = 0/65 (0%)
 Frame = +2

Query  335  IKPLLASIATGVILWFVPQPGGVSRNAWQLLSIFLATIVGIITQPLPLGAVALMGLGACV  514
            +KPL+ASIATGV+LWFVP P GVSRNAWQLL++FLATIVGIITQPLPLGAVALMGLGA V
Sbjct  93   LKPLVASIATGVLLWFVPAPAGVSRNAWQLLAVFLATIVGIITQPLPLGAVALMGLGASV  152

Query  515  LTKTL  529
            LTKTL
Sbjct  153  LTKTL  157



>ref|XP_009411283.1| PREDICTED: dicarboxylate transporter 1, chloroplastic-like [Musa 
acuminata subsp. malaccensis]
Length=562

 Score =   115 bits (288),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 59/66 (89%), Positives = 61/66 (92%), Gaps = 0/66 (0%)
 Frame = +2

Query  335  IKPLLASIATGVILWFVPQPGGVSRNAWQLLSIFLATIVGIITQPLPLGAVALMGLGACV  514
            +KPL ASIATGVILW VP P GVSRNAWQLL+IFLATIVGIITQPLPLGAVALMGLGA V
Sbjct  97   LKPLAASIATGVILWLVPAPSGVSRNAWQLLAIFLATIVGIITQPLPLGAVALMGLGASV  156

Query  515  LTKTLT  532
            LTKTLT
Sbjct  157  LTKTLT  162



>ref|NP_001066885.1| Os12g0515400 [Oryza sativa Japonica Group]
 gb|ABA98704.1| 2-oxoglutarate/malate translocator, chloroplast precursor, putative, 
expressed [Oryza sativa Japonica Group]
 dbj|BAF29904.1| Os12g0515400 [Oryza sativa Japonica Group]
Length=548

 Score =   114 bits (285),  Expect = 2e-26, Method: Composition-based stats.
 Identities = 54/66 (82%), Positives = 61/66 (92%), Gaps = 0/66 (0%)
 Frame = +2

Query  335  IKPLLASIATGVILWFVPQPGGVSRNAWQLLSIFLATIVGIITQPLPLGAVALMGLGACV  514
            IKPL+A+I TGV++W VP P GV+RNAWQLLSIFLATIVGIITQPLPLGAVAL+GLGA V
Sbjct  83   IKPLVATIGTGVLIWLVPPPAGVARNAWQLLSIFLATIVGIITQPLPLGAVALLGLGAAV  142

Query  515  LTKTLT  532
            LT+TLT
Sbjct  143  LTRTLT  148



>ref|XP_010931014.1| PREDICTED: LOW QUALITY PROTEIN: dicarboxylate transporter 1, 
chloroplastic [Elaeis guineensis]
Length=557

 Score =   114 bits (285),  Expect = 3e-26, Method: Composition-based stats.
 Identities = 55/65 (85%), Positives = 60/65 (92%), Gaps = 0/65 (0%)
 Frame = +2

Query  335  IKPLLASIATGVILWFVPQPGGVSRNAWQLLSIFLATIVGIITQPLPLGAVALMGLGACV  514
            +KPL A+IATGV+LW VP P GVSRNAWQLL+IFLATIVGIITQPLPLGAVAL+GLGA V
Sbjct  92   LKPLAATIATGVLLWLVPAPAGVSRNAWQLLAIFLATIVGIITQPLPLGAVALLGLGASV  151

Query  515  LTKTL  529
            LTKTL
Sbjct  152  LTKTL  156



>ref|XP_007132020.1| hypothetical protein PHAVU_011G059900g [Phaseolus vulgaris]
 gb|ESW04014.1| hypothetical protein PHAVU_011G059900g [Phaseolus vulgaris]
Length=559

 Score =   114 bits (285),  Expect = 3e-26, Method: Composition-based stats.
 Identities = 55/65 (85%), Positives = 59/65 (91%), Gaps = 0/65 (0%)
 Frame = +2

Query  335  IKPLLASIATGVILWFVPQPGGVSRNAWQLLSIFLATIVGIITQPLPLGAVALMGLGACV  514
            IKPLLASIATGVILWF P P GV+RNAWQLL+IFL TIVGIITQPLPLGAVA++GLG  V
Sbjct  94   IKPLLASIATGVILWFTPVPAGVNRNAWQLLAIFLGTIVGIITQPLPLGAVAILGLGVSV  153

Query  515  LTKTL  529
            LTKTL
Sbjct  154  LTKTL  158



>ref|XP_002442229.1| hypothetical protein SORBIDRAFT_08g016630 [Sorghum bicolor]
 gb|EES16067.1| hypothetical protein SORBIDRAFT_08g016630 [Sorghum bicolor]
Length=584

 Score =   114 bits (286),  Expect = 3e-26, Method: Composition-based stats.
 Identities = 54/66 (82%), Positives = 61/66 (92%), Gaps = 0/66 (0%)
 Frame = +2

Query  335  IKPLLASIATGVILWFVPQPGGVSRNAWQLLSIFLATIVGIITQPLPLGAVALMGLGACV  514
            IKPLLAS+A GV++WF+P P GV RNAWQLL+IFL+TIVGIITQPLPLGAVAL+GLGA V
Sbjct  119  IKPLLASLAIGVLIWFLPAPAGVPRNAWQLLAIFLSTIVGIITQPLPLGAVALLGLGAAV  178

Query  515  LTKTLT  532
            LTKTLT
Sbjct  179  LTKTLT  184



>ref|XP_002299910.2| hypothetical protein POPTR_0001s26580g [Populus trichocarpa]
 gb|EEE84715.2| hypothetical protein POPTR_0001s26580g [Populus trichocarpa]
Length=560

 Score =   114 bits (285),  Expect = 3e-26, Method: Composition-based stats.
 Identities = 56/65 (86%), Positives = 60/65 (92%), Gaps = 0/65 (0%)
 Frame = +2

Query  335  IKPLLASIATGVILWFVPQPGGVSRNAWQLLSIFLATIVGIITQPLPLGAVALMGLGACV  514
            +KPLLASIA GVILWFVP P GV++ AWQLL+IFLATIVGIITQPLPLGAVALMGLGA V
Sbjct  95   MKPLLASIAIGVILWFVPVPSGVTKPAWQLLAIFLATIVGIITQPLPLGAVALMGLGASV  154

Query  515  LTKTL  529
            LTKTL
Sbjct  155  LTKTL  159



>gb|KEH30210.1| 2-oxoglutarate/malate translocator [Medicago truncatula]
Length=557

 Score =   114 bits (285),  Expect = 4e-26, Method: Composition-based stats.
 Identities = 55/65 (85%), Positives = 59/65 (91%), Gaps = 0/65 (0%)
 Frame = +2

Query  335  IKPLLASIATGVILWFVPQPGGVSRNAWQLLSIFLATIVGIITQPLPLGAVALMGLGACV  514
            IKPL+ASI TGVILWFVP P GVSRNAWQLL+IFL TIVGIITQPLPLGAVA++GLG  V
Sbjct  92   IKPLIASILTGVILWFVPTPEGVSRNAWQLLAIFLGTIVGIITQPLPLGAVAILGLGVSV  151

Query  515  LTKTL  529
            LTKTL
Sbjct  152  LTKTL  156



>ref|XP_011006198.1| PREDICTED: dicarboxylate transporter 1, chloroplastic-like [Populus 
euphratica]
Length=560

 Score =   114 bits (284),  Expect = 5e-26, Method: Composition-based stats.
 Identities = 56/65 (86%), Positives = 60/65 (92%), Gaps = 0/65 (0%)
 Frame = +2

Query  335  IKPLLASIATGVILWFVPQPGGVSRNAWQLLSIFLATIVGIITQPLPLGAVALMGLGACV  514
            +KPLLASIATGVILW VP P GV++ AWQLL+IFLATIVGIITQPLPLGAVALMGLGA V
Sbjct  95   MKPLLASIATGVILWLVPVPSGVTKPAWQLLAIFLATIVGIITQPLPLGAVALMGLGASV  154

Query  515  LTKTL  529
            LTKTL
Sbjct  155  LTKTL  159



>ref|XP_008344435.1| PREDICTED: LOW QUALITY PROTEIN: dicarboxylate transporter 1, 
chloroplastic-like [Malus domestica]
Length=447

 Score =   112 bits (280),  Expect = 6e-26, Method: Compositional matrix adjust.
 Identities = 55/66 (83%), Positives = 61/66 (92%), Gaps = 0/66 (0%)
 Frame = +2

Query  335  IKPLLASIATGVILWFVPQPGGVSRNAWQLLSIFLATIVGIITQPLPLGAVALMGLGACV  514
            + PL+ASIATG+ILWF P P GV++NAWQLLSIFLATIVGIITQPLPLGAVAL+GLGA V
Sbjct  102  MTPLIASIATGLILWFFPTPAGVTKNAWQLLSIFLATIVGIITQPLPLGAVALLGLGASV  161

Query  515  LTKTLT  532
            LTKTLT
Sbjct  162  LTKTLT  167



>ref|XP_007015046.1| Dicarboxylate transporter 1 isoform 2 [Theobroma cacao]
 gb|EOY32665.1| Dicarboxylate transporter 1 isoform 2 [Theobroma cacao]
Length=462

 Score =   112 bits (280),  Expect = 7e-26, Method: Compositional matrix adjust.
 Identities = 57/62 (92%), Positives = 59/62 (95%), Gaps = 0/62 (0%)
 Frame = +2

Query  347  LASIATGVILWFVPQPGGVSRNAWQLLSIFLATIVGIITQPLPLGAVALMGLGACVLTKT  526
            +ASIATGVILWFVP P GVSRNAWQLLSIFLATIVGIITQPLPLGAVAL+GLGA VLTKT
Sbjct  1    MASIATGVILWFVPVPSGVSRNAWQLLSIFLATIVGIITQPLPLGAVALLGLGASVLTKT  60

Query  527  LT  532
            LT
Sbjct  61   LT  62



>ref|NP_001105570.1| LOC542560 [Zea mays]
 dbj|BAD06219.1| plastidic 2-oxoglutarate/malate transporter [Zea mays]
 gb|AFW56593.1| plastidic 2-oxoglutarate/malate transporter [Zea mays]
Length=578

 Score =   113 bits (282),  Expect = 8e-26, Method: Composition-based stats.
 Identities = 53/66 (80%), Positives = 61/66 (92%), Gaps = 0/66 (0%)
 Frame = +2

Query  335  IKPLLASIATGVILWFVPQPGGVSRNAWQLLSIFLATIVGIITQPLPLGAVALMGLGACV  514
            IKPLLASIATGV++W +P P GV RNAWQLL+IFL+TIVGIITQPLPLGAVAL+GLGA V
Sbjct  113  IKPLLASIATGVLIWLIPPPAGVPRNAWQLLAIFLSTIVGIITQPLPLGAVALLGLGAAV  172

Query  515  LTKTLT  532
            L++TLT
Sbjct  173  LSRTLT  178



>ref|XP_003537966.1| PREDICTED: dicarboxylate transporter 1, chloroplastic-like [Glycine 
max]
Length=560

 Score =   113 bits (282),  Expect = 8e-26, Method: Composition-based stats.
 Identities = 54/65 (83%), Positives = 59/65 (91%), Gaps = 0/65 (0%)
 Frame = +2

Query  335  IKPLLASIATGVILWFVPQPGGVSRNAWQLLSIFLATIVGIITQPLPLGAVALMGLGACV  514
            IKPL+ASIATGVILWF P P GV+RNAWQLL+IFL TIVGIITQPLPLGAVA++GLG  V
Sbjct  95   IKPLIASIATGVILWFSPVPAGVNRNAWQLLAIFLGTIVGIITQPLPLGAVAILGLGVSV  154

Query  515  LTKTL  529
            LTKTL
Sbjct  155  LTKTL  159



>ref|XP_003575954.1| PREDICTED: LOW QUALITY PROTEIN: dicarboxylate transporter 1, 
chloroplastic [Brachypodium distachyon]
Length=560

 Score =   113 bits (282),  Expect = 8e-26, Method: Compositional matrix adjust.
 Identities = 54/66 (82%), Positives = 63/66 (95%), Gaps = 0/66 (0%)
 Frame = +2

Query  335  IKPLLASIATGVILWFVPQPGGVSRNAWQLLSIFLATIVGIITQPLPLGAVALMGLGACV  514
            IKPLLASIATG+++WF+P P GV+RNAWQLL++FLATIVGIITQPLPLGAVAL+GLGA V
Sbjct  93   IKPLLASIATGLLIWFIPAPAGVARNAWQLLAVFLATIVGIITQPLPLGAVALLGLGAAV  152

Query  515  LTKTLT  532
            LT+TLT
Sbjct  153  LTRTLT  158



>gb|ABK24751.1| unknown [Picea sitchensis]
Length=594

 Score =   112 bits (281),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 56/66 (85%), Positives = 61/66 (92%), Gaps = 0/66 (0%)
 Frame = +2

Query  335  IKPLLASIATGVILWFVPQPGGVSRNAWQLLSIFLATIVGIITQPLPLGAVALMGLGACV  514
            +KPL ASIATGVI+W VP P GV++NAWQLL+IFLATIVGIITQPLPLGAVALMGLGA V
Sbjct  129  LKPLAASIATGVIMWLVPAPAGVTKNAWQLLAIFLATIVGIITQPLPLGAVALMGLGAAV  188

Query  515  LTKTLT  532
            LTKTLT
Sbjct  189  LTKTLT  194



>emb|CAX65044.1| plastidic 2-oxoglutarate/malate translocator [Pisum sativum]
Length=480

 Score =   109 bits (273),  Expect = 6e-25, Method: Compositional matrix adjust.
 Identities = 55/65 (85%), Positives = 60/65 (92%), Gaps = 0/65 (0%)
 Frame = +2

Query  335  IKPLLASIATGVILWFVPQPGGVSRNAWQLLSIFLATIVGIITQPLPLGAVALMGLGACV  514
            IKPLLASIATGVI+WF+P P GVSRNAWQLL+IFL TIVGIITQPLPLGAVA++GLG  V
Sbjct  14   IKPLLASIATGVIIWFLPTPEGVSRNAWQLLAIFLGTIVGIITQPLPLGAVAILGLGVSV  73

Query  515  LTKTL  529
            LTKTL
Sbjct  74   LTKTL  78



>ref|XP_010673637.1| PREDICTED: dicarboxylate transporter 1, chloroplastic [Beta vulgaris 
subsp. vulgaris]
Length=560

 Score =   110 bits (274),  Expect = 1e-24, Method: Composition-based stats.
 Identities = 52/65 (80%), Positives = 59/65 (91%), Gaps = 0/65 (0%)
 Frame = +2

Query  335  IKPLLASIATGVILWFVPQPGGVSRNAWQLLSIFLATIVGIITQPLPLGAVALMGLGACV  514
            IKPLLASI TGVI+W +P P GV++ AWQLL+IFL+TIVGIITQPLPLGAVALMGLGA V
Sbjct  95   IKPLLASIITGVIIWLIPTPEGVTKQAWQLLAIFLSTIVGIITQPLPLGAVALMGLGASV  154

Query  515  LTKTL  529
            +TKTL
Sbjct  155  VTKTL  159



>ref|XP_003539493.1| PREDICTED: dicarboxylate transporter 1, chloroplastic-like [Glycine 
max]
Length=553

 Score =   108 bits (270),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 54/65 (83%), Positives = 59/65 (91%), Gaps = 0/65 (0%)
 Frame = +2

Query  335  IKPLLASIATGVILWFVPQPGGVSRNAWQLLSIFLATIVGIITQPLPLGAVALMGLGACV  514
            IKPL+ASIATGVILWF P P GV+RNAWQLL+IFL TIVGIITQPLPLGAVA++GLG  V
Sbjct  88   IKPLIASIATGVILWFSPVPAGVNRNAWQLLAIFLGTIVGIITQPLPLGAVAILGLGVSV  147

Query  515  LTKTL  529
            LTKTL
Sbjct  148  LTKTL  152



>ref|XP_004964101.1| PREDICTED: dicarboxylate transporter 1, chloroplastic-like [Setaria 
italica]
Length=567

 Score =   100 bits (250),  Expect = 2e-21, Method: Composition-based stats.
 Identities = 49/66 (74%), Positives = 57/66 (86%), Gaps = 0/66 (0%)
 Frame = +2

Query  335  IKPLLASIATGVILWFVPQPGGVSRNAWQLLSIFLATIVGIITQPLPLGAVALMGLGACV  514
            I PLLA++ATGV++   P P GV R AWQLL+IFL+TIVGIITQPLPLGAVAL+GLGA V
Sbjct  102  ITPLLATVATGVLIRLGPAPSGVPRKAWQLLAIFLSTIVGIITQPLPLGAVALLGLGAAV  161

Query  515  LTKTLT  532
            LT+TLT
Sbjct  162  LTRTLT  167



>emb|CAN74406.1| hypothetical protein VITISV_043636 [Vitis vinifera]
Length=303

 Score = 97.4 bits (241),  Expect = 6e-21, Method: Compositional matrix adjust.
 Identities = 49/66 (74%), Positives = 54/66 (82%), Gaps = 0/66 (0%)
 Frame = -1

Query  534  NVRVFVSTHAPRPINATAPSGSGWVMIPTMVARKIDSNCHAFRETPPGCGTNQRITPVAM  355
             VRV VST APRP +ATAPSGSG VM+PTMVARKI S+CHAF ETP GCGTN R+TPVA+
Sbjct  35   KVRVLVSTDAPRPRSATAPSGSGCVMMPTMVARKIASSCHAFLETPAGCGTNHRMTPVAI  94

Query  354  DARSGL  337
             A SG 
Sbjct  95   AAASGF  100



>ref|XP_001700411.1| chloroplast oxoglutarate-malate translocator [Chlamydomonas reinhardtii]
 gb|EDO98100.1| chloroplast oxoglutarate-malate translocator [Chlamydomonas reinhardtii]
Length=587

 Score = 84.0 bits (206),  Expect = 2e-15, Method: Composition-based stats.
 Identities = 37/66 (56%), Positives = 48/66 (73%), Gaps = 0/66 (0%)
 Frame = +2

Query  335  IKPLLASIATGVILWFVPQPGGVSRNAWQLLSIFLATIVGIITQPLPLGAVALMGLGACV  514
            +K L   +     LWF+P P GV+  AW LL++F+ TIVGIIT PLPLGAVA++GLGA +
Sbjct  123  MKDLAICVGVATALWFIPPPAGVTAKAWHLLAVFIGTIVGIITTPLPLGAVAIIGLGAAM  182

Query  515  LTKTLT  532
            +TK LT
Sbjct  183  ITKVLT  188



>ref|XP_001700410.1| oxoglutarate:malate antiporter [Chlamydomonas reinhardtii]
 gb|EDO98099.1| oxoglutarate:malate antiporter [Chlamydomonas reinhardtii]
Length=553

 Score = 83.6 bits (205),  Expect = 2e-15, Method: Composition-based stats.
 Identities = 37/66 (56%), Positives = 48/66 (73%), Gaps = 0/66 (0%)
 Frame = +2

Query  335  IKPLLASIATGVILWFVPQPGGVSRNAWQLLSIFLATIVGIITQPLPLGAVALMGLGACV  514
            +K L   +     LWF+P P GV+  AW LL++F+ TIVGIIT PLPLGAVA++GLGA +
Sbjct  89   MKDLAICVGVATALWFIPPPAGVTAKAWHLLAVFIGTIVGIITTPLPLGAVAIIGLGAAM  148

Query  515  LTKTLT  532
            +TK LT
Sbjct  149  ITKVLT  154



>ref|XP_005650106.1| oxoglutarate:malate antiporter, partial [Coccomyxa subellipsoidea 
C-169]
 gb|EIE25562.1| oxoglutarate:malate antiporter, partial [Coccomyxa subellipsoidea 
C-169]
Length=466

 Score = 82.4 bits (202),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 42/66 (64%), Positives = 50/66 (76%), Gaps = 0/66 (0%)
 Frame = +2

Query  335  IKPLLASIATGVILWFVPQPGGVSRNAWQLLSIFLATIVGIITQPLPLGAVALMGLGACV  514
            +K L   +A  V +WF P P GV+  AW LL+IFL TIVGIITQPLPLGAVA++GLGA +
Sbjct  1    MKNLGICVAVAVAVWFCPPPAGVTIQAWHLLAIFLGTIVGIITQPLPLGAVAMLGLGATM  60

Query  515  LTKTLT  532
            LTK LT
Sbjct  61   LTKVLT  66



>ref|XP_002507903.1| divalent Anion:Na+ symporter family [Micromonas sp. RCC299]
 gb|ACO69161.1| divalent Anion:Na+ symporter family [Micromonas sp. RCC299]
Length=563

 Score = 81.6 bits (200),  Expect = 1e-14, Method: Composition-based stats.
 Identities = 35/65 (54%), Positives = 48/65 (74%), Gaps = 0/65 (0%)
 Frame = +2

Query  335  IKPLLASIATGVILWFVPQPGGVSRNAWQLLSIFLATIVGIITQPLPLGAVALMGLGACV  514
            +KPL  S+  G+++W +P P GVS  AW LL++F+ TIVGIIT PLPLGA A++GLG  +
Sbjct  98   LKPLGYSVLAGLLIWLIPAPAGVSAQAWHLLAVFVGTIVGIITNPLPLGATAMIGLGVSM  157

Query  515  LTKTL  529
            +T  L
Sbjct  158  VTGLL  162



>ref|WP_038563803.1| 2-oxoglutarate translocator [Terribacillus aidingensis]
 gb|AIF67752.1| 2-oxoglutarate translocator [Terribacillus aidingensis]
Length=477

 Score = 80.9 bits (198),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 36/63 (57%), Positives = 49/63 (78%), Gaps = 0/63 (0%)
 Frame = +2

Query  341  PLLASIATGVILWFVPQPGGVSRNAWQLLSIFLATIVGIITQPLPLGAVALMGLGACVLT  520
            PLL ++  GVILWF+P P GV   AW L +IF+ATI+G+I +P+P+G+VA++ L A VLT
Sbjct  16   PLLITVLIGVILWFIPSPDGVKAEAWHLFAIFVATIIGLIIKPMPMGSVAILSLTAIVLT  75

Query  521  KTL  529
            KTL
Sbjct  76   KTL  78



>ref|XP_005843613.1| hypothetical protein CHLNCDRAFT_140201 [Chlorella variabilis]
 gb|EFN51511.1| hypothetical protein CHLNCDRAFT_140201 [Chlorella variabilis]
Length=536

 Score = 79.7 bits (195),  Expect = 4e-14, Method: Composition-based stats.
 Identities = 38/66 (58%), Positives = 45/66 (68%), Gaps = 0/66 (0%)
 Frame = +2

Query  335  IKPLLASIATGVILWFVPQPGGVSRNAWQLLSIFLATIVGIITQPLPLGAVALMGLGACV  514
            +K L   +A G  LW  P P GVS  AW LL++FL+TI GIIT P+PLGAVA+MGL A  
Sbjct  71   LKKLGICVAIGAALWVSPAPAGVSSQAWHLLAVFLSTICGIITTPMPLGAVAMMGLAAAQ  130

Query  515  LTKTLT  532
            LT  LT
Sbjct  131  LTGVLT  136



>ref|XP_007512423.1| 2-oxoglutarate/malate translocator [Bathycoccus prasinos]
 emb|CCO17023.1| 2-oxoglutarate/malate translocator [Bathycoccus prasinos]
Length=594

 Score = 79.3 bits (194),  Expect = 7e-14, Method: Composition-based stats.
 Identities = 36/64 (56%), Positives = 46/64 (72%), Gaps = 0/64 (0%)
 Frame = +2

Query  338  KPLLASIATGVILWFVPQPGGVSRNAWQLLSIFLATIVGIITQPLPLGAVALMGLGACVL  517
            K L  S+  G++LW  P P GV+  AW L ++F+ATIVGIITQPLPLGAVA++GLG  + 
Sbjct  130  KNLGYSVLAGLLLWICPAPAGVTAQAWHLFAVFVATIVGIITQPLPLGAVAMIGLGVSMT  189

Query  518  TKTL  529
            T  L
Sbjct  190  TGLL  193



>ref|WP_025601890.1| hypothetical protein, partial [Bacillus sp. JGI 0001002-E22]
Length=84

 Score = 73.9 bits (180),  Expect = 8e-14, Method: Compositional matrix adjust.
 Identities = 35/64 (55%), Positives = 47/64 (73%), Gaps = 0/64 (0%)
 Frame = +2

Query  341  PLLASIATGVILWFVPQPGGVSRNAWQLLSIFLATIVGIITQPLPLGAVALMGLGACVLT  520
            PLL  +A G++LWF+  P G+   AW L +IF+ATIVG+I +PLPLG+VA++ L   VLT
Sbjct  16   PLLICLAIGLVLWFITPPSGLDVKAWHLFAIFVATIVGLIIKPLPLGSVAILSLTIIVLT  75

Query  521  KTLT  532
             TLT
Sbjct  76   NTLT  79



>ref|XP_002955862.1| hypothetical protein VOLCADRAFT_106989 [Volvox carteri f. nagariensis]
 gb|EFJ43063.1| hypothetical protein VOLCADRAFT_106989 [Volvox carteri f. nagariensis]
Length=551

 Score = 78.6 bits (192),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 37/66 (56%), Positives = 49/66 (74%), Gaps = 0/66 (0%)
 Frame = +2

Query  335  IKPLLASIATGVILWFVPQPGGVSRNAWQLLSIFLATIVGIITQPLPLGAVALMGLGACV  514
            +K L   +    +LWF+P P GV+  AW LL++F+ TIVGIIT PLPLGAVA++GLGA +
Sbjct  87   MKDLGICVGIATLLWFIPPPAGVTAKAWHLLAVFIGTIVGIITTPLPLGAVAVLGLGAAM  146

Query  515  LTKTLT  532
            +TK LT
Sbjct  147  ITKVLT  152



>ref|WP_032858509.1| 2-oxoglutarate translocator [Bacillus amyloliquefaciens]
 gb|KDN91710.1| 2-oxoglutarate translocator [Bacillus amyloliquefaciens]
Length=478

 Score = 77.8 bits (190),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 33/66 (50%), Positives = 48/66 (73%), Gaps = 0/66 (0%)
 Frame = +2

Query  335  IKPLLASIATGVILWFVPQPGGVSRNAWQLLSIFLATIVGIITQPLPLGAVALMGLGACV  514
            I PLL ++A G+I+WF+P P G+   AW L +IF+ATI+G I++PLP+GA+A+  L    
Sbjct  15   IIPLLITVAVGLIIWFIPAPSGLEPKAWHLFAIFVATIIGFISKPLPMGAIAIFALAVTA  74

Query  515  LTKTLT  532
            LT TL+
Sbjct  75   LTGTLS  80



>ref|WP_015417012.1| MULTISPECIES: 2-oxoglutarate/malate transporter [Bacillus]
 emb|CCP20741.1| 2-oxoglutarate/malate transporter [Bacillus amyloliquefaciens 
subsp. plantarum UCMB5036]
 gb|AJC24759.1| 2-oxoglutarate translocator [Bacillus sp. Pc3]
 gb|AJH23098.1| 2-oxoglutarate translocator [Bacillus amyloliquefaciens]
Length=478

 Score = 77.8 bits (190),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 33/66 (50%), Positives = 48/66 (73%), Gaps = 0/66 (0%)
 Frame = +2

Query  335  IKPLLASIATGVILWFVPQPGGVSRNAWQLLSIFLATIVGIITQPLPLGAVALMGLGACV  514
            I PLL ++A G+I+WF+P P G+   AW L +IF+ATI+G I++PLP+GA+A+  L    
Sbjct  15   IIPLLITVAVGLIIWFIPAPSGLEPKAWHLFAIFVATIIGFISKPLPMGAIAIFALAVTA  74

Query  515  LTKTLT  532
            LT TL+
Sbjct  75   LTGTLS  80



>ref|WP_013351349.1| MULTISPECIES: 2-oxoglutarate translocator [Bacillus subtilis 
group]
 emb|CBI41844.1| 2-oxoglutarate/malate transporter [Bacillus amyloliquefaciens 
DSM 7]
 gb|AEB22862.1| 2-oxoglutarate/malate transporter [Bacillus amyloliquefaciens 
TA208]
 gb|AEB62315.1| 2-oxoglutarate/malate transporter [Bacillus amyloliquefaciens 
LL3]
 gb|AEK87860.1| 2-oxoglutarate/malate transporter [Bacillus amyloliquefaciens 
XH7]
 gb|AIW32753.1| 2-oxoglutarate translocator [Bacillus subtilis]
Length=478

 Score = 77.8 bits (190),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 33/66 (50%), Positives = 48/66 (73%), Gaps = 0/66 (0%)
 Frame = +2

Query  335  IKPLLASIATGVILWFVPQPGGVSRNAWQLLSIFLATIVGIITQPLPLGAVALMGLGACV  514
            I PLL ++A G+I+WF+P P G+   AW L +IF+ATI+G I++PLP+GA+A+  L    
Sbjct  15   IIPLLITVAVGLIIWFIPAPSGLEPKAWHLFAIFVATIIGFISKPLPMGAIAIFALAVTA  74

Query  515  LTKTLT  532
            LT TL+
Sbjct  75   LTGTLS  80



>ref|WP_007408966.1| MULTISPECIES: 2-oxoglutarate translocator [Bacillales]
 gb|ABS73157.1| YflS [Bacillus amyloliquefaciens subsp. plantarum str. FZB42]
 emb|CCG48710.1| Citrate carrier Citrate transporter [Bacillus amyloliquefaciens 
subsp. plantarum YAU B9601-Y2]
 gb|EIF12295.1| 2-oxoglutarate/malate translocator [Bacillus sp. 5B6]
 gb|AFJ60820.1| divalent anion:Na+ symporter, DASS family [Bacillus amyloliquefaciens 
Y2]
 gb|EJD67601.1| YflS [Bacillus sp. 916]
 gb|AFZ89764.1| divalent anion:Na+ symporter, DASS family protein [Bacillus amyloliquefaciens 
subsp. plantarum AS43.3]
 emb|CDG28718.1| 2-oxoglutarate/malate transporter [Bacillus amyloliquefaciens 
subsp. plantarum UCMB5033]
 emb|CDG25023.1| 2-oxoglutarate/malate transporter [Bacillus amyloliquefaciens 
subsp. plantarum UCMB5113]
 gb|ERH50988.1| 2-oxoglutarate translocator [Bacillus amyloliquefaciens EGD-AQ14]
 emb|CDH94478.1| Citrate carrier [Bacillus amyloliquefaciens subsp. plantarum 
NAU-B3]
 gb|AGZ55461.1| 2-oxoglutarate/malate translocator [Bacillus amyloliquefaciens 
CC178]
 gb|AHK48341.1| 2-oxoglutarate translocator [Bacillus amyloliquefaciens subsp. 
plantarum TrigoCor1448]
 gb|EYB35514.1| 2-oxoglutarate translocator [Bacillus amyloliquefaciens EBL11]
 gb|AHZ14735.1| Citrate carrier Citrate transporter [Bacillus amyloliquefaciens 
SQR9]
 gb|KFI14833.1| 2-oxoglutarate translocator [Bacillus subtilis]
 gb|KFX40261.1| 2-oxoglutarate translocator [Bacillus amyloliquefaciens]
 gb|AIU80898.1| Putative malate transporter YflS [Bacillus methylotrophicus]
 gb|AIW29039.1| 2-oxoglutarate translocator [Bacillus subtilis]
 gb|AIW36630.1| 2-oxoglutarate translocator [Bacillus subtilis]
 gb|AJE77762.1| 2-oxoglutarate translocator [Bacillus sp. BH072]
 gb|KIR06440.1| 2-oxoglutarate translocator [Bacillus amyloliquefaciens subsp. 
plantarum]
 gb|KJD58150.1| 2-oxoglutarate translocator [Bacillus amyloliquefaciens]
Length=478

 Score = 77.8 bits (190),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 33/66 (50%), Positives = 48/66 (73%), Gaps = 0/66 (0%)
 Frame = +2

Query  335  IKPLLASIATGVILWFVPQPGGVSRNAWQLLSIFLATIVGIITQPLPLGAVALMGLGACV  514
            I PLL ++A G+I+WF+P P G+   AW L +IF+ATI+G I++PLP+GA+A+  L    
Sbjct  15   IIPLLITVAVGLIIWFIPAPSGLEPKAWHLFAIFVATIIGFISKPLPMGAIAIFALAVTA  74

Query  515  LTKTLT  532
            LT TL+
Sbjct  75   LTGTLS  80



>ref|WP_042634956.1| 2-oxoglutarate translocator [Bacillus amyloliquefaciens]
 gb|AJK64496.1| 2-oxoglutarate/malate transporter [Bacillus amyloliquefaciens 
subsp. amyloliquefaciens KHG19]
Length=478

 Score = 77.4 bits (189),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 33/66 (50%), Positives = 48/66 (73%), Gaps = 0/66 (0%)
 Frame = +2

Query  335  IKPLLASIATGVILWFVPQPGGVSRNAWQLLSIFLATIVGIITQPLPLGAVALMGLGACV  514
            I PLL ++A G+I+WF+P P G+   AW L +IF+ATI+G I++PLP+GA+A+  L    
Sbjct  15   IIPLLITVAAGLIIWFIPAPSGLEPKAWHLFAIFVATIIGFISKPLPMGAIAIFALAVTA  74

Query  515  LTKTLT  532
            LT TL+
Sbjct  75   LTGTLS  80



>ref|WP_003155645.1| MULTISPECIES: 2-oxoglutarate translocator [Bacillus subtilis 
group]
 emb|CCF04276.1| Citrate carrier Citrate transporter [Bacillus amyloliquefaciens 
subsp. plantarum CAU B946]
 gb|EKE46374.1| Citrate carrier Citrate transporter [Bacillus amyloliquefaciens 
subsp. plantarum M27]
 gb|AGF28678.1| Citrate carrier Citrate transporter [Bacillus amyloliquefaciens 
IT-45]
 gb|ERK81651.1| 2-oxoglutarate translocator [Bacillus amyloliquefaciens UASWS 
BA1]
 gb|AHC41276.1| 2-oxoglutarate translocator [Bacillus amyloliquefaciens LFB112]
 gb|AIU76127.1| 2-oxoglutarate translocator [Bacillus subtilis]
Length=478

 Score = 77.4 bits (189),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 33/66 (50%), Positives = 48/66 (73%), Gaps = 0/66 (0%)
 Frame = +2

Query  335  IKPLLASIATGVILWFVPQPGGVSRNAWQLLSIFLATIVGIITQPLPLGAVALMGLGACV  514
            I PLL ++A G+I+WF+P P G+   AW L +IF+ATI+G I++PLP+GA+A+  L    
Sbjct  15   IIPLLITVAVGLIIWFIPAPSGLEPKAWHLFAIFVATIIGFISKPLPMGAIAIFALAVTA  74

Query  515  LTKTLT  532
            LT TL+
Sbjct  75   LTGTLS  80



>ref|WP_038829541.1| 2-oxoglutarate translocator, partial [Bacillus subtilis]
Length=450

 Score = 77.4 bits (189),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 32/64 (50%), Positives = 47/64 (73%), Gaps = 0/64 (0%)
 Frame = +2

Query  341  PLLASIATGVILWFVPQPGGVSRNAWQLLSIFLATIVGIITQPLPLGAVALMGLGACVLT  520
            PLL ++A G+I+WF+P P G+   AW L +IF+ATI+G I++PLP+GA+A+  L    LT
Sbjct  17   PLLITVAVGLIIWFIPAPSGLEPKAWHLFAIFVATIIGFISKPLPMGAIAIFALAVTALT  76

Query  521  KTLT  532
             TL+
Sbjct  77   GTLS  80



>ref|XP_009774993.1| PREDICTED: dicarboxylate transporter 2.1, chloroplastic-like 
[Nicotiana sylvestris]
 gb|AAM89397.1| glutamate/malate translocator [Nicotiana tabacum]
Length=583

 Score = 77.8 bits (190),  Expect = 2e-13, Method: Composition-based stats.
 Identities = 38/65 (58%), Positives = 50/65 (77%), Gaps = 1/65 (2%)
 Frame = +2

Query  341  PLLASIATGVIL-WFVPQPGGVSRNAWQLLSIFLATIVGIITQPLPLGAVALMGLGACVL  517
            PL+ S++ G+I+ +FVP+P  VS  AWQLLSIFL+TI G++  PLP+GA A +GL   VL
Sbjct  118  PLIISVSIGLIVRFFVPKPPEVSPQAWQLLSIFLSTIAGLVLSPLPVGAWAFLGLTTSVL  177

Query  518  TKTLT  532
            TKTLT
Sbjct  178  TKTLT  182



>ref|XP_009624586.1| PREDICTED: dicarboxylate transporter 2.1, chloroplastic [Nicotiana 
tomentosiformis]
Length=585

 Score = 77.8 bits (190),  Expect = 2e-13, Method: Composition-based stats.
 Identities = 38/65 (58%), Positives = 50/65 (77%), Gaps = 1/65 (2%)
 Frame = +2

Query  341  PLLASIATGVIL-WFVPQPGGVSRNAWQLLSIFLATIVGIITQPLPLGAVALMGLGACVL  517
            PL+ S++ G+I+ +FVP+P  VS  AWQLLSIFL+TI G++  PLP+GA A +GL   VL
Sbjct  120  PLIISVSIGLIVRFFVPKPPEVSLQAWQLLSIFLSTIAGLVLSPLPVGAWAFLGLTTSVL  179

Query  518  TKTLT  532
            TKTLT
Sbjct  180  TKTLT  184



>ref|WP_036800605.1| 2-oxoglutarate translocator [Pleurocapsa sp. PCC 7319]
Length=472

 Score = 77.0 bits (188),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 35/65 (54%), Positives = 48/65 (74%), Gaps = 0/65 (0%)
 Frame = +2

Query  338  KPLLASIATGVILWFVPQPGGVSRNAWQLLSIFLATIVGIITQPLPLGAVALMGLGACVL  517
            K  +  +  G++LWF+P P GV+  AW LL+IFLATI+G IT+PLP+GAVA++ L   V+
Sbjct  9    KSFIFPLFVGILLWFIPSPEGVNEQAWHLLAIFLATIIGFITKPLPIGAVAVIALTVSVI  68

Query  518  TKTLT  532
            T TLT
Sbjct  69   TDTLT  73



>ref|WP_010333359.1| 2-oxoglutarate translocator [Bacillus mojavensis]
Length=478

 Score = 77.0 bits (188),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 32/64 (50%), Positives = 47/64 (73%), Gaps = 0/64 (0%)
 Frame = +2

Query  341  PLLASIATGVILWFVPQPGGVSRNAWQLLSIFLATIVGIITQPLPLGAVALMGLGACVLT  520
            PLL ++A G+I+WF+P P G+   AW L +IF+ATI+G I++PLP+GA+A+  L    LT
Sbjct  17   PLLITVAVGLIIWFIPAPSGLEPKAWHLFAIFVATIIGFISKPLPMGAIAIFALAVTALT  76

Query  521  KTLT  532
             TL+
Sbjct  77   GTLS  80



>ref|WP_024572847.1| 2-oxoglutarate translocator [Bacillus subtilis]
 gb|KIU10460.1| 2-oxoglutarate/malate transporter [Bacillus subtilis]
Length=478

 Score = 77.0 bits (188),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 32/64 (50%), Positives = 47/64 (73%), Gaps = 0/64 (0%)
 Frame = +2

Query  341  PLLASIATGVILWFVPQPGGVSRNAWQLLSIFLATIVGIITQPLPLGAVALMGLGACVLT  520
            PLL ++A G+I+WF+P P G+   AW L +IF+ATI+G I++PLP+GA+A+  L    LT
Sbjct  17   PLLITVAVGLIIWFIPAPSGLEPKAWHLFAIFVATIIGFISKPLPMGAIAIFALAVTALT  76

Query  521  KTLT  532
             TL+
Sbjct  77   GTLS  80



>ref|WP_015383080.1| MULTISPECIES: 2-oxoglutarate/malate transporter [Bacillus]
 gb|AGE62620.1| 2-oxoglutarate/malate transporter [Bacillus subtilis XF-1]
 gb|AGI28021.1| 2-oxoglutarate/malate transporter [Bacillus subtilis subsp. subtilis 
str. BAB-1]
 gb|ERI42751.1| 2-oxoglutarate translocator [Bacillus sp. EGD-AK10]
 gb|AID00435.1| 2-oxoglutarate translocator [Bacillus subtilis subsp. subtilis 
str. OH 131.1]
 emb|CCU59962.1| 2-oxoglutarate/malate translocator [Bacillus subtilis E1]
 gb|KFF56609.1| 2-oxoglutarate translocator [Bacillus subtilis]
 gb|KIN32357.1| hypothetical protein B4068_0716 [Bacillus subtilis]
 gb|KIN34108.1| hypothetical protein B4070_0771 [Bacillus subtilis]
 gb|KIN49661.1| hypothetical protein B4146_0798 [Bacillus subtilis]
 gb|KIN53365.1| hypothetical protein B4073_0722 [Bacillus subtilis]
 gb|KIO54969.1| hypothetical protein B4143_0730 [Bacillus subtilis]
 gb|AJO57407.1| 2-oxoglutarate translocator [Bacillus sp. YP1]
Length=478

 Score = 77.0 bits (188),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 32/64 (50%), Positives = 47/64 (73%), Gaps = 0/64 (0%)
 Frame = +2

Query  341  PLLASIATGVILWFVPQPGGVSRNAWQLLSIFLATIVGIITQPLPLGAVALMGLGACVLT  520
            PLL ++A G+I+WF+P P G+   AW L +IF+ATI+G I++PLP+GA+A+  L    LT
Sbjct  17   PLLITVAVGLIIWFIPAPSGLEPKAWHLFAIFVATIIGFISKPLPMGAIAIFALAVTALT  76

Query  521  KTLT  532
             TL+
Sbjct  77   GTLS  80



>ref|WP_013390434.1| MULTISPECIES: 2-oxoglutarate translocator [Bacillus subtilis 
group]
 gb|ADP31232.1| 2-oxoglutarate/malate transporter [Bacillus atrophaeus 1942]
 gb|AIK49393.1| 2-oxoglutarate/malate translocator [Bacillus atrophaeus subsp. 
globigii]
 gb|KFK81246.1| 2-oxoglutarate/malate translocator, chloroplastic [Bacillus subtilis 
subsp. niger]
 gb|AJF84091.1| 2-oxoglutarate translocator [Bacillus atrophaeus]
Length=478

 Score = 77.0 bits (188),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 32/64 (50%), Positives = 47/64 (73%), Gaps = 0/64 (0%)
 Frame = +2

Query  341  PLLASIATGVILWFVPQPGGVSRNAWQLLSIFLATIVGIITQPLPLGAVALMGLGACVLT  520
            PLL ++A G+I+WF+P P G+   AW L +IF+ATI+G I++PLP+GA+A+  L    LT
Sbjct  17   PLLITVAVGLIIWFIPAPSGLEPKAWHLFAIFVATIIGFISKPLPMGAIAIFALAVTALT  76

Query  521  KTLT  532
             TL+
Sbjct  77   GTLS  80



>ref|WP_010787924.1| 2-oxoglutarate/malate translocator [Bacillus atrophaeus]
 gb|EOB38136.1| 2-oxoglutarate/malate translocator [Bacillus atrophaeus UCMB-5137]
Length=478

 Score = 77.0 bits (188),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 32/64 (50%), Positives = 47/64 (73%), Gaps = 0/64 (0%)
 Frame = +2

Query  341  PLLASIATGVILWFVPQPGGVSRNAWQLLSIFLATIVGIITQPLPLGAVALMGLGACVLT  520
            PLL ++A G+I+WF+P P G+   AW L +IF+ATI+G I++PLP+GA+A+  L    LT
Sbjct  17   PLLITVAVGLIIWFIPAPSGLEPKAWHLFAIFVATIIGFISKPLPMGAIAIFALAVTALT  76

Query  521  KTLT  532
             TL+
Sbjct  77   GTLS  80



>ref|WP_041057032.1| 2-oxoglutarate translocator [Bacillus subtilis]
 gb|KIL30211.1| hypothetical protein B4067_0819 [Bacillus subtilis subsp. subtilis]
 gb|KIN58890.1| hypothetical protein B4145_0772 [Bacillus subtilis]
Length=478

 Score = 77.0 bits (188),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 32/64 (50%), Positives = 47/64 (73%), Gaps = 0/64 (0%)
 Frame = +2

Query  341  PLLASIATGVILWFVPQPGGVSRNAWQLLSIFLATIVGIITQPLPLGAVALMGLGACVLT  520
            PLL ++A G+I+WF+P P G+   AW L +IF+ATI+G I++PLP+GA+A+  L    LT
Sbjct  17   PLLITVAVGLIIWFIPAPSGLEPKAWHLFAIFVATIIGFISKPLPMGAIAIFALAVTALT  76

Query  521  KTLT  532
             TL+
Sbjct  77   GTLS  80



>gb|KIN32538.1| hypothetical protein B4069_0846 [Bacillus subtilis]
 gb|KIN44477.1| hypothetical protein B4071_0845 [Bacillus subtilis]
 gb|KIN49092.1| hypothetical protein B4072_0842 [Bacillus subtilis]
Length=493

 Score = 77.0 bits (188),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 32/64 (50%), Positives = 47/64 (73%), Gaps = 0/64 (0%)
 Frame = +2

Query  341  PLLASIATGVILWFVPQPGGVSRNAWQLLSIFLATIVGIITQPLPLGAVALMGLGACVLT  520
            PLL ++A G+I+WF+P P G+   AW L +IF+ATI+G I++PLP+GA+A+  L    LT
Sbjct  32   PLLITVAVGLIIWFIPAPSGLEPKAWHLFAIFVATIIGFISKPLPMGAIAIFALAVTALT  91

Query  521  KTLT  532
             TL+
Sbjct  92   GTLS  95



>ref|WP_039076181.1| 2-oxoglutarate translocator [Bacillus sp. MSP13]
Length=478

 Score = 77.0 bits (188),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 32/64 (50%), Positives = 47/64 (73%), Gaps = 0/64 (0%)
 Frame = +2

Query  341  PLLASIATGVILWFVPQPGGVSRNAWQLLSIFLATIVGIITQPLPLGAVALMGLGACVLT  520
            PLL ++A G+I+WF+P P G+   AW L +IF+ATI+G I++PLP+GA+A+  L    LT
Sbjct  17   PLLITVAVGLIIWFIPAPSGLEPKAWHLFAIFVATIIGFISKPLPMGAIAIFALAVTALT  76

Query  521  KTLT  532
             TL+
Sbjct  77   GTLS  80



>ref|WP_041906771.1| MULTISPECIES: 2-oxoglutarate translocator [Bacillus]
 gb|KFI01861.1| 2-oxoglutarate translocator [Bacillus sp. BSC154]
Length=478

 Score = 77.0 bits (188),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 32/64 (50%), Positives = 47/64 (73%), Gaps = 0/64 (0%)
 Frame = +2

Query  341  PLLASIATGVILWFVPQPGGVSRNAWQLLSIFLATIVGIITQPLPLGAVALMGLGACVLT  520
            PLL ++A G+I+WF+P P G+   AW L +IF+ATI+G I++PLP+GA+A+  L    LT
Sbjct  17   PLLITVAVGLIIWFIPAPSGLEPKAWHLFAIFVATIIGFISKPLPMGAIAIFALAVTALT  76

Query  521  KTLT  532
             TL+
Sbjct  77   GTLS  80



>ref|WP_019713597.1| 2-oxoglutarate translocator [Bacillus subtilis]
Length=478

 Score = 77.0 bits (188),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 32/64 (50%), Positives = 47/64 (73%), Gaps = 0/64 (0%)
 Frame = +2

Query  341  PLLASIATGVILWFVPQPGGVSRNAWQLLSIFLATIVGIITQPLPLGAVALMGLGACVLT  520
            PLL ++A G+I+WF+P P G+   AW L +IF+ATI+G I++PLP+GA+A+  L    LT
Sbjct  17   PLLITVAVGLIIWFIPAPSGLEPKAWHLFAIFVATIIGFISKPLPMGAIAIFALAVTALT  76

Query  521  KTLT  532
             TL+
Sbjct  77   GTLS  80



>ref|WP_044163592.1| 2-oxoglutarate translocator [Salinibacillus aidingensis]
Length=478

 Score = 77.0 bits (188),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 32/64 (50%), Positives = 47/64 (73%), Gaps = 0/64 (0%)
 Frame = +2

Query  341  PLLASIATGVILWFVPQPGGVSRNAWQLLSIFLATIVGIITQPLPLGAVALMGLGACVLT  520
            PLL ++A G+I+WF+P P G+   AW L +IF+ATI+G I++PLP+GA+A+  L    LT
Sbjct  17   PLLITVAVGLIIWFIPAPSGLEPKAWHLFAIFVATIIGFISKPLPMGAIAIFALAVTALT  76

Query  521  KTLT  532
             TL+
Sbjct  77   GTLS  80



>ref|WP_010330322.1| 2-oxoglutarate translocator [Bacillus vallismortis]
Length=478

 Score = 77.0 bits (188),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 32/64 (50%), Positives = 47/64 (73%), Gaps = 0/64 (0%)
 Frame = +2

Query  341  PLLASIATGVILWFVPQPGGVSRNAWQLLSIFLATIVGIITQPLPLGAVALMGLGACVLT  520
            PLL ++A G+I+WF+P P G+   AW L +IF+ATI+G I++PLP+GA+A+  L    LT
Sbjct  17   PLLITVAVGLIIWFIPAPSGLEPKAWHLFAIFVATIIGFISKPLPMGAIAIFALAVTALT  76

Query  521  KTLT  532
             TL+
Sbjct  77   GTLS  80



>ref|WP_024120552.1| 2-oxoglutarate translocator [Bacillus mojavensis]
Length=478

 Score = 77.0 bits (188),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 32/64 (50%), Positives = 47/64 (73%), Gaps = 0/64 (0%)
 Frame = +2

Query  341  PLLASIATGVILWFVPQPGGVSRNAWQLLSIFLATIVGIITQPLPLGAVALMGLGACVLT  520
            PLL ++A G+I+WF+P P G+   AW L +IF+ATI+G I++PLP+GA+A+  L    LT
Sbjct  17   PLLITVAVGLIIWFIPAPSGLEPKAWHLFAIFVATIIGFISKPLPMGAIAIFALAVTALT  76

Query  521  KTLT  532
             TL+
Sbjct  77   GTLS  80



>ref|WP_014113016.1| 2-oxoglutarate translocator [Bacillus subtilis]
 gb|AEP85700.1| 2-oxoglutarate/malate translocator [Bacillus subtilis subsp. 
spizizenii TU-B-10]
Length=478

 Score = 77.0 bits (188),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 32/64 (50%), Positives = 47/64 (73%), Gaps = 0/64 (0%)
 Frame = +2

Query  341  PLLASIATGVILWFVPQPGGVSRNAWQLLSIFLATIVGIITQPLPLGAVALMGLGACVLT  520
            PLL ++A G+I+WF+P P G+   AW L +IF+ATI+G I++PLP+GA+A+  L    LT
Sbjct  17   PLLITVAVGLIIWFIPAPSGLEPKAWHLFAIFVATIIGFISKPLPMGAIAIFALAVTALT  76

Query  521  KTLT  532
             TL+
Sbjct  77   GTLS  80



>ref|WP_024715768.1| 2-oxoglutarate translocator [Bacillus tequilensis]
Length=478

 Score = 76.6 bits (187),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 32/64 (50%), Positives = 47/64 (73%), Gaps = 0/64 (0%)
 Frame = +2

Query  341  PLLASIATGVILWFVPQPGGVSRNAWQLLSIFLATIVGIITQPLPLGAVALMGLGACVLT  520
            PLL ++A G+I+WF+P P G+   AW L +IF+ATI+G I++PLP+GA+A+  L    LT
Sbjct  17   PLLITVAVGLIIWFIPAPSGLEPKAWHLFAIFVATIIGFISKPLPMGAIAIFALAVTALT  76

Query  521  KTLT  532
             TL+
Sbjct  77   GTLS  80



>ref|WP_003233725.1| 2-oxoglutarate translocator [Bacillus subtilis]
 ref|NP_388638.1| malate transporter YflS [Bacillus subtilis subsp. subtilis str. 
168]
 sp|O34726.1|YFLS_BACSU RecName: Full=Putative malate transporter YflS [Bacillus subtilis 
subsp. subtilis str. 168]
 dbj|BAA22312.1| YflS [Bacillus subtilis]
 emb|CAB12586.1| 2-oxoglutarate/malate transporter [Bacillus subtilis subsp. subtilis 
str. 168]
 dbj|BAI84272.1| hypothetical protein BSNT_07134 [Bacillus subtilis subsp. natto 
BEST195]
 gb|ADV95745.1| 2-oxoglutarate/malate transporter [Bacillus subtilis BSn5]
 gb|AEP89842.1| 2-oxoglutarate/malate translocator [Bacillus subtilis subsp. 
subtilis str. RO-NN-1]
 gb|EHA29288.1| hypothetical protein BSSC8_35680 [Bacillus subtilis subsp. subtilis 
str. SC-8]
 gb|AFQ56676.1| 2-oxoglutarate/malate transporter [Bacillus subtilis QB928]
 dbj|BAM49680.1| 2-oxoglutarate/malate transporter [Bacillus subtilis BEST7613]
 dbj|BAM56950.1| 2-oxoglutarate/malate transporter [Bacillus subtilis BEST7003]
 gb|AGA21274.1| Malate transporter YflS [Bacillus subtilis subsp. subtilis str. 
BSP1]
 gb|EME07702.1| Na+ symporter (DASS) family protein [Bacillus subtilis MB73/2]
 gb|AGG60110.1| 2-oxoglutarate/malate transporter YflS [Bacillus subtilis subsp. 
subtilis 6051-HGW]
 gb|AHA76716.1| Putative malate transporter yflS [Bacillus subtilis PY79]
 gb|EXF51708.1| 2-oxoglutarate translocator [Bacillus subtilis QH-1]
 gb|KDE24759.1| 2-oxoglutarate translocator [Bacillus subtilis]
 gb|AIC39140.1| 2-oxoglutarate/malate transporter [Bacillus subtilis subsp. subtilis 
str. JH642 substr. AG174]
 gb|AIC43372.1| 2-oxoglutarate/malate transporter [Bacillus subtilis subsp. subtilis 
str. AG1839]
 gb|KFC28723.1| 2-oxoglutarate translocator [Bacillus subtilis]
 gb|KFH30358.1| 2-oxoglutarate translocator [Bacillus subtilis subsp. subtilis]
 gb|KFH30640.1| 2-oxoglutarate translocator [Bacillus subtilis subsp. subtilis]
 dbj|GAK79227.1| 2-oxoglutarate/malate transporter [Bacillus subtilis Miyagi-4]
 gb|AIX06521.1| Putative malate transporter YflS [Bacillus subtilis]
 emb|CEI55895.1| malate transporter YflS [Bacillus subtilis]
 emb|CEJ76320.1| malate transporter YflS [Bacillus sp.]
 gb|AIY92047.1| 2-oxoglutarate translocator [Bacillus subtilis subsp. subtilis 
str. 168]
 gb|AIY96359.1| 2-oxoglutarate translocator [Bacillus subtilis]
 gb|AJE93426.1| 2-oxoglutarate translocator [Bacillus subtilis subsp. subtilis]
 gb|KIX81986.1| Putative malate transporter YflS [Bacillus subtilis]
Length=478

 Score = 76.6 bits (187),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 32/64 (50%), Positives = 47/64 (73%), Gaps = 0/64 (0%)
 Frame = +2

Query  341  PLLASIATGVILWFVPQPGGVSRNAWQLLSIFLATIVGIITQPLPLGAVALMGLGACVLT  520
            PLL ++A G+I+WF+P P G+   AW L +IF+ATI+G I++PLP+GA+A+  L    LT
Sbjct  17   PLLITVAVGLIIWFIPAPSGLEPKAWHLFAIFVATIIGFISKPLPMGAIAIFALAVTALT  76

Query  521  KTLT  532
             TL+
Sbjct  77   GTLS  80



>ref|WP_003239908.1| hypothetical protein [Bacillus subtilis]
 gb|ELS60507.1| hypothetical protein BSI_29070 [Bacillus subtilis subsp. inaquosorum 
KCTC 13429]
Length=478

 Score = 76.6 bits (187),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 32/64 (50%), Positives = 47/64 (73%), Gaps = 0/64 (0%)
 Frame = +2

Query  341  PLLASIATGVILWFVPQPGGVSRNAWQLLSIFLATIVGIITQPLPLGAVALMGLGACVLT  520
            PLL ++A G+I+WF+P P G+   AW L +IF+ATI+G I++PLP+GA+A+  L    LT
Sbjct  17   PLLITVAVGLIIWFIPAPSGLEPKAWHLFAIFVATIIGFISKPLPMGAIAIFALAVTALT  76

Query  521  KTLT  532
             TL+
Sbjct  77   GTLS  80



>ref|WP_040083848.1| 2-oxoglutarate translocator [Bacillus sp. A053]
 gb|KIH38638.1| 2-oxoglutarate translocator [Bacillus sp. A053]
Length=478

 Score = 76.6 bits (187),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 32/64 (50%), Positives = 47/64 (73%), Gaps = 0/64 (0%)
 Frame = +2

Query  341  PLLASIATGVILWFVPQPGGVSRNAWQLLSIFLATIVGIITQPLPLGAVALMGLGACVLT  520
            PLL ++A G+I+WF+P P G+   AW L +IF+ATI+G I++PLP+GA+A+  L    LT
Sbjct  17   PLLITVAVGLIIWFIPAPSGLEPKAWHLFAIFVATIIGFISKPLPMGAIAIFALAVTALT  76

Query  521  KTLT  532
             TL+
Sbjct  77   GTLS  80



>ref|WP_019257759.1| 2-oxoglutarate translocator [Bacillus subtilis]
Length=478

 Score = 76.6 bits (187),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 32/64 (50%), Positives = 47/64 (73%), Gaps = 0/64 (0%)
 Frame = +2

Query  341  PLLASIATGVILWFVPQPGGVSRNAWQLLSIFLATIVGIITQPLPLGAVALMGLGACVLT  520
            PLL ++A G+I+WF+P P G+   AW L +IF+ATI+G I++PLP+GA+A+  L    LT
Sbjct  17   PLLITVAVGLIIWFIPAPSGLEPKAWHLFAIFVATIIGFISKPLPMGAIAIFALAVTALT  76

Query  521  KTLT  532
             TL+
Sbjct  77   GTLS  80



>ref|WP_014663179.1| 2-oxoglutarate translocator [Bacillus sp. JS]
 gb|AFI27386.1| 2-oxoglutarate/malate translocator [Bacillus sp. JS]
Length=478

 Score = 76.6 bits (187),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 32/64 (50%), Positives = 47/64 (73%), Gaps = 0/64 (0%)
 Frame = +2

Query  341  PLLASIATGVILWFVPQPGGVSRNAWQLLSIFLATIVGIITQPLPLGAVALMGLGACVLT  520
            PLL ++A G+I+WF+P P G+   AW L +IF+ATI+G I++PLP+GA+A+  L    LT
Sbjct  17   PLLITVAVGLIIWFIPAPSGLEPKAWHLFAIFVATIIGFISKPLPMGAIAIFALAVTALT  76

Query  521  KTLT  532
             TL+
Sbjct  77   GTLS  80



>ref|WP_003328331.1| 2-oxoglutarate translocator [Bacillus atrophaeus]
 gb|EIM09398.1| 2-oxoglutarate/malate transporter [Bacillus atrophaeus C89]
Length=478

 Score = 76.6 bits (187),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 32/64 (50%), Positives = 47/64 (73%), Gaps = 0/64 (0%)
 Frame = +2

Query  341  PLLASIATGVILWFVPQPGGVSRNAWQLLSIFLATIVGIITQPLPLGAVALMGLGACVLT  520
            PLL ++A G+I+WF+P P G+   AW L +IF+ATI+G I++PLP+GA+A+  L    LT
Sbjct  17   PLLITVAVGLIIWFIPAPSGLEPKAWHLFAIFVATIIGFISKPLPMGAIAIFALAVTALT  76

Query  521  KTLT  532
             TL+
Sbjct  77   GTLS  80



>ref|XP_011087921.1| PREDICTED: dicarboxylate transporter 2.1, chloroplastic-like 
[Sesamum indicum]
Length=562

 Score = 76.6 bits (187),  Expect = 5e-13, Method: Composition-based stats.
 Identities = 37/65 (57%), Positives = 50/65 (77%), Gaps = 1/65 (2%)
 Frame = +2

Query  341  PLLASIATGVIL-WFVPQPGGVSRNAWQLLSIFLATIVGIITQPLPLGAVALMGLGACVL  517
            PLL SIA G+++ +FVP+P  V+  AWQLLSIFL+TI G++  PLP+GA A +GL   ++
Sbjct  97   PLLISIAIGILVRFFVPKPPEVTPQAWQLLSIFLSTIAGLVLSPLPVGAWAFLGLTTSIV  156

Query  518  TKTLT  532
            TKTLT
Sbjct  157  TKTLT  161



>ref|WP_042744509.1| 2-oxoglutarate translocator, partial [Oenococcus oeni]
Length=163

 Score = 73.2 bits (178),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 35/59 (59%), Positives = 46/59 (78%), Gaps = 0/59 (0%)
 Frame = +2

Query  356  IATGVILWFVPQPGGVSRNAWQLLSIFLATIVGIITQPLPLGAVALMGLGACVLTKTLT  532
            IA G+ILW +P P G+  +AW LL+IF+ TIVGIIT PLP+GAV+++GL   +LT TLT
Sbjct  9    IAVGIILWLIPAPVGIKIHAWHLLAIFIGTIVGIITGPLPMGAVSMLGLVLVMLTGTLT  67



>ref|XP_003078785.1| 2-oxoglutarate/malate translocator (ISS) [Ostreococcus tauri]
 emb|CAL51665.1| Sodium/sulphate symporter [Ostreococcus tauri]
Length=565

 Score = 76.6 bits (187),  Expect = 6e-13, Method: Composition-based stats.
 Identities = 33/57 (58%), Positives = 46/57 (81%), Gaps = 0/57 (0%)
 Frame = +2

Query  335  IKPLLASIATGVILWFVPQPGGVSRNAWQLLSIFLATIVGIITQPLPLGAVALMGLG  505
            +KPL  S+  G++++ +P P GV+  AW LL++F+ATIVGIIT PLPLGAVA++GLG
Sbjct  100  LKPLGYSVLAGLLIYLIPTPAGVTVKAWNLLAVFVATIVGIITNPLPLGAVAMIGLG  156



>gb|EYU18451.1| hypothetical protein MIMGU_mgv1a003725mg [Erythranthe guttata]
Length=568

 Score = 76.6 bits (187),  Expect = 6e-13, Method: Composition-based stats.
 Identities = 37/65 (57%), Positives = 49/65 (75%), Gaps = 1/65 (2%)
 Frame = +2

Query  341  PLLASIATGV-ILWFVPQPGGVSRNAWQLLSIFLATIVGIITQPLPLGAVALMGLGACVL  517
            PL+ S+A G+ + +FVP+P  V+  AWQLLSIFL+TI G++  PLP+GA A +GL   VL
Sbjct  103  PLIISLAIGIAVRFFVPKPVEVTPQAWQLLSIFLSTIAGLVLSPLPVGAWAFLGLTTAVL  162

Query  518  TKTLT  532
            TKTLT
Sbjct  163  TKTLT  167



>ref|WP_025752426.1| 2-oxoglutarate translocator [Bacillus flexus]
Length=477

 Score = 76.3 bits (186),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 36/64 (56%), Positives = 48/64 (75%), Gaps = 0/64 (0%)
 Frame = +2

Query  341  PLLASIATGVILWFVPQPGGVSRNAWQLLSIFLATIVGIITQPLPLGAVALMGLGACVLT  520
            PLL  +ATG++LWF+  P G+   AW L +IF+ATIVG+I +PLPLG+VA++ L   VLT
Sbjct  16   PLLICLATGLVLWFITPPSGLDVKAWHLFAIFVATIVGLIIKPLPLGSVAILSLTIIVLT  75

Query  521  KTLT  532
             TLT
Sbjct  76   NTLT  79



>gb|KGH77071.1| 2-oxoglutarate translocator, partial [Oenococcus oeni IOEB_9304]
Length=179

 Score = 73.2 bits (178),  Expect = 7e-13, Method: Compositional matrix adjust.
 Identities = 35/59 (59%), Positives = 46/59 (78%), Gaps = 0/59 (0%)
 Frame = +2

Query  356  IATGVILWFVPQPGGVSRNAWQLLSIFLATIVGIITQPLPLGAVALMGLGACVLTKTLT  532
            IA G+ILW +P P G+  +AW LL+IF+ TIVGIIT PLP+GAV+++GL   +LT TLT
Sbjct  25   IAVGIILWLIPAPVGIKIHAWHLLAIFIGTIVGIITGPLPMGAVSMLGLVLVMLTGTLT  83



>gb|KFM93392.1| transporter, divalent anion:Na+ symporter family protein [Bacillus 
licheniformis]
Length=295

 Score = 73.9 bits (180),  Expect = 9e-13, Method: Compositional matrix adjust.
 Identities = 31/66 (47%), Positives = 45/66 (68%), Gaps = 0/66 (0%)
 Frame = +2

Query  335  IKPLLASIATGVILWFVPQPGGVSRNAWQLLSIFLATIVGIITQPLPLGAVALMGLGACV  514
            I PL  +I  G ++WF+P P G+   AW L +IF+ATI+G I++PLP+GA+A+  L    
Sbjct  15   IIPLAVTILVGAVIWFIPSPAGLDPKAWHLFAIFVATIIGFISKPLPMGAIAVFALAVTA  74

Query  515  LTKTLT  532
            LT TL+
Sbjct  75   LTGTLS  80



>ref|XP_010315125.1| PREDICTED: LOW QUALITY PROTEIN: dicarboxylate transporter 2.1, 
chloroplastic-like [Solanum lycopersicum]
Length=584

 Score = 75.9 bits (185),  Expect = 9e-13, Method: Composition-based stats.
 Identities = 38/65 (58%), Positives = 49/65 (75%), Gaps = 1/65 (2%)
 Frame = +2

Query  341  PLLASIATGVILWF-VPQPGGVSRNAWQLLSIFLATIVGIITQPLPLGAVALMGLGACVL  517
            PL+ S++ G+I+ F VP+P  VS  AWQLLSIFL+TI G++  PLP+GA A +GL   VL
Sbjct  119  PLIISVSIGLIVRFLVPRPPEVSPQAWQLLSIFLSTIAGLVLSPLPVGAWAFLGLTTSVL  178

Query  518  TKTLT  532
            TKTLT
Sbjct  179  TKTLT  183



>ref|XP_006351757.1| PREDICTED: dicarboxylate transporter 2.1, chloroplastic-like 
[Solanum tuberosum]
Length=584

 Score = 75.9 bits (185),  Expect = 1e-12, Method: Composition-based stats.
 Identities = 38/65 (58%), Positives = 49/65 (75%), Gaps = 1/65 (2%)
 Frame = +2

Query  341  PLLASIATGVILWF-VPQPGGVSRNAWQLLSIFLATIVGIITQPLPLGAVALMGLGACVL  517
            PL+ S++ G+I+ F VP+P  VS  AWQLLSIFL+TI G++  PLP+GA A +GL   VL
Sbjct  119  PLIISVSIGLIVRFLVPRPPEVSPQAWQLLSIFLSTIAGLVLSPLPVGAWAFLGLTTSVL  178

Query  518  TKTLT  532
            TKTLT
Sbjct  179  TKTLT  183



>ref|XP_004485598.1| PREDICTED: dicarboxylate transporter 2.1, chloroplastic-like 
[Cicer arietinum]
Length=566

 Score = 75.9 bits (185),  Expect = 1e-12, Method: Composition-based stats.
 Identities = 37/65 (57%), Positives = 50/65 (77%), Gaps = 1/65 (2%)
 Frame = +2

Query  341  PLLASIATGVIL-WFVPQPGGVSRNAWQLLSIFLATIVGIITQPLPLGAVALMGLGACVL  517
            P + SIA G+I+ +FVP+P  V+  AWQLLSIFL+TI G++  PLP+GA A +GL A V+
Sbjct  101  PFVISIAIGLIVRFFVPKPVEVTPQAWQLLSIFLSTIAGLVLSPLPVGAWAFLGLTASVV  160

Query  518  TKTLT  532
            TKTL+
Sbjct  161  TKTLS  165



>ref|XP_010266911.1| PREDICTED: dicarboxylate transporter 2.1, chloroplastic-like 
[Nelumbo nucifera]
Length=578

 Score = 75.5 bits (184),  Expect = 1e-12, Method: Composition-based stats.
 Identities = 36/65 (55%), Positives = 50/65 (77%), Gaps = 1/65 (2%)
 Frame = +2

Query  341  PLLASIATGVIL-WFVPQPGGVSRNAWQLLSIFLATIVGIITQPLPLGAVALMGLGACVL  517
            PL+ S+A GVI+ +FVP+P  V+  AWQLLSIFL+TI G++  PLP+GA A +GL   ++
Sbjct  113  PLVISVAIGVIVRFFVPKPVEVTPQAWQLLSIFLSTIAGLVLSPLPVGAWAFLGLTTSIV  172

Query  518  TKTLT  532
            TKTL+
Sbjct  173  TKTLS  177



>ref|WP_019392157.1| MULTISPECIES: 2-oxoglutarate translocator [Bacillus]
Length=466

 Score = 75.1 bits (183),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 32/66 (48%), Positives = 48/66 (73%), Gaps = 0/66 (0%)
 Frame = +2

Query  335  IKPLLASIATGVILWFVPQPGGVSRNAWQLLSIFLATIVGIITQPLPLGAVALMGLGACV  514
            + P L +IA GV++WF+P+P GV   AW LL+IF+ATI+G I +PLP+G++A++ L    
Sbjct  3    VVPFLITIAIGVLIWFIPEPSGVDPKAWHLLAIFVATIIGFILKPLPMGSLAILSLAVVA  62

Query  515  LTKTLT  532
            +T  LT
Sbjct  63   VTGVLT  68



>ref|XP_002866607.1| DCT/DIT2.1 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH42866.1| DCT/DIT2.1 [Arabidopsis lyrata subsp. lyrata]
Length=561

 Score = 75.5 bits (184),  Expect = 1e-12, Method: Composition-based stats.
 Identities = 37/65 (57%), Positives = 49/65 (75%), Gaps = 1/65 (2%)
 Frame = +2

Query  341  PLLASIATGVILWF-VPQPGGVSRNAWQLLSIFLATIVGIITQPLPLGAVALMGLGACVL  517
            PL+ SI+ G+IL F VP P GV+   WQLLSIFL+TI G++  PLP+GA A +GL A ++
Sbjct  96   PLILSISVGLILRFAVPVPEGVTPQGWQLLSIFLSTIAGLVLSPLPVGAWAFIGLTASIV  155

Query  518  TKTLT  532
            TKTL+
Sbjct  156  TKTLS  160



>ref|NP_201234.1| dicarboxylate transport 2.1 [Arabidopsis thaliana]
 sp|Q9FMF7.1|DIT21_ARATH RecName: Full=Dicarboxylate transporter 2.1, chloroplastic; AltName: 
Full=AtpDCT1; AltName: Full=Glutamate/malate translocator; 
Flags: Precursor [Arabidopsis thaliana]
 dbj|BAB09860.1| 2-oxoglutarate/malate translocator [Arabidopsis thaliana]
 gb|AAL07178.1| putative 2-oxoglutarate/malate translocator protein [Arabidopsis 
thaliana]
 gb|AAN31801.1| putative 2-oxoglutarate/malate translocator [Arabidopsis thaliana]
 gb|AAU95461.1| At5g64290 [Arabidopsis thaliana]
 gb|AED97866.1| dicarboxylate transport 2.1 [Arabidopsis thaliana]
Length=563

 Score = 75.5 bits (184),  Expect = 1e-12, Method: Composition-based stats.
 Identities = 37/65 (57%), Positives = 49/65 (75%), Gaps = 1/65 (2%)
 Frame = +2

Query  341  PLLASIATGVILWF-VPQPGGVSRNAWQLLSIFLATIVGIITQPLPLGAVALMGLGACVL  517
            PL+ SI+ G+IL F VP P GV+   WQLLSIFL+TI G++  PLP+GA A +GL A ++
Sbjct  98   PLILSISVGLILRFAVPVPEGVTPQGWQLLSIFLSTIAGLVLSPLPVGAWAFIGLTASIV  157

Query  518  TKTLT  532
            TKTL+
Sbjct  158  TKTLS  162



>ref|WP_043977584.1| 2-oxoglutarate translocator [Bacillus aryabhattai]
Length=477

 Score = 74.7 bits (182),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 36/64 (56%), Positives = 47/64 (73%), Gaps = 0/64 (0%)
 Frame = +2

Query  341  PLLASIATGVILWFVPQPGGVSRNAWQLLSIFLATIVGIITQPLPLGAVALMGLGACVLT  520
            PLL  +A G+ILWF+  P G+   AW L +IF+ATIVG+I +PLPLG+VA++ L   VLT
Sbjct  16   PLLICLAIGLILWFITPPSGLDLKAWHLFAIFVATIVGLIIKPLPLGSVAILSLTIIVLT  75

Query  521  KTLT  532
             TLT
Sbjct  76   NTLT  79



>ref|WP_034648188.1| 2-oxoglutarate translocator [Bacillus megaterium]
 gb|KFN06787.1| 2-oxoglutarate/malate translocator, chloroplastic [Bacillus megaterium]
 gb|KGJ85087.1| 2-oxoglutarate translocator [Bacillus megaterium NBRC 15308 = 
ATCC 14581]
 gb|AJI23694.1| transporter, divalent anion:Na+ symporter family protein [Bacillus 
megaterium NBRC 15308 = ATCC 14581]
Length=477

 Score = 74.7 bits (182),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 36/64 (56%), Positives = 47/64 (73%), Gaps = 0/64 (0%)
 Frame = +2

Query  341  PLLASIATGVILWFVPQPGGVSRNAWQLLSIFLATIVGIITQPLPLGAVALMGLGACVLT  520
            PLL  +A G+ILWF+  P G+   AW L +IF+ATIVG+I +PLPLG+VA++ L   VLT
Sbjct  16   PLLICLAIGLILWFITPPSGLDVKAWHLFAIFVATIVGLIIKPLPLGSVAILSLTIIVLT  75

Query  521  KTLT  532
             TLT
Sbjct  76   NTLT  79



>ref|WP_028409745.1| 2-oxoglutarate translocator [Bacillus sp. 171095_106]
Length=477

 Score = 74.3 bits (181),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 36/64 (56%), Positives = 47/64 (73%), Gaps = 0/64 (0%)
 Frame = +2

Query  341  PLLASIATGVILWFVPQPGGVSRNAWQLLSIFLATIVGIITQPLPLGAVALMGLGACVLT  520
            PLL  +A G+ILWF+  P G+   AW L +IF+ATIVG+I +PLPLG+VA++ L   VLT
Sbjct  16   PLLICLAIGLILWFITPPSGLDVKAWHLFAIFVATIVGLIIKPLPLGSVAILSLTIIVLT  75

Query  521  KTLT  532
             TLT
Sbjct  76   NTLT  79



>ref|WP_013085539.1| 2-oxoglutarate translocator [Bacillus megaterium]
 gb|ADF42029.1| transporter, divalent anion:Na+ symporter (DASS) family protein 
[Bacillus megaterium DSM 319]
Length=477

 Score = 74.3 bits (181),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 36/64 (56%), Positives = 47/64 (73%), Gaps = 0/64 (0%)
 Frame = +2

Query  341  PLLASIATGVILWFVPQPGGVSRNAWQLLSIFLATIVGIITQPLPLGAVALMGLGACVLT  520
            PLL  +A G+ILWF+  P G+   AW L +IF+ATIVG+I +PLPLG+VA++ L   VLT
Sbjct  16   PLLICLAIGLILWFITPPSGLDVKAWHLFAIFVATIVGLIIKPLPLGSVAILSLTIIVLT  75

Query  521  KTLT  532
             TLT
Sbjct  76   NTLT  79



>ref|WP_016765975.1| 2-oxoglutarate translocator [Bacillus megaterium]
Length=477

 Score = 74.3 bits (181),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 36/64 (56%), Positives = 47/64 (73%), Gaps = 0/64 (0%)
 Frame = +2

Query  341  PLLASIATGVILWFVPQPGGVSRNAWQLLSIFLATIVGIITQPLPLGAVALMGLGACVLT  520
            PLL  +A G+ILWF+  P G+   AW L +IF+ATIVG+I +PLPLG+VA++ L   VLT
Sbjct  16   PLLICLAIGLILWFITPPSGLDVKAWHLFAIFVATIVGLIIKPLPLGSVAILSLTIIVLT  75

Query  521  KTLT  532
             TLT
Sbjct  76   NTLT  79



>emb|CDY18717.1| BnaA09g06780D [Brassica napus]
Length=563

 Score = 74.7 bits (182),  Expect = 2e-12, Method: Composition-based stats.
 Identities = 36/65 (55%), Positives = 49/65 (75%), Gaps = 1/65 (2%)
 Frame = +2

Query  341  PLLASIATGVILWF-VPQPGGVSRNAWQLLSIFLATIVGIITQPLPLGAVALMGLGACVL  517
            PL+ S++ G+IL F VP P G++   WQLLSIFL+TI G++  PLP+GA A MGL A ++
Sbjct  98   PLILSLSVGLILRFAVPLPEGLTPQGWQLLSIFLSTIAGLVLSPLPVGAWAFMGLTASIV  157

Query  518  TKTLT  532
            TKTL+
Sbjct  158  TKTLS  162



>ref|XP_010272978.1| PREDICTED: dicarboxylate transporter 2.1, chloroplastic-like 
[Nelumbo nucifera]
Length=572

 Score = 74.7 bits (182),  Expect = 3e-12, Method: Composition-based stats.
 Identities = 36/65 (55%), Positives = 48/65 (74%), Gaps = 1/65 (2%)
 Frame = +2

Query  341  PLLASIATGVILWF-VPQPGGVSRNAWQLLSIFLATIVGIITQPLPLGAVALMGLGACVL  517
            P L S++ GVI+ F VP+P  VS  AWQLL+IFL+TI G++  PLP+GA A +GL   ++
Sbjct  107  PFLISVSIGVIVRFIVPKPVEVSLQAWQLLAIFLSTIAGLVLNPLPVGAWAFLGLTTSIV  166

Query  518  TKTLT  532
            TKTLT
Sbjct  167  TKTLT  171



>ref|XP_009112126.1| PREDICTED: dicarboxylate transporter 2.1, chloroplastic-like 
[Brassica rapa]
Length=563

 Score = 74.7 bits (182),  Expect = 3e-12, Method: Composition-based stats.
 Identities = 36/65 (55%), Positives = 49/65 (75%), Gaps = 1/65 (2%)
 Frame = +2

Query  341  PLLASIATGVILWF-VPQPGGVSRNAWQLLSIFLATIVGIITQPLPLGAVALMGLGACVL  517
            PL+ S++ G+IL F VP P G++   WQLLSIFL+TI G++  PLP+GA A MGL A ++
Sbjct  98   PLILSLSVGLILRFAVPLPEGLTPQGWQLLSIFLSTIAGLVLSPLPVGAWAFMGLTASIV  157

Query  518  TKTLT  532
            TKTL+
Sbjct  158  TKTLS  162



>ref|WP_028402895.1| 2-oxoglutarate translocator [Bacillus panaciterrae]
Length=483

 Score = 74.3 bits (181),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 34/64 (53%), Positives = 47/64 (73%), Gaps = 0/64 (0%)
 Frame = +2

Query  341  PLLASIATGVILWFVPQPGGVSRNAWQLLSIFLATIVGIITQPLPLGAVALMGLGACVLT  520
            PLL  +A G+ILWF+  P G+   AW L +IF+ATI+G+I +PLPLG++A++ L   VLT
Sbjct  22   PLLTCVAIGLILWFITPPSGLDVKAWHLFAIFVATIIGLIIKPLPLGSIAVLSLTIIVLT  81

Query  521  KTLT  532
             TLT
Sbjct  82   NTLT  85



>ref|XP_010520862.1| PREDICTED: dicarboxylate transporter 2.1, chloroplastic [Tarenaya 
hassleriana]
Length=564

 Score = 74.3 bits (181),  Expect = 3e-12, Method: Composition-based stats.
 Identities = 35/66 (53%), Positives = 49/66 (74%), Gaps = 1/66 (2%)
 Frame = +2

Query  335  IKPLLASIATGVILWF-VPQPGGVSRNAWQLLSIFLATIVGIITQPLPLGAVALMGLGAC  511
            I PL+ S+A G++L F VP+P GV+   WQLLSIFL+TI G++  PLP+GA A +GL   
Sbjct  97   ILPLILSVAVGLVLRFAVPKPEGVTPQGWQLLSIFLSTIAGLVLSPLPVGAWAFIGLTTS  156

Query  512  VLTKTL  529
            ++T+TL
Sbjct  157  IVTRTL  162



>ref|WP_029319476.1| 2-oxoglutarate translocator [Bacillus sp. RP1137]
Length=477

 Score = 73.9 bits (180),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 35/64 (55%), Positives = 47/64 (73%), Gaps = 0/64 (0%)
 Frame = +2

Query  341  PLLASIATGVILWFVPQPGGVSRNAWQLLSIFLATIVGIITQPLPLGAVALMGLGACVLT  520
            PLL  +A G++LWF+  P G+   AW L +IF+ATIVG+I +PLPLG+VA++ L   VLT
Sbjct  16   PLLICLAIGLVLWFITPPSGLDVKAWHLFAIFVATIVGLIIKPLPLGSVAILSLTIIVLT  75

Query  521  KTLT  532
             TLT
Sbjct  76   NTLT  79



>ref|WP_013059892.1| 2-oxoglutarate translocator [Bacillus megaterium]
 gb|ADE72219.1| transporter, divalent anion:Na+ symporter (DASS) family protein 
[Bacillus megaterium QM B1551]
Length=477

 Score = 73.9 bits (180),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 35/64 (55%), Positives = 47/64 (73%), Gaps = 0/64 (0%)
 Frame = +2

Query  341  PLLASIATGVILWFVPQPGGVSRNAWQLLSIFLATIVGIITQPLPLGAVALMGLGACVLT  520
            PLL  +A G++LWF+  P G+   AW L +IF+ATIVG+I +PLPLG+VA++ L   VLT
Sbjct  16   PLLICLAIGLVLWFITPPSGLDVKAWHLFAIFVATIVGLIIKPLPLGSVAILSLTIIVLT  75

Query  521  KTLT  532
             TLT
Sbjct  76   NTLT  79



>ref|XP_007148387.1| hypothetical protein PHAVU_006G204300g [Phaseolus vulgaris]
 gb|ESW20381.1| hypothetical protein PHAVU_006G204300g [Phaseolus vulgaris]
Length=566

 Score = 74.3 bits (181),  Expect = 3e-12, Method: Composition-based stats.
 Identities = 37/65 (57%), Positives = 48/65 (74%), Gaps = 1/65 (2%)
 Frame = +2

Query  341  PLLASIATGV-ILWFVPQPGGVSRNAWQLLSIFLATIVGIITQPLPLGAVALMGLGACVL  517
            P L SI  G+ + +FVP+P  V+  AWQLLSIFL+TI G++  PLP+GA A +GL A V+
Sbjct  101  PFLISICIGLAVRFFVPKPVEVTPEAWQLLSIFLSTIAGLVLSPLPVGAWAFLGLTATVV  160

Query  518  TKTLT  532
            TKTLT
Sbjct  161  TKTLT  165



>ref|WP_014457694.1| 2-oxoglutarate translocator [Bacillus megaterium]
 gb|AEN86919.1| Dicarboxylase translocator [Bacillus megaterium WSH-002]
Length=477

 Score = 73.9 bits (180),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 35/64 (55%), Positives = 47/64 (73%), Gaps = 0/64 (0%)
 Frame = +2

Query  341  PLLASIATGVILWFVPQPGGVSRNAWQLLSIFLATIVGIITQPLPLGAVALMGLGACVLT  520
            PLL  +A G++LWF+  P G+   AW L +IF+ATIVG+I +PLPLG+VA++ L   VLT
Sbjct  16   PLLICLAIGLVLWFITPPSGLDVKAWHLFAIFVATIVGLIIKPLPLGSVAILSLTIIVLT  75

Query  521  KTLT  532
             TLT
Sbjct  76   NTLT  79



>ref|WP_028411930.1| MULTISPECIES: 2-oxoglutarate translocator [Bacillus]
Length=477

 Score = 73.9 bits (180),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 35/64 (55%), Positives = 47/64 (73%), Gaps = 0/64 (0%)
 Frame = +2

Query  341  PLLASIATGVILWFVPQPGGVSRNAWQLLSIFLATIVGIITQPLPLGAVALMGLGACVLT  520
            PLL  +A G++LWF+  P G+   AW L +IF+ATIVG+I +PLPLG+VA++ L   VLT
Sbjct  16   PLLICLAIGLVLWFITPPSGLDVKAWHLFAIFVATIVGLIIKPLPLGSVAILSLTIIVLT  75

Query  521  KTLT  532
             TLT
Sbjct  76   NTLT  79



>ref|XP_010108404.1| 2-oxoglutarate/malate translocator [Morus notabilis]
 gb|EXC19408.1| 2-oxoglutarate/malate translocator [Morus notabilis]
Length=565

 Score = 73.9 bits (180),  Expect = 4e-12, Method: Composition-based stats.
 Identities = 35/65 (54%), Positives = 50/65 (77%), Gaps = 1/65 (2%)
 Frame = +2

Query  341  PLLASIATGVIL-WFVPQPGGVSRNAWQLLSIFLATIVGIITQPLPLGAVALMGLGACVL  517
            PL+ S+A GV++ +FVP+P  VS  AWQLL+IFL+TI G++  PLP+GA A +GL   ++
Sbjct  100  PLVISVAIGVLVRFFVPKPVEVSAQAWQLLAIFLSTIAGLVLSPLPVGAWAFIGLTTSIV  159

Query  518  TKTLT  532
            TKTL+
Sbjct  160  TKTLS  164



>ref|XP_003593234.1| 2-oxoglutarate/malate translocator [Medicago truncatula]
 gb|AES63485.1| 2-oxoglutarate/malate translocator [Medicago truncatula]
Length=567

 Score = 73.9 bits (180),  Expect = 4e-12, Method: Composition-based stats.
 Identities = 37/65 (57%), Positives = 48/65 (74%), Gaps = 1/65 (2%)
 Frame = +2

Query  341  PLLASIATGVIL-WFVPQPGGVSRNAWQLLSIFLATIVGIITQPLPLGAVALMGLGACVL  517
            P   SI  G+I+ +FVP+P  V+  AWQLLSIFL+TI G++  PLP+GA A +GL A V+
Sbjct  102  PFAISILIGLIVRFFVPKPVEVTPQAWQLLSIFLSTIAGLVLSPLPVGAWAFLGLTASVV  161

Query  518  TKTLT  532
            TKTLT
Sbjct  162  TKTLT  166



>gb|EPS71302.1| glutamate/malate translocator [Genlisea aurea]
Length=548

 Score = 73.9 bits (180),  Expect = 4e-12, Method: Composition-based stats.
 Identities = 34/64 (53%), Positives = 48/64 (75%), Gaps = 1/64 (2%)
 Frame = +2

Query  341  PLLASIATGVIL-WFVPQPGGVSRNAWQLLSIFLATIVGIITQPLPLGAVALMGLGACVL  517
            PLL S+A G++  +F+P+P  V+  AWQLLSIFL+T+ G++  PLP+GA A +GL   V+
Sbjct  83   PLLISLAVGIVTRYFIPKPPEVTPQAWQLLSIFLSTVAGLVLSPLPVGAWAFIGLTTAVV  142

Query  518  TKTL  529
            TKTL
Sbjct  143  TKTL  146



>ref|WP_020450525.1| MULTISPECIES: 2-oxoglutarate/malate transporter YflS [Bacillus]
 gb|AGN35273.1| 2-oxoglutarate/malate transporter YflS [Bacillus licheniformis 
9945A]
 gb|ETB72216.1| 2-oxoglutarate translocator [Bacillus sp. CPSM8]
 gb|KJD54202.1| 2-oxoglutarate translocator [Bacillus amyloliquefaciens]
Length=478

 Score = 73.6 bits (179),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 31/66 (47%), Positives = 45/66 (68%), Gaps = 0/66 (0%)
 Frame = +2

Query  335  IKPLLASIATGVILWFVPQPGGVSRNAWQLLSIFLATIVGIITQPLPLGAVALMGLGACV  514
            I PL  +I  G ++WF+P P G+   AW L +IF+ATI+G I++PLP+GA+A+  L    
Sbjct  15   IIPLTVTILVGAVIWFIPSPAGLDPKAWHLFAIFVATIIGFISKPLPMGAIAVFALAVTA  74

Query  515  LTKTLT  532
            LT TL+
Sbjct  75   LTGTLS  80



>ref|XP_010546344.1| PREDICTED: dicarboxylate transporter 2.1, chloroplastic-like 
isoform X1 [Tarenaya hassleriana]
 ref|XP_010546345.1| PREDICTED: dicarboxylate transporter 2.1, chloroplastic-like 
isoform X2 [Tarenaya hassleriana]
Length=558

 Score = 73.6 bits (179),  Expect = 5e-12, Method: Composition-based stats.
 Identities = 36/66 (55%), Positives = 48/66 (73%), Gaps = 1/66 (2%)
 Frame = +2

Query  335  IKPLLASIATGVILWF-VPQPGGVSRNAWQLLSIFLATIVGIITQPLPLGAVALMGLGAC  511
            I PL+ S+A G+IL F VP P GV+   WQLLSIFL+TI G++  PLP+GA A +GL   
Sbjct  91   ILPLILSVAVGIILRFAVPIPQGVTPQGWQLLSIFLSTIAGLVLSPLPVGAWAFIGLTTS  150

Query  512  VLTKTL  529
            ++T+TL
Sbjct  151  IVTRTL  156



>ref|WP_021797818.1| transporter, DASS family [Propionibacterium acidifaciens]
 gb|ERK54719.1| transporter, DASS family [Propionibacterium acidifaciens F0233]
Length=496

 Score = 73.6 bits (179),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 32/55 (58%), Positives = 43/55 (78%), Gaps = 0/55 (0%)
 Frame = +2

Query  365  GVILWFVPQPGGVSRNAWQLLSIFLATIVGIITQPLPLGAVALMGLGACVLTKTL  529
            G ++WF P PGGV+  AW +L+IFLATIVGII +PLP+GAV ++G   C+LT T+
Sbjct  37   GAVIWFAPPPGGVTGRAWHMLAIFLATIVGIIAKPLPMGAVTIIGTVVCILTGTV  91



>ref|XP_009381487.1| PREDICTED: dicarboxylate transporter 2.1, chloroplastic-like 
isoform X2 [Musa acuminata subsp. malaccensis]
Length=559

 Score = 73.6 bits (179),  Expect = 5e-12, Method: Composition-based stats.
 Identities = 37/65 (57%), Positives = 45/65 (69%), Gaps = 1/65 (2%)
 Frame = +2

Query  341  PLLASIATGVILWF-VPQPGGVSRNAWQLLSIFLATIVGIITQPLPLGAVALMGLGACVL  517
            PL  S+A G+ +WF VP P  V+  AWQLL+IFL+TI G I  PLP+ A A +GL A V 
Sbjct  94   PLAISLAVGLAIWFLVPTPAEVTPQAWQLLAIFLSTITGFILGPLPIAAWAFLGLTASVA  153

Query  518  TKTLT  532
            TKTLT
Sbjct  154  TKTLT  158



>ref|WP_039073282.1| MULTISPECIES: 2-oxoglutarate translocator [Bacillus]
 gb|AJO17019.1| YflS protein [Bacillus licheniformis]
Length=478

 Score = 73.6 bits (179),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 31/66 (47%), Positives = 45/66 (68%), Gaps = 0/66 (0%)
 Frame = +2

Query  335  IKPLLASIATGVILWFVPQPGGVSRNAWQLLSIFLATIVGIITQPLPLGAVALMGLGACV  514
            I PL  +I  G ++WF+P P G+   AW L +IF+ATI+G I++PLP+GA+A+  L    
Sbjct  15   IIPLAVTILVGAVIWFIPSPAGLDPKAWHLFAIFVATIIGFISKPLPMGAIAVFALAVTA  74

Query  515  LTKTLT  532
            LT TL+
Sbjct  75   LTGTLS  80



>ref|XP_009381486.1| PREDICTED: dicarboxylate transporter 2.1, chloroplastic-like 
isoform X1 [Musa acuminata subsp. malaccensis]
Length=565

 Score = 73.6 bits (179),  Expect = 6e-12, Method: Composition-based stats.
 Identities = 37/65 (57%), Positives = 45/65 (69%), Gaps = 1/65 (2%)
 Frame = +2

Query  341  PLLASIATGVILWF-VPQPGGVSRNAWQLLSIFLATIVGIITQPLPLGAVALMGLGACVL  517
            PL  S+A G+ +WF VP P  V+  AWQLL+IFL+TI G I  PLP+ A A +GL A V 
Sbjct  94   PLAISLAVGLAIWFLVPTPAEVTPQAWQLLAIFLSTITGFILGPLPIAAWAFLGLTASVA  153

Query  518  TKTLT  532
            TKTLT
Sbjct  154  TKTLT  158



>ref|WP_043151211.1| permease [Propionibacterium acidifaciens]
Length=463

 Score = 73.2 bits (178),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 32/55 (58%), Positives = 43/55 (78%), Gaps = 0/55 (0%)
 Frame = +2

Query  365  GVILWFVPQPGGVSRNAWQLLSIFLATIVGIITQPLPLGAVALMGLGACVLTKTL  529
            G ++WF P PGGV+  AW +L+IFLATIVGII +PLP+GAV ++G   C+LT T+
Sbjct  4    GAVIWFAPPPGGVTGRAWHMLAIFLATIVGIIAKPLPMGAVTIIGTVVCILTGTV  58



>ref|XP_002323748.1| putative oxoglutarate-malate-translocase family protein [Populus 
trichocarpa]
 gb|EEF03881.1| putative oxoglutarate-malate-translocase family protein [Populus 
trichocarpa]
Length=569

 Score = 73.6 bits (179),  Expect = 6e-12, Method: Composition-based stats.
 Identities = 36/65 (55%), Positives = 49/65 (75%), Gaps = 1/65 (2%)
 Frame = +2

Query  341  PLLASIATGVILWF-VPQPGGVSRNAWQLLSIFLATIVGIITQPLPLGAVALMGLGACVL  517
            PLL S++ G+I+ F VP+P  V+  AWQLLSIFL+TI G++  PLP+GA A +GL   V+
Sbjct  104  PLLISVSIGLIVRFAVPKPIEVTPQAWQLLSIFLSTIAGLVLSPLPVGAWAFLGLTTSVV  163

Query  518  TKTLT  532
            T+TLT
Sbjct  164  TRTLT  168



>ref|WP_043925701.1| 2-oxoglutarate translocator [Bacillus licheniformis]
 gb|EWH23105.1| 2-oxoglutarate translocator [Bacillus licheniformis S 16]
Length=478

 Score = 73.2 bits (178),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 31/66 (47%), Positives = 45/66 (68%), Gaps = 0/66 (0%)
 Frame = +2

Query  335  IKPLLASIATGVILWFVPQPGGVSRNAWQLLSIFLATIVGIITQPLPLGAVALMGLGACV  514
            I PL  +I  G ++WF+P P G+   AW L +IF+ATI+G I++PLP+GA+A+  L    
Sbjct  15   IIPLAVTILVGAVIWFIPSPAGLDPKAWHLFAIFVATIIGFISKPLPMGAIAVFALAVTA  74

Query  515  LTKTLT  532
            LT TL+
Sbjct  75   LTGTLS  80



>gb|KFK28120.1| hypothetical protein AALP_AA8G475200 [Arabis alpina]
Length=559

 Score = 73.6 bits (179),  Expect = 6e-12, Method: Composition-based stats.
 Identities = 35/65 (54%), Positives = 49/65 (75%), Gaps = 1/65 (2%)
 Frame = +2

Query  341  PLLASIATGVILWF-VPQPGGVSRNAWQLLSIFLATIVGIITQPLPLGAVALMGLGACVL  517
            PL+ S++ G+IL F VP P GV+   WQLLSIFL+TI G++  PLP+GA A +GL A ++
Sbjct  94   PLILSVSVGLILRFAVPVPEGVTPQGWQLLSIFLSTIAGLVLSPLPVGAWAFIGLTASIV  153

Query  518  TKTLT  532
            T+TL+
Sbjct  154  TRTLS  158



>ref|WP_003223030.1| 2-oxoglutarate translocator [Bacillus subtilis]
 gb|EFG91812.1| 2-oxoglutarate/malate transporter [Bacillus subtilis subsp. spizizenii 
ATCC 6633]
 gb|ADM36825.1| 2-oxoglutarate/malate transporter [Bacillus subtilis subsp. spizizenii 
str. W23]
 gb|KFK80732.1| 2-oxoglutarate/malate translocator [Bacillus subtilis]
 gb|AJD35451.1| 2-oxoglutarate translocator [Bacillus subtilis subsp. spizizenii]
Length=477

 Score = 73.2 bits (178),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 32/64 (50%), Positives = 47/64 (73%), Gaps = 1/64 (2%)
 Frame = +2

Query  341  PLLASIATGVILWFVPQPGGVSRNAWQLLSIFLATIVGIITQPLPLGAVALMGLGACVLT  520
            PLL ++A G+I+WF+P P G+   AW L +IF+ATI+G I++PLP+GA+A+  L    LT
Sbjct  17   PLL-TVAVGLIIWFIPAPSGLEPKAWHLFAIFVATIIGFISKPLPMGAIAIFALAVTALT  75

Query  521  KTLT  532
             TL+
Sbjct  76   GTLS  79



>ref|WP_041581256.1| 2-oxoglutarate translocator [Bacillus sp. 1NLA3E]
Length=481

 Score = 72.8 bits (177),  Expect = 8e-12, Method: Compositional matrix adjust.
 Identities = 33/64 (52%), Positives = 48/64 (75%), Gaps = 0/64 (0%)
 Frame = +2

Query  341  PLLASIATGVILWFVPQPGGVSRNAWQLLSIFLATIVGIITQPLPLGAVALMGLGACVLT  520
            PLL +I  GV LW +  P G+   AW L +IF+ATIVG++++P+P+G+VA++ L A VLT
Sbjct  20   PLLITIIVGVALWMITPPAGLDVQAWHLFAIFVATIVGLVSKPMPMGSVAILALTATVLT  79

Query  521  KTLT  532
            +TLT
Sbjct  80   QTLT  83



>ref|WP_003179716.1| MULTISPECIES: 2-oxoglutarate translocator [Bacillus]
 gb|EFV71632.1| YflS protein [Bacillus sp. BT1B_CT2]
 gb|EID49989.1| 2-oxoglutarate/malate translocator [Bacillus licheniformis WX-02]
 gb|EQM29468.1| 2-oxoglutarate translocator [Bacillus licheniformis CG-B52]
Length=478

 Score = 72.8 bits (177),  Expect = 8e-12, Method: Compositional matrix adjust.
 Identities = 31/66 (47%), Positives = 45/66 (68%), Gaps = 0/66 (0%)
 Frame = +2

Query  335  IKPLLASIATGVILWFVPQPGGVSRNAWQLLSIFLATIVGIITQPLPLGAVALMGLGACV  514
            I PL  +I  G ++WF+P P G+   AW L +IF+ATI+G I++PLP+GA+A+  L    
Sbjct  15   IIPLAVTILVGAVIWFIPSPAGLDPKAWHLFAIFVATIIGFISKPLPMGAIAVFALAITA  74

Query  515  LTKTLT  532
            LT TL+
Sbjct  75   LTGTLS  80



>gb|AGK55800.1| divalent anion:Na+ symporter (DASS) family transporter [Bacillus 
sp. 1NLA3E]
Length=491

 Score = 72.8 bits (177),  Expect = 8e-12, Method: Compositional matrix adjust.
 Identities = 33/64 (52%), Positives = 48/64 (75%), Gaps = 0/64 (0%)
 Frame = +2

Query  341  PLLASIATGVILWFVPQPGGVSRNAWQLLSIFLATIVGIITQPLPLGAVALMGLGACVLT  520
            PLL +I  GV LW +  P G+   AW L +IF+ATIVG++++P+P+G+VA++ L A VLT
Sbjct  30   PLLITIIVGVALWMITPPAGLDVQAWHLFAIFVATIVGLVSKPMPMGSVAILALTATVLT  89

Query  521  KTLT  532
            +TLT
Sbjct  90   QTLT  93



>ref|WP_011197641.1| 2-oxoglutarate translocator [Bacillus licheniformis]
 gb|AAU39715.1| putative malate transporter YflS [Bacillus licheniformis DSM 
13 = ATCC 14580]
 gb|AAU22366.2| putative 2-oxoglutarate/malate translocator [Bacillus licheniformis 
DSM 13 = ATCC 14580]
 gb|KJE31653.1| transporter, divalent anion:Na+ symporter family protein [Bacillus 
licheniformis]
Length=478

 Score = 72.8 bits (177),  Expect = 8e-12, Method: Compositional matrix adjust.
 Identities = 31/66 (47%), Positives = 45/66 (68%), Gaps = 0/66 (0%)
 Frame = +2

Query  335  IKPLLASIATGVILWFVPQPGGVSRNAWQLLSIFLATIVGIITQPLPLGAVALMGLGACV  514
            I PL  +I  G ++WF+P P G+   AW L +IF+ATI+G I++PLP+GA+A+  L    
Sbjct  15   IIPLAVTILVGAVIWFIPSPAGLDPKAWHLFAIFVATIIGFISKPLPMGAIAVFALAITA  74

Query  515  LTKTLT  532
            LT TL+
Sbjct  75   LTGTLS  80



>ref|XP_006827969.1| hypothetical protein AMTR_s00008p00213760 [Amborella trichopoda]
 gb|ERM95385.1| hypothetical protein AMTR_s00008p00213760 [Amborella trichopoda]
Length=563

 Score = 73.2 bits (178),  Expect = 9e-12, Method: Composition-based stats.
 Identities = 34/65 (52%), Positives = 47/65 (72%), Gaps = 1/65 (2%)
 Frame = +2

Query  341  PLLASIATG-VILWFVPQPGGVSRNAWQLLSIFLATIVGIITQPLPLGAVALMGLGACVL  517
            P + S+A G V+ + VP+P  V+  AWQLLSIFL+TI G++  PLP+GA A MGL   V+
Sbjct  98   PFILSVAVGLVVRYLVPKPVEVTTQAWQLLSIFLSTITGLVLSPLPVGAWAFMGLTTAVI  157

Query  518  TKTLT  532
            T+TL+
Sbjct  158  TRTLS  162



>gb|EYU39124.1| hypothetical protein MIMGU_mgv1a003844mg [Erythranthe guttata]
Length=560

 Score = 73.2 bits (178),  Expect = 9e-12, Method: Composition-based stats.
 Identities = 34/64 (53%), Positives = 48/64 (75%), Gaps = 1/64 (2%)
 Frame = +2

Query  341  PLLASIATGVILWF-VPQPGGVSRNAWQLLSIFLATIVGIITQPLPLGAVALMGLGACVL  517
            PL++S+A G  ++F +P+P  V+  AWQLLSIFL+TI G++  PLP+GA A +GL A +L
Sbjct  95   PLISSLAIGAAVFFLIPRPPEVTPQAWQLLSIFLSTIAGLVLSPLPVGAWAFLGLTATIL  154

Query  518  TKTL  529
            T TL
Sbjct  155  TNTL  158



>ref|XP_010461628.1| PREDICTED: dicarboxylate transporter 2.1, chloroplastic-like 
[Camelina sativa]
Length=560

 Score = 72.8 bits (177),  Expect = 1e-11, Method: Composition-based stats.
 Identities = 36/65 (55%), Positives = 48/65 (74%), Gaps = 1/65 (2%)
 Frame = +2

Query  341  PLLASIATGVILWF-VPQPGGVSRNAWQLLSIFLATIVGIITQPLPLGAVALMGLGACVL  517
            PL+ S++ G+IL F V  P GV+   WQLLSIFL+TI G++  PLP+GA A +GL A ++
Sbjct  95   PLILSVSVGLILRFAVSVPEGVTPQGWQLLSIFLSTIAGLVLSPLPVGAWAFIGLTASIV  154

Query  518  TKTLT  532
            TKTLT
Sbjct  155  TKTLT  159



>ref|XP_010484204.1| PREDICTED: dicarboxylate transporter 2.1, chloroplastic [Camelina 
sativa]
Length=563

 Score = 72.8 bits (177),  Expect = 1e-11, Method: Composition-based stats.
 Identities = 36/65 (55%), Positives = 48/65 (74%), Gaps = 1/65 (2%)
 Frame = +2

Query  341  PLLASIATGVILWF-VPQPGGVSRNAWQLLSIFLATIVGIITQPLPLGAVALMGLGACVL  517
            PL+ S++ G+IL F V  P GV+   WQLLSIFL+TI G++  PLP+GA A +GL A ++
Sbjct  98   PLILSVSVGLILRFAVSVPEGVTPQGWQLLSIFLSTIAGLVLSPLPVGAWAFIGLTASIV  157

Query  518  TKTLT  532
            TKTLT
Sbjct  158  TKTLT  162



>ref|WP_026578902.1| 2-oxoglutarate translocator [Bacillus sp. SB47]
Length=478

 Score = 72.4 bits (176),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 30/66 (45%), Positives = 45/66 (68%), Gaps = 0/66 (0%)
 Frame = +2

Query  335  IKPLLASIATGVILWFVPQPGGVSRNAWQLLSIFLATIVGIITQPLPLGAVALMGLGACV  514
            I PL  +I  G ++WF+P P G+   AW L +IF++TI+G I++PLP+GA+A+  L    
Sbjct  15   IIPLTVTILVGAVIWFIPSPAGLDPKAWHLFAIFVSTIIGFISKPLPMGAIAVFALAVTA  74

Query  515  LTKTLT  532
            LT TL+
Sbjct  75   LTGTLS  80



>gb|AFK44505.1| unknown [Medicago truncatula]
Length=285

 Score = 70.5 bits (171),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 37/65 (57%), Positives = 48/65 (74%), Gaps = 1/65 (2%)
 Frame = +2

Query  341  PLLASIATGVIL-WFVPQPGGVSRNAWQLLSIFLATIVGIITQPLPLGAVALMGLGACVL  517
            P   SI  G+I+ +FVP+P  V+  AWQLLSIFL+TI G++  PLP+GA A +GL A V+
Sbjct  102  PFAISILIGLIVRFFVPKPVEVTPQAWQLLSIFLSTIAGLVLSPLPVGAWAFLGLTASVV  161

Query  518  TKTLT  532
            TKTLT
Sbjct  162  TKTLT  166



>ref|WP_026589611.1| 2-oxoglutarate translocator [Bacillus sp. NSP9.1]
Length=478

 Score = 72.4 bits (176),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 32/66 (48%), Positives = 45/66 (68%), Gaps = 0/66 (0%)
 Frame = +2

Query  335  IKPLLASIATGVILWFVPQPGGVSRNAWQLLSIFLATIVGIITQPLPLGAVALMGLGACV  514
            I PL  +I  G ++W +P PGG+   AW L +IF+ATI+G I++PLP+GAVA+  L    
Sbjct  15   ILPLAVTILAGAVIWLIPPPGGLDPKAWHLFAIFVATIIGFISKPLPMGAVAIFALAMTA  74

Query  515  LTKTLT  532
            LT TL+
Sbjct  75   LTGTLS  80



>emb|CDO97413.1| unnamed protein product [Coffea canephora]
Length=562

 Score = 72.4 bits (176),  Expect = 1e-11, Method: Composition-based stats.
 Identities = 35/66 (53%), Positives = 49/66 (74%), Gaps = 1/66 (2%)
 Frame = +2

Query  335  IKPLLASIATGVILWF-VPQPGGVSRNAWQLLSIFLATIVGIITQPLPLGAVALMGLGAC  511
            I PL+ S++ G+I+ F VP+P  V+  AWQLLSIFL+TI G++  PLP+GA A +GL   
Sbjct  95   IIPLIISVSIGLIVRFLVPKPPEVTPQAWQLLSIFLSTIAGLVLSPLPVGAWAFLGLTTA  154

Query  512  VLTKTL  529
            +LT+TL
Sbjct  155  ILTRTL  160



>ref|WP_018712252.1| hypothetical protein [Campylobacter ureolyticus]
Length=466

 Score = 72.0 bits (175),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 32/65 (49%), Positives = 47/65 (72%), Gaps = 0/65 (0%)
 Frame = +2

Query  338  KPLLASIATGVILWFVPQPGGVSRNAWQLLSIFLATIVGIITQPLPLGAVALMGLGACVL  517
            K L+     G+++WF+P    VS+ AWQL +I +ATI+G+I QPLP+GAVA +G+ A +L
Sbjct  5    KKLITLFVVGLVIWFIPHSDAVSKEAWQLFAIVVATILGLILQPLPIGAVAFIGVAAAML  64

Query  518  TKTLT  532
            T TL+
Sbjct  65   TNTLS  69



>emb|CDY43805.1| BnaA06g23410D [Brassica napus]
Length=555

 Score = 72.4 bits (176),  Expect = 1e-11, Method: Composition-based stats.
 Identities = 36/65 (55%), Positives = 48/65 (74%), Gaps = 1/65 (2%)
 Frame = +2

Query  341  PLLASIATGVILWF-VPQPGGVSRNAWQLLSIFLATIVGIITQPLPLGAVALMGLGACVL  517
            PL+ S++ G+IL F V  P GV+   WQLLSIFLATI G++  PLP+GA A +GL A ++
Sbjct  90   PLILSLSVGLILRFAVSVPEGVTPQGWQLLSIFLATIAGLVLSPLPVGAWAFIGLTASIV  149

Query  518  TKTLT  532
            TKTL+
Sbjct  150  TKTLS  154



>ref|WP_018664356.1| hypothetical protein [Bacillus acidiproducens]
Length=164

 Score = 68.9 bits (167),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 29/62 (47%), Positives = 44/62 (71%), Gaps = 0/62 (0%)
 Frame = +2

Query  344  LLASIATGVILWFVPQPGGVSRNAWQLLSIFLATIVGIITQPLPLGAVALMGLGACVLTK  523
            L  ++A GVI+W +  P G+   AW L +IF+ATI+G+I +PLP+G +A++ + A VLT 
Sbjct  25   LFITLAAGVIIWLIGAPAGLDEKAWHLFAIFVATIIGLIIKPLPMGGIAILSITAVVLTG  84

Query  524  TL  529
            TL
Sbjct  85   TL  86



>ref|XP_010444361.1| PREDICTED: dicarboxylate transporter 2.1, chloroplastic-like 
[Camelina sativa]
Length=563

 Score = 72.0 bits (175),  Expect = 2e-11, Method: Composition-based stats.
 Identities = 36/65 (55%), Positives = 48/65 (74%), Gaps = 1/65 (2%)
 Frame = +2

Query  341  PLLASIATGVILWF-VPQPGGVSRNAWQLLSIFLATIVGIITQPLPLGAVALMGLGACVL  517
            PL+ S++ G+IL F V  P GV+   WQLLSIFL+TI G++  PLP+GA A +GL A V+
Sbjct  98   PLILSVSVGLILRFAVSVPEGVTPQGWQLLSIFLSTIAGLVLSPLPVGAWAFIGLTASVV  157

Query  518  TKTLT  532
            TKTL+
Sbjct  158  TKTLS  162



>ref|WP_036200998.1| 2-oxoglutarate translocator [Lysinibacillus sinduriensis]
 gb|KGR75386.1| 2-oxoglutarate translocator [Lysinibacillus sinduriensis BLB-1 
= JCM 15800]
Length=478

 Score = 71.6 bits (174),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 31/66 (47%), Positives = 47/66 (71%), Gaps = 0/66 (0%)
 Frame = +2

Query  335  IKPLLASIATGVILWFVPQPGGVSRNAWQLLSIFLATIVGIITQPLPLGAVALMGLGACV  514
            I PLL  I  G ++W +P PGG+   AW L +IF+ATI+G+I +P+P+G++A++ L    
Sbjct  15   IIPLLVVILIGAVIWLIPPPGGLQVQAWHLFAIFVATIIGLIIKPIPMGSMAILALTVIT  74

Query  515  LTKTLT  532
            +TKTLT
Sbjct  75   VTKTLT  80



>ref|XP_011043103.1| PREDICTED: dicarboxylate transporter 2.1, chloroplastic-like 
[Populus euphratica]
Length=569

 Score = 71.6 bits (174),  Expect = 2e-11, Method: Composition-based stats.
 Identities = 35/64 (55%), Positives = 48/64 (75%), Gaps = 1/64 (2%)
 Frame = +2

Query  341  PLLASIATGVILWF-VPQPGGVSRNAWQLLSIFLATIVGIITQPLPLGAVALMGLGACVL  517
            PLL S++ G+I+ F VP+P  V+  AWQLLSIFL+TI G++  PLP+GA A +GL   V+
Sbjct  104  PLLISVSIGLIVRFAVPKPIEVTPQAWQLLSIFLSTIAGLVLSPLPVGAWAFLGLTTSVV  163

Query  518  TKTL  529
            T+TL
Sbjct  164  TRTL  167



>ref|XP_010942614.1| PREDICTED: dicarboxylate transporter 2.1, chloroplastic [Elaeis 
guineensis]
Length=563

 Score = 71.6 bits (174),  Expect = 3e-11, Method: Composition-based stats.
 Identities = 35/65 (54%), Positives = 49/65 (75%), Gaps = 1/65 (2%)
 Frame = +2

Query  341  PLLASIATGVILWF-VPQPGGVSRNAWQLLSIFLATIVGIITQPLPLGAVALMGLGACVL  517
            PL  S+A G+++ F VP+P  V+  AWQLL+IFL+TI G++  PLP+GA A +GL A V+
Sbjct  98   PLAISVAIGLVVRFLVPRPVEVTPQAWQLLAIFLSTIAGLVLSPLPVGAWAFLGLTASVV  157

Query  518  TKTLT  532
            TKTL+
Sbjct  158  TKTLS  162



>emb|CDX81219.1| BnaC09g06300D [Brassica napus]
Length=556

 Score = 71.6 bits (174),  Expect = 3e-11, Method: Composition-based stats.
 Identities = 35/65 (54%), Positives = 48/65 (74%), Gaps = 1/65 (2%)
 Frame = +2

Query  341  PLLASIATGVILWF-VPQPGGVSRNAWQLLSIFLATIVGIITQPLPLGAVALMGLGACVL  517
            PL+ S++ G+IL F V  P G++   WQLLSIFL+TI G++  PLP+GA A MGL A ++
Sbjct  91   PLILSLSVGLILRFAVSLPEGLTPQGWQLLSIFLSTIAGLVLSPLPVGAWAFMGLTASIV  150

Query  518  TKTLT  532
            TKTL+
Sbjct  151  TKTLS  155



>ref|XP_006280257.1| hypothetical protein CARUB_v10026173mg [Capsella rubella]
 gb|EOA13155.1| hypothetical protein CARUB_v10026173mg [Capsella rubella]
Length=560

 Score = 71.2 bits (173),  Expect = 3e-11, Method: Composition-based stats.
 Identities = 35/65 (54%), Positives = 48/65 (74%), Gaps = 1/65 (2%)
 Frame = +2

Query  341  PLLASIATGVILWF-VPQPGGVSRNAWQLLSIFLATIVGIITQPLPLGAVALMGLGACVL  517
            PL+ S++ G+IL F V  P GV+   WQLLSIFL+TI G++  PLP+GA A +GL A ++
Sbjct  95   PLILSVSVGLILRFAVSVPEGVTPQGWQLLSIFLSTIAGLVLSPLPVGAWAFIGLTASIV  154

Query  518  TKTLT  532
            TKTL+
Sbjct  155  TKTLS  159



>ref|XP_006394170.1| hypothetical protein EUTSA_v10003922mg [Eutrema salsugineum]
 dbj|BAJ34188.1| unnamed protein product [Thellungiella halophila]
 gb|ESQ31456.1| hypothetical protein EUTSA_v10003922mg [Eutrema salsugineum]
Length=561

 Score = 71.2 bits (173),  Expect = 3e-11, Method: Composition-based stats.
 Identities = 35/65 (54%), Positives = 48/65 (74%), Gaps = 1/65 (2%)
 Frame = +2

Query  341  PLLASIATGVILWF-VPQPGGVSRNAWQLLSIFLATIVGIITQPLPLGAVALMGLGACVL  517
            PLL S++ G+IL F V  P GV+   WQLLSIFL+TI G++  PLP+GA A +GL A ++
Sbjct  96   PLLLSVSVGLILRFAVSVPEGVTPQGWQLLSIFLSTIAGLVLSPLPVGAWAFIGLTASIV  155

Query  518  TKTLT  532
            T+TL+
Sbjct  156  TRTLS  160



>ref|WP_006637412.1| sodium/sulfate symporter YflS [Bacillus sonorensis]
 gb|EME75561.1| sodium/sulfate symporter YflS [Bacillus sonorensis L12]
Length=478

 Score = 71.2 bits (173),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 29/64 (45%), Positives = 44/64 (69%), Gaps = 0/64 (0%)
 Frame = +2

Query  341  PLLASIATGVILWFVPQPGGVSRNAWQLLSIFLATIVGIITQPLPLGAVALMGLGACVLT  520
            P +  +  GV++WF+P P G+   AW L +IF+ATI+G I++PLP+GA+A+  L    LT
Sbjct  17   PFIIMVLAGVVIWFIPVPAGLDVKAWHLFAIFVATIIGFISKPLPMGAIAVFALAVTALT  76

Query  521  KTLT  532
             TL+
Sbjct  77   GTLS  80



>ref|XP_006492620.1| PREDICTED: dicarboxylate transporter 2.1, chloroplastic-like 
[Citrus sinensis]
 gb|KDO45021.1| hypothetical protein CISIN_1g008532mg [Citrus sinensis]
Length=562

 Score = 71.2 bits (173),  Expect = 3e-11, Method: Composition-based stats.
 Identities = 35/64 (55%), Positives = 47/64 (73%), Gaps = 1/64 (2%)
 Frame = +2

Query  341  PLLASIATGVILWF-VPQPGGVSRNAWQLLSIFLATIVGIITQPLPLGAVALMGLGACVL  517
            P + SI+ G+IL F VP+P  VS  AWQLLSIFL+TI G++  PLP+GA A +GL   ++
Sbjct  97   PFVISISIGLILRFLVPKPVEVSPQAWQLLSIFLSTIAGLVLSPLPVGAWAFLGLTTSIV  156

Query  518  TKTL  529
            T+TL
Sbjct  157  TRTL  160



>ref|XP_006423815.1| hypothetical protein CICLE_v10028114mg [Citrus clementina]
 gb|ESR37055.1| hypothetical protein CICLE_v10028114mg [Citrus clementina]
Length=562

 Score = 71.2 bits (173),  Expect = 3e-11, Method: Composition-based stats.
 Identities = 35/64 (55%), Positives = 47/64 (73%), Gaps = 1/64 (2%)
 Frame = +2

Query  341  PLLASIATGVILWF-VPQPGGVSRNAWQLLSIFLATIVGIITQPLPLGAVALMGLGACVL  517
            P + SI+ G+IL F VP+P  VS  AWQLLSIFL+TI G++  PLP+GA A +GL   ++
Sbjct  97   PFVISISIGLILRFLVPKPVEVSPQAWQLLSIFLSTIAGLVLSPLPVGAWAFLGLTTSIV  156

Query  518  TKTL  529
            T+TL
Sbjct  157  TRTL  160



>ref|WP_010299206.1| 2-oxoglutarate translocator [Candidatus Odyssella thessalonicensis]
Length=467

 Score = 70.9 bits (172),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 34/65 (52%), Positives = 44/65 (68%), Gaps = 0/65 (0%)
 Frame = +2

Query  335  IKPLLASIATGVILWFVPQPGGVSRNAWQLLSIFLATIVGIITQPLPLGAVALMGLGACV  514
            I   L  I  G+ L+F P PGG+    W L +IF+ATI G+I +PLP+GAVAL+G+ A V
Sbjct  4    IFSFLVPIIVGISLYFYPAPGGMDTQGWHLFAIFVATITGLIFKPLPMGAVALIGMAATV  63

Query  515  LTKTL  529
            LT TL
Sbjct  64   LTGTL  68



>ref|XP_009150500.1| PREDICTED: dicarboxylate transporter 2.1, chloroplastic [Brassica 
rapa]
Length=555

 Score = 71.2 bits (173),  Expect = 3e-11, Method: Composition-based stats.
 Identities = 35/65 (54%), Positives = 48/65 (74%), Gaps = 1/65 (2%)
 Frame = +2

Query  341  PLLASIATGVILWF-VPQPGGVSRNAWQLLSIFLATIVGIITQPLPLGAVALMGLGACVL  517
            PL+ S++ G+IL F V  P GV+   WQLLSIFL+TI G++  PLP+GA A +GL A ++
Sbjct  90   PLILSLSVGLILRFAVSVPEGVTPQGWQLLSIFLSTIAGLVLSPLPVGAWAFIGLTASIV  149

Query  518  TKTLT  532
            TKTL+
Sbjct  150  TKTLS  154



>ref|WP_042357669.1| 2-oxoglutarate translocator [Bacillus sp. MT2]
Length=490

 Score = 70.9 bits (172),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 32/63 (51%), Positives = 44/63 (70%), Gaps = 0/63 (0%)
 Frame = +2

Query  341  PLLASIATGVILWFVPQPGGVSRNAWQLLSIFLATIVGIITQPLPLGAVALMGLGACVLT  520
            PLL +IA G   W +P P G+  NAW LL IF+ATI G+I++PLP+GA+ ++ +   VLT
Sbjct  29   PLLITIAIGAAFWIIPAPSGLEVNAWHLLGIFIATIFGVISKPLPMGAICIVAITITVLT  88

Query  521  KTL  529
             TL
Sbjct  89   GTL  91



>gb|ABO87605.1| chloroplast glutamate/malate translocator [Pisum sativum]
Length=519

 Score = 71.2 bits (173),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 37/65 (57%), Positives = 49/65 (75%), Gaps = 1/65 (2%)
 Frame = +2

Query  341  PLLASIATGVIL-WFVPQPGGVSRNAWQLLSIFLATIVGIITQPLPLGAVALMGLGACVL  517
            P L SI+ G+I+ +FVP+P  V+  AWQLLSIFL+TI G++  PLP+GA A +GL   V+
Sbjct  54   PFLLSISIGLIVRFFVPKPVEVTAQAWQLLSIFLSTIAGLVLSPLPVGAWAFLGLTTSVV  113

Query  518  TKTLT  532
            TKTLT
Sbjct  114  TKTLT  118



>ref|WP_016645858.1| divalent anion:Na+ symporter (DASS) family transporter [Campylobacter 
ureolyticus]
 gb|EPH10223.1| divalent anion:Na+ symporter (DASS) family transporter [Campylobacter 
ureolyticus ACS-301-V-Sch3b]
Length=466

 Score = 70.9 bits (172),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 31/65 (48%), Positives = 47/65 (72%), Gaps = 0/65 (0%)
 Frame = +2

Query  338  KPLLASIATGVILWFVPQPGGVSRNAWQLLSIFLATIVGIITQPLPLGAVALMGLGACVL  517
            K L+     G+++WF+P    +S+ AWQL +I +ATI+G+I QPLP+GAVA +G+ A +L
Sbjct  5    KKLITLFVVGLVIWFIPHSDALSKEAWQLFAIVVATILGLILQPLPIGAVAFIGVAAAML  64

Query  518  TKTLT  532
            T TL+
Sbjct  65   TNTLS  69



>ref|XP_009366350.1| PREDICTED: dicarboxylate transporter 2, chloroplastic-like, partial 
[Pyrus x bretschneideri]
Length=550

 Score = 70.9 bits (172),  Expect = 4e-11, Method: Composition-based stats.
 Identities = 33/65 (51%), Positives = 48/65 (74%), Gaps = 1/65 (2%)
 Frame = +2

Query  341  PLLASIATGVIL-WFVPQPGGVSRNAWQLLSIFLATIVGIITQPLPLGAVALMGLGACVL  517
            P + SIA G+++ +FVP+P  V+  AWQLL+IFL+TI G++  PLP+GA A +GL   V+
Sbjct  99   PFIISIAIGIVVRFFVPKPVQVTPQAWQLLAIFLSTIAGLVLSPLPVGAWAFLGLTTSVV  158

Query  518  TKTLT  532
            T TL+
Sbjct  159  TGTLS  163



>ref|XP_003574657.1| PREDICTED: dicarboxylate transporter 2.1, chloroplastic [Brachypodium 
distachyon]
Length=556

 Score = 70.9 bits (172),  Expect = 5e-11, Method: Composition-based stats.
 Identities = 35/64 (55%), Positives = 48/64 (75%), Gaps = 1/64 (2%)
 Frame = +2

Query  341  PLLASIATGVILWFV-PQPGGVSRNAWQLLSIFLATIVGIITQPLPLGAVALMGLGACVL  517
            PL+AS+A G+ + F+ P+P  V+  AWQLLSIFL+TI G++  PLP+GA A +GL A V 
Sbjct  91   PLIASVAVGLAVRFLAPRPAEVTPEAWQLLSIFLSTIAGLVLGPLPVGAWAFLGLTATVA  150

Query  518  TKTL  529
            T+TL
Sbjct  151  TRTL  154



>ref|WP_025553155.1| hypothetical protein, partial [Vibrio parahaemolyticus]
Length=194

 Score = 68.2 bits (165),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 29/53 (55%), Positives = 42/53 (79%), Gaps = 0/53 (0%)
 Frame = +2

Query  344  LLASIATGVILWFVPQPGGVSRNAWQLLSIFLATIVGIITQPLPLGAVALMGL  502
            +L  +ATG ILWF+P P G++  AWQ+++IF+ T++ +I  PLPLGA+ALMGL
Sbjct  8    MLLLVATGCILWFIPTPEGLTDQAWQMMAIFVTTVLSLILAPLPLGAMALMGL  60



>ref|XP_002445990.1| hypothetical protein SORBIDRAFT_07g029170 [Sorghum bicolor]
 gb|EES15485.1| hypothetical protein SORBIDRAFT_07g029170 [Sorghum bicolor]
Length=551

 Score = 70.5 bits (171),  Expect = 5e-11, Method: Composition-based stats.
 Identities = 36/64 (56%), Positives = 47/64 (73%), Gaps = 1/64 (2%)
 Frame = +2

Query  341  PLLASIATGVILWF-VPQPGGVSRNAWQLLSIFLATIVGIITQPLPLGAVALMGLGACVL  517
            PLL S+A G+ + F VP+P  V+  AWQLLSIFL+TI G++  PLP+GA A +GL A V 
Sbjct  86   PLLISLAAGLAVRFLVPRPAEVTPEAWQLLSIFLSTIAGLVLGPLPVGAWAFLGLTATVA  145

Query  518  TKTL  529
            T+TL
Sbjct  146  TRTL  149



>ref|XP_009401226.1| PREDICTED: dicarboxylate transporter 2.1, chloroplastic-like 
[Musa acuminata subsp. malaccensis]
Length=562

 Score = 70.5 bits (171),  Expect = 5e-11, Method: Composition-based stats.
 Identities = 36/65 (55%), Positives = 48/65 (74%), Gaps = 1/65 (2%)
 Frame = +2

Query  341  PLLASIATGVILWF-VPQPGGVSRNAWQLLSIFLATIVGIITQPLPLGAVALMGLGACVL  517
            PL  S+A G+ + F VP+P  V+  AWQLL+IFL+TI G++  PLP+GA A +GL A V+
Sbjct  97   PLAISLAVGLAVRFLVPRPVEVTPQAWQLLAIFLSTIAGLVLSPLPVGAWAFIGLTASVI  156

Query  518  TKTLT  532
            TKTLT
Sbjct  157  TKTLT  161



>dbj|BAK44253.1| dicarboxylate transporter [Eggerthella sp. YY7918]
Length=492

 Score = 70.5 bits (171),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 29/58 (50%), Positives = 42/58 (72%), Gaps = 0/58 (0%)
 Frame = +2

Query  353  SIATGVILWFVPQPGGVSRNAWQLLSIFLATIVGIITQPLPLGAVALMGLGACVLTKT  526
            S+A GV+LWFVP P G+   AW + +IF ATIV +I +P+P+G++A+  +  CVLT T
Sbjct  35   SVAIGVVLWFVPTPAGLETQAWHMFAIFAATIVALIIKPMPMGSIAICAIALCVLTNT  92



>ref|XP_003547089.1| PREDICTED: dicarboxylate transporter 2.1, chloroplastic-like 
[Glycine max]
Length=562

 Score = 70.5 bits (171),  Expect = 6e-11, Method: Composition-based stats.
 Identities = 32/55 (58%), Positives = 43/55 (78%), Gaps = 0/55 (0%)
 Frame = +2

Query  368  VILWFVPQPGGVSRNAWQLLSIFLATIVGIITQPLPLGAVALMGLGACVLTKTLT  532
            ++ +FVP+P  V+  AWQLLSIFL+TI G++  PLP+GA A +GL A V+TKTLT
Sbjct  107  IVRFFVPKPVEVTPEAWQLLSIFLSTIAGLVLSPLPVGAWAFLGLTASVVTKTLT  161



>sp|Q8L7Z9.1|DIT2_SPIOL RecName: Full=Dicarboxylate transporter 2, chloroplastic; AltName: 
Full=Glutamate/malate translocator; Flags: Precursor [Spinacia 
oleracea]
 gb|AAM89396.1| glutamate/malate translocator [Spinacia oleracea]
Length=564

 Score = 70.5 bits (171),  Expect = 6e-11, Method: Composition-based stats.
 Identities = 32/64 (50%), Positives = 49/64 (77%), Gaps = 1/64 (2%)
 Frame = +2

Query  341  PLLASIATGVILWF-VPQPGGVSRNAWQLLSIFLATIVGIITQPLPLGAVALMGLGACVL  517
            PL+ S++ G++L F VP+P  ++  AWQLL+IFL+T+ G++  PLP+GA A +G+ A V+
Sbjct  99   PLILSVSVGLLLRFAVPKPAELTPQAWQLLAIFLSTVAGLVLSPLPVGAWAFLGVTASVV  158

Query  518  TKTL  529
            TKTL
Sbjct  159  TKTL  162



>ref|WP_006555548.1| divalent anion:Na+ symporter (DASS) family transporter [Veillonella 
ratti]
 gb|EKU78851.1| divalent anion:Na+ symporter (DASS) family transporter [Veillonella 
ratti ACS-216-V-Col6b]
Length=470

 Score = 70.5 bits (171),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 31/66 (47%), Positives = 47/66 (71%), Gaps = 0/66 (0%)
 Frame = +2

Query  335  IKPLLASIATGVILWFVPQPGGVSRNAWQLLSIFLATIVGIITQPLPLGAVALMGLGACV  514
            I+ LL +IA GV++WF+P P G++  AW L ++F++TI+G I  PLP+GAVA +G+    
Sbjct  6    IRNLLITIAVGVVIWFLPVPNGITDQAWHLFAVFVSTILGFILAPLPIGAVAFLGVTIAA  65

Query  515  LTKTLT  532
            LT  +T
Sbjct  66   LTGVIT  71



>ref|XP_010690536.1| PREDICTED: dicarboxylate transporter 2, chloroplastic [Beta vulgaris 
subsp. vulgaris]
Length=559

 Score = 70.5 bits (171),  Expect = 6e-11, Method: Composition-based stats.
 Identities = 34/64 (53%), Positives = 49/64 (77%), Gaps = 1/64 (2%)
 Frame = +2

Query  341  PLLASIATGVILWF-VPQPGGVSRNAWQLLSIFLATIVGIITQPLPLGAVALMGLGACVL  517
            PL+ SI+ G+IL F VP+P  ++  AWQLL+IFL+T+ G++  PLP+GA A +G+ A V+
Sbjct  94   PLILSISIGLILRFIVPRPVELTLQAWQLLAIFLSTVAGLVLNPLPVGAWAFLGVTASVV  153

Query  518  TKTL  529
            TKTL
Sbjct  154  TKTL  157



>ref|WP_023385002.1| divalent anion:Na+ symporter (DASS) family protein [Campylobacter 
fetus]
 gb|AGZ81689.1| divalent anion:Na+ symporter (DASS) family protein [Campylobacter 
fetus subsp. testudinum 03-427]
 gb|AJB45428.1| 2-oxoglutarate translocator [Campylobacter fetus subsp. testudinum]
Length=467

 Score = 70.1 bits (170),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 33/61 (54%), Positives = 43/61 (70%), Gaps = 0/61 (0%)
 Frame = +2

Query  347  LASIATGVILWFVPQPGGVSRNAWQLLSIFLATIVGIITQPLPLGAVALMGLGACVLTKT  526
            LA IA GV++WF+P P  VS  AW L +I LATI+G+I QPLP+GAVA  G+   +LT  
Sbjct  9    LAVIAIGVLVWFLPHPDAVSAQAWHLFAIVLATILGLIFQPLPIGAVAFFGVTVAILTNV  68

Query  527  L  529
            +
Sbjct  69   M  69



>ref|WP_041690951.1| 2-oxoglutarate translocator [Eggerthella sp. YY7918]
Length=473

 Score = 70.1 bits (170),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 29/58 (50%), Positives = 42/58 (72%), Gaps = 0/58 (0%)
 Frame = +2

Query  353  SIATGVILWFVPQPGGVSRNAWQLLSIFLATIVGIITQPLPLGAVALMGLGACVLTKT  526
            S+A GV+LWFVP P G+   AW + +IF ATIV +I +P+P+G++A+  +  CVLT T
Sbjct  16   SVAIGVVLWFVPTPAGLETQAWHMFAIFAATIVALIIKPMPMGSIAICAIALCVLTNT  73



>ref|XP_009381488.1| PREDICTED: dicarboxylate transporter 2.1, chloroplastic-like 
isoform X3 [Musa acuminata subsp. malaccensis]
Length=528

 Score = 70.5 bits (171),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 37/65 (57%), Positives = 45/65 (69%), Gaps = 1/65 (2%)
 Frame = +2

Query  341  PLLASIATGVILWF-VPQPGGVSRNAWQLLSIFLATIVGIITQPLPLGAVALMGLGACVL  517
            PL  S+A G+ +WF VP P  V+  AWQLL+IFL+TI G I  PLP+ A A +GL A V 
Sbjct  94   PLAISLAVGLAIWFLVPTPAEVTPQAWQLLAIFLSTITGFILGPLPIAAWAFLGLTASVA  153

Query  518  TKTLT  532
            TKTLT
Sbjct  154  TKTLT  158



>ref|XP_008805911.1| PREDICTED: dicarboxylate transporter 2.1, chloroplastic [Phoenix 
dactylifera]
Length=590

 Score = 70.5 bits (171),  Expect = 7e-11, Method: Composition-based stats.
 Identities = 35/65 (54%), Positives = 48/65 (74%), Gaps = 1/65 (2%)
 Frame = +2

Query  341  PLLASIATGVILWF-VPQPGGVSRNAWQLLSIFLATIVGIITQPLPLGAVALMGLGACVL  517
            PL  S+A G+ + F VP+P  V+  AWQLL+IFL+TI G++  PLP+GA A +GL A V+
Sbjct  125  PLAISLAIGLAVRFLVPRPIEVTSQAWQLLAIFLSTIAGLVLSPLPVGAWAFLGLTASVV  184

Query  518  TKTLT  532
            TKTL+
Sbjct  185  TKTLS  189



>emb|CAN78375.1| hypothetical protein VITISV_000698 [Vitis vinifera]
Length=564

 Score = 70.1 bits (170),  Expect = 7e-11, Method: Composition-based stats.
 Identities = 33/65 (51%), Positives = 47/65 (72%), Gaps = 1/65 (2%)
 Frame = +2

Query  341  PLLASIATGVILWF-VPQPGGVSRNAWQLLSIFLATIVGIITQPLPLGAVALMGLGACVL  517
            P + SI+ G+I+ F VP+P  VS  AWQLL+IFL+T+ G++  PLP+GA A +GL   +L
Sbjct  99   PFIISISIGLIVRFLVPKPVQVSMQAWQLLAIFLSTVAGLVLNPLPVGAWAFLGLXTSIL  158

Query  518  TKTLT  532
            T TL+
Sbjct  159  TNTLS  163



>ref|WP_041017059.1| 2-oxoglutarate translocator [Criblamydia sequanensis]
 emb|CDR33597.1| Na+-dependent transporter [Criblamydia sequanensis CRIB-18]
Length=467

 Score = 70.1 bits (170),  Expect = 8e-11, Method: Compositional matrix adjust.
 Identities = 28/65 (43%), Positives = 43/65 (66%), Gaps = 0/65 (0%)
 Frame = +2

Query  335  IKPLLASIATGVILWFVPQPGGVSRNAWQLLSIFLATIVGIITQPLPLGAVALMGLGACV  514
            + P   + A G ++W +P P G++  +W L +IF+ATI G++ +PLP+G VA M L A +
Sbjct  5    VMPFFLTFAVGFLIWLLPIPEGITEQSWHLFAIFVATIFGVVARPLPMGGVAFMALAALI  64

Query  515  LTKTL  529
             TKTL
Sbjct  65   WTKTL  69



>emb|CDX84512.1| BnaC03g49880D [Brassica napus]
Length=562

 Score = 70.1 bits (170),  Expect = 8e-11, Method: Composition-based stats.
 Identities = 34/65 (52%), Positives = 48/65 (74%), Gaps = 1/65 (2%)
 Frame = +2

Query  341  PLLASIATGVILWF-VPQPGGVSRNAWQLLSIFLATIVGIITQPLPLGAVALMGLGACVL  517
            PL+ S++ G+IL F V  P GV+   WQLLSIFL+TI G++  PLP+GA A +GL A ++
Sbjct  97   PLILSLSVGLILRFAVSVPEGVTPQGWQLLSIFLSTIAGLVLSPLPVGAWAFIGLTASIV  156

Query  518  TKTLT  532
            T+TL+
Sbjct  157  TRTLS  161



>ref|XP_010648147.1| PREDICTED: dicarboxylate transporter 2.1, chloroplastic-like 
[Vitis vinifera]
Length=573

 Score = 70.1 bits (170),  Expect = 9e-11, Method: Composition-based stats.
 Identities = 33/65 (51%), Positives = 47/65 (72%), Gaps = 1/65 (2%)
 Frame = +2

Query  341  PLLASIATGVILWF-VPQPGGVSRNAWQLLSIFLATIVGIITQPLPLGAVALMGLGACVL  517
            P + SI+ G+I+ F VP+P  VS  AWQLL+IFL+T+ G++  PLP+GA A +GL   +L
Sbjct  108  PFIISISIGLIVRFLVPKPVQVSMQAWQLLAIFLSTVAGLVLNPLPVGAWAFLGLTTSIL  167

Query  518  TKTLT  532
            T TL+
Sbjct  168  TNTLS  172



>ref|XP_008382044.1| PREDICTED: dicarboxylate transporter 2, chloroplastic-like [Malus 
domestica]
Length=565

 Score = 69.7 bits (169),  Expect = 1e-10, Method: Composition-based stats.
 Identities = 33/65 (51%), Positives = 47/65 (72%), Gaps = 1/65 (2%)
 Frame = +2

Query  341  PLLASIATGV-ILWFVPQPGGVSRNAWQLLSIFLATIVGIITQPLPLGAVALMGLGACVL  517
            P + SIA G+ + +FVP+P  V+  AWQLL+IFL+TI G++  PLP+GA A +GL A  +
Sbjct  100  PFIISIAVGIAVRFFVPKPVEVTPQAWQLLAIFLSTIAGLVLSPLPVGAWAFLGLTASXV  159

Query  518  TKTLT  532
            T TL+
Sbjct  160  TGTLS  164



>gb|KDP40929.1| hypothetical protein JCGZ_24928 [Jatropha curcas]
Length=569

 Score = 69.7 bits (169),  Expect = 1e-10, Method: Composition-based stats.
 Identities = 31/67 (46%), Positives = 50/67 (75%), Gaps = 1/67 (1%)
 Frame = +2

Query  335  IKPLLASIATGVILWF-VPQPGGVSRNAWQLLSIFLATIVGIITQPLPLGAVALMGLGAC  511
            I PL+ S++ G++L F +P+P  ++  AWQLL+IF++TI G++  PLP+GA A +GL   
Sbjct  102  IFPLVISVSIGLVLRFCIPRPVEITPQAWQLLAIFISTIAGLVLNPLPVGAWAFLGLTTS  161

Query  512  VLTKTLT  532
            ++T+TLT
Sbjct  162  IVTRTLT  168



>gb|KJB32094.1| hypothetical protein B456_005G223500 [Gossypium raimondii]
Length=562

 Score = 69.3 bits (168),  Expect = 1e-10, Method: Composition-based stats.
 Identities = 33/64 (52%), Positives = 47/64 (73%), Gaps = 1/64 (2%)
 Frame = +2

Query  341  PLLASIATGVILWF-VPQPGGVSRNAWQLLSIFLATIVGIITQPLPLGAVALMGLGACVL  517
            PL  S++ G+I+ F VP+P  V+  AWQLL+IFL+TI G++  PLP+GA A +GL   ++
Sbjct  97   PLFLSVSIGLIVRFLVPKPVEVTPQAWQLLAIFLSTIAGLVLSPLPVGAWAFIGLTTSIV  156

Query  518  TKTL  529
            TKTL
Sbjct  157  TKTL  160



>gb|EAZ09443.1| hypothetical protein OsI_31717 [Oryza sativa Indica Group]
Length=550

 Score = 69.3 bits (168),  Expect = 2e-10, Method: Composition-based stats.
 Identities = 36/66 (55%), Positives = 47/66 (71%), Gaps = 1/66 (2%)
 Frame = +2

Query  335  IKPLLASIATGVILWFV-PQPGGVSRNAWQLLSIFLATIVGIITQPLPLGAVALMGLGAC  511
            + PLL S+A G+ + F+ P+P  VS  AWQLLSIFL+TI G++  PLP+GA A +GL A 
Sbjct  83   LAPLLVSLAVGLAVRFLAPRPPEVSPQAWQLLSIFLSTIAGLVLGPLPVGAWAFLGLTAA  142

Query  512  VLTKTL  529
            V T TL
Sbjct  143  VATHTL  148



>ref|XP_003057697.1| divalent Anion:Na+ symporter family [Micromonas pusilla CCMP1545]
 gb|EEH57648.1| divalent Anion:Na+ symporter family [Micromonas pusilla CCMP1545]
Length=515

 Score = 69.3 bits (168),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 33/65 (51%), Positives = 46/65 (71%), Gaps = 0/65 (0%)
 Frame = +2

Query  335  IKPLLASIATGVILWFVPQPGGVSRNAWQLLSIFLATIVGIITQPLPLGAVALMGLGACV  514
            +KPL  S+  G+I+W +P P GV+  AW L ++F+ TIVGIIT PLPLGA A++GL   +
Sbjct  50   LKPLGYSVLAGLIIWCIPAPVGVTVKAWHLFAVFVGTIVGIITNPLPLGATAMVGLAVSM  109

Query  515  LTKTL  529
            +T  L
Sbjct  110  VTGLL  114



>gb|ACN34632.1| unknown [Zea mays]
 tpg|DAA40306.1| TPA: plastidic general dicarboxylate transporter [Zea mays]
Length=554

 Score = 69.3 bits (168),  Expect = 2e-10, Method: Composition-based stats.
 Identities = 36/64 (56%), Positives = 47/64 (73%), Gaps = 1/64 (2%)
 Frame = +2

Query  341  PLLASIATGVILWFV-PQPGGVSRNAWQLLSIFLATIVGIITQPLPLGAVALMGLGACVL  517
            PL+ SIA G+ + F+ P+P  VS  AWQLLSIFL+TI G++  PLP+GA A +GL A V 
Sbjct  89   PLVISIAIGLAVRFLAPRPVEVSPQAWQLLSIFLSTIAGLVLGPLPVGAWAFLGLTAAVA  148

Query  518  TKTL  529
            T+TL
Sbjct  149  TRTL  152



>ref|NP_001104868.1| plastidic general dicarboxylate transporter [Zea mays]
 dbj|BAD06220.1| plastidic general dicarboxylate transporter [Zea mays]
Length=554

 Score = 69.3 bits (168),  Expect = 2e-10, Method: Composition-based stats.
 Identities = 36/64 (56%), Positives = 47/64 (73%), Gaps = 1/64 (2%)
 Frame = +2

Query  341  PLLASIATGVILWFV-PQPGGVSRNAWQLLSIFLATIVGIITQPLPLGAVALMGLGACVL  517
            PL+ SIA G+ + F+ P+P  VS  AWQLLSIFL+TI G++  PLP+GA A +GL A V 
Sbjct  89   PLVISIAIGLAVRFLAPRPVEVSPQAWQLLSIFLSTIAGLVLGPLPVGAWAFLGLTAAVA  148

Query  518  TKTL  529
            T+TL
Sbjct  149  TRTL  152



>dbj|BAD19756.1| putative plastidic general dicarboxylate transporter [Oryza sativa 
Japonica Group]
 dbj|BAD22267.1| putative plastidic general dicarboxylate transporter [Oryza sativa 
Japonica Group]
Length=550

 Score = 69.3 bits (168),  Expect = 2e-10, Method: Composition-based stats.
 Identities = 36/66 (55%), Positives = 47/66 (71%), Gaps = 1/66 (2%)
 Frame = +2

Query  335  IKPLLASIATGVILWFV-PQPGGVSRNAWQLLSIFLATIVGIITQPLPLGAVALMGLGAC  511
            + PLL S+A G+ + F+ P+P  VS  AWQLLSIFL+TI G++  PLP+GA A +GL A 
Sbjct  83   LAPLLVSLAVGLAVRFLAPRPPEVSPQAWQLLSIFLSTIAGLVLGPLPVGAWAFLGLTAA  142

Query  512  VLTKTL  529
            V T TL
Sbjct  143  VATHTL  148



>ref|WP_029859134.1| hypothetical protein, partial [Vibrio parahaemolyticus]
Length=180

 Score = 66.2 bits (160),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 30/62 (48%), Positives = 43/62 (69%), Gaps = 0/62 (0%)
 Frame = +2

Query  344  LLASIATGVILWFVPQPGGVSRNAWQLLSIFLATIVGIITQPLPLGAVALMGLGACVLTK  523
            +L  +A G ILWF+P P G++  AWQ+++IF+ T++ +I  PLPLGA+ALMGL    L  
Sbjct  44   MLLLVAIGCILWFIPTPEGLTDQAWQMMAIFVTTVLSLILAPLPLGAMALMGLTLATLLG  103

Query  524  TL  529
             L
Sbjct  104  VL  105



>dbj|BAD06222.1| plastidic general dicarboxylate transporter [Zea mays]
Length=551

 Score = 69.3 bits (168),  Expect = 2e-10, Method: Composition-based stats.
 Identities = 35/64 (55%), Positives = 46/64 (72%), Gaps = 1/64 (2%)
 Frame = +2

Query  341  PLLASIATGVILWF-VPQPGGVSRNAWQLLSIFLATIVGIITQPLPLGAVALMGLGACVL  517
            PL  S+A G+ + F VP+P  V+  AWQLLSIFL+TI G++  PLP+GA A +GL A V 
Sbjct  86   PLFLSLAAGLAVRFLVPRPAEVTPEAWQLLSIFLSTIAGLVLGPLPVGAWAFLGLTATVA  145

Query  518  TKTL  529
            T+TL
Sbjct  146  TRTL  149



>dbj|BAK03702.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ89524.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=556

 Score = 69.3 bits (168),  Expect = 2e-10, Method: Composition-based stats.
 Identities = 36/64 (56%), Positives = 47/64 (73%), Gaps = 1/64 (2%)
 Frame = +2

Query  341  PLLASIATGVILWFV-PQPGGVSRNAWQLLSIFLATIVGIITQPLPLGAVALMGLGACVL  517
            PL+ASIA G+ + F+ P+P  V+  AWQLLSIFL+TI G++  PLP+GA A +GL A V 
Sbjct  91   PLVASIAVGLAVRFLAPRPPEVTPQAWQLLSIFLSTIAGLVLGPLPVGAWAFLGLTATVA  150

Query  518  TKTL  529
            T TL
Sbjct  151  TGTL  154



>dbj|BAJ99052.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=556

 Score = 69.3 bits (168),  Expect = 2e-10, Method: Composition-based stats.
 Identities = 36/64 (56%), Positives = 47/64 (73%), Gaps = 1/64 (2%)
 Frame = +2

Query  341  PLLASIATGVILWFV-PQPGGVSRNAWQLLSIFLATIVGIITQPLPLGAVALMGLGACVL  517
            PL+ASIA G+ + F+ P+P  V+  AWQLLSIFL+TI G++  PLP+GA A +GL A V 
Sbjct  91   PLVASIAVGLAVRFLAPRPPEVTPQAWQLLSIFLSTIAGLVLGPLPVGAWAFLGLTATVA  150

Query  518  TKTL  529
            T TL
Sbjct  151  TGTL  154



>ref|XP_004984114.1| PREDICTED: dicarboxylate transporter 2.1, chloroplastic-like 
[Setaria italica]
Length=551

 Score = 68.9 bits (167),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 37/64 (58%), Positives = 48/64 (75%), Gaps = 1/64 (2%)
 Frame = +2

Query  341  PLLASIATGVILWFV-PQPGGVSRNAWQLLSIFLATIVGIITQPLPLGAVALMGLGACVL  517
            PL+ SIA G+ + F+ P+P  VS NAWQ+LSIFL+TI G++  PLP+GAVA +GL   V 
Sbjct  86   PLVISIAVGLAVRFLAPRPAEVSPNAWQMLSIFLSTIAGLVLGPLPVGAVAFLGLTTVVA  145

Query  518  TKTL  529
            TKTL
Sbjct  146  TKTL  149



>ref|NP_001104869.1| plastidic general dicarboxylate transporter [Zea mays]
 dbj|BAD06221.1| plastidic general dicarboxylate transporter [Zea mays]
 gb|ACN30635.1| unknown [Zea mays]
 tpg|DAA47746.1| TPA: plastidic general dicarboxylate transporter [Zea mays]
Length=551

 Score = 68.9 bits (167),  Expect = 2e-10, Method: Composition-based stats.
 Identities = 35/64 (55%), Positives = 46/64 (72%), Gaps = 1/64 (2%)
 Frame = +2

Query  341  PLLASIATGVILWF-VPQPGGVSRNAWQLLSIFLATIVGIITQPLPLGAVALMGLGACVL  517
            PL  S+A G+ + F VP+P  V+  AWQLLSIFL+TI G++  PLP+GA A +GL A V 
Sbjct  86   PLFLSLAAGLAVRFLVPRPAEVTPEAWQLLSIFLSTIAGLVLGPLPVGAWAFLGLTATVA  145

Query  518  TKTL  529
            T+TL
Sbjct  146  TRTL  149



>ref|WP_036802812.1| 2-oxoglutarate translocator [Planomicrobium glaciei]
Length=482

 Score = 68.9 bits (167),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 31/65 (48%), Positives = 45/65 (69%), Gaps = 0/65 (0%)
 Frame = +2

Query  338  KPLLASIATGVILWFVPQPGGVSRNAWQLLSIFLATIVGIITQPLPLGAVALMGLGACVL  517
            K LL   A G++LWF+P P G+  +AW L SIF+ATIV ++ +P+P+G+ A++ L   VL
Sbjct  20   KSLLFCAALGLVLWFIPAPSGLETDAWHLFSIFVATIVALVIKPVPMGSTAILALTLIVL  79

Query  518  TKTLT  532
            T  LT
Sbjct  80   TDILT  84



>ref|XP_007199747.1| hypothetical protein PRUPE_ppa003588mg [Prunus persica]
 gb|EMJ00946.1| hypothetical protein PRUPE_ppa003588mg [Prunus persica]
Length=563

 Score = 68.9 bits (167),  Expect = 2e-10, Method: Composition-based stats.
 Identities = 33/64 (52%), Positives = 47/64 (73%), Gaps = 1/64 (2%)
 Frame = +2

Query  341  PLLASIATGVILWF-VPQPGGVSRNAWQLLSIFLATIVGIITQPLPLGAVALMGLGACVL  517
            P + SIA G+++ F VP+P  VS  AWQLL+IFL+TI G++  PLP+GA A +GL + ++
Sbjct  98   PFIISIAIGLVVRFLVPKPVEVSPQAWQLLAIFLSTIAGLVLSPLPVGAWAFLGLTSSIV  157

Query  518  TKTL  529
            T TL
Sbjct  158  TGTL  161



>ref|WP_033543815.1| 2-oxoglutarate translocator [Planococcus sp. CAU13]
Length=474

 Score = 68.6 bits (166),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 30/63 (48%), Positives = 45/63 (71%), Gaps = 0/63 (0%)
 Frame = +2

Query  344  LLASIATGVILWFVPQPGGVSRNAWQLLSIFLATIVGIITQPLPLGAVALMGLGACVLTK  523
            LL  +  G++LWF+P P G+   AW L SIF+ATIV ++ +P+P+G+ A++ L   VLT+
Sbjct  14   LLICLVIGLVLWFIPAPSGLETEAWHLFSIFVATIVALVIKPVPMGSAAILALTIIVLTQ  73

Query  524  TLT  532
            TLT
Sbjct  74   TLT  76



>ref|XP_004290424.1| PREDICTED: dicarboxylate transporter 2.1, chloroplastic-like 
[Fragaria vesca subsp. vesca]
Length=545

 Score = 68.9 bits (167),  Expect = 2e-10, Method: Composition-based stats.
 Identities = 34/67 (51%), Positives = 48/67 (72%), Gaps = 1/67 (1%)
 Frame = +2

Query  335  IKPLLASIATGVILWF-VPQPGGVSRNAWQLLSIFLATIVGIITQPLPLGAVALMGLGAC  511
            I PL+ S+A G+ + F VP+P  V+  AWQLL+IFL+TI G++  PLP+GA A +GL   
Sbjct  78   IAPLILSVAIGLAVRFLVPKPVQVTPQAWQLLAIFLSTIAGLVLSPLPVGAWAFLGLTTS  137

Query  512  VLTKTLT  532
            V++ TLT
Sbjct  138  VVSGTLT  144



>ref|XP_007042895.1| Dicarboxylate transport 2.1 [Theobroma cacao]
 gb|EOX98726.1| Dicarboxylate transport 2.1 [Theobroma cacao]
Length=564

 Score = 68.9 bits (167),  Expect = 2e-10, Method: Composition-based stats.
 Identities = 32/64 (50%), Positives = 46/64 (72%), Gaps = 1/64 (2%)
 Frame = +2

Query  341  PLLASIATGVILWF-VPQPGGVSRNAWQLLSIFLATIVGIITQPLPLGAVALMGLGACVL  517
            P   SI+ G+I+ F VP+P  V+  AWQLL+IFL+TI G++  PLP+GA A +GL   ++
Sbjct  99   PFFVSISIGLIVHFLVPKPVDVTPQAWQLLAIFLSTIAGLVLSPLPVGAWAFLGLTTSIV  158

Query  518  TKTL  529
            T+TL
Sbjct  159  TRTL  162



>gb|KIY93848.1| hypothetical protein MNEG_14114 [Monoraphidium neglectum]
Length=79

 Score = 64.3 bits (155),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 32/45 (71%), Positives = 37/45 (82%), Gaps = 0/45 (0%)
 Frame = +2

Query  398  GVSRNAWQLLSIFLATIVGIITQPLPLGAVALMGLGACVLTKTLT  532
            GV+  AW LL+IF  TIVGIIT PLPLGAVA++GLG  +LTKTLT
Sbjct  22   GVTVKAWNLLAIFTGTIVGIITTPLPLGAVAVLGLGVSMLTKTLT  66



>ref|WP_000493040.1| 2-oxoglutarate translocator [Vibrio cholerae]
 gb|EDM55699.1| 2-oxoglutarate/malate translocator [Vibrio cholerae MZO-2]
Length=468

 Score = 68.6 bits (166),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 34/62 (55%), Positives = 44/62 (71%), Gaps = 0/62 (0%)
 Frame = +2

Query  344  LLASIATGVILWFVPQPGGVSRNAWQLLSIFLATIVGIITQPLPLGAVALMGLGACVLTK  523
            LLA I  G ILWF+P P G+   AWQ++++F+ T+V +I  PLPLGA+ALMGL A VL  
Sbjct  9    LLALIFFGSILWFIPTPEGLEPEAWQMMTVFVTTVVSLILAPLPLGAMALMGLCATVLLG  68

Query  524  TL  529
             L
Sbjct  69   IL  70



>gb|ETP70180.1| 2-oxoglutarate translocator [Planomicrobium glaciei CHR43]
Length=474

 Score = 68.6 bits (166),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 31/65 (48%), Positives = 45/65 (69%), Gaps = 0/65 (0%)
 Frame = +2

Query  338  KPLLASIATGVILWFVPQPGGVSRNAWQLLSIFLATIVGIITQPLPLGAVALMGLGACVL  517
            K LL   A G++LWF+P P G+  +AW L SIF+ATIV ++ +P+P+G+ A++ L   VL
Sbjct  12   KSLLFCAALGLVLWFIPAPSGLETDAWHLFSIFVATIVALVIKPVPMGSTAILALTLIVL  71

Query  518  TKTLT  532
            T  LT
Sbjct  72   TDILT  76



>ref|WP_000493041.1| 2-oxoglutarate translocator [Vibrio cholerae]
 gb|EFH74421.1| 2-oxoglutarate/malate translocator [Vibrio cholerae RC385]
Length=468

 Score = 68.6 bits (166),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 34/62 (55%), Positives = 44/62 (71%), Gaps = 0/62 (0%)
 Frame = +2

Query  344  LLASIATGVILWFVPQPGGVSRNAWQLLSIFLATIVGIITQPLPLGAVALMGLGACVLTK  523
            LLA I  G ILWF+P P G+   AWQ++++F+ T+V +I  PLPLGA+ALMGL A VL  
Sbjct  9    LLALIFFGSILWFIPTPEGLEPKAWQMMTVFVTTVVSLILAPLPLGAMALMGLCATVLLG  68

Query  524  TL  529
             L
Sbjct  69   IL  70



>ref|XP_007511000.1| 2-oxoglutarate/malate translocator [Bathycoccus prasinos]
 emb|CCO66560.1| 2-oxoglutarate/malate translocator [Bathycoccus prasinos]
Length=573

 Score = 68.9 bits (167),  Expect = 2e-10, Method: Composition-based stats.
 Identities = 34/67 (51%), Positives = 45/67 (67%), Gaps = 1/67 (1%)
 Frame = +2

Query  335  IKPLLASIATGVILWFV-PQPGGVSRNAWQLLSIFLATIVGIITQPLPLGAVALMGLGAC  511
            +K    S+  G+ + FV P+P GV   AW LLSIFLAT+ G++  PLP+GA A +GL   
Sbjct  108  LKAAAMSVGFGLFVCFVVPRPDGVVPQAWNLLSIFLATVAGLVLSPLPVGAWAFLGLTTA  167

Query  512  VLTKTLT  532
            V+TKTLT
Sbjct  168  VVTKTLT  174



>ref|XP_008346519.1| PREDICTED: dicarboxylate transporter 2, chloroplastic-like [Malus 
domestica]
Length=279

 Score = 67.0 bits (162),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 33/65 (51%), Positives = 48/65 (74%), Gaps = 1/65 (2%)
 Frame = +2

Query  341  PLLASIATGVIL-WFVPQPGGVSRNAWQLLSIFLATIVGIITQPLPLGAVALMGLGACVL  517
            P + SIA G+++ +FVP+P  V+  AWQLL+IFL+TI G++  PLP+GA A +GL   V+
Sbjct  99   PFIISIAIGIVVRFFVPKPVEVTPQAWQLLAIFLSTIAGLVLSPLPVGAWAFLGLTTSVV  158

Query  518  TKTLT  532
            T TL+
Sbjct  159  TGTLS  163



>ref|WP_000493042.1| 2-oxoglutarate translocator [Vibrio cholerae]
 gb|EDN17198.1| 2-oxoglutarate/malate translocator [Vibrio cholerae AM-19226]
 gb|EJH60830.1| 2-oxoglutarate/malate translocator [Vibrio cholerae HE-45]
Length=468

 Score = 68.6 bits (166),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 34/62 (55%), Positives = 44/62 (71%), Gaps = 0/62 (0%)
 Frame = +2

Query  344  LLASIATGVILWFVPQPGGVSRNAWQLLSIFLATIVGIITQPLPLGAVALMGLGACVLTK  523
            LLA I  G ILWF+P P G+   AWQ++++F+ T+V +I  PLPLGA+ALMGL A VL  
Sbjct  9    LLALIFFGSILWFIPTPEGLEPKAWQMMTVFVTTVVSLILAPLPLGAMALMGLCATVLLG  68

Query  524  TL  529
             L
Sbjct  69   IL  70



>ref|WP_031828591.1| 2-oxoglutarate translocator, partial [Vibrio parahaemolyticus]
Length=192

 Score = 65.9 bits (159),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 28/53 (53%), Positives = 41/53 (77%), Gaps = 0/53 (0%)
 Frame = +2

Query  344  LLASIATGVILWFVPQPGGVSRNAWQLLSIFLATIVGIITQPLPLGAVALMGL  502
            +L  +A G ILWF+P P G++  AWQ+++IF+ T++ +I  PLPLGA+ALMGL
Sbjct  8    MLLLVAIGCILWFIPTPEGLTDQAWQMMAIFVTTVLSLILAPLPLGAMALMGL  60



>ref|XP_003531538.1| PREDICTED: dicarboxylate transporter 2.1, chloroplastic-like 
[Glycine max]
Length=557

 Score = 68.6 bits (166),  Expect = 3e-10, Method: Composition-based stats.
 Identities = 31/55 (56%), Positives = 42/55 (76%), Gaps = 0/55 (0%)
 Frame = +2

Query  368  VILWFVPQPGGVSRNAWQLLSIFLATIVGIITQPLPLGAVALMGLGACVLTKTLT  532
            ++ + VP+P  V+  AWQLLSIFL+TI G++  PLP+GA A +GL A V+TKTLT
Sbjct  102  IVRFLVPKPVQVTPEAWQLLSIFLSTIAGLVLSPLPVGAWAFLGLTASVVTKTLT  156



>ref|WP_042479679.1| 2-oxoglutarate translocator [Vibrio diazotrophicus]
Length=468

 Score = 68.2 bits (165),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 31/55 (56%), Positives = 42/55 (76%), Gaps = 0/55 (0%)
 Frame = +2

Query  365  GVILWFVPQPGGVSRNAWQLLSIFLATIVGIITQPLPLGAVALMGLGACVLTKTL  529
            GVILWFVP P G++ NAWQ++ IF+ T++ +I  PLPLGA+AL+GL AC +   L
Sbjct  16   GVILWFVPVPDGLTDNAWQMMVIFVITVLSLILAPLPLGAMALIGLVACTVLGVL  70



>emb|CEG93672.1| Anion transporter [Propionibacterium freudenreichii]
Length=499

 Score = 68.2 bits (165),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 29/57 (51%), Positives = 44/57 (77%), Gaps = 0/57 (0%)
 Frame = +2

Query  341  PLLASIATGVILWFVPQPGGVSRNAWQLLSIFLATIVGIITQPLPLGAVALMGLGAC  511
            PLLA++  GV++WFVP P G++ NAW LL+IF+ATIVGII +  P+G ++++ +  C
Sbjct  30   PLLATLVVGVVIWFVPVPAGLAANAWHLLAIFVATIVGIIGKAAPMGTLSVIAMALC  86



>ref|WP_025518842.1| hypothetical protein, partial [Vibrio parahaemolyticus]
Length=194

 Score = 65.9 bits (159),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 28/53 (53%), Positives = 41/53 (77%), Gaps = 0/53 (0%)
 Frame = +2

Query  344  LLASIATGVILWFVPQPGGVSRNAWQLLSIFLATIVGIITQPLPLGAVALMGL  502
            +L  +A G ILWF+P P G++  AWQ+++IF+ T++ +I  PLPLGA+ALMGL
Sbjct  8    MLLLVAIGCILWFIPTPEGLTDQAWQMMAIFVTTVLSLILAPLPLGAMALMGL  60



>ref|XP_008237290.1| PREDICTED: dicarboxylate transporter 2.1, chloroplastic-like 
[Prunus mume]
Length=563

 Score = 68.6 bits (166),  Expect = 3e-10, Method: Composition-based stats.
 Identities = 32/64 (50%), Positives = 47/64 (73%), Gaps = 1/64 (2%)
 Frame = +2

Query  341  PLLASIATGVILWF-VPQPGGVSRNAWQLLSIFLATIVGIITQPLPLGAVALMGLGACVL  517
            P + S+A G+++ F VP+P  VS  AWQLL+IFL+TI G++  PLP+GA A +GL + ++
Sbjct  98   PFIISVAIGLVVRFLVPKPVEVSPQAWQLLAIFLSTIAGLVLSPLPVGAWAFLGLTSSIV  157

Query  518  TKTL  529
            T TL
Sbjct  158  TGTL  161



>ref|WP_036154823.1| 2-oxoglutarate translocator [Lysinibacillus odysseyi]
 gb|KGR84276.1| 2-oxoglutarate translocator [Lysinibacillus odysseyi 34hs-1 = 
NBRC 100172]
Length=472

 Score = 68.2 bits (165),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 28/63 (44%), Positives = 45/63 (71%), Gaps = 0/63 (0%)
 Frame = +2

Query  341  PLLASIATGVILWFVPQPGGVSRNAWQLLSIFLATIVGIITQPLPLGAVALMGLGACVLT  520
            PLL  +  G I+WF+P P G+   AW L ++F+ATI+G+I +PLP+G++A++ L   ++T
Sbjct  11   PLLIIVLIGAIIWFIPSPEGLEVQAWHLFAVFVATIIGLILKPLPMGSIAILSLTIIIVT  70

Query  521  KTL  529
             TL
Sbjct  71   NTL  73



>ref|WP_010372129.1| 2-oxoglutarate translocator [Weissella cibaria]
 gb|KIU19200.1| putative malate transporter YflS [Weissella cibaria]
 gb|KIU23825.1| putative malate transporter YflS [Weissella cibaria]
 gb|KIU25311.1| putative malate transporter YflS [Weissella cibaria]
Length=473

 Score = 68.2 bits (165),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 33/66 (50%), Positives = 48/66 (73%), Gaps = 2/66 (3%)
 Frame = +2

Query  338  KPLLASIATGVILWFVPQ--PGGVSRNAWQLLSIFLATIVGIITQPLPLGAVALMGLGAC  511
            K  +A +  G++LWF+    P G+S +AW + +IF+ATIVG++T+PLPLG VAL+G  A 
Sbjct  10   KKFIAPLVVGLVLWFLASVRPDGMSISAWHMFAIFVATIVGLVTKPLPLGGVALVGFVAV  69

Query  512  VLTKTL  529
            VLT T+
Sbjct  70   VLTGTV  75



>ref|WP_000493039.1| 2-oxoglutarate translocator [Vibrio cholerae]
 gb|EDL74860.1| 2-oxoglutarate/malate translocator [Vibrio cholerae 623-39]
 gb|EJH66801.1| 2-oxoglutarate/malate translocator [Vibrio cholerae HE-25]
 gb|EMQ59695.1| na+ symporter family protein [Vibrio cholerae O1 str. EM-1676A]
Length=468

 Score = 68.2 bits (165),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 34/62 (55%), Positives = 44/62 (71%), Gaps = 0/62 (0%)
 Frame = +2

Query  344  LLASIATGVILWFVPQPGGVSRNAWQLLSIFLATIVGIITQPLPLGAVALMGLGACVLTK  523
            LLA I  G ILWF+P P G+   AWQ++++F+ T+V +I  PLPLGA+ALMGL A VL  
Sbjct  9    LLALIFFGSILWFIPPPEGLEPKAWQMMTVFVTTVVSLILAPLPLGAMALMGLCATVLLG  68

Query  524  TL  529
             L
Sbjct  69   IL  70



>ref|WP_033930314.1| 2-oxoglutarate translocator [Vibrio cholerae]
Length=468

 Score = 68.2 bits (165),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 34/62 (55%), Positives = 44/62 (71%), Gaps = 0/62 (0%)
 Frame = +2

Query  344  LLASIATGVILWFVPQPGGVSRNAWQLLSIFLATIVGIITQPLPLGAVALMGLGACVLTK  523
            LLA I  G ILWF+P P G+   AWQ++++F+ T+V +I  PLPLGA+ALMGL A VL  
Sbjct  9    LLALIFFGSILWFIPPPEGLEPKAWQMMTVFVTTVVSLILAPLPLGAMALMGLCATVLLG  68

Query  524  TL  529
             L
Sbjct  69   IL  70



>ref|XP_004957073.1| PREDICTED: dicarboxylate transporter 2.1, chloroplastic-like 
[Setaria italica]
Length=549

 Score = 68.2 bits (165),  Expect = 3e-10, Method: Composition-based stats.
 Identities = 34/64 (53%), Positives = 46/64 (72%), Gaps = 1/64 (2%)
 Frame = +2

Query  341  PLLASIATGVILWFV-PQPGGVSRNAWQLLSIFLATIVGIITQPLPLGAVALMGLGACVL  517
            PL+ S+A G+ + F+ P+P  VS   WQLLSIFL+TI G++  PLP+GA A +GL A V 
Sbjct  84   PLVISVAIGLAVRFLAPRPAEVSLQGWQLLSIFLSTIAGLVLGPLPVGAWAFLGLTAAVA  143

Query  518  TKTL  529
            T+TL
Sbjct  144  TRTL  147



>ref|WP_029810646.1| 2-oxoglutarate translocator, partial [Vibrio parahaemolyticus]
Length=194

 Score = 65.5 bits (158),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 27/49 (55%), Positives = 39/49 (80%), Gaps = 0/49 (0%)
 Frame = +2

Query  356  IATGVILWFVPQPGGVSRNAWQLLSIFLATIVGIITQPLPLGAVALMGL  502
            +A G ILWF+P P G++  AWQ+++IF+ T++ +I  PLPLGA+ALMGL
Sbjct  12   VAIGCILWFIPTPEGLTDQAWQMMAIFVTTVLSLILAPLPLGAMALMGL  60



>ref|WP_029862441.1| 2-oxoglutarate translocator, partial [Vibrio parahaemolyticus]
Length=194

 Score = 65.5 bits (158),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 28/53 (53%), Positives = 41/53 (77%), Gaps = 0/53 (0%)
 Frame = +2

Query  344  LLASIATGVILWFVPQPGGVSRNAWQLLSIFLATIVGIITQPLPLGAVALMGL  502
            +L  +A G ILWF+P P G++  AWQ+++IF+ T++ +I  PLPLGA+ALMGL
Sbjct  8    ILLLVAIGCILWFIPTPEGLTDQAWQMMAIFVTTVLSLILAPLPLGAMALMGL  60



>ref|WP_043498342.1| 2-oxoglutarate translocator [Georgenia sp. SUBG003]
 gb|KEP24014.1| 2-oxoglutarate translocator [Georgenia sp. SUBG003]
Length=465

 Score = 67.8 bits (164),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 33/62 (53%), Positives = 42/62 (68%), Gaps = 0/62 (0%)
 Frame = +2

Query  344  LLASIATGVILWFVPQPGGVSRNAWQLLSIFLATIVGIITQPLPLGAVALMGLGACVLTK  523
            LL  +  G  LWFVP P GV   AW L +IF ATIVG+I +PLP+GAV ++GL A ++T 
Sbjct  6    LLVPVLVGTALWFVPAPSGVDAAAWHLFAIFAATIVGVIAKPLPMGAVTVVGLVAVLVTG  65

Query  524  TL  529
             L
Sbjct  66   VL  67



>ref|WP_008510084.1| 2-oxoglutarate translocator [Mucilaginibacter paludis]
 gb|EHQ29055.1| anion transporter [Mucilaginibacter paludis DSM 18603]
Length=476

 Score = 67.8 bits (164),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 30/65 (46%), Positives = 47/65 (72%), Gaps = 0/65 (0%)
 Frame = +2

Query  335  IKPLLASIATGVILWFVPQPGGVSRNAWQLLSIFLATIVGIITQPLPLGAVALMGLGACV  514
            +K L  ++A G+++WF+P P G+  NAW LL+IF+ATIVGII +  P+G +A++G+  C 
Sbjct  6    LKTLAITLAVGLVIWFIPVPEGLKPNAWHLLAIFVATIVGIILKAAPMGTMAMLGITVCA  65

Query  515  LTKTL  529
             T+ L
Sbjct  66   ATEVL  70



>ref|WP_014425790.1| 2-oxoglutarate translocator [Selenomonas ruminantium]
 dbj|BAL84372.1| putative anion transporter [Selenomonas ruminantium subsp. lactilytica 
TAM6421]
Length=474

 Score = 67.4 bits (163),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 29/52 (56%), Positives = 39/52 (75%), Gaps = 0/52 (0%)
 Frame = +2

Query  347  LASIATGVILWFVPQPGGVSRNAWQLLSIFLATIVGIITQPLPLGAVALMGL  502
            L  +A G I+WF+P P GV+  AW LL+IF+ATI G I QP+P+GA+AL+ L
Sbjct  15   LMCVAIGAIIWFIPAPAGVTAQAWGLLAIFIATIAGFILQPMPIGAIALIAL  66



>ref|WP_029285914.1| 2-oxoglutarate translocator [Pedobacter sp. R20-19]
Length=476

 Score = 67.4 bits (163),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 30/64 (47%), Positives = 46/64 (72%), Gaps = 0/64 (0%)
 Frame = +2

Query  338  KPLLASIATGVILWFVPQPGGVSRNAWQLLSIFLATIVGIITQPLPLGAVALMGLGACVL  517
            K L+ ++  GV++WF+P P GV  NAW LL+IF+ATIVGII++   +G +A++G+  C  
Sbjct  7    KSLIITLVVGVVIWFIPVPNGVKPNAWHLLAIFVATIVGIISKAASMGTMAIIGITLCAA  66

Query  518  TKTL  529
            T+ L
Sbjct  67   TQVL  70



>ref|WP_037354028.1| 2-oxoglutarate translocator [Selenomonas sp. FC4001]
Length=475

 Score = 67.4 bits (163),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 29/52 (56%), Positives = 39/52 (75%), Gaps = 0/52 (0%)
 Frame = +2

Query  347  LASIATGVILWFVPQPGGVSRNAWQLLSIFLATIVGIITQPLPLGAVALMGL  502
            L  +A G I+WF+P P GV+  AW LL+IF+ATI G I QP+P+GA+AL+ L
Sbjct  16   LMCVAIGAIIWFIPAPAGVTAQAWGLLAIFIATIAGFILQPMPIGAIALIAL  67



>ref|WP_026759724.1| 2-oxoglutarate translocator [Selenomonas ruminantium]
Length=475

 Score = 67.4 bits (163),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 29/52 (56%), Positives = 39/52 (75%), Gaps = 0/52 (0%)
 Frame = +2

Query  347  LASIATGVILWFVPQPGGVSRNAWQLLSIFLATIVGIITQPLPLGAVALMGL  502
            L  +A G I+WF+P P GV+  AW LL+IF+ATI G I QP+P+GA+AL+ L
Sbjct  16   LMCVAIGAIIWFIPAPAGVTAQAWGLLAIFIATIAGFILQPMPIGAIALIAL  67



>ref|WP_029095534.1| 2-oxoglutarate translocator [Budvicia aquatica]
Length=467

 Score = 67.4 bits (163),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 30/61 (49%), Positives = 45/61 (74%), Gaps = 0/61 (0%)
 Frame = +2

Query  347  LASIATGVILWFVPQPGGVSRNAWQLLSIFLATIVGIITQPLPLGAVALMGLGACVLTKT  526
            LA+I  G+I+WF+P P G++  AW L ++ +A I+G I QP+P+GAVA +G+   VLT+T
Sbjct  9    LATILIGMIIWFIPVPDGLTPQAWHLFALMVAIIIGFILQPVPVGAVAFIGITVIVLTET  68

Query  527  L  529
            L
Sbjct  69   L  69



>ref|XP_002866606.1| DIT2.2 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH42865.1| DIT2.2 [Arabidopsis lyrata subsp. lyrata]
Length=551

 Score = 67.8 bits (164),  Expect = 5e-10, Method: Composition-based stats.
 Identities = 34/64 (53%), Positives = 46/64 (72%), Gaps = 1/64 (2%)
 Frame = +2

Query  341  PLLASIATGVILWF-VPQPGGVSRNAWQLLSIFLATIVGIITQPLPLGAVALMGLGACVL  517
            PL  SI+ G+I+ F +P+P  V+   WQLLSIFL TI G++  PLP+GA A +GL A ++
Sbjct  86   PLTISISIGLIVRFLIPRPEQVTSQGWQLLSIFLFTISGLVLGPLPVGAWAFIGLTASIV  145

Query  518  TKTL  529
            TKTL
Sbjct  146  TKTL  149



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 553975666000