BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFF037J18

Length=571
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009617293.1|  PREDICTED: uncharacterized protein LOC104109646    180   2e-55   Nicotiana tomentosiformis
ref|XP_004245192.1|  PREDICTED: uncharacterized protein LOC101262737    174   7e-55   Solanum lycopersicum
ref|XP_009771440.1|  PREDICTED: uncharacterized protein LOC104221976    177   8e-55   Nicotiana sylvestris
ref|XP_011085499.1|  PREDICTED: uncharacterized protein LOC105167438    174   7e-54   Sesamum indicum [beniseed]
ref|XP_006364278.1|  PREDICTED: uncharacterized protein LOC102598357    174   7e-54   Solanum tuberosum [potatoes]
emb|CDP04798.1|  unnamed protein product                                171   1e-50   Coffea canephora [robusta coffee]
ref|XP_011081926.1|  PREDICTED: uncharacterized protein LOC105164832    166   2e-50   Sesamum indicum [beniseed]
ref|XP_010110340.1|  GTP-binding nuclear protein                        160   6e-50   
gb|KFK25408.1|  hypothetical protein AALP_AA8G110600                    159   2e-49   Arabis alpina [alpine rockcress]
ref|XP_004291483.1|  PREDICTED: uncharacterized protein LOC101294330    155   4e-49   Fragaria vesca subsp. vesca
ref|XP_010048243.1|  PREDICTED: uncharacterized protein LOC104437065    154   7e-49   Eucalyptus grandis [rose gum]
ref|XP_010249980.1|  PREDICTED: uncharacterized protein LOC104592350    153   1e-48   Nelumbo nucifera [Indian lotus]
emb|CDX69757.1|  BnaA10g21060D                                          152   1e-48   
ref|XP_010254319.1|  PREDICTED: uncharacterized protein LOC104595325    152   4e-48   Nelumbo nucifera [Indian lotus]
ref|XP_008775036.1|  PREDICTED: uncharacterized protein LOC103695476    150   6e-48   Phoenix dactylifera
gb|KDP33619.1|  hypothetical protein JCGZ_07190                         153   6e-48   Jatropha curcas
ref|XP_010918669.1|  PREDICTED: uncharacterized protein LOC105042950    154   6e-48   Elaeis guineensis
ref|XP_009345289.1|  PREDICTED: uncharacterized protein LOC103937097    155   6e-48   Pyrus x bretschneideri [bai li]
emb|CDX91217.1|  BnaC02g03800D                                          155   7e-48   
ref|XP_006287989.1|  hypothetical protein CARUB_v10001222mg             154   7e-48   Capsella rubella
ref|XP_009334778.1|  PREDICTED: uncharacterized protein LOC103927565    155   7e-48   Pyrus x bretschneideri [bai li]
ref|XP_008394047.1|  PREDICTED: uncharacterized protein LOC103456171    155   9e-48   
emb|CDX85713.1|  BnaA02g01000D                                          154   1e-47   
emb|CDX97108.1|  BnaC09g45170D                                          149   1e-47   
ref|XP_010491872.1|  PREDICTED: uncharacterized protein LOC104769372    154   1e-47   Camelina sativa [gold-of-pleasure]
ref|XP_010419712.1|  PREDICTED: uncharacterized protein LOC104705408    154   1e-47   Camelina sativa [gold-of-pleasure]
gb|EPS73289.1|  hypothetical protein M569_01466                         158   1e-47   Genlisea aurea
ref|XP_009125805.1|  PREDICTED: uncharacterized protein LOC103850771    153   2e-47   Brassica rapa
ref|XP_007223355.1|  hypothetical protein PRUPE_ppa007452mg             152   2e-47   Prunus persica
ref|XP_006399646.1|  hypothetical protein EUTSA_v10013887mg             150   2e-47   Eutrema salsugineum [saltwater cress]
gb|AAM63507.1|  unknown                                                 152   4e-47   Arabidopsis thaliana [mouse-ear cress]
ref|NP_196703.1|  uncharacterized protein                               152   5e-47   Arabidopsis thaliana [mouse-ear cress]
gb|AAN31807.1|  unknown protein                                         152   5e-47   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010453190.1|  PREDICTED: uncharacterized protein LOC104735158    152   5e-47   Camelina sativa [gold-of-pleasure]
ref|XP_002871473.1|  hypothetical protein ARALYDRAFT_487977             151   8e-47   
ref|XP_008219896.1|  PREDICTED: uncharacterized protein LOC103320060    150   1e-46   Prunus mume [ume]
ref|XP_002284962.1|  PREDICTED: uncharacterized protein LOC100252479    154   1e-46   Vitis vinifera
ref|XP_009121952.1|  PREDICTED: uncharacterized protein LOC103846721    150   2e-46   Brassica rapa
gb|KHG19965.1|  putative e3 ubiquitin-protein ligase hul4               154   2e-46   Gossypium arboreum [tree cotton]
ref|XP_008378299.1|  PREDICTED: uncharacterized protein LOC103441403    150   3e-46   
ref|XP_008445161.1|  PREDICTED: uncharacterized protein LOC103488281    154   3e-46   
gb|AAM61720.1|  unknown                                                 147   3e-46   Arabidopsis thaliana [mouse-ear cress]
ref|NP_197928.1|  UF642 l-GalL-responsive protein 1                     147   4e-46   Arabidopsis thaliana [mouse-ear cress]
gb|AAL06839.1|  AT5g25460/F18G18_200                                    147   4e-46   Arabidopsis thaliana [mouse-ear cress]
emb|CBI20999.3|  unnamed protein product                                153   4e-46   Vitis vinifera
gb|KJB07802.1|  hypothetical protein B456_001G045200                    153   4e-46   Gossypium raimondii
ref|XP_002872166.1|  hypothetical protein ARALYDRAFT_910605             147   4e-46   Arabidopsis lyrata subsp. lyrata
ref|XP_009389493.1|  PREDICTED: uncharacterized protein LOC103976040    157   5e-46   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010454874.1|  PREDICTED: uncharacterized protein LOC104736571    146   6e-46   Camelina sativa [gold-of-pleasure]
ref|XP_006399647.1|  hypothetical protein EUTSA_v10013887mg             146   7e-46   
ref|XP_010421395.1|  PREDICTED: uncharacterized protein LOC104706866    146   7e-46   Camelina sativa [gold-of-pleasure]
gb|EYU21948.1|  hypothetical protein MIMGU_mgv1a0096341mg               150   8e-46   Erythranthe guttata [common monkey flower]
ref|XP_006287976.1|  hypothetical protein CARUB_v10001211mg             146   1e-45   Capsella rubella
ref|XP_009151074.1|  PREDICTED: uncharacterized protein LOC103874406    147   1e-45   Brassica rapa
gb|KJB07801.1|  hypothetical protein B456_001G045200                    151   1e-45   Gossypium raimondii
gb|ACU22840.1|  unknown                                                 156   1e-45   Glycine max [soybeans]
ref|XP_004138737.1|  PREDICTED: uncharacterized protein LOC101219952    151   2e-45   Cucumis sativus [cucumbers]
ref|XP_002515557.1|  conserved hypothetical protein                     150   2e-45   
gb|KHN44154.1|  hypothetical protein glysoja_031815                     157   2e-45   Glycine soja [wild soybean]
gb|ACU17881.1|  unknown                                                 157   3e-45   Glycine max [soybeans]
gb|KJB80693.1|  hypothetical protein B456_013G110800                    153   3e-45   Gossypium raimondii
ref|XP_011019761.1|  PREDICTED: uncharacterized protein LOC105122382    154   3e-45   Populus euphratica
ref|XP_006394799.1|  hypothetical protein EUTSA_v10004442mg             145   3e-45   Eutrema salsugineum [saltwater cress]
ref|XP_006450498.1|  hypothetical protein CICLE_v10008711mg             147   5e-45   Citrus clementina [clementine]
ref|XP_010493802.1|  PREDICTED: uncharacterized protein LOC104771027    144   5e-45   Camelina sativa [gold-of-pleasure]
ref|XP_006483312.1|  PREDICTED: uncharacterized protein LOC102608149    147   5e-45   Citrus sinensis [apfelsine]
ref|XP_009129962.1|  PREDICTED: uncharacterized protein LOC103854751    145   6e-45   Brassica rapa
gb|KFK27809.1|  hypothetical protein AALP_AA8G432300                    145   6e-45   Arabis alpina [alpine rockcress]
ref|XP_006427179.1|  hypothetical protein CICLE_v10025880mg             151   8e-45   Citrus clementina [clementine]
ref|XP_002517567.1|  conserved hypothetical protein                     149   9e-45   Ricinus communis
gb|KHG29602.1|  Allergen Act d 3                                        151   9e-45   Gossypium arboreum [tree cotton]
ref|XP_010670694.1|  PREDICTED: uncharacterized protein LOC104887687    149   9e-45   Beta vulgaris subsp. vulgaris [field beet]
gb|ABK94923.1|  unknown                                                 152   1e-44   Populus trichocarpa [western balsam poplar]
ref|XP_002308647.2|  hypothetical protein POPTR_0006s26630g             152   1e-44   
ref|XP_008362680.1|  PREDICTED: uncharacterized protein LOC103426358    149   1e-44   
ref|XP_011019764.1|  PREDICTED: uncharacterized protein LOC105122387    151   2e-44   Populus euphratica
ref|XP_007217604.1|  hypothetical protein PRUPE_ppa018156mg             155   2e-44   Prunus persica
ref|XP_006465391.1|  PREDICTED: uncharacterized protein LOC102618171    150   2e-44   Citrus sinensis [apfelsine]
ref|XP_003597843.1|  hypothetical protein MTR_2g103170                  153   2e-44   Medicago truncatula
ref|XP_002303263.1|  hypothetical protein POPTR_0003s05850g             142   2e-44   
ref|XP_009401767.1|  PREDICTED: uncharacterized protein LOC103985700    154   3e-44   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_004486698.1|  PREDICTED: uncharacterized protein LOC101495368    153   4e-44   Cicer arietinum [garbanzo]
ref|XP_011026488.1|  PREDICTED: uncharacterized protein LOC105127071    149   4e-44   Populus euphratica
ref|XP_007013813.1|  Uncharacterized protein isoform 1                  149   4e-44   
ref|XP_007013814.1|  Uncharacterized protein isoform 2                  149   4e-44   Theobroma cacao [chocolate]
ref|XP_011040006.1|  PREDICTED: uncharacterized protein LOC105136392    143   4e-44   Populus euphratica
emb|CDY19801.1|  BnaA09g04540D                                          142   5e-44   Brassica napus [oilseed rape]
ref|XP_002324280.2|  hypothetical protein POPTR_0018s01390g             149   6e-44   
ref|XP_009125963.1|  PREDICTED: uncharacterized protein LOC103850912    146   6e-44   Brassica rapa
ref|XP_008228640.1|  PREDICTED: uncharacterized protein LOC103328032    151   1e-43   Prunus mume [ume]
ref|XP_010541619.1|  PREDICTED: uncharacterized protein LOC104815031    144   2e-43   Tarenaya hassleriana [spider flower]
ref|XP_010432718.1|  PREDICTED: uncharacterized protein LOC104716937    145   2e-43   Camelina sativa [gold-of-pleasure]
emb|CDY54909.1|  BnaC02g48660D                                          140   2e-43   Brassica napus [oilseed rape]
ref|XP_009407651.1|  PREDICTED: uncharacterized protein LOC103990295    148   3e-43   Musa acuminata subsp. malaccensis [pisang utan]
gb|KDP37140.1|  hypothetical protein JCGZ_06196                         144   3e-43   Jatropha curcas
ref|XP_002298115.2|  hypothetical protein POPTR_0001s17430g             140   3e-43   Populus trichocarpa [western balsam poplar]
emb|CDX68849.1|  BnaC01g06040D                                          144   3e-43   
ref|XP_004978106.1|  PREDICTED: uncharacterized protein LOC101761311    140   5e-43   Setaria italica
ref|XP_011035644.1|  PREDICTED: uncharacterized protein LOC105133377    138   6e-43   Populus euphratica
ref|XP_010654739.1|  PREDICTED: uncharacterized protein LOC100261739    146   6e-43   Vitis vinifera
gb|KDO52908.1|  hypothetical protein CISIN_1g0399092mg                  144   8e-43   Citrus sinensis [apfelsine]
emb|CBI36253.3|  unnamed protein product                                145   9e-43   Vitis vinifera
ref|XP_010445004.1|  PREDICTED: uncharacterized protein LOC104727612    143   9e-43   
ref|XP_010539514.1|  PREDICTED: uncharacterized protein LOC104813570    142   1e-42   Tarenaya hassleriana [spider flower]
ref|XP_010526203.1|  PREDICTED: uncharacterized protein LOC104803829    142   1e-42   Tarenaya hassleriana [spider flower]
ref|NP_567894.1|  uncharacterized protein                               142   1e-42   Arabidopsis thaliana [mouse-ear cress]
dbj|BAE98407.1|  hypothetical protein                                   142   1e-42   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010447383.1|  PREDICTED: uncharacterized protein LOC104730027    142   1e-42   Camelina sativa [gold-of-pleasure]
ref|XP_002867243.1|  hypothetical protein ARALYDRAFT_913203             142   1e-42   Arabidopsis lyrata subsp. lyrata
ref|XP_002446725.1|  hypothetical protein SORBIDRAFT_06g021290          140   2e-42   
ref|XP_003569339.1|  PREDICTED: uncharacterized protein LOC100821501    147   4e-42   Brachypodium distachyon [annual false brome]
gb|AES58962.2|  plant/F18G18-200 protein                                148   5e-42   Medicago truncatula
ref|XP_007161233.1|  hypothetical protein PHAVU_001G053100g             150   5e-42   Phaseolus vulgaris [French bean]
tpg|DAA37152.1|  TPA: hypothetical protein ZEAMMB73_071426              139   5e-42   
ref|XP_010914930.1|  PREDICTED: uncharacterized protein LOC105040204    140   6e-42   Elaeis guineensis
gb|ACJ84308.1|  unknown                                                 147   8e-42   Medicago truncatula
gb|AAB41813.1|  unknown protein                                         147   9e-42   Medicago sativa [alfalfa]
ref|NP_001043549.2|  Os01g0611000                                       142   9e-42   
gb|KJB70568.1|  hypothetical protein B456_011G080100                    139   1e-41   Gossypium raimondii
ref|XP_010519935.1|  PREDICTED: uncharacterized protein LOC104799224    141   1e-41   Tarenaya hassleriana [spider flower]
gb|KHG06895.1|  Agmatine deiminase                                      139   1e-41   Gossypium arboreum [tree cotton]
gb|AFK49528.1|  unknown                                                 147   1e-41   Medicago truncatula
gb|EAY74932.1|  hypothetical protein OsI_02826                          141   1e-41   Oryza sativa Indica Group [Indian rice]
ref|XP_002446724.1|  hypothetical protein SORBIDRAFT_06g021280          138   2e-41   Sorghum bicolor [broomcorn]
ref|XP_003531698.1|  PREDICTED: uncharacterized protein LOC100779277    146   2e-41   Glycine max [soybeans]
dbj|BAB21293.1|  unknown protein                                        141   2e-41   Oryza sativa Japonica Group [Japonica rice]
gb|KHN47787.1|  hypothetical protein glysoja_029205                     146   2e-41   Glycine soja [wild soybean]
ref|XP_003544618.1|  PREDICTED: uncharacterized protein LOC100776765    145   2e-41   Glycine max [soybeans]
ref|XP_008347484.1|  PREDICTED: uncharacterized protein LOC103410579    141   2e-41   Malus domestica [apple tree]
gb|EMT06486.1|  hypothetical protein F775_26416                         139   2e-41   
ref|XP_004969140.1|  PREDICTED: uncharacterized protein LOC101755969    142   2e-41   Setaria italica
ref|NP_001053189.1|  Os04g0494800                                       144   3e-41   
gb|AGV54541.1|  hypothetical protein                                    142   3e-41   Phaseolus vulgaris [French bean]
gb|EAY94676.1|  hypothetical protein OsI_16455                          144   3e-41   Oryza sativa Indica Group [Indian rice]
emb|CAE01676.2|  OSJNBb0091E11.17                                       144   3e-41   Oryza sativa Japonica Group [Japonica rice]
emb|CAH67292.1|  OSIGBa0103O01.10                                       144   4e-41   Oryza sativa [red rice]
ref|XP_002455939.1|  hypothetical protein SORBIDRAFT_03g027650          141   4e-41   
ref|XP_006389772.1|  hypothetical protein EUTSA_v10018730mg             138   6e-41   Eutrema salsugineum [saltwater cress]
ref|XP_006841925.1|  hypothetical protein AMTR_s00042p00185900          135   6e-41   
dbj|BAK03627.1|  predicted protein                                      137   7e-41   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_006301335.1|  hypothetical protein CARUB_v10021745mg             138   7e-41   Capsella rubella
ref|XP_008792101.1|  PREDICTED: uncharacterized protein LOC103708794    137   1e-40   Phoenix dactylifera
gb|KFK42429.1|  hypothetical protein AALP_AA2G255100                    138   1e-40   Arabis alpina [alpine rockcress]
ref|XP_009348421.1|  PREDICTED: uncharacterized protein LOC103940075    138   2e-40   Pyrus x bretschneideri [bai li]
ref|XP_006601137.1|  PREDICTED: uncharacterized protein LOC100813...    144   2e-40   
gb|KHN06654.1|  hypothetical protein glysoja_037506                     144   2e-40   Glycine soja [wild soybean]
ref|XP_010048991.1|  PREDICTED: uncharacterized protein LOC104437692    131   3e-40   Eucalyptus grandis [rose gum]
ref|XP_011072257.1|  PREDICTED: uncharacterized protein LOC105157546    139   3e-40   
gb|KJB80694.1|  hypothetical protein B456_013G110800                    136   3e-40   Gossypium raimondii
gb|ACG40327.1|  hypothetical protein                                    138   3e-40   Zea mays [maize]
ref|XP_008672703.1|  PREDICTED: hypothetical protein isoform X1         138   3e-40   Zea mays [maize]
ref|NP_001053188.1|  Os04g0494600                                       151   4e-40   
ref|XP_010417734.1|  PREDICTED: uncharacterized protein LOC104703420    135   5e-40   Camelina sativa [gold-of-pleasure]
ref|XP_010472958.1|  PREDICTED: uncharacterized protein LOC104752499    135   5e-40   Camelina sativa [gold-of-pleasure]
ref|XP_010429991.1|  PREDICTED: uncharacterized protein LOC104714356    135   5e-40   Camelina sativa [gold-of-pleasure]
ref|XP_006581022.1|  PREDICTED: uncharacterized protein LOC100802...    139   6e-40   
ref|XP_011466736.1|  PREDICTED: uncharacterized protein LOC101306...    150   6e-40   Fragaria vesca subsp. vesca
ref|XP_009333642.1|  PREDICTED: uncharacterized protein LOC103926567    150   8e-40   Pyrus x bretschneideri [bai li]
ref|XP_006646088.1|  PREDICTED: uncharacterized protein LOC102706903    137   8e-40   
gb|EAZ31211.1|  hypothetical protein OsJ_15311                          139   8e-40   Oryza sativa Japonica Group [Japonica rice]
ref|XP_009104452.1|  PREDICTED: uncharacterized protein LOC103830427    137   1e-39   Brassica rapa
ref|XP_004498654.1|  PREDICTED: uncharacterized protein LOC101508759    149   1e-39   Cicer arietinum [garbanzo]
ref|NP_001053190.1|  Os04g0494900                                       138   1e-39   
emb|CAD41548.2|  OSJNBb0091E11.18                                       138   2e-39   Oryza sativa Japonica Group [Japonica rice]
gb|KHG21630.1|  Adenosylhomocysteinase                                  132   2e-39   Gossypium arboreum [tree cotton]
ref|XP_002887838.1|  hypothetical protein ARALYDRAFT_340195             135   2e-39   Arabidopsis lyrata subsp. lyrata
emb|CAH67377.1|  OSIGBa0159F11.1                                        138   2e-39   Oryza sativa [red rice]
ref|XP_006653557.1|  PREDICTED: uncharacterized protein LOC102718925    139   2e-39   
gb|EYU21602.1|  hypothetical protein MIMGU_mgv1a008411mg                135   2e-39   Erythranthe guttata [common monkey flower]
ref|XP_006652463.1|  PREDICTED: uncharacterized protein LOC102714172    149   2e-39   Oryza brachyantha
ref|XP_003526423.1|  PREDICTED: uncharacterized protein LOC100801917    139   3e-39   
emb|CDY39990.1|  BnaC06g40680D                                          135   3e-39   Brassica napus [oilseed rape]
ref|NP_178141.1|  protein DUF642 L-GALL RESPONSIVE GENE 1               132   4e-39   Arabidopsis thaliana [mouse-ear cress]
ref|NP_001242447.1|  uncharacterized protein LOC100802444 precursor     136   4e-39   Glycine max [soybeans]
emb|CDX87297.1|  BnaA07g35760D                                          132   5e-39   
ref|NP_001145978.1|  hypothetical protein                               134   6e-39   Zea mays [maize]
gb|EMS63052.1|  hypothetical protein TRIUR3_01733                       134   8e-39   Triticum urartu
gb|EMS58461.1|  hypothetical protein TRIUR3_29087                       131   8e-39   Triticum urartu
ref|XP_008669227.1|  PREDICTED: uncharacterized protein LOC103646275    139   9e-39   Zea mays [maize]
gb|EMT04285.1|  hypothetical protein F775_14657                         134   1e-38   
ref|XP_011081171.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...    133   1e-38   Sesamum indicum [beniseed]
emb|CAH67378.1|  OSIGBa0159F11.2                                        138   1e-38   Oryza sativa [red rice]
ref|XP_008669229.1|  PREDICTED: uncharacterized protein LOC103646276    136   2e-38   Zea mays [maize]
tpg|DAA37149.1|  TPA: hypothetical protein ZEAMMB73_398073              136   2e-38   
ref|XP_003588711.1|  hypothetical protein MTR_1g011800                  145   2e-38   
emb|CDY54317.1|  BnaC06g43150D                                          132   2e-38   Brassica napus [oilseed rape]
emb|CDY57694.1|  BnaA07g38340D                                          132   3e-38   Brassica napus [oilseed rape]
ref|XP_003581385.1|  PREDICTED: uncharacterized protein LOC100824265    133   4e-38   Brachypodium distachyon [annual false brome]
gb|ABK26874.1|  unknown                                                 133   5e-38   Picea sitchensis
ref|XP_006285882.1|  hypothetical protein CARUB_v10007385mg             145   6e-38   
ref|XP_010061944.1|  PREDICTED: uncharacterized protein LOC104449472    144   9e-38   Eucalyptus grandis [rose gum]
ref|XP_007023946.1|  Uncharacterized protein TCM_028364                 144   9e-38   Theobroma cacao [chocolate]
gb|KHG10708.1|  Allergen Act d 3                                        144   9e-38   Gossypium arboreum [tree cotton]
gb|KJB68131.1|  hypothetical protein B456_010G227400                    144   1e-37   Gossypium raimondii
ref|NP_001173996.1|  Os04g0494950                                       134   3e-37   
ref|XP_002446727.1|  hypothetical protein SORBIDRAFT_06g021310          135   3e-37   
emb|CAA22573.1|  putative protein                                       124   3e-37   Arabidopsis thaliana [mouse-ear cress]
ref|XP_004976082.1|  PREDICTED: uncharacterized protein LOC101765204    132   5e-37   Setaria italica
ref|XP_008377611.1|  PREDICTED: uncharacterized protein LOC103440696    142   5e-37   Malus domestica [apple tree]
emb|CAE01677.2|  OSJNBb0091E11.19                                       133   5e-37   Oryza sativa Japonica Group [Japonica rice]
ref|XP_006653558.1|  PREDICTED: uncharacterized protein LOC102719203    134   5e-37   Oryza brachyantha
gb|EEE61252.1|  hypothetical protein OsJ_15312                          133   5e-37   Oryza sativa Japonica Group [Japonica rice]
dbj|BAJ96954.1|  predicted protein                                      132   6e-37   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_002446728.1|  hypothetical protein SORBIDRAFT_06g021320          128   7e-36   
ref|NP_001140426.1|  hypothetical protein precursor                     126   7e-36   Zea mays [maize]
ref|XP_009591297.1|  PREDICTED: uncharacterized protein LOC104088341    128   8e-36   Nicotiana tomentosiformis
emb|CDO98108.1|  unnamed protein product                                129   8e-36   Coffea canephora [robusta coffee]
dbj|BAK03126.1|  predicted protein                                      125   9e-36   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_003580051.1|  PREDICTED: uncharacterized protein LOC100841904    129   1e-35   Brachypodium distachyon [annual false brome]
ref|XP_004978107.1|  PREDICTED: uncharacterized protein LOC101761699    128   2e-35   Setaria italica
gb|KHN07098.1|  hypothetical protein glysoja_023281                     125   2e-35   Glycine soja [wild soybean]
gb|KHN07099.1|  hypothetical protein glysoja_023282                     124   2e-35   Glycine soja [wild soybean]
gb|ABK24630.1|  unknown                                                 124   4e-35   Picea sitchensis
ref|XP_002453515.1|  hypothetical protein SORBIDRAFT_04g007160          125   5e-35   
ref|XP_004978108.1|  PREDICTED: uncharacterized protein LOC101762525    125   5e-35   
ref|XP_004235717.1|  PREDICTED: uncharacterized protein LOC101252763    124   8e-35   Solanum lycopersicum
gb|ABR13280.1|  unknown protein                                         110   9e-35   Prunus dulcis [sweet almond]
ref|XP_006341715.1|  PREDICTED: uncharacterized protein LOC102601890    124   9e-35   
gb|KJB70569.1|  hypothetical protein B456_011G080100                    116   1e-34   Gossypium raimondii
ref|XP_002446726.1|  hypothetical protein SORBIDRAFT_06g021300          124   1e-34   Sorghum bicolor [broomcorn]
gb|ACN40837.1|  unknown                                                 122   2e-34   Picea sitchensis
gb|EMT19274.1|  hypothetical protein F775_14136                         128   2e-34   
ref|XP_009764126.1|  PREDICTED: uncharacterized protein LOC104215887    123   3e-34   Nicotiana sylvestris
ref|XP_006826721.1|  hypothetical protein AMTR_s00264p00012960          124   4e-34   
gb|EMT25742.1|  hypothetical protein F775_05959                         124   7e-34   
ref|XP_004951511.1|  PREDICTED: uncharacterized protein LOC101755979    125   1e-33   Setaria italica
gb|EMS51274.1|  hypothetical protein TRIUR3_06873                       127   1e-33   Triticum urartu
ref|XP_009598172.1|  PREDICTED: uncharacterized protein LOC104094024    120   1e-33   Nicotiana tomentosiformis
gb|EMS51275.1|  hypothetical protein TRIUR3_06876                       122   2e-33   Triticum urartu
ref|XP_004976081.1|  PREDICTED: uncharacterized protein LOC101764801    129   2e-33   Setaria italica
ref|NP_001141282.1|  hypothetical protein precursor                     116   2e-33   Zea mays [maize]
gb|EYU24667.1|  hypothetical protein MIMGU_mgv1a008541mg                132   3e-33   Erythranthe guttata [common monkey flower]
ref|XP_010092662.1|  hypothetical protein L484_019736                   128   4e-33   Morus notabilis
ref|XP_011466738.1|  PREDICTED: uncharacterized protein LOC101306...    131   4e-33   Fragaria vesca subsp. vesca
ref|XP_006346648.1|  PREDICTED: uncharacterized protein LOC102598480    118   9e-33   
gb|EMT04284.1|  hypothetical protein F775_14656                         130   1e-32   
ref|XP_004252488.1|  PREDICTED: uncharacterized protein LOC101250580    117   1e-32   Solanum lycopersicum
ref|XP_003581384.1|  PREDICTED: uncharacterized protein LOC100823957    120   1e-32   Brachypodium distachyon [annual false brome]
ref|XP_010088264.1|  hypothetical protein L484_005140                   130   1e-32   Morus notabilis
ref|XP_004241713.1|  PREDICTED: uncharacterized protein LOC101268115    130   1e-32   Solanum lycopersicum
dbj|BAJ94417.1|  predicted protein                                      124   2e-32   Hordeum vulgare subsp. vulgare [two-rowed barley]
dbj|BAJ97095.1|  predicted protein                                      122   2e-32   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_008363312.1|  PREDICTED: uncharacterized protein LOC103427013    117   4e-32   
ref|XP_006356190.1|  PREDICTED: uncharacterized protein LOC102589576    129   5e-32   Solanum tuberosum [potatoes]
ref|XP_008375195.1|  PREDICTED: uncharacterized protein LOC103438421    116   8e-32   Malus domestica [apple tree]
ref|XP_004307221.1|  PREDICTED: uncharacterized protein LOC101292742    116   9e-32   Fragaria vesca subsp. vesca
ref|XP_008364711.1|  PREDICTED: uncharacterized protein LOC103428382    116   9e-32   
ref|XP_008669230.1|  PREDICTED: uncharacterized protein LOC103646278    124   1e-31   Zea mays [maize]
ref|XP_007218160.1|  hypothetical protein PRUPE_ppa007461mg             116   2e-31   Prunus persica
gb|EEE56530.1|  hypothetical protein OsJ_05823                          118   2e-31   Oryza sativa Japonica Group [Japonica rice]
ref|XP_009354784.1|  PREDICTED: uncharacterized protein LOC103945912    114   3e-31   Pyrus x bretschneideri [bai li]
gb|EEC72709.1|  hypothetical protein OsI_06304                          117   3e-31   Oryza sativa Indica Group [Indian rice]
ref|XP_008231461.1|  PREDICTED: uncharacterized protein LOC103330638    115   3e-31   Prunus mume [ume]
gb|KDP43556.1|  hypothetical protein JCGZ_16843                         112   3e-31   Jatropha curcas
ref|XP_009778816.1|  PREDICTED: uncharacterized protein LOC104228110    126   4e-31   Nicotiana sylvestris
ref|XP_009758146.1|  PREDICTED: uncharacterized protein LOC104210873    126   5e-31   Nicotiana sylvestris
ref|XP_009590498.1|  PREDICTED: uncharacterized protein LOC104087663    126   6e-31   Nicotiana tomentosiformis
ref|XP_010067858.1|  PREDICTED: uncharacterized protein LOC104454644    111   7e-31   Eucalyptus grandis [rose gum]
ref|XP_003581666.1|  PREDICTED: uncharacterized protein LOC100833858    125   2e-30   Brachypodium distachyon [annual false brome]
ref|XP_002446723.1|  hypothetical protein SORBIDRAFT_06g021270          116   2e-30   
ref|XP_004149718.1|  PREDICTED: uncharacterized protein LOC101216438    115   2e-30   Cucumis sativus [cucumbers]
ref|XP_006412472.1|  hypothetical protein EUTSA_v10025706mg             124   2e-30   
ref|XP_006644728.1|  PREDICTED: uncharacterized protein LOC102722258    112   3e-30   Oryza brachyantha
ref|XP_002517797.1|  conserved hypothetical protein                     112   3e-30   Ricinus communis
ref|XP_009143769.1|  PREDICTED: uncharacterized protein LOC103867448    113   4e-30   Brassica rapa
emb|CDX84311.1|  BnaC04g10730D                                          113   4e-30   
emb|CDY17255.1|  BnaA05g09330D                                          113   4e-30   Brassica napus [oilseed rape]
ref|XP_011096549.1|  PREDICTED: uncharacterized protein LOC105175704    107   4e-30   Sesamum indicum [beniseed]
ref|XP_010257158.1|  PREDICTED: uncharacterized protein LOC104597378    108   5e-30   Nelumbo nucifera [Indian lotus]
ref|NP_001044289.1|  Os01g0756600                                       112   5e-30   
ref|XP_002456374.1|  hypothetical protein SORBIDRAFT_03g034960          112   6e-30   Sorghum bicolor [broomcorn]
ref|NP_001046247.2|  Os02g0205200                                       113   6e-30   
ref|XP_006410597.1|  hypothetical protein EUTSA_v10016749mg             114   6e-30   Eutrema salsugineum [saltwater cress]
ref|XP_010257157.1|  PREDICTED: uncharacterized protein LOC104597377    107   7e-30   Nelumbo nucifera [Indian lotus]
ref|XP_011085252.1|  PREDICTED: uncharacterized protein LOC105167296    106   9e-30   Sesamum indicum [beniseed]
ref|XP_004233117.1|  PREDICTED: uncharacterized protein LOC101246207    107   1e-29   
ref|NP_180998.1|  uncharacterized protein                               114   1e-29   Arabidopsis thaliana [mouse-ear cress]
ref|XP_004970002.1|  PREDICTED: uncharacterized protein LOC101758272    110   1e-29   Setaria italica
ref|XP_010691193.1|  PREDICTED: uncharacterized protein LOC104904598    108   1e-29   Beta vulgaris subsp. vulgaris [field beet]
gb|ACF86181.1|  unknown                                                 111   1e-29   
ref|XP_011091660.1|  PREDICTED: uncharacterized protein LOC105172024    108   1e-29   
gb|EYU33356.1|  hypothetical protein MIMGU_mgv1a007799mg                103   1e-29   
ref|XP_003581665.1|  PREDICTED: uncharacterized protein LOC100833550    115   1e-29   
ref|NP_001143645.1|  hypothetical protein precursor                     111   2e-29   
gb|ACG32132.1|  hypothetical protein                                    111   2e-29   
ref|XP_002881340.1|  hypothetical protein ARALYDRAFT_902536             113   2e-29   
ref|XP_006294334.1|  hypothetical protein CARUB_v10023341mg             115   2e-29   
ref|NP_001053191.2|  Os04g0495000                                       104   2e-29   
gb|EAY94679.1|  hypothetical protein OsI_16458                          104   2e-29   
ref|XP_010549485.1|  PREDICTED: uncharacterized protein LOC104820646    112   2e-29   
ref|XP_006352963.1|  PREDICTED: uncharacterized protein LOC102582541    107   2e-29   
ref|XP_010461096.1|  PREDICTED: uncharacterized protein LOC104741840    110   2e-29   
emb|CDM84231.1|  unnamed protein product                                108   2e-29   
ref|XP_010056890.1|  PREDICTED: uncharacterized protein LOC104444833    111   3e-29   
ref|XP_009788467.1|  PREDICTED: uncharacterized protein LOC104236274    105   3e-29   
ref|XP_008461812.1|  PREDICTED: uncharacterized protein LOC103500323    113   3e-29   
gb|EEC71507.1|  hypothetical protein OsI_03789                          109   3e-29   
ref|XP_006489949.1|  PREDICTED: uncharacterized protein LOC102629059    107   3e-29   
ref|XP_003580050.1|  PREDICTED: uncharacterized protein LOC100841598    121   4e-29   
ref|XP_006297975.1|  hypothetical protein CARUB_v10014019mg             108   5e-29   
gb|EYU43266.1|  hypothetical protein MIMGU_mgv1a007866mg                106   5e-29   
ref|XP_010464451.1|  PREDICTED: uncharacterized protein LOC104744998    108   5e-29   
ref|XP_010057181.1|  PREDICTED: uncharacterized protein LOC104445070    107   6e-29   
ref|XP_010486384.1|  PREDICTED: uncharacterized protein LOC104764532    108   6e-29   
ref|XP_010673134.1|  PREDICTED: uncharacterized protein LOC104889574    105   6e-29   
gb|EMT29323.1|  hypothetical protein F775_30539                         106   7e-29   
ref|NP_566328.1|  germination-related protein                           107   8e-29   
ref|XP_006407770.1|  hypothetical protein EUTSA_v10020990mg             112   9e-29   
ref|XP_010665821.1|  PREDICTED: uncharacterized protein LOC104883071    107   9e-29   
gb|KDP37968.1|  hypothetical protein JCGZ_04611                         107   1e-28   
ref|XP_011087959.1|  PREDICTED: uncharacterized protein LOC105169285    106   1e-28   
ref|XP_010509742.1|  PREDICTED: uncharacterized protein LOC104786108    112   1e-28   
tpg|DAA57583.1|  TPA: hypothetical protein ZEAMMB73_913803              108   1e-28   
ref|XP_007147896.1|  hypothetical protein PHAVU_006G164100g             115   1e-28   
gb|EMS50963.1|  hypothetical protein TRIUR3_30516                       105   1e-28   
ref|XP_010478373.1|  PREDICTED: uncharacterized protein LOC104757341    107   1e-28   
ref|XP_009123974.1|  PREDICTED: uncharacterized protein LOC103848900    110   2e-28   
ref|XP_010460777.1|  PREDICTED: uncharacterized protein LOC104741589    107   2e-28   
ref|XP_009630913.1|  PREDICTED: uncharacterized protein LOC104120779    105   2e-28   
ref|XP_009418805.1|  PREDICTED: uncharacterized protein LOC103998920    107   2e-28   
ref|XP_002275370.1|  PREDICTED: uncharacterized protein LOC100253669    106   2e-28   
emb|CBI30867.3|  unnamed protein product                                106   2e-28   
ref|XP_008776092.1|  PREDICTED: uncharacterized protein LOC103696299    107   2e-28   
emb|CDY28002.1|  BnaC05g44040D                                          109   2e-28   
ref|XP_010499517.1|  PREDICTED: uncharacterized protein LOC104777028    107   2e-28   
ref|XP_009147007.1|  PREDICTED: uncharacterized protein LOC103870618    109   2e-28   
ref|XP_004134601.1|  PREDICTED: uncharacterized protein LOC101220961    110   2e-28   
ref|XP_008439641.1|  PREDICTED: uncharacterized protein LOC103484373    108   2e-28   
ref|NP_564344.1|  uncharacterized protein                               104   3e-28   
ref|XP_009603034.1|  PREDICTED: uncharacterized protein LOC104098081    105   3e-28   
gb|AGV54803.1|  hypothetical protein                                    114   3e-28   
gb|AGV54847.1|  hypothetical protein                                    114   3e-28   
emb|CDY22149.1|  BnaC01g39520D                                          109   3e-28   
emb|CDY26302.1|  BnaA09g26530D                                          106   3e-28   
ref|XP_004229647.1|  PREDICTED: uncharacterized protein LOC101251618    105   3e-28   
gb|EPS66311.1|  hypothetical protein M569_08463                         106   4e-28   
ref|XP_006467477.1|  PREDICTED: uncharacterized protein LOC102617...    104   4e-28   
ref|XP_006307659.1|  hypothetical protein CARUB_v10009287mg             105   4e-28   
ref|XP_010937268.1|  PREDICTED: uncharacterized protein LOC105056672    105   4e-28   
ref|XP_006415525.1|  hypothetical protein EUTSA_v10007784mg             105   4e-28   
ref|XP_010504912.1|  PREDICTED: uncharacterized protein LOC104781...    110   5e-28   
ref|XP_006449683.1|  hypothetical protein CICLE_v10015527mg             104   5e-28   
emb|CDP19178.1|  unnamed protein product                                102   5e-28   
ref|XP_003569841.1|  PREDICTED: uncharacterized protein LOC100844886    105   6e-28   
ref|XP_010516598.1|  PREDICTED: uncharacterized protein LOC104792204    109   6e-28   
ref|XP_009115202.1|  PREDICTED: uncharacterized protein LOC103840445    105   6e-28   
ref|XP_010241207.1|  PREDICTED: uncharacterized protein LOC104585883    105   7e-28   
ref|XP_010275001.1|  PREDICTED: uncharacterized protein LOC104610185    103   8e-28   
ref|XP_006845336.1|  hypothetical protein AMTR_s00141p00085330          108   1e-27   
ref|XP_010279657.1|  PREDICTED: uncharacterized protein LOC104613510    101   1e-27   
emb|CDP07813.1|  unnamed protein product                                108   1e-27   
gb|EYU20209.1|  hypothetical protein MIMGU_mgv1a008620mg                107   1e-27   
ref|XP_002317331.2|  hypothetical protein POPTR_0011s08980g             108   1e-27   
ref|XP_002519690.1|  conserved hypothetical protein                     104   1e-27   
ref|XP_002283940.2|  PREDICTED: uncharacterized protein LOC100257236    103   1e-27   
ref|XP_006421409.1|  hypothetical protein CICLE_v10005198mg             106   1e-27   
ref|XP_006489938.1|  PREDICTED: uncharacterized protein LOC102625022    105   1e-27   
gb|AFK48735.1|  unknown                                                 112   1e-27   
emb|CAN80832.1|  hypothetical protein VITISV_002505                     102   1e-27   
ref|XP_003546086.1|  PREDICTED: uncharacterized protein LOC100807088    114   1e-27   
ref|XP_009396509.1|  PREDICTED: uncharacterized protein LOC103981490    108   1e-27   
ref|XP_011078904.1|  PREDICTED: uncharacterized protein LOC105162545    103   1e-27   
ref|NP_973938.1|  uncharacterized protein                               102   1e-27   
ref|XP_008792993.1|  PREDICTED: uncharacterized protein LOC103709448    105   1e-27   
ref|XP_003542933.1|  PREDICTED: uncharacterized protein LOC100788675    114   1e-27   
gb|EYU20746.1|  hypothetical protein MIMGU_mgv1a008437mg                103   2e-27   
ref|XP_010534242.1|  PREDICTED: uncharacterized protein LOC104809851    108   2e-27   
ref|XP_010097437.1|  hypothetical protein L484_003208                   107   2e-27   
gb|KDO53673.1|  hypothetical protein CISIN_1g017355mg                   105   2e-27   
ref|XP_007028767.1|  F17A17.37 protein                                  109   2e-27   
ref|XP_004293568.1|  PREDICTED: uncharacterized protein LOC101302531    103   2e-27   
ref|XP_006467478.1|  PREDICTED: uncharacterized protein LOC102617...    102   3e-27   
gb|ACN30906.1|  unknown                                                 103   3e-27   
ref|XP_002276894.1|  PREDICTED: uncharacterized protein LOC100258445    106   3e-27   
ref|XP_006421407.1|  hypothetical protein CICLE_v10006613mg             100   3e-27   
ref|XP_002313314.1|  hypothetical protein POPTR_0009s06370g             106   3e-27   
ref|XP_011025472.1|  PREDICTED: uncharacterized protein LOC105126334    106   3e-27   
ref|XP_007213876.1|  hypothetical protein PRUPE_ppa006814mg             102   4e-27   
ref|XP_006845348.1|  hypothetical protein AMTR_s00141p00103540          102   4e-27   
ref|XP_011015145.1|  PREDICTED: uncharacterized protein LOC105118803    108   4e-27   
ref|XP_009758716.1|  PREDICTED: uncharacterized protein LOC104211372    103   4e-27   
ref|XP_010540565.1|  PREDICTED: uncharacterized protein LOC104814294    105   4e-27   
ref|XP_011016219.1|  PREDICTED: uncharacterized protein LOC105119742    102   4e-27   
ref|XP_008371603.1|  PREDICTED: uncharacterized protein LOC103434995    101   5e-27   
ref|XP_009394197.1|  PREDICTED: uncharacterized protein LOC103979736    106   7e-27   
ref|XP_002893594.1|  predicted protein                                  100   7e-27   
ref|XP_009360881.1|  PREDICTED: uncharacterized protein LOC103951270    100   7e-27   
gb|AFK49395.1|  unknown                                                 110   8e-27   
ref|XP_003593943.1|  hypothetical protein MTR_2g019600                  110   9e-27   
ref|XP_002532070.1|  conserved hypothetical protein                     105   9e-27   
gb|KDO78161.1|  hypothetical protein CISIN_1g0159862mg                99.8    1e-26   
gb|KFK36341.1|  hypothetical protein AALP_AA4G110000                    114   1e-26   
ref|XP_004486030.1|  PREDICTED: uncharacterized protein LOC101488455    110   1e-26   
ref|XP_006439076.1|  hypothetical protein CICLE_v10031881mg             103   2e-26   
ref|XP_003593942.1|  Glutamate-gated kainate-type ion channel rec...    110   2e-26   
ref|XP_007052493.1|  F17A17.37 protein                                  104   2e-26   
gb|KJB36028.1|  hypothetical protein B456_006G137000                    107   2e-26   
gb|KJB36031.1|  hypothetical protein B456_006G137000                    108   2e-26   
ref|XP_010241208.1|  PREDICTED: uncharacterized protein LOC104585885  98.2    3e-26   
emb|CDO98109.1|  unnamed protein product                                112   3e-26   
gb|KHG07966.1|  Imidazolonepropionase                                   107   3e-26   
ref|XP_008383561.1|  PREDICTED: uncharacterized protein LOC103446251  99.8    3e-26   
ref|XP_010504914.1|  PREDICTED: uncharacterized protein LOC104781...    103   4e-26   
ref|XP_009379646.1|  PREDICTED: uncharacterized protein LOC103968043  96.7    4e-26   
ref|XP_006345424.1|  PREDICTED: uncharacterized protein LOC102582371  99.4    4e-26   
gb|KHN47316.1|  hypothetical protein glysoja_020184                     108   4e-26   
ref|XP_010919817.1|  PREDICTED: uncharacterized protein LOC105043799    102   5e-26   
ref|XP_002308027.2|  hypothetical protein POPTR_0006s04880g             101   5e-26   
ref|XP_011013325.1|  PREDICTED: uncharacterized protein LOC105117377    101   6e-26   
ref|XP_008392232.1|  PREDICTED: uncharacterized protein LOC103454416  99.8    9e-26   
ref|XP_002322719.1|  hypothetical protein POPTR_0016s05640g             102   9e-26   
ref|XP_011033339.1|  PREDICTED: uncharacterized protein LOC105131855    102   9e-26   
ref|XP_008225474.1|  PREDICTED: uncharacterized protein LOC103325117  97.8    1e-25   
ref|XP_010554835.1|  PREDICTED: uncharacterized protein LOC104824444  97.4    1e-25   
ref|XP_008663355.1|  PREDICTED: uncharacterized protein LOC103641799    111   1e-25   
ref|XP_010695068.1|  PREDICTED: uncharacterized protein LOC104907775  97.8    1e-25   
ref|XP_010673133.1|  PREDICTED: uncharacterized protein LOC104889573  95.5    1e-25   
ref|XP_010673132.1|  PREDICTED: uncharacterized protein LOC104889572  99.0    1e-25   
ref|XP_009142778.1|  PREDICTED: uncharacterized protein LOC103866588  95.5    1e-25   
gb|EMT25156.1|  hypothetical protein F775_26385                         106   2e-25   
ref|XP_010508668.1|  PREDICTED: uncharacterized protein LOC104785200  92.4    3e-25   
ref|XP_004981346.1|  PREDICTED: uncharacterized protein LOC101768647    107   3e-25   
ref|XP_010505974.1|  PREDICTED: uncharacterized protein LOC104782672  92.0    4e-25   
ref|XP_010517673.1|  PREDICTED: uncharacterized protein LOC104793095  92.0    4e-25   
gb|KDP26060.1|  hypothetical protein JCGZ_21093                       98.6    4e-25   
ref|XP_006411450.1|  hypothetical protein EUTSA_v10016825mg           91.3    5e-25   
ref|XP_006368102.1|  PREDICTED: uncharacterized protein LOC102603851  95.1    5e-25   
dbj|BAJ89665.1|  predicted protein                                      105   5e-25   
ref|XP_011047367.1|  PREDICTED: uncharacterized protein LOC105141733    101   6e-25   
ref|XP_002466246.1|  hypothetical protein SORBIDRAFT_01g004270          106   6e-25   
ref|XP_006350194.1|  PREDICTED: uncharacterized protein LOC102578783  94.4    6e-25   
gb|EPS66859.1|  hypothetical protein M569_07917                       98.6    8e-25   
ref|XP_008245331.1|  PREDICTED: uncharacterized protein LOC103343457  99.8    9e-25   
ref|XP_002299934.2|  hypothetical protein POPTR_0001s27110g             101   1e-24   
ref|NP_001172996.1|  Os02g0527500                                     91.7    1e-24   
ref|XP_006296392.1|  hypothetical protein CARUB_v10025565mg           90.5    1e-24   
ref|XP_010911072.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...  96.7    1e-24   
gb|EEC73302.1|  hypothetical protein OsI_07475                        91.7    1e-24   
ref|XP_008812841.1|  PREDICTED: uncharacterized protein LOC103723648  99.4    1e-24   
tpg|DAA52069.1|  TPA: hypothetical protein ZEAMMB73_133538              105   1e-24   
ref|XP_002881800.1|  hypothetical protein ARALYDRAFT_483262           90.1    1e-24   
ref|XP_009355498.1|  PREDICTED: uncharacterized protein LOC103946508  95.5    2e-24   
ref|XP_006411448.1|  hypothetical protein EUTSA_v10016810mg           94.7    2e-24   
ref|NP_001051644.1|  Os03g0807700                                       105   2e-24   
ref|XP_006294452.1|  hypothetical protein CARUB_v10023465mg           93.6    3e-24   
ref|XP_010672845.1|  PREDICTED: uncharacterized protein LOC104889...  95.5    3e-24   
ref|XP_010546243.1|  PREDICTED: uncharacterized protein LOC104818346  94.4    3e-24   
gb|KDO42201.1|  hypothetical protein CISIN_1g045875mg                 97.8    3e-24   
ref|XP_004236613.1|  PREDICTED: uncharacterized protein LOC101245049  92.0    3e-24   
gb|KHN33140.1|  La-related protein 7                                    103   3e-24   
ref|XP_010672846.1|  PREDICTED: uncharacterized protein LOC104889...  95.5    3e-24   
gb|KJB69808.1|  hypothetical protein B456_011G043300                  96.7    3e-24   
ref|NP_001144239.1|  uncharacterized protein LOC100277106 precursor     104   3e-24   
emb|CDX79912.1|  BnaA05g02440D                                        89.0    3e-24   
ref|XP_010110985.1|  hypothetical protein L484_021680                 98.2    4e-24   
ref|XP_009142779.1|  PREDICTED: uncharacterized protein LOC103866589  88.2    5e-24   
gb|KHG21629.1|  GTPase Der                                            80.1    6e-24   
gb|AAK74007.1|  At1g29980/T1P2_9                                        104   6e-24   
ref|NP_181712.1|  uncharacterized protein                             90.5    6e-24   
ref|XP_007025094.1|  Uncharacterized protein TCM_029497               93.2    6e-24   
ref|XP_003564086.1|  PREDICTED: uncharacterized protein LOC100845370    106   7e-24   
ref|XP_011048055.1|  PREDICTED: uncharacterized protein LOC105142230    100   8e-24   
gb|KHG28355.1|  putative metabolite transport                         94.7    9e-24   
ref|NP_181711.1|  uncharacterized protein                             92.4    9e-24   
ref|XP_010517674.1|  PREDICTED: uncharacterized protein LOC104793096  92.4    1e-23   
ref|XP_010505975.1|  PREDICTED: uncharacterized protein LOC104782673  92.0    1e-23   
emb|CDY48765.1|  BnaC04g02180D                                        88.2    1e-23   
ref|XP_009775467.1|  PREDICTED: uncharacterized protein LOC104225390  88.6    1e-23   
ref|XP_009142006.1|  PREDICTED: uncharacterized protein LOC103865900  92.4    1e-23   
ref|XP_007201993.1|  hypothetical protein PRUPE_ppa024647mg           95.9    1e-23   
ref|XP_009355525.1|  PREDICTED: uncharacterized protein LOC103946533  92.4    1e-23   
gb|EMS62745.1|  hypothetical protein TRIUR3_16982                     92.0    2e-23   
ref|XP_008460770.1|  PREDICTED: uncharacterized protein LOC103499530  98.2    2e-23   
ref|XP_010508665.1|  PREDICTED: uncharacterized protein LOC104785...  92.4    2e-23   
ref|XP_010508664.1|  PREDICTED: uncharacterized protein LOC104785...  92.0    2e-23   
ref|XP_002308942.2|  hypothetical protein POPTR_0006s04890g           99.8    2e-23   
emb|CDP21696.1|  unnamed protein product                              93.6    2e-23   
emb|CDY06908.1|  BnaA04g24070D                                        94.0    3e-23   
dbj|BAD52536.1|  unknown protein                                      80.5    3e-23   
emb|CDY14785.1|  BnaC04g47820D                                        92.8    5e-23   
ref|XP_009587019.1|  PREDICTED: uncharacterized protein LOC104084774  87.0    5e-23   
ref|XP_004236614.1|  PREDICTED: uncharacterized protein LOC101245348  93.6    5e-23   
ref|XP_006350197.1|  PREDICTED: uncharacterized protein LOC102579762  93.2    6e-23   
ref|XP_004499913.1|  PREDICTED: uncharacterized protein LOC101495888  92.4    6e-23   
gb|KJB69807.1|  hypothetical protein B456_011G043300                  91.7    8e-23   
gb|KHN11697.1|  hypothetical protein glysoja_006150                   92.0    1e-22   
ref|XP_003534397.1|  PREDICTED: uncharacterized protein LOC100812299  92.0    1e-22   
ref|XP_006648442.1|  PREDICTED: uncharacterized protein LOC102701241  90.5    2e-22   
ref|NP_974254.1|  germination-related protein                         86.7    2e-22   
ref|XP_002882567.1|  hypothetical protein ARALYDRAFT_478145           86.7    2e-22   
gb|KEH17090.1|  DUF642 family protein                                 91.3    2e-22   
gb|EAY92272.1|  hypothetical protein OsI_13995                        98.6    2e-22   
ref|XP_004162183.1|  PREDICTED: uncharacterized LOC101213859          95.1    3e-22   
ref|XP_004149398.1|  PREDICTED: uncharacterized protein LOC101213859  95.1    3e-22   
gb|AFK39561.1|  unknown                                               89.7    4e-22   
gb|KFK37021.1|  hypothetical protein AALP_AA4G201900                  87.0    6e-22   
ref|XP_002881799.1|  hypothetical protein ARALYDRAFT_483261           85.9    6e-22   
ref|XP_003605789.1|  hypothetical protein MTR_4g039680                88.2    7e-22   
gb|KHG06200.1|  Periplasmic nitrate reductase                         93.2    7e-22   
gb|KJB57254.1|  hypothetical protein B456_009G155400                  93.6    7e-22   



>ref|XP_009617293.1| PREDICTED: uncharacterized protein LOC104109646 [Nicotiana tomentosiformis]
Length=373

 Score =   180 bits (456),  Expect(2) = 2e-55, Method: Compositional matrix adjust.
 Identities = 79/104 (76%), Positives = 94/104 (90%), Gaps = 0/104 (0%)
 Frame = +1

Query  142  TDGLLVNGNFEAPVKKTDLNGTIVTRHDAVPGWTVTGFVEYIQAGQKQGDMQLVVPEGFA  321
            TDGLL NGNFE P+ K DLNGT+V +H+A+P W+++GFVEYI+AGQKQGDM LVVPEG+A
Sbjct  27   TDGLLKNGNFEMPLAKADLNGTVVLKHNAIPEWSISGFVEYIKAGQKQGDMLLVVPEGYA  86

Query  322  AVRLGNEASIKQTLNVSKGMYYSITFCAARTCAQEERLNITVAP  453
            AVRLGNEASIKQ LNV+KGMYYS+TF AARTCAQEER+N++V P
Sbjct  87   AVRLGNEASIKQVLNVTKGMYYSLTFSAARTCAQEERINVSVTP  130


 Score = 63.2 bits (152),  Expect(2) = 2e-55, Method: Compositional matrix adjust.
 Identities = 27/39 (69%), Positives = 31/39 (79%), Gaps = 0/39 (0%)
 Frame = +2

Query  455  DSDVLPIQTLYSINGWDCYPWAFQAENPQAEIIIHNPGV  571
            D  VLPIQTLYS +GWD Y WAFQAE  Q E+++HNPGV
Sbjct  131  DFGVLPIQTLYSSSGWDSYAWAFQAEFSQVEVLLHNPGV  169



>ref|XP_004245192.1| PREDICTED: uncharacterized protein LOC101262737 [Solanum lycopersicum]
Length=371

 Score =   174 bits (442),  Expect(2) = 7e-55, Method: Compositional matrix adjust.
 Identities = 78/103 (76%), Positives = 91/103 (88%), Gaps = 0/103 (0%)
 Frame = +1

Query  145  DGLLVNGNFEAPVKKTDLNGTIVTRHDAVPGWTVTGFVEYIQAGQKQGDMQLVVPEGFAA  324
            DGLL NGNFE P  K DLNGT V +H+A+P W+++GFVEYI+AGQKQGDM LVVPEG+AA
Sbjct  26   DGLLKNGNFEMPPSKADLNGTEVLKHNAIPEWSISGFVEYIKAGQKQGDMLLVVPEGYAA  85

Query  325  VRLGNEASIKQTLNVSKGMYYSITFCAARTCAQEERLNITVAP  453
            VRLGNEASIKQ LNV+KGMYYS+TF AARTCAQEER+N++V P
Sbjct  86   VRLGNEASIKQILNVTKGMYYSLTFSAARTCAQEERINVSVTP  128


 Score = 66.2 bits (160),  Expect(2) = 7e-55, Method: Compositional matrix adjust.
 Identities = 29/39 (74%), Positives = 32/39 (82%), Gaps = 0/39 (0%)
 Frame = +2

Query  455  DSDVLPIQTLYSINGWDCYPWAFQAENPQAEIIIHNPGV  571
            D  VLPIQTLYS +GWD Y WAFQAE PQ EI++HNPGV
Sbjct  129  DFGVLPIQTLYSSSGWDSYAWAFQAEFPQVEILLHNPGV  167



>ref|XP_009771440.1| PREDICTED: uncharacterized protein LOC104221976 [Nicotiana sylvestris]
Length=373

 Score =   177 bits (450),  Expect(2) = 8e-55, Method: Compositional matrix adjust.
 Identities = 78/104 (75%), Positives = 94/104 (90%), Gaps = 0/104 (0%)
 Frame = +1

Query  142  TDGLLVNGNFEAPVKKTDLNGTIVTRHDAVPGWTVTGFVEYIQAGQKQGDMQLVVPEGFA  321
            TDGLL NGNFE P+ K +LNGT+V +H+A+P W+++GFVEYI+AGQKQGDM LVVPEG+A
Sbjct  27   TDGLLKNGNFEMPLAKGNLNGTVVLKHNAIPEWSISGFVEYIKAGQKQGDMLLVVPEGYA  86

Query  322  AVRLGNEASIKQTLNVSKGMYYSITFCAARTCAQEERLNITVAP  453
            AVRLGNEASIKQ LNV+KGMYYS+TF AARTCAQEER+N++V P
Sbjct  87   AVRLGNEASIKQVLNVTKGMYYSLTFSAARTCAQEERINVSVTP  130


 Score = 63.2 bits (152),  Expect(2) = 8e-55, Method: Compositional matrix adjust.
 Identities = 27/39 (69%), Positives = 31/39 (79%), Gaps = 0/39 (0%)
 Frame = +2

Query  455  DSDVLPIQTLYSINGWDCYPWAFQAENPQAEIIIHNPGV  571
            D  VLPIQTLYS +GWD Y WAFQAE  Q E+++HNPGV
Sbjct  131  DFGVLPIQTLYSSSGWDSYAWAFQAEFSQVEVLLHNPGV  169



>ref|XP_011085499.1| PREDICTED: uncharacterized protein LOC105167438 [Sesamum indicum]
Length=369

 Score =   174 bits (441),  Expect(2) = 7e-54, Method: Compositional matrix adjust.
 Identities = 81/105 (77%), Positives = 93/105 (89%), Gaps = 0/105 (0%)
 Frame = +1

Query  145  DGLLVNGNFEAPVKKTDLNGTIVTRHDAVPGWTVTGFVEYIQAGQKQGDMQLVVPEGFAA  324
            DGLL NGNFE   K ++LNGTIV + +A+P W V+GFVEYI+AGQKQGDM LVVPEG+AA
Sbjct  24   DGLLDNGNFEQAPKASELNGTIVLKPNAIPKWRVSGFVEYIKAGQKQGDMLLVVPEGYAA  83

Query  325  VRLGNEASIKQTLNVSKGMYYSITFCAARTCAQEERLNITVAPGL  459
            VRLGNEASIKQ+LNVSKGMYYS+TF AARTCAQEERLN++VAPG 
Sbjct  84   VRLGNEASIKQSLNVSKGMYYSLTFSAARTCAQEERLNVSVAPGF  128


 Score = 63.2 bits (152),  Expect(2) = 7e-54, Method: Compositional matrix adjust.
 Identities = 28/36 (78%), Positives = 30/36 (83%), Gaps = 0/36 (0%)
 Frame = +2

Query  464  VLPIQTLYSINGWDCYPWAFQAENPQAEIIIHNPGV  571
            VLPIQTLYS NGWD Y WAFQA +  AEI+IHNPGV
Sbjct  130  VLPIQTLYSSNGWDSYAWAFQANHSVAEILIHNPGV  165



>ref|XP_006364278.1| PREDICTED: uncharacterized protein LOC102598357 [Solanum tuberosum]
Length=371

 Score =   174 bits (442),  Expect(2) = 7e-54, Method: Compositional matrix adjust.
 Identities = 78/103 (76%), Positives = 91/103 (88%), Gaps = 0/103 (0%)
 Frame = +1

Query  145  DGLLVNGNFEAPVKKTDLNGTIVTRHDAVPGWTVTGFVEYIQAGQKQGDMQLVVPEGFAA  324
            DGLL NGNFE P  K DLNGT V +H+A+P W+++GFVEYI+AGQKQGDM LVVPEG+AA
Sbjct  26   DGLLKNGNFEIPPSKADLNGTEVLKHNAIPEWSISGFVEYIKAGQKQGDMLLVVPEGYAA  85

Query  325  VRLGNEASIKQTLNVSKGMYYSITFCAARTCAQEERLNITVAP  453
            VRLGNEASIKQ LNV+KGMYYS+TF AARTCAQEER+N++V P
Sbjct  86   VRLGNEASIKQILNVTKGMYYSLTFSAARTCAQEERINVSVTP  128


 Score = 63.2 bits (152),  Expect(2) = 7e-54, Method: Compositional matrix adjust.
 Identities = 28/39 (72%), Positives = 31/39 (79%), Gaps = 0/39 (0%)
 Frame = +2

Query  455  DSDVLPIQTLYSINGWDCYPWAFQAENPQAEIIIHNPGV  571
            D  VLPIQTLYS +GWD Y WAFQAE  Q EI++HNPGV
Sbjct  129  DFGVLPIQTLYSSSGWDSYAWAFQAELHQVEILLHNPGV  167



>emb|CDP04798.1| unnamed protein product [Coffea canephora]
Length=371

 Score =   171 bits (432),  Expect(2) = 1e-50, Method: Compositional matrix adjust.
 Identities = 78/103 (76%), Positives = 90/103 (87%), Gaps = 0/103 (0%)
 Frame = +1

Query  145  DGLLVNGNFEAPVKKTDLNGTIVTRHDAVPGWTVTGFVEYIQAGQKQGDMQLVVPEGFAA  324
            DGL+ NGNFE   K +DLNGT+V R +AVPGW  +GFVEYI+AGQKQGDM LVVPEG AA
Sbjct  26   DGLMENGNFEIAPKDSDLNGTVVLRQNAVPGWITSGFVEYIKAGQKQGDMILVVPEGHAA  85

Query  325  VRLGNEASIKQTLNVSKGMYYSITFCAARTCAQEERLNITVAP  453
            +RLGNEASIKQ +NV+KGMYYSITF AARTCAQEE+LN++VAP
Sbjct  86   IRLGNEASIKQKINVTKGMYYSITFSAARTCAQEEQLNVSVAP  128


 Score = 55.8 bits (133),  Expect(2) = 1e-50, Method: Compositional matrix adjust.
 Identities = 26/39 (67%), Positives = 28/39 (72%), Gaps = 0/39 (0%)
 Frame = +2

Query  455  DSDVLPIQTLYSINGWDCYPWAFQAENPQAEIIIHNPGV  571
            D  VLP+QTLYS +GWD Y WAFQA      IIIHNPGV
Sbjct  129  DFGVLPMQTLYSSSGWDSYAWAFQAMYTVVYIIIHNPGV  167



>ref|XP_011081926.1| PREDICTED: uncharacterized protein LOC105164832 [Sesamum indicum]
Length=405

 Score =   166 bits (420),  Expect(2) = 2e-50, Method: Compositional matrix adjust.
 Identities = 76/103 (74%), Positives = 90/103 (87%), Gaps = 0/103 (0%)
 Frame = +1

Query  145  DGLLVNGNFEAPVKKTDLNGTIVTRHDAVPGWTVTGFVEYIQAGQKQGDMQLVVPEGFAA  324
            DGLL NGNFE   K ++LNGTIV +  AVP W ++GFVEYI+AGQKQGDM LVVPEG+AA
Sbjct  60   DGLLDNGNFEQAPKSSELNGTIVLKPHAVPKWQISGFVEYIKAGQKQGDMLLVVPEGYAA  119

Query  325  VRLGNEASIKQTLNVSKGMYYSITFCAARTCAQEERLNITVAP  453
            VRLGNEASIKQ +NV+KGM+YS+TF AARTCAQEER+N++VAP
Sbjct  120  VRLGNEASIKQLINVTKGMFYSLTFSAARTCAQEERVNVSVAP  162


 Score = 59.7 bits (143),  Expect(2) = 2e-50, Method: Compositional matrix adjust.
 Identities = 27/39 (69%), Positives = 29/39 (74%), Gaps = 0/39 (0%)
 Frame = +2

Query  455  DSDVLPIQTLYSINGWDCYPWAFQAENPQAEIIIHNPGV  571
            D  VLPIQTLYS NGWD Y WAF+     AEI+IHNPGV
Sbjct  163  DYGVLPIQTLYSSNGWDSYAWAFRTSYDVAEILIHNPGV  201



>ref|XP_010110340.1| GTP-binding nuclear protein [Morus notabilis]
 gb|EXC26027.1| GTP-binding nuclear protein [Morus notabilis]
Length=573

 Score =   160 bits (406),  Expect(2) = 6e-50, Method: Compositional matrix adjust.
 Identities = 75/103 (73%), Positives = 86/103 (83%), Gaps = 0/103 (0%)
 Frame = +1

Query  145  DGLLVNGNFEAPVKKTDLNGTIVTRHDAVPGWTVTGFVEYIQAGQKQGDMQLVVPEGFAA  324
            DGLL NGNFE   K +DLNGT V    A+P W ++GFVEYI+AGQKQGDM LVVPEG  A
Sbjct  23   DGLLENGNFELAPKASDLNGTEVKGRYAIPEWEISGFVEYIKAGQKQGDMLLVVPEGACA  82

Query  325  VRLGNEASIKQTLNVSKGMYYSITFCAARTCAQEERLNITVAP  453
            VRLGNEASIKQ LNV+KGM+Y++TFCAARTCAQEERLN++V P
Sbjct  83   VRLGNEASIKQRLNVTKGMFYALTFCAARTCAQEERLNVSVPP  125


 Score = 63.9 bits (154),  Expect(2) = 6e-50, Method: Composition-based stats.
 Identities = 28/39 (72%), Positives = 29/39 (74%), Gaps = 0/39 (0%)
 Frame = +2

Query  455  DSDVLPIQTLYSINGWDCYPWAFQAENPQAEIIIHNPGV  571
            DS +LPIQTLY  NGWDCY WAF A     EIIIHNPGV
Sbjct  126  DSGLLPIQTLYGSNGWDCYSWAFLAPLSLVEIIIHNPGV  164



>gb|KFK25408.1| hypothetical protein AALP_AA8G110600 [Arabis alpina]
Length=367

 Score =   159 bits (402),  Expect(2) = 2e-49, Method: Compositional matrix adjust.
 Identities = 75/104 (72%), Positives = 88/104 (85%), Gaps = 0/104 (0%)
 Frame = +1

Query  142  TDGLLVNGNFEAPVKKTDLNGTIVTRHDAVPGWTVTGFVEYIQAGQKQGDMQLVVPEGFA  321
            TDG+L NG+FE   K +D+ GT V + +A+P W VTGFVEYI++GQKQGDM LVVP G  
Sbjct  25   TDGMLPNGDFELGPKPSDIKGTKVLKKNAIPSWEVTGFVEYIKSGQKQGDMLLVVPAGKF  84

Query  322  AVRLGNEASIKQTLNVSKGMYYSITFCAARTCAQEERLNITVAP  453
            AVRLGNEASIKQTLNV+KGMYYS+TF AARTCAQ+ERLNI+VAP
Sbjct  85   AVRLGNEASIKQTLNVTKGMYYSLTFSAARTCAQDERLNISVAP  128


 Score = 63.2 bits (152),  Expect(2) = 2e-49, Method: Compositional matrix adjust.
 Identities = 27/38 (71%), Positives = 32/38 (84%), Gaps = 0/38 (0%)
 Frame = +2

Query  455  DSDVLPIQTLYSINGWDCYPWAFQAENPQAEIIIHNPG  568
            DS V+PIQT+YS +GWD Y WAFQAE+  AEI+IHNPG
Sbjct  129  DSGVIPIQTVYSSSGWDLYAWAFQAESSVAEILIHNPG  166



>ref|XP_004291483.1| PREDICTED: uncharacterized protein LOC101294330 [Fragaria vesca 
subsp. vesca]
Length=368

 Score =   155 bits (392),  Expect(2) = 4e-49, Method: Compositional matrix adjust.
 Identities = 74/103 (72%), Positives = 84/103 (82%), Gaps = 0/103 (0%)
 Frame = +1

Query  145  DGLLVNGNFEAPVKKTDLNGTIVTRHDAVPGWTVTGFVEYIQAGQKQGDMQLVVPEGFAA  324
            DG L NGNFE   K +DL GT V    A+P W ++GFVEYI++GQKQGDM LVVPEG  A
Sbjct  25   DGYLENGNFELAPKPSDLKGTEVIGRYAIPKWEISGFVEYIKSGQKQGDMLLVVPEGAYA  84

Query  325  VRLGNEASIKQTLNVSKGMYYSITFCAARTCAQEERLNITVAP  453
            VRLGNEASIKQ +NV+KG+YYSITF AARTCAQEERLNI+VAP
Sbjct  85   VRLGNEASIKQRINVTKGLYYSITFSAARTCAQEERLNISVAP  127


 Score = 66.2 bits (160),  Expect(2) = 4e-49, Method: Compositional matrix adjust.
 Identities = 28/39 (72%), Positives = 33/39 (85%), Gaps = 0/39 (0%)
 Frame = +2

Query  455  DSDVLPIQTLYSINGWDCYPWAFQAENPQAEIIIHNPGV  571
            DS VLPIQT+YS NGWD Y WAFQA+ PQ E+++HNPGV
Sbjct  128  DSGVLPIQTVYSSNGWDSYAWAFQADFPQIELVLHNPGV  166



>ref|XP_010048243.1| PREDICTED: uncharacterized protein LOC104437065 [Eucalyptus grandis]
 gb|KCW80448.1| hypothetical protein EUGRSUZ_C01791 [Eucalyptus grandis]
Length=369

 Score =   154 bits (390),  Expect(2) = 7e-49, Method: Compositional matrix adjust.
 Identities = 73/103 (71%), Positives = 84/103 (82%), Gaps = 0/103 (0%)
 Frame = +1

Query  145  DGLLVNGNFEAPVKKTDLNGTIVTRHDAVPGWTVTGFVEYIQAGQKQGDMQLVVPEGFAA  324
            DGL+ NGNFE   K +D+ GT+V    A+P W ++GFVEYI++GQKQGDM LVVPEG  A
Sbjct  25   DGLVPNGNFELAPKPSDMKGTVVIGKYAIPKWEISGFVEYIKSGQKQGDMLLVVPEGAFA  84

Query  325  VRLGNEASIKQTLNVSKGMYYSITFCAARTCAQEERLNITVAP  453
            VRLGNEASIKQ L V KGMYYSITF AARTCAQEE+LNI+VAP
Sbjct  85   VRLGNEASIKQRLRVQKGMYYSITFSAARTCAQEEKLNISVAP  127


 Score = 66.2 bits (160),  Expect(2) = 7e-49, Method: Compositional matrix adjust.
 Identities = 30/39 (77%), Positives = 32/39 (82%), Gaps = 0/39 (0%)
 Frame = +2

Query  455  DSDVLPIQTLYSINGWDCYPWAFQAENPQAEIIIHNPGV  571
            DS VLP+QTLYS NGWD Y WAFQAE   AEI+IHNPGV
Sbjct  128  DSGVLPMQTLYSSNGWDSYAWAFQAELDVAEIVIHNPGV  166



>ref|XP_010249980.1| PREDICTED: uncharacterized protein LOC104592350 [Nelumbo nucifera]
Length=369

 Score =   153 bits (387),  Expect(2) = 1e-48, Method: Compositional matrix adjust.
 Identities = 73/103 (71%), Positives = 84/103 (82%), Gaps = 0/103 (0%)
 Frame = +1

Query  145  DGLLVNGNFEAPVKKTDLNGTIVTRHDAVPGWTVTGFVEYIQAGQKQGDMQLVVPEGFAA  324
            DGLL NGNFE   K + + GT+VT   A+P W +TG+VEYI++GQKQGDM LVVPEG  A
Sbjct  25   DGLLPNGNFEYGPKPSQMKGTLVTDAHAIPEWELTGYVEYIKSGQKQGDMLLVVPEGAYA  84

Query  325  VRLGNEASIKQTLNVSKGMYYSITFCAARTCAQEERLNITVAP  453
            VRLGNEASIKQ + V KGMYYSITF AARTCAQEERLN++VAP
Sbjct  85   VRLGNEASIKQKVKVIKGMYYSITFSAARTCAQEERLNVSVAP  127


 Score = 66.6 bits (161),  Expect(2) = 1e-48, Method: Compositional matrix adjust.
 Identities = 27/39 (69%), Positives = 33/39 (85%), Gaps = 0/39 (0%)
 Frame = +2

Query  455  DSDVLPIQTLYSINGWDCYPWAFQAENPQAEIIIHNPGV  571
            DS +LP+QT+YS NGWD Y WAFQA+ P+ EI+IHNPGV
Sbjct  128  DSGILPMQTMYSSNGWDSYAWAFQADYPEVEIVIHNPGV  166



>emb|CDX69757.1| BnaA10g21060D [Brassica napus]
Length=1312

 Score =   152 bits (384),  Expect(2) = 1e-48, Method: Compositional matrix adjust.
 Identities = 70/103 (68%), Positives = 84/103 (82%), Gaps = 0/103 (0%)
 Frame = +1

Query  145  DGLLVNGNFEAPVKKTDLNGTIVTRHDAVPGWTVTGFVEYIQAGQKQGDMQLVVPEGFAA  324
            DG+L NG FE   K +DL GT V   +A+P W ++GF+EYI++GQKQGDM LVVP G  A
Sbjct  25   DGMLPNGGFERGPKPSDLKGTRVINKNAIPNWELSGFIEYIKSGQKQGDMLLVVPAGKFA  84

Query  325  VRLGNEASIKQTLNVSKGMYYSITFCAARTCAQEERLNITVAP  453
            VRLGNEASIKQ +NV+KGMYYS+TF AARTCAQ+ERLNI+VAP
Sbjct  85   VRLGNEASIKQRVNVTKGMYYSLTFSAARTCAQDERLNISVAP  127


 Score = 67.4 bits (163),  Expect(2) = 1e-48, Method: Composition-based stats.
 Identities = 28/38 (74%), Positives = 32/38 (84%), Gaps = 0/38 (0%)
 Frame = +2

Query  455  DSDVLPIQTLYSINGWDCYPWAFQAENPQAEIIIHNPG  568
            DS V+PIQTLYS NGWD Y WAFQA++  AEI+IHNPG
Sbjct  128  DSGVIPIQTLYSSNGWDLYAWAFQAQSDVAEIVIHNPG  165



>ref|XP_010254319.1| PREDICTED: uncharacterized protein LOC104595325 [Nelumbo nucifera]
 ref|XP_010254320.1| PREDICTED: uncharacterized protein LOC104595325 [Nelumbo nucifera]
Length=370

 Score =   152 bits (384),  Expect(2) = 4e-48, Method: Compositional matrix adjust.
 Identities = 72/103 (70%), Positives = 83/103 (81%), Gaps = 0/103 (0%)
 Frame = +1

Query  145  DGLLVNGNFEAPVKKTDLNGTIVTRHDAVPGWTVTGFVEYIQAGQKQGDMQLVVPEGFAA  324
            DGLL NG+FE   K +D+ GT+V    A+P W ++GFVEYI+AGQKQGDM LVVP G  A
Sbjct  26   DGLLPNGDFEYGPKPSDMKGTVVINRHAIPEWELSGFVEYIKAGQKQGDMLLVVPAGEFA  85

Query  325  VRLGNEASIKQTLNVSKGMYYSITFCAARTCAQEERLNITVAP  453
            VRLGNEASIKQ + V KGMYYSITF AARTCAQEERLN++VAP
Sbjct  86   VRLGNEASIKQKVKVIKGMYYSITFSAARTCAQEERLNVSVAP  128


 Score = 66.2 bits (160),  Expect(2) = 4e-48, Method: Compositional matrix adjust.
 Identities = 28/39 (72%), Positives = 32/39 (82%), Gaps = 0/39 (0%)
 Frame = +2

Query  455  DSDVLPIQTLYSINGWDCYPWAFQAENPQAEIIIHNPGV  571
            DS +LPIQT YS NGWD Y WAFQA+ P+ EI+IHNPGV
Sbjct  129  DSGILPIQTTYSSNGWDSYAWAFQADYPEVEIVIHNPGV  167



>ref|XP_008775036.1| PREDICTED: uncharacterized protein LOC103695476 [Phoenix dactylifera]
Length=376

 Score =   150 bits (379),  Expect(2) = 6e-48, Method: Compositional matrix adjust.
 Identities = 71/101 (70%), Positives = 80/101 (79%), Gaps = 0/101 (0%)
 Frame = +1

Query  151  LLVNGNFEAPVKKTDLNGTIVTRHDAVPGWTVTGFVEYIQAGQKQGDMQLVVPEGFAAVR  330
            LL NGNFE    ++ LNGT V    A+P W +TGFVEYI++G KQGDM L VPEG  AVR
Sbjct  32   LLPNGNFEKGPSRSQLNGTQVIGRYAIPEWEITGFVEYIESGHKQGDMLLPVPEGVHAVR  91

Query  331  LGNEASIKQTLNVSKGMYYSITFCAARTCAQEERLNITVAP  453
            LGNEASIKQ L V+KGMYYSITFCAARTCAQEERLN++V P
Sbjct  92   LGNEASIKQKLKVTKGMYYSITFCAARTCAQEERLNVSVTP  132


 Score = 67.4 bits (163),  Expect(2) = 6e-48, Method: Compositional matrix adjust.
 Identities = 28/39 (72%), Positives = 33/39 (85%), Gaps = 0/39 (0%)
 Frame = +2

Query  455  DSDVLPIQTLYSINGWDCYPWAFQAENPQAEIIIHNPGV  571
            DS VLP+QT+YS +GWDCY WAFQA  PQ E++IHNPGV
Sbjct  133  DSGVLPMQTMYSSSGWDCYAWAFQALFPQVELVIHNPGV  171



>gb|KDP33619.1| hypothetical protein JCGZ_07190 [Jatropha curcas]
Length=364

 Score =   153 bits (386),  Expect(2) = 6e-48, Method: Compositional matrix adjust.
 Identities = 73/103 (71%), Positives = 84/103 (82%), Gaps = 0/103 (0%)
 Frame = +1

Query  145  DGLLVNGNFEAPVKKTDLNGTIVTRHDAVPGWTVTGFVEYIQAGQKQGDMQLVVPEGFAA  324
            DGL+ NGNFE   K++DLNGT V    A+P W ++GFVEYI++GQKQGDM LVVPEG  A
Sbjct  23   DGLIENGNFELGPKQSDLNGTKVLGRYAIPRWEISGFVEYIKSGQKQGDMLLVVPEGAYA  82

Query  325  VRLGNEASIKQTLNVSKGMYYSITFCAARTCAQEERLNITVAP  453
            VRLGNEASIKQ L V KGMYYSITF AARTCAQEE LN++V+P
Sbjct  83   VRLGNEASIKQKLKVIKGMYYSITFSAARTCAQEEALNVSVSP  125


 Score = 65.1 bits (157),  Expect(2) = 6e-48, Method: Compositional matrix adjust.
 Identities = 27/39 (69%), Positives = 32/39 (82%), Gaps = 0/39 (0%)
 Frame = +2

Query  455  DSDVLPIQTLYSINGWDCYPWAFQAENPQAEIIIHNPGV  571
            DS VLP+QT+YS NGWD Y WAFQAE P  +++IHNPGV
Sbjct  126  DSGVLPMQTMYSSNGWDSYAWAFQAEYPVVDLVIHNPGV  164



>ref|XP_010918669.1| PREDICTED: uncharacterized protein LOC105042950 [Elaeis guineensis]
Length=370

 Score =   154 bits (390),  Expect(2) = 6e-48, Method: Compositional matrix adjust.
 Identities = 72/104 (69%), Positives = 83/104 (80%), Gaps = 0/104 (0%)
 Frame = +1

Query  142  TDGLLVNGNFEAPVKKTDLNGTIVTRHDAVPGWTVTGFVEYIQAGQKQGDMQLVVPEGFA  321
            TDGLL NGNFE    ++ LNGT VT   A+P W ++G VEYI++G KQGDM L VPEG  
Sbjct  23   TDGLLPNGNFEKGPSRSQLNGTQVTSRYAIPEWEISGVVEYIESGHKQGDMLLPVPEGVY  82

Query  322  AVRLGNEASIKQTLNVSKGMYYSITFCAARTCAQEERLNITVAP  453
            AVRLGNEAS+KQ L V+KGMYYSITFCAARTCAQEERLN++V P
Sbjct  83   AVRLGNEASVKQNLKVTKGMYYSITFCAARTCAQEERLNVSVTP  126


 Score = 63.2 bits (152),  Expect(2) = 6e-48, Method: Compositional matrix adjust.
 Identities = 26/39 (67%), Positives = 32/39 (82%), Gaps = 0/39 (0%)
 Frame = +2

Query  455  DSDVLPIQTLYSINGWDCYPWAFQAENPQAEIIIHNPGV  571
            DS VLP+QT+YS +GWDCY WAF+A   Q E++IHNPGV
Sbjct  127  DSGVLPMQTMYSSSGWDCYAWAFKALFAQVELVIHNPGV  165



>ref|XP_009345289.1| PREDICTED: uncharacterized protein LOC103937097 [Pyrus x bretschneideri]
Length=369

 Score =   155 bits (392),  Expect(2) = 6e-48, Method: Compositional matrix adjust.
 Identities = 71/103 (69%), Positives = 85/103 (83%), Gaps = 0/103 (0%)
 Frame = +1

Query  145  DGLLVNGNFEAPVKKTDLNGTIVTRHDAVPGWTVTGFVEYIQAGQKQGDMQLVVPEGFAA  324
            DG L NGNFE P K +D+ G+ V    A+P W ++GFVEYI++GQKQGDM LVVPEG  A
Sbjct  28   DGYLENGNFELPPKPSDIKGSEVIGRYAIPKWEISGFVEYIKSGQKQGDMLLVVPEGAYA  87

Query  325  VRLGNEASIKQTLNVSKGMYYSITFCAARTCAQEERLNITVAP  453
            VRLGNEASIKQ++ V+KG+YYSITF AARTCAQEERLN++VAP
Sbjct  88   VRLGNEASIKQSIKVTKGLYYSITFSAARTCAQEERLNVSVAP  130


 Score = 62.4 bits (150),  Expect(2) = 6e-48, Method: Compositional matrix adjust.
 Identities = 26/39 (67%), Positives = 31/39 (79%), Gaps = 0/39 (0%)
 Frame = +2

Query  455  DSDVLPIQTLYSINGWDCYPWAFQAENPQAEIIIHNPGV  571
            DS VLPIQT+YS NGWD Y WAFQA+    E+++HNPGV
Sbjct  131  DSGVLPIQTVYSSNGWDSYAWAFQADYETVELVLHNPGV  169



>emb|CDX91217.1| BnaC02g03800D [Brassica napus]
Length=366

 Score =   155 bits (391),  Expect(2) = 7e-48, Method: Compositional matrix adjust.
 Identities = 73/103 (71%), Positives = 85/103 (83%), Gaps = 0/103 (0%)
 Frame = +1

Query  145  DGLLVNGNFEAPVKKTDLNGTIVTRHDAVPGWTVTGFVEYIQAGQKQGDMQLVVPEGFAA  324
            DG+L NG+FE   K +D+ GT V   +A+P W +TGFVEYIQ+GQKQGDM LVVP G  A
Sbjct  25   DGMLPNGDFELGPKPSDMKGTQVINKNAIPSWELTGFVEYIQSGQKQGDMLLVVPAGKFA  84

Query  325  VRLGNEASIKQTLNVSKGMYYSITFCAARTCAQEERLNITVAP  453
            VRLGNEASIKQ LNV+KGMYYS+TF AARTCAQ+ERLNI+VAP
Sbjct  85   VRLGNEASIKQRLNVTKGMYYSLTFSAARTCAQDERLNISVAP  127


 Score = 62.8 bits (151),  Expect(2) = 7e-48, Method: Compositional matrix adjust.
 Identities = 27/38 (71%), Positives = 32/38 (84%), Gaps = 0/38 (0%)
 Frame = +2

Query  455  DSDVLPIQTLYSINGWDCYPWAFQAENPQAEIIIHNPG  568
            DS V+PIQT+YS +GWD Y WAFQAE+  AEI+IHNPG
Sbjct  128  DSGVIPIQTVYSSSGWDLYAWAFQAESNVAEIVIHNPG  165



>ref|XP_006287989.1| hypothetical protein CARUB_v10001222mg [Capsella rubella]
 gb|EOA20887.1| hypothetical protein CARUB_v10001222mg [Capsella rubella]
Length=367

 Score =   154 bits (390),  Expect(2) = 7e-48, Method: Compositional matrix adjust.
 Identities = 73/104 (70%), Positives = 86/104 (83%), Gaps = 0/104 (0%)
 Frame = +1

Query  142  TDGLLVNGNFEAPVKKTDLNGTIVTRHDAVPGWTVTGFVEYIQAGQKQGDMQLVVPEGFA  321
            TDG+L NG+FE   K +DL GT V   +A+P W ++GFVEYI++GQKQGDM LVVP G  
Sbjct  25   TDGMLPNGDFELGPKPSDLKGTQVISKNAIPSWELSGFVEYIKSGQKQGDMLLVVPAGKF  84

Query  322  AVRLGNEASIKQTLNVSKGMYYSITFCAARTCAQEERLNITVAP  453
            AVRLGNEASIKQ LNV+KGMYYS+TF AARTCAQ+ERLNI+VAP
Sbjct  85   AVRLGNEASIKQRLNVTKGMYYSLTFSAARTCAQDERLNISVAP  128


 Score = 62.8 bits (151),  Expect(2) = 7e-48, Method: Compositional matrix adjust.
 Identities = 27/38 (71%), Positives = 32/38 (84%), Gaps = 0/38 (0%)
 Frame = +2

Query  455  DSDVLPIQTLYSINGWDCYPWAFQAENPQAEIIIHNPG  568
            DS V+PIQT+YS +GWD Y WAFQAE+  AEI+IHNPG
Sbjct  129  DSGVIPIQTVYSSSGWDLYAWAFQAESNVAEIVIHNPG  166



>ref|XP_009334778.1| PREDICTED: uncharacterized protein LOC103927565 [Pyrus x bretschneideri]
Length=365

 Score =   155 bits (392),  Expect(2) = 7e-48, Method: Compositional matrix adjust.
 Identities = 71/103 (69%), Positives = 85/103 (83%), Gaps = 0/103 (0%)
 Frame = +1

Query  145  DGLLVNGNFEAPVKKTDLNGTIVTRHDAVPGWTVTGFVEYIQAGQKQGDMQLVVPEGFAA  324
            DG L NGNFE P K +D+ G+ V    A+P W ++GFVEYI++GQKQGDM LVVPEG  A
Sbjct  24   DGYLENGNFELPPKPSDIKGSEVIGRYAIPKWEISGFVEYIKSGQKQGDMLLVVPEGAYA  83

Query  325  VRLGNEASIKQTLNVSKGMYYSITFCAARTCAQEERLNITVAP  453
            VRLGNEASIKQ++ V+KG+YYSITF AARTCAQEERLN++VAP
Sbjct  84   VRLGNEASIKQSIKVTKGLYYSITFSAARTCAQEERLNVSVAP  126


 Score = 62.4 bits (150),  Expect(2) = 7e-48, Method: Compositional matrix adjust.
 Identities = 26/39 (67%), Positives = 31/39 (79%), Gaps = 0/39 (0%)
 Frame = +2

Query  455  DSDVLPIQTLYSINGWDCYPWAFQAENPQAEIIIHNPGV  571
            DS VLPIQT+YS NGWD Y WAFQA+    E+++HNPGV
Sbjct  127  DSGVLPIQTVYSSNGWDSYAWAFQADYETVELVLHNPGV  165



>ref|XP_008394047.1| PREDICTED: uncharacterized protein LOC103456171 [Malus domestica]
Length=365

 Score =   155 bits (391),  Expect(2) = 9e-48, Method: Compositional matrix adjust.
 Identities = 70/103 (68%), Positives = 85/103 (83%), Gaps = 0/103 (0%)
 Frame = +1

Query  145  DGLLVNGNFEAPVKKTDLNGTIVTRHDAVPGWTVTGFVEYIQAGQKQGDMQLVVPEGFAA  324
            DG L NGNFE P K +D+ G+ V    A+P W ++GFVEYI++GQKQGDM LVVP+G  A
Sbjct  24   DGYLENGNFELPPKPSDIKGSEVIGRYAIPKWEISGFVEYIKSGQKQGDMLLVVPZGAYA  83

Query  325  VRLGNEASIKQTLNVSKGMYYSITFCAARTCAQEERLNITVAP  453
            VRLGNEASIKQ++ V+KG+YYSITF AARTCAQEERLN++VAP
Sbjct  84   VRLGNEASIKQSIKVTKGLYYSITFSAARTCAQEERLNVSVAP  126


 Score = 62.4 bits (150),  Expect(2) = 9e-48, Method: Compositional matrix adjust.
 Identities = 26/39 (67%), Positives = 31/39 (79%), Gaps = 0/39 (0%)
 Frame = +2

Query  455  DSDVLPIQTLYSINGWDCYPWAFQAENPQAEIIIHNPGV  571
            DS VLPIQT+YS NGWD Y WAFQA+    E+++HNPGV
Sbjct  127  DSGVLPIQTVYSSNGWDSYAWAFQADYETVELVLHNPGV  165



>emb|CDX85713.1| BnaA02g01000D [Brassica napus]
Length=366

 Score =   154 bits (388),  Expect(2) = 1e-47, Method: Compositional matrix adjust.
 Identities = 72/103 (70%), Positives = 85/103 (83%), Gaps = 0/103 (0%)
 Frame = +1

Query  145  DGLLVNGNFEAPVKKTDLNGTIVTRHDAVPGWTVTGFVEYIQAGQKQGDMQLVVPEGFAA  324
            DG+L NG+FE   K  D+ GT V + +A+P W +TGFVEYI++GQKQGDM LVVP G  A
Sbjct  25   DGMLPNGDFELGPKPADMKGTQVIKKNAIPSWELTGFVEYIKSGQKQGDMLLVVPAGKFA  84

Query  325  VRLGNEASIKQTLNVSKGMYYSITFCAARTCAQEERLNITVAP  453
            VRLGNEASIKQ LNV+KGMYYS+TF AARTCAQ+ERLNI+VAP
Sbjct  85   VRLGNEASIKQRLNVTKGMYYSLTFSAARTCAQDERLNISVAP  127


 Score = 62.8 bits (151),  Expect(2) = 1e-47, Method: Compositional matrix adjust.
 Identities = 27/38 (71%), Positives = 32/38 (84%), Gaps = 0/38 (0%)
 Frame = +2

Query  455  DSDVLPIQTLYSINGWDCYPWAFQAENPQAEIIIHNPG  568
            DS V+PIQT+YS +GWD Y WAFQAE+  AEI+IHNPG
Sbjct  128  DSGVIPIQTVYSSSGWDLYAWAFQAESNVAEIVIHNPG  165



>emb|CDX97108.1| BnaC09g45170D [Brassica napus]
Length=366

 Score =   149 bits (377),  Expect(2) = 1e-47, Method: Compositional matrix adjust.
 Identities = 69/103 (67%), Positives = 84/103 (82%), Gaps = 0/103 (0%)
 Frame = +1

Query  145  DGLLVNGNFEAPVKKTDLNGTIVTRHDAVPGWTVTGFVEYIQAGQKQGDMQLVVPEGFAA  324
            DG+L NG FE   K +D+ GT V   +A+P W ++GF+EYI++GQKQGDM LVVP G  A
Sbjct  25   DGMLPNGGFERGPKPSDMKGTRVINKNAIPNWELSGFIEYIKSGQKQGDMLLVVPAGKFA  84

Query  325  VRLGNEASIKQTLNVSKGMYYSITFCAARTCAQEERLNITVAP  453
            VRLGNEASIKQ +NV+KGMYYS+TF AARTCAQ+ERLNI+VAP
Sbjct  85   VRLGNEASIKQRINVTKGMYYSLTFSAARTCAQDERLNISVAP  127


 Score = 67.0 bits (162),  Expect(2) = 1e-47, Method: Compositional matrix adjust.
 Identities = 29/38 (76%), Positives = 32/38 (84%), Gaps = 0/38 (0%)
 Frame = +2

Query  455  DSDVLPIQTLYSINGWDCYPWAFQAENPQAEIIIHNPG  568
            DS V+PIQTLYS NGWD Y WAFQA+N  AEI+IHNPG
Sbjct  128  DSGVIPIQTLYSSNGWDLYAWAFQAQNDVAEIVIHNPG  165



>ref|XP_010491872.1| PREDICTED: uncharacterized protein LOC104769372 [Camelina sativa]
Length=367

 Score =   154 bits (388),  Expect(2) = 1e-47, Method: Compositional matrix adjust.
 Identities = 72/104 (69%), Positives = 86/104 (83%), Gaps = 0/104 (0%)
 Frame = +1

Query  142  TDGLLVNGNFEAPVKKTDLNGTIVTRHDAVPGWTVTGFVEYIQAGQKQGDMQLVVPEGFA  321
            TDG+L NG+FE   K +D+ GT V   +A+P W ++GFVEYI++GQKQGDM LVVP G  
Sbjct  25   TDGMLPNGDFELGPKPSDMKGTRVINKNAIPSWELSGFVEYIKSGQKQGDMLLVVPAGKF  84

Query  322  AVRLGNEASIKQTLNVSKGMYYSITFCAARTCAQEERLNITVAP  453
            AVRLGNEASIKQ LNV+KGMYYS+TF AARTCAQ+ERLNI+VAP
Sbjct  85   AVRLGNEASIKQRLNVTKGMYYSLTFSAARTCAQDERLNISVAP  128


 Score = 62.8 bits (151),  Expect(2) = 1e-47, Method: Compositional matrix adjust.
 Identities = 27/38 (71%), Positives = 32/38 (84%), Gaps = 0/38 (0%)
 Frame = +2

Query  455  DSDVLPIQTLYSINGWDCYPWAFQAENPQAEIIIHNPG  568
            DS V+PIQT+YS +GWD Y WAFQAE+  AEI+IHNPG
Sbjct  129  DSGVIPIQTVYSSSGWDLYAWAFQAESNVAEIVIHNPG  166



>ref|XP_010419712.1| PREDICTED: uncharacterized protein LOC104705408 [Camelina sativa]
Length=367

 Score =   154 bits (388),  Expect(2) = 1e-47, Method: Compositional matrix adjust.
 Identities = 72/104 (69%), Positives = 86/104 (83%), Gaps = 0/104 (0%)
 Frame = +1

Query  142  TDGLLVNGNFEAPVKKTDLNGTIVTRHDAVPGWTVTGFVEYIQAGQKQGDMQLVVPEGFA  321
            TDG+L NG+FE   K +D+ GT V   +A+P W ++GFVEYI++GQKQGDM LVVP G  
Sbjct  25   TDGMLPNGDFELGPKPSDMKGTRVINKNAIPSWELSGFVEYIKSGQKQGDMLLVVPAGKF  84

Query  322  AVRLGNEASIKQTLNVSKGMYYSITFCAARTCAQEERLNITVAP  453
            AVRLGNEASIKQ LNV+KGMYYS+TF AARTCAQ+ERLNI+VAP
Sbjct  85   AVRLGNEASIKQRLNVTKGMYYSLTFSAARTCAQDERLNISVAP  128


 Score = 62.8 bits (151),  Expect(2) = 1e-47, Method: Compositional matrix adjust.
 Identities = 27/38 (71%), Positives = 32/38 (84%), Gaps = 0/38 (0%)
 Frame = +2

Query  455  DSDVLPIQTLYSINGWDCYPWAFQAENPQAEIIIHNPG  568
            DS V+PIQT+YS +GWD Y WAFQAE+  AEI+IHNPG
Sbjct  129  DSGVIPIQTVYSSSGWDLYAWAFQAESNVAEIVIHNPG  166



>gb|EPS73289.1| hypothetical protein M569_01466, partial [Genlisea aurea]
Length=348

 Score =   158 bits (400),  Expect(2) = 1e-47, Method: Compositional matrix adjust.
 Identities = 71/102 (70%), Positives = 86/102 (84%), Gaps = 0/102 (0%)
 Frame = +1

Query  148  GLLVNGNFEAPVKKTDLNGTIVTRHDAVPGWTVTGFVEYIQAGQKQGDMQLVVPEGFAAV  327
            G L NGNFE P    DLNG+++    A+P W ++GFVEYI+AGQKQGDM LVVPEG+AA+
Sbjct  5    GPLDNGNFEQPPDPKDLNGSVIKTRYAIPKWEISGFVEYIKAGQKQGDMLLVVPEGYAAI  64

Query  328  RLGNEASIKQTLNVSKGMYYSITFCAARTCAQEERLNITVAP  453
            RLGNEASIKQ+LNV+ G+YYS+TF AARTCAQEE+LNI+VAP
Sbjct  65   RLGNEASIKQSLNVTPGLYYSLTFSAARTCAQEEKLNISVAP  106


 Score = 58.2 bits (139),  Expect(2) = 1e-47, Method: Compositional matrix adjust.
 Identities = 25/39 (64%), Positives = 31/39 (79%), Gaps = 0/39 (0%)
 Frame = +2

Query  455  DSDVLPIQTLYSINGWDCYPWAFQAENPQAEIIIHNPGV  571
            D+ VLP+QTLYS NGWD Y WAF+A    A+++IHNPGV
Sbjct  107  DNGVLPVQTLYSSNGWDSYAWAFRAVYGVADVLIHNPGV  145



>ref|XP_009125805.1| PREDICTED: uncharacterized protein LOC103850771 [Brassica rapa]
Length=366

 Score =   153 bits (387),  Expect(2) = 2e-47, Method: Compositional matrix adjust.
 Identities = 72/103 (70%), Positives = 85/103 (83%), Gaps = 0/103 (0%)
 Frame = +1

Query  145  DGLLVNGNFEAPVKKTDLNGTIVTRHDAVPGWTVTGFVEYIQAGQKQGDMQLVVPEGFAA  324
            DG+L NG+FE   K +D+ GT V   +A+P W +TGFVEYI++GQKQGDM LVVP G  A
Sbjct  25   DGMLPNGDFELGPKPSDMKGTQVINKNAIPSWELTGFVEYIKSGQKQGDMLLVVPAGKFA  84

Query  325  VRLGNEASIKQTLNVSKGMYYSITFCAARTCAQEERLNITVAP  453
            VRLGNEASIKQ LNV+KGMYYS+TF AARTCAQ+ERLNI+VAP
Sbjct  85   VRLGNEASIKQRLNVTKGMYYSLTFSAARTCAQDERLNISVAP  127


 Score = 62.8 bits (151),  Expect(2) = 2e-47, Method: Compositional matrix adjust.
 Identities = 27/38 (71%), Positives = 32/38 (84%), Gaps = 0/38 (0%)
 Frame = +2

Query  455  DSDVLPIQTLYSINGWDCYPWAFQAENPQAEIIIHNPG  568
            DS V+PIQT+YS +GWD Y WAFQAE+  AEI+IHNPG
Sbjct  128  DSGVIPIQTVYSSSGWDLYAWAFQAESNVAEIVIHNPG  165



>ref|XP_007223355.1| hypothetical protein PRUPE_ppa007452mg [Prunus persica]
 gb|EMJ24554.1| hypothetical protein PRUPE_ppa007452mg [Prunus persica]
Length=367

 Score =   152 bits (384),  Expect(2) = 2e-47, Method: Compositional matrix adjust.
 Identities = 72/103 (70%), Positives = 83/103 (81%), Gaps = 0/103 (0%)
 Frame = +1

Query  145  DGLLVNGNFEAPVKKTDLNGTIVTRHDAVPGWTVTGFVEYIQAGQKQGDMQLVVPEGFAA  324
            DG L NGNFE   K +D+ GT V    A+P W ++GFVEYI++GQKQGDM LVVPEG  A
Sbjct  24   DGYLENGNFEEAPKPSDIRGTEVIGRYAIPKWEISGFVEYIKSGQKQGDMLLVVPEGAYA  83

Query  325  VRLGNEASIKQTLNVSKGMYYSITFCAARTCAQEERLNITVAP  453
            VRLGNEASIKQ + V+KG+YYSITF AARTCAQEERLNI+VAP
Sbjct  84   VRLGNEASIKQRIKVTKGLYYSITFSAARTCAQEERLNISVAP  126


 Score = 63.5 bits (153),  Expect(2) = 2e-47, Method: Compositional matrix adjust.
 Identities = 27/39 (69%), Positives = 32/39 (82%), Gaps = 0/39 (0%)
 Frame = +2

Query  455  DSDVLPIQTLYSINGWDCYPWAFQAENPQAEIIIHNPGV  571
            DS VLPIQT+YS NGWD Y WAFQA+  Q E+++HNPGV
Sbjct  127  DSGVLPIQTVYSSNGWDSYAWAFQADYEQIELLLHNPGV  165



>ref|XP_006399646.1| hypothetical protein EUTSA_v10013887mg [Eutrema salsugineum]
 gb|ESQ41099.1| hypothetical protein EUTSA_v10013887mg [Eutrema salsugineum]
Length=366

 Score =   150 bits (380),  Expect(2) = 2e-47, Method: Compositional matrix adjust.
 Identities = 71/103 (69%), Positives = 84/103 (82%), Gaps = 0/103 (0%)
 Frame = +1

Query  145  DGLLVNGNFEAPVKKTDLNGTIVTRHDAVPGWTVTGFVEYIQAGQKQGDMQLVVPEGFAA  324
            DG+L NG+FE   K +D+ GT V    A+P W ++GFVEYI++GQKQGDM LVVP G  A
Sbjct  25   DGMLPNGDFERGPKPSDMKGTQVINKKALPSWELSGFVEYIKSGQKQGDMLLVVPAGKFA  84

Query  325  VRLGNEASIKQTLNVSKGMYYSITFCAARTCAQEERLNITVAP  453
            VRLGNEASIKQ LNV+KGMYYS+TF AARTCAQ+ERLNI+VAP
Sbjct  85   VRLGNEASIKQRLNVTKGMYYSLTFSAARTCAQDERLNISVAP  127


 Score = 65.1 bits (157),  Expect(2) = 2e-47, Method: Compositional matrix adjust.
 Identities = 28/38 (74%), Positives = 32/38 (84%), Gaps = 0/38 (0%)
 Frame = +2

Query  455  DSDVLPIQTLYSINGWDCYPWAFQAENPQAEIIIHNPG  568
            DS V+PIQT+YS NGWD Y WAFQAE+  AEI+IHNPG
Sbjct  128  DSGVIPIQTVYSSNGWDLYAWAFQAESDVAEIVIHNPG  165



>gb|AAM63507.1| unknown [Arabidopsis thaliana]
Length=366

 Score =   152 bits (383),  Expect(2) = 4e-47, Method: Compositional matrix adjust.
 Identities = 70/104 (67%), Positives = 85/104 (82%), Gaps = 0/104 (0%)
 Frame = +1

Query  142  TDGLLVNGNFEAPVKKTDLNGTIVTRHDAVPGWTVTGFVEYIQAGQKQGDMQLVVPEGFA  321
            +DG+L NG+FE   K +D+ GT V    A+P W ++GFVEYI++GQKQGDM LVVP G  
Sbjct  24   SDGMLPNGDFELGPKPSDMKGTQVINKKAIPSWELSGFVEYIKSGQKQGDMLLVVPAGKF  83

Query  322  AVRLGNEASIKQTLNVSKGMYYSITFCAARTCAQEERLNITVAP  453
            A+RLGNEASIKQ LNV+KGMYYS+TF AARTCAQ+ERLNI+VAP
Sbjct  84   AIRLGNEASIKQRLNVTKGMYYSLTFSAARTCAQDERLNISVAP  127


 Score = 63.2 bits (152),  Expect(2) = 4e-47, Method: Compositional matrix adjust.
 Identities = 27/38 (71%), Positives = 32/38 (84%), Gaps = 0/38 (0%)
 Frame = +2

Query  455  DSDVLPIQTLYSINGWDCYPWAFQAENPQAEIIIHNPG  568
            DS V+PIQT+YS +GWD Y WAFQAE+  AEI+IHNPG
Sbjct  128  DSGVIPIQTVYSSSGWDLYAWAFQAESNVAEIVIHNPG  165



>ref|NP_196703.1| uncharacterized protein [Arabidopsis thaliana]
 emb|CAB87702.1| putative protein [Arabidopsis thaliana]
 gb|AAK76721.1| unknown protein [Arabidopsis thaliana]
 gb|AAM20000.1| unknown protein [Arabidopsis thaliana]
 gb|AED91677.1| uncharacterized protein AT5G11420 [Arabidopsis thaliana]
Length=366

 Score =   152 bits (383),  Expect(2) = 5e-47, Method: Compositional matrix adjust.
 Identities = 70/104 (67%), Positives = 85/104 (82%), Gaps = 0/104 (0%)
 Frame = +1

Query  142  TDGLLVNGNFEAPVKKTDLNGTIVTRHDAVPGWTVTGFVEYIQAGQKQGDMQLVVPEGFA  321
            +DG+L NG+FE   K +D+ GT V    A+P W ++GFVEYI++GQKQGDM LVVP G  
Sbjct  24   SDGMLPNGDFELGPKPSDMKGTQVINKKAIPSWELSGFVEYIKSGQKQGDMLLVVPAGKF  83

Query  322  AVRLGNEASIKQTLNVSKGMYYSITFCAARTCAQEERLNITVAP  453
            A+RLGNEASIKQ LNV+KGMYYS+TF AARTCAQ+ERLNI+VAP
Sbjct  84   AIRLGNEASIKQRLNVTKGMYYSLTFSAARTCAQDERLNISVAP  127


 Score = 62.8 bits (151),  Expect(2) = 5e-47, Method: Compositional matrix adjust.
 Identities = 27/38 (71%), Positives = 32/38 (84%), Gaps = 0/38 (0%)
 Frame = +2

Query  455  DSDVLPIQTLYSINGWDCYPWAFQAENPQAEIIIHNPG  568
            DS V+PIQT+YS +GWD Y WAFQAE+  AEI+IHNPG
Sbjct  128  DSGVIPIQTVYSSSGWDLYAWAFQAESNVAEIVIHNPG  165



>gb|AAN31807.1| unknown protein [Arabidopsis thaliana]
Length=366

 Score =   152 bits (383),  Expect(2) = 5e-47, Method: Compositional matrix adjust.
 Identities = 70/104 (67%), Positives = 85/104 (82%), Gaps = 0/104 (0%)
 Frame = +1

Query  142  TDGLLVNGNFEAPVKKTDLNGTIVTRHDAVPGWTVTGFVEYIQAGQKQGDMQLVVPEGFA  321
            +DG+L NG+FE   K +D+ GT V    A+P W ++GFVEYI++GQKQGDM LVVP G  
Sbjct  24   SDGMLPNGDFELGPKPSDMKGTQVINKKAIPSWELSGFVEYIKSGQKQGDMLLVVPAGKF  83

Query  322  AVRLGNEASIKQTLNVSKGMYYSITFCAARTCAQEERLNITVAP  453
            A+RLGNEASIKQ LNV+KGMYYS+TF AARTCAQ+ERLNI+VAP
Sbjct  84   AIRLGNEASIKQRLNVTKGMYYSLTFSAARTCAQDERLNISVAP  127


 Score = 62.8 bits (151),  Expect(2) = 5e-47, Method: Compositional matrix adjust.
 Identities = 27/38 (71%), Positives = 32/38 (84%), Gaps = 0/38 (0%)
 Frame = +2

Query  455  DSDVLPIQTLYSINGWDCYPWAFQAENPQAEIIIHNPG  568
            DS V+PIQT+YS +GWD Y WAFQAE+  AEI+IHNPG
Sbjct  128  DSGVIPIQTVYSSSGWDLYAWAFQAESNVAEIVIHNPG  165



>ref|XP_010453190.1| PREDICTED: uncharacterized protein LOC104735158 [Camelina sativa]
Length=367

 Score =   152 bits (383),  Expect(2) = 5e-47, Method: Compositional matrix adjust.
 Identities = 71/104 (68%), Positives = 85/104 (82%), Gaps = 0/104 (0%)
 Frame = +1

Query  142  TDGLLVNGNFEAPVKKTDLNGTIVTRHDAVPGWTVTGFVEYIQAGQKQGDMQLVVPEGFA  321
            TD +L NG+FE   K +D+ GT V   +A+P W ++GFVEYI++GQKQGDM LVVP G  
Sbjct  25   TDAMLPNGDFELGPKPSDMKGTRVINKNAIPSWELSGFVEYIKSGQKQGDMLLVVPAGKF  84

Query  322  AVRLGNEASIKQTLNVSKGMYYSITFCAARTCAQEERLNITVAP  453
            AVRLGNEASIKQ LNV+KGMYYS+TF AARTCAQ+ERLNI+VAP
Sbjct  85   AVRLGNEASIKQRLNVTKGMYYSLTFSAARTCAQDERLNISVAP  128


 Score = 62.8 bits (151),  Expect(2) = 5e-47, Method: Compositional matrix adjust.
 Identities = 27/38 (71%), Positives = 32/38 (84%), Gaps = 0/38 (0%)
 Frame = +2

Query  455  DSDVLPIQTLYSINGWDCYPWAFQAENPQAEIIIHNPG  568
            DS V+PIQT+YS +GWD Y WAFQAE+  AEI+IHNPG
Sbjct  129  DSGVIPIQTVYSSSGWDLYAWAFQAESNVAEIVIHNPG  166



>ref|XP_002871473.1| hypothetical protein ARALYDRAFT_487977 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH47732.1| hypothetical protein ARALYDRAFT_487977 [Arabidopsis lyrata subsp. 
lyrata]
Length=366

 Score =   151 bits (381),  Expect(2) = 8e-47, Method: Compositional matrix adjust.
 Identities = 69/104 (66%), Positives = 86/104 (83%), Gaps = 0/104 (0%)
 Frame = +1

Query  142  TDGLLVNGNFEAPVKKTDLNGTIVTRHDAVPGWTVTGFVEYIQAGQKQGDMQLVVPEGFA  321
            +DG++ NG+FE   K +D+ GT V   +A+P W ++GFVEYI++GQKQGDM LVVP G  
Sbjct  24   SDGMVPNGDFELGPKPSDMKGTQVINKNAIPSWELSGFVEYIKSGQKQGDMLLVVPAGKF  83

Query  322  AVRLGNEASIKQTLNVSKGMYYSITFCAARTCAQEERLNITVAP  453
            A+RLGNEASIKQ LNV+KGMYYS+TF AARTCAQ+ERLNI+VAP
Sbjct  84   AIRLGNEASIKQRLNVTKGMYYSLTFSAARTCAQDERLNISVAP  127


 Score = 62.8 bits (151),  Expect(2) = 8e-47, Method: Compositional matrix adjust.
 Identities = 27/38 (71%), Positives = 32/38 (84%), Gaps = 0/38 (0%)
 Frame = +2

Query  455  DSDVLPIQTLYSINGWDCYPWAFQAENPQAEIIIHNPG  568
            DS V+PIQT+YS +GWD Y WAFQAE+  AEI+IHNPG
Sbjct  128  DSGVIPIQTVYSSSGWDLYAWAFQAESNVAEIVIHNPG  165



>ref|XP_008219896.1| PREDICTED: uncharacterized protein LOC103320060 [Prunus mume]
Length=367

 Score =   150 bits (380),  Expect(2) = 1e-46, Method: Compositional matrix adjust.
 Identities = 71/103 (69%), Positives = 82/103 (80%), Gaps = 0/103 (0%)
 Frame = +1

Query  145  DGLLVNGNFEAPVKKTDLNGTIVTRHDAVPGWTVTGFVEYIQAGQKQGDMQLVVPEGFAA  324
            DG L NGNFE   K +D+ GT V    A+P W ++GFVEYI++G KQGDM LVVPEG  A
Sbjct  24   DGYLENGNFEEAPKPSDIRGTEVIGRYAIPKWEISGFVEYIKSGHKQGDMLLVVPEGAYA  83

Query  325  VRLGNEASIKQTLNVSKGMYYSITFCAARTCAQEERLNITVAP  453
            VRLGNEASIKQ + V+KG+YYSITF AARTCAQEERLNI+VAP
Sbjct  84   VRLGNEASIKQRIKVTKGLYYSITFSAARTCAQEERLNISVAP  126


 Score = 62.8 bits (151),  Expect(2) = 1e-46, Method: Compositional matrix adjust.
 Identities = 26/39 (67%), Positives = 32/39 (82%), Gaps = 0/39 (0%)
 Frame = +2

Query  455  DSDVLPIQTLYSINGWDCYPWAFQAENPQAEIIIHNPGV  571
            DS VLPIQT+YS NGWD Y WAFQ++  Q E+++HNPGV
Sbjct  127  DSGVLPIQTVYSSNGWDSYAWAFQSDYEQIELVLHNPGV  165



>ref|XP_002284962.1| PREDICTED: uncharacterized protein LOC100252479 [Vitis vinifera]
Length=368

 Score =   154 bits (389),  Expect(2) = 1e-46, Method: Compositional matrix adjust.
 Identities = 75/104 (72%), Positives = 83/104 (80%), Gaps = 0/104 (0%)
 Frame = +1

Query  142  TDGLLVNGNFEAPVKKTDLNGTIVTRHDAVPGWTVTGFVEYIQAGQKQGDMQLVVPEGFA  321
            TDGLL NGNFE   K +D+ GT V    A+P W  +GF+EYI+AGQKQGDM LVVPEG  
Sbjct  22   TDGLLPNGNFELGPKPSDMKGTEVIGPHAIPEWETSGFIEYIKAGQKQGDMLLVVPEGAF  81

Query  322  AVRLGNEASIKQTLNVSKGMYYSITFCAARTCAQEERLNITVAP  453
            AVRLGNEASIKQ + V KGMYYSITF AARTCAQEERLNI+VAP
Sbjct  82   AVRLGNEASIKQRVKVIKGMYYSITFSAARTCAQEERLNISVAP  125


 Score = 59.3 bits (142),  Expect(2) = 1e-46, Method: Compositional matrix adjust.
 Identities = 26/36 (72%), Positives = 29/36 (81%), Gaps = 0/36 (0%)
 Frame = +2

Query  464  VLPIQTLYSINGWDCYPWAFQAENPQAEIIIHNPGV  571
            VLP+QTLYS NGWD Y WAFQA+    EI+IHNPGV
Sbjct  129  VLPMQTLYSSNGWDSYAWAFQADYDVIEIVIHNPGV  164



>ref|XP_009121952.1| PREDICTED: uncharacterized protein LOC103846721 [Brassica rapa]
Length=366

 Score =   150 bits (378),  Expect(2) = 2e-46, Method: Compositional matrix adjust.
 Identities = 70/103 (68%), Positives = 84/103 (82%), Gaps = 0/103 (0%)
 Frame = +1

Query  145  DGLLVNGNFEAPVKKTDLNGTIVTRHDAVPGWTVTGFVEYIQAGQKQGDMQLVVPEGFAA  324
            DG+L NG FE   K +DL GT V   +A+P W ++GF+EYI++GQKQGDM LVVP G  A
Sbjct  25   DGMLPNGGFERGPKPSDLKGTRVINKNAIPNWELSGFIEYIKSGQKQGDMLLVVPAGKFA  84

Query  325  VRLGNEASIKQTLNVSKGMYYSITFCAARTCAQEERLNITVAP  453
            VRLGNEASIKQ +NV+KGMYYS+TF AARTCAQ+ERLNI+VAP
Sbjct  85   VRLGNEASIKQRVNVTKGMYYSLTFSAARTCAQDERLNISVAP  127


 Score = 62.8 bits (151),  Expect(2) = 2e-46, Method: Compositional matrix adjust.
 Identities = 27/38 (71%), Positives = 31/38 (82%), Gaps = 0/38 (0%)
 Frame = +2

Query  455  DSDVLPIQTLYSINGWDCYPWAFQAENPQAEIIIHNPG  568
            DS V+PIQTLYS NGWD Y WA QA++  AEI+IHNPG
Sbjct  128  DSGVIPIQTLYSSNGWDLYAWALQAQSDVAEIVIHNPG  165



>gb|KHG19965.1| putative e3 ubiquitin-protein ligase hul4 [Gossypium arboreum]
Length=377

 Score =   154 bits (389),  Expect(2) = 2e-46, Method: Compositional matrix adjust.
 Identities = 74/103 (72%), Positives = 82/103 (80%), Gaps = 0/103 (0%)
 Frame = +1

Query  145  DGLLVNGNFEAPVKKTDLNGTIVTRHDAVPGWTVTGFVEYIQAGQKQGDMQLVVPEGFAA  324
            DGLL NGNFE     T++ GT+V    A+PGW   GFVEYI++GQKQGDM LVVPEG  A
Sbjct  33   DGLLENGNFENAPNATNMKGTVVVGRYAIPGWVNEGFVEYIKSGQKQGDMLLVVPEGAYA  92

Query  325  VRLGNEASIKQTLNVSKGMYYSITFCAARTCAQEERLNITVAP  453
            VRLGNEASIKQ + V KGMYYSITF AARTCAQEERLN+TVAP
Sbjct  93   VRLGNEASIKQKIKVIKGMYYSITFSAARTCAQEERLNVTVAP  135


 Score = 58.5 bits (140),  Expect(2) = 2e-46, Method: Compositional matrix adjust.
 Identities = 27/39 (69%), Positives = 31/39 (79%), Gaps = 0/39 (0%)
 Frame = +2

Query  455  DSDVLPIQTLYSINGWDCYPWAFQAENPQAEIIIHNPGV  571
            DS VLPIQT+YS +GWD Y WAF+A    AE+IIHNPGV
Sbjct  136  DSGVLPIQTVYSSSGWDNYAWAFKAIYEVAELIIHNPGV  174



>ref|XP_008378299.1| PREDICTED: uncharacterized protein LOC103441403, partial [Malus 
domestica]
Length=345

 Score =   150 bits (380),  Expect(2) = 3e-46, Method: Compositional matrix adjust.
 Identities = 71/102 (70%), Positives = 82/102 (80%), Gaps = 0/102 (0%)
 Frame = +1

Query  148  GLLVNGNFEAPVKKTDLNGTIVTRHDAVPGWTVTGFVEYIQAGQKQGDMQLVVPEGFAAV  327
            G L NGNFE P K +DL G+ V    A+P W ++GFVEYI++GQKQGDM LVVPEG  AV
Sbjct  5    GYLENGNFELPPKPSDLKGSEVIGRYAIPKWEISGFVEYIKSGQKQGDMLLVVPEGAYAV  64

Query  328  RLGNEASIKQTLNVSKGMYYSITFCAARTCAQEERLNITVAP  453
            RLGNEA IKQ++ V KG+YYSITF AARTCAQEERLNI+VAP
Sbjct  65   RLGNEALIKQSIKVIKGLYYSITFSAARTCAQEERLNISVAP  106


 Score = 61.6 bits (148),  Expect(2) = 3e-46, Method: Compositional matrix adjust.
 Identities = 26/39 (67%), Positives = 31/39 (79%), Gaps = 0/39 (0%)
 Frame = +2

Query  455  DSDVLPIQTLYSINGWDCYPWAFQAENPQAEIIIHNPGV  571
            DS VLPIQT+YS NGWD Y WAFQA+    E+++HNPGV
Sbjct  107  DSGVLPIQTVYSSNGWDSYAWAFQADYETIELVLHNPGV  145



>ref|XP_008445161.1| PREDICTED: uncharacterized protein LOC103488281 [Cucumis melo]
Length=422

 Score =   154 bits (389),  Expect(2) = 3e-46, Method: Compositional matrix adjust.
 Identities = 72/104 (69%), Positives = 84/104 (81%), Gaps = 0/104 (0%)
 Frame = +1

Query  142  TDGLLVNGNFEAPVKKTDLNGTIVTRHDAVPGWTVTGFVEYIQAGQKQGDMQLVVPEGFA  321
             DG L NG+FE   K +D+NGT+V    A+P W ++GFVEYI++GQKQGDM LVVPEG  
Sbjct  78   VDGYLPNGDFERGPKASDMNGTVVKGPYAIPEWEISGFVEYIKSGQKQGDMLLVVPEGAF  137

Query  322  AVRLGNEASIKQTLNVSKGMYYSITFCAARTCAQEERLNITVAP  453
            AVRLGNEASIKQ + V KG+YYSITF AARTCAQEERLNI+VAP
Sbjct  138  AVRLGNEASIKQKIKVVKGLYYSITFSAARTCAQEERLNISVAP  181


 Score = 58.2 bits (139),  Expect(2) = 3e-46, Method: Compositional matrix adjust.
 Identities = 24/35 (69%), Positives = 29/35 (83%), Gaps = 0/35 (0%)
 Frame = +2

Query  464  VLPIQTLYSINGWDCYPWAFQAENPQAEIIIHNPG  568
            VLP+QTLY+ NGWD Y WAFQAE+ +  I+IHNPG
Sbjct  185  VLPMQTLYNSNGWDLYAWAFQAESDEVVILIHNPG  219



>gb|AAM61720.1| unknown [Arabidopsis thaliana]
Length=369

 Score =   147 bits (371),  Expect(2) = 3e-46, Method: Compositional matrix adjust.
 Identities = 70/103 (68%), Positives = 81/103 (79%), Gaps = 0/103 (0%)
 Frame = +1

Query  145  DGLLVNGNFEAPVKKTDLNGTIVTRHDAVPGWTVTGFVEYIQAGQKQGDMQLVVPEGFAA  324
            DG+L NG+FE   K +D+ GT +    A+P W VTGFVEYI++G KQGDM LVVP G  A
Sbjct  28   DGMLPNGDFELGPKPSDMKGTEILNKLAIPNWEVTGFVEYIKSGHKQGDMLLVVPAGKFA  87

Query  325  VRLGNEASIKQTLNVSKGMYYSITFCAARTCAQEERLNITVAP  453
            VRLGNEASIKQ L V KGMYYS+TF AARTCAQ+ERLNI+VAP
Sbjct  88   VRLGNEASIKQRLKVVKGMYYSLTFSAARTCAQDERLNISVAP  130


 Score = 64.3 bits (155),  Expect(2) = 3e-46, Method: Compositional matrix adjust.
 Identities = 27/39 (69%), Positives = 33/39 (85%), Gaps = 0/39 (0%)
 Frame = +2

Query  455  DSDVLPIQTLYSINGWDCYPWAFQAENPQAEIIIHNPGV  571
            DS V+PIQT+YS +GWD Y WAFQAE+  AE++IHNPGV
Sbjct  131  DSGVIPIQTVYSSSGWDLYAWAFQAESDVAEVVIHNPGV  169



>ref|NP_197928.1| UF642 l-GalL-responsive protein 1 [Arabidopsis thaliana]
 gb|AAK62407.1|AF386962_1 Unknown protein [Arabidopsis thaliana]
 gb|AAP37805.1| At5g25460 [Arabidopsis thaliana]
 gb|AED93446.1| uncharacterized protein AT5G25460 [Arabidopsis thaliana]
Length=369

 Score =   147 bits (371),  Expect(2) = 4e-46, Method: Compositional matrix adjust.
 Identities = 70/103 (68%), Positives = 81/103 (79%), Gaps = 0/103 (0%)
 Frame = +1

Query  145  DGLLVNGNFEAPVKKTDLNGTIVTRHDAVPGWTVTGFVEYIQAGQKQGDMQLVVPEGFAA  324
            DG+L NG+FE   K +D+ GT +    A+P W VTGFVEYI++G KQGDM LVVP G  A
Sbjct  28   DGMLPNGDFELGPKPSDMKGTEILNKLAIPNWEVTGFVEYIKSGHKQGDMLLVVPAGKFA  87

Query  325  VRLGNEASIKQTLNVSKGMYYSITFCAARTCAQEERLNITVAP  453
            VRLGNEASIKQ L V KGMYYS+TF AARTCAQ+ERLNI+VAP
Sbjct  88   VRLGNEASIKQRLKVVKGMYYSLTFSAARTCAQDERLNISVAP  130


 Score = 64.3 bits (155),  Expect(2) = 4e-46, Method: Compositional matrix adjust.
 Identities = 27/39 (69%), Positives = 33/39 (85%), Gaps = 0/39 (0%)
 Frame = +2

Query  455  DSDVLPIQTLYSINGWDCYPWAFQAENPQAEIIIHNPGV  571
            DS V+PIQT+YS +GWD Y WAFQAE+  AE++IHNPGV
Sbjct  131  DSGVIPIQTVYSSSGWDLYAWAFQAESDVAEVVIHNPGV  169



>gb|AAL06839.1| AT5g25460/F18G18_200 [Arabidopsis thaliana]
Length=369

 Score =   147 bits (371),  Expect(2) = 4e-46, Method: Compositional matrix adjust.
 Identities = 70/103 (68%), Positives = 81/103 (79%), Gaps = 0/103 (0%)
 Frame = +1

Query  145  DGLLVNGNFEAPVKKTDLNGTIVTRHDAVPGWTVTGFVEYIQAGQKQGDMQLVVPEGFAA  324
            DG+L NG+FE   K +D+ GT +    A+P W VTGFVEYI++G KQGDM LVVP G  A
Sbjct  28   DGMLPNGDFELGPKPSDMKGTEILNKLAIPNWEVTGFVEYIKSGHKQGDMLLVVPAGKFA  87

Query  325  VRLGNEASIKQTLNVSKGMYYSITFCAARTCAQEERLNITVAP  453
            VRLGNEASIKQ L V KGMYYS+TF AARTCAQ+ERLNI+VAP
Sbjct  88   VRLGNEASIKQRLKVVKGMYYSLTFSAARTCAQDERLNISVAP  130


 Score = 64.3 bits (155),  Expect(2) = 4e-46, Method: Compositional matrix adjust.
 Identities = 27/39 (69%), Positives = 33/39 (85%), Gaps = 0/39 (0%)
 Frame = +2

Query  455  DSDVLPIQTLYSINGWDCYPWAFQAENPQAEIIIHNPGV  571
            DS V+PIQT+YS +GWD Y WAFQAE+  AE++IHNPGV
Sbjct  131  DSGVIPIQTVYSSSGWDLYAWAFQAESDVAEVVIHNPGV  169



>emb|CBI20999.3| unnamed protein product [Vitis vinifera]
Length=239

 Score =   153 bits (387),  Expect(2) = 4e-46, Method: Compositional matrix adjust.
 Identities = 75/104 (72%), Positives = 83/104 (80%), Gaps = 0/104 (0%)
 Frame = +1

Query  142  TDGLLVNGNFEAPVKKTDLNGTIVTRHDAVPGWTVTGFVEYIQAGQKQGDMQLVVPEGFA  321
            TDGLL NGNFE   K +D+ GT V    A+P W  +GF+EYI+AGQKQGDM LVVPEG  
Sbjct  22   TDGLLPNGNFELGPKPSDMKGTEVIGPHAIPEWETSGFIEYIKAGQKQGDMLLVVPEGAF  81

Query  322  AVRLGNEASIKQTLNVSKGMYYSITFCAARTCAQEERLNITVAP  453
            AVRLGNEASIKQ + V KGMYYSITF AARTCAQEERLNI+VAP
Sbjct  82   AVRLGNEASIKQRVKVIKGMYYSITFSAARTCAQEERLNISVAP  125


 Score = 58.2 bits (139),  Expect(2) = 4e-46, Method: Compositional matrix adjust.
 Identities = 26/36 (72%), Positives = 29/36 (81%), Gaps = 0/36 (0%)
 Frame = +2

Query  464  VLPIQTLYSINGWDCYPWAFQAENPQAEIIIHNPGV  571
            VLP+QTLYS NGWD Y WAFQA+    EI+IHNPGV
Sbjct  129  VLPMQTLYSSNGWDSYAWAFQADYDVIEIVIHNPGV  164



>gb|KJB07802.1| hypothetical protein B456_001G045200 [Gossypium raimondii]
Length=377

 Score =   153 bits (386),  Expect(2) = 4e-46, Method: Compositional matrix adjust.
 Identities = 73/103 (71%), Positives = 82/103 (80%), Gaps = 0/103 (0%)
 Frame = +1

Query  145  DGLLVNGNFEAPVKKTDLNGTIVTRHDAVPGWTVTGFVEYIQAGQKQGDMQLVVPEGFAA  324
            DGLL NGNFE     T++ GT+V    ++PGW   GFVEYI++GQKQGDM LVVPEG  A
Sbjct  33   DGLLENGNFENAPNATNMKGTVVVGRYSIPGWVNEGFVEYIKSGQKQGDMLLVVPEGAYA  92

Query  325  VRLGNEASIKQTLNVSKGMYYSITFCAARTCAQEERLNITVAP  453
            VRLGNEASIKQ + V KGMYYSITF AARTCAQEERLN+TVAP
Sbjct  93   VRLGNEASIKQKIKVIKGMYYSITFSAARTCAQEERLNVTVAP  135


 Score = 58.5 bits (140),  Expect(2) = 4e-46, Method: Compositional matrix adjust.
 Identities = 27/39 (69%), Positives = 31/39 (79%), Gaps = 0/39 (0%)
 Frame = +2

Query  455  DSDVLPIQTLYSINGWDCYPWAFQAENPQAEIIIHNPGV  571
            DS VLPIQT+YS +GWD Y WAF+A    AE+IIHNPGV
Sbjct  136  DSGVLPIQTVYSSSGWDNYAWAFKAIYEVAELIIHNPGV  174



>ref|XP_002872166.1| hypothetical protein ARALYDRAFT_910605 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH48425.1| hypothetical protein ARALYDRAFT_910605 [Arabidopsis lyrata subsp. 
lyrata]
Length=369

 Score =   147 bits (371),  Expect(2) = 4e-46, Method: Compositional matrix adjust.
 Identities = 70/103 (68%), Positives = 81/103 (79%), Gaps = 0/103 (0%)
 Frame = +1

Query  145  DGLLVNGNFEAPVKKTDLNGTIVTRHDAVPGWTVTGFVEYIQAGQKQGDMQLVVPEGFAA  324
            DG+L NG+FE   K +D+ GT +    A+P W VTGFVEYI++G KQGDM LVVP G  A
Sbjct  28   DGMLPNGDFELGPKPSDMKGTEILNKLAIPNWEVTGFVEYIKSGHKQGDMLLVVPAGKFA  87

Query  325  VRLGNEASIKQTLNVSKGMYYSITFCAARTCAQEERLNITVAP  453
            VRLGNEASIKQ L V KGMYYS+TF AARTCAQ+ERLNI+VAP
Sbjct  88   VRLGNEASIKQRLKVVKGMYYSLTFSAARTCAQDERLNISVAP  130


 Score = 64.3 bits (155),  Expect(2) = 4e-46, Method: Compositional matrix adjust.
 Identities = 26/39 (67%), Positives = 33/39 (85%), Gaps = 0/39 (0%)
 Frame = +2

Query  455  DSDVLPIQTLYSINGWDCYPWAFQAENPQAEIIIHNPGV  571
            DS V+P+QT+YS +GWD Y WAFQAE+  AE++IHNPGV
Sbjct  131  DSGVIPVQTVYSSSGWDLYAWAFQAESEVAEVVIHNPGV  169



>ref|XP_009389493.1| PREDICTED: uncharacterized protein LOC103976040 [Musa acuminata 
subsp. malaccensis]
Length=369

 Score =   157 bits (397),  Expect(2) = 5e-46, Method: Compositional matrix adjust.
 Identities = 75/104 (72%), Positives = 84/104 (81%), Gaps = 0/104 (0%)
 Frame = +1

Query  142  TDGLLVNGNFEAPVKKTDLNGTIVTRHDAVPGWTVTGFVEYIQAGQKQGDMQLVVPEGFA  321
            TDGLL NGNFEA  K +DLNGT V    A+P W ++GFVEYI++G KQGDM LVVPEG  
Sbjct  25   TDGLLPNGNFEAKPKASDLNGTQVMSRYAIPQWEISGFVEYIESGHKQGDMLLVVPEGAY  84

Query  322  AVRLGNEASIKQTLNVSKGMYYSITFCAARTCAQEERLNITVAP  453
            AVRLGNEASIKQ L V KGMYYSITF AARTCAQ+ERLN++V P
Sbjct  85   AVRLGNEASIKQKLKVVKGMYYSITFSAARTCAQDERLNVSVTP  128


 Score = 53.9 bits (128),  Expect(2) = 5e-46, Method: Compositional matrix adjust.
 Identities = 22/39 (56%), Positives = 28/39 (72%), Gaps = 0/39 (0%)
 Frame = +2

Query  455  DSDVLPIQTLYSINGWDCYPWAFQAENPQAEIIIHNPGV  571
            DS +LPIQT Y  +GWD Y WAF+A   +  ++IHNPGV
Sbjct  129  DSGLLPIQTTYGSDGWDSYAWAFRATLEEVHLVIHNPGV  167



>ref|XP_010454874.1| PREDICTED: uncharacterized protein LOC104736571 [Camelina sativa]
Length=369

 Score =   146 bits (369),  Expect(2) = 6e-46, Method: Compositional matrix adjust.
 Identities = 70/103 (68%), Positives = 81/103 (79%), Gaps = 0/103 (0%)
 Frame = +1

Query  145  DGLLVNGNFEAPVKKTDLNGTIVTRHDAVPGWTVTGFVEYIQAGQKQGDMQLVVPEGFAA  324
            DG+L NG+FE   K +D+ GT V    A+P W VTGFVEYI++G KQGDM LVVP G  A
Sbjct  28   DGILPNGDFELGPKPSDMKGTEVVNKLAIPNWEVTGFVEYIKSGHKQGDMLLVVPAGKFA  87

Query  325  VRLGNEASIKQTLNVSKGMYYSITFCAARTCAQEERLNITVAP  453
            VRLGNEASIKQ L V KGMYYS+TF AARTCAQ+ERLNI+V+P
Sbjct  88   VRLGNEASIKQRLRVVKGMYYSLTFSAARTCAQDERLNISVSP  130


 Score = 64.3 bits (155),  Expect(2) = 6e-46, Method: Compositional matrix adjust.
 Identities = 27/39 (69%), Positives = 33/39 (85%), Gaps = 0/39 (0%)
 Frame = +2

Query  455  DSDVLPIQTLYSINGWDCYPWAFQAENPQAEIIIHNPGV  571
            DS V+PIQT+YS +GWD Y WAFQAE+  AE++IHNPGV
Sbjct  131  DSGVIPIQTVYSSSGWDLYAWAFQAESEVAEVVIHNPGV  169



>ref|XP_006399647.1| hypothetical protein EUTSA_v10013887mg [Eutrema salsugineum]
 gb|ESQ41100.1| hypothetical protein EUTSA_v10013887mg [Eutrema salsugineum]
Length=340

 Score =   146 bits (368),  Expect(2) = 7e-46, Method: Compositional matrix adjust.
 Identities = 69/101 (68%), Positives = 82/101 (81%), Gaps = 0/101 (0%)
 Frame = +1

Query  151  LLVNGNFEAPVKKTDLNGTIVTRHDAVPGWTVTGFVEYIQAGQKQGDMQLVVPEGFAAVR  330
            +L NG+FE   K +D+ GT V    A+P W ++GFVEYI++GQKQGDM LVVP G  AVR
Sbjct  1    MLPNGDFERGPKPSDMKGTQVINKKALPSWELSGFVEYIKSGQKQGDMLLVVPAGKFAVR  60

Query  331  LGNEASIKQTLNVSKGMYYSITFCAARTCAQEERLNITVAP  453
            LGNEASIKQ LNV+KGMYYS+TF AARTCAQ+ERLNI+VAP
Sbjct  61   LGNEASIKQRLNVTKGMYYSLTFSAARTCAQDERLNISVAP  101


 Score = 64.7 bits (156),  Expect(2) = 7e-46, Method: Compositional matrix adjust.
 Identities = 28/38 (74%), Positives = 32/38 (84%), Gaps = 0/38 (0%)
 Frame = +2

Query  455  DSDVLPIQTLYSINGWDCYPWAFQAENPQAEIIIHNPG  568
            DS V+PIQT+YS NGWD Y WAFQAE+  AEI+IHNPG
Sbjct  102  DSGVIPIQTVYSSNGWDLYAWAFQAESDVAEIVIHNPG  139



>ref|XP_010421395.1| PREDICTED: uncharacterized protein LOC104706866 [Camelina sativa]
Length=369

 Score =   146 bits (369),  Expect(2) = 7e-46, Method: Compositional matrix adjust.
 Identities = 70/103 (68%), Positives = 81/103 (79%), Gaps = 0/103 (0%)
 Frame = +1

Query  145  DGLLVNGNFEAPVKKTDLNGTIVTRHDAVPGWTVTGFVEYIQAGQKQGDMQLVVPEGFAA  324
            DG+L NG+FE   K +D+ GT V    A+P W VTGFVEYI++G KQGDM LVVP G  A
Sbjct  28   DGILPNGDFELGPKPSDMKGTEVVNKLAIPNWEVTGFVEYIKSGHKQGDMLLVVPAGKFA  87

Query  325  VRLGNEASIKQTLNVSKGMYYSITFCAARTCAQEERLNITVAP  453
            VRLGNEASIKQ L V KGMYYS+TF AARTCAQ+ERLNI+V+P
Sbjct  88   VRLGNEASIKQRLRVVKGMYYSLTFSAARTCAQDERLNISVSP  130


 Score = 64.3 bits (155),  Expect(2) = 7e-46, Method: Compositional matrix adjust.
 Identities = 27/39 (69%), Positives = 33/39 (85%), Gaps = 0/39 (0%)
 Frame = +2

Query  455  DSDVLPIQTLYSINGWDCYPWAFQAENPQAEIIIHNPGV  571
            DS V+PIQT+YS +GWD Y WAFQAE+  AE++IHNPGV
Sbjct  131  DSGVIPIQTVYSSSGWDLYAWAFQAESDVAEVVIHNPGV  169



>gb|EYU21948.1| hypothetical protein MIMGU_mgv1a0096341mg [Erythranthe guttata]
Length=336

 Score =   150 bits (378),  Expect(2) = 8e-46, Method: Compositional matrix adjust.
 Identities = 67/89 (75%), Positives = 80/89 (90%), Gaps = 0/89 (0%)
 Frame = +1

Query  187  KTDLNGTIVTRHDAVPGWTVTGFVEYIQAGQKQGDMQLVVPEGFAAVRLGNEASIKQTLN  366
            K+DLNGTIV +  A+P W ++GFVEYI+AGQKQGDM LVVPEG+AAVRLGNEAS+KQ +N
Sbjct  5    KSDLNGTIVLKPHAIPKWQISGFVEYIKAGQKQGDMLLVVPEGYAAVRLGNEASVKQYVN  64

Query  367  VSKGMYYSITFCAARTCAQEERLNITVAP  453
            V+KGMYYSITF AARTCAQEE +N++VAP
Sbjct  65   VTKGMYYSITFSAARTCAQEEMVNVSVAP  93


 Score = 60.8 bits (146),  Expect(2) = 8e-46, Method: Compositional matrix adjust.
 Identities = 27/39 (69%), Positives = 30/39 (77%), Gaps = 0/39 (0%)
 Frame = +2

Query  455  DSDVLPIQTLYSINGWDCYPWAFQAENPQAEIIIHNPGV  571
            D  VLPIQTLYS NGWD Y WAF+  +  AEI+IHNPGV
Sbjct  94   DFGVLPIQTLYSSNGWDSYAWAFRTSSSVAEILIHNPGV  132



>ref|XP_006287976.1| hypothetical protein CARUB_v10001211mg [Capsella rubella]
 gb|EOA20874.1| hypothetical protein CARUB_v10001211mg [Capsella rubella]
Length=370

 Score =   146 bits (369),  Expect(2) = 1e-45, Method: Compositional matrix adjust.
 Identities = 70/103 (68%), Positives = 81/103 (79%), Gaps = 0/103 (0%)
 Frame = +1

Query  145  DGLLVNGNFEAPVKKTDLNGTIVTRHDAVPGWTVTGFVEYIQAGQKQGDMQLVVPEGFAA  324
            DG+L NG+FE   K +D+ GT V    A+P W V+GFVEYI++G KQGDM LVVP G  A
Sbjct  29   DGMLPNGDFELGPKPSDMKGTEVLNKLAIPNWEVSGFVEYIKSGHKQGDMLLVVPAGKFA  88

Query  325  VRLGNEASIKQTLNVSKGMYYSITFCAARTCAQEERLNITVAP  453
            VRLGNEASIKQ L V KGMYYS+TF AARTCAQ+ERLNI+VAP
Sbjct  89   VRLGNEASIKQRLKVVKGMYYSLTFSAARTCAQDERLNISVAP  131


 Score = 63.9 bits (154),  Expect(2) = 1e-45, Method: Compositional matrix adjust.
 Identities = 26/39 (67%), Positives = 33/39 (85%), Gaps = 0/39 (0%)
 Frame = +2

Query  455  DSDVLPIQTLYSINGWDCYPWAFQAENPQAEIIIHNPGV  571
            DS V+P+QT+YS +GWD Y WAFQAE+  AE++IHNPGV
Sbjct  132  DSGVIPVQTVYSSSGWDLYAWAFQAESDVAEVVIHNPGV  170



>ref|XP_009151074.1| PREDICTED: uncharacterized protein LOC103874406 [Brassica rapa]
 emb|CDX88180.1| BnaA06g27710D [Brassica napus]
 emb|CDX80511.1| BnaC07g29330D [Brassica napus]
Length=367

 Score =   147 bits (371),  Expect(2) = 1e-45, Method: Compositional matrix adjust.
 Identities = 71/103 (69%), Positives = 80/103 (78%), Gaps = 0/103 (0%)
 Frame = +1

Query  145  DGLLVNGNFEAPVKKTDLNGTIVTRHDAVPGWTVTGFVEYIQAGQKQGDMQLVVPEGFAA  324
            DG+L NG+FE   K +D+ GT V    A+P W VTGFVEYI +G KQGDM LVVP G  A
Sbjct  26   DGILPNGDFELGPKPSDMKGTEVINKMAIPNWEVTGFVEYISSGHKQGDMLLVVPAGKFA  85

Query  325  VRLGNEASIKQTLNVSKGMYYSITFCAARTCAQEERLNITVAP  453
            VRLGNEASIKQ L V KGMYYS+TF AARTCAQ+ERLNI+VAP
Sbjct  86   VRLGNEASIKQRLKVVKGMYYSLTFSAARTCAQDERLNISVAP  128


 Score = 62.8 bits (151),  Expect(2) = 1e-45, Method: Compositional matrix adjust.
 Identities = 26/38 (68%), Positives = 32/38 (84%), Gaps = 0/38 (0%)
 Frame = +2

Query  455  DSDVLPIQTLYSINGWDCYPWAFQAENPQAEIIIHNPG  568
            DS V+P+QT+YS +GWD Y WAFQAE+  AEI+IHNPG
Sbjct  129  DSGVIPVQTVYSSSGWDLYAWAFQAESEVAEIVIHNPG  166



>gb|KJB07801.1| hypothetical protein B456_001G045200 [Gossypium raimondii]
Length=372

 Score =   151 bits (382),  Expect(2) = 1e-45, Method: Compositional matrix adjust.
 Identities = 72/104 (69%), Positives = 83/104 (80%), Gaps = 0/104 (0%)
 Frame = +1

Query  142  TDGLLVNGNFEAPVKKTDLNGTIVTRHDAVPGWTVTGFVEYIQAGQKQGDMQLVVPEGFA  321
            ++GLL NGNFE     T++ GT+V    ++PGW   GFVEYI++GQKQGDM LVVPEG  
Sbjct  27   SNGLLENGNFENAPNATNMKGTVVVGRYSIPGWVNEGFVEYIKSGQKQGDMLLVVPEGAY  86

Query  322  AVRLGNEASIKQTLNVSKGMYYSITFCAARTCAQEERLNITVAP  453
            AVRLGNEASIKQ + V KGMYYSITF AARTCAQEERLN+TVAP
Sbjct  87   AVRLGNEASIKQKIKVIKGMYYSITFSAARTCAQEERLNVTVAP  130


 Score = 58.5 bits (140),  Expect(2) = 1e-45, Method: Compositional matrix adjust.
 Identities = 27/39 (69%), Positives = 31/39 (79%), Gaps = 0/39 (0%)
 Frame = +2

Query  455  DSDVLPIQTLYSINGWDCYPWAFQAENPQAEIIIHNPGV  571
            DS VLPIQT+YS +GWD Y WAF+A    AE+IIHNPGV
Sbjct  131  DSGVLPIQTVYSSSGWDNYAWAFKAIYEVAELIIHNPGV  169



>gb|ACU22840.1| unknown [Glycine max]
Length=199

 Score =   156 bits (395),  Expect(2) = 1e-45, Method: Compositional matrix adjust.
 Identities = 73/104 (70%), Positives = 86/104 (83%), Gaps = 0/104 (0%)
 Frame = +1

Query  142  TDGLLVNGNFEAPVKKTDLNGTIVTRHDAVPGWTVTGFVEYIQAGQKQGDMQLVVPEGFA  321
            TDGLL NGNFE   K + L G++VT HDA+P WT++GFVEYI++GQKQGDM LVVPEG  
Sbjct  24   TDGLLPNGNFEQGPKPSQLKGSVVTGHDAIPNWTISGFVEYIKSGQKQGDMLLVVPEGDY  83

Query  322  AVRLGNEASIKQTLNVSKGMYYSITFCAARTCAQEERLNITVAP  453
            AVRLGNEASIKQ L + KG +YSITF AARTCAQEE+LN++V P
Sbjct  84   AVRLGNEASIKQKLKLIKGSFYSITFSAARTCAQEEKLNVSVVP  127


 Score = 53.1 bits (126),  Expect(2) = 1e-45, Method: Compositional matrix adjust.
 Identities = 21/40 (53%), Positives = 31/40 (78%), Gaps = 0/40 (0%)
 Frame = +2

Query  449  RRDSDVLPIQTLYSINGWDCYPWAFQAENPQAEIIIHNPG  568
            +RD  ++PIQT+Y  NGW+ +   F+A+ P+AEI+IHNPG
Sbjct  131  KRDWGIIPIQTMYGSNGWESFTCGFRADFPEAEIVIHNPG  170



>ref|XP_004138737.1| PREDICTED: uncharacterized protein LOC101219952 [Cucumis sativus]
 ref|XP_004164530.1| PREDICTED: uncharacterized protein LOC101227825 [Cucumis sativus]
 gb|KGN62919.1| hypothetical protein Csa_2G379990 [Cucumis sativus]
Length=368

 Score =   151 bits (381),  Expect(2) = 2e-45, Method: Compositional matrix adjust.
 Identities = 71/104 (68%), Positives = 83/104 (80%), Gaps = 0/104 (0%)
 Frame = +1

Query  142  TDGLLVNGNFEAPVKKTDLNGTIVTRHDAVPGWTVTGFVEYIQAGQKQGDMQLVVPEGFA  321
             DG L NG+FE     +D+NGT+V    A+P W ++GFVEYI++GQKQGDM LVVPEG  
Sbjct  24   VDGYLPNGDFERGPNASDMNGTVVKGPYAIPEWEISGFVEYIKSGQKQGDMLLVVPEGAF  83

Query  322  AVRLGNEASIKQTLNVSKGMYYSITFCAARTCAQEERLNITVAP  453
            AVRLGNEASIKQ + V KG+YYSITF AARTCAQEERLNI+VAP
Sbjct  84   AVRLGNEASIKQKIKVVKGLYYSITFSAARTCAQEERLNISVAP  127


 Score = 58.2 bits (139),  Expect(2) = 2e-45, Method: Compositional matrix adjust.
 Identities = 24/35 (69%), Positives = 29/35 (83%), Gaps = 0/35 (0%)
 Frame = +2

Query  464  VLPIQTLYSINGWDCYPWAFQAENPQAEIIIHNPG  568
            VLP+QTLY+ NGWD Y WAFQAE+ +  I+IHNPG
Sbjct  131  VLPMQTLYNSNGWDLYAWAFQAESDEVVILIHNPG  165



>ref|XP_002515557.1| conserved hypothetical protein [Ricinus communis]
 emb|CAB02653.1| unknown [Ricinus communis]
 gb|EEF47006.1| conserved hypothetical protein [Ricinus communis]
Length=364

 Score =   150 bits (380),  Expect(2) = 2e-45, Method: Compositional matrix adjust.
 Identities = 70/103 (68%), Positives = 84/103 (82%), Gaps = 0/103 (0%)
 Frame = +1

Query  145  DGLLVNGNFEAPVKKTDLNGTIVTRHDAVPGWTVTGFVEYIQAGQKQGDMQLVVPEGFAA  324
            DGL+ NGNFE   K +D+ GT V   +A+P W ++GFVEYI++GQKQGDM LVVPEG  A
Sbjct  23   DGLVKNGNFELAPKPSDMKGTQVIGKNAIPEWEISGFVEYIKSGQKQGDMLLVVPEGAYA  82

Query  325  VRLGNEASIKQTLNVSKGMYYSITFCAARTCAQEERLNITVAP  453
            VRLGNEASIKQ + V KGMYYSITF AARTCAQEE+LN++V+P
Sbjct  83   VRLGNEASIKQRMRVIKGMYYSITFSAARTCAQEEKLNVSVSP  125


 Score = 58.5 bits (140),  Expect(2) = 2e-45, Method: Compositional matrix adjust.
 Identities = 24/36 (67%), Positives = 29/36 (81%), Gaps = 0/36 (0%)
 Frame = +2

Query  464  VLPIQTLYSINGWDCYPWAFQAENPQAEIIIHNPGV  571
            VLP+QT+YS NGWD Y WAFQAE    +++IHNPGV
Sbjct  129  VLPMQTMYSSNGWDSYAWAFQAEFQYVDLVIHNPGV  164



>gb|KHN44154.1| hypothetical protein glysoja_031815 [Glycine soja]
Length=374

 Score =   157 bits (396),  Expect(2) = 2e-45, Method: Compositional matrix adjust.
 Identities = 73/104 (70%), Positives = 86/104 (83%), Gaps = 0/104 (0%)
 Frame = +1

Query  142  TDGLLVNGNFEAPVKKTDLNGTIVTRHDAVPGWTVTGFVEYIQAGQKQGDMQLVVPEGFA  321
            TDGLL NGNFE   K + L G++VT HDA+P WT++GFVEYI++GQKQGDM LVVPEG  
Sbjct  24   TDGLLPNGNFEQGPKPSQLKGSVVTGHDAIPNWTISGFVEYIKSGQKQGDMLLVVPEGDY  83

Query  322  AVRLGNEASIKQTLNVSKGMYYSITFCAARTCAQEERLNITVAP  453
            AVRLGNEASIKQ L + KG +YSITF AARTCAQEE+LN++V P
Sbjct  84   AVRLGNEASIKQKLKLIKGSFYSITFSAARTCAQEEKLNVSVVP  127


 Score = 52.4 bits (124),  Expect(2) = 2e-45, Method: Compositional matrix adjust.
 Identities = 20/40 (50%), Positives = 31/40 (78%), Gaps = 0/40 (0%)
 Frame = +2

Query  449  RRDSDVLPIQTLYSINGWDCYPWAFQAENPQAEIIIHNPG  568
            +RD  ++PIQT+Y  NGW+ +   F+A+ P+A+I+IHNPG
Sbjct  131  KRDWGIIPIQTMYGSNGWESFTCGFRADFPEAQIVIHNPG  170



>gb|ACU17881.1| unknown [Glycine max]
Length=282

 Score =   157 bits (397),  Expect(2) = 3e-45, Method: Compositional matrix adjust.
 Identities = 73/104 (70%), Positives = 86/104 (83%), Gaps = 0/104 (0%)
 Frame = +1

Query  142  TDGLLVNGNFEAPVKKTDLNGTIVTRHDAVPGWTVTGFVEYIQAGQKQGDMQLVVPEGFA  321
            TDGLL NGNFE   K + L G++VT HDA+P WT++GFVEYI++GQKQGDM LVVPEG  
Sbjct  24   TDGLLPNGNFEQGPKPSQLKGSVVTGHDAIPNWTISGFVEYIKSGQKQGDMLLVVPEGDY  83

Query  322  AVRLGNEASIKQTLNVSKGMYYSITFCAARTCAQEERLNITVAP  453
            AVRLGNEASIKQ L + KG +YSITF AARTCAQEE+LN++V P
Sbjct  84   AVRLGNEASIKQKLKLIKGSFYSITFSAARTCAQEEKLNVSVVP  127


 Score = 51.6 bits (122),  Expect(2) = 3e-45, Method: Compositional matrix adjust.
 Identities = 20/40 (50%), Positives = 31/40 (78%), Gaps = 0/40 (0%)
 Frame = +2

Query  449  RRDSDVLPIQTLYSINGWDCYPWAFQAENPQAEIIIHNPG  568
            +RD  ++PIQT+Y  NGW+ +   F+A+ P+A+I+IHNPG
Sbjct  131  KRDWGIIPIQTMYGSNGWESFTCGFRADFPEAQIVIHNPG  170



>gb|KJB80693.1| hypothetical protein B456_013G110800 [Gossypium raimondii]
Length=369

 Score =   153 bits (386),  Expect(2) = 3e-45, Method: Compositional matrix adjust.
 Identities = 73/103 (71%), Positives = 82/103 (80%), Gaps = 0/103 (0%)
 Frame = +1

Query  145  DGLLVNGNFEAPVKKTDLNGTIVTRHDAVPGWTVTGFVEYIQAGQKQGDMQLVVPEGFAA  324
            DGLL NGNFE     +++ GT+V    A+PGW   GFVEYI++GQKQGDM LVVPEG  A
Sbjct  28   DGLLDNGNFEQAPNASNMKGTVVVGRYAIPGWVNEGFVEYIKSGQKQGDMLLVVPEGAYA  87

Query  325  VRLGNEASIKQTLNVSKGMYYSITFCAARTCAQEERLNITVAP  453
            VRLGNEASIKQ + V KGMYYSITF AARTCAQEERLN+TVAP
Sbjct  88   VRLGNEASIKQEIKVVKGMYYSITFSAARTCAQEERLNVTVAP  130


 Score = 55.5 bits (132),  Expect(2) = 3e-45, Method: Compositional matrix adjust.
 Identities = 23/39 (59%), Positives = 30/39 (77%), Gaps = 0/39 (0%)
 Frame = +2

Query  455  DSDVLPIQTLYSINGWDCYPWAFQAENPQAEIIIHNPGV  571
            DS V+PIQT+YS +GWD Y WAF+ ++    +IIHNPGV
Sbjct  131  DSGVMPIQTVYSSSGWDNYAWAFKTQSDAVMLIIHNPGV  169



>ref|XP_011019761.1| PREDICTED: uncharacterized protein LOC105122382 [Populus euphratica]
Length=365

 Score =   154 bits (388),  Expect(2) = 3e-45, Method: Compositional matrix adjust.
 Identities = 73/103 (71%), Positives = 84/103 (82%), Gaps = 0/103 (0%)
 Frame = +1

Query  145  DGLLVNGNFEAPVKKTDLNGTIVTRHDAVPGWTVTGFVEYIQAGQKQGDMQLVVPEGFAA  324
            DGL+ NGNFE   K +DL GT +    A+P W ++GFVEYI+AGQKQGDM LVVPEG  A
Sbjct  24   DGLVENGNFEVGPKPSDLKGTEMIGRYALPKWEISGFVEYIKAGQKQGDMLLVVPEGAYA  83

Query  325  VRLGNEASIKQTLNVSKGMYYSITFCAARTCAQEERLNITVAP  453
            VRLGNEASIKQ LNV+KGMYYSITF AARTCAQEE LNI+++P
Sbjct  84   VRLGNEASIKQVLNVTKGMYYSITFSAARTCAQEEELNISISP  126


 Score = 54.7 bits (130),  Expect(2) = 3e-45, Method: Compositional matrix adjust.
 Identities = 22/36 (61%), Positives = 28/36 (78%), Gaps = 0/36 (0%)
 Frame = +2

Query  464  VLPIQTLYSINGWDCYPWAFQAENPQAEIIIHNPGV  571
            VLP+QT+YS NGWD Y WAF+A     E+++HNPGV
Sbjct  130  VLPMQTMYSSNGWDSYAWAFKALLDIVELVVHNPGV  165



>ref|XP_006394799.1| hypothetical protein EUTSA_v10004442mg [Eutrema salsugineum]
 gb|ESQ32085.1| hypothetical protein EUTSA_v10004442mg [Eutrema salsugineum]
Length=367

 Score =   145 bits (367),  Expect(2) = 3e-45, Method: Compositional matrix adjust.
 Identities = 70/103 (68%), Positives = 80/103 (78%), Gaps = 0/103 (0%)
 Frame = +1

Query  145  DGLLVNGNFEAPVKKTDLNGTIVTRHDAVPGWTVTGFVEYIQAGQKQGDMQLVVPEGFAA  324
            DG+L NG+FE   K +D+ GT V    A+P W VTGFVEYI +G KQGDM LVVP G  A
Sbjct  26   DGMLPNGDFELGPKPSDMKGTEVLNKMAIPKWEVTGFVEYISSGHKQGDMLLVVPAGKFA  85

Query  325  VRLGNEASIKQTLNVSKGMYYSITFCAARTCAQEERLNITVAP  453
            VRLGNEASIKQ L V KGMYYS+TF AARTCAQ+ERLNI+V+P
Sbjct  86   VRLGNEASIKQRLKVVKGMYYSLTFSAARTCAQDERLNISVSP  128


 Score = 63.2 bits (152),  Expect(2) = 3e-45, Method: Compositional matrix adjust.
 Identities = 26/39 (67%), Positives = 33/39 (85%), Gaps = 0/39 (0%)
 Frame = +2

Query  455  DSDVLPIQTLYSINGWDCYPWAFQAENPQAEIIIHNPGV  571
            DS V+P+QT+YS +GWD Y WAFQAE+  A+I+IHNPGV
Sbjct  129  DSGVIPVQTVYSSSGWDLYAWAFQAESEIADIVIHNPGV  167



>ref|XP_006450498.1| hypothetical protein CICLE_v10008711mg [Citrus clementina]
 gb|ESR63738.1| hypothetical protein CICLE_v10008711mg [Citrus clementina]
 gb|KDO61660.1| hypothetical protein CISIN_1g017767mg [Citrus sinensis]
Length=366

 Score =   147 bits (372),  Expect(2) = 5e-45, Method: Compositional matrix adjust.
 Identities = 70/104 (67%), Positives = 83/104 (80%), Gaps = 0/104 (0%)
 Frame = +1

Query  142  TDGLLVNGNFEAPVKKTDLNGTIVTRHDAVPGWTVTGFVEYIQAGQKQGDMQLVVPEGFA  321
            TDGLL NGNFE   + +D+NGT+V    A+P W ++GFVEYI++GQKQGDM LVVPEG  
Sbjct  23   TDGLLPNGNFELGPRPSDMNGTVVLGRYAIPSWEISGFVEYIRSGQKQGDMLLVVPEGAF  82

Query  322  AVRLGNEASIKQTLNVSKGMYYSITFCAARTCAQEERLNITVAP  453
            AVRLGNEAS+KQ + V KG YYSI+F  ARTCAQEE LNI+VAP
Sbjct  83   AVRLGNEASVKQRIKVIKGNYYSISFNFARTCAQEESLNISVAP  126


 Score = 60.5 bits (145),  Expect(2) = 5e-45, Method: Compositional matrix adjust.
 Identities = 26/36 (72%), Positives = 30/36 (83%), Gaps = 0/36 (0%)
 Frame = +2

Query  464  VLPIQTLYSINGWDCYPWAFQAENPQAEIIIHNPGV  571
            VLP+QTLYS NGWD Y WAFQA+   AEI++HNPGV
Sbjct  130  VLPLQTLYSSNGWDTYAWAFQAKFNYAEIVLHNPGV  165



>ref|XP_010493802.1| PREDICTED: uncharacterized protein LOC104771027 [Camelina sativa]
Length=370

 Score =   144 bits (362),  Expect(2) = 5e-45, Method: Compositional matrix adjust.
 Identities = 69/103 (67%), Positives = 80/103 (78%), Gaps = 0/103 (0%)
 Frame = +1

Query  145  DGLLVNGNFEAPVKKTDLNGTIVTRHDAVPGWTVTGFVEYIQAGQKQGDMQLVVPEGFAA  324
            DG+L NG+FE   K +D+ GT V    A+P W VTGFVEYI++G KQGDM LVVP G  A
Sbjct  29   DGILPNGDFELGPKPSDMKGTEVVNKLAIPNWEVTGFVEYIKSGHKQGDMLLVVPAGKFA  88

Query  325  VRLGNEASIKQTLNVSKGMYYSITFCAARTCAQEERLNITVAP  453
            VRLGNEASIKQ L V KGMYYS+TF AARTCAQ+E LNI+V+P
Sbjct  89   VRLGNEASIKQRLRVVKGMYYSLTFSAARTCAQDEMLNISVSP  131


 Score = 64.3 bits (155),  Expect(2) = 5e-45, Method: Compositional matrix adjust.
 Identities = 27/39 (69%), Positives = 33/39 (85%), Gaps = 0/39 (0%)
 Frame = +2

Query  455  DSDVLPIQTLYSINGWDCYPWAFQAENPQAEIIIHNPGV  571
            DS V+PIQT+YS +GWD Y WAFQAE+  AE++IHNPGV
Sbjct  132  DSGVIPIQTVYSSSGWDLYAWAFQAESEVAEVVIHNPGV  170



>ref|XP_006483312.1| PREDICTED: uncharacterized protein LOC102608149 [Citrus sinensis]
Length=366

 Score =   147 bits (372),  Expect(2) = 5e-45, Method: Compositional matrix adjust.
 Identities = 70/104 (67%), Positives = 83/104 (80%), Gaps = 0/104 (0%)
 Frame = +1

Query  142  TDGLLVNGNFEAPVKKTDLNGTIVTRHDAVPGWTVTGFVEYIQAGQKQGDMQLVVPEGFA  321
            TDGLL NGNFE   + +D+NGT+V    A+P W ++GFVEYI++GQKQGDM LVVPEG  
Sbjct  23   TDGLLPNGNFELGPRPSDMNGTVVLGRYAIPSWEISGFVEYIRSGQKQGDMLLVVPEGAF  82

Query  322  AVRLGNEASIKQTLNVSKGMYYSITFCAARTCAQEERLNITVAP  453
            AVRLGNEAS+KQ + V KG YYSI+F  ARTCAQEE LNI+VAP
Sbjct  83   AVRLGNEASVKQRIKVIKGNYYSISFNFARTCAQEESLNISVAP  126


 Score = 60.5 bits (145),  Expect(2) = 5e-45, Method: Compositional matrix adjust.
 Identities = 26/36 (72%), Positives = 30/36 (83%), Gaps = 0/36 (0%)
 Frame = +2

Query  464  VLPIQTLYSINGWDCYPWAFQAENPQAEIIIHNPGV  571
            VLP+QTLYS NGWD Y WAFQA+   AEI++HNPGV
Sbjct  130  VLPLQTLYSSNGWDTYAWAFQAKFNYAEIVLHNPGV  165



>ref|XP_009129962.1| PREDICTED: uncharacterized protein LOC103854751 [Brassica rapa]
 emb|CDY05493.1| BnaA02g31980D [Brassica napus]
Length=366

 Score =   145 bits (365),  Expect(2) = 6e-45, Method: Compositional matrix adjust.
 Identities = 70/103 (68%), Positives = 79/103 (77%), Gaps = 0/103 (0%)
 Frame = +1

Query  145  DGLLVNGNFEAPVKKTDLNGTIVTRHDAVPGWTVTGFVEYIQAGQKQGDMQLVVPEGFAA  324
            DG+L NG+FE   K +D+ GT V    A+P W VTGFVEYI +G  QGDM LVVP G  A
Sbjct  26   DGMLPNGDFELGPKPSDMKGTEVLNKMAIPNWEVTGFVEYISSGHTQGDMLLVVPAGKFA  85

Query  325  VRLGNEASIKQTLNVSKGMYYSITFCAARTCAQEERLNITVAP  453
            VRLGNEASIKQ L V KGMYYS+TF AARTCAQ+ERLNI+VAP
Sbjct  86   VRLGNEASIKQRLKVVKGMYYSLTFSAARTCAQDERLNISVAP  128


 Score = 62.8 bits (151),  Expect(2) = 6e-45, Method: Compositional matrix adjust.
 Identities = 26/38 (68%), Positives = 32/38 (84%), Gaps = 0/38 (0%)
 Frame = +2

Query  455  DSDVLPIQTLYSINGWDCYPWAFQAENPQAEIIIHNPG  568
            DS V+P+QT+YS +GWD Y WAFQAE+  AEI+IHNPG
Sbjct  129  DSGVIPVQTVYSSSGWDLYSWAFQAESEIAEIVIHNPG  166



>gb|KFK27809.1| hypothetical protein AALP_AA8G432300 [Arabis alpina]
Length=370

 Score =   145 bits (366),  Expect(2) = 6e-45, Method: Compositional matrix adjust.
 Identities = 69/103 (67%), Positives = 81/103 (79%), Gaps = 0/103 (0%)
 Frame = +1

Query  145  DGLLVNGNFEAPVKKTDLNGTIVTRHDAVPGWTVTGFVEYIQAGQKQGDMQLVVPEGFAA  324
            DG+L NG+FE   K++D+ GT V    A+P W V+GFVEYI +G KQGDM LVVP G  A
Sbjct  29   DGMLPNGDFELGPKQSDMKGTEVLNKLAIPNWEVSGFVEYISSGHKQGDMILVVPAGKFA  88

Query  325  VRLGNEASIKQTLNVSKGMYYSITFCAARTCAQEERLNITVAP  453
            VRLGNEASIKQ L V KGMYYS+TF AARTCAQ+ERLNI+V+P
Sbjct  89   VRLGNEASIKQRLKVVKGMYYSLTFSAARTCAQDERLNISVSP  131


 Score = 62.4 bits (150),  Expect(2) = 6e-45, Method: Compositional matrix adjust.
 Identities = 25/38 (66%), Positives = 32/38 (84%), Gaps = 0/38 (0%)
 Frame = +2

Query  455  DSDVLPIQTLYSINGWDCYPWAFQAENPQAEIIIHNPG  568
            DS V+P+QT+YS +GWD Y WAFQAE+  AE++IHNPG
Sbjct  132  DSGVIPVQTVYSSSGWDLYAWAFQAESDVAEVVIHNPG  169



>ref|XP_006427179.1| hypothetical protein CICLE_v10025880mg [Citrus clementina]
 gb|ESR40419.1| hypothetical protein CICLE_v10025880mg [Citrus clementina]
Length=374

 Score =   151 bits (381),  Expect(2) = 8e-45, Method: Compositional matrix adjust.
 Identities = 67/107 (63%), Positives = 87/107 (81%), Gaps = 0/107 (0%)
 Frame = +1

Query  142  TDGLLVNGNFEAPVKKTDLNGTIVTRHDAVPGWTVTGFVEYIQAGQKQGDMQLVVPEGFA  321
            TDGLL NGNFE   K++ + GT+VT  +A+P W ++G+VEYI++G KQGDM L+VPEG  
Sbjct  22   TDGLLPNGNFEYGPKRSQMKGTVVTHPNAIPNWQISGYVEYIKSGHKQGDMLLIVPEGVF  81

Query  322  AVRLGNEASIKQTLNVSKGMYYSITFCAARTCAQEERLNITVAPGLR  462
            AVRLGNEASIKQ + V+KG +YS+TF AARTCAQEE+LN++V+P L 
Sbjct  82   AVRLGNEASIKQNIKVTKGRFYSMTFSAARTCAQEEKLNVSVSPNLE  128


 Score = 56.2 bits (134),  Expect(2) = 8e-45, Method: Compositional matrix adjust.
 Identities = 23/36 (64%), Positives = 28/36 (78%), Gaps = 0/36 (0%)
 Frame = +2

Query  464  VLPIQTLYSINGWDCYPWAFQAENPQAEIIIHNPGV  571
            +LP+QT+YS NGWD Y WAF A+  + EI IHNPGV
Sbjct  134  ILPMQTMYSNNGWDSYAWAFVADAEEVEITIHNPGV  169



>ref|XP_002517567.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF44731.1| conserved hypothetical protein [Ricinus communis]
Length=378

 Score =   149 bits (375),  Expect(2) = 9e-45, Method: Compositional matrix adjust.
 Identities = 69/108 (64%), Positives = 86/108 (80%), Gaps = 0/108 (0%)
 Frame = +1

Query  142  TDGLLVNGNFEAPVKKTDLNGTIVTRHDAVPGWTVTGFVEYIQAGQKQGDMQLVVPEGFA  321
            TDGLL NGNFE   K   L GT+VT  +A+P W ++G+VEYI++GQKQGDM LVVP G  
Sbjct  27   TDGLLPNGNFEYGPKPWQLKGTVVTAKNAIPNWEISGYVEYIKSGQKQGDMLLVVPSGAF  86

Query  322  AVRLGNEASIKQTLNVSKGMYYSITFCAARTCAQEERLNITVAPGLRR  465
            AVRLGNEASIKQ ++V+KG YYSITF  ARTCAQEE+LN++V+P + +
Sbjct  87   AVRLGNEASIKQKISVAKGSYYSITFNVARTCAQEEKLNVSVSPNIEQ  134


 Score = 58.2 bits (139),  Expect(2) = 9e-45, Method: Compositional matrix adjust.
 Identities = 24/35 (69%), Positives = 28/35 (80%), Gaps = 0/35 (0%)
 Frame = +2

Query  464  VLPIQTLYSINGWDCYPWAFQAENPQAEIIIHNPG  568
            +LP+QT+YS NGWD Y WAFQA+ P  EI IHNPG
Sbjct  139  ILPMQTMYSSNGWDSYAWAFQADYPDIEISIHNPG  173



>gb|KHG29602.1| Allergen Act d 3 [Gossypium arboreum]
Length=369

 Score =   151 bits (381),  Expect(2) = 9e-45, Method: Compositional matrix adjust.
 Identities = 72/103 (70%), Positives = 82/103 (80%), Gaps = 0/103 (0%)
 Frame = +1

Query  145  DGLLVNGNFEAPVKKTDLNGTIVTRHDAVPGWTVTGFVEYIQAGQKQGDMQLVVPEGFAA  324
            +GLL NGNFE     +++ GT+V    A+PGW   GFVEYI++GQKQGDM LVVPEG  A
Sbjct  28   EGLLDNGNFEQAPNASNMKGTVVVGRYAIPGWVNEGFVEYIKSGQKQGDMLLVVPEGAYA  87

Query  325  VRLGNEASIKQTLNVSKGMYYSITFCAARTCAQEERLNITVAP  453
            VRLGNEASIKQ + V KGMYYSITF AARTCAQEERLN+TVAP
Sbjct  88   VRLGNEASIKQEIKVVKGMYYSITFSAARTCAQEERLNVTVAP  130


 Score = 55.8 bits (133),  Expect(2) = 9e-45, Method: Compositional matrix adjust.
 Identities = 23/39 (59%), Positives = 31/39 (79%), Gaps = 0/39 (0%)
 Frame = +2

Query  455  DSDVLPIQTLYSINGWDCYPWAFQAENPQAEIIIHNPGV  571
            DS V+PIQT+YS +GWD Y WAF++++    +IIHNPGV
Sbjct  131  DSGVMPIQTVYSSSGWDNYAWAFKSQSDAVMLIIHNPGV  169



>ref|XP_010670694.1| PREDICTED: uncharacterized protein LOC104887687 [Beta vulgaris 
subsp. vulgaris]
Length=367

 Score =   149 bits (375),  Expect(2) = 9e-45, Method: Compositional matrix adjust.
 Identities = 69/104 (66%), Positives = 85/104 (82%), Gaps = 0/104 (0%)
 Frame = +1

Query  142  TDGLLVNGNFEAPVKKTDLNGTIVTRHDAVPGWTVTGFVEYIQAGQKQGDMQLVVPEGFA  321
            TDGLL NG+FE   K +D+ G+ V    A+P W ++GFVEYI++GQKQGDM LVVPEG  
Sbjct  25   TDGLLPNGDFEKGPKPSDMKGSEVLNRHAIPNWELSGFVEYIKSGQKQGDMLLVVPEGAF  84

Query  322  AVRLGNEASIKQTLNVSKGMYYSITFCAARTCAQEERLNITVAP  453
            AVRLGNEASIKQ ++V+KGM Y+ITFCAARTCAQEE+LN++V P
Sbjct  85   AVRLGNEASIKQRVSVTKGMNYAITFCAARTCAQEEQLNVSVTP  128


 Score = 58.2 bits (139),  Expect(2) = 9e-45, Method: Compositional matrix adjust.
 Identities = 25/36 (69%), Positives = 29/36 (81%), Gaps = 0/36 (0%)
 Frame = +2

Query  464  VLPIQTLYSINGWDCYPWAFQAENPQAEIIIHNPGV  571
            VLP+QTLYS +GWDCY W F A +  AEI+IHNPGV
Sbjct  132  VLPMQTLYSSSGWDCYAWGFVALSKVAEIMIHNPGV  167



>gb|ABK94923.1| unknown [Populus trichocarpa]
Length=365

 Score =   152 bits (384),  Expect(2) = 1e-44, Method: Compositional matrix adjust.
 Identities = 72/103 (70%), Positives = 84/103 (82%), Gaps = 0/103 (0%)
 Frame = +1

Query  145  DGLLVNGNFEAPVKKTDLNGTIVTRHDAVPGWTVTGFVEYIQAGQKQGDMQLVVPEGFAA  324
            DGL+ NGNFE   K ++L GT +    A+P W ++GFVEYI+AGQKQGDM LVVPEG  A
Sbjct  24   DGLVENGNFEVGPKPSELKGTEMIGRYALPKWEISGFVEYIKAGQKQGDMLLVVPEGAYA  83

Query  325  VRLGNEASIKQTLNVSKGMYYSITFCAARTCAQEERLNITVAP  453
            VRLGNEASIKQ LNV+KGMYYSITF AARTCAQEE LNI+++P
Sbjct  84   VRLGNEASIKQVLNVTKGMYYSITFSAARTCAQEEELNISISP  126


 Score = 54.7 bits (130),  Expect(2) = 1e-44, Method: Compositional matrix adjust.
 Identities = 22/36 (61%), Positives = 28/36 (78%), Gaps = 0/36 (0%)
 Frame = +2

Query  464  VLPIQTLYSINGWDCYPWAFQAENPQAEIIIHNPGV  571
            VLP+QT+YS NGWD Y WAF+A     E+++HNPGV
Sbjct  130  VLPMQTMYSSNGWDSYAWAFKALLDIVELVVHNPGV  165



>ref|XP_002308647.2| hypothetical protein POPTR_0006s26630g [Populus trichocarpa]
 gb|EEE92170.2| hypothetical protein POPTR_0006s26630g [Populus trichocarpa]
Length=415

 Score =   152 bits (383),  Expect(2) = 1e-44, Method: Compositional matrix adjust.
 Identities = 72/103 (70%), Positives = 84/103 (82%), Gaps = 0/103 (0%)
 Frame = +1

Query  145  DGLLVNGNFEAPVKKTDLNGTIVTRHDAVPGWTVTGFVEYIQAGQKQGDMQLVVPEGFAA  324
            DGL+ NGNFE   K ++L GT +    A+P W ++GFVEYI+AGQKQGDM LVVPEG  A
Sbjct  74   DGLVENGNFEVGPKPSELKGTEMIGRYALPKWEISGFVEYIKAGQKQGDMLLVVPEGAYA  133

Query  325  VRLGNEASIKQTLNVSKGMYYSITFCAARTCAQEERLNITVAP  453
            VRLGNEASIKQ LNV+KGMYYSITF AARTCAQEE LNI+++P
Sbjct  134  VRLGNEASIKQVLNVTKGMYYSITFSAARTCAQEEELNISISP  176


 Score = 54.7 bits (130),  Expect(2) = 1e-44, Method: Compositional matrix adjust.
 Identities = 22/36 (61%), Positives = 28/36 (78%), Gaps = 0/36 (0%)
 Frame = +2

Query  464  VLPIQTLYSINGWDCYPWAFQAENPQAEIIIHNPGV  571
            VLP+QT+YS NGWD Y WAF+A     E+++HNPGV
Sbjct  180  VLPMQTMYSSNGWDSYAWAFKALLDIVELVVHNPGV  215



>ref|XP_008362680.1| PREDICTED: uncharacterized protein LOC103426358 [Malus domestica]
Length=361

 Score =   149 bits (375),  Expect(2) = 1e-44, Method: Compositional matrix adjust.
 Identities = 70/106 (66%), Positives = 84/106 (79%), Gaps = 0/106 (0%)
 Frame = +1

Query  148  GLLVNGNFEAPVKKTDLNGTIVTRHDAVPGWTVTGFVEYIQAGQKQGDMQLVVPEGFAAV  327
            GLL NGNFE   K+++L GT+VT   A+P W ++GFVEYI++GQKQGDM LVVPEG  AV
Sbjct  19   GLLPNGNFEYGPKQSELKGTVVTNPHAIPNWEISGFVEYIKSGQKQGDMLLVVPEGGFAV  78

Query  328  RLGNEASIKQTLNVSKGMYYSITFCAARTCAQEERLNITVAPGLRR  465
            RLGNEASIKQ L V KG +YSITF AARTCAQEE LN+++ P L +
Sbjct  79   RLGNEASIKQKLKVKKGEFYSITFSAARTCAQEETLNVSITPNLEK  124


 Score = 57.4 bits (137),  Expect(2) = 1e-44, Method: Compositional matrix adjust.
 Identities = 22/41 (54%), Positives = 30/41 (73%), Gaps = 0/41 (0%)
 Frame = +2

Query  449  RRDSDVLPIQTLYSINGWDCYPWAFQAENPQAEIIIHNPGV  571
            +R   ++PIQT+YS NGWD Y W F A+  + E++IHNPGV
Sbjct  124  KRHRGIMPIQTMYSSNGWDSYAWGFNADFDEIELVIHNPGV  164



>ref|XP_011019764.1| PREDICTED: uncharacterized protein LOC105122387 [Populus euphratica]
Length=343

 Score =   151 bits (382),  Expect(2) = 2e-44, Method: Compositional matrix adjust.
 Identities = 72/102 (71%), Positives = 83/102 (81%), Gaps = 0/102 (0%)
 Frame = +1

Query  148  GLLVNGNFEAPVKKTDLNGTIVTRHDAVPGWTVTGFVEYIQAGQKQGDMQLVVPEGFAAV  327
            GL+ NGNFE   K +DL GT +    A+P W ++GFVEYI+AGQKQGDM LVVPEG  AV
Sbjct  3    GLVENGNFEVGPKPSDLKGTEMIGRYALPKWEISGFVEYIKAGQKQGDMLLVVPEGAYAV  62

Query  328  RLGNEASIKQTLNVSKGMYYSITFCAARTCAQEERLNITVAP  453
            RLGNEASIKQ LNV+KGMYYSITF AARTCAQEE LNI+++P
Sbjct  63   RLGNEASIKQVLNVTKGMYYSITFSAARTCAQEEELNISISP  104


 Score = 54.7 bits (130),  Expect(2) = 2e-44, Method: Compositional matrix adjust.
 Identities = 22/36 (61%), Positives = 28/36 (78%), Gaps = 0/36 (0%)
 Frame = +2

Query  464  VLPIQTLYSINGWDCYPWAFQAENPQAEIIIHNPGV  571
            VLP+QT+YS NGWD Y WAF+A     E+++HNPGV
Sbjct  108  VLPMQTMYSSNGWDSYAWAFKALLDIVELVVHNPGV  143



>ref|XP_007217604.1| hypothetical protein PRUPE_ppa018156mg [Prunus persica]
 gb|EMJ18803.1| hypothetical protein PRUPE_ppa018156mg [Prunus persica]
Length=375

 Score =   155 bits (391),  Expect(2) = 2e-44, Method: Compositional matrix adjust.
 Identities = 71/108 (66%), Positives = 89/108 (82%), Gaps = 0/108 (0%)
 Frame = +1

Query  142  TDGLLVNGNFEAPVKKTDLNGTIVTRHDAVPGWTVTGFVEYIQAGQKQGDMQLVVPEGFA  321
            TDGLL NGNFE   KK+DL GT+VT+ +A+P W V+G+VEYI++GQKQGDM LVVPEG  
Sbjct  26   TDGLLPNGNFEYGPKKSDLKGTVVTQPNAIPNWEVSGYVEYIKSGQKQGDMLLVVPEGGF  85

Query  322  AVRLGNEASIKQTLNVSKGMYYSITFCAARTCAQEERLNITVAPGLRR  465
            AVRLGNEASIKQ + V+KG +YS+TF AARTC QEE LN++++P L +
Sbjct  86   AVRLGNEASIKQKIKVTKGRFYSVTFSAARTCGQEETLNVSISPNLEK  133


 Score = 51.2 bits (121),  Expect(2) = 2e-44, Method: Compositional matrix adjust.
 Identities = 21/40 (53%), Positives = 26/40 (65%), Gaps = 0/40 (0%)
 Frame = +2

Query  449  RRDSDVLPIQTLYSINGWDCYPWAFQAENPQAEIIIHNPG  568
            + D  + PIQT+YS NGWD Y W F A + + E  IHNPG
Sbjct  133  KNDWGIFPIQTMYSSNGWDSYAWGFNANSDELEFRIHNPG  172



>ref|XP_006465391.1| PREDICTED: uncharacterized protein LOC102618171 [Citrus sinensis]
Length=374

 Score =   150 bits (379),  Expect(2) = 2e-44, Method: Compositional matrix adjust.
 Identities = 67/107 (63%), Positives = 87/107 (81%), Gaps = 0/107 (0%)
 Frame = +1

Query  142  TDGLLVNGNFEAPVKKTDLNGTIVTRHDAVPGWTVTGFVEYIQAGQKQGDMQLVVPEGFA  321
            TDGLL NGNFE   K++ + GT+VT  +A+P W ++G+VEYI++G KQGDM L+VPEG  
Sbjct  22   TDGLLPNGNFEYGPKRSQMKGTVVTHPNAIPNWQISGYVEYIKSGHKQGDMLLIVPEGAF  81

Query  322  AVRLGNEASIKQTLNVSKGMYYSITFCAARTCAQEERLNITVAPGLR  462
            AVRLGNEASIKQ + V+KG +YS+TF AARTCAQEE+LN++V+P L 
Sbjct  82   AVRLGNEASIKQKIKVTKGRFYSMTFSAARTCAQEEKLNVSVSPNLE  128


 Score = 55.8 bits (133),  Expect(2) = 2e-44, Method: Compositional matrix adjust.
 Identities = 22/36 (61%), Positives = 28/36 (78%), Gaps = 0/36 (0%)
 Frame = +2

Query  464  VLPIQTLYSINGWDCYPWAFQAENPQAEIIIHNPGV  571
            +LP+QT+YS NGWD Y WAF A+  + EI +HNPGV
Sbjct  134  ILPMQTMYSNNGWDSYAWAFVADADEVEITVHNPGV  169



>ref|XP_003597843.1| hypothetical protein MTR_2g103170 [Medicago truncatula]
 gb|AES68094.1| plant/F18G18-200 protein [Medicago truncatula]
Length=373

 Score =   153 bits (386),  Expect(2) = 2e-44, Method: Compositional matrix adjust.
 Identities = 71/104 (68%), Positives = 86/104 (83%), Gaps = 0/104 (0%)
 Frame = +1

Query  142  TDGLLVNGNFEAPVKKTDLNGTIVTRHDAVPGWTVTGFVEYIQAGQKQGDMQLVVPEGFA  321
            TDGLL NG+FE   K ++L GT+VT HDA+P WTV+G+VEYI++GQKQGDM LVVPEG  
Sbjct  22   TDGLLPNGDFEVGPKASNLKGTVVTTHDAIPNWTVSGYVEYIKSGQKQGDMLLVVPEGAY  81

Query  322  AVRLGNEASIKQTLNVSKGMYYSITFCAARTCAQEERLNITVAP  453
            AVRLGNEA IKQ + ++KG  YSITF AARTCAQEE+LN++V P
Sbjct  82   AVRLGNEAYIKQKVKLNKGSSYSITFSAARTCAQEEKLNVSVVP  125


 Score = 53.1 bits (126),  Expect(2) = 2e-44, Method: Compositional matrix adjust.
 Identities = 20/41 (49%), Positives = 30/41 (73%), Gaps = 0/41 (0%)
 Frame = +2

Query  449  RRDSDVLPIQTLYSINGWDCYPWAFQAENPQAEIIIHNPGV  571
            +RD  ++PIQT+Y  NGW+ +   F+A+ P+ EI+IHN GV
Sbjct  129  KRDYGIIPIQTMYGSNGWESFACGFRADYPEGEIVIHNSGV  169



>ref|XP_002303263.1| hypothetical protein POPTR_0003s05850g [Populus trichocarpa]
 gb|EEE78242.1| hypothetical protein POPTR_0003s05850g [Populus trichocarpa]
Length=374

 Score =   142 bits (358),  Expect(2) = 2e-44, Method: Compositional matrix adjust.
 Identities = 62/104 (60%), Positives = 85/104 (82%), Gaps = 0/104 (0%)
 Frame = +1

Query  142  TDGLLVNGNFEAPVKKTDLNGTIVTRHDAVPGWTVTGFVEYIQAGQKQGDMQLVVPEGFA  321
            TDGLL NG+FE   + +++ GT+VT  +A+P W ++GF+EYI++G KQGDM LVVP G  
Sbjct  22   TDGLLPNGDFEQGPRPSEMKGTVVTAKNAIPNWEISGFIEYIKSGHKQGDMVLVVPAGAY  81

Query  322  AVRLGNEASIKQTLNVSKGMYYSITFCAARTCAQEERLNITVAP  453
            AVRLGNEASIKQ + V++G++YS+TF  ARTCAQEE+LN++V+P
Sbjct  82   AVRLGNEASIKQRVKVTQGLFYSLTFNVARTCAQEEKLNVSVSP  125


 Score = 63.5 bits (153),  Expect(2) = 2e-44, Method: Compositional matrix adjust.
 Identities = 27/40 (68%), Positives = 32/40 (80%), Gaps = 0/40 (0%)
 Frame = +2

Query  452  RDSDVLPIQTLYSINGWDCYPWAFQAENPQAEIIIHNPGV  571
            RD  +LP+QT+YS NGWD Y WAFQA+ P+ EI IHNPGV
Sbjct  130  RDWGILPMQTMYSSNGWDAYAWAFQADGPEVEISIHNPGV  169



>ref|XP_009401767.1| PREDICTED: uncharacterized protein LOC103985700 [Musa acuminata 
subsp. malaccensis]
Length=368

 Score =   154 bits (388),  Expect(2) = 3e-44, Method: Compositional matrix adjust.
 Identities = 73/104 (70%), Positives = 84/104 (81%), Gaps = 0/104 (0%)
 Frame = +1

Query  142  TDGLLVNGNFEAPVKKTDLNGTIVTRHDAVPGWTVTGFVEYIQAGQKQGDMQLVVPEGFA  321
            TDGLL NGNFEA  K +++NGT V    A+P W ++GFVEYI++G KQGDM LVVPEG  
Sbjct  23   TDGLLPNGNFEATPKASEMNGTQVLGRYAIPQWEISGFVEYIESGHKQGDMLLVVPEGAY  82

Query  322  AVRLGNEASIKQTLNVSKGMYYSITFCAARTCAQEERLNITVAP  453
            AVRLGNEASIKQ L V KGMYYSITF AARTCAQ+ERLN++V P
Sbjct  83   AVRLGNEASIKQKLTVVKGMYYSITFSAARTCAQDERLNVSVTP  126


 Score = 52.0 bits (123),  Expect(2) = 3e-44, Method: Compositional matrix adjust.
 Identities = 22/39 (56%), Positives = 27/39 (69%), Gaps = 0/39 (0%)
 Frame = +2

Query  455  DSDVLPIQTLYSINGWDCYPWAFQAENPQAEIIIHNPGV  571
            DS +LPIQT+Y   GWD Y WAF+A      ++IHNPGV
Sbjct  127  DSGMLPIQTMYGSVGWDSYAWAFRALFEVVHLVIHNPGV  165



>ref|XP_004486698.1| PREDICTED: uncharacterized protein LOC101495368 [Cicer arietinum]
Length=373

 Score =   153 bits (387),  Expect(2) = 4e-44, Method: Compositional matrix adjust.
 Identities = 68/104 (65%), Positives = 86/104 (83%), Gaps = 0/104 (0%)
 Frame = +1

Query  142  TDGLLVNGNFEAPVKKTDLNGTIVTRHDAVPGWTVTGFVEYIQAGQKQGDMQLVVPEGFA  321
            TDGLL NG+FE   K ++L G++VT HD +P WT++GFVEYI++GQKQGDM L+VPEG  
Sbjct  22   TDGLLPNGDFEVGPKASELKGSVVTSHDGIPNWTISGFVEYIKSGQKQGDMLLIVPEGAY  81

Query  322  AVRLGNEASIKQTLNVSKGMYYSITFCAARTCAQEERLNITVAP  453
            AVRLGNEA IKQ + ++KG +YSITF AARTCAQEE+LN++V P
Sbjct  82   AVRLGNEAYIKQKVKLNKGSFYSITFSAARTCAQEEKLNVSVVP  125


 Score = 52.0 bits (123),  Expect(2) = 4e-44, Method: Compositional matrix adjust.
 Identities = 20/41 (49%), Positives = 29/41 (71%), Gaps = 0/41 (0%)
 Frame = +2

Query  449  RRDSDVLPIQTLYSINGWDCYPWAFQAENPQAEIIIHNPGV  571
            +RD  ++PIQT+Y  NGW+ +   F+A+  Q EI+IHN GV
Sbjct  129  KRDYGIIPIQTMYGSNGWESFACGFKADYEQGEIVIHNSGV  169



>ref|XP_011026488.1| PREDICTED: uncharacterized protein LOC105127071 [Populus euphratica]
Length=366

 Score =   149 bits (376),  Expect(2) = 4e-44, Method: Compositional matrix adjust.
 Identities = 70/103 (68%), Positives = 85/103 (83%), Gaps = 0/103 (0%)
 Frame = +1

Query  145  DGLLVNGNFEAPVKKTDLNGTIVTRHDAVPGWTVTGFVEYIQAGQKQGDMQLVVPEGFAA  324
            +GL+ NGNFE   +++D+ GT +    A+P W ++GFVEYI+AGQKQGDM LVVPEG  A
Sbjct  25   EGLVENGNFENSPRQSDMKGTQMIGRYALPNWEISGFVEYIKAGQKQGDMLLVVPEGAYA  84

Query  325  VRLGNEASIKQTLNVSKGMYYSITFCAARTCAQEERLNITVAP  453
            VRLGNEASIKQ LN++KGMYYSITF AARTCAQEE LNI+V+P
Sbjct  85   VRLGNEASIKQRLNLTKGMYYSITFSAARTCAQEETLNISVSP  127


 Score = 55.8 bits (133),  Expect(2) = 4e-44, Method: Compositional matrix adjust.
 Identities = 24/36 (67%), Positives = 27/36 (75%), Gaps = 0/36 (0%)
 Frame = +2

Query  464  VLPIQTLYSINGWDCYPWAFQAENPQAEIIIHNPGV  571
            VLP+QTLYS NGWD Y WAF+A     E +IHNPGV
Sbjct  131  VLPMQTLYSSNGWDSYAWAFKALISPVEFVIHNPGV  166



>ref|XP_007013813.1| Uncharacterized protein isoform 1 [Theobroma cacao]
 gb|EOY31432.1| Uncharacterized protein isoform 1 [Theobroma cacao]
Length=412

 Score =   149 bits (376),  Expect(2) = 4e-44, Method: Compositional matrix adjust.
 Identities = 71/103 (69%), Positives = 81/103 (79%), Gaps = 0/103 (0%)
 Frame = +1

Query  145  DGLLVNGNFEAPVKKTDLNGTIVTRHDAVPGWTVTGFVEYIQAGQKQGDMQLVVPEGFAA  324
            DGLL NGNFE     T++ GT+V    A+PGW   GFVEYI++GQKQGDM LVVPEG  A
Sbjct  71   DGLLDNGNFERAPNATNMKGTVVVGRYAIPGWINEGFVEYIKSGQKQGDMLLVVPEGAYA  130

Query  325  VRLGNEASIKQTLNVSKGMYYSITFCAARTCAQEERLNITVAP  453
            VRLGN+ASIKQ + V  G+YYSITF AARTCAQEERLN+TVAP
Sbjct  131  VRLGNDASIKQAIKVIVGLYYSITFSAARTCAQEERLNVTVAP  173


 Score = 55.8 bits (133),  Expect(2) = 4e-44, Method: Compositional matrix adjust.
 Identities = 25/38 (66%), Positives = 28/38 (74%), Gaps = 0/38 (0%)
 Frame = +2

Query  455  DSDVLPIQTLYSINGWDCYPWAFQAENPQAEIIIHNPG  568
            DS VLPIQT+YS NGWD Y WAF+A     E+IIHN G
Sbjct  174  DSGVLPIQTVYSSNGWDSYAWAFKAIAAVIELIIHNTG  211



>ref|XP_007013814.1| Uncharacterized protein isoform 2 [Theobroma cacao]
 gb|EOY31433.1| Uncharacterized protein isoform 2 [Theobroma cacao]
Length=375

 Score =   149 bits (375),  Expect(2) = 4e-44, Method: Compositional matrix adjust.
 Identities = 71/103 (69%), Positives = 81/103 (79%), Gaps = 0/103 (0%)
 Frame = +1

Query  145  DGLLVNGNFEAPVKKTDLNGTIVTRHDAVPGWTVTGFVEYIQAGQKQGDMQLVVPEGFAA  324
            DGLL NGNFE     T++ GT+V    A+PGW   GFVEYI++GQKQGDM LVVPEG  A
Sbjct  34   DGLLDNGNFERAPNATNMKGTVVVGRYAIPGWINEGFVEYIKSGQKQGDMLLVVPEGAYA  93

Query  325  VRLGNEASIKQTLNVSKGMYYSITFCAARTCAQEERLNITVAP  453
            VRLGN+ASIKQ + V  G+YYSITF AARTCAQEERLN+TVAP
Sbjct  94   VRLGNDASIKQAIKVIVGLYYSITFSAARTCAQEERLNVTVAP  136


 Score = 56.2 bits (134),  Expect(2) = 4e-44, Method: Compositional matrix adjust.
 Identities = 25/38 (66%), Positives = 28/38 (74%), Gaps = 0/38 (0%)
 Frame = +2

Query  455  DSDVLPIQTLYSINGWDCYPWAFQAENPQAEIIIHNPG  568
            DS VLPIQT+YS NGWD Y WAF+A     E+IIHN G
Sbjct  137  DSGVLPIQTVYSSNGWDSYAWAFKAIAAVIELIIHNTG  174



>ref|XP_011040006.1| PREDICTED: uncharacterized protein LOC105136392 [Populus euphratica]
Length=396

 Score =   143 bits (360),  Expect(2) = 4e-44, Method: Compositional matrix adjust.
 Identities = 63/104 (61%), Positives = 84/104 (81%), Gaps = 0/104 (0%)
 Frame = +1

Query  142  TDGLLVNGNFEAPVKKTDLNGTIVTRHDAVPGWTVTGFVEYIQAGQKQGDMQLVVPEGFA  321
            TDGLL NG+FE   K +++ GT+VT   A+P W ++GF+EYI++G KQGDM LVVP G  
Sbjct  44   TDGLLPNGDFEQGPKPSEMKGTVVTAKSAIPNWEISGFIEYIKSGHKQGDMVLVVPAGAY  103

Query  322  AVRLGNEASIKQTLNVSKGMYYSITFCAARTCAQEERLNITVAP  453
            AVRLGNEASIKQ + V++G++YS+TF  ARTCAQEE+LN++V+P
Sbjct  104  AVRLGNEASIKQRVKVTQGLFYSLTFNVARTCAQEEKLNVSVSP  147


 Score = 62.0 bits (149),  Expect(2) = 4e-44, Method: Compositional matrix adjust.
 Identities = 26/40 (65%), Positives = 32/40 (80%), Gaps = 0/40 (0%)
 Frame = +2

Query  452  RDSDVLPIQTLYSINGWDCYPWAFQAENPQAEIIIHNPGV  571
            RD  +LP+QT+YS NGWD Y WAFQA+ P+ +I IHNPGV
Sbjct  152  RDWGILPMQTMYSSNGWDAYAWAFQADGPEVKISIHNPGV  191



>emb|CDY19801.1| BnaA09g04540D [Brassica napus]
Length=370

 Score =   142 bits (357),  Expect(2) = 5e-44, Method: Compositional matrix adjust.
 Identities = 71/105 (68%), Positives = 80/105 (76%), Gaps = 2/105 (2%)
 Frame = +1

Query  145  DGLLVNGNFEAPVKKTDLNGTIVTRHDAVPGWTVTGFVEYIQA--GQKQGDMQLVVPEGF  318
            DG+L NG+FE   K +D+ GT V    A+P W VTGFVEYI +  G KQGDM LVVP G 
Sbjct  27   DGILPNGDFELGPKPSDIKGTEVLNKMAIPNWEVTGFVEYISSASGHKQGDMLLVVPAGK  86

Query  319  AAVRLGNEASIKQTLNVSKGMYYSITFCAARTCAQEERLNITVAP  453
             AVRLGNEASIKQ L V KGMYYS+TF AARTCAQ+ERLNI+VAP
Sbjct  87   FAVRLGNEASIKQRLKVVKGMYYSLTFSAARTCAQDERLNISVAP  131


 Score = 62.4 bits (150),  Expect(2) = 5e-44, Method: Compositional matrix adjust.
 Identities = 25/38 (66%), Positives = 32/38 (84%), Gaps = 0/38 (0%)
 Frame = +2

Query  455  DSDVLPIQTLYSINGWDCYPWAFQAENPQAEIIIHNPG  568
            DS V+P+QT+YS +GWD Y WAFQAE+  AE++IHNPG
Sbjct  132  DSGVIPVQTVYSSSGWDLYAWAFQAESEVAEVVIHNPG  169



>ref|XP_002324280.2| hypothetical protein POPTR_0018s01390g [Populus trichocarpa]
 gb|EEF02845.2| hypothetical protein POPTR_0018s01390g [Populus trichocarpa]
Length=398

 Score =   149 bits (377),  Expect(2) = 6e-44, Method: Compositional matrix adjust.
 Identities = 70/103 (68%), Positives = 85/103 (83%), Gaps = 0/103 (0%)
 Frame = +1

Query  145  DGLLVNGNFEAPVKKTDLNGTIVTRHDAVPGWTVTGFVEYIQAGQKQGDMQLVVPEGFAA  324
            +GL+ NGNFE   K++D+ GT +    A+P W ++GFVEYI+AGQKQGDM LVVPEG  A
Sbjct  57   EGLVENGNFELSPKQSDMKGTQMIGRYALPKWEISGFVEYIKAGQKQGDMLLVVPEGAYA  116

Query  325  VRLGNEASIKQTLNVSKGMYYSITFCAARTCAQEERLNITVAP  453
            +RLGNEASIKQ LN++KGMYYSITF AARTCAQEE LNI+V+P
Sbjct  117  IRLGNEASIKQRLNLTKGMYYSITFSAARTCAQEETLNISVSP  159


 Score = 54.7 bits (130),  Expect(2) = 6e-44, Method: Compositional matrix adjust.
 Identities = 23/36 (64%), Positives = 27/36 (75%), Gaps = 0/36 (0%)
 Frame = +2

Query  464  VLPIQTLYSINGWDCYPWAFQAENPQAEIIIHNPGV  571
            VLP+QT+YS NGWD Y WAF+A     E +IHNPGV
Sbjct  163  VLPMQTMYSSNGWDSYAWAFKALISPVEFVIHNPGV  198



>ref|XP_009125963.1| PREDICTED: uncharacterized protein LOC103850912 [Brassica rapa]
 emb|CDX75247.1| BnaA01g04550D [Brassica napus]
Length=365

 Score =   146 bits (368),  Expect(2) = 6e-44, Method: Compositional matrix adjust.
 Identities = 69/103 (67%), Positives = 80/103 (78%), Gaps = 0/103 (0%)
 Frame = +1

Query  145  DGLLVNGNFEAPVKKTDLNGTIVTRHDAVPGWTVTGFVEYIQAGQKQGDMQLVVPEGFAA  324
            DGLL NG+FE     TD+ GT V    A+P W ++GFVEYI +G KQGDM LVVP+G  A
Sbjct  24   DGLLPNGDFELGPHHTDMKGTQVMNKTAIPSWELSGFVEYIPSGHKQGDMILVVPKGAFA  83

Query  325  VRLGNEASIKQTLNVSKGMYYSITFCAARTCAQEERLNITVAP  453
            VRLGNEASIKQ +NV KG YYSITF AARTCAQ+ERLN++VAP
Sbjct  84   VRLGNEASIKQKINVKKGSYYSITFSAARTCAQDERLNVSVAP  126


 Score = 58.2 bits (139),  Expect(2) = 6e-44, Method: Compositional matrix adjust.
 Identities = 23/36 (64%), Positives = 31/36 (86%), Gaps = 0/36 (0%)
 Frame = +2

Query  464  VLPIQTLYSINGWDCYPWAFQAENPQAEIIIHNPGV  571
            V+PIQT+YS +GWD Y WAF+A++  AE++IHNPGV
Sbjct  130  VMPIQTVYSSSGWDLYSWAFKAQSDYAEVVIHNPGV  165



>ref|XP_008228640.1| PREDICTED: uncharacterized protein LOC103328032 [Prunus mume]
Length=375

 Score =   151 bits (381),  Expect(2) = 1e-43, Method: Compositional matrix adjust.
 Identities = 70/108 (65%), Positives = 87/108 (81%), Gaps = 0/108 (0%)
 Frame = +1

Query  142  TDGLLVNGNFEAPVKKTDLNGTIVTRHDAVPGWTVTGFVEYIQAGQKQGDMQLVVPEGFA  321
            TDGLL NGNFE   KK+DL GT+VT+ +A+P W V+G+VEYI++GQKQGDM LVVPEG  
Sbjct  26   TDGLLPNGNFEYGPKKSDLKGTVVTQPNAIPNWEVSGYVEYIKSGQKQGDMLLVVPEGGF  85

Query  322  AVRLGNEASIKQTLNVSKGMYYSITFCAARTCAQEERLNITVAPGLRR  465
            AVRLG EASIKQ + V+KG +YS+TF AARTC QEE LN+++ P L +
Sbjct  86   AVRLGKEASIKQKIKVTKGRFYSVTFSAARTCGQEETLNLSINPNLEK  133


 Score = 52.0 bits (123),  Expect(2) = 1e-43, Method: Compositional matrix adjust.
 Identities = 21/40 (53%), Positives = 27/40 (68%), Gaps = 0/40 (0%)
 Frame = +2

Query  449  RRDSDVLPIQTLYSINGWDCYPWAFQAENPQAEIIIHNPG  568
            + D  + PIQT+YS NGWD Y W F A++ + E  IHNPG
Sbjct  133  KNDWGIFPIQTMYSSNGWDSYAWGFNADSDELEFRIHNPG  172



>ref|XP_010541619.1| PREDICTED: uncharacterized protein LOC104815031 [Tarenaya hassleriana]
Length=364

 Score =   144 bits (364),  Expect(2) = 2e-43, Method: Compositional matrix adjust.
 Identities = 67/103 (65%), Positives = 81/103 (79%), Gaps = 0/103 (0%)
 Frame = +1

Query  145  DGLLVNGNFEAPVKKTDLNGTIVTRHDAVPGWTVTGFVEYIQAGQKQGDMQLVVPEGFAA  324
            DG+L NG+FE   K +D+ GT V    A+P W ++GFVEYI++GQKQGDM LVVP G  A
Sbjct  23   DGMLPNGDFELGPKPSDMKGTQVINRSAIPNWELSGFVEYIKSGQKQGDMLLVVPAGKFA  82

Query  325  VRLGNEASIKQTLNVSKGMYYSITFCAARTCAQEERLNITVAP  453
            +RLGNEASIKQ L + KGMYYS+TF AARTCAQ+ERLNI+ AP
Sbjct  83   IRLGNEASIKQRLRLIKGMYYSLTFSAARTCAQDERLNISAAP  125


 Score = 57.8 bits (138),  Expect(2) = 2e-43, Method: Compositional matrix adjust.
 Identities = 24/36 (67%), Positives = 28/36 (78%), Gaps = 0/36 (0%)
 Frame = +2

Query  464  VLPIQTLYSINGWDCYPWAFQAENPQAEIIIHNPGV  571
            V+PIQT+YS  GWD Y WAFQAE    E++IHNPGV
Sbjct  129  VIPIQTVYSSYGWDLYAWAFQAETEVVEVVIHNPGV  164



>ref|XP_010432718.1| PREDICTED: uncharacterized protein LOC104716937 [Camelina sativa]
Length=365

 Score =   145 bits (365),  Expect(2) = 2e-43, Method: Compositional matrix adjust.
 Identities = 68/103 (66%), Positives = 82/103 (80%), Gaps = 0/103 (0%)
 Frame = +1

Query  145  DGLLVNGNFEAPVKKTDLNGTIVTRHDAVPGWTVTGFVEYIQAGQKQGDMQLVVPEGFAA  324
            DGLL NG+FE   + +D+ GT V    A+P W ++GFVEYI +GQKQGDM LVVP+G  A
Sbjct  24   DGLLPNGDFELGPRHSDMKGTQVINKAAIPNWELSGFVEYIPSGQKQGDMILVVPKGAFA  83

Query  325  VRLGNEASIKQTLNVSKGMYYSITFCAARTCAQEERLNITVAP  453
            VRLGNEASIKQ ++V KG YYSITF AARTCAQ+ERLN++VAP
Sbjct  84   VRLGNEASIKQKISVKKGSYYSITFSAARTCAQDERLNVSVAP  126


 Score = 57.4 bits (137),  Expect(2) = 2e-43, Method: Compositional matrix adjust.
 Identities = 23/36 (64%), Positives = 31/36 (86%), Gaps = 0/36 (0%)
 Frame = +2

Query  464  VLPIQTLYSINGWDCYPWAFQAENPQAEIIIHNPGV  571
            V+PIQT+YS +GWD Y WAF+A++  A+I+IHNPGV
Sbjct  130  VMPIQTVYSSSGWDLYSWAFKAQSDYADIVIHNPGV  165



>emb|CDY54909.1| BnaC02g48660D [Brassica napus]
Length=339

 Score =   140 bits (352),  Expect(2) = 2e-43, Method: Compositional matrix adjust.
 Identities = 67/101 (66%), Positives = 77/101 (76%), Gaps = 0/101 (0%)
 Frame = +1

Query  151  LLVNGNFEAPVKKTDLNGTIVTRHDAVPGWTVTGFVEYIQAGQKQGDMQLVVPEGFAAVR  330
            +L NG+FE   K +D+ GT V    A+P W +TGFVEYI +G  QGDM LVVP G  AVR
Sbjct  1    MLPNGDFELGPKPSDMKGTEVLNRMAIPNWEITGFVEYISSGHTQGDMLLVVPAGKFAVR  60

Query  331  LGNEASIKQTLNVSKGMYYSITFCAARTCAQEERLNITVAP  453
            LGNEASIKQ L V KGMYYS+TF AARTCAQ+ERLNI+VAP
Sbjct  61   LGNEASIKQRLKVVKGMYYSLTFSAARTCAQDERLNISVAP  101


 Score = 62.4 bits (150),  Expect(2) = 2e-43, Method: Compositional matrix adjust.
 Identities = 26/38 (68%), Positives = 32/38 (84%), Gaps = 0/38 (0%)
 Frame = +2

Query  455  DSDVLPIQTLYSINGWDCYPWAFQAENPQAEIIIHNPG  568
            DS V+P+QT+YS +GWD Y WAFQAE+  AEI+IHNPG
Sbjct  102  DSGVIPVQTVYSSSGWDLYSWAFQAESEIAEIVIHNPG  139



>ref|XP_009407651.1| PREDICTED: uncharacterized protein LOC103990295 [Musa acuminata 
subsp. malaccensis]
Length=367

 Score =   148 bits (373),  Expect(2) = 3e-43, Method: Compositional matrix adjust.
 Identities = 71/104 (68%), Positives = 82/104 (79%), Gaps = 0/104 (0%)
 Frame = +1

Query  142  TDGLLVNGNFEAPVKKTDLNGTIVTRHDAVPGWTVTGFVEYIQAGQKQGDMQLVVPEGFA  321
            TDGLL NGNFE   K   L GT V   DA+P W +TGFVEYIQ GQKQGDM LVVPEG  
Sbjct  22   TDGLLPNGNFEQGPKPWQLKGTKVAGRDAIPRWQITGFVEYIQWGQKQGDMLLVVPEGSY  81

Query  322  AVRLGNEASIKQTLNVSKGMYYSITFCAARTCAQEERLNITVAP  453
            AVRLGN+ASIKQ++ V+KG+ YS+TF AARTCAQEERLN++ +P
Sbjct  82   AVRLGNDASIKQSVKVTKGVRYSLTFSAARTCAQEERLNVSASP  125


 Score = 54.3 bits (129),  Expect(2) = 3e-43, Method: Compositional matrix adjust.
 Identities = 22/39 (56%), Positives = 31/39 (79%), Gaps = 0/39 (0%)
 Frame = +2

Query  455  DSDVLPIQTLYSINGWDCYPWAFQAENPQAEIIIHNPGV  571
            +S VLP+QT+YS NGWD Y WA+ A++ + E++IHN GV
Sbjct  126  ESGVLPMQTMYSSNGWDSYAWAWLAKSDEVEVVIHNTGV  164



>gb|KDP37140.1| hypothetical protein JCGZ_06196 [Jatropha curcas]
Length=375

 Score =   144 bits (362),  Expect(2) = 3e-43, Method: Compositional matrix adjust.
 Identities = 67/107 (63%), Positives = 84/107 (79%), Gaps = 0/107 (0%)
 Frame = +1

Query  142  TDGLLVNGNFEAPVKKTDLNGTIVTRHDAVPGWTVTGFVEYIQAGQKQGDMQLVVPEGFA  321
            TDGLL NG+FE   K   + GT+VT  +A+P W ++G+VEYI++GQKQGDM LVVP G  
Sbjct  24   TDGLLPNGDFEHGPKPWQMKGTVVTAKNAIPNWEISGYVEYIKSGQKQGDMLLVVPGGAF  83

Query  322  AVRLGNEASIKQTLNVSKGMYYSITFCAARTCAQEERLNITVAPGLR  462
            AVRLGNEASIKQ ++V+K  YYSITF  ARTCAQEE+LN++V+P L 
Sbjct  84   AVRLGNEASIKQKISVTKDSYYSITFNVARTCAQEEKLNVSVSPNLE  130


 Score = 58.2 bits (139),  Expect(2) = 3e-43, Method: Compositional matrix adjust.
 Identities = 25/40 (63%), Positives = 31/40 (78%), Gaps = 0/40 (0%)
 Frame = +2

Query  452  RDSDVLPIQTLYSINGWDCYPWAFQAENPQAEIIIHNPGV  571
            +D  +LP+QT+YS NGWD Y WAFQA+  + EI IHNPGV
Sbjct  132  KDWGILPMQTVYSSNGWDSYSWAFQADASEVEISIHNPGV  171



>ref|XP_002298115.2| hypothetical protein POPTR_0001s17430g [Populus trichocarpa]
 gb|EEE82920.2| hypothetical protein POPTR_0001s17430g [Populus trichocarpa]
Length=389

 Score =   140 bits (354),  Expect(2) = 3e-43, Method: Compositional matrix adjust.
 Identities = 63/104 (61%), Positives = 84/104 (81%), Gaps = 0/104 (0%)
 Frame = +1

Query  142  TDGLLVNGNFEAPVKKTDLNGTIVTRHDAVPGWTVTGFVEYIQAGQKQGDMQLVVPEGFA  321
            TDGLL NG+FE   K +++ GT+VT  +A+P W ++GF+EYI++G KQGDM LVVP G  
Sbjct  38   TDGLLPNGDFEYGPKPSEMKGTVVTAKNAIPNWEISGFIEYIKSGHKQGDMLLVVPVGAY  97

Query  322  AVRLGNEASIKQTLNVSKGMYYSITFCAARTCAQEERLNITVAP  453
            AVRLGNEASIKQ + V++G +YS+TF  ARTCAQEE+LN++V+P
Sbjct  98   AVRLGNEASIKQKVKVTQGEFYSLTFNVARTCAQEEKLNLSVSP  141


 Score = 61.2 bits (147),  Expect(2) = 3e-43, Method: Compositional matrix adjust.
 Identities = 26/40 (65%), Positives = 31/40 (78%), Gaps = 0/40 (0%)
 Frame = +2

Query  452  RDSDVLPIQTLYSINGWDCYPWAFQAENPQAEIIIHNPGV  571
            RD  +LP+QT+YS NGWD Y WAF A+ P+ EI IHNPGV
Sbjct  146  RDWGILPMQTMYSSNGWDAYAWAFHADGPEVEISIHNPGV  185



>emb|CDX68849.1| BnaC01g06040D [Brassica napus]
Length=365

 Score =   144 bits (363),  Expect(2) = 3e-43, Method: Compositional matrix adjust.
 Identities = 68/103 (66%), Positives = 80/103 (78%), Gaps = 0/103 (0%)
 Frame = +1

Query  145  DGLLVNGNFEAPVKKTDLNGTIVTRHDAVPGWTVTGFVEYIQAGQKQGDMQLVVPEGFAA  324
            DGLL NG+FE     TD+ GT V    A+P W ++GFVEYI +G KQGDM LVVP+G  A
Sbjct  24   DGLLPNGDFELGPHHTDMKGTQVMNKTAIPSWELSGFVEYIPSGHKQGDMILVVPKGAFA  83

Query  325  VRLGNEASIKQTLNVSKGMYYSITFCAARTCAQEERLNITVAP  453
            VRLGNEASIKQ ++V KG YYSITF AARTCAQ+ERLN++VAP
Sbjct  84   VRLGNEASIKQKISVKKGSYYSITFSAARTCAQDERLNVSVAP  126


 Score = 57.8 bits (138),  Expect(2) = 3e-43, Method: Compositional matrix adjust.
 Identities = 23/36 (64%), Positives = 30/36 (83%), Gaps = 0/36 (0%)
 Frame = +2

Query  464  VLPIQTLYSINGWDCYPWAFQAENPQAEIIIHNPGV  571
            V+PIQT+YS +GWD Y WAF+A+   AE++IHNPGV
Sbjct  130  VMPIQTVYSSSGWDLYSWAFKAQGDYAEVVIHNPGV  165



>ref|XP_004978106.1| PREDICTED: uncharacterized protein LOC101761311 [Setaria italica]
Length=381

 Score =   140 bits (354),  Expect(2) = 5e-43, Method: Compositional matrix adjust.
 Identities = 69/103 (67%), Positives = 77/103 (75%), Gaps = 0/103 (0%)
 Frame = +1

Query  145  DGLLVNGNFEAPVKKTDLNGTIVTRHDAVPGWTVTGFVEYIQAGQKQGDMQLVVPEGFAA  324
            DGLL NGNFE     + LNGT V    A+P W ++GFVEYI   QKQGDM L VPEG  A
Sbjct  34   DGLLPNGNFEEAPATSQLNGTRVMGRYAIPHWEISGFVEYIGPAQKQGDMILPVPEGAYA  93

Query  325  VRLGNEASIKQTLNVSKGMYYSITFCAARTCAQEERLNITVAP  453
            VRLGNEASI+Q LNV++  YYSITF AARTCAQ ERLN+TVAP
Sbjct  94   VRLGNEASIRQLLNVTRKAYYSITFSAARTCAQAERLNVTVAP  136


 Score = 60.5 bits (145),  Expect(2) = 5e-43, Method: Compositional matrix adjust.
 Identities = 24/39 (62%), Positives = 30/39 (77%), Gaps = 0/39 (0%)
 Frame = +2

Query  455  DSDVLPIQTLYSINGWDCYPWAFQAENPQAEIIIHNPGV  571
            +SDVLPIQT+Y+ NGWD Y WAF+A      +I+HNPGV
Sbjct  137  ESDVLPIQTVYTANGWDSYSWAFKARRSAVTLIVHNPGV  175



>ref|XP_011035644.1| PREDICTED: uncharacterized protein LOC105133377 [Populus euphratica]
Length=373

 Score =   138 bits (347),  Expect(2) = 6e-43, Method: Compositional matrix adjust.
 Identities = 62/103 (60%), Positives = 83/103 (81%), Gaps = 0/103 (0%)
 Frame = +1

Query  142  TDGLLVNGNFEAPVKKTDLNGTIVTRHDAVPGWTVTGFVEYIQAGQKQGDMQLVVPEGFA  321
            TDGLL NG+FE   K +++ GT+VT  +A+P W ++GF+EYI++G KQGDM LVVP G  
Sbjct  22   TDGLLPNGDFEYGPKPSEMKGTVVTAKNAIPNWEISGFIEYIKSGHKQGDMLLVVPVGAY  81

Query  322  AVRLGNEASIKQTLNVSKGMYYSITFCAARTCAQEERLNITVA  450
            AVRLGNEASIKQ + V++G +YS+TF  ARTCAQEE+LN++V+
Sbjct  82   AVRLGNEASIKQKVKVTQGKFYSLTFNVARTCAQEEKLNLSVS  124


 Score = 63.2 bits (152),  Expect(2) = 6e-43, Method: Compositional matrix adjust.
 Identities = 27/40 (68%), Positives = 31/40 (78%), Gaps = 0/40 (0%)
 Frame = +2

Query  452  RDSDVLPIQTLYSINGWDCYPWAFQAENPQAEIIIHNPGV  571
            RD  +LP+QT+YS NGWD Y WAF AE P+ EI IHNPGV
Sbjct  130  RDWGILPMQTMYSSNGWDAYAWAFHAEGPEVEISIHNPGV  169



>ref|XP_010654739.1| PREDICTED: uncharacterized protein LOC100261739 [Vitis vinifera]
Length=372

 Score =   146 bits (368),  Expect(2) = 6e-43, Method: Compositional matrix adjust.
 Identities = 69/104 (66%), Positives = 82/104 (79%), Gaps = 0/104 (0%)
 Frame = +1

Query  142  TDGLLVNGNFEAPVKKTDLNGTIVTRHDAVPGWTVTGFVEYIQAGQKQGDMQLVVPEGFA  321
            T+GLL NGNFE   K  ++ GT V    A+P W ++G+VEYI++GQKQGDM L+VPEG  
Sbjct  23   TNGLLPNGNFEYGPKPWEMKGTKVMASRAIPKWEISGYVEYIKSGQKQGDMLLIVPEGAY  82

Query  322  AVRLGNEASIKQTLNVSKGMYYSITFCAARTCAQEERLNITVAP  453
            AVRLGNEASIKQ + V KGMYYSITF AARTCAQEE LN++VAP
Sbjct  83   AVRLGNEASIKQKVKVVKGMYYSITFSAARTCAQEETLNVSVAP  126


 Score = 55.1 bits (131),  Expect(2) = 6e-43, Method: Compositional matrix adjust.
 Identities = 22/36 (61%), Positives = 28/36 (78%), Gaps = 0/36 (0%)
 Frame = +2

Query  464  VLPIQTLYSINGWDCYPWAFQAENPQAEIIIHNPGV  571
            +LP+QT+YS NGWD Y W FQA++ +  I IHNPGV
Sbjct  135  MLPMQTMYSSNGWDSYAWGFQADDKEIAISIHNPGV  170



>gb|KDO52908.1| hypothetical protein CISIN_1g0399092mg, partial [Citrus sinensis]
Length=315

 Score =   144 bits (364),  Expect(2) = 8e-43, Method: Compositional matrix adjust.
 Identities = 64/104 (62%), Positives = 84/104 (81%), Gaps = 0/104 (0%)
 Frame = +1

Query  151  LLVNGNFEAPVKKTDLNGTIVTRHDAVPGWTVTGFVEYIQAGQKQGDMQLVVPEGFAAVR  330
            LL NGNFE   K++ + GT+VT  +A+P W ++G+VEYI++G KQGDM L+VPEG  AVR
Sbjct  1    LLPNGNFEYGPKRSQMKGTVVTHPNAIPNWQISGYVEYIKSGHKQGDMLLIVPEGVFAVR  60

Query  331  LGNEASIKQTLNVSKGMYYSITFCAARTCAQEERLNITVAPGLR  462
            LGNEASIKQ + V+KG +YS+TF AARTCAQEE+LN++V+P L 
Sbjct  61   LGNEASIKQNIKVTKGRFYSMTFSAARTCAQEEKLNVSVSPNLE  104


 Score = 56.2 bits (134),  Expect(2) = 8e-43, Method: Compositional matrix adjust.
 Identities = 23/36 (64%), Positives = 28/36 (78%), Gaps = 0/36 (0%)
 Frame = +2

Query  464  VLPIQTLYSINGWDCYPWAFQAENPQAEIIIHNPGV  571
            +LP+QT+YS NGWD Y WAF A+  + EI IHNPGV
Sbjct  110  ILPMQTMYSNNGWDSYAWAFVADAEEVEITIHNPGV  145



>emb|CBI36253.3| unnamed protein product [Vitis vinifera]
Length=405

 Score =   145 bits (366),  Expect(2) = 9e-43, Method: Compositional matrix adjust.
 Identities = 69/104 (66%), Positives = 82/104 (79%), Gaps = 0/104 (0%)
 Frame = +1

Query  142  TDGLLVNGNFEAPVKKTDLNGTIVTRHDAVPGWTVTGFVEYIQAGQKQGDMQLVVPEGFA  321
            T+GLL NGNFE   K  ++ GT V    A+P W ++G+VEYI++GQKQGDM L+VPEG  
Sbjct  23   TNGLLPNGNFEYGPKPWEMKGTKVMASRAIPKWEISGYVEYIKSGQKQGDMLLIVPEGAY  82

Query  322  AVRLGNEASIKQTLNVSKGMYYSITFCAARTCAQEERLNITVAP  453
            AVRLGNEASIKQ + V KGMYYSITF AARTCAQEE LN++VAP
Sbjct  83   AVRLGNEASIKQKVKVVKGMYYSITFSAARTCAQEETLNVSVAP  126


 Score = 55.1 bits (131),  Expect(2) = 9e-43, Method: Compositional matrix adjust.
 Identities = 22/36 (61%), Positives = 28/36 (78%), Gaps = 0/36 (0%)
 Frame = +2

Query  464  VLPIQTLYSINGWDCYPWAFQAENPQAEIIIHNPGV  571
            +LP+QT+YS NGWD Y W FQA++ +  I IHNPGV
Sbjct  135  MLPMQTMYSSNGWDSYAWGFQADDKEIAISIHNPGV  170



>ref|XP_010445004.1| PREDICTED: uncharacterized protein LOC104727612, partial [Camelina 
sativa]
Length=325

 Score =   143 bits (361),  Expect(2) = 9e-43, Method: Compositional matrix adjust.
 Identities = 68/103 (66%), Positives = 81/103 (79%), Gaps = 0/103 (0%)
 Frame = +1

Query  145  DGLLVNGNFEAPVKKTDLNGTIVTRHDAVPGWTVTGFVEYIQAGQKQGDMQLVVPEGFAA  324
            DGLL NG+FE   + +D+ GT V    A+P W ++GFVEYI +GQKQGDM LVVP+G  A
Sbjct  24   DGLLPNGDFELGPRHSDMKGTQVINKAAIPNWELSGFVEYIPSGQKQGDMILVVPKGAFA  83

Query  325  VRLGNEASIKQTLNVSKGMYYSITFCAARTCAQEERLNITVAP  453
            VRLGNEASIKQ + V KG YYSITF AARTCAQ+ERLN++VAP
Sbjct  84   VRLGNEASIKQKIIVKKGSYYSITFSAARTCAQDERLNVSVAP  126


 Score = 57.0 bits (136),  Expect(2) = 9e-43, Method: Compositional matrix adjust.
 Identities = 23/36 (64%), Positives = 31/36 (86%), Gaps = 0/36 (0%)
 Frame = +2

Query  464  VLPIQTLYSINGWDCYPWAFQAENPQAEIIIHNPGV  571
            V+PIQT+YS +GWD Y WAF+A++  A+I+IHNPGV
Sbjct  130  VMPIQTVYSSSGWDLYSWAFKAQSDYADIVIHNPGV  165



>ref|XP_010539514.1| PREDICTED: uncharacterized protein LOC104813570 [Tarenaya hassleriana]
Length=365

 Score =   142 bits (359),  Expect(2) = 1e-42, Method: Compositional matrix adjust.
 Identities = 67/101 (66%), Positives = 80/101 (79%), Gaps = 0/101 (0%)
 Frame = +1

Query  145  DGLLVNGNFEAPVKKTDLNGTIVTRHDAVPGWTVTGFVEYIQAGQKQGDMQLVVPEGFAA  324
            DGLL NGNFE   K + L G +VT   A+P W ++G+VEYI+AGQ QGDM LVVPEG +A
Sbjct  22   DGLLPNGNFELGPKSSQLKGVLVTDRAAIPKWEISGYVEYIKAGQTQGDMLLVVPEGSSA  81

Query  325  VRLGNEASIKQTLNVSKGMYYSITFCAARTCAQEERLNITV  447
            VRLGNEASI+Q ++V  G +YSITF AARTCAQEERLNI+V
Sbjct  82   VRLGNEASIRQKISVRTGQFYSITFSAARTCAQEERLNISV  122


 Score = 57.8 bits (138),  Expect(2) = 1e-42, Method: Compositional matrix adjust.
 Identities = 23/39 (59%), Positives = 30/39 (77%), Gaps = 0/39 (0%)
 Frame = +2

Query  455  DSDVLPIQTLYSINGWDCYPWAFQAENPQAEIIIHNPGV  571
            +S ++PIQT+YS NGWD Y WAF+A  P  E+ IHNPG+
Sbjct  125  ESGIIPIQTMYSSNGWDSYAWAFKAGGPDIEVRIHNPGL  163



>ref|XP_010526203.1| PREDICTED: uncharacterized protein LOC104803829 [Tarenaya hassleriana]
Length=363

 Score =   142 bits (359),  Expect(2) = 1e-42, Method: Compositional matrix adjust.
 Identities = 65/103 (63%), Positives = 81/103 (79%), Gaps = 0/103 (0%)
 Frame = +1

Query  145  DGLLVNGNFEAPVKKTDLNGTIVTRHDAVPGWTVTGFVEYIQAGQKQGDMQLVVPEGFAA  324
            DGLL NG+FE    ++D+ GT V    A+P W ++GFVEYI +G KQGDM LVVP+G  A
Sbjct  22   DGLLPNGDFEHGPSRSDMKGTQVMNSKAIPNWEISGFVEYIPSGHKQGDMLLVVPKGSFA  81

Query  325  VRLGNEASIKQTLNVSKGMYYSITFCAARTCAQEERLNITVAP  453
            VRLGNEASIKQ++ V+KG YY+ITF AARTCAQ+ERLN++ AP
Sbjct  82   VRLGNEASIKQSVKVAKGSYYAITFSAARTCAQDERLNVSAAP  124


 Score = 57.4 bits (137),  Expect(2) = 1e-42, Method: Compositional matrix adjust.
 Identities = 24/36 (67%), Positives = 29/36 (81%), Gaps = 0/36 (0%)
 Frame = +2

Query  464  VLPIQTLYSINGWDCYPWAFQAENPQAEIIIHNPGV  571
            VLPIQT+YS +GWD Y WAF+A+    EI+IHNPGV
Sbjct  128  VLPIQTVYSSSGWDLYSWAFKAQAEYVEIVIHNPGV  163



>ref|NP_567894.1| uncharacterized protein [Arabidopsis thaliana]
 ref|NP_974661.1| uncharacterized protein [Arabidopsis thaliana]
 gb|AAM65206.1| unknown [Arabidopsis thaliana]
 gb|ABF19001.1| At4g32460 [Arabidopsis thaliana]
 gb|AEE86063.1| uncharacterized protein AT4G32460 [Arabidopsis thaliana]
 gb|AEE86064.1| uncharacterized protein AT4G32460 [Arabidopsis thaliana]
Length=365

 Score =   142 bits (359),  Expect(2) = 1e-42, Method: Compositional matrix adjust.
 Identities = 67/103 (65%), Positives = 81/103 (79%), Gaps = 0/103 (0%)
 Frame = +1

Query  145  DGLLVNGNFEAPVKKTDLNGTIVTRHDAVPGWTVTGFVEYIQAGQKQGDMQLVVPEGFAA  324
            DGLL NG+FE   + +D+ GT V    A+P W ++GFVEYI +G KQGDM LVVP+G  A
Sbjct  24   DGLLPNGDFELGPRHSDMKGTQVINITAIPNWELSGFVEYIPSGHKQGDMILVVPKGAFA  83

Query  325  VRLGNEASIKQTLNVSKGMYYSITFCAARTCAQEERLNITVAP  453
            VRLGNEASIKQ ++V KG YYSITF AARTCAQ+ERLN++VAP
Sbjct  84   VRLGNEASIKQKISVKKGSYYSITFSAARTCAQDERLNVSVAP  126


 Score = 57.4 bits (137),  Expect(2) = 1e-42, Method: Compositional matrix adjust.
 Identities = 23/36 (64%), Positives = 31/36 (86%), Gaps = 0/36 (0%)
 Frame = +2

Query  464  VLPIQTLYSINGWDCYPWAFQAENPQAEIIIHNPGV  571
            V+PIQT+YS +GWD Y WAF+A++  A+I+IHNPGV
Sbjct  130  VMPIQTVYSSSGWDLYSWAFKAQSDYADIVIHNPGV  165



>dbj|BAE98407.1| hypothetical protein [Arabidopsis thaliana]
Length=365

 Score =   142 bits (359),  Expect(2) = 1e-42, Method: Compositional matrix adjust.
 Identities = 67/103 (65%), Positives = 81/103 (79%), Gaps = 0/103 (0%)
 Frame = +1

Query  145  DGLLVNGNFEAPVKKTDLNGTIVTRHDAVPGWTVTGFVEYIQAGQKQGDMQLVVPEGFAA  324
            DGLL NG+FE   + +D+ GT V    A+P W ++GFVEYI +G KQGDM LVVP+G  A
Sbjct  24   DGLLPNGDFELGPRHSDMKGTQVINITAIPNWELSGFVEYIPSGHKQGDMILVVPKGAFA  83

Query  325  VRLGNEASIKQTLNVSKGMYYSITFCAARTCAQEERLNITVAP  453
            VRLGNEASIKQ ++V KG YYSITF AARTCAQ+ERLN++VAP
Sbjct  84   VRLGNEASIKQKISVKKGSYYSITFSAARTCAQDERLNVSVAP  126


 Score = 57.4 bits (137),  Expect(2) = 1e-42, Method: Compositional matrix adjust.
 Identities = 23/36 (64%), Positives = 31/36 (86%), Gaps = 0/36 (0%)
 Frame = +2

Query  464  VLPIQTLYSINGWDCYPWAFQAENPQAEIIIHNPGV  571
            V+PIQT+YS +GWD Y WAF+A++  A+I+IHNPGV
Sbjct  130  VMPIQTVYSSSGWDLYSWAFKAQSDYADIVIHNPGV  165



>ref|XP_010447383.1| PREDICTED: uncharacterized protein LOC104730027 [Camelina sativa]
Length=365

 Score =   142 bits (359),  Expect(2) = 1e-42, Method: Compositional matrix adjust.
 Identities = 66/103 (64%), Positives = 82/103 (80%), Gaps = 0/103 (0%)
 Frame = +1

Query  145  DGLLVNGNFEAPVKKTDLNGTIVTRHDAVPGWTVTGFVEYIQAGQKQGDMQLVVPEGFAA  324
            DGLL NG+FE   + +D+ GT V    ++P W ++GFVEYI +G+KQGDM LVVP+G  A
Sbjct  24   DGLLPNGDFELGPRHSDMKGTQVINKTSIPNWELSGFVEYIPSGKKQGDMILVVPKGAFA  83

Query  325  VRLGNEASIKQTLNVSKGMYYSITFCAARTCAQEERLNITVAP  453
            VRLGNEASIKQ ++V KG YYSITF AARTCAQ+ERLN++VAP
Sbjct  84   VRLGNEASIKQKISVKKGSYYSITFSAARTCAQDERLNVSVAP  126


 Score = 57.4 bits (137),  Expect(2) = 1e-42, Method: Compositional matrix adjust.
 Identities = 23/36 (64%), Positives = 31/36 (86%), Gaps = 0/36 (0%)
 Frame = +2

Query  464  VLPIQTLYSINGWDCYPWAFQAENPQAEIIIHNPGV  571
            V+PIQT+YS +GWD Y WAF+A++  A+I+IHNPGV
Sbjct  130  VMPIQTVYSSSGWDLYSWAFKAQSDYADIVIHNPGV  165



>ref|XP_002867243.1| hypothetical protein ARALYDRAFT_913203 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH43502.1| hypothetical protein ARALYDRAFT_913203 [Arabidopsis lyrata subsp. 
lyrata]
Length=365

 Score =   142 bits (359),  Expect(2) = 1e-42, Method: Compositional matrix adjust.
 Identities = 67/103 (65%), Positives = 81/103 (79%), Gaps = 0/103 (0%)
 Frame = +1

Query  145  DGLLVNGNFEAPVKKTDLNGTIVTRHDAVPGWTVTGFVEYIQAGQKQGDMQLVVPEGFAA  324
            DGLL NG+FE   + +D+ GT V    A+P W ++GFVEYI +G KQGDM LVVP+G  A
Sbjct  24   DGLLPNGDFELGPRHSDMKGTQVINITAIPNWELSGFVEYIPSGHKQGDMILVVPKGAFA  83

Query  325  VRLGNEASIKQTLNVSKGMYYSITFCAARTCAQEERLNITVAP  453
            VRLGNEASIKQ ++V KG YYSITF AARTCAQ+ERLN++VAP
Sbjct  84   VRLGNEASIKQKISVKKGSYYSITFSAARTCAQDERLNVSVAP  126


 Score = 57.4 bits (137),  Expect(2) = 1e-42, Method: Compositional matrix adjust.
 Identities = 23/36 (64%), Positives = 31/36 (86%), Gaps = 0/36 (0%)
 Frame = +2

Query  464  VLPIQTLYSINGWDCYPWAFQAENPQAEIIIHNPGV  571
            V+PIQT+YS +GWD Y WAF+A++  A+I+IHNPGV
Sbjct  130  VMPIQTVYSSSGWDLYSWAFKAQSDYADIVIHNPGV  165



>ref|XP_002446725.1| hypothetical protein SORBIDRAFT_06g021290 [Sorghum bicolor]
 gb|EES11053.1| hypothetical protein SORBIDRAFT_06g021290 [Sorghum bicolor]
Length=374

 Score =   140 bits (353),  Expect(2) = 2e-42, Method: Compositional matrix adjust.
 Identities = 68/102 (67%), Positives = 79/102 (77%), Gaps = 0/102 (0%)
 Frame = +1

Query  145  DGLLVNGNFEAPVKKTDLNGTIVTRHDAVPGWTVTGFVEYIQAGQKQGDMQLVVPEGFAA  324
            DGLL NGNFE    K++LNGT V   DA+P W ++GFVEYI  GQKQGDM L VPEG  A
Sbjct  26   DGLLPNGNFEEAPAKSELNGTRVKGRDAIPHWEISGFVEYIGPGQKQGDMILPVPEGAYA  85

Query  325  VRLGNEASIKQTLNVSKGMYYSITFCAARTCAQEERLNITVA  450
            VRLGNEASI+Q L V++G  YS+TF AARTCAQ E+LN+TVA
Sbjct  86   VRLGNEASIQQRLAVTQGARYSVTFSAARTCAQAEQLNVTVA  127


 Score = 59.3 bits (142),  Expect(2) = 2e-42, Method: Compositional matrix adjust.
 Identities = 24/39 (62%), Positives = 30/39 (77%), Gaps = 0/39 (0%)
 Frame = +2

Query  455  DSDVLPIQTLYSINGWDCYPWAFQAENPQAEIIIHNPGV  571
            DSDVLPIQT+Y+ +GWD Y WAF+A      +I+HNPGV
Sbjct  129  DSDVLPIQTVYTSSGWDSYSWAFEATRSAVTLIVHNPGV  167



>ref|XP_003569339.1| PREDICTED: uncharacterized protein LOC100821501 [Brachypodium 
distachyon]
Length=370

 Score =   147 bits (371),  Expect(2) = 4e-42, Method: Compositional matrix adjust.
 Identities = 71/105 (68%), Positives = 85/105 (81%), Gaps = 1/105 (1%)
 Frame = +1

Query  142  TDGLLVNGNFEAPVKKTDL-NGTIVTRHDAVPGWTVTGFVEYIQAGQKQGDMQLVVPEGF  318
            TDGLL NGNFEA   KTDL NGT+V   +A+P W  +GFVEYI++G KQGDM LVVP+G 
Sbjct  21   TDGLLPNGNFEAGPPKTDLVNGTVVKGGNAIPNWETSGFVEYIESGHKQGDMLLVVPQGA  80

Query  319  AAVRLGNEASIKQTLNVSKGMYYSITFCAARTCAQEERLNITVAP  453
             AVRLGNEASI+Q L V++G YY+ITF AARTCAQ ER+NI+V+P
Sbjct  81   HAVRLGNEASIRQKLAVARGSYYAITFSAARTCAQAERINISVSP  125


 Score = 50.8 bits (120),  Expect(2) = 4e-42, Method: Compositional matrix adjust.
 Identities = 19/39 (49%), Positives = 29/39 (74%), Gaps = 0/39 (0%)
 Frame = +2

Query  455  DSDVLPIQTLYSINGWDCYPWAFQAENPQAEIIIHNPGV  571
            +S VLP+QT+Y  NGWD Y WAF+A+    ++++HN G+
Sbjct  126  ESGVLPMQTIYGSNGWDSYAWAFKAKLDVVQLVLHNVGI  164



>gb|AES58962.2| plant/F18G18-200 protein [Medicago truncatula]
Length=376

 Score =   148 bits (374),  Expect(2) = 5e-42, Method: Compositional matrix adjust.
 Identities = 71/104 (68%), Positives = 84/104 (81%), Gaps = 1/104 (1%)
 Frame = +1

Query  145  DGLLVNGNFEAPVKKTDLNGTIVTR-HDAVPGWTVTGFVEYIQAGQKQGDMQLVVPEGFA  321
            DGL+ NGNFE   K T+L GT+VT   +++P W ++G VEYI++GQKQGDM LVVPEG  
Sbjct  34   DGLVANGNFELGPKPTELKGTVVTGGKNSIPEWEISGLVEYIKSGQKQGDMLLVVPEGAY  93

Query  322  AVRLGNEASIKQTLNVSKGMYYSITFCAARTCAQEERLNITVAP  453
            AVRLGNEASIKQ + V KGMYYSITF  ARTCAQEER+NI+VAP
Sbjct  94   AVRLGNEASIKQRIKVIKGMYYSITFMVARTCAQEERINISVAP  137


 Score = 49.7 bits (117),  Expect(2) = 5e-42, Method: Compositional matrix adjust.
 Identities = 21/39 (54%), Positives = 28/39 (72%), Gaps = 0/39 (0%)
 Frame = +2

Query  455  DSDVLPIQTLYSINGWDCYPWAFQAENPQAEIIIHNPGV  571
            D  V+PIQTLY+ +GWD   + F+AE    E++IHNPGV
Sbjct  138  DFGVIPIQTLYTSSGWDPIAYGFKAEYDVVEMVIHNPGV  176



>ref|XP_007161233.1| hypothetical protein PHAVU_001G053100g [Phaseolus vulgaris]
 gb|ESW33227.1| hypothetical protein PHAVU_001G053100g [Phaseolus vulgaris]
Length=366

 Score =   150 bits (378),  Expect(2) = 5e-42, Method: Compositional matrix adjust.
 Identities = 72/104 (69%), Positives = 83/104 (80%), Gaps = 1/104 (1%)
 Frame = +1

Query  145  DGLLVNGNFEAPVKKTDLNGTIVTR-HDAVPGWTVTGFVEYIQAGQKQGDMQLVVPEGFA  321
            DGL+ NGNFE   K +DL GT+V     ++P W ++GFVEYI++GQKQGDM LVVPEG  
Sbjct  24   DGLVANGNFELGPKASDLKGTVVVGGSKSIPEWEISGFVEYIKSGQKQGDMLLVVPEGAY  83

Query  322  AVRLGNEASIKQTLNVSKGMYYSITFCAARTCAQEERLNITVAP  453
            AVRLGNEASIKQTL V KGMYYSITF  ARTCAQEER+NI+V P
Sbjct  84   AVRLGNEASIKQTLKVMKGMYYSITFMVARTCAQEERINISVTP  127


 Score = 47.8 bits (112),  Expect(2) = 5e-42, Method: Compositional matrix adjust.
 Identities = 19/35 (54%), Positives = 27/35 (77%), Gaps = 0/35 (0%)
 Frame = +2

Query  464  VLPIQTLYSINGWDCYPWAFQAENPQAEIIIHNPG  568
            V+PIQTLY+ +GWD   + F+AE+   E++IHNPG
Sbjct  131  VIPIQTLYTSSGWDPIAFGFRAESETVEMLIHNPG  165



>tpg|DAA37152.1| TPA: hypothetical protein ZEAMMB73_071426 [Zea mays]
Length=379

 Score =   139 bits (351),  Expect(2) = 5e-42, Method: Compositional matrix adjust.
 Identities = 68/103 (66%), Positives = 79/103 (77%), Gaps = 0/103 (0%)
 Frame = +1

Query  145  DGLLVNGNFEAPVKKTDLNGTIVTRHDAVPGWTVTGFVEYIQAGQKQGDMQLVVPEGFAA  324
            DGLL NGNFE    K+ LNGT V   +A+P W ++G+VEYI +GQKQGDM L VPEG  A
Sbjct  32   DGLLPNGNFEEAPPKSQLNGTRVMGRNAIPHWEISGYVEYIGSGQKQGDMLLPVPEGAYA  91

Query  325  VRLGNEASIKQTLNVSKGMYYSITFCAARTCAQEERLNITVAP  453
            VRLGNEASI+Q L V+ G  YSITF AARTCAQ E+LN+TVAP
Sbjct  92   VRLGNEASIQQRLAVTPGARYSITFSAARTCAQAEQLNVTVAP  134


 Score = 58.2 bits (139),  Expect(2) = 5e-42, Method: Compositional matrix adjust.
 Identities = 24/39 (62%), Positives = 30/39 (77%), Gaps = 0/39 (0%)
 Frame = +2

Query  455  DSDVLPIQTLYSINGWDCYPWAFQAENPQAEIIIHNPGV  571
            +SDVLPIQT+Y+ +GWD Y WAFQA      +I+HNPGV
Sbjct  135  ESDVLPIQTVYTSSGWDSYSWAFQAAGSVVTLIVHNPGV  173



>ref|XP_010914930.1| PREDICTED: uncharacterized protein LOC105040204 [Elaeis guineensis]
Length=370

 Score =   140 bits (354),  Expect(2) = 6e-42, Method: Compositional matrix adjust.
 Identities = 68/104 (65%), Positives = 79/104 (76%), Gaps = 0/104 (0%)
 Frame = +1

Query  142  TDGLLVNGNFEAPVKKTDLNGTIVTRHDAVPGWTVTGFVEYIQAGQKQGDMQLVVPEGFA  321
            TDGLL NGNFE     + L GT V   +A+P W ++G VEYI  G KQGDM LVVPEG  
Sbjct  22   TDGLLPNGNFELGPASSQLRGTEVIGRNAIPRWEISGTVEYIPWGHKQGDMLLVVPEGSY  81

Query  322  AVRLGNEASIKQTLNVSKGMYYSITFCAARTCAQEERLNITVAP  453
            AVRLGNEASIKQ + V++GM YS+TF AARTCAQEERLN++VAP
Sbjct  82   AVRLGNEASIKQRIKVTRGMRYSLTFSAARTCAQEERLNVSVAP  125


 Score = 57.0 bits (136),  Expect(2) = 6e-42, Method: Compositional matrix adjust.
 Identities = 24/39 (62%), Positives = 31/39 (79%), Gaps = 0/39 (0%)
 Frame = +2

Query  455  DSDVLPIQTLYSINGWDCYPWAFQAENPQAEIIIHNPGV  571
            +S VLP+QT+YS NGWD Y WA+ A +  AEI++HNPGV
Sbjct  126  ESGVLPMQTMYSSNGWDSYAWAWNARSDVAEIVVHNPGV  164



>gb|ACJ84308.1| unknown [Medicago truncatula]
Length=376

 Score =   147 bits (372),  Expect(2) = 8e-42, Method: Compositional matrix adjust.
 Identities = 70/104 (67%), Positives = 84/104 (81%), Gaps = 1/104 (1%)
 Frame = +1

Query  145  DGLLVNGNFEAPVKKTDLNGTIVTR-HDAVPGWTVTGFVEYIQAGQKQGDMQLVVPEGFA  321
            DGL+ NGNFE   K T+L GT+VT   +++P W ++G VEY+++GQKQGDM LVVPEG  
Sbjct  34   DGLVANGNFELGPKPTELKGTVVTGGKNSIPEWEISGLVEYVKSGQKQGDMLLVVPEGAY  93

Query  322  AVRLGNEASIKQTLNVSKGMYYSITFCAARTCAQEERLNITVAP  453
            AVRLGNEASIKQ + V KGMYYSITF  ARTCAQEER+NI+VAP
Sbjct  94   AVRLGNEASIKQRIKVIKGMYYSITFMVARTCAQEERINISVAP  137


 Score = 49.7 bits (117),  Expect(2) = 8e-42, Method: Compositional matrix adjust.
 Identities = 21/39 (54%), Positives = 28/39 (72%), Gaps = 0/39 (0%)
 Frame = +2

Query  455  DSDVLPIQTLYSINGWDCYPWAFQAENPQAEIIIHNPGV  571
            D  V+PIQTLY+ +GWD   + F+AE    E++IHNPGV
Sbjct  138  DFGVIPIQTLYTSSGWDPIAYGFKAEYDVVEMVIHNPGV  176



>gb|AAB41813.1| unknown protein [Medicago sativa]
Length=375

 Score =   147 bits (371),  Expect(2) = 9e-42, Method: Compositional matrix adjust.
 Identities = 70/104 (67%), Positives = 84/104 (81%), Gaps = 1/104 (1%)
 Frame = +1

Query  145  DGLLVNGNFEAPVKKTDLNGTIVTR-HDAVPGWTVTGFVEYIQAGQKQGDMQLVVPEGFA  321
            DGL+ NGNFE   K ++L GT+VT   +++P W ++G VEYI++GQKQGDM LVVPEG  
Sbjct  33   DGLVANGNFELGPKPSELKGTVVTGGKNSIPEWEISGLVEYIKSGQKQGDMLLVVPEGAY  92

Query  322  AVRLGNEASIKQTLNVSKGMYYSITFCAARTCAQEERLNITVAP  453
            AVRLGNEASIKQ + V KGMYYSITF  ARTCAQEER+NI+VAP
Sbjct  93   AVRLGNEASIKQRIKVIKGMYYSITFMVARTCAQEERINISVAP  136


 Score = 49.7 bits (117),  Expect(2) = 9e-42, Method: Compositional matrix adjust.
 Identities = 21/39 (54%), Positives = 28/39 (72%), Gaps = 0/39 (0%)
 Frame = +2

Query  455  DSDVLPIQTLYSINGWDCYPWAFQAENPQAEIIIHNPGV  571
            D  V+PIQTLY+ +GWD   + F+AE    E++IHNPGV
Sbjct  137  DFGVIPIQTLYTSSGWDPIAYGFKAEYDVVEMVIHNPGV  175



>ref|NP_001043549.2| Os01g0611000 [Oryza sativa Japonica Group]
 dbj|BAF05463.2| Os01g0611000, partial [Oryza sativa Japonica Group]
Length=399

 Score =   142 bits (357),  Expect(2) = 9e-42, Method: Compositional matrix adjust.
 Identities = 67/105 (64%), Positives = 84/105 (80%), Gaps = 1/105 (1%)
 Frame = +1

Query  142  TDGLLVNGNFEAPVKKTDL-NGTIVTRHDAVPGWTVTGFVEYIQAGQKQGDMQLVVPEGF  318
            TDGLL NGNFE    K+DL NGT+V   +A+P W  +GFVEYI++G KQGDM LVVP+G 
Sbjct  50   TDGLLPNGNFEEGPPKSDLVNGTVVRGANAIPRWETSGFVEYIESGHKQGDMLLVVPQGA  109

Query  319  AAVRLGNEASIKQTLNVSKGMYYSITFCAARTCAQEERLNITVAP  453
             AVRLGNEASI+Q L V++G YY++TF AARTCAQ E+LN++V+P
Sbjct  110  HAVRLGNEASIRQRLAVTRGAYYAVTFSAARTCAQAEQLNVSVSP  154


 Score = 55.1 bits (131),  Expect(2) = 9e-42, Method: Compositional matrix adjust.
 Identities = 21/36 (58%), Positives = 28/36 (78%), Gaps = 0/36 (0%)
 Frame = +2

Query  464  VLPIQTLYSINGWDCYPWAFQAENPQAEIIIHNPGV  571
            VLP+QT+Y  NGWD Y WAF+A+  +  ++IHNPGV
Sbjct  158  VLPMQTIYGSNGWDSYAWAFKAKMDEVALVIHNPGV  193



>gb|KJB70568.1| hypothetical protein B456_011G080100 [Gossypium raimondii]
Length=374

 Score =   139 bits (350),  Expect(2) = 1e-41, Method: Compositional matrix adjust.
 Identities = 64/103 (62%), Positives = 79/103 (77%), Gaps = 0/103 (0%)
 Frame = +1

Query  145  DGLLVNGNFEAPVKKTDLNGTIVTRHDAVPGWTVTGFVEYIQAGQKQGDMQLVVPEGFAA  324
            DGLL NGNFE   K ++L GT V    A+P W ++G+VEYI++G KQGDM L+VPEG  A
Sbjct  24   DGLLPNGNFEYGPKASELEGTKVMSAKAIPNWEISGYVEYIKSGHKQGDMLLIVPEGAFA  83

Query  325  VRLGNEASIKQTLNVSKGMYYSITFCAARTCAQEERLNITVAP  453
            VRLGNEA IKQ + V KG +YS+TF  ARTCAQEERLN++V+P
Sbjct  84   VRLGNEALIKQKIEVVKGDFYSLTFSTARTCAQEERLNVSVSP  126


 Score = 57.8 bits (138),  Expect(2) = 1e-41, Method: Compositional matrix adjust.
 Identities = 25/41 (61%), Positives = 29/41 (71%), Gaps = 0/41 (0%)
 Frame = +2

Query  449  RRDSDVLPIQTLYSINGWDCYPWAFQAENPQAEIIIHNPGV  571
            + D  + PIQT+YS NGWD Y WAFQA+    EI IHNPGV
Sbjct  130  KNDFGLFPIQTMYSSNGWDSYAWAFQADAHVIEISIHNPGV  170



>ref|XP_010519935.1| PREDICTED: uncharacterized protein LOC104799224 [Tarenaya hassleriana]
Length=365

 Score =   141 bits (356),  Expect(2) = 1e-41, Method: Compositional matrix adjust.
 Identities = 67/103 (65%), Positives = 80/103 (78%), Gaps = 0/103 (0%)
 Frame = +1

Query  145  DGLLVNGNFEAPVKKTDLNGTIVTRHDAVPGWTVTGFVEYIQAGQKQGDMQLVVPEGFAA  324
            DG L NG+FE   K +D+ GT V    A+P W ++GFVEYI++GQKQGDM LVVP G  A
Sbjct  24   DGQLPNGDFELGPKPSDMKGTQVVNKTAIPNWELSGFVEYIKSGQKQGDMLLVVPAGKFA  83

Query  325  VRLGNEASIKQTLNVSKGMYYSITFCAARTCAQEERLNITVAP  453
            VRLGNEASIKQ L + KGMYYS+TF AARTCAQ+ERLNI+ +P
Sbjct  84   VRLGNEASIKQRLRLVKGMYYSLTFSAARTCAQDERLNISASP  126


 Score = 55.1 bits (131),  Expect(2) = 1e-41, Method: Compositional matrix adjust.
 Identities = 22/35 (63%), Positives = 28/35 (80%), Gaps = 0/35 (0%)
 Frame = +2

Query  464  VLPIQTLYSINGWDCYPWAFQAENPQAEIIIHNPG  568
            V+PIQT+YS  GWD Y WAFQAE+   +++IHNPG
Sbjct  130  VIPIQTVYSSYGWDLYAWAFQAESELVDVVIHNPG  164



>gb|KHG06895.1| Agmatine deiminase [Gossypium arboreum]
Length=374

 Score =   139 bits (349),  Expect(2) = 1e-41, Method: Compositional matrix adjust.
 Identities = 64/103 (62%), Positives = 79/103 (77%), Gaps = 0/103 (0%)
 Frame = +1

Query  145  DGLLVNGNFEAPVKKTDLNGTIVTRHDAVPGWTVTGFVEYIQAGQKQGDMQLVVPEGFAA  324
            DGLL NGNFE   K ++L GT V    A+P W ++G+VEYI++G KQGDM L+VPEG  A
Sbjct  24   DGLLPNGNFEYGPKASELEGTKVMSAKAIPNWEISGYVEYIKSGHKQGDMLLIVPEGAFA  83

Query  325  VRLGNEASIKQTLNVSKGMYYSITFCAARTCAQEERLNITVAP  453
            VRLGNEA IKQ + V KG +YS+TF  ARTCAQEERLN++V+P
Sbjct  84   VRLGNEALIKQKVEVVKGDFYSLTFSTARTCAQEERLNVSVSP  126


 Score = 57.8 bits (138),  Expect(2) = 1e-41, Method: Compositional matrix adjust.
 Identities = 25/41 (61%), Positives = 29/41 (71%), Gaps = 0/41 (0%)
 Frame = +2

Query  449  RRDSDVLPIQTLYSINGWDCYPWAFQAENPQAEIIIHNPGV  571
            + D  + PIQT+YS NGWD Y WAFQA+    EI IHNPGV
Sbjct  130  KNDFGLFPIQTMYSSNGWDSYAWAFQADAHVIEISIHNPGV  170



>gb|AFK49528.1| unknown [Medicago truncatula]
Length=204

 Score =   147 bits (371),  Expect(2) = 1e-41, Method: Compositional matrix adjust.
 Identities = 70/104 (67%), Positives = 84/104 (81%), Gaps = 1/104 (1%)
 Frame = +1

Query  145  DGLLVNGNFEAPVKKTDLNGTIVTR-HDAVPGWTVTGFVEYIQAGQKQGDMQLVVPEGFA  321
            DGL+ NGNFE   K T+L GT+VT   +++P W ++G VEY+++GQKQGDM LVVPEG  
Sbjct  34   DGLVANGNFELGPKPTELKGTVVTGGKNSIPEWEISGLVEYVKSGQKQGDMLLVVPEGAY  93

Query  322  AVRLGNEASIKQTLNVSKGMYYSITFCAARTCAQEERLNITVAP  453
            AVRLGNEASIKQ + V KGMYYSITF  ARTCAQEER+NI+VAP
Sbjct  94   AVRLGNEASIKQRIKVIKGMYYSITFMVARTCAQEERINISVAP  137


 Score = 49.3 bits (116),  Expect(2) = 1e-41, Method: Compositional matrix adjust.
 Identities = 21/39 (54%), Positives = 28/39 (72%), Gaps = 0/39 (0%)
 Frame = +2

Query  455  DSDVLPIQTLYSINGWDCYPWAFQAENPQAEIIIHNPGV  571
            D  V+PIQTLY+ +GWD   + F+AE    E++IHNPGV
Sbjct  138  DFGVIPIQTLYTSSGWDPIAYGFKAEYDVVEMVIHNPGV  176



>gb|EAY74932.1| hypothetical protein OsI_02826 [Oryza sativa Indica Group]
Length=361

 Score =   141 bits (356),  Expect(2) = 1e-41, Method: Compositional matrix adjust.
 Identities = 67/105 (64%), Positives = 83/105 (79%), Gaps = 1/105 (1%)
 Frame = +1

Query  142  TDGLLVNGNFEAPVKKTDL-NGTIVTRHDAVPGWTVTGFVEYIQAGQKQGDMQLVVPEGF  318
            TDGLL NGNFE    K+DL NGT+V   +A+P W  +GFVEYI++G KQGDM LVVP+G 
Sbjct  24   TDGLLPNGNFEEGPPKSDLVNGTVVRGANAIPRWETSGFVEYIESGHKQGDMLLVVPQGA  83

Query  319  AAVRLGNEASIKQTLNVSKGMYYSITFCAARTCAQEERLNITVAP  453
             AVRLGNEASI+Q L V++G YY++TF AARTCAQ E+LN++V P
Sbjct  84   HAVRLGNEASIRQRLAVTRGAYYAVTFSAARTCAQAEQLNVSVTP  128


 Score = 54.7 bits (130),  Expect(2) = 1e-41, Method: Compositional matrix adjust.
 Identities = 21/36 (58%), Positives = 28/36 (78%), Gaps = 0/36 (0%)
 Frame = +2

Query  464  VLPIQTLYSINGWDCYPWAFQAENPQAEIIIHNPGV  571
            VLP+QT+Y  NGWD Y WAF+A+  +  ++IHNPGV
Sbjct  132  VLPMQTIYGSNGWDSYAWAFKAKMDEVALVIHNPGV  167



>ref|XP_002446724.1| hypothetical protein SORBIDRAFT_06g021280 [Sorghum bicolor]
 gb|EES11052.1| hypothetical protein SORBIDRAFT_06g021280 [Sorghum bicolor]
Length=379

 Score =   138 bits (348),  Expect(2) = 2e-41, Method: Compositional matrix adjust.
 Identities = 66/103 (64%), Positives = 80/103 (78%), Gaps = 0/103 (0%)
 Frame = +1

Query  145  DGLLVNGNFEAPVKKTDLNGTIVTRHDAVPGWTVTGFVEYIQAGQKQGDMQLVVPEGFAA  324
            DGLL NGNFE    K+ L G+ V   +A+P W ++GFVEYI +GQKQGDM L VPEG  A
Sbjct  32   DGLLPNGNFEEAPPKSQLKGSRVMGRNAIPHWEISGFVEYIGSGQKQGDMLLPVPEGAYA  91

Query  325  VRLGNEASIKQTLNVSKGMYYSITFCAARTCAQEERLNITVAP  453
            VRLGNEASI+Q L +++G +YSITF AARTCAQ E+LN+TVAP
Sbjct  92   VRLGNEASIQQRLALTQGAHYSITFSAARTCAQAEQLNVTVAP  134


 Score = 57.8 bits (138),  Expect(2) = 2e-41, Method: Compositional matrix adjust.
 Identities = 23/39 (59%), Positives = 31/39 (79%), Gaps = 0/39 (0%)
 Frame = +2

Query  455  DSDVLPIQTLYSINGWDCYPWAFQAENPQAEIIIHNPGV  571
            +SD+LPIQT+Y+ +GWD Y WAF+A +    +IIHNPGV
Sbjct  135  ESDILPIQTVYTSSGWDSYSWAFKATSSVVSLIIHNPGV  173



>ref|XP_003531698.1| PREDICTED: uncharacterized protein LOC100779277 [Glycine max]
Length=371

 Score =   146 bits (369),  Expect(2) = 2e-41, Method: Compositional matrix adjust.
 Identities = 67/104 (64%), Positives = 84/104 (81%), Gaps = 0/104 (0%)
 Frame = +1

Query  142  TDGLLVNGNFEAPVKKTDLNGTIVTRHDAVPGWTVTGFVEYIQAGQKQGDMQLVVPEGFA  321
            TDGLL NG+FE   K ++L G+IVT  + +P WT++G VEYI++GQKQGDM LVVP G  
Sbjct  24   TDGLLPNGDFEVGPKPSELKGSIVTTPNGIPHWTISGMVEYIKSGQKQGDMVLVVPHGTY  83

Query  322  AVRLGNEASIKQTLNVSKGMYYSITFCAARTCAQEERLNITVAP  453
            AVRLGNEASIKQ + V KGM+YS+TF A+RTCAQEE+LN++V P
Sbjct  84   AVRLGNEASIKQKIQVVKGMFYSLTFSASRTCAQEEKLNVSVVP  127


 Score = 49.7 bits (117),  Expect(2) = 2e-41, Method: Compositional matrix adjust.
 Identities = 21/36 (58%), Positives = 26/36 (72%), Gaps = 0/36 (0%)
 Frame = +2

Query  464  VLPIQTLYSINGWDCYPWAFQAENPQAEIIIHNPGV  571
            V PIQT+Y  NG D Y   F+A+ P+ EI+IHNPGV
Sbjct  136  VFPIQTMYGSNGCDSYACGFRADYPRVEIVIHNPGV  171



>dbj|BAB21293.1| unknown protein [Oryza sativa Japonica Group]
 dbj|BAB93263.1| unknown protein [Oryza sativa Japonica Group]
 gb|EAZ12659.1| hypothetical protein OsJ_02574 [Oryza sativa Japonica Group]
 dbj|BAG93001.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG87537.1| unnamed protein product [Oryza sativa Japonica Group]
Length=373

 Score =   141 bits (356),  Expect(2) = 2e-41, Method: Compositional matrix adjust.
 Identities = 67/105 (64%), Positives = 84/105 (80%), Gaps = 1/105 (1%)
 Frame = +1

Query  142  TDGLLVNGNFEAPVKKTDL-NGTIVTRHDAVPGWTVTGFVEYIQAGQKQGDMQLVVPEGF  318
            TDGLL NGNFE    K+DL NGT+V   +A+P W  +GFVEYI++G KQGDM LVVP+G 
Sbjct  24   TDGLLPNGNFEEGPPKSDLVNGTVVRGANAIPRWETSGFVEYIESGHKQGDMLLVVPQGA  83

Query  319  AAVRLGNEASIKQTLNVSKGMYYSITFCAARTCAQEERLNITVAP  453
             AVRLGNEASI+Q L V++G YY++TF AARTCAQ E+LN++V+P
Sbjct  84   HAVRLGNEASIRQRLAVTRGAYYAVTFSAARTCAQAEQLNVSVSP  128


 Score = 54.7 bits (130),  Expect(2) = 2e-41, Method: Compositional matrix adjust.
 Identities = 21/36 (58%), Positives = 28/36 (78%), Gaps = 0/36 (0%)
 Frame = +2

Query  464  VLPIQTLYSINGWDCYPWAFQAENPQAEIIIHNPGV  571
            VLP+QT+Y  NGWD Y WAF+A+  +  ++IHNPGV
Sbjct  132  VLPMQTIYGSNGWDSYAWAFKAKMDEVALVIHNPGV  167



>gb|KHN47787.1| hypothetical protein glysoja_029205 [Glycine soja]
Length=369

 Score =   146 bits (369),  Expect(2) = 2e-41, Method: Compositional matrix adjust.
 Identities = 67/104 (64%), Positives = 84/104 (81%), Gaps = 0/104 (0%)
 Frame = +1

Query  142  TDGLLVNGNFEAPVKKTDLNGTIVTRHDAVPGWTVTGFVEYIQAGQKQGDMQLVVPEGFA  321
            TDGLL NG+FE   K ++L G+IVT  + +P WT++G VEYI++GQKQGDM LVVP G  
Sbjct  22   TDGLLPNGDFEVGPKPSELKGSIVTTPNGIPHWTISGMVEYIKSGQKQGDMVLVVPHGTY  81

Query  322  AVRLGNEASIKQTLNVSKGMYYSITFCAARTCAQEERLNITVAP  453
            AVRLGNEASIKQ + V KGM+YS+TF A+RTCAQEE+LN++V P
Sbjct  82   AVRLGNEASIKQKIQVVKGMFYSLTFSASRTCAQEEKLNVSVVP  125


 Score = 49.7 bits (117),  Expect(2) = 2e-41, Method: Compositional matrix adjust.
 Identities = 21/36 (58%), Positives = 26/36 (72%), Gaps = 0/36 (0%)
 Frame = +2

Query  464  VLPIQTLYSINGWDCYPWAFQAENPQAEIIIHNPGV  571
            V PIQT+Y  NG D Y   F+A+ P+ EI+IHNPGV
Sbjct  134  VFPIQTMYGSNGCDSYACGFRADYPRVEIVIHNPGV  169



>ref|XP_003544618.1| PREDICTED: uncharacterized protein LOC100776765 [Glycine max]
 gb|KHN05403.1| hypothetical protein glysoja_046455 [Glycine soja]
Length=366

 Score =   145 bits (367),  Expect(2) = 2e-41, Method: Compositional matrix adjust.
 Identities = 71/105 (68%), Positives = 82/105 (78%), Gaps = 1/105 (1%)
 Frame = +1

Query  142  TDGLLVNGNFEAPVKKTDLNGTIVTR-HDAVPGWTVTGFVEYIQAGQKQGDMQLVVPEGF  318
            TDGL+ NGNFE   K + L GT+V     ++P W ++GFVEYI++GQKQGDM LVVPEG 
Sbjct  23   TDGLVANGNFELGPKPSALKGTVVIGGSHSIPEWEISGFVEYIKSGQKQGDMLLVVPEGA  82

Query  319  AAVRLGNEASIKQTLNVSKGMYYSITFCAARTCAQEERLNITVAP  453
             AVRLGNEASIKQ + V KGMYYSITF  ARTCAQEERLNI+V P
Sbjct  83   YAVRLGNEASIKQRIKVIKGMYYSITFMVARTCAQEERLNISVTP  127


 Score = 50.1 bits (118),  Expect(2) = 2e-41, Method: Compositional matrix adjust.
 Identities = 20/35 (57%), Positives = 27/35 (77%), Gaps = 0/35 (0%)
 Frame = +2

Query  464  VLPIQTLYSINGWDCYPWAFQAENPQAEIIIHNPG  568
            V+PIQTLY+ +GWD   + F+AEN   E++IHNPG
Sbjct  131  VIPIQTLYTSSGWDPIAFGFKAENETVEMLIHNPG  165



>ref|XP_008347484.1| PREDICTED: uncharacterized protein LOC103410579 [Malus domestica]
Length=374

 Score =   141 bits (356),  Expect(2) = 2e-41, Method: Compositional matrix adjust.
 Identities = 66/108 (61%), Positives = 83/108 (77%), Gaps = 0/108 (0%)
 Frame = +1

Query  142  TDGLLVNGNFEAPVKKTDLNGTIVTRHDAVPGWTVTGFVEYIQAGQKQGDMQLVVPEGFA  321
            TDGLL NGNFE   K+++L GT+VT   A+P W ++GFVEYI++GQKQGDM LVVPEG  
Sbjct  25   TDGLLPNGNFEYGPKQSELKGTVVTNPHAIPNWEISGFVEYIKSGQKQGDMVLVVPEGGF  84

Query  322  AVRLGNEASIKQTLNVSKGMYYSITFCAARTCAQEERLNITVAPGLRR  465
            AV+LGNEA IKQ L ++KG +YS TF A+RTC QE +LN++V P L  
Sbjct  85   AVKLGNEALIKQKLKLTKGSFYSTTFTASRTCGQEAKLNVSVNPNLEE  132


 Score = 54.7 bits (130),  Expect(2) = 2e-41, Method: Compositional matrix adjust.
 Identities = 21/36 (58%), Positives = 27/36 (75%), Gaps = 0/36 (0%)
 Frame = +2

Query  464  VLPIQTLYSINGWDCYPWAFQAENPQAEIIIHNPGV  571
            ++PIQT+YS NGWD Y W F A+    E++IHNPGV
Sbjct  137  IMPIQTIYSCNGWDSYAWGFNADFDDVELVIHNPGV  172



>gb|EMT06486.1| hypothetical protein F775_26416 [Aegilops tauschii]
Length=370

 Score =   139 bits (350),  Expect(2) = 2e-41, Method: Compositional matrix adjust.
 Identities = 66/105 (63%), Positives = 82/105 (78%), Gaps = 1/105 (1%)
 Frame = +1

Query  142  TDGLLVNGNFEA-PVKKTDLNGTIVTRHDAVPGWTVTGFVEYIQAGQKQGDMQLVVPEGF  318
            TDGLL NGNFE+ P K   +NGT+V    A+P W  +GFVEYI++G KQGDM LVVP+G 
Sbjct  21   TDGLLPNGNFESGPAKSELVNGTVVKGGKAIPKWETSGFVEYIESGHKQGDMLLVVPQGA  80

Query  319  AAVRLGNEASIKQTLNVSKGMYYSITFCAARTCAQEERLNITVAP  453
             AVRLGN+ASI Q + V++G YY+ITF AARTCAQ ERLN++V+P
Sbjct  81   YAVRLGNDASILQRIPVARGSYYAITFSAARTCAQAERLNVSVSP  125


 Score = 56.6 bits (135),  Expect(2) = 2e-41, Method: Compositional matrix adjust.
 Identities = 23/39 (59%), Positives = 30/39 (77%), Gaps = 0/39 (0%)
 Frame = +2

Query  455  DSDVLPIQTLYSINGWDCYPWAFQAENPQAEIIIHNPGV  571
            +S VLP+QT+Y  NGWD Y WAF+A+    E++IHNPGV
Sbjct  126  ESGVLPMQTIYGSNGWDSYAWAFKAKLDVVELVIHNPGV  164



>ref|XP_004969140.1| PREDICTED: uncharacterized protein LOC101755969 [Setaria italica]
Length=372

 Score =   142 bits (358),  Expect(2) = 2e-41, Method: Compositional matrix adjust.
 Identities = 68/105 (65%), Positives = 83/105 (79%), Gaps = 1/105 (1%)
 Frame = +1

Query  142  TDGLLVNGNFE-APVKKTDLNGTIVTRHDAVPGWTVTGFVEYIQAGQKQGDMQLVVPEGF  318
            TDGLL NGNFE  P K   +NGT+V   +A+P W  +GFVEYI++G KQGDM LVVP+G 
Sbjct  22   TDGLLPNGNFEEGPPKSALVNGTVVRGANAIPLWETSGFVEYIESGHKQGDMLLVVPQGA  81

Query  319  AAVRLGNEASIKQTLNVSKGMYYSITFCAARTCAQEERLNITVAP  453
             AVRLGNEASI+Q L V++G YY+ITF AARTCAQ ERLN++V+P
Sbjct  82   HAVRLGNEASIRQRLAVTRGAYYAITFSAARTCAQAERLNVSVSP  126


 Score = 53.1 bits (126),  Expect(2) = 2e-41, Method: Compositional matrix adjust.
 Identities = 21/36 (58%), Positives = 27/36 (75%), Gaps = 0/36 (0%)
 Frame = +2

Query  464  VLPIQTLYSINGWDCYPWAFQAENPQAEIIIHNPGV  571
            VLP+QT+Y  NGWD Y WAF+A+     ++IHNPGV
Sbjct  130  VLPMQTIYGSNGWDSYAWAFKAKFDTVTLVIHNPGV  165



>ref|NP_001053189.1| Os04g0494800 [Oryza sativa Japonica Group]
 dbj|BAF15103.1| Os04g0494800 [Oryza sativa Japonica Group]
Length=379

 Score =   144 bits (364),  Expect(2) = 3e-41, Method: Compositional matrix adjust.
 Identities = 69/104 (66%), Positives = 81/104 (78%), Gaps = 0/104 (0%)
 Frame = +1

Query  142  TDGLLVNGNFEAPVKKTDLNGTIVTRHDAVPGWTVTGFVEYIQAGQKQGDMQLVVPEGFA  321
            TDGLL NGNFE    K+ +NGT VT   A+P W ++GFVEYI +GQKQGDM L VPEG  
Sbjct  33   TDGLLPNGNFEEAPDKSQMNGTRVTGRYAIPQWEISGFVEYIGSGQKQGDMLLPVPEGAY  92

Query  322  AVRLGNEASIKQTLNVSKGMYYSITFCAARTCAQEERLNITVAP  453
            AVRLGNEASI+Q L +++GM+YSITF AARTCAQ E LNIT+ P
Sbjct  93   AVRLGNEASIQQRLTLTRGMHYSITFSAARTCAQSELLNITITP  136


 Score = 51.2 bits (121),  Expect(2) = 3e-41, Method: Compositional matrix adjust.
 Identities = 20/39 (51%), Positives = 29/39 (74%), Gaps = 0/39 (0%)
 Frame = +2

Query  455  DSDVLPIQTLYSINGWDCYPWAFQAENPQAEIIIHNPGV  571
            +S  +PIQT+Y+ +GWD Y WAF+A++     I+HNPGV
Sbjct  137  ESGEIPIQTVYTSSGWDSYSWAFKAKHSVVLFIVHNPGV  175



>gb|AGV54541.1| hypothetical protein [Phaseolus vulgaris]
Length=376

 Score =   142 bits (357),  Expect(2) = 3e-41, Method: Compositional matrix adjust.
 Identities = 64/104 (62%), Positives = 85/104 (82%), Gaps = 0/104 (0%)
 Frame = +1

Query  142  TDGLLVNGNFEAPVKKTDLNGTIVTRHDAVPGWTVTGFVEYIQAGQKQGDMQLVVPEGFA  321
            T+GLL NGNFE   K +++ G++V   +A+P WT+TG VEYI++GQKQGDM LVVPEG  
Sbjct  26   TNGLLPNGNFERGPKASEMKGSVVIGQNAIPNWTITGLVEYIKSGQKQGDMLLVVPEGDY  85

Query  322  AVRLGNEASIKQTLNVSKGMYYSITFCAARTCAQEERLNITVAP  453
            AVRLG+EASIKQ + +++G +Y+ITF AARTCAQEE+LN++V P
Sbjct  86   AVRLGDEASIKQKVKLNEGFFYAITFGAARTCAQEEKLNVSVVP  129


 Score = 53.5 bits (127),  Expect(2) = 3e-41, Method: Compositional matrix adjust.
 Identities = 21/40 (53%), Positives = 31/40 (78%), Gaps = 0/40 (0%)
 Frame = +2

Query  449  RRDSDVLPIQTLYSINGWDCYPWAFQAENPQAEIIIHNPG  568
            +RD  ++PIQT+Y  NGW+ +   F+A+ P+AEI+IHNPG
Sbjct  133  KRDWGIIPIQTMYGSNGWESFTCGFRADFPEAEIVIHNPG  172



>gb|EAY94676.1| hypothetical protein OsI_16455 [Oryza sativa Indica Group]
Length=379

 Score =   144 bits (363),  Expect(2) = 3e-41, Method: Compositional matrix adjust.
 Identities = 69/104 (66%), Positives = 81/104 (78%), Gaps = 0/104 (0%)
 Frame = +1

Query  142  TDGLLVNGNFEAPVKKTDLNGTIVTRHDAVPGWTVTGFVEYIQAGQKQGDMQLVVPEGFA  321
            TDGLL NGNFE    K+ +NGT VT   A+P W ++GFVEYI +GQKQGDM L VPEG  
Sbjct  33   TDGLLPNGNFEEAPDKSQMNGTRVTGRYAIPQWEISGFVEYIGSGQKQGDMLLPVPEGAY  92

Query  322  AVRLGNEASIKQTLNVSKGMYYSITFCAARTCAQEERLNITVAP  453
            AVRLGNEASI+Q L +++GM+YSITF AARTCAQ E LNIT+ P
Sbjct  93   AVRLGNEASIQQRLTLTRGMHYSITFSAARTCAQSELLNITITP  136


 Score = 51.2 bits (121),  Expect(2) = 3e-41, Method: Compositional matrix adjust.
 Identities = 20/39 (51%), Positives = 29/39 (74%), Gaps = 0/39 (0%)
 Frame = +2

Query  455  DSDVLPIQTLYSINGWDCYPWAFQAENPQAEIIIHNPGV  571
            +S  +PIQT+Y+ +GWD Y WAF+A++     I+HNPGV
Sbjct  137  ESGEIPIQTVYTSSGWDSYSWAFKAKHSVVLFIVHNPGV  175



>emb|CAE01676.2| OSJNBb0091E11.17 [Oryza sativa Japonica Group]
 gb|EAZ31210.1| hypothetical protein OsJ_15310 [Oryza sativa Japonica Group]
Length=373

 Score =   144 bits (363),  Expect(2) = 3e-41, Method: Compositional matrix adjust.
 Identities = 69/104 (66%), Positives = 81/104 (78%), Gaps = 0/104 (0%)
 Frame = +1

Query  142  TDGLLVNGNFEAPVKKTDLNGTIVTRHDAVPGWTVTGFVEYIQAGQKQGDMQLVVPEGFA  321
            TDGLL NGNFE    K+ +NGT VT   A+P W ++GFVEYI +GQKQGDM L VPEG  
Sbjct  27   TDGLLPNGNFEEAPDKSQMNGTRVTGRYAIPQWEISGFVEYIGSGQKQGDMLLPVPEGAY  86

Query  322  AVRLGNEASIKQTLNVSKGMYYSITFCAARTCAQEERLNITVAP  453
            AVRLGNEASI+Q L +++GM+YSITF AARTCAQ E LNIT+ P
Sbjct  87   AVRLGNEASIQQRLTLTRGMHYSITFSAARTCAQSELLNITITP  130


 Score = 50.8 bits (120),  Expect(2) = 3e-41, Method: Compositional matrix adjust.
 Identities = 20/39 (51%), Positives = 29/39 (74%), Gaps = 0/39 (0%)
 Frame = +2

Query  455  DSDVLPIQTLYSINGWDCYPWAFQAENPQAEIIIHNPGV  571
            +S  +PIQT+Y+ +GWD Y WAF+A++     I+HNPGV
Sbjct  131  ESGEIPIQTVYTSSGWDSYSWAFKAKHSVVLFIVHNPGV  169



>emb|CAH67292.1| OSIGBa0103O01.10 [Oryza sativa Indica Group]
Length=373

 Score =   144 bits (363),  Expect(2) = 4e-41, Method: Compositional matrix adjust.
 Identities = 69/104 (66%), Positives = 81/104 (78%), Gaps = 0/104 (0%)
 Frame = +1

Query  142  TDGLLVNGNFEAPVKKTDLNGTIVTRHDAVPGWTVTGFVEYIQAGQKQGDMQLVVPEGFA  321
            TDGLL NGNFE    K+ +NGT VT   A+P W ++GFVEYI +GQKQGDM L VPEG  
Sbjct  27   TDGLLPNGNFEEAPDKSQMNGTRVTGRYAIPQWEISGFVEYIGSGQKQGDMLLPVPEGAY  86

Query  322  AVRLGNEASIKQTLNVSKGMYYSITFCAARTCAQEERLNITVAP  453
            AVRLGNEASI+Q L +++GM+YSITF AARTCAQ E LNIT+ P
Sbjct  87   AVRLGNEASIQQRLTLTRGMHYSITFSAARTCAQSELLNITITP  130


 Score = 50.8 bits (120),  Expect(2) = 4e-41, Method: Compositional matrix adjust.
 Identities = 20/39 (51%), Positives = 29/39 (74%), Gaps = 0/39 (0%)
 Frame = +2

Query  455  DSDVLPIQTLYSINGWDCYPWAFQAENPQAEIIIHNPGV  571
            +S  +PIQT+Y+ +GWD Y WAF+A++     I+HNPGV
Sbjct  131  ESGEIPIQTVYTSSGWDSYSWAFKAKHSVVLFIVHNPGV  169



>ref|XP_002455939.1| hypothetical protein SORBIDRAFT_03g027650 [Sorghum bicolor]
 gb|EES01059.1| hypothetical protein SORBIDRAFT_03g027650 [Sorghum bicolor]
Length=375

 Score =   141 bits (356),  Expect(2) = 4e-41, Method: Compositional matrix adjust.
 Identities = 67/105 (64%), Positives = 83/105 (79%), Gaps = 1/105 (1%)
 Frame = +1

Query  142  TDGLLVNGNFE-APVKKTDLNGTIVTRHDAVPGWTVTGFVEYIQAGQKQGDMQLVVPEGF  318
            TDGLL NGNFE  P K   +NGT+V+  +A+P W  +GFVEYI++G KQGDM LVVP+G 
Sbjct  22   TDGLLPNGNFEDGPPKSALVNGTVVSGANAIPRWETSGFVEYIESGHKQGDMLLVVPQGA  81

Query  319  AAVRLGNEASIKQTLNVSKGMYYSITFCAARTCAQEERLNITVAP  453
             AVRLGNEASI+Q L V++G YY+ITF AARTCAQ E LN++V+P
Sbjct  82   HAVRLGNEASIRQRLAVARGAYYAITFSAARTCAQAEALNVSVSP  126


 Score = 53.5 bits (127),  Expect(2) = 4e-41, Method: Compositional matrix adjust.
 Identities = 21/36 (58%), Positives = 27/36 (75%), Gaps = 0/36 (0%)
 Frame = +2

Query  464  VLPIQTLYSINGWDCYPWAFQAENPQAEIIIHNPGV  571
            VLP+QT+Y  NGWD Y WAF+A+     ++IHNPGV
Sbjct  130  VLPMQTIYGSNGWDSYAWAFKAKLSTVTLVIHNPGV  165



>ref|XP_006389772.1| hypothetical protein EUTSA_v10018730mg [Eutrema salsugineum]
 gb|ESQ27058.1| hypothetical protein EUTSA_v10018730mg [Eutrema salsugineum]
Length=372

 Score =   138 bits (347),  Expect(2) = 6e-41, Method: Compositional matrix adjust.
 Identities = 67/101 (66%), Positives = 77/101 (76%), Gaps = 0/101 (0%)
 Frame = +1

Query  145  DGLLVNGNFEAPVKKTDLNGTIVTRHDAVPGWTVTGFVEYIQAGQKQGDMQLVVPEGFAA  324
            DGLL NGNFE   K + L G++V    AVP W +TG VEYI+AGQKQ DM LVVPEG +A
Sbjct  29   DGLLPNGNFEKGPKPSQLKGSVVKERSAVPNWDMTGLVEYIKAGQKQDDMVLVVPEGSSA  88

Query  325  VRLGNEASIKQTLNVSKGMYYSITFCAARTCAQEERLNITV  447
            VRLGNEASI Q ++V  G  YSITF AARTCAQ+ERLNI+V
Sbjct  89   VRLGNEASISQKISVRSGRLYSITFSAARTCAQDERLNISV  129


 Score = 56.2 bits (134),  Expect(2) = 6e-41, Method: Compositional matrix adjust.
 Identities = 24/38 (63%), Positives = 29/38 (76%), Gaps = 0/38 (0%)
 Frame = +2

Query  455  DSDVLPIQTLYSINGWDCYPWAFQAENPQAEIIIHNPG  568
            +S V+PIQTLY  +GWD Y WAF+A  P+ EI IHNPG
Sbjct  132  ESGVIPIQTLYGSDGWDSYSWAFKAGGPEIEIRIHNPG  169



>ref|XP_006841925.1| hypothetical protein AMTR_s00042p00185900 [Amborella trichopoda]
 gb|ERN03600.1| hypothetical protein AMTR_s00042p00185900 [Amborella trichopoda]
Length=332

 Score =   135 bits (341),  Expect(2) = 6e-41, Method: Compositional matrix adjust.
 Identities = 61/86 (71%), Positives = 71/86 (83%), Gaps = 0/86 (0%)
 Frame = +1

Query  196  LNGTIVTRHDAVPGWTVTGFVEYIQAGQKQGDMQLVVPEGFAAVRLGNEASIKQTLNVSK  375
            +NGT+V  H A+PGW + GFVEYI AG KQGDM LVVPEG  AVRLGNEA I+Q++ V+ 
Sbjct  1    MNGTVVRDHYAIPGWEIGGFVEYITAGHKQGDMLLVVPEGACAVRLGNEAYIRQSVAVAT  60

Query  376  GMYYSITFCAARTCAQEERLNITVAP  453
            GMYY+ITF AARTCAQEER+NITV P
Sbjct  61   GMYYAITFSAARTCAQEERINITVPP  86


 Score = 58.5 bits (140),  Expect(2) = 6e-41, Method: Compositional matrix adjust.
 Identities = 24/39 (62%), Positives = 30/39 (77%), Gaps = 0/39 (0%)
 Frame = +2

Query  455  DSDVLPIQTLYSINGWDCYPWAFQAENPQAEIIIHNPGV  571
            ++DV P+QTLYS +GWD Y WAF+A +  A I IHNPGV
Sbjct  87   ETDVFPVQTLYSSSGWDSYSWAFKATSAVAHIFIHNPGV  125



>dbj|BAK03627.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=371

 Score =   137 bits (345),  Expect(2) = 7e-41, Method: Compositional matrix adjust.
 Identities = 65/105 (62%), Positives = 81/105 (77%), Gaps = 1/105 (1%)
 Frame = +1

Query  142  TDGLLVNGNFEA-PVKKTDLNGTIVTRHDAVPGWTVTGFVEYIQAGQKQGDMQLVVPEGF  318
            TDGLL NGNFE  P K   +NGT+V    A+P W  +GFVEYI++G KQGDM LVVP+G 
Sbjct  22   TDGLLPNGNFELDPAKSELVNGTVVKGGKAIPKWETSGFVEYIESGHKQGDMLLVVPQGA  81

Query  319  AAVRLGNEASIKQTLNVSKGMYYSITFCAARTCAQEERLNITVAP  453
             AVRLGN+ASI Q + V++G YY++TF AARTCAQ ERLN++V+P
Sbjct  82   YAVRLGNDASILQRIPVARGSYYAVTFSAARTCAQAERLNVSVSP  126


 Score = 56.6 bits (135),  Expect(2) = 7e-41, Method: Compositional matrix adjust.
 Identities = 23/39 (59%), Positives = 30/39 (77%), Gaps = 0/39 (0%)
 Frame = +2

Query  455  DSDVLPIQTLYSINGWDCYPWAFQAENPQAEIIIHNPGV  571
            +S VLP+QT+Y  NGWD Y WAF+A+    E++IHNPGV
Sbjct  127  ESGVLPMQTIYGSNGWDSYAWAFKAKLDVVELVIHNPGV  165



>ref|XP_006301335.1| hypothetical protein CARUB_v10021745mg [Capsella rubella]
 gb|EOA34233.1| hypothetical protein CARUB_v10021745mg [Capsella rubella]
Length=378

 Score =   138 bits (348),  Expect(2) = 7e-41, Method: Compositional matrix adjust.
 Identities = 66/101 (65%), Positives = 78/101 (77%), Gaps = 0/101 (0%)
 Frame = +1

Query  145  DGLLVNGNFEAPVKKTDLNGTIVTRHDAVPGWTVTGFVEYIQAGQKQGDMQLVVPEGFAA  324
            DGLL NGNFE   K + L G++V    AVP W +TGFVEYI++GQKQ DM LVVP+G +A
Sbjct  35   DGLLPNGNFEMGPKPSQLKGSVVKERSAVPNWDITGFVEYIKSGQKQDDMVLVVPQGSSA  94

Query  325  VRLGNEASIKQTLNVSKGMYYSITFCAARTCAQEERLNITV  447
            VRLGNEAS+ Q ++V  G  YSITF AARTCAQEERLNI+V
Sbjct  95   VRLGNEASVSQKISVIPGRLYSITFSAARTCAQEERLNISV  135


 Score = 55.5 bits (132),  Expect(2) = 7e-41, Method: Compositional matrix adjust.
 Identities = 23/39 (59%), Positives = 29/39 (74%), Gaps = 0/39 (0%)
 Frame = +2

Query  455  DSDVLPIQTLYSINGWDCYPWAFQAENPQAEIIIHNPGV  571
            +S V+PIQT+Y  +GWD Y WAF+A  P+ EI  HNPGV
Sbjct  138  ESGVIPIQTMYGSDGWDSYSWAFKAGGPKIEIRFHNPGV  176



>ref|XP_008792101.1| PREDICTED: uncharacterized protein LOC103708794 [Phoenix dactylifera]
Length=371

 Score =   137 bits (345),  Expect(2) = 1e-40, Method: Compositional matrix adjust.
 Identities = 66/104 (63%), Positives = 79/104 (76%), Gaps = 0/104 (0%)
 Frame = +1

Query  142  TDGLLVNGNFEAPVKKTDLNGTIVTRHDAVPGWTVTGFVEYIQAGQKQGDMQLVVPEGFA  321
            TDGLL NGNFE     + L GT V   +A+P W ++G VEYI  G KQGDM LVVPEG  
Sbjct  23   TDGLLPNGNFELGPASSKLRGTEVIGRNAIPRWEISGTVEYIPWGHKQGDMLLVVPEGSY  82

Query  322  AVRLGNEASIKQTLNVSKGMYYSITFCAARTCAQEERLNITVAP  453
            AVRLGNEASIKQ + V++G+ YS+TF AARTCAQ+ERLN++VAP
Sbjct  83   AVRLGNEASIKQRIKVTRGVRYSLTFSAARTCAQDERLNVSVAP  126


 Score = 56.2 bits (134),  Expect(2) = 1e-40, Method: Compositional matrix adjust.
 Identities = 23/39 (59%), Positives = 32/39 (82%), Gaps = 0/39 (0%)
 Frame = +2

Query  455  DSDVLPIQTLYSINGWDCYPWAFQAENPQAEIIIHNPGV  571
            +S V+P+QT+YS NGWD Y WA+ A++  AE++IHNPGV
Sbjct  127  ESGVVPMQTMYSSNGWDSYAWAWNAKSDVAEVVIHNPGV  165



>gb|KFK42429.1| hypothetical protein AALP_AA2G255100 [Arabis alpina]
Length=368

 Score =   138 bits (347),  Expect(2) = 1e-40, Method: Compositional matrix adjust.
 Identities = 67/101 (66%), Positives = 77/101 (76%), Gaps = 0/101 (0%)
 Frame = +1

Query  145  DGLLVNGNFEAPVKKTDLNGTIVTRHDAVPGWTVTGFVEYIQAGQKQGDMQLVVPEGFAA  324
            DGLL NGNFE   K + L G+I+    AVP W +TGFVEYI+AGQ+Q DM LVVPEG +A
Sbjct  26   DGLLPNGNFEMGPKPSQLKGSIIKGRTAVPNWDITGFVEYIKAGQRQEDMVLVVPEGASA  85

Query  325  VRLGNEASIKQTLNVSKGMYYSITFCAARTCAQEERLNITV  447
            VRLGNEASI Q + V  G  YSITF AARTCAQ+ERLNI+V
Sbjct  86   VRLGNEASISQKITVQSGRLYSITFSAARTCAQDERLNISV  126


 Score = 55.1 bits (131),  Expect(2) = 1e-40, Method: Compositional matrix adjust.
 Identities = 22/39 (56%), Positives = 29/39 (74%), Gaps = 0/39 (0%)
 Frame = +2

Query  452  RDSDVLPIQTLYSINGWDCYPWAFQAENPQAEIIIHNPG  568
             +S V+PIQT+Y  +GWD Y WAF+A  P+ EI +HNPG
Sbjct  128  HESGVIPIQTMYGSDGWDSYSWAFKAGGPEIEIRVHNPG  166



>ref|XP_009348421.1| PREDICTED: uncharacterized protein LOC103940075 [Pyrus x bretschneideri]
Length=374

 Score =   138 bits (348),  Expect(2) = 2e-40, Method: Compositional matrix adjust.
 Identities = 64/108 (59%), Positives = 82/108 (76%), Gaps = 0/108 (0%)
 Frame = +1

Query  142  TDGLLVNGNFEAPVKKTDLNGTIVTRHDAVPGWTVTGFVEYIQAGQKQGDMQLVVPEGFA  321
            TDGLL NGNFE   K ++L GT+VT  +A+P W ++GFVEYI++G+KQGDM LVVP G  
Sbjct  25   TDGLLPNGNFEYGPKHSELKGTVVTNPNAIPNWEISGFVEYIKSGKKQGDMLLVVPAGGF  84

Query  322  AVRLGNEASIKQTLNVSKGMYYSITFCAARTCAQEERLNITVAPGLRR  465
            AVRLG EA IKQ L ++KG +YSITF   RTC QEE+LN++V P + +
Sbjct  85   AVRLGKEALIKQKLKLTKGGFYSITFTGGRTCGQEEKLNVSVNPNVEK  132


 Score = 54.3 bits (129),  Expect(2) = 2e-40, Method: Compositional matrix adjust.
 Identities = 21/40 (53%), Positives = 29/40 (73%), Gaps = 0/40 (0%)
 Frame = +2

Query  449  RRDSDVLPIQTLYSINGWDCYPWAFQAENPQAEIIIHNPG  568
            + D  ++PIQT+YS NGWD Y W F A+  + E++IHNPG
Sbjct  132  KNDWGIIPIQTMYSCNGWDSYAWGFNADFDEVELVIHNPG  171



>ref|XP_006601137.1| PREDICTED: uncharacterized protein LOC100813910 isoform X1 [Glycine 
max]
 ref|XP_006601138.1| PREDICTED: uncharacterized protein LOC100813910 isoform X2 [Glycine 
max]
Length=366

 Score =   144 bits (363),  Expect(2) = 2e-40, Method: Compositional matrix adjust.
 Identities = 70/104 (67%), Positives = 81/104 (78%), Gaps = 1/104 (1%)
 Frame = +1

Query  145  DGLLVNGNFEAPVKKTDLNGTIVTR-HDAVPGWTVTGFVEYIQAGQKQGDMQLVVPEGFA  321
            DGL+ NGNFE   K + L GT+V     ++P W ++GFVEYI++GQKQGDM LVVPEG  
Sbjct  24   DGLVANGNFELGPKPSALKGTVVVGGSHSIPEWEISGFVEYIKSGQKQGDMLLVVPEGAY  83

Query  322  AVRLGNEASIKQTLNVSKGMYYSITFCAARTCAQEERLNITVAP  453
            AVRLGNEASIKQ + V KGMYYSITF  ARTCAQEERLNI+V P
Sbjct  84   AVRLGNEASIKQRIKVIKGMYYSITFMVARTCAQEERLNISVTP  127


 Score = 48.1 bits (113),  Expect(2) = 2e-40, Method: Compositional matrix adjust.
 Identities = 19/35 (54%), Positives = 27/35 (77%), Gaps = 0/35 (0%)
 Frame = +2

Query  464  VLPIQTLYSINGWDCYPWAFQAENPQAEIIIHNPG  568
            V+PIQTLY+ +GWD   + F+AE+   E++IHNPG
Sbjct  131  VIPIQTLYTSSGWDPIAFGFKAESETVEMLIHNPG  165



>gb|KHN06654.1| hypothetical protein glysoja_037506 [Glycine soja]
Length=366

 Score =   144 bits (363),  Expect(2) = 2e-40, Method: Compositional matrix adjust.
 Identities = 70/104 (67%), Positives = 81/104 (78%), Gaps = 1/104 (1%)
 Frame = +1

Query  145  DGLLVNGNFEAPVKKTDLNGTIVTR-HDAVPGWTVTGFVEYIQAGQKQGDMQLVVPEGFA  321
            DGL+ NGNFE   K + L GT+V     ++P W ++GFVEYI++GQKQGDM LVVPEG  
Sbjct  24   DGLVANGNFELGPKPSALKGTVVIGGSHSIPEWEISGFVEYIKSGQKQGDMLLVVPEGAY  83

Query  322  AVRLGNEASIKQTLNVSKGMYYSITFCAARTCAQEERLNITVAP  453
            AVRLGNEASIKQ + V KGMYYSITF  ARTCAQEERLNI+V P
Sbjct  84   AVRLGNEASIKQRIKVIKGMYYSITFMVARTCAQEERLNISVTP  127


 Score = 48.1 bits (113),  Expect(2) = 2e-40, Method: Compositional matrix adjust.
 Identities = 19/35 (54%), Positives = 27/35 (77%), Gaps = 0/35 (0%)
 Frame = +2

Query  464  VLPIQTLYSINGWDCYPWAFQAENPQAEIIIHNPG  568
            V+PIQTLY+ +GWD   + F+AE+   E++IHNPG
Sbjct  131  VIPIQTLYTSSGWDPIAFGFKAESETVEMLIHNPG  165



>ref|XP_010048991.1| PREDICTED: uncharacterized protein LOC104437692 [Eucalyptus grandis]
 gb|KCW81432.1| hypothetical protein EUGRSUZ_C02812 [Eucalyptus grandis]
Length=325

 Score =   131 bits (329),  Expect(2) = 3e-40, Method: Compositional matrix adjust.
 Identities = 60/86 (70%), Positives = 72/86 (84%), Gaps = 0/86 (0%)
 Frame = +1

Query  196  LNGTIVTRHDAVPGWTVTGFVEYIQAGQKQGDMQLVVPEGFAAVRLGNEASIKQTLNVSK  375
            + GT+V    AVP W ++GFVEYI++GQKQGDM LVVP G  AVRLGNEASIKQ L V++
Sbjct  1    MRGTVVVGRYAVPKWEISGFVEYIKSGQKQGDMLLVVPAGAFAVRLGNEASIKQRLPVAR  60

Query  376  GMYYSITFCAARTCAQEERLNITVAP  453
            GMYYS+TF AARTCAQEE+LN++VAP
Sbjct  61   GMYYSLTFSAARTCAQEEKLNVSVAP  86


 Score = 60.8 bits (146),  Expect(2) = 3e-40, Method: Compositional matrix adjust.
 Identities = 26/36 (72%), Positives = 30/36 (83%), Gaps = 0/36 (0%)
 Frame = +2

Query  464  VLPIQTLYSINGWDCYPWAFQAENPQAEIIIHNPGV  571
            VLP+QTLYS NGWD Y WAF+A+   AEI+IHNPGV
Sbjct  90   VLPMQTLYSSNGWDSYAWAFRADQDVAEIVIHNPGV  125



>ref|XP_011072257.1| PREDICTED: uncharacterized protein LOC105157546 [Sesamum indicum]
Length=401

 Score =   139 bits (351),  Expect(2) = 3e-40, Method: Compositional matrix adjust.
 Identities = 64/104 (62%), Positives = 80/104 (77%), Gaps = 0/104 (0%)
 Frame = +1

Query  142  TDGLLVNGNFEAPVKKTDLNGTIVTRHDAVPGWTVTGFVEYIQAGQKQGDMQLVVPEGFA  321
            TDGLL NGNFE   K + + GT V    A+P W ++GFVEYI +G KQGDM LVVPEG +
Sbjct  51   TDGLLPNGNFEYGPKPSQMKGTKVIDPHAIPSWEISGFVEYITSGHKQGDMLLVVPEGAS  110

Query  322  AVRLGNEASIKQTLNVSKGMYYSITFCAARTCAQEERLNITVAP  453
            AVRLG+EASIK  + V+ GM+YS++F AARTCAQEE+LN++V P
Sbjct  111  AVRLGDEASIKTKVKVTNGMFYSLSFSAARTCAQEEKLNVSVLP  154


 Score = 52.4 bits (124),  Expect(2) = 3e-40, Method: Compositional matrix adjust.
 Identities = 22/39 (56%), Positives = 29/39 (74%), Gaps = 0/39 (0%)
 Frame = +2

Query  452  RDSDVLPIQTLYSINGWDCYPWAFQAENPQAEIIIHNPG  568
            +D  +LPIQT+YS +GWD Y W F A++   EI+IHNPG
Sbjct  159  KDWGILPIQTVYSSDGWDSYSWGFLAQSNDIEIMIHNPG  197



>gb|KJB80694.1| hypothetical protein B456_013G110800 [Gossypium raimondii]
Length=325

 Score =   136 bits (343),  Expect(2) = 3e-40, Method: Compositional matrix adjust.
 Identities = 64/86 (74%), Positives = 71/86 (83%), Gaps = 0/86 (0%)
 Frame = +1

Query  196  LNGTIVTRHDAVPGWTVTGFVEYIQAGQKQGDMQLVVPEGFAAVRLGNEASIKQTLNVSK  375
            + GT+V    A+PGW   GFVEYI++GQKQGDM LVVPEG  AVRLGNEASIKQ + V K
Sbjct  1    MKGTVVVGRYAIPGWVNEGFVEYIKSGQKQGDMLLVVPEGAYAVRLGNEASIKQEIKVVK  60

Query  376  GMYYSITFCAARTCAQEERLNITVAP  453
            GMYYSITF AARTCAQEERLN+TVAP
Sbjct  61   GMYYSITFSAARTCAQEERLNVTVAP  86


 Score = 55.5 bits (132),  Expect(2) = 3e-40, Method: Compositional matrix adjust.
 Identities = 23/39 (59%), Positives = 30/39 (77%), Gaps = 0/39 (0%)
 Frame = +2

Query  455  DSDVLPIQTLYSINGWDCYPWAFQAENPQAEIIIHNPGV  571
            DS V+PIQT+YS +GWD Y WAF+ ++    +IIHNPGV
Sbjct  87   DSGVMPIQTVYSSSGWDNYAWAFKTQSDAVMLIIHNPGV  125



>gb|ACG40327.1| hypothetical protein [Zea mays]
Length=381

 Score =   138 bits (348),  Expect(2) = 3e-40, Method: Compositional matrix adjust.
 Identities = 68/107 (64%), Positives = 83/107 (78%), Gaps = 3/107 (3%)
 Frame = +1

Query  142  TDGLLVNGNFE-APVKKTDLNGTIVTRHDAVPGWTVTGFVEYIQAGQKQGDMQLVVPEGF  318
            TDGLL NGNFE  P K   +NGT+V+   A+P W  +GFVEYI++G KQGDM LVVP+G 
Sbjct  24   TDGLLPNGNFEDGPPKSALVNGTVVSGAHAIPRWETSGFVEYIESGHKQGDMLLVVPQGA  83

Query  319  AAVRLGNEASIKQTLNVSKGMYYSITFCAARTCAQEE--RLNITVAP  453
             AVRLGNEASI+Q L V++G YY+ITF AARTCAQ E  RLN++V+P
Sbjct  84   HAVRLGNEASIRQRLAVARGAYYAITFSAARTCAQAERXRLNVSVSP  130


 Score = 53.5 bits (127),  Expect(2) = 3e-40, Method: Compositional matrix adjust.
 Identities = 21/36 (58%), Positives = 27/36 (75%), Gaps = 0/36 (0%)
 Frame = +2

Query  464  VLPIQTLYSINGWDCYPWAFQAENPQAEIIIHNPGV  571
            VLP+QT+Y  NGWD Y WAF+A+     ++IHNPGV
Sbjct  134  VLPMQTIYGSNGWDSYAWAFKAKMDAVTLVIHNPGV  169



>ref|XP_008672703.1| PREDICTED: hypothetical protein isoform X1 [Zea mays]
 gb|ACF84649.1| unknown [Zea mays]
 gb|ACF87605.1| unknown [Zea mays]
 gb|ACF87824.1| unknown [Zea mays]
 tpg|DAA58942.1| TPA: hypothetical protein ZEAMMB73_364218 [Zea mays]
Length=381

 Score =   138 bits (348),  Expect(2) = 3e-40, Method: Compositional matrix adjust.
 Identities = 68/107 (64%), Positives = 83/107 (78%), Gaps = 3/107 (3%)
 Frame = +1

Query  142  TDGLLVNGNFE-APVKKTDLNGTIVTRHDAVPGWTVTGFVEYIQAGQKQGDMQLVVPEGF  318
            TDGLL NGNFE  P K   +NGT+V+   A+P W  +GFVEYI++G KQGDM LVVP+G 
Sbjct  24   TDGLLPNGNFEDGPPKSALVNGTVVSGAHAIPRWETSGFVEYIESGHKQGDMLLVVPQGA  83

Query  319  AAVRLGNEASIKQTLNVSKGMYYSITFCAARTCAQEE--RLNITVAP  453
             AVRLGNEASI+Q L V++G YY+ITF AARTCAQ E  RLN++V+P
Sbjct  84   HAVRLGNEASIRQRLAVARGAYYAITFSAARTCAQAERQRLNVSVSP  130


 Score = 53.5 bits (127),  Expect(2) = 3e-40, Method: Compositional matrix adjust.
 Identities = 21/36 (58%), Positives = 27/36 (75%), Gaps = 0/36 (0%)
 Frame = +2

Query  464  VLPIQTLYSINGWDCYPWAFQAENPQAEIIIHNPGV  571
            VLP+QT+Y  NGWD Y WAF+A+     ++IHNPGV
Sbjct  134  VLPMQTIYGSNGWDSYAWAFKAKMDAVTLVIHNPGV  169



>ref|NP_001053188.1| Os04g0494600 [Oryza sativa Japonica Group]
 emb|CAD41544.2| OSJNBb0091E11.14 [Oryza sativa Japonica Group]
 dbj|BAF15102.1| Os04g0494600 [Oryza sativa Japonica Group]
 emb|CAH67289.1| OSIGBa0103O01.7 [Oryza sativa Indica Group]
 gb|EAY94693.1| hypothetical protein OsI_16470 [Oryza sativa Indica Group]
 gb|EAZ31209.1| hypothetical protein OsJ_15309 [Oryza sativa Japonica Group]
 dbj|BAG99074.1| unnamed protein product [Oryza sativa Japonica Group]
Length=377

 Score =   151 bits (381),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 73/120 (61%), Positives = 87/120 (73%), Gaps = 0/120 (0%)
 Frame = +1

Query  145  DGLLVNGNFEAPVKKTDLNGTIVTRHDAVPGWTVTGFVEYIQAGQKQGDMQLVVPEGFAA  324
            DGLL+NGNFE    K+ +NGT V    A+P W +TGFVEYI +GQKQGDM L VPEG  A
Sbjct  25   DGLLLNGNFEYQPSKSQMNGTRVMAEYAIPYWKITGFVEYISSGQKQGDMLLTVPEGAHA  84

Query  325  VRLGNEASIKQTLNVSKGMYYSITFCAARTCAQEERLNITVAPGLRRAAHPNAVQYQRLG  504
            VRLGNEASI+Q ++V++GMYYSITF AARTCAQ E+LN++VAPG      P    Y   G
Sbjct  85   VRLGNEASIEQQISVTRGMYYSITFSAARTCAQSEKLNVSVAPGPESGELPIQTVYTSSG  144



>ref|XP_010417734.1| PREDICTED: uncharacterized protein LOC104703420 [Camelina sativa]
Length=369

 Score =   135 bits (341),  Expect(2) = 5e-40, Method: Compositional matrix adjust.
 Identities = 65/101 (64%), Positives = 78/101 (77%), Gaps = 0/101 (0%)
 Frame = +1

Query  145  DGLLVNGNFEAPVKKTDLNGTIVTRHDAVPGWTVTGFVEYIQAGQKQGDMQLVVPEGFAA  324
            DGLL NGNFE   K + L G+++    AVP W +TGFVEYI++GQKQ DM LVVP+G +A
Sbjct  26   DGLLPNGNFELGPKLSQLKGSMIKERTAVPNWDITGFVEYIKSGQKQDDMVLVVPQGSSA  85

Query  325  VRLGNEASIKQTLNVSKGMYYSITFCAARTCAQEERLNITV  447
            VRLGNEASI Q ++V  G  YSITF AARTCAQ+ERLNI+V
Sbjct  86   VRLGNEASISQKISVIPGRLYSITFSAARTCAQDERLNISV  126


 Score = 55.8 bits (133),  Expect(2) = 5e-40, Method: Compositional matrix adjust.
 Identities = 23/39 (59%), Positives = 29/39 (74%), Gaps = 0/39 (0%)
 Frame = +2

Query  455  DSDVLPIQTLYSINGWDCYPWAFQAENPQAEIIIHNPGV  571
            +S V+PIQT+Y  +GWD Y WAF+A  P+ EI  HNPGV
Sbjct  129  ESGVIPIQTMYGSDGWDSYSWAFKAGGPKIEIRFHNPGV  167



>ref|XP_010472958.1| PREDICTED: uncharacterized protein LOC104752499 [Camelina sativa]
Length=369

 Score =   135 bits (341),  Expect(2) = 5e-40, Method: Compositional matrix adjust.
 Identities = 65/101 (64%), Positives = 78/101 (77%), Gaps = 0/101 (0%)
 Frame = +1

Query  145  DGLLVNGNFEAPVKKTDLNGTIVTRHDAVPGWTVTGFVEYIQAGQKQGDMQLVVPEGFAA  324
            DGLL NGNFE   + + L G++V    AVP W +TGFVEYI++GQKQ DM LVVP+G +A
Sbjct  26   DGLLPNGNFELGPRPSQLKGSLVKERTAVPNWDITGFVEYIKSGQKQDDMVLVVPQGSSA  85

Query  325  VRLGNEASIKQTLNVSKGMYYSITFCAARTCAQEERLNITV  447
            VRLGNEASI Q ++V  G  YSITF AARTCAQ+ERLNI+V
Sbjct  86   VRLGNEASISQKISVIPGRLYSITFSAARTCAQDERLNISV  126


 Score = 55.5 bits (132),  Expect(2) = 5e-40, Method: Compositional matrix adjust.
 Identities = 23/39 (59%), Positives = 29/39 (74%), Gaps = 0/39 (0%)
 Frame = +2

Query  455  DSDVLPIQTLYSINGWDCYPWAFQAENPQAEIIIHNPGV  571
            +S V+PIQT+Y  +GWD Y WAF+A  P+ EI  HNPGV
Sbjct  129  ESGVIPIQTMYGSDGWDSYSWAFKAGGPKIEIRFHNPGV  167



>ref|XP_010429991.1| PREDICTED: uncharacterized protein LOC104714356 [Camelina sativa]
Length=369

 Score =   135 bits (340),  Expect(2) = 5e-40, Method: Compositional matrix adjust.
 Identities = 65/101 (64%), Positives = 78/101 (77%), Gaps = 0/101 (0%)
 Frame = +1

Query  145  DGLLVNGNFEAPVKKTDLNGTIVTRHDAVPGWTVTGFVEYIQAGQKQGDMQLVVPEGFAA  324
            DGLL NGNFE   + + L G++V    AVP W +TGFVEYI++GQKQ DM LVVP+G +A
Sbjct  26   DGLLPNGNFELGPRPSQLKGSLVKERTAVPDWDITGFVEYIKSGQKQDDMVLVVPQGSSA  85

Query  325  VRLGNEASIKQTLNVSKGMYYSITFCAARTCAQEERLNITV  447
            VRLGNEASI Q ++V  G  YSITF AARTCAQ+ERLNI+V
Sbjct  86   VRLGNEASISQKISVIPGRLYSITFSAARTCAQDERLNISV  126


 Score = 55.8 bits (133),  Expect(2) = 5e-40, Method: Compositional matrix adjust.
 Identities = 23/39 (59%), Positives = 29/39 (74%), Gaps = 0/39 (0%)
 Frame = +2

Query  455  DSDVLPIQTLYSINGWDCYPWAFQAENPQAEIIIHNPGV  571
            +S V+PIQT+Y  +GWD Y WAF+A  P+ EI  HNPGV
Sbjct  129  ESGVIPIQTMYGSDGWDSYSWAFKAGGPKIEIRFHNPGV  167



>ref|XP_006581022.1| PREDICTED: uncharacterized protein LOC100802444 isoform X1 [Glycine 
max]
Length=372

 Score =   139 bits (351),  Expect(2) = 6e-40, Method: Compositional matrix adjust.
 Identities = 66/105 (63%), Positives = 80/105 (76%), Gaps = 1/105 (1%)
 Frame = +1

Query  142  TDGLLVNGNFEAPVKKTDLNGTIVTR-HDAVPGWTVTGFVEYIQAGQKQGDMQLVVPEGF  318
            T G ++NG FE   K  D+ GT+VT    ++PGW ++GF+EYI++GQKQ DM LVVP G 
Sbjct  21   THGAVINGEFELGPKPQDMKGTVVTGGPHSIPGWEISGFIEYIKSGQKQDDMLLVVPNGA  80

Query  319  AAVRLGNEASIKQTLNVSKGMYYSITFCAARTCAQEERLNITVAP  453
             AVRLGNEASIKQ L V KGMYYSITF  ARTCAQEE+LN++ AP
Sbjct  81   YAVRLGNEASIKQNLKVVKGMYYSITFVVARTCAQEEKLNVSAAP  125


 Score = 51.6 bits (122),  Expect(2) = 6e-40, Method: Compositional matrix adjust.
 Identities = 19/35 (54%), Positives = 27/35 (77%), Gaps = 0/35 (0%)
 Frame = +2

Query  464  VLPIQTLYSINGWDCYPWAFQAENPQAEIIIHNPG  568
            VLP+QT+Y  NGWD Y W+F+A+ P  +++ HNPG
Sbjct  129  VLPMQTVYGGNGWDAYAWSFRADYPSVDMVFHNPG  163



>ref|XP_011466736.1| PREDICTED: uncharacterized protein LOC101306247 isoform X1 [Fragaria 
vesca subsp. vesca]
Length=373

 Score =   150 bits (379),  Expect = 6e-40, Method: Compositional matrix adjust.
 Identities = 73/125 (58%), Positives = 91/125 (73%), Gaps = 9/125 (7%)
 Frame = +1

Query  142  TDGLLVNGNFEAPVKKTDLNGTIVTRHDAVPGWTVTGFVEYIQAGQKQGDMQLVVPEGFA  321
            TDGLL NGNFE   K + + GT+VT H+A+P W  +G+VEYI++G KQGDM LVVPEG  
Sbjct  23   TDGLLPNGNFEYGPKPSQMKGTVVTAHNAIPNWETSGYVEYIKSGHKQGDMLLVVPEGGF  82

Query  322  AVRLGNEASIKQTLNVSKGMYYSITFCAARTCAQEERLNITVAPGLRRAAHPNAVQYQRL  501
            A+RLGNEASIKQ + V+KG +Y+ITF AARTCAQEE LNI+V P          V+ Q  
Sbjct  83   AIRLGNEASIKQKIKVTKGGFYAITFSAARTCAQEEILNISVNPN---------VEKQDF  133

Query  502  GLLPV  516
            G+LP+
Sbjct  134  GILPI  138


 Score = 55.5 bits (132),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 22/41 (54%), Positives = 29/41 (71%), Gaps = 0/41 (0%)
 Frame = +2

Query  449  RRDSDVLPIQTLYSINGWDCYPWAFQAENPQAEIIIHNPGV  571
            ++D  +LPIQT+YS  GWD Y W F A+  + E+ IHNPGV
Sbjct  130  KQDFGILPIQTMYSSTGWDSYAWGFNADADEIELTIHNPGV  170



>ref|XP_009333642.1| PREDICTED: uncharacterized protein LOC103926567 [Pyrus x bretschneideri]
Length=373

 Score =   150 bits (378),  Expect = 8e-40, Method: Compositional matrix adjust.
 Identities = 72/125 (58%), Positives = 91/125 (73%), Gaps = 9/125 (7%)
 Frame = +1

Query  142  TDGLLVNGNFEAPVKKTDLNGTIVTRHDAVPGWTVTGFVEYIQAGQKQGDMQLVVPEGFA  321
            TDGLL NGNFE   K+++L GT+VT   A+P W ++GFVEYI++GQKQGDM LVVPEG  
Sbjct  25   TDGLLPNGNFEYGPKQSELKGTVVTNPHAIPNWEISGFVEYIKSGQKQGDMLLVVPEGGF  84

Query  322  AVRLGNEASIKQTLNVSKGMYYSITFCAARTCAQEERLNITVAPGLRRAAHPNAVQYQRL  501
            AVRLGNEA IKQ L V KG +YS+TF AARTCAQEE LN+++ P L +         +  
Sbjct  85   AVRLGNEALIKQKLKVKKGGFYSVTFSAARTCAQEETLNVSITPNLEK---------RHW  135

Query  502  GLLPV  516
            G++P+
Sbjct  136  GIMPI  140


 Score = 52.4 bits (124),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 21/41 (51%), Positives = 29/41 (71%), Gaps = 0/41 (0%)
 Frame = +2

Query  449  RRDSDVLPIQTLYSINGWDCYPWAFQAENPQAEIIIHNPGV  571
            +R   ++PIQT+YS  GWD Y W F A+  + E++IHNPGV
Sbjct  132  KRHWGIMPIQTMYSSIGWDSYAWGFNADFDEIELVIHNPGV  172



>ref|XP_006646088.1| PREDICTED: uncharacterized protein LOC102706903 [Oryza brachyantha]
Length=276

 Score =   137 bits (346),  Expect(2) = 8e-40, Method: Compositional matrix adjust.
 Identities = 68/109 (62%), Positives = 84/109 (77%), Gaps = 5/109 (5%)
 Frame = +1

Query  142  TDG----LLVNGNFEAPVKKTDL-NGTIVTRHDAVPGWTVTGFVEYIQAGQKQGDMQLVV  306
            TDG    LL NGNFE    K+DL NGT+V   +A+P W  +GFVEYI++G KQGDM LVV
Sbjct  29   TDGIISWLLPNGNFEDGPPKSDLVNGTVVRGANAIPRWETSGFVEYIESGHKQGDMLLVV  88

Query  307  PEGFAAVRLGNEASIKQTLNVSKGMYYSITFCAARTCAQEERLNITVAP  453
            P+G  AVRLGNEASI+Q L V++G YY++TF AARTCAQ ERLN++V+P
Sbjct  89   PQGAHAVRLGNEASIRQRLAVARGAYYAVTFSAARTCAQAERLNVSVSP  137


 Score = 52.8 bits (125),  Expect(2) = 8e-40, Method: Compositional matrix adjust.
 Identities = 20/36 (56%), Positives = 28/36 (78%), Gaps = 0/36 (0%)
 Frame = +2

Query  464  VLPIQTLYSINGWDCYPWAFQAENPQAEIIIHNPGV  571
            VLP+QT+Y  +GWD Y WAF+A+  +  ++IHNPGV
Sbjct  141  VLPMQTIYGSSGWDSYAWAFRAKMDEVALVIHNPGV  176



>gb|EAZ31211.1| hypothetical protein OsJ_15311 [Oryza sativa Japonica Group]
Length=294

 Score =   139 bits (349),  Expect(2) = 8e-40, Method: Compositional matrix adjust.
 Identities = 67/103 (65%), Positives = 78/103 (76%), Gaps = 0/103 (0%)
 Frame = +1

Query  145  DGLLVNGNFEAPVKKTDLNGTIVTRHDAVPGWTVTGFVEYIQAGQKQGDMQLVVPEGFAA  324
            DGLL NGNFE    K+ LNGT V    A+P W ++GFVEYI +GQ QGDM L VPEG  A
Sbjct  26   DGLLPNGNFEEAPDKSQLNGTRVIGRYAIPQWEISGFVEYIGSGQMQGDMLLPVPEGAYA  85

Query  325  VRLGNEASIKQTLNVSKGMYYSITFCAARTCAQEERLNITVAP  453
            VRLGNEASI+Q L +++GM+YS+TF AARTCAQ E LNITV P
Sbjct  86   VRLGNEASIQQRLTLTRGMHYSVTFSAARTCAQSELLNITVTP  128


 Score = 51.6 bits (122),  Expect(2) = 8e-40, Method: Compositional matrix adjust.
 Identities = 19/35 (54%), Positives = 26/35 (74%), Gaps = 0/35 (0%)
 Frame = +2

Query  467  LPIQTLYSINGWDCYPWAFQAENPQAEIIIHNPGV  571
            +PIQT+Y+ +GWD Y WAF+A      +I+HNPGV
Sbjct  133  VPIQTVYTSSGWDSYSWAFKARRSDVSLIVHNPGV  167



>ref|XP_009104452.1| PREDICTED: uncharacterized protein LOC103830427 [Brassica rapa]
Length=404

 Score =   137 bits (345),  Expect(2) = 1e-39, Method: Compositional matrix adjust.
 Identities = 67/101 (66%), Positives = 78/101 (77%), Gaps = 0/101 (0%)
 Frame = +1

Query  145  DGLLVNGNFEAPVKKTDLNGTIVTRHDAVPGWTVTGFVEYIQAGQKQGDMQLVVPEGFAA  324
            DGLL NGNFE   K + L G++V   +AV  W +TGFVEYI+AGQKQ DM LVVPEG +A
Sbjct  26   DGLLPNGNFEIGPKPSQLKGSVVKERNAVAHWDMTGFVEYIKAGQKQDDMVLVVPEGSSA  85

Query  325  VRLGNEASIKQTLNVSKGMYYSITFCAARTCAQEERLNITV  447
            VRLGNEASI Q ++V  G  YSITF AARTCAQ+ERLNI+V
Sbjct  86   VRLGNEASISQKISVRSGRLYSITFSAARTCAQDERLNISV  126


 Score = 53.1 bits (126),  Expect(2) = 1e-39, Method: Compositional matrix adjust.
 Identities = 22/38 (58%), Positives = 28/38 (74%), Gaps = 0/38 (0%)
 Frame = +2

Query  455  DSDVLPIQTLYSINGWDCYPWAFQAENPQAEIIIHNPG  568
            +S V+PIQT+Y  +GWD Y WAF+A  P+  I IHNPG
Sbjct  129  ESGVIPIQTMYGSDGWDSYSWAFKAGGPEIVIRIHNPG  166



>ref|XP_004498654.1| PREDICTED: uncharacterized protein LOC101508759 [Cicer arietinum]
Length=366

 Score =   149 bits (377),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 76/126 (60%), Positives = 90/126 (71%), Gaps = 3/126 (2%)
 Frame = +1

Query  145  DGLLVNGNFEAPVKKTDLNGTIVTR-HDAVPGWTVTGFVEYIQAGQKQGDMQLVVPEGFA  321
            DGL+ NGNFE   K +DL GT++T    A+P W ++GFVEYI++GQKQGDM LVVPEG  
Sbjct  24   DGLVANGNFELGPKASDLKGTVITGGKTAIPEWEISGFVEYIKSGQKQGDMLLVVPEGAY  83

Query  322  AVRLGNEASIKQTLNVSKGMYYSITFCAARTCAQEERLNITVAPGLRRAAHPNAVQYQRL  501
            AVRLGNEASIKQ + V KGM+YSITF  ARTCAQEER+NI+VAP       P    Y   
Sbjct  84   AVRLGNEASIKQRIKVIKGMHYSITFMVARTCAQEERINISVAPDF--GIIPIQTLYTSS  141

Query  502  GLLPVG  519
            G  P+G
Sbjct  142  GWDPIG  147



>ref|NP_001053190.1| Os04g0494900 [Oryza sativa Japonica Group]
 dbj|BAF15104.1| Os04g0494900 [Oryza sativa Japonica Group]
 dbj|BAG93696.1| unnamed protein product [Oryza sativa Japonica Group]
Length=377

 Score =   138 bits (348),  Expect(2) = 1e-39, Method: Compositional matrix adjust.
 Identities = 67/103 (65%), Positives = 78/103 (76%), Gaps = 0/103 (0%)
 Frame = +1

Query  145  DGLLVNGNFEAPVKKTDLNGTIVTRHDAVPGWTVTGFVEYIQAGQKQGDMQLVVPEGFAA  324
            DGLL NGNFE    K+ LNGT V    A+P W ++GFVEYI +GQ QGDM L VPEG  A
Sbjct  32   DGLLPNGNFEEAPDKSQLNGTRVIGRYAIPQWEISGFVEYIGSGQMQGDMLLPVPEGAYA  91

Query  325  VRLGNEASIKQTLNVSKGMYYSITFCAARTCAQEERLNITVAP  453
            VRLGNEASI+Q L +++GM+YS+TF AARTCAQ E LNITV P
Sbjct  92   VRLGNEASIQQRLTLTRGMHYSVTFSAARTCAQSELLNITVTP  134


 Score = 51.2 bits (121),  Expect(2) = 1e-39, Method: Compositional matrix adjust.
 Identities = 19/35 (54%), Positives = 26/35 (74%), Gaps = 0/35 (0%)
 Frame = +2

Query  467  LPIQTLYSINGWDCYPWAFQAENPQAEIIIHNPGV  571
            +PIQT+Y+ +GWD Y WAF+A      +I+HNPGV
Sbjct  139  VPIQTVYTSSGWDSYSWAFKARRSDVSLIVHNPGV  173



>emb|CAD41548.2| OSJNBb0091E11.18 [Oryza sativa Japonica Group]
Length=371

 Score =   138 bits (348),  Expect(2) = 2e-39, Method: Compositional matrix adjust.
 Identities = 67/103 (65%), Positives = 78/103 (76%), Gaps = 0/103 (0%)
 Frame = +1

Query  145  DGLLVNGNFEAPVKKTDLNGTIVTRHDAVPGWTVTGFVEYIQAGQKQGDMQLVVPEGFAA  324
            DGLL NGNFE    K+ LNGT V    A+P W ++GFVEYI +GQ QGDM L VPEG  A
Sbjct  26   DGLLPNGNFEEAPDKSQLNGTRVIGRYAIPQWEISGFVEYIGSGQMQGDMLLPVPEGAYA  85

Query  325  VRLGNEASIKQTLNVSKGMYYSITFCAARTCAQEERLNITVAP  453
            VRLGNEASI+Q L +++GM+YS+TF AARTCAQ E LNITV P
Sbjct  86   VRLGNEASIQQRLTLTRGMHYSVTFSAARTCAQSELLNITVTP  128


 Score = 50.8 bits (120),  Expect(2) = 2e-39, Method: Compositional matrix adjust.
 Identities = 19/35 (54%), Positives = 26/35 (74%), Gaps = 0/35 (0%)
 Frame = +2

Query  467  LPIQTLYSINGWDCYPWAFQAENPQAEIIIHNPGV  571
            +PIQT+Y+ +GWD Y WAF+A      +I+HNPGV
Sbjct  133  VPIQTVYTSSGWDSYSWAFKARRSDVSLIVHNPGV  167



>gb|KHG21630.1| Adenosylhomocysteinase [Gossypium arboreum]
Length=374

 Score =   132 bits (333),  Expect(2) = 2e-39, Method: Compositional matrix adjust.
 Identities = 61/103 (59%), Positives = 78/103 (76%), Gaps = 0/103 (0%)
 Frame = +1

Query  145  DGLLVNGNFEAPVKKTDLNGTIVTRHDAVPGWTVTGFVEYIQAGQKQGDMQLVVPEGFAA  324
            DGLL NGNFE   K ++L GT V    ++P W + G+VEYI++GQKQ DM L+VP+G  A
Sbjct  24   DGLLPNGNFEQGPKASELKGTKVMSGKSIPNWEICGYVEYIKSGQKQDDMLLIVPQGAFA  83

Query  325  VRLGNEASIKQTLNVSKGMYYSITFCAARTCAQEERLNITVAP  453
            VRLGN A IKQ + V K M+YS+TF A+RTCAQEERLN++V+P
Sbjct  84   VRLGNGALIKQKIRVIKDMFYSLTFSASRTCAQEERLNVSVSP  126


 Score = 57.0 bits (136),  Expect(2) = 2e-39, Method: Compositional matrix adjust.
 Identities = 25/41 (61%), Positives = 29/41 (71%), Gaps = 0/41 (0%)
 Frame = +2

Query  449  RRDSDVLPIQTLYSINGWDCYPWAFQAENPQAEIIIHNPGV  571
            + DS + PIQT+YS NGWD Y WAFQA+    EI IHNP V
Sbjct  130  QNDSGLFPIQTMYSSNGWDSYAWAFQADAHVIEISIHNPSV  170



>ref|XP_002887838.1| hypothetical protein ARALYDRAFT_340195 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH64097.1| hypothetical protein ARALYDRAFT_340195 [Arabidopsis lyrata subsp. 
lyrata]
Length=371

 Score =   135 bits (341),  Expect(2) = 2e-39, Method: Compositional matrix adjust.
 Identities = 65/101 (64%), Positives = 78/101 (77%), Gaps = 0/101 (0%)
 Frame = +1

Query  145  DGLLVNGNFEAPVKKTDLNGTIVTRHDAVPGWTVTGFVEYIQAGQKQGDMQLVVPEGFAA  324
            DGLL NGNFE   K + L G++V    AVP W +TGFVEYI++GQKQ DM LVVP+G +A
Sbjct  28   DGLLPNGNFELGPKPSQLKGSVVKERTAVPNWDITGFVEYIKSGQKQDDMVLVVPQGSSA  87

Query  325  VRLGNEASIKQTLNVSKGMYYSITFCAARTCAQEERLNITV  447
            VRLGNEASI Q ++V  G  YSITF AARTCAQ+E+LNI+V
Sbjct  88   VRLGNEASISQKISVLPGRLYSITFSAARTCAQDEKLNISV  128


 Score = 53.9 bits (128),  Expect(2) = 2e-39, Method: Compositional matrix adjust.
 Identities = 22/40 (55%), Positives = 28/40 (70%), Gaps = 0/40 (0%)
 Frame = +2

Query  452  RDSDVLPIQTLYSINGWDCYPWAFQAENPQAEIIIHNPGV  571
             +S V+PIQT+Y  +GWD Y WAF+A  P+  I  HNPGV
Sbjct  130  HESGVIPIQTMYGSDGWDSYAWAFKAGGPEIHIRFHNPGV  169



>emb|CAH67377.1| OSIGBa0159F11.1 [Oryza sativa Indica Group]
 emb|CAH67293.1| OSIGBa0103O01.11 [Oryza sativa Indica Group]
 gb|EAY94677.1| hypothetical protein OsI_16456 [Oryza sativa Indica Group]
Length=371

 Score =   138 bits (348),  Expect(2) = 2e-39, Method: Compositional matrix adjust.
 Identities = 67/103 (65%), Positives = 78/103 (76%), Gaps = 0/103 (0%)
 Frame = +1

Query  145  DGLLVNGNFEAPVKKTDLNGTIVTRHDAVPGWTVTGFVEYIQAGQKQGDMQLVVPEGFAA  324
            DGLL NGNFE    K+ LNGT V    A+P W ++GFVEYI +GQ QGDM L VPEG  A
Sbjct  26   DGLLPNGNFEEAPDKSQLNGTRVIGRYAIPQWEISGFVEYIGSGQMQGDMLLPVPEGAYA  85

Query  325  VRLGNEASIKQTLNVSKGMYYSITFCAARTCAQEERLNITVAP  453
            VRLGNEASI+Q L +++GM+YS+TF AARTCAQ E LNITV P
Sbjct  86   VRLGNEASIQQRLTLTRGMHYSVTFSAARTCAQSELLNITVTP  128


 Score = 50.8 bits (120),  Expect(2) = 2e-39, Method: Compositional matrix adjust.
 Identities = 19/35 (54%), Positives = 26/35 (74%), Gaps = 0/35 (0%)
 Frame = +2

Query  467  LPIQTLYSINGWDCYPWAFQAENPQAEIIIHNPGV  571
            +PIQT+Y+ +GWD Y WAF+A      +I+HNPGV
Sbjct  133  VPIQTVYTSSGWDSYSWAFKARRSDVSLIVHNPGV  167



>ref|XP_006653557.1| PREDICTED: uncharacterized protein LOC102718925 [Oryza brachyantha]
Length=384

 Score =   139 bits (350),  Expect(2) = 2e-39, Method: Compositional matrix adjust.
 Identities = 66/102 (65%), Positives = 80/102 (78%), Gaps = 0/102 (0%)
 Frame = +1

Query  148  GLLVNGNFEAPVKKTDLNGTIVTRHDAVPGWTVTGFVEYIQAGQKQGDMQLVVPEGFAAV  327
            GLL NGNFE    ++ +NGT VT   A+P W ++GFVEYI +GQKQGDM L VPEG  AV
Sbjct  27   GLLPNGNFEEAPDESQMNGTRVTGRYAIPKWEISGFVEYIGSGQKQGDMLLPVPEGAYAV  86

Query  328  RLGNEASIKQTLNVSKGMYYSITFCAARTCAQEERLNITVAP  453
            RLGNEASI+Q L +++GM+YSITF AARTCAQ E LN+TV+P
Sbjct  87   RLGNEASIQQKLGLTRGMHYSITFSAARTCAQSEVLNVTVSP  128


 Score = 50.1 bits (118),  Expect(2) = 2e-39, Method: Compositional matrix adjust.
 Identities = 20/39 (51%), Positives = 29/39 (74%), Gaps = 0/39 (0%)
 Frame = +2

Query  455  DSDVLPIQTLYSINGWDCYPWAFQAENPQAEIIIHNPGV  571
            +S  LPIQT+Y+ +GWD Y WAF+A++    +I+HN GV
Sbjct  129  ESGDLPIQTVYTSSGWDSYSWAFKAKHSVVTLIVHNVGV  167



>gb|EYU21602.1| hypothetical protein MIMGU_mgv1a008411mg [Erythranthe guttata]
Length=374

 Score =   135 bits (340),  Expect(2) = 2e-39, Method: Compositional matrix adjust.
 Identities = 66/105 (63%), Positives = 83/105 (79%), Gaps = 1/105 (1%)
 Frame = +1

Query  142  TDGLLVNGNFEAPVKKTDLNGTIVTRHDAVPGWTVTGFVEYIQAGQKQGDMQLVVPEGFA  321
            TDGLL NGNFE   K + L GT VT   ++P W V+G+VEYI++GQKQGDM LVVP+G A
Sbjct  23   TDGLLPNGNFEFGPKPSQLKGTKVTDPHSIPDWEVSGYVEYIKSGQKQGDMILVVPQGAA  82

Query  322  AVRLGNEASIK-QTLNVSKGMYYSITFCAARTCAQEERLNITVAP  453
            AVRLG+EASIK + + V  GM+YS++F AARTCAQEE+LN++ AP
Sbjct  83   AVRLGDEASIKTKRVKVINGMFYSVSFGAARTCAQEEKLNVSFAP  127


 Score = 53.9 bits (128),  Expect(2) = 2e-39, Method: Compositional matrix adjust.
 Identities = 23/41 (56%), Positives = 29/41 (71%), Gaps = 0/41 (0%)
 Frame = +2

Query  449  RRDSDVLPIQTLYSINGWDCYPWAFQAENPQAEIIIHNPGV  571
             +D  VLPIQT+YS +GWDCY W F A++ +  I  HNPGV
Sbjct  131  EKDWGVLPIQTVYSSDGWDCYSWGFLAQSDEIVITFHNPGV  171



>ref|XP_006652463.1| PREDICTED: uncharacterized protein LOC102714172 [Oryza brachyantha]
Length=378

 Score =   149 bits (376),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 74/120 (62%), Positives = 86/120 (72%), Gaps = 0/120 (0%)
 Frame = +1

Query  145  DGLLVNGNFEAPVKKTDLNGTIVTRHDAVPGWTVTGFVEYIQAGQKQGDMQLVVPEGFAA  324
            DGLL NGNFE    K+ +NGT V    A+P W VTGFVEYI +GQKQGDM L VPEG  A
Sbjct  26   DGLLQNGNFEYSPNKSQMNGTRVMGEYAIPYWKVTGFVEYIASGQKQGDMLLTVPEGAHA  85

Query  325  VRLGNEASIKQTLNVSKGMYYSITFCAARTCAQEERLNITVAPGLRRAAHPNAVQYQRLG  504
            VRLGNEASI+Q ++V++GMYYSITF AARTCAQ E+LN++VAPG      P    Y   G
Sbjct  86   VRLGNEASIQQQISVTRGMYYSITFSAARTCAQSEKLNVSVAPGPESGELPIQTVYTSSG  145



>ref|XP_003526423.1| PREDICTED: uncharacterized protein LOC100801917 [Glycine max]
Length=365

 Score =   139 bits (349),  Expect(2) = 3e-39, Method: Compositional matrix adjust.
 Identities = 66/105 (63%), Positives = 80/105 (76%), Gaps = 1/105 (1%)
 Frame = +1

Query  142  TDGLLVNGNFEAPVKKTDLNGTIVTR-HDAVPGWTVTGFVEYIQAGQKQGDMQLVVPEGF  318
            TDG + N  FE   K  D+ GT+VT    A+PGW ++GF+EY+++GQKQGDM LVVP G 
Sbjct  20   TDGSIANAEFEFGPKPQDMKGTVVTGGPHAIPGWEISGFIEYLKSGQKQGDMLLVVPNGA  79

Query  319  AAVRLGNEASIKQTLNVSKGMYYSITFCAARTCAQEERLNITVAP  453
             AVRLGN ASIKQ + V KGMYYSITF  ARTCAQEE+LN++VAP
Sbjct  80   YAVRLGNGASIKQKIKVVKGMYYSITFMVARTCAQEEKLNVSVAP  124


 Score = 49.7 bits (117),  Expect(2) = 3e-39, Method: Compositional matrix adjust.
 Identities = 20/35 (57%), Positives = 26/35 (74%), Gaps = 0/35 (0%)
 Frame = +2

Query  464  VLPIQTLYSINGWDCYPWAFQAENPQAEIIIHNPG  568
            VLP+QTLYS NGWD Y W+FQA+    ++  H+PG
Sbjct  128  VLPMQTLYSGNGWDAYAWSFQADYSLVDMAFHHPG  162



>emb|CDY39990.1| BnaC06g40680D [Brassica napus]
Length=341

 Score =   135 bits (341),  Expect(2) = 3e-39, Method: Compositional matrix adjust.
 Identities = 67/103 (65%), Positives = 79/103 (77%), Gaps = 1/103 (1%)
 Frame = +1

Query  142  TDG-LLVNGNFEAPVKKTDLNGTIVTRHDAVPGWTVTGFVEYIQAGQKQGDMQLVVPEGF  318
            +DG LL NGNFE   K + L G+++    AVP W +TGFVEYI+AGQKQ DM LVVPEG 
Sbjct  25   SDGSLLANGNFEKGPKPSQLKGSVIKGRTAVPNWEITGFVEYIKAGQKQDDMVLVVPEGS  84

Query  319  AAVRLGNEASIKQTLNVSKGMYYSITFCAARTCAQEERLNITV  447
            +AVRLGNEASI Q ++V  G  YSITF AARTCAQ+ERLNI+V
Sbjct  85   SAVRLGNEASISQKISVRSGRLYSITFSAARTCAQDERLNISV  127


 Score = 52.8 bits (125),  Expect(2) = 3e-39, Method: Compositional matrix adjust.
 Identities = 22/39 (56%), Positives = 28/39 (72%), Gaps = 0/39 (0%)
 Frame = +2

Query  452  RDSDVLPIQTLYSINGWDCYPWAFQAENPQAEIIIHNPG  568
             +S V+PIQT+Y  +GWD Y WAF+A   + EI IHNPG
Sbjct  129  HESGVIPIQTMYGSDGWDSYSWAFKAGGSEIEIRIHNPG  167



>ref|NP_178141.1| protein DUF642 L-GALL RESPONSIVE GENE 1 [Arabidopsis thaliana]
 gb|AAD55477.1|AC009322_17 Unknown protein [Arabidopsis thaliana]
 gb|ACD85595.1| At1g80240 [Arabidopsis thaliana]
 gb|AEE36374.1| uncharacterized protein AT1G80240 [Arabidopsis thaliana]
Length=370

 Score =   132 bits (333),  Expect(2) = 4e-39, Method: Compositional matrix adjust.
 Identities = 63/101 (62%), Positives = 77/101 (76%), Gaps = 0/101 (0%)
 Frame = +1

Query  145  DGLLVNGNFEAPVKKTDLNGTIVTRHDAVPGWTVTGFVEYIQAGQKQGDMQLVVPEGFAA  324
            DGLL NGNFE   K + + G++V    AVP W + GFVE+I++GQKQ DM LVVP+G +A
Sbjct  27   DGLLPNGNFELGPKPSQMKGSVVKERTAVPNWNIIGFVEFIKSGQKQDDMVLVVPQGSSA  86

Query  325  VRLGNEASIKQTLNVSKGMYYSITFCAARTCAQEERLNITV  447
            VRLGNEASI Q ++V  G  YSITF AARTCAQ+ERLNI+V
Sbjct  87   VRLGNEASISQKISVLPGRLYSITFSAARTCAQDERLNISV  127


 Score = 55.8 bits (133),  Expect(2) = 4e-39, Method: Compositional matrix adjust.
 Identities = 23/39 (59%), Positives = 29/39 (74%), Gaps = 0/39 (0%)
 Frame = +2

Query  455  DSDVLPIQTLYSINGWDCYPWAFQAENPQAEIIIHNPGV  571
            +S V+PIQT+Y  +GWD Y WAF+A  P+ EI  HNPGV
Sbjct  130  ESGVIPIQTMYGSDGWDSYSWAFKAGGPEIEIRFHNPGV  168



>ref|NP_001242447.1| uncharacterized protein LOC100802444 precursor [Glycine max]
 gb|ACU22816.1| unknown [Glycine max]
Length=370

 Score =   136 bits (343),  Expect(2) = 4e-39, Method: Compositional matrix adjust.
 Identities = 64/101 (63%), Positives = 78/101 (77%), Gaps = 1/101 (1%)
 Frame = +1

Query  154  LVNGNFEAPVKKTDLNGTIVTR-HDAVPGWTVTGFVEYIQAGQKQGDMQLVVPEGFAAVR  330
            ++NG FE   K  D+ GT+VT    ++PGW ++GF+EYI++GQKQ DM LVVP G  AVR
Sbjct  23   VINGEFELGPKPQDMKGTVVTGGPHSIPGWEISGFIEYIKSGQKQDDMLLVVPNGAYAVR  82

Query  331  LGNEASIKQTLNVSKGMYYSITFCAARTCAQEERLNITVAP  453
            LGNEASIKQ L V KGMYYSITF  ARTCAQEE+LN++ AP
Sbjct  83   LGNEASIKQNLKVVKGMYYSITFVVARTCAQEEKLNVSAAP  123


 Score = 51.6 bits (122),  Expect(2) = 4e-39, Method: Compositional matrix adjust.
 Identities = 19/35 (54%), Positives = 27/35 (77%), Gaps = 0/35 (0%)
 Frame = +2

Query  464  VLPIQTLYSINGWDCYPWAFQAENPQAEIIIHNPG  568
            VLP+QT+Y  NGWD Y W+F+A+ P  +++ HNPG
Sbjct  127  VLPMQTVYGGNGWDAYAWSFRADYPSVDMVFHNPG  161



>emb|CDX87297.1| BnaA07g35760D [Brassica napus]
Length=342

 Score =   132 bits (332),  Expect(2) = 5e-39, Method: Compositional matrix adjust.
 Identities = 66/103 (64%), Positives = 78/103 (76%), Gaps = 1/103 (1%)
 Frame = +1

Query  142  TDG-LLVNGNFEAPVKKTDLNGTIVTRHDAVPGWTVTGFVEYIQAGQKQGDMQLVVPEGF  318
            +DG LL NGNFE   K + L G++V    AVP W +TG VEYI+AGQKQ DM LVVPEG 
Sbjct  25   SDGSLLPNGNFEMGPKPSQLKGSVVKGRTAVPNWEITGLVEYIKAGQKQDDMVLVVPEGS  84

Query  319  AAVRLGNEASIKQTLNVSKGMYYSITFCAARTCAQEERLNITV  447
            +AVRLGNEASI Q ++V  G  YS+TF AARTCAQ+ERLNI+V
Sbjct  85   SAVRLGNEASISQKISVRSGRLYSVTFSAARTCAQDERLNISV  127


 Score = 55.5 bits (132),  Expect(2) = 5e-39, Method: Compositional matrix adjust.
 Identities = 23/39 (59%), Positives = 29/39 (74%), Gaps = 0/39 (0%)
 Frame = +2

Query  452  RDSDVLPIQTLYSINGWDCYPWAFQAENPQAEIIIHNPG  568
             +S V+PIQT+Y  +GWD Y WAF+A  P+ EI IHNPG
Sbjct  129  HESGVIPIQTMYGSDGWDSYSWAFKAGGPEIEIRIHNPG  167



>ref|NP_001145978.1| hypothetical protein [Zea mays]
 gb|ACL52972.1| unknown [Zea mays]
 tpg|DAA58943.1| TPA: hypothetical protein ZEAMMB73_364218 [Zea mays]
Length=428

 Score =   134 bits (338),  Expect(2) = 6e-39, Method: Compositional matrix adjust.
 Identities = 66/105 (63%), Positives = 81/105 (77%), Gaps = 3/105 (3%)
 Frame = +1

Query  148  GLLVNGNFE-APVKKTDLNGTIVTRHDAVPGWTVTGFVEYIQAGQKQGDMQLVVPEGFAA  324
            GLL NGNFE  P K   +NGT+V+   A+P W  +GFVEYI++G KQGDM LVVP+G  A
Sbjct  73   GLLPNGNFEDGPPKSALVNGTVVSGAHAIPRWETSGFVEYIESGHKQGDMLLVVPQGAHA  132

Query  325  VRLGNEASIKQTLNVSKGMYYSITFCAARTCAQEE--RLNITVAP  453
            VRLGNEASI+Q L V++G YY+ITF AARTCAQ E  RLN++V+P
Sbjct  133  VRLGNEASIRQRLAVARGAYYAITFSAARTCAQAERQRLNVSVSP  177


 Score = 53.1 bits (126),  Expect(2) = 6e-39, Method: Compositional matrix adjust.
 Identities = 21/36 (58%), Positives = 27/36 (75%), Gaps = 0/36 (0%)
 Frame = +2

Query  464  VLPIQTLYSINGWDCYPWAFQAENPQAEIIIHNPGV  571
            VLP+QT+Y  NGWD Y WAF+A+     ++IHNPGV
Sbjct  181  VLPMQTIYGSNGWDSYAWAFKAKMDAVTLVIHNPGV  216



>gb|EMS63052.1| hypothetical protein TRIUR3_01733 [Triticum urartu]
Length=375

 Score =   134 bits (336),  Expect(2) = 8e-39, Method: Compositional matrix adjust.
 Identities = 61/103 (59%), Positives = 79/103 (77%), Gaps = 0/103 (0%)
 Frame = +1

Query  142  TDGLLVNGNFEAPVKKTDLNGTIVTRHDAVPGWTVTGFVEYIQAGQKQGDMQLVVPEGFA  321
            TDGLL NGNF+    K+ LNGT+V    ++P W ++GFVEYIQ+G  Q DM + VPEG +
Sbjct  27   TDGLLPNGNFKDGPAKSQLNGTVVMGRHSIPNWEISGFVEYIQSGHTQDDMIVAVPEGAS  86

Query  322  AVRLGNEASIKQTLNVSKGMYYSITFCAARTCAQEERLNITVA  450
            AVRLGN+ASI+Q + V++  YYSITF AARTCAQ E+LN++VA
Sbjct  87   AVRLGNDASIRQNIRVTRRAYYSITFSAARTCAQAEKLNVSVA  129


 Score = 53.5 bits (127),  Expect(2) = 8e-39, Method: Compositional matrix adjust.
 Identities = 23/39 (59%), Positives = 29/39 (74%), Gaps = 0/39 (0%)
 Frame = +2

Query  455  DSDVLPIQTLYSINGWDCYPWAFQAENPQAEIIIHNPGV  571
            DS VLP+QT+YS  GWD Y WAF+A++    + IHNPGV
Sbjct  131  DSGVLPVQTVYSSGGWDSYSWAFRAKHSAVWLAIHNPGV  169



>gb|EMS58461.1| hypothetical protein TRIUR3_29087 [Triticum urartu]
Length=336

 Score =   131 bits (330),  Expect(2) = 8e-39, Method: Compositional matrix adjust.
 Identities = 63/102 (62%), Positives = 78/102 (76%), Gaps = 1/102 (1%)
 Frame = +1

Query  151  LLVNGNFE-APVKKTDLNGTIVTRHDAVPGWTVTGFVEYIQAGQKQGDMQLVVPEGFAAV  327
            LL NGNFE  P K   +NGT+V    A+P W  +GFVEYI++G KQGDM LVVP+G  AV
Sbjct  20   LLPNGNFELGPAKSELVNGTVVKGGKAIPRWETSGFVEYIESGHKQGDMLLVVPQGAYAV  79

Query  328  RLGNEASIKQTLNVSKGMYYSITFCAARTCAQEERLNITVAP  453
            RLGN+ASI Q + V++G YY+ITF AARTCAQ ERLN++V+P
Sbjct  80   RLGNDASILQRIPVARGSYYAITFSAARTCAQAERLNVSVSP  121


 Score = 55.5 bits (132),  Expect(2) = 8e-39, Method: Compositional matrix adjust.
 Identities = 22/39 (56%), Positives = 30/39 (77%), Gaps = 0/39 (0%)
 Frame = +2

Query  455  DSDVLPIQTLYSINGWDCYPWAFQAENPQAEIIIHNPGV  571
            +S VLP+QT+Y  NGWD Y WAF+A+    E+++HNPGV
Sbjct  122  ESGVLPMQTIYGSNGWDSYAWAFKAKLDVVELVLHNPGV  160



>ref|XP_008669227.1| PREDICTED: uncharacterized protein LOC103646275 [Zea mays]
 ref|XP_008669228.1| PREDICTED: uncharacterized protein LOC103646275 [Zea mays]
 tpg|DAA37148.1| TPA: hypothetical protein ZEAMMB73_528816 [Zea mays]
Length=380

 Score =   139 bits (349),  Expect(2) = 9e-39, Method: Compositional matrix adjust.
 Identities = 67/103 (65%), Positives = 78/103 (76%), Gaps = 0/103 (0%)
 Frame = +1

Query  142  TDGLLVNGNFEAPVKKTDLNGTIVTRHDAVPGWTVTGFVEYIQAGQKQGDMQLVVPEGFA  321
            TDGLL NGNFE    K+DLNGT V   ++VP W + GFVEYI +GQKQ DM L VPEG  
Sbjct  41   TDGLLPNGNFELGPAKSDLNGTRVMNQNSVPNWEIFGFVEYIGSGQKQDDMILAVPEGAC  100

Query  322  AVRLGNEASIKQTLNVSKGMYYSITFCAARTCAQEERLNITVA  450
            AVRLGN+A+I+Q L V +   YSITFCAARTCAQ ERLN++VA
Sbjct  101  AVRLGNDATIRQKLEVIRKTTYSITFCAARTCAQAERLNVSVA  143


 Score = 48.1 bits (113),  Expect(2) = 9e-39, Method: Compositional matrix adjust.
 Identities = 21/38 (55%), Positives = 28/38 (74%), Gaps = 0/38 (0%)
 Frame = +2

Query  455  DSDVLPIQTLYSINGWDCYPWAFQAENPQAEIIIHNPG  568
            +S VLPIQT+Y+ +GWD Y +AF+A +  A   IHNPG
Sbjct  145  ESGVLPIQTVYTSSGWDSYAYAFRARHSTAWFSIHNPG  182



>gb|EMT04285.1| hypothetical protein F775_14657 [Aegilops tauschii]
Length=375

 Score =   134 bits (338),  Expect(2) = 1e-38, Method: Compositional matrix adjust.
 Identities = 61/103 (59%), Positives = 80/103 (78%), Gaps = 0/103 (0%)
 Frame = +1

Query  142  TDGLLVNGNFEAPVKKTDLNGTIVTRHDAVPGWTVTGFVEYIQAGQKQGDMQLVVPEGFA  321
            TDGLL NGNF+    K+ LNGT+V    ++P W ++GFVEYIQ+G +QG M + VPEG +
Sbjct  27   TDGLLPNGNFKDGPAKSQLNGTVVMGRHSIPNWEISGFVEYIQSGHQQGGMVVAVPEGAS  86

Query  322  AVRLGNEASIKQTLNVSKGMYYSITFCAARTCAQEERLNITVA  450
            AVRLGN+ASI+Q + V++  YYSITF AARTCAQ E+LN++VA
Sbjct  87   AVRLGNDASIRQNIRVTRRAYYSITFSAARTCAQAEKLNVSVA  129


 Score = 52.4 bits (124),  Expect(2) = 1e-38, Method: Compositional matrix adjust.
 Identities = 22/38 (58%), Positives = 28/38 (74%), Gaps = 0/38 (0%)
 Frame = +2

Query  455  DSDVLPIQTLYSINGWDCYPWAFQAENPQAEIIIHNPG  568
            DS VLP+QT+YS  GWD Y WAF+A++    + IHNPG
Sbjct  131  DSGVLPVQTVYSSGGWDSYSWAFRAKHSAVWLAIHNPG  168



>ref|XP_011081171.1| PREDICTED: LOW QUALITY PROTEIN: uncharacterized protein LOC105164253 
[Sesamum indicum]
Length=373

 Score =   133 bits (335),  Expect(2) = 1e-38, Method: Compositional matrix adjust.
 Identities = 61/103 (59%), Positives = 79/103 (77%), Gaps = 0/103 (0%)
 Frame = +1

Query  145  DGLLVNGNFEAPVKKTDLNGTIVTRHDAVPGWTVTGFVEYIQAGQKQGDMQLVVPEGFAA  324
            DG L NGNFE   K + + GT V    ++P W  +GFVEYI++GQKQGDM LVVPEG +A
Sbjct  21   DGQLPNGNFEFGPKPSQMKGTKVMDPHSIPHWETSGFVEYIKSGQKQGDMLLVVPEGASA  80

Query  325  VRLGNEASIKQTLNVSKGMYYSITFCAARTCAQEERLNITVAP  453
            VRLG+EASIK  + V  G++YS++F AARTCAQEE+LN++V+P
Sbjct  81   VRLGDEASIKTKVKVKNGLFYSVSFSAARTCAQEEKLNVSVSP  123


 Score = 53.1 bits (126),  Expect(2) = 1e-38, Method: Compositional matrix adjust.
 Identities = 21/36 (58%), Positives = 29/36 (81%), Gaps = 0/36 (0%)
 Frame = +2

Query  464  VLPIQTLYSINGWDCYPWAFQAENPQAEIIIHNPGV  571
            +LP+QT+YS +GWD Y W F A++ + EI+IHNPGV
Sbjct  132  ILPMQTVYSSDGWDSYCWGFLAQSNEIEIVIHNPGV  167



>emb|CAH67378.1| OSIGBa0159F11.2 [Oryza sativa Indica Group]
 emb|CAH67294.1| OSIGBa0103O01.12 [Oryza sativa Indica Group]
 gb|EAY94678.1| hypothetical protein OsI_16457 [Oryza sativa Indica Group]
Length=372

 Score =   138 bits (348),  Expect(2) = 1e-38, Method: Compositional matrix adjust.
 Identities = 63/104 (61%), Positives = 82/104 (79%), Gaps = 0/104 (0%)
 Frame = +1

Query  142  TDGLLVNGNFEAPVKKTDLNGTIVTRHDAVPGWTVTGFVEYIQAGQKQGDMQLVVPEGFA  321
            TDGLL NGNFE    K+ LNGT+VT   A+P W ++GFVEYI++G ++ DM L VPEG  
Sbjct  27   TDGLLPNGNFEDGPDKSQLNGTVVTGRYAIPNWEISGFVEYIESGHREQDMILAVPEGAR  86

Query  322  AVRLGNEASIKQTLNVSKGMYYSITFCAARTCAQEERLNITVAP  453
            AVRLGN+A+I+Q L+V++  YYSITF AARTCAQ+E+LN++V P
Sbjct  87   AVRLGNDATIRQRLSVTRRAYYSITFSAARTCAQKEKLNVSVTP  130


 Score = 47.8 bits (112),  Expect(2) = 1e-38, Method: Compositional matrix adjust.
 Identities = 20/35 (57%), Positives = 27/35 (77%), Gaps = 0/35 (0%)
 Frame = +2

Query  464  VLPIQTLYSINGWDCYPWAFQAENPQAEIIIHNPG  568
            VLPIQT+Y+ +GWD Y WAF+A++    + IHNPG
Sbjct  134  VLPIQTVYTSSGWDSYSWAFRAKHSVVWLSIHNPG  168



>ref|XP_008669229.1| PREDICTED: uncharacterized protein LOC103646276 [Zea mays]
Length=379

 Score =   136 bits (343),  Expect(2) = 2e-38, Method: Compositional matrix adjust.
 Identities = 65/103 (63%), Positives = 78/103 (76%), Gaps = 0/103 (0%)
 Frame = +1

Query  142  TDGLLVNGNFEAPVKKTDLNGTIVTRHDAVPGWTVTGFVEYIQAGQKQGDMQLVVPEGFA  321
            +DGLL NGNFE    K+DLNGT V   ++VP W + GFVEYI +GQKQ DM L VPEG  
Sbjct  40   SDGLLPNGNFELGPAKSDLNGTRVMNQNSVPNWEILGFVEYIGSGQKQDDMILPVPEGAC  99

Query  322  AVRLGNEASIKQTLNVSKGMYYSITFCAARTCAQEERLNITVA  450
            AVRLGN+A+I+Q LN+ +   YSITFCAARTCAQ ERL ++VA
Sbjct  100  AVRLGNDATIRQNLNLIRETTYSITFCAARTCAQAERLKVSVA  142


 Score = 49.7 bits (117),  Expect(2) = 2e-38, Method: Compositional matrix adjust.
 Identities = 22/38 (58%), Positives = 28/38 (74%), Gaps = 0/38 (0%)
 Frame = +2

Query  455  DSDVLPIQTLYSINGWDCYPWAFQAENPQAEIIIHNPG  568
            +S VLPIQT+Y+ NGWD Y +AF+A +  A   IHNPG
Sbjct  144  ESGVLPIQTVYTSNGWDSYSYAFRARHSTAWFSIHNPG  181



>tpg|DAA37149.1| TPA: hypothetical protein ZEAMMB73_398073 [Zea mays]
Length=382

 Score =   136 bits (343),  Expect(2) = 2e-38, Method: Compositional matrix adjust.
 Identities = 65/103 (63%), Positives = 78/103 (76%), Gaps = 0/103 (0%)
 Frame = +1

Query  142  TDGLLVNGNFEAPVKKTDLNGTIVTRHDAVPGWTVTGFVEYIQAGQKQGDMQLVVPEGFA  321
            +DGLL NGNFE    K+DLNGT V   ++VP W + GFVEYI +GQKQ DM L VPEG  
Sbjct  29   SDGLLPNGNFELGPAKSDLNGTRVMNQNSVPNWEILGFVEYIGSGQKQDDMILPVPEGAC  88

Query  322  AVRLGNEASIKQTLNVSKGMYYSITFCAARTCAQEERLNITVA  450
            AVRLGN+A+I+Q LN+ +   YSITFCAARTCAQ ERL ++VA
Sbjct  89   AVRLGNDATIRQNLNLIRETTYSITFCAARTCAQAERLKVSVA  131


 Score = 49.7 bits (117),  Expect(2) = 2e-38, Method: Compositional matrix adjust.
 Identities = 22/38 (58%), Positives = 28/38 (74%), Gaps = 0/38 (0%)
 Frame = +2

Query  455  DSDVLPIQTLYSINGWDCYPWAFQAENPQAEIIIHNPG  568
            +S VLPIQT+Y+ NGWD Y +AF+A +  A   IHNPG
Sbjct  133  ESGVLPIQTVYTSNGWDSYSYAFRARHSTAWFSIHNPG  170



>ref|XP_003588711.1| hypothetical protein MTR_1g011800 [Medicago truncatula]
Length=326

 Score =   145 bits (367),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 70/103 (68%), Positives = 83/103 (81%), Gaps = 1/103 (1%)
 Frame = +1

Query  148  GLLVNGNFEAPVKKTDLNGTIVTR-HDAVPGWTVTGFVEYIQAGQKQGDMQLVVPEGFAA  324
            GL+ NGNFE   K T+L GT+VT   +++P W ++G VEYI++GQKQGDM LVVPEG  A
Sbjct  7    GLVANGNFELGPKPTELKGTVVTGGKNSIPEWEISGLVEYIKSGQKQGDMLLVVPEGAYA  66

Query  325  VRLGNEASIKQTLNVSKGMYYSITFCAARTCAQEERLNITVAP  453
            VRLGNEASIKQ + V KGMYYSITF  ARTCAQEER+NI+VAP
Sbjct  67   VRLGNEASIKQRIKVIKGMYYSITFMVARTCAQEERINISVAP  109



>emb|CDY54317.1| BnaC06g43150D [Brassica napus]
Length=370

 Score =   132 bits (332),  Expect(2) = 2e-38, Method: Compositional matrix adjust.
 Identities = 67/102 (66%), Positives = 78/102 (76%), Gaps = 1/102 (1%)
 Frame = +1

Query  145  DG-LLVNGNFEAPVKKTDLNGTIVTRHDAVPGWTVTGFVEYIQAGQKQGDMQLVVPEGFA  321
            DG LL NGNFE   K + L G++V   +AV  W +TGFVEYI+AGQKQ DM LVVPEG +
Sbjct  26   DGSLLPNGNFEIGPKPSQLKGSVVKERNAVAHWDMTGFVEYIKAGQKQDDMVLVVPEGSS  85

Query  322  AVRLGNEASIKQTLNVSKGMYYSITFCAARTCAQEERLNITV  447
            AVRLGNEASI Q ++V  G  YSITF AARTCAQ+ERLNI+V
Sbjct  86   AVRLGNEASISQKISVRSGRLYSITFSAARTCAQDERLNISV  127


 Score = 53.9 bits (128),  Expect(2) = 2e-38, Method: Compositional matrix adjust.
 Identities = 23/39 (59%), Positives = 28/39 (72%), Gaps = 0/39 (0%)
 Frame = +2

Query  452  RDSDVLPIQTLYSINGWDCYPWAFQAENPQAEIIIHNPG  568
             +S V+PIQT+Y  +GWD Y WAF+A  PQ  I IHNPG
Sbjct  129  HESGVIPIQTMYGSDGWDSYSWAFKAGGPQIVIRIHNPG  167



>emb|CDY57694.1| BnaA07g38340D [Brassica napus]
Length=370

 Score =   132 bits (332),  Expect(2) = 3e-38, Method: Compositional matrix adjust.
 Identities = 67/102 (66%), Positives = 78/102 (76%), Gaps = 1/102 (1%)
 Frame = +1

Query  145  DG-LLVNGNFEAPVKKTDLNGTIVTRHDAVPGWTVTGFVEYIQAGQKQGDMQLVVPEGFA  321
            DG LL NGNFE   K + L G++V   +AV  W +TGFVEYI+AGQKQ DM LVVPEG +
Sbjct  26   DGSLLPNGNFEIGPKPSQLKGSVVKERNAVAHWDMTGFVEYIKAGQKQDDMVLVVPEGSS  85

Query  322  AVRLGNEASIKQTLNVSKGMYYSITFCAARTCAQEERLNITV  447
            AVRLGNEASI Q ++V  G  YSITF AARTCAQ+ERLNI+V
Sbjct  86   AVRLGNEASISQKISVRSGRLYSITFSAARTCAQDERLNISV  127


 Score = 53.1 bits (126),  Expect(2) = 3e-38, Method: Compositional matrix adjust.
 Identities = 22/38 (58%), Positives = 28/38 (74%), Gaps = 0/38 (0%)
 Frame = +2

Query  455  DSDVLPIQTLYSINGWDCYPWAFQAENPQAEIIIHNPG  568
            +S V+PIQT+Y  +GWD Y WAF+A  P+  I IHNPG
Sbjct  130  ESGVIPIQTMYGSDGWDSYSWAFKAGGPEIVIRIHNPG  167



>ref|XP_003581385.1| PREDICTED: uncharacterized protein LOC100824265 [Brachypodium 
distachyon]
Length=373

 Score =   133 bits (334),  Expect(2) = 4e-38, Method: Compositional matrix adjust.
 Identities = 64/102 (63%), Positives = 80/102 (78%), Gaps = 0/102 (0%)
 Frame = +1

Query  145  DGLLVNGNFEAPVKKTDLNGTIVTRHDAVPGWTVTGFVEYIQAGQKQGDMQLVVPEGFAA  324
            DGLL NGNF+    K+ LNGTIV    ++P W V+GFVEYI +GQKQG+M L VPEG  A
Sbjct  26   DGLLPNGNFKDGPGKSQLNGTIVMGSHSIPFWEVSGFVEYIGSGQKQGEMILPVPEGACA  85

Query  325  VRLGNEASIKQTLNVSKGMYYSITFCAARTCAQEERLNITVA  450
            VRLGN+ASI+Q L+V++  +YSITF AARTCAQ E+LN++VA
Sbjct  86   VRLGNDASIRQKLSVTRRTFYSITFSAARTCAQAEKLNVSVA  127


 Score = 52.0 bits (123),  Expect(2) = 4e-38, Method: Compositional matrix adjust.
 Identities = 22/39 (56%), Positives = 28/39 (72%), Gaps = 0/39 (0%)
 Frame = +2

Query  455  DSDVLPIQTLYSINGWDCYPWAFQAENPQAEIIIHNPGV  571
            DS +LPIQT+Y+  GWD Y WAF+A +    + IHNPGV
Sbjct  129  DSGLLPIQTVYASIGWDSYSWAFKAMHSVVSLAIHNPGV  167



>gb|ABK26874.1| unknown [Picea sitchensis]
Length=182

 Score =   133 bits (334),  Expect(2) = 5e-38, Method: Compositional matrix adjust.
 Identities = 61/104 (59%), Positives = 77/104 (74%), Gaps = 0/104 (0%)
 Frame = +1

Query  142  TDGLLVNGNFEAPVKKTDLNGTIVTRHDAVPGWTVTGFVEYIQAGQKQGDMQLVVPEGFA  321
            +DGLL NG+FE   K  DL GT++   +++P W   GFVEYI +G  Q DM +VVPEG  
Sbjct  28   SDGLLPNGDFELAPKPKDLKGTVLLGRNSLPQWRTKGFVEYITSGHHQRDMLVVVPEGAH  87

Query  322  AVRLGNEASIKQTLNVSKGMYYSITFCAARTCAQEERLNITVAP  453
            AVRLGNEASI Q++ V++G YYS+TF AARTCAQ ERLN++V P
Sbjct  88   AVRLGNEASISQSIKVTRGSYYSLTFSAARTCAQSERLNVSVPP  131


 Score = 51.6 bits (122),  Expect(2) = 5e-38, Method: Compositional matrix adjust.
 Identities = 21/35 (60%), Positives = 27/35 (77%), Gaps = 0/35 (0%)
 Frame = +2

Query  467  LPIQTLYSINGWDCYPWAFQAENPQAEIIIHNPGV  571
            + IQTLYS NGWD Y WAF+A +   ++I+HNPGV
Sbjct  136  ISIQTLYSSNGWDAYSWAFRAPSSVVDVILHNPGV  170



>ref|XP_006285882.1| hypothetical protein CARUB_v10007385mg [Capsella rubella]
 gb|EOA18780.1| hypothetical protein CARUB_v10007385mg [Capsella rubella]
Length=354

 Score =   145 bits (365),  Expect = 6e-38, Method: Compositional matrix adjust.
 Identities = 73/125 (58%), Positives = 88/125 (70%), Gaps = 2/125 (2%)
 Frame = +1

Query  145  DGLLVNGNFEAPVKKTDLNGTIVTRHDAVPGWTVTGFVEYIQAGQKQGDMQLVVPEGFAA  324
            DGLL NG+FE   + +D+ GT V    A+P W ++GFVEYI +GQKQGDM LVVP+G  A
Sbjct  24   DGLLPNGDFELGPRHSDMKGTQVINKAAIPNWELSGFVEYIPSGQKQGDMILVVPKGAFA  83

Query  325  VRLGNEASIKQTLNVSKGMYYSITFCAARTCAQEERLNITVAPGLRRAAHPNAVQYQRLG  504
            VRLGNEASIKQ ++V KG YYSITF AARTCAQ+ERLN++VAP    A  P    Y   G
Sbjct  84   VRLGNEASIKQKISVKKGSYYSITFSAARTCAQDERLNVSVAP--HHAVMPIQTVYSSSG  141

Query  505  LLPVG  519
               +G
Sbjct  142  WDRIG  146



>ref|XP_010061944.1| PREDICTED: uncharacterized protein LOC104449472 [Eucalyptus grandis]
 gb|KCW68990.1| hypothetical protein EUGRSUZ_F02553 [Eucalyptus grandis]
Length=372

 Score =   144 bits (364),  Expect = 9e-38, Method: Compositional matrix adjust.
 Identities = 71/124 (57%), Positives = 90/124 (73%), Gaps = 9/124 (7%)
 Frame = +1

Query  145  DGLLVNGNFEAPVKKTDLNGTIVTRHDAVPGWTVTGFVEYIQAGQKQGDMQLVVPEGFAA  324
            DGLL NG+FE   +++ L GT+VT   A+P W ++G+VEYI++GQKQGDM LVVPEG  A
Sbjct  23   DGLLPNGDFEKGPEQSQLKGTVVTSKTAIPKWGISGYVEYIKSGQKQGDMLLVVPEGEFA  82

Query  325  VRLGNEASIKQTLNVSKGMYYSITFCAARTCAQEERLNITVAPGLRRAAHPNAVQYQRLG  504
            VRLGNEASIKQ + V KG +YS+TF AARTCAQEE+LN++V P     AH         G
Sbjct  83   VRLGNEASIKQKVKVEKGTFYSVTFSAARTCAQEEKLNVSVTP--NHEAH-------DWG  133

Query  505  LLPV  516
            +LP+
Sbjct  134  ILPM  137


 Score = 55.8 bits (133),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 22/36 (61%), Positives = 30/36 (83%), Gaps = 0/36 (0%)
 Frame = +2

Query  464  VLPIQTLYSINGWDCYPWAFQAENPQAEIIIHNPGV  571
            +LP+QT+YS NGWD Y W+F+A+ P+ EI IHNPG+
Sbjct  134  ILPMQTMYSSNGWDSYCWSFRADAPEIEISIHNPGM  169



>ref|XP_007023946.1| Uncharacterized protein TCM_028364 [Theobroma cacao]
 gb|EOY26568.1| Uncharacterized protein TCM_028364 [Theobroma cacao]
Length=372

 Score =   144 bits (364),  Expect = 9e-38, Method: Compositional matrix adjust.
 Identities = 69/124 (56%), Positives = 88/124 (71%), Gaps = 9/124 (7%)
 Frame = +1

Query  145  DGLLVNGNFEAPVKKTDLNGTIVTRHDAVPGWTVTGFVEYIQAGQKQGDMQLVVPEGFAA  324
            DGLL NGNFE   K +++ GT V    A+P W ++G VEYI++GQKQGDM L+VPEG  A
Sbjct  23   DGLLPNGNFEYGPKPSEMKGTKVVSPKAIPNWEISGVVEYIKSGQKQGDMLLIVPEGAFA  82

Query  325  VRLGNEASIKQTLNVSKGMYYSITFCAARTCAQEERLNITVAPGLRRAAHPNAVQYQRLG  504
            VRLGN+A IKQT+ V KGM+YS+TF AARTCAQEERLN++V+P   +  +         G
Sbjct  83   VRLGNDALIKQTMKVIKGMFYSLTFSAARTCAQEERLNVSVSPNYEKNDY---------G  133

Query  505  LLPV  516
            L P+
Sbjct  134  LFPI  137


 Score = 61.6 bits (148),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 26/41 (63%), Positives = 30/41 (73%), Gaps = 0/41 (0%)
 Frame = +2

Query  449  RRDSDVLPIQTLYSINGWDCYPWAFQAENPQAEIIIHNPGV  571
            + D  + PIQT+YS NGWD Y WAFQA+ P  EI IHNPGV
Sbjct  129  KNDYGLFPIQTMYSSNGWDSYAWAFQADEPLIEISIHNPGV  169



>gb|KHG10708.1| Allergen Act d 3 [Gossypium arboreum]
Length=374

 Score =   144 bits (364),  Expect = 9e-38, Method: Compositional matrix adjust.
 Identities = 69/124 (56%), Positives = 87/124 (70%), Gaps = 9/124 (7%)
 Frame = +1

Query  145  DGLLVNGNFEAPVKKTDLNGTIVTRHDAVPGWTVTGFVEYIQAGQKQGDMQLVVPEGFAA  324
            DGLL NGNFE   K ++L GT V    A+P W ++G+VEYI++GQKQGDM L+VPEG  A
Sbjct  24   DGLLPNGNFEYGPKPSELKGTKVMSPKAIPNWEISGYVEYIKSGQKQGDMLLIVPEGGFA  83

Query  325  VRLGNEASIKQTLNVSKGMYYSITFCAARTCAQEERLNITVAPGLRRAAHPNAVQYQRLG  504
            VRLGNEA IKQ + V KGM+YS+TF AARTCAQEE+LN++V+P   +            G
Sbjct  84   VRLGNEALIKQKIKVIKGMFYSLTFSAARTCAQEEKLNVSVSPNYEK---------NDFG  134

Query  505  LLPV  516
            L P+
Sbjct  135  LFPI  138


 Score = 57.8 bits (138),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 25/41 (61%), Positives = 28/41 (68%), Gaps = 0/41 (0%)
 Frame = +2

Query  449  RRDSDVLPIQTLYSINGWDCYPWAFQAENPQAEIIIHNPGV  571
            + D  + PIQT+YS NGWD Y WAFQA     EI IHNPGV
Sbjct  130  KNDFGLFPIQTMYSSNGWDSYAWAFQASESVIEISIHNPGV  170



>gb|KJB68131.1| hypothetical protein B456_010G227400 [Gossypium raimondii]
Length=374

 Score =   144 bits (363),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 68/124 (55%), Positives = 87/124 (70%), Gaps = 9/124 (7%)
 Frame = +1

Query  145  DGLLVNGNFEAPVKKTDLNGTIVTRHDAVPGWTVTGFVEYIQAGQKQGDMQLVVPEGFAA  324
            DGLL NGNFE   K ++L GT V    A+P W ++G+VEYI++GQKQGDM L+VPEG  A
Sbjct  24   DGLLPNGNFEYGPKPSELKGTKVMSPKAIPNWEISGYVEYIKSGQKQGDMLLIVPEGGFA  83

Query  325  VRLGNEASIKQTLNVSKGMYYSITFCAARTCAQEERLNITVAPGLRRAAHPNAVQYQRLG  504
            VRLGNEA IKQ + V KGM+YS+TF AARTCAQEE+LN++++P   +            G
Sbjct  84   VRLGNEALIKQKIKVIKGMFYSLTFSAARTCAQEEKLNVSISPNYEK---------NDFG  134

Query  505  LLPV  516
            L P+
Sbjct  135  LFPI  138


 Score = 57.8 bits (138),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 25/41 (61%), Positives = 28/41 (68%), Gaps = 0/41 (0%)
 Frame = +2

Query  449  RRDSDVLPIQTLYSINGWDCYPWAFQAENPQAEIIIHNPGV  571
            + D  + PIQT+YS NGWD Y WAFQA     EI IHNPGV
Sbjct  130  KNDFGLFPIQTMYSSNGWDSYAWAFQASESVIEISIHNPGV  170



>ref|NP_001173996.1| Os04g0494950 [Oryza sativa Japonica Group]
 dbj|BAH92724.1| Os04g0494950 [Oryza sativa Japonica Group]
Length=209

 Score =   134 bits (337),  Expect(2) = 3e-37, Method: Compositional matrix adjust.
 Identities = 62/104 (60%), Positives = 81/104 (78%), Gaps = 0/104 (0%)
 Frame = +1

Query  142  TDGLLVNGNFEAPVKKTDLNGTIVTRHDAVPGWTVTGFVEYIQAGQKQGDMQLVVPEGFA  321
            TDGLL NGNFE    K+ LNGT+VT   A+  W ++GFVEYI++G ++ DM L VPEG  
Sbjct  27   TDGLLPNGNFEDGPDKSQLNGTVVTGRYAILNWEISGFVEYIESGHREQDMILAVPEGAR  86

Query  322  AVRLGNEASIKQTLNVSKGMYYSITFCAARTCAQEERLNITVAP  453
            AVRLGN+A+I+Q L+V++  YYSITF AARTCAQ+E+LN++V P
Sbjct  87   AVRLGNDATIRQRLSVTRRAYYSITFSAARTCAQKEKLNMSVTP  130


 Score = 47.8 bits (112),  Expect(2) = 3e-37, Method: Compositional matrix adjust.
 Identities = 20/35 (57%), Positives = 27/35 (77%), Gaps = 0/35 (0%)
 Frame = +2

Query  464  VLPIQTLYSINGWDCYPWAFQAENPQAEIIIHNPG  568
            VLPIQT+Y+ +GWD Y WAF+A++    + IHNPG
Sbjct  134  VLPIQTVYTSSGWDSYSWAFRAKHSVVWLSIHNPG  168



>ref|XP_002446727.1| hypothetical protein SORBIDRAFT_06g021310 [Sorghum bicolor]
 gb|EES11055.1| hypothetical protein SORBIDRAFT_06g021310 [Sorghum bicolor]
Length=380

 Score =   135 bits (339),  Expect(2) = 3e-37, Method: Compositional matrix adjust.
 Identities = 64/103 (62%), Positives = 81/103 (79%), Gaps = 0/103 (0%)
 Frame = +1

Query  142  TDGLLVNGNFEAPVKKTDLNGTIVTRHDAVPGWTVTGFVEYIQAGQKQGDMQLVVPEGFA  321
            TDGLL NGNFE    K+DLNGT V   +++P W ++GFVEYI +GQ+Q DM L VPEG  
Sbjct  29   TDGLLPNGNFEFGPAKSDLNGTRVMGQNSIPNWEISGFVEYIGSGQQQDDMILPVPEGAY  88

Query  322  AVRLGNEASIKQTLNVSKGMYYSITFCAARTCAQEERLNITVA  450
            AVRLGN+A+I+Q L+V++   YSITFCAARTCAQ E+LN++VA
Sbjct  89   AVRLGNDATIRQKLSVNRKTTYSITFCAARTCAQAEQLNVSVA  131


 Score = 47.0 bits (110),  Expect(2) = 3e-37, Method: Compositional matrix adjust.
 Identities = 19/37 (51%), Positives = 28/37 (76%), Gaps = 0/37 (0%)
 Frame = +2

Query  455  DSDVLPIQTLYSINGWDCYPWAFQAENPQAEIIIHNP  565
            +S VLP+QT+Y+ +GWD Y +AF+A +  A + IHNP
Sbjct  133  ESGVLPVQTVYTSSGWDSYSYAFRARHSTAWLTIHNP  169



>emb|CAA22573.1| putative protein [Arabidopsis thaliana]
 emb|CAB79963.1| putative protein [Arabidopsis thaliana]
Length=325

 Score =   124 bits (312),  Expect(2) = 3e-37, Method: Compositional matrix adjust.
 Identities = 58/86 (67%), Positives = 69/86 (80%), Gaps = 0/86 (0%)
 Frame = +1

Query  196  LNGTIVTRHDAVPGWTVTGFVEYIQAGQKQGDMQLVVPEGFAAVRLGNEASIKQTLNVSK  375
            + GT V    A+P W ++GFVEYI +G KQGDM LVVP+G  AVRLGNEASIKQ ++V K
Sbjct  1    MKGTQVINITAIPNWELSGFVEYIPSGHKQGDMILVVPKGAFAVRLGNEASIKQKISVKK  60

Query  376  GMYYSITFCAARTCAQEERLNITVAP  453
            G YYSITF AARTCAQ+ERLN++VAP
Sbjct  61   GSYYSITFSAARTCAQDERLNVSVAP  86


 Score = 57.4 bits (137),  Expect(2) = 3e-37, Method: Compositional matrix adjust.
 Identities = 23/36 (64%), Positives = 31/36 (86%), Gaps = 0/36 (0%)
 Frame = +2

Query  464  VLPIQTLYSINGWDCYPWAFQAENPQAEIIIHNPGV  571
            V+PIQT+YS +GWD Y WAF+A++  A+I+IHNPGV
Sbjct  90   VMPIQTVYSSSGWDLYSWAFKAQSDYADIVIHNPGV  125



>ref|XP_004976082.1| PREDICTED: uncharacterized protein LOC101765204 [Setaria italica]
Length=375

 Score =   132 bits (331),  Expect(2) = 5e-37, Method: Compositional matrix adjust.
 Identities = 62/104 (60%), Positives = 79/104 (76%), Gaps = 0/104 (0%)
 Frame = +1

Query  142  TDGLLVNGNFEAPVKKTDLNGTIVTRHDAVPGWTVTGFVEYIQAGQKQGDMQLVVPEGFA  321
            TDG+L NG+FE    K+ +NGT V   DA+P W + GFVEYI +GQ+Q DM L VPEG  
Sbjct  25   TDGILPNGHFEQGPDKSQMNGTRVMDPDAIPYWKIYGFVEYIGSGQQQDDMILPVPEGEQ  84

Query  322  AVRLGNEASIKQTLNVSKGMYYSITFCAARTCAQEERLNITVAP  453
            AVRLGN+A+I+Q L+V++  YYSITF AARTCAQ E+LN++V P
Sbjct  85   AVRLGNDATIRQQLDVTRHTYYSITFGAARTCAQAEKLNVSVTP  128


 Score = 49.3 bits (116),  Expect(2) = 5e-37, Method: Compositional matrix adjust.
 Identities = 21/38 (55%), Positives = 29/38 (76%), Gaps = 0/38 (0%)
 Frame = +2

Query  455  DSDVLPIQTLYSINGWDCYPWAFQAENPQAEIIIHNPG  568
            +S VLPIQT+Y+ +GWD Y WAF+A++    + IHNPG
Sbjct  129  ESGVLPIQTVYTSSGWDSYSWAFKAKHSTVWLSIHNPG  166



>ref|XP_008377611.1| PREDICTED: uncharacterized protein LOC103440696 [Malus domestica]
Length=374

 Score =   142 bits (359),  Expect = 5e-37, Method: Compositional matrix adjust.
 Identities = 68/125 (54%), Positives = 90/125 (72%), Gaps = 9/125 (7%)
 Frame = +1

Query  142  TDGLLVNGNFEAPVKKTDLNGTIVTRHDAVPGWTVTGFVEYIQAGQKQGDMQLVVPEGFA  321
            TDGLL NGNFE   K ++L GT+VT  +A+P W ++GFVEYI++GQKQGDM L+VPEG  
Sbjct  25   TDGLLPNGNFEYGPKHSELKGTVVTNPNAIPNWEISGFVEYIKSGQKQGDMLLLVPEGGF  84

Query  322  AVRLGNEASIKQTLNVSKGMYYSITFCAARTCAQEERLNITVAPGLRRAAHPNAVQYQRL  501
            AVRLG EA IKQ L ++KG +YS+TF A RTC QEE+LN++V P          V+ +  
Sbjct  85   AVRLGKEALIKQKLKLTKGGFYSVTFTAGRTCGQEEKLNVSVNPN---------VEEKDW  135

Query  502  GLLPV  516
            G++P+
Sbjct  136  GIMPI  140


 Score = 56.2 bits (134),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 21/40 (53%), Positives = 30/40 (75%), Gaps = 0/40 (0%)
 Frame = +2

Query  449  RRDSDVLPIQTLYSINGWDCYPWAFQAENPQAEIIIHNPG  568
             +D  ++PIQT+YS NGWD Y W F A++ + E++IHNPG
Sbjct  132  EKDWGIMPIQTMYSSNGWDSYAWGFNADSDEVELVIHNPG  171



>emb|CAE01677.2| OSJNBb0091E11.19 [Oryza sativa Japonica Group]
Length=372

 Score =   133 bits (335),  Expect(2) = 5e-37, Method: Compositional matrix adjust.
 Identities = 62/104 (60%), Positives = 81/104 (78%), Gaps = 0/104 (0%)
 Frame = +1

Query  142  TDGLLVNGNFEAPVKKTDLNGTIVTRHDAVPGWTVTGFVEYIQAGQKQGDMQLVVPEGFA  321
            TDGLL NGNFE    K+ LNGT+VT   A+  W ++GFVEYI++G ++ DM L VPEG  
Sbjct  27   TDGLLPNGNFEDGPDKSQLNGTVVTGRYAILNWEISGFVEYIESGHREQDMILAVPEGAR  86

Query  322  AVRLGNEASIKQTLNVSKGMYYSITFCAARTCAQEERLNITVAP  453
            AVRLGN+A+I+Q L+V++  YYSITF AARTCAQ+E+LN++V P
Sbjct  87   AVRLGNDATIRQRLSVTRRAYYSITFSAARTCAQKEKLNMSVTP  130


 Score = 47.8 bits (112),  Expect(2) = 5e-37, Method: Compositional matrix adjust.
 Identities = 20/35 (57%), Positives = 27/35 (77%), Gaps = 0/35 (0%)
 Frame = +2

Query  464  VLPIQTLYSINGWDCYPWAFQAENPQAEIIIHNPG  568
            VLPIQT+Y+ +GWD Y WAF+A++    + IHNPG
Sbjct  134  VLPIQTVYTSSGWDSYSWAFRAKHSVVWLSIHNPG  168



>ref|XP_006653558.1| PREDICTED: uncharacterized protein LOC102719203 [Oryza brachyantha]
Length=374

 Score =   134 bits (338),  Expect(2) = 5e-37, Method: Compositional matrix adjust.
 Identities = 61/103 (59%), Positives = 80/103 (78%), Gaps = 0/103 (0%)
 Frame = +1

Query  145  DGLLVNGNFEAPVKKTDLNGTIVTRHDAVPGWTVTGFVEYIQAGQKQGDMQLVVPEGFAA  324
            DGLL NGNFE    K+ LNGT+VT   ++P W ++GFVEYI++G  + DM + VPEG  A
Sbjct  30   DGLLPNGNFEDGPDKSQLNGTVVTGRYSIPNWEISGFVEYIESGHNEKDMIVAVPEGARA  89

Query  325  VRLGNEASIKQTLNVSKGMYYSITFCAARTCAQEERLNITVAP  453
            VRLGN+A+I+Q L+V++  YYSITF AARTCAQ+ERLN++V P
Sbjct  90   VRLGNDATIRQKLSVTRRAYYSITFSAARTCAQKERLNVSVTP  132


 Score = 46.6 bits (109),  Expect(2) = 5e-37, Method: Compositional matrix adjust.
 Identities = 19/35 (54%), Positives = 26/35 (74%), Gaps = 0/35 (0%)
 Frame = +2

Query  464  VLPIQTLYSINGWDCYPWAFQAENPQAEIIIHNPG  568
            VLPIQT+Y+ +GWD Y WAF+A++    +  HNPG
Sbjct  136  VLPIQTVYTSSGWDSYSWAFKAKHSAVWLSFHNPG  170



>gb|EEE61252.1| hypothetical protein OsJ_15312 [Oryza sativa Japonica Group]
Length=626

 Score =   133 bits (335),  Expect(2) = 5e-37, Method: Composition-based stats.
 Identities = 62/104 (60%), Positives = 81/104 (78%), Gaps = 0/104 (0%)
 Frame = +1

Query  142  TDGLLVNGNFEAPVKKTDLNGTIVTRHDAVPGWTVTGFVEYIQAGQKQGDMQLVVPEGFA  321
            TDGLL NGNFE    K+ LNGT+VT   A+  W ++GFVEYI++G ++ DM L VPEG  
Sbjct  27   TDGLLPNGNFEDGPDKSQLNGTVVTGRYAILNWEISGFVEYIESGHREQDMILAVPEGAR  86

Query  322  AVRLGNEASIKQTLNVSKGMYYSITFCAARTCAQEERLNITVAP  453
            AVRLGN+A+I+Q L+V++  YYSITF AARTCAQ+E+LN++V P
Sbjct  87   AVRLGNDATIRQRLSVTRRAYYSITFSAARTCAQKEKLNMSVTP  130


 Score = 47.8 bits (112),  Expect(2) = 5e-37, Method: Compositional matrix adjust.
 Identities = 20/35 (57%), Positives = 27/35 (77%), Gaps = 0/35 (0%)
 Frame = +2

Query  464  VLPIQTLYSINGWDCYPWAFQAENPQAEIIIHNPG  568
            VLPIQT+Y+ +GWD Y WAF+A++    + IHNPG
Sbjct  134  VLPIQTVYTSSGWDSYSWAFRAKHSVVWLSIHNPG  168


 Score =   103 bits (256),  Expect(2) = 5e-29, Method: Composition-based stats.
 Identities = 45/74 (61%), Positives = 60/74 (81%), Gaps = 0/74 (0%)
 Frame = +1

Query  226  AVPGWTVTGFVEYIQAGQKQGDMQLVVPEGFAAVRLGNEASIKQTLNVSKGMYYSITFCA  405
            A P W ++GFVEYI +G K+ DM L VPEG  AVRLGN+A+I+Q ++V++ MYYS+TF A
Sbjct  305  AEPNWEISGFVEYIGSGHKEQDMILAVPEGAYAVRLGNDATIRQRISVTRHMYYSVTFSA  364

Query  406  ARTCAQEERLNITV  447
            ARTCAQ E+LN++V
Sbjct  365  ARTCAQAEKLNVSV  378


 Score = 51.2 bits (121),  Expect(2) = 5e-29, Method: Compositional matrix adjust.
 Identities = 22/36 (61%), Positives = 27/36 (75%), Gaps = 0/36 (0%)
 Frame = +2

Query  464  VLPIQTLYSINGWDCYPWAFQAENPQAEIIIHNPGV  571
            VLPIQT+Y+  GWD Y WAF+AE+    + IHNPGV
Sbjct  384  VLPIQTVYTSTGWDSYSWAFKAEHSAVWLSIHNPGV  419



>dbj|BAJ96954.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=378

 Score =   132 bits (332),  Expect(2) = 6e-37, Method: Compositional matrix adjust.
 Identities = 64/103 (62%), Positives = 79/103 (77%), Gaps = 0/103 (0%)
 Frame = +1

Query  142  TDGLLVNGNFEAPVKKTDLNGTIVTRHDAVPGWTVTGFVEYIQAGQKQGDMQLVVPEGFA  321
            TDG+L NGNFE    ++ ++GT VT   A+P W V G VEYI +GQKQGDM L VPEG  
Sbjct  31   TDGILPNGNFEEAPDRSQMDGTRVTGRYAIPRWEVCGCVEYICSGQKQGDMVLPVPEGAY  90

Query  322  AVRLGNEASIKQTLNVSKGMYYSITFCAARTCAQEERLNITVA  450
            A+RLGN+AS++Q L+V+ G +YSITF AARTCAQ ERLN+TVA
Sbjct  91   AMRLGNDASVQQQLSVTPGTHYSITFSAARTCAQAERLNVTVA  133


 Score = 48.5 bits (114),  Expect(2) = 6e-37, Method: Compositional matrix adjust.
 Identities = 19/38 (50%), Positives = 28/38 (74%), Gaps = 0/38 (0%)
 Frame = +2

Query  455  DSDVLPIQTLYSINGWDCYPWAFQAENPQAEIIIHNPG  568
            +S  LPIQT+Y+ +GWD Y WAF+A++    + +HNPG
Sbjct  135  ESGQLPIQTVYTSSGWDSYSWAFEAKDNVVLLTVHNPG  172



>ref|XP_002446728.1| hypothetical protein SORBIDRAFT_06g021320 [Sorghum bicolor]
 gb|EES11056.1| hypothetical protein SORBIDRAFT_06g021320 [Sorghum bicolor]
Length=371

 Score =   128 bits (321),  Expect(2) = 7e-36, Method: Compositional matrix adjust.
 Identities = 59/104 (57%), Positives = 80/104 (77%), Gaps = 0/104 (0%)
 Frame = +1

Query  142  TDGLLVNGNFEAPVKKTDLNGTIVTRHDAVPGWTVTGFVEYIQAGQKQGDMQLVVPEGFA  321
            T+GLL NG+FE    K+++NGT V    ++P W ++GF+EYI++GQKQ DM L VPEG  
Sbjct  25   TEGLLPNGHFEQGPAKSEMNGTRVLGRYSIPHWEISGFLEYIESGQKQDDMLLQVPEGER  84

Query  322  AVRLGNEASIKQTLNVSKGMYYSITFCAARTCAQEERLNITVAP  453
            AVRLGN+A+I+Q L V++  YYSITF A+RTCAQ E+LN++V P
Sbjct  85   AVRLGNDATIQQQLAVTRHTYYSITFSASRTCAQAEKLNVSVTP  128


 Score = 49.7 bits (117),  Expect(2) = 7e-36, Method: Compositional matrix adjust.
 Identities = 21/38 (55%), Positives = 28/38 (74%), Gaps = 0/38 (0%)
 Frame = +2

Query  455  DSDVLPIQTLYSINGWDCYPWAFQAENPQAEIIIHNPG  568
            +S VLPIQT+Y+ +GWD Y WAF+A +    + IHNPG
Sbjct  129  ESGVLPIQTVYTSSGWDSYSWAFKARHSTVWLSIHNPG  166



>ref|NP_001140426.1| hypothetical protein precursor [Zea mays]
 gb|ACF83808.1| unknown [Zea mays]
 gb|ACR34644.1| unknown [Zea mays]
 gb|AFW70605.1| hypothetical protein ZEAMMB73_168025 [Zea mays]
Length=371

 Score =   126 bits (317),  Expect(2) = 7e-36, Method: Compositional matrix adjust.
 Identities = 63/104 (61%), Positives = 75/104 (72%), Gaps = 1/104 (1%)
 Frame = +1

Query  142  TDGLLVNGNFEAPVKKTDLNGTIVTRHDAVPGWTVTGFVEYIQAGQKQGDMQLVVPEGFA  321
            TDGLL NGNFE     + L GT V    A+P W  +GFVEYI +GQKQGDM LVVPEG  
Sbjct  26   TDGLLPNGNFERSPLPSQLRGTRVVGASAIPSWQTSGFVEYISSGQKQGDMVLVVPEGAY  85

Query  322  AVRLGNEASIKQTL-NVSKGMYYSITFCAARTCAQEERLNITVA  450
            AVRLGNEASI+Q L   ++G  YS+TF AARTCAQ E+LN++ +
Sbjct  86   AVRLGNEASIRQRLRGAARGARYSLTFSAARTCAQAEQLNVSAS  129


 Score = 50.4 bits (119),  Expect(2) = 7e-36, Method: Compositional matrix adjust.
 Identities = 21/38 (55%), Positives = 28/38 (74%), Gaps = 0/38 (0%)
 Frame = +2

Query  458  SDVLPIQTLYSINGWDCYPWAFQAENPQAEIIIHNPGV  571
            S +L +QT+YS NGWD Y WA+ A   + +I+IHNPGV
Sbjct  132  SGLLAMQTMYSSNGWDSYAWAWVANADEVDIVIHNPGV  169



>ref|XP_009591297.1| PREDICTED: uncharacterized protein LOC104088341 [Nicotiana tomentosiformis]
Length=372

 Score =   128 bits (322),  Expect(2) = 8e-36, Method: Compositional matrix adjust.
 Identities = 62/104 (60%), Positives = 79/104 (76%), Gaps = 1/104 (1%)
 Frame = +1

Query  145  DGLLVNGNFEAPVKKTDLNGTIVTRHDAVPGWTVTGFVEYIQAGQKQGDMQLVVPEGFAA  324
            DGLL NGNFE   K + L GT VT   A+P W ++G+VEYI++GQ QGDM L VPEG  A
Sbjct  25   DGLLPNGNFEQGPKPSQLKGTKVTEPHAIPHWEISGYVEYIKSGQTQGDMLLPVPEGAFA  84

Query  325  VRLGNEASIKQTL-NVSKGMYYSITFCAARTCAQEERLNITVAP  453
            VRLG +ASIK  + NV+KG +YS++F  ARTCAQEE+LN++V+P
Sbjct  85   VRLGEDASIKTRITNVTKGTFYSLSFNFARTCAQEEKLNVSVSP  128


 Score = 48.9 bits (115),  Expect(2) = 8e-36, Method: Compositional matrix adjust.
 Identities = 18/36 (50%), Positives = 27/36 (75%), Gaps = 0/36 (0%)
 Frame = +2

Query  464  VLPIQTLYSINGWDCYPWAFQAENPQAEIIIHNPGV  571
            +LP+QT+YS +GWD Y W F A+  + +I++HNP V
Sbjct  137  MLPMQTMYSSDGWDSYSWGFLAQATEIDIMLHNPAV  172



>emb|CDO98108.1| unnamed protein product [Coffea canephora]
Length=368

 Score =   129 bits (324),  Expect(2) = 8e-36, Method: Compositional matrix adjust.
 Identities = 59/103 (57%), Positives = 81/103 (79%), Gaps = 0/103 (0%)
 Frame = +1

Query  145  DGLLVNGNFEAPVKKTDLNGTIVTRHDAVPGWTVTGFVEYIQAGQKQGDMQLVVPEGFAA  324
            DGL+ NG+FE   K   ++GT V    +VP W ++GFVEYI++GQKQGDM L VP+G  A
Sbjct  23   DGLVPNGDFEEGPKPWQMHGTEVVDPHSVPHWELSGFVEYIKSGQKQGDMILPVPKGHFA  82

Query  325  VRLGNEASIKQTLNVSKGMYYSITFCAARTCAQEERLNITVAP  453
            +RLGNEASIK  + V+KG++YS++F AARTCAQ+E+LN++V+P
Sbjct  83   LRLGNEASIKTKVQVAKGLFYSLSFGAARTCAQQEQLNLSVSP  125


 Score = 48.1 bits (113),  Expect(2) = 8e-36, Method: Compositional matrix adjust.
 Identities = 18/38 (47%), Positives = 27/38 (71%), Gaps = 0/38 (0%)
 Frame = +2

Query  452  RDSDVLPIQTLYSINGWDCYPWAFQAENPQAEIIIHNP  565
            +D  +LP+QT+YS  GWD + W F AE+ + E+I H+P
Sbjct  130  KDWGMLPMQTMYSTEGWDSFSWGFLAESNEVEVIFHHP  167



>dbj|BAK03126.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=374

 Score =   125 bits (313),  Expect(2) = 9e-36, Method: Compositional matrix adjust.
 Identities = 63/104 (61%), Positives = 73/104 (70%), Gaps = 1/104 (1%)
 Frame = +1

Query  142  TDGLLVNGNFEAPVKKTDLNGTIVTRHDAVPGWTVTGFVEYIQAGQKQGDMQLVVPEGFA  321
            TDGLL NGNFE   + + L GT V    ++P W  +GFVEYI +GQKQGDM LVVPEG  
Sbjct  25   TDGLLANGNFERGPQPSQLRGTQVVGASSIPSWRTSGFVEYIPSGQKQGDMVLVVPEGAY  84

Query  322  AVRLGNEASIKQTLN-VSKGMYYSITFCAARTCAQEERLNITVA  450
            AVRLGNEASI Q L     G  YS+TF AARTCAQ ERLN++ +
Sbjct  85   AVRLGNEASIAQRLRGAVPGARYSLTFSAARTCAQAERLNVSAS  128


 Score = 52.0 bits (123),  Expect(2) = 9e-36, Method: Compositional matrix adjust.
 Identities = 21/38 (55%), Positives = 28/38 (74%), Gaps = 0/38 (0%)
 Frame = +2

Query  458  SDVLPIQTLYSINGWDCYPWAFQAENPQAEIIIHNPGV  571
            S VL +QT+YS NGWD Y WA+ A   + E+++HNPGV
Sbjct  131  SGVLVMQTMYSSNGWDSYSWAWDASADEVEVVVHNPGV  168



>ref|XP_003580051.1| PREDICTED: uncharacterized protein LOC100841904 [Brachypodium 
distachyon]
Length=373

 Score =   129 bits (323),  Expect(2) = 1e-35, Method: Compositional matrix adjust.
 Identities = 59/104 (57%), Positives = 78/104 (75%), Gaps = 0/104 (0%)
 Frame = +1

Query  142  TDGLLVNGNFEAPVKKTDLNGTIVTRHDAVPGWTVTGFVEYIQAGQKQGDMQLVVPEGFA  321
            TDGLL NG F     K+ +NGT+VT   A+P W ++GFVEYI++G K+ DM L VP G  
Sbjct  25   TDGLLPNGRFSQGPDKSQMNGTVVTGKHAMPNWELSGFVEYIESGHKEADMLLAVPVGAN  84

Query  322  AVRLGNEASIKQTLNVSKGMYYSITFCAARTCAQEERLNITVAP  453
            AVRLGN+A+I+Q L+V++  YYSITF AAR+CAQ E+LN++V P
Sbjct  85   AVRLGNDATIRQQLSVTRKAYYSITFVAARSCAQAEKLNVSVDP  128


 Score = 47.8 bits (112),  Expect(2) = 1e-35, Method: Compositional matrix adjust.
 Identities = 19/36 (53%), Positives = 24/36 (67%), Gaps = 0/36 (0%)
 Frame = +2

Query  464  VLPIQTLYSINGWDCYPWAFQAENPQAEIIIHNPGV  571
            VLPIQT+Y+  GWD Y WAF+A      + IHN G+
Sbjct  132  VLPIQTVYTSTGWDSYSWAFKARRSTVTLSIHNTGI  167



>ref|XP_004978107.1| PREDICTED: uncharacterized protein LOC101761699 [Setaria italica]
Length=377

 Score =   128 bits (321),  Expect(2) = 2e-35, Method: Compositional matrix adjust.
 Identities = 66/105 (63%), Positives = 78/105 (74%), Gaps = 2/105 (2%)
 Frame = +1

Query  145  DGLLVNGNFEAPVKKTDLNGTIVTRHDAVPGWTVTGFVEYIQAGQKQGD-MQLVVPEGFA  321
            DG L NG FE     + LNGT VTR DA+P W ++GFVEYIQ+GQ Q D M L VPEG  
Sbjct  28   DGPLPNGIFEQGPDASQLNGTRVTRQDAIPCWEISGFVEYIQSGQNQQDGMVLAVPEGAH  87

Query  322  AVRLGNEASIKQTL-NVSKGMYYSITFCAARTCAQEERLNITVAP  453
            AVRLGN ASI+Q L N+++  YYSITF AARTCAQ E+LN++VAP
Sbjct  88   AVRLGNGASIRQQLTNLARRSYYSITFSAARTCAQAEQLNVSVAP  132


 Score = 48.1 bits (113),  Expect(2) = 2e-35, Method: Compositional matrix adjust.
 Identities = 21/39 (54%), Positives = 29/39 (74%), Gaps = 0/39 (0%)
 Frame = +2

Query  455  DSDVLPIQTLYSINGWDCYPWAFQAENPQAEIIIHNPGV  571
            +S VLPIQT+Y+ +GWD Y +AF+A +  A + I NPGV
Sbjct  133  ESGVLPIQTVYTSSGWDSYSYAFKARHTTAWLTIQNPGV  171



>gb|KHN07098.1| hypothetical protein glysoja_023281 [Glycine soja]
Length=328

 Score =   125 bits (315),  Expect(2) = 2e-35, Method: Compositional matrix adjust.
 Identities = 58/87 (67%), Positives = 71/87 (82%), Gaps = 1/87 (1%)
 Frame = +1

Query  196  LNGTIVTR-HDAVPGWTVTGFVEYIQAGQKQGDMQLVVPEGFAAVRLGNEASIKQTLNVS  372
            + GT+VT    A+PGW ++GF+EY+++GQKQGDM LVVP G  AVRLGN ASIKQ + V 
Sbjct  1    MKGTVVTGGPHAIPGWEISGFIEYLKSGQKQGDMLLVVPNGAYAVRLGNGASIKQKIKVV  60

Query  373  KGMYYSITFCAARTCAQEERLNITVAP  453
            KGMYYSITF  ARTCAQEE+LN++VAP
Sbjct  61   KGMYYSITFMVARTCAQEEKLNVSVAP  87


 Score = 49.7 bits (117),  Expect(2) = 2e-35, Method: Compositional matrix adjust.
 Identities = 20/35 (57%), Positives = 26/35 (74%), Gaps = 0/35 (0%)
 Frame = +2

Query  464  VLPIQTLYSINGWDCYPWAFQAENPQAEIIIHNPG  568
            VLP+QTLYS NGWD Y W+FQA+    ++  H+PG
Sbjct  91   VLPMQTLYSGNGWDAYAWSFQADYSLVDMAFHHPG  125



>gb|KHN07099.1| hypothetical protein glysoja_023282 [Glycine soja]
Length=359

 Score =   124 bits (310),  Expect(2) = 2e-35, Method: Compositional matrix adjust.
 Identities = 58/85 (68%), Positives = 69/85 (81%), Gaps = 1/85 (1%)
 Frame = +1

Query  202  GTIVTR-HDAVPGWTVTGFVEYIQAGQKQGDMQLVVPEGFAAVRLGNEASIKQTLNVSKG  378
            GT+VT    ++PGW ++GF+EYI++GQKQ DM LVVP G  AVRLGNEASIKQ L V KG
Sbjct  28   GTVVTGGPHSIPGWEISGFIEYIKSGQKQDDMLLVVPNGAYAVRLGNEASIKQNLKVVKG  87

Query  379  MYYSITFCAARTCAQEERLNITVAP  453
            MYYSITF  ARTCAQEE+LN++ AP
Sbjct  88   MYYSITFVVARTCAQEEKLNVSAAP  112


 Score = 51.6 bits (122),  Expect(2) = 2e-35, Method: Compositional matrix adjust.
 Identities = 19/35 (54%), Positives = 27/35 (77%), Gaps = 0/35 (0%)
 Frame = +2

Query  464  VLPIQTLYSINGWDCYPWAFQAENPQAEIIIHNPG  568
            VLP+QT+Y  NGWD Y W+F+A+ P  +++ HNPG
Sbjct  116  VLPMQTVYGGNGWDAYAWSFRADYPSVDMVFHNPG  150



>gb|ABK24630.1| unknown [Picea sitchensis]
 gb|ABR18446.1| unknown [Picea sitchensis]
Length=408

 Score =   124 bits (310),  Expect(2) = 4e-35, Method: Compositional matrix adjust.
 Identities = 64/108 (59%), Positives = 73/108 (68%), Gaps = 6/108 (6%)
 Frame = +1

Query  145  DGLLVNGNFEAP--VKKTDLNGTIVTRHDAVPGWTVTGFVEYIQAGQKQGDMQLVVPEGF  318
            DGLLVNGNFE      +T   G I    D++PGW + G VEYI  GQKQG M LVVPEG 
Sbjct  39   DGLLVNGNFEKEGIENRTSRAGDI----DSLPGWNIDGMVEYINEGQKQGSMYLVVPEGK  94

Query  319  AAVRLGNEASIKQTLNVSKGMYYSITFCAARTCAQEERLNITVAPGLR  462
             AVRLGNEA I Q +N+ KG  YS+TF AARTCAQ E LN++V P  R
Sbjct  95   HAVRLGNEAQISQQINIQKGSTYSLTFSAARTCAQLESLNVSVPPSTR  142


 Score = 50.8 bits (120),  Expect(2) = 4e-35, Method: Compositional matrix adjust.
 Identities = 20/35 (57%), Positives = 26/35 (74%), Gaps = 0/35 (0%)
 Frame = +2

Query  467  LPIQTLYSINGWDCYPWAFQAENPQAEIIIHNPGV  571
            + +QTLYSI GWD Y WAFQA++   E+I  NPG+
Sbjct  144  VDLQTLYSIYGWDTYAWAFQAQSENVEVIFQNPGM  178



>ref|XP_002453515.1| hypothetical protein SORBIDRAFT_04g007160 [Sorghum bicolor]
 gb|EES06491.1| hypothetical protein SORBIDRAFT_04g007160 [Sorghum bicolor]
Length=364

 Score =   125 bits (314),  Expect(2) = 5e-35, Method: Compositional matrix adjust.
 Identities = 62/104 (60%), Positives = 76/104 (73%), Gaps = 1/104 (1%)
 Frame = +1

Query  142  TDGLLVNGNFEAPVKKTDLNGTIVTRHDAVPGWTVTGFVEYIQAGQKQGDMQLVVPEGFA  321
            TDGLL NGNFE     + L GT V    A+P W  +GFVEYI +G+KQGDM LVVPEG  
Sbjct  21   TDGLLPNGNFERGPAPSQLRGTRVMGSSAIPAWQTSGFVEYIPSGRKQGDMVLVVPEGAY  80

Query  322  AVRLGNEASIKQTLN-VSKGMYYSITFCAARTCAQEERLNITVA  450
            AVRLGNEASI+Q L+  ++G  YS+TF AARTCAQ E+LN++ +
Sbjct  81   AVRLGNEASIRQRLHGAARGARYSLTFSAARTCAQAEQLNVSAS  124


 Score = 49.3 bits (116),  Expect(2) = 5e-35, Method: Compositional matrix adjust.
 Identities = 19/37 (51%), Positives = 28/37 (76%), Gaps = 0/37 (0%)
 Frame = +2

Query  458  SDVLPIQTLYSINGWDCYPWAFQAENPQAEIIIHNPG  568
            S +L +QT+YS NGWD Y WA+ A+  + +++IHNPG
Sbjct  127  SGLLAMQTMYSSNGWDSYAWAWVADADEVDVVIHNPG  163



>ref|XP_004978108.1| PREDICTED: uncharacterized protein LOC101762525 [Setaria italica]
Length=381

 Score =   125 bits (313),  Expect(2) = 5e-35, Method: Compositional matrix adjust.
 Identities = 60/103 (58%), Positives = 75/103 (73%), Gaps = 0/103 (0%)
 Frame = +1

Query  145  DGLLVNGNFEAPVKKTDLNGTIVTRHDAVPGWTVTGFVEYIQAGQKQGDMQLVVPEGFAA  324
            DGLL NGNFE    K+++NGT V   DA+  W + GFVEYI++G  Q DM L VPEG  A
Sbjct  34   DGLLPNGNFEQGPNKSEMNGTRVKDRDAILHWEIYGFVEYIESGHTQEDMILPVPEGDRA  93

Query  325  VRLGNEASIKQTLNVSKGMYYSITFCAARTCAQEERLNITVAP  453
            VRLGN+A+I+Q L V++  YYSITF AAR+CAQ E LN++V P
Sbjct  94   VRLGNDATIRQKLCVTRQAYYSITFTAARSCAQAEALNVSVTP  136


 Score = 49.3 bits (116),  Expect(2) = 5e-35, Method: Compositional matrix adjust.
 Identities = 21/38 (55%), Positives = 28/38 (74%), Gaps = 0/38 (0%)
 Frame = +2

Query  455  DSDVLPIQTLYSINGWDCYPWAFQAENPQAEIIIHNPG  568
            D  VLPIQT+Y+ +GWD Y WAF+A++    + IHNPG
Sbjct  137  DFGVLPIQTVYTSSGWDSYSWAFKAKHSSVWLSIHNPG  174



>ref|XP_004235717.1| PREDICTED: uncharacterized protein LOC101252763 [Solanum lycopersicum]
Length=373

 Score =   124 bits (312),  Expect(2) = 8e-35, Method: Compositional matrix adjust.
 Identities = 60/104 (58%), Positives = 78/104 (75%), Gaps = 1/104 (1%)
 Frame = +1

Query  145  DGLLVNGNFEAPVKKTDLNGTIVTRHDAVPGWTVTGFVEYIQAGQKQGDMQLVVPEGFAA  324
            DGLL NGNFE   K + + GT VT   A+P W ++G+VEYI++GQ QGDM L VPEG  A
Sbjct  26   DGLLPNGNFEQGPKASQMKGTKVTDPHAIPHWEISGYVEYIRSGQTQGDMLLPVPEGAFA  85

Query  325  VRLGNEASIK-QTLNVSKGMYYSITFCAARTCAQEERLNITVAP  453
            VRLG +ASIK +  NV+ G +YS++F  ARTCAQEE+LN++V+P
Sbjct  86   VRLGEDASIKTRVTNVTSGSFYSLSFNFARTCAQEEKLNVSVSP  129


 Score = 49.3 bits (116),  Expect(2) = 8e-35, Method: Compositional matrix adjust.
 Identities = 19/36 (53%), Positives = 26/36 (72%), Gaps = 0/36 (0%)
 Frame = +2

Query  464  VLPIQTLYSINGWDCYPWAFQAENPQAEIIIHNPGV  571
            +LP+QT+YS +GWD Y W F A+  + EI +HNP V
Sbjct  138  MLPMQTMYSSDGWDSYSWGFLAQANEIEITLHNPAV  173



>gb|ABR13280.1| unknown protein [Prunus dulcis]
Length=175

 Score =   110 bits (276),  Expect(2) = 9e-35, Method: Compositional matrix adjust.
 Identities = 52/64 (81%), Positives = 58/64 (91%), Gaps = 0/64 (0%)
 Frame = +1

Query  262  YIQAGQKQGDMQLVVPEGFAAVRLGNEASIKQTLNVSKGMYYSITFCAARTCAQEERLNI  441
            YI++GQKQGDM LVVPEG  AVRLGNEASIKQ + V+KG+YYSITF AARTCAQEERLNI
Sbjct  2    YIKSGQKQGDMLLVVPEGAYAVRLGNEASIKQRIKVTKGLYYSITFSAARTCAQEERLNI  61

Query  442  TVAP  453
            +VAP
Sbjct  62   SVAP  65


 Score = 62.8 bits (151),  Expect(2) = 9e-35, Method: Compositional matrix adjust.
 Identities = 27/39 (69%), Positives = 32/39 (82%), Gaps = 0/39 (0%)
 Frame = +2

Query  455  DSDVLPIQTLYSINGWDCYPWAFQAENPQAEIIIHNPGV  571
            DS VLPIQT+YS NGWD Y WAFQA+  Q E+++HNPGV
Sbjct  66   DSGVLPIQTVYSSNGWDSYAWAFQADYEQIELVLHNPGV  104



>ref|XP_006341715.1| PREDICTED: uncharacterized protein LOC102601890 [Solanum tuberosum]
Length=368

 Score =   124 bits (310),  Expect(2) = 9e-35, Method: Compositional matrix adjust.
 Identities = 60/104 (58%), Positives = 77/104 (74%), Gaps = 1/104 (1%)
 Frame = +1

Query  145  DGLLVNGNFEAPVKKTDLNGTIVTRHDAVPGWTVTGFVEYIQAGQKQGDMQLVVPEGFAA  324
            DGLL NGNFE   K + + GT VT   A+P W ++G+VEYI+AGQ QGDM L VPEG  A
Sbjct  21   DGLLPNGNFEQGPKASQMKGTKVTDPHAIPHWEISGYVEYIKAGQTQGDMLLPVPEGAFA  80

Query  325  VRLGNEASIK-QTLNVSKGMYYSITFCAARTCAQEERLNITVAP  453
            VRLG +A IK +  NV+ G +YS++F  ARTCAQEE+LN++V+P
Sbjct  81   VRLGEDAYIKTRVTNVTNGTFYSLSFNFARTCAQEEKLNVSVSP  124


 Score = 49.7 bits (117),  Expect(2) = 9e-35, Method: Compositional matrix adjust.
 Identities = 19/36 (53%), Positives = 27/36 (75%), Gaps = 0/36 (0%)
 Frame = +2

Query  464  VLPIQTLYSINGWDCYPWAFQAENPQAEIIIHNPGV  571
            +LP+QT+YS +GWD Y W F A+  + EI++HNP V
Sbjct  133  MLPMQTMYSSDGWDSYSWGFLAQANEIEIMLHNPAV  168



>gb|KJB70569.1| hypothetical protein B456_011G080100 [Gossypium raimondii]
Length=328

 Score =   116 bits (290),  Expect(2) = 1e-34, Method: Compositional matrix adjust.
 Identities = 50/76 (66%), Positives = 63/76 (83%), Gaps = 0/76 (0%)
 Frame = +1

Query  226  AVPGWTVTGFVEYIQAGQKQGDMQLVVPEGFAAVRLGNEASIKQTLNVSKGMYYSITFCA  405
            A+P W ++G+VEYI++G KQGDM L+VPEG  AVRLGNEA IKQ + V KG +YS+TF  
Sbjct  5    AIPNWEISGYVEYIKSGHKQGDMLLIVPEGAFAVRLGNEALIKQKIEVVKGDFYSLTFST  64

Query  406  ARTCAQEERLNITVAP  453
            ARTCAQEERLN++V+P
Sbjct  65   ARTCAQEERLNVSVSP  80


 Score = 57.4 bits (137),  Expect(2) = 1e-34, Method: Compositional matrix adjust.
 Identities = 25/41 (61%), Positives = 29/41 (71%), Gaps = 0/41 (0%)
 Frame = +2

Query  449  RRDSDVLPIQTLYSINGWDCYPWAFQAENPQAEIIIHNPGV  571
            + D  + PIQT+YS NGWD Y WAFQA+    EI IHNPGV
Sbjct  84   KNDFGLFPIQTMYSSNGWDSYAWAFQADAHVIEISIHNPGV  124



>ref|XP_002446726.1| hypothetical protein SORBIDRAFT_06g021300 [Sorghum bicolor]
 gb|EES11054.1| hypothetical protein SORBIDRAFT_06g021300 [Sorghum bicolor]
Length=378

 Score =   124 bits (312),  Expect(2) = 1e-34, Method: Compositional matrix adjust.
 Identities = 60/103 (58%), Positives = 78/103 (76%), Gaps = 1/103 (1%)
 Frame = +1

Query  145  DGLLVNGNFEAPVKKTDLNGTIVTRHDAVPGWTVTGFVEYIQAGQKQGDMQLVVPEGFAA  324
            DGLL NGNFE    K+ +NG+ V   +++P W  +GFVEYI+ GQ+Q DM LVVPEG  A
Sbjct  30   DGLLPNGNFEQGPDKSQMNGSRVIGQNSIPCWETSGFVEYIEPGQQQNDMVLVVPEGARA  89

Query  325  VRLGNEASIKQTL-NVSKGMYYSITFCAARTCAQEERLNITVA  450
            VRLGN+A+I+Q L  +++ M YSITF AARTCAQ E+LN++VA
Sbjct  90   VRLGNDATIRQQLPGLTRSMSYSITFSAARTCAQAEQLNVSVA  132


 Score = 48.9 bits (115),  Expect(2) = 1e-34, Method: Compositional matrix adjust.
 Identities = 20/39 (51%), Positives = 29/39 (74%), Gaps = 0/39 (0%)
 Frame = +2

Query  455  DSDVLPIQTLYSINGWDCYPWAFQAENPQAEIIIHNPGV  571
            +S VLP+QT+Y+ +GWD Y +AF+A +    + IHNPGV
Sbjct  134  ESGVLPVQTVYTSSGWDSYSYAFKARHTAVWLTIHNPGV  172



>gb|ACN40837.1| unknown [Picea sitchensis]
Length=408

 Score =   122 bits (305),  Expect(2) = 2e-34, Method: Compositional matrix adjust.
 Identities = 63/108 (58%), Positives = 73/108 (68%), Gaps = 6/108 (6%)
 Frame = +1

Query  145  DGLLVNGNFEAP--VKKTDLNGTIVTRHDAVPGWTVTGFVEYIQAGQKQGDMQLVVPEGF  318
            DGLLVNGNFE      +T   G I    D++PGW + G VEYI  GQKQG + LVVPEG 
Sbjct  39   DGLLVNGNFEKEGIENRTSRAGDI----DSLPGWNIDGMVEYINEGQKQGSIYLVVPEGK  94

Query  319  AAVRLGNEASIKQTLNVSKGMYYSITFCAARTCAQEERLNITVAPGLR  462
             AVRLGNEA I Q +N+ KG  YS+TF AARTCAQ E LN++V P  R
Sbjct  95   HAVRLGNEAQISQQINIQKGSTYSLTFSAARTCAQLESLNVSVPPSTR  142


 Score = 50.8 bits (120),  Expect(2) = 2e-34, Method: Compositional matrix adjust.
 Identities = 20/35 (57%), Positives = 26/35 (74%), Gaps = 0/35 (0%)
 Frame = +2

Query  467  LPIQTLYSINGWDCYPWAFQAENPQAEIIIHNPGV  571
            + +QTLYSI GWD Y WAFQA++   E+I  NPG+
Sbjct  144  VDLQTLYSIYGWDTYAWAFQAQSENVEVIFQNPGM  178



>gb|EMT19274.1| hypothetical protein F775_14136 [Aegilops tauschii]
Length=393

 Score =   128 bits (322),  Expect(2) = 2e-34, Method: Compositional matrix adjust.
 Identities = 59/104 (57%), Positives = 76/104 (73%), Gaps = 0/104 (0%)
 Frame = +1

Query  145  DGLLVNGNFEAPVKKTDLNGTIVTRHDAVPGWTVTGFVEYIQAGQKQGDMQLVVPEGFAA  324
            DG L+NGNFE    ++ +NG+ VT   A+P W  TGFVEYI+ G KQ  M LVVPEG  A
Sbjct  23   DGPLLNGNFEQAPNRSQMNGSRVTGKYAIPHWKATGFVEYIECGAKQDHMVLVVPEGRHA  82

Query  325  VRLGNEASIKQTLNVSKGMYYSITFCAARTCAQEERLNITVAPG  456
            VRLG E+SI+  L+V++G YYS+TF AARTCAQ E+L +++ PG
Sbjct  83   VRLGTESSIEHQLSVTRGKYYSVTFSAARTCAQSEKLRVSIVPG  126


 Score = 43.9 bits (102),  Expect(2) = 2e-34, Method: Compositional matrix adjust.
 Identities = 16/32 (50%), Positives = 24/32 (75%), Gaps = 0/32 (0%)
 Frame = +2

Query  467  LPIQTLYSINGWDCYPWAFQAENPQAEIIIHN  562
            LP+QT+Y+ +GWD Y WAF+A+     +IIH+
Sbjct  133  LPVQTVYTSSGWDSYAWAFKAQQGVVSLIIHH  164



>ref|XP_009764126.1| PREDICTED: uncharacterized protein LOC104215887 [Nicotiana sylvestris]
Length=379

 Score =   123 bits (309),  Expect(2) = 3e-34, Method: Compositional matrix adjust.
 Identities = 58/104 (56%), Positives = 78/104 (75%), Gaps = 1/104 (1%)
 Frame = +1

Query  145  DGLLVNGNFEAPVKKTDLNGTIVTRHDAVPGWTVTGFVEYIQAGQKQGDMQLVVPEGFAA  324
            DGLL NGNFE   K + +  TIV    A+P W ++G+VEYI++GQ QGDM L VP+G  A
Sbjct  29   DGLLPNGNFEQGPKPSQMKHTIVINPHAIPHWELSGYVEYIKSGQMQGDMLLPVPQGDFA  88

Query  325  VRLGNEASIK-QTLNVSKGMYYSITFCAARTCAQEERLNITVAP  453
            VRLG +AS+K + +NV+KG +Y+++F  ARTCAQEERLN++V P
Sbjct  89   VRLGEDASLKTKVVNVTKGTFYALSFVFARTCAQEERLNVSVTP  132


 Score = 48.5 bits (114),  Expect(2) = 3e-34, Method: Compositional matrix adjust.
 Identities = 20/39 (51%), Positives = 27/39 (69%), Gaps = 0/39 (0%)
 Frame = +2

Query  452  RDSDVLPIQTLYSINGWDCYPWAFQAENPQAEIIIHNPG  568
            +D  +LP+QT+YS +GWD Y W F AE    EI++HNP 
Sbjct  137  KDWGMLPLQTMYSSDGWDTYSWGFFAEANVIEIVLHNPA  175



>ref|XP_006826721.1| hypothetical protein AMTR_s00264p00012960 [Amborella trichopoda]
 gb|ERM93958.1| hypothetical protein AMTR_s00264p00012960 [Amborella trichopoda]
Length=372

 Score =   124 bits (311),  Expect(2) = 4e-34, Method: Compositional matrix adjust.
 Identities = 54/103 (52%), Positives = 79/103 (77%), Gaps = 0/103 (0%)
 Frame = +1

Query  142  TDGLLVNGNFEAPVKKTDLNGTIVTRHDAVPGWTVTGFVEYIQAGQKQGDMQLVVPEGFA  321
            +DGLL NGNFE     + L G++V   +++P W + G VEY+++GQK GD+ LV+PEGFA
Sbjct  23   SDGLLPNGNFEKAPSHSSLKGSVVIGKNSLPDWEIGGAVEYVKSGQKSGDLMLVIPEGFA  82

Query  322  AVRLGNEASIKQTLNVSKGMYYSITFCAARTCAQEERLNITVA  450
            AVRLG++A I+Q ++V+KG  Y++T  AARTCA +E+LN+TV+
Sbjct  83   AVRLGSDAFIRQRVSVNKGELYALTLSAARTCASDEKLNVTVS  125


 Score = 47.0 bits (110),  Expect(2) = 4e-34, Method: Compositional matrix adjust.
 Identities = 18/39 (46%), Positives = 27/39 (69%), Gaps = 0/39 (0%)
 Frame = +2

Query  452  RDSDVLPIQTLYSINGWDCYPWAFQAENPQAEIIIHNPG  568
            RDS ++ +QT+Y+  GWD Y WAF AE+ +  + I +PG
Sbjct  130  RDSGLISVQTIYNAKGWDSYAWAFLAESSEIGVFIGDPG  168



>gb|EMT25742.1| hypothetical protein F775_05959 [Aegilops tauschii]
Length=379

 Score =   124 bits (310),  Expect(2) = 7e-34, Method: Compositional matrix adjust.
 Identities = 58/104 (56%), Positives = 75/104 (72%), Gaps = 0/104 (0%)
 Frame = +1

Query  145  DGLLVNGNFEAPVKKTDLNGTIVTRHDAVPGWTVTGFVEYIQAGQKQGDMQLVVPEGFAA  324
            DG L NGNFE    +  ++G+ VT  +A+P W +TG VEYI++GQK+GDM L VPEG  A
Sbjct  23   DGPLPNGNFEDSPDRFQMDGSRVTGANAIPQWKITGHVEYIESGQKEGDMILTVPEGSHA  82

Query  325  VRLGNEASIKQTLNVSKGMYYSITFCAARTCAQEERLNITVAPG  456
            VRLG + SI Q L+V+ G  YS+TF AARTCAQ E+L ++V PG
Sbjct  83   VRLGEDGSIHQQLSVAPGTQYSVTFSAARTCAQYEKLTVSVVPG  126


 Score = 47.0 bits (110),  Expect(2) = 7e-34, Method: Compositional matrix adjust.
 Identities = 20/36 (56%), Positives = 25/36 (69%), Gaps = 0/36 (0%)
 Frame = +2

Query  458  SDVLPIQTLYSINGWDCYPWAFQAENPQAEIIIHNP  565
            SD + IQT+Y+ +GWD Y WAFQA N    + IHNP
Sbjct  129  SDEISIQTVYTSSGWDSYCWAFQATNDVMTLTIHNP  164



>ref|XP_004951511.1| PREDICTED: uncharacterized protein LOC101755979 [Setaria italica]
Length=374

 Score =   125 bits (315),  Expect(2) = 1e-33, Method: Compositional matrix adjust.
 Identities = 64/104 (62%), Positives = 74/104 (71%), Gaps = 1/104 (1%)
 Frame = +1

Query  142  TDGLLVNGNFEAPVKKTDLNGTIVTRHDAVPGWTVTGFVEYIQAGQKQGDMQLVVPEGFA  321
            TDGLL NGNFE     + L GT V    ++P W  +GFVEYI +GQKQGDM LVVPEG  
Sbjct  26   TDGLLPNGNFERGPLPSQLRGTRVLGSSSIPSWQTSGFVEYIPSGQKQGDMLLVVPEGAY  85

Query  322  AVRLGNEASIKQTL-NVSKGMYYSITFCAARTCAQEERLNITVA  450
            AVRLGNEASI+Q L   + G  YS+TF AARTCAQ ERLNI+ +
Sbjct  86   AVRLGNEASIRQRLRGAAPGARYSLTFSAARTCAQAERLNISAS  129


 Score = 44.7 bits (104),  Expect(2) = 1e-33, Method: Compositional matrix adjust.
 Identities = 22/41 (54%), Positives = 27/41 (66%), Gaps = 3/41 (7%)
 Frame = +2

Query  458  SDVLPIQTLYSINGWDCYPWAFQA---ENPQAEIIIHNPGV  571
            S +L IQT YS NGWD Y WA+ A    + + E+ IHNPGV
Sbjct  132  SGLLAIQTTYSSNGWDSYAWAWVAAVDSSGEVEVSIHNPGV  172



>gb|EMS51274.1| hypothetical protein TRIUR3_06873 [Triticum urartu]
Length=377

 Score =   127 bits (319),  Expect(2) = 1e-33, Method: Compositional matrix adjust.
 Identities = 58/104 (56%), Positives = 77/104 (74%), Gaps = 0/104 (0%)
 Frame = +1

Query  145  DGLLVNGNFEAPVKKTDLNGTIVTRHDAVPGWTVTGFVEYIQAGQKQGDMQLVVPEGFAA  324
            DG L+NGNFE    ++ +NG+ VT   A+P W  TGFVEYI+ G KQ  M LVVPEG  A
Sbjct  23   DGPLLNGNFEQAPNRSQMNGSRVTGKYAIPHWKATGFVEYIECGAKQDHMVLVVPEGRHA  82

Query  325  VRLGNEASIKQTLNVSKGMYYSITFCAARTCAQEERLNITVAPG  456
            VRLG ++SI+  L+V++G YYS+TF AARTCAQ E+L++++ PG
Sbjct  83   VRLGTDSSIEHQLSVTRGKYYSVTFSAARTCAQSEKLSVSIVPG  126


 Score = 42.7 bits (99),  Expect(2) = 1e-33, Method: Compositional matrix adjust.
 Identities = 15/32 (47%), Positives = 23/32 (72%), Gaps = 0/32 (0%)
 Frame = +2

Query  467  LPIQTLYSINGWDCYPWAFQAENPQAEIIIHN  562
            LP+QT+Y+ +GWD Y WAF+A      ++IH+
Sbjct  133  LPVQTVYTSSGWDSYAWAFKARQGVVSLVIHH  164



>ref|XP_009598172.1| PREDICTED: uncharacterized protein LOC104094024 [Nicotiana tomentosiformis]
Length=379

 Score =   120 bits (301),  Expect(2) = 1e-33, Method: Compositional matrix adjust.
 Identities = 57/104 (55%), Positives = 77/104 (74%), Gaps = 1/104 (1%)
 Frame = +1

Query  145  DGLLVNGNFEAPVKKTDLNGTIVTRHDAVPGWTVTGFVEYIQAGQKQGDMQLVVPEGFAA  324
            DGLL NGNFE   K + +  T V    A+P W ++G+VEYI++GQ QGDM L VP+G  A
Sbjct  29   DGLLPNGNFEQGPKPSQMKHTRVMDPHAIPHWELSGYVEYIKSGQMQGDMLLPVPQGDFA  88

Query  325  VRLGNEASIK-QTLNVSKGMYYSITFCAARTCAQEERLNITVAP  453
            VRLG +AS+K + +NV+KG +Y+++F  ARTCAQEERLN++V P
Sbjct  89   VRLGEDASLKTKVVNVTKGTFYALSFVFARTCAQEERLNVSVTP  132


 Score = 49.3 bits (116),  Expect(2) = 1e-33, Method: Compositional matrix adjust.
 Identities = 20/39 (51%), Positives = 27/39 (69%), Gaps = 0/39 (0%)
 Frame = +2

Query  452  RDSDVLPIQTLYSINGWDCYPWAFQAENPQAEIIIHNPG  568
            +D  +LP+QT+YS +GWD Y W F AE    EI++HNP 
Sbjct  137  KDWGMLPLQTMYSSDGWDTYSWGFLAEANVVEIVLHNPA  175



>gb|EMS51275.1| hypothetical protein TRIUR3_06876 [Triticum urartu]
Length=379

 Score =   122 bits (307),  Expect(2) = 2e-33, Method: Compositional matrix adjust.
 Identities = 58/104 (56%), Positives = 74/104 (71%), Gaps = 0/104 (0%)
 Frame = +1

Query  145  DGLLVNGNFEAPVKKTDLNGTIVTRHDAVPGWTVTGFVEYIQAGQKQGDMQLVVPEGFAA  324
            DG L NGNFE    +  ++G+ VT  +A+P W +TG VEYI++GQ QGDM L VPEG  A
Sbjct  23   DGPLPNGNFEDSPDRFQMDGSRVTGANAIPQWKITGHVEYIESGQTQGDMILTVPEGSHA  82

Query  325  VRLGNEASIKQTLNVSKGMYYSITFCAARTCAQEERLNITVAPG  456
            VRLG + SI Q L+V+ G  YS+TF AARTCAQ E+L ++V PG
Sbjct  83   VRLGEDGSIHQQLSVAPGTQYSVTFSAARTCAQYEKLTVSVVPG  126


 Score = 46.6 bits (109),  Expect(2) = 2e-33, Method: Compositional matrix adjust.
 Identities = 20/36 (56%), Positives = 25/36 (69%), Gaps = 0/36 (0%)
 Frame = +2

Query  458  SDVLPIQTLYSINGWDCYPWAFQAENPQAEIIIHNP  565
            SD + IQT+Y+ +GWD Y WAFQA N    + IHNP
Sbjct  129  SDEISIQTVYTSSGWDSYCWAFQATNDVMTLTIHNP  164



>ref|XP_004976081.1| PREDICTED: uncharacterized protein LOC101764801 [Setaria italica]
Length=392

 Score =   129 bits (323),  Expect(2) = 2e-33, Method: Compositional matrix adjust.
 Identities = 57/103 (55%), Positives = 83/103 (81%), Gaps = 0/103 (0%)
 Frame = +1

Query  145  DGLLVNGNFEAPVKKTDLNGTIVTRHDAVPGWTVTGFVEYIQAGQKQGDMQLVVPEGFAA  324
            DG L+NGNFE P  ++ ++G+ VT  +A+P W  TG VEYI +GQ+QGDM L VPEG  A
Sbjct  26   DGPLLNGNFEYPPNQSQMSGSKVTGENAIPYWKTTGTVEYIGSGQQQGDMILTVPEGAHA  85

Query  325  VRLGNEASIKQTLNVSKGMYYSITFCAARTCAQEERLNITVAP  453
            +RLG++ASI+Q ++V++G+YYS+TF A+RTCAQ+E+L++T+ P
Sbjct  86   LRLGSDASIQQQISVTRGLYYSVTFRASRTCAQDEKLSLTIVP  128


 Score = 40.4 bits (93),  Expect(2) = 2e-33, Method: Compositional matrix adjust.
 Identities = 18/33 (55%), Positives = 21/33 (64%), Gaps = 0/33 (0%)
 Frame = +2

Query  467  LPIQTLYSINGWDCYPWAFQAENPQAEIIIHNP  565
            LPIQT+YS  GWD Y WAF+AE       I +P
Sbjct  140  LPIQTVYSSCGWDAYSWAFKAEAGIVSFTIRHP  172



>ref|NP_001141282.1| hypothetical protein precursor [Zea mays]
 gb|ACF85954.1| unknown [Zea mays]
 tpg|DAA37150.1| TPA: hypothetical protein ZEAMMB73_862661 [Zea mays]
Length=375

 Score =   116 bits (291),  Expect(2) = 2e-33, Method: Compositional matrix adjust.
 Identities = 58/105 (55%), Positives = 77/105 (73%), Gaps = 2/105 (2%)
 Frame = +1

Query  145  DGLLVNGNFEAPVKKTDLNGTIVTRHDAVPGWTVTGFVEYIQAGQKQGD-MQLVVPEGFA  321
            DGLL NGNFE    K  +NGT V    ++P W ++GFVEYI +GQ+Q + M + VPEG  
Sbjct  25   DGLLPNGNFEQGPDKYQMNGTWVIGRKSIPCWEISGFVEYIVSGQQQDNGMVVAVPEGAR  84

Query  322  AVRLGNEASIKQTL-NVSKGMYYSITFCAARTCAQEERLNITVAP  453
            AVRLGN+ASI+Q L  +++G  YS+TF A+RTCAQ E+LN++VAP
Sbjct  85   AVRLGNDASIRQRLTGMTRGTSYSVTFSASRTCAQAEQLNVSVAP  129


 Score = 52.4 bits (124),  Expect(2) = 2e-33, Method: Compositional matrix adjust.
 Identities = 22/39 (56%), Positives = 31/39 (79%), Gaps = 0/39 (0%)
 Frame = +2

Query  455  DSDVLPIQTLYSINGWDCYPWAFQAENPQAEIIIHNPGV  571
            +S VLPIQT+Y+ +GWD Y +AF+A +  A ++IHNPGV
Sbjct  130  ESGVLPIQTVYTSSGWDSYSYAFRARHSAAWLVIHNPGV  168



>gb|EYU24667.1| hypothetical protein MIMGU_mgv1a008541mg [Erythranthe guttata]
Length=370

 Score =   132 bits (332),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 65/125 (52%), Positives = 90/125 (72%), Gaps = 9/125 (7%)
 Frame = +1

Query  142  TDGLLVNGNFEAPVKKTDLNGTIVTRHDAVPGWTVTGFVEYIQAGQKQGDMQLVVPEGFA  321
            TDGLL NGNFE   K++++ GT V    ++P W  TGFVEYI++ QKQGDMQLVVPEG +
Sbjct  20   TDGLLPNGNFENGPKRSEMKGTRVINSRSIPFWETTGFVEYIKSTQKQGDMQLVVPEGNS  79

Query  322  AVRLGNEASIKQTLNVSKGMYYSITFCAARTCAQEERLNITVAPGLRRAAHPNAVQYQRL  501
            AVRLG+ A++K  + V+ G +YS++F A+RTCAQEE+LNI+        A PN+ + +  
Sbjct  80   AVRLGDGAAVKTKVKVTNGKFYSVSFSASRTCAQEEKLNIS--------ASPNS-EPKDW  130

Query  502  GLLPV  516
            G+LP+
Sbjct  131  GMLPI  135


 Score = 52.4 bits (124),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 23/40 (58%), Positives = 30/40 (75%), Gaps = 0/40 (0%)
 Frame = +2

Query  452  RDSDVLPIQTLYSINGWDCYPWAFQAENPQAEIIIHNPGV  571
            +D  +LPIQT+YS +GWD Y W F A++ + EI IHNPGV
Sbjct  128  KDWGMLPIQTVYSSDGWDSYCWGFLAQSDEIEIAIHNPGV  167



>ref|XP_010092662.1| hypothetical protein L484_019736 [Morus notabilis]
 gb|EXB51959.1| hypothetical protein L484_019736 [Morus notabilis]
Length=209

 Score =   128 bits (322),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 64/124 (52%), Positives = 86/124 (69%), Gaps = 9/124 (7%)
 Frame = +1

Query  145  DGLLVNGNFEAPVKKTDLNGTIVTRHDAVPGWTVTGFVEYIQAGQKQGDMQLVVPEGFAA  324
            +G L NGNFE   K +++ GT+V  H A+P W ++G V+YI++G  QGDM LVVPEG  A
Sbjct  26   NGHLPNGNFEYGPKPSEMKGTLVLNHKAIPNWEISGVVDYIKSGHTQGDMLLVVPEGAFA  85

Query  325  VRLGNEASIKQTLNVSKGMYYSITFCAARTCAQEERLNITVAPGLRRAAHPNAVQYQRLG  504
             RLGNEASIKQ + V    +YS+TF AARTCAQEE+LN++V+P    ++ PN       G
Sbjct  86   GRLGNEASIKQKVKVITEGFYSLTFSAARTCAQEEKLNMSVSP----SSEPN-----DWG  136

Query  505  LLPV  516
            +LP+
Sbjct  137  ILPM  140


 Score = 52.4 bits (124),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 22/36 (61%), Positives = 27/36 (75%), Gaps = 0/36 (0%)
 Frame = +2

Query  464  VLPIQTLYSINGWDCYPWAFQAENPQAEIIIHNPGV  571
            +LP+QT+YS  GWD Y   F+A+  Q EIIIHNPGV
Sbjct  137  ILPMQTMYSRTGWDSYSCGFKADASQIEIIIHNPGV  172



>ref|XP_011466738.1| PREDICTED: uncharacterized protein LOC101306247 isoform X2 [Fragaria 
vesca subsp. vesca]
 ref|XP_011466739.1| PREDICTED: uncharacterized protein LOC101306247 isoform X2 [Fragaria 
vesca subsp. vesca]
Length=333

 Score =   131 bits (329),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 62/107 (58%), Positives = 79/107 (74%), Gaps = 9/107 (8%)
 Frame = +1

Query  196  LNGTIVTRHDAVPGWTVTGFVEYIQAGQKQGDMQLVVPEGFAAVRLGNEASIKQTLNVSK  375
            + GT+VT H+A+P W  +G+VEYI++G KQGDM LVVPEG  A+RLGNEASIKQ + V+K
Sbjct  1    MKGTVVTAHNAIPNWETSGYVEYIKSGHKQGDMLLVVPEGGFAIRLGNEASIKQKIKVTK  60

Query  376  GMYYSITFCAARTCAQEERLNITVAPGLRRAAHPNAVQYQRLGLLPV  516
            G +Y+ITF AARTCAQEE LNI+V P          V+ Q  G+LP+
Sbjct  61   GGFYAITFSAARTCAQEEILNISVNPN---------VEKQDFGILPI  98


 Score = 55.8 bits (133),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 22/41 (54%), Positives = 29/41 (71%), Gaps = 0/41 (0%)
 Frame = +2

Query  449  RRDSDVLPIQTLYSINGWDCYPWAFQAENPQAEIIIHNPGV  571
            ++D  +LPIQT+YS  GWD Y W F A+  + E+ IHNPGV
Sbjct  90   KQDFGILPIQTMYSSTGWDSYAWGFNADADEIELTIHNPGV  130



>ref|XP_006346648.1| PREDICTED: uncharacterized protein LOC102598480 [Solanum tuberosum]
Length=380

 Score =   118 bits (295),  Expect(2) = 9e-33, Method: Compositional matrix adjust.
 Identities = 56/104 (54%), Positives = 76/104 (73%), Gaps = 1/104 (1%)
 Frame = +1

Query  145  DGLLVNGNFEAPVKKTDLNGTIVTRHDAVPGWTVTGFVEYIQAGQKQGDMQLVVPEGFAA  324
            DGLL NGNFE   K + +  T V     +P W ++G+VEYI++GQ QGDM L VP+G  A
Sbjct  29   DGLLPNGNFEQGPKPSQMKKTRVIDPHGIPHWELSGYVEYIKSGQMQGDMLLPVPQGDYA  88

Query  325  VRLGNEASIK-QTLNVSKGMYYSITFCAARTCAQEERLNITVAP  453
            VRLG +AS+K + +NV+K  +YS++F  ARTCAQEERLN++V+P
Sbjct  89   VRLGEDASLKTKVINVTKETFYSLSFVFARTCAQEERLNVSVSP  132


 Score = 48.9 bits (115),  Expect(2) = 9e-33, Method: Compositional matrix adjust.
 Identities = 19/38 (50%), Positives = 28/38 (74%), Gaps = 0/38 (0%)
 Frame = +2

Query  452  RDSDVLPIQTLYSINGWDCYPWAFQAENPQAEIIIHNP  565
            +D  +LP+QT+YS +GWD Y W F AE  + +I++HNP
Sbjct  137  KDWGMLPLQTMYSSDGWDTYSWGFLAEANEIDIVLHNP  174



>gb|EMT04284.1| hypothetical protein F775_14656 [Aegilops tauschii]
Length=353

 Score =   130 bits (328),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 63/102 (62%), Positives = 77/102 (75%), Gaps = 0/102 (0%)
 Frame = +1

Query  142  TDGLLVNGNFEAPVKKTDLNGTIVTRHDAVPGWTVTGFVEYIQAGQKQGDMQLVVPEGFA  321
            TDGLL NGNFE    ++ ++GT VT   A+P W   G VEYI +GQKQGDM L VPEG  
Sbjct  25   TDGLLPNGNFEEAPDRSQMDGTRVTGRYAIPRWESCGCVEYICSGQKQGDMVLPVPEGAH  84

Query  322  AVRLGNEASIKQTLNVSKGMYYSITFCAARTCAQEERLNITV  447
            AVRLGNEAS++Q L+V+ G +Y+ITF AARTCAQ E+LN+TV
Sbjct  85   AVRLGNEASVQQQLSVTPGTHYAITFSAARTCAQAEKLNVTV  126



>ref|XP_004252488.1| PREDICTED: uncharacterized protein LOC101250580 [Solanum lycopersicum]
Length=380

 Score =   117 bits (294),  Expect(2) = 1e-32, Method: Compositional matrix adjust.
 Identities = 57/104 (55%), Positives = 76/104 (73%), Gaps = 1/104 (1%)
 Frame = +1

Query  145  DGLLVNGNFEAPVKKTDLNGTIVTRHDAVPGWTVTGFVEYIQAGQKQGDMQLVVPEGFAA  324
            DGLL NGNFE   K + +  T V    A+P W ++G+VEYI++GQ QGDM L VP+G  A
Sbjct  29   DGLLPNGNFEQGPKSSQMKNTRVIDPHAIPHWELSGYVEYIKSGQMQGDMLLPVPQGDYA  88

Query  325  VRLGNEASIK-QTLNVSKGMYYSITFCAARTCAQEERLNITVAP  453
            VRLG  AS+K +  +V+KG +YS++F  ARTCAQEERLN++V+P
Sbjct  89   VRLGEGASLKTKVTSVTKGTFYSLSFVFARTCAQEERLNVSVSP  132


 Score = 48.9 bits (115),  Expect(2) = 1e-32, Method: Compositional matrix adjust.
 Identities = 19/38 (50%), Positives = 28/38 (74%), Gaps = 0/38 (0%)
 Frame = +2

Query  452  RDSDVLPIQTLYSINGWDCYPWAFQAENPQAEIIIHNP  565
            +D  +LP+QT+YS +GWD Y W F AE  + +I++HNP
Sbjct  137  KDWGMLPLQTMYSSDGWDTYSWGFLAEANEIDIVLHNP  174



>ref|XP_003581384.1| PREDICTED: uncharacterized protein LOC100823957 [Brachypodium 
distachyon]
Length=386

 Score =   120 bits (301),  Expect(2) = 1e-32, Method: Compositional matrix adjust.
 Identities = 57/104 (55%), Positives = 76/104 (73%), Gaps = 1/104 (1%)
 Frame = +1

Query  145  DGLLVNGNFEAPVKKTDLNGTIVTRHDAVPGWTVTGFVEYIQAGQKQGDMQLVVPEGFAA  324
            DG L+NGNFE    ++ ++G  V   DA+P W  TGFVEY++ G KQGDM L VPEG  A
Sbjct  30   DGPLLNGNFEDTPDRSQMDGLKVLGPDAIPYWKTTGFVEYVERGAKQGDMALTVPEGAHA  89

Query  325  VRLGNEASIKQTLNVSKGMYYSITFCAARTCAQ-EERLNITVAP  453
            VRLG ++SI+Q L+V+ G +Y+ITF AARTC Q +ERLN+++ P
Sbjct  90   VRLGIQSSIEQQLSVTPGRHYAITFSAARTCTQADERLNVSILP  133


 Score = 46.6 bits (109),  Expect(2) = 1e-32, Method: Compositional matrix adjust.
 Identities = 18/32 (56%), Positives = 25/32 (78%), Gaps = 0/32 (0%)
 Frame = +2

Query  467  LPIQTLYSINGWDCYPWAFQAENPQAEIIIHN  562
            LPIQT+YS NGWD Y WAF+A++    ++IH+
Sbjct  141  LPIQTIYSHNGWDSYAWAFKAKHGLVTLVIHH  172



>ref|XP_010088264.1| hypothetical protein L484_005140 [Morus notabilis]
 gb|EXB33248.1| hypothetical protein L484_005140 [Morus notabilis]
Length=378

 Score =   130 bits (328),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 66/124 (53%), Positives = 87/124 (70%), Gaps = 9/124 (7%)
 Frame = +1

Query  145  DGLLVNGNFEAPVKKTDLNGTIVTRHDAVPGWTVTGFVEYIQAGQKQGDMQLVVPEGFAA  324
            +GLL NGNFE   K +++ GT+V    A+P W ++G VEYI++G  QGDM LVVPEG  A
Sbjct  26   NGLLPNGNFEYGPKPSEMKGTLVLNRKAIPNWEISGEVEYIKSGHTQGDMLLVVPEGAFA  85

Query  325  VRLGNEASIKQTLNVSKGMYYSITFCAARTCAQEERLNITVAPGLRRAAHPNAVQYQRLG  504
            VRLGNEASIKQ + + K  +YS+TF AARTCAQEE+LN++V+    R+  PN       G
Sbjct  86   VRLGNEASIKQKVRMIKDGFYSLTFSAARTCAQEEKLNVSVS----RSLEPN-----DWG  136

Query  505  LLPV  516
            +LP+
Sbjct  137  ILPM  140


 Score = 57.4 bits (137),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 23/36 (64%), Positives = 29/36 (81%), Gaps = 0/36 (0%)
 Frame = +2

Query  464  VLPIQTLYSINGWDCYPWAFQAENPQAEIIIHNPGV  571
            +LP+QT+YS NGWD Y + F+A+  Q EIIIHNPGV
Sbjct  137  ILPMQTMYSSNGWDSYSYGFKADASQIEIIIHNPGV  172



>ref|XP_004241713.1| PREDICTED: uncharacterized protein LOC101268115 [Solanum lycopersicum]
Length=372

 Score =   130 bits (328),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 64/124 (52%), Positives = 86/124 (69%), Gaps = 9/124 (7%)
 Frame = +1

Query  145  DGLLVNGNFEAPVKKTDLNGTIVTRHDAVPGWTVTGFVEYIQAGQKQGDMQLVVPEGFAA  324
            DGLL NGNFE   K + + GT V    A+P W ++G+VEYI++GQ QGDM L VP+G  A
Sbjct  23   DGLLSNGNFELGPKPSQMKGTKVVDRHAIPNWEISGYVEYIKSGQTQGDMLLPVPQGDYA  82

Query  325  VRLGNEASIKQTLNVSKGMYYSITFCAARTCAQEERLNITVAPGLRRAAHPNAVQYQRLG  504
            VRLG +ASIK  + V+KG++YSI+F  ARTCAQEE+LN++V+P     + PN       G
Sbjct  83   VRLGEDASIKTKVKVTKGIFYSISFVFARTCAQEEKLNVSVSPN----SEPN-----DWG  133

Query  505  LLPV  516
            +LP+
Sbjct  134  MLPL  137


 Score = 51.2 bits (121),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 20/36 (56%), Positives = 26/36 (72%), Gaps = 0/36 (0%)
 Frame = +2

Query  464  VLPIQTLYSINGWDCYPWAFQAENPQAEIIIHNPGV  571
            +LP+QT+YS  GWD Y W F AE  + +I+IHNP V
Sbjct  134  MLPLQTMYSSEGWDSYSWGFLAEADEIDIVIHNPAV  169



>dbj|BAJ94417.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=380

 Score =   124 bits (310),  Expect(2) = 2e-32, Method: Compositional matrix adjust.
 Identities = 57/104 (55%), Positives = 75/104 (72%), Gaps = 0/104 (0%)
 Frame = +1

Query  145  DGLLVNGNFEAPVKKTDLNGTIVTRHDAVPGWTVTGFVEYIQAGQKQGDMQLVVPEGFAA  324
            DG L NG+FE    ++ ++G++VT  +A+P W  TG VEYI++GQK+GDM L VPEG  A
Sbjct  24   DGPLPNGHFEDTPDRSQMDGSVVTGENAIPQWKTTGHVEYIESGQKEGDMILTVPEGSHA  83

Query  325  VRLGNEASIKQTLNVSKGMYYSITFCAARTCAQEERLNITVAPG  456
            VRLG + SI Q L V+ G  YS+TF AARTCAQ E+L ++V PG
Sbjct  84   VRLGEDGSIHQQLYVTPGAQYSVTFSAARTCAQYEKLTVSVVPG  127


 Score = 42.0 bits (97),  Expect(2) = 2e-32, Method: Compositional matrix adjust.
 Identities = 18/36 (50%), Positives = 24/36 (67%), Gaps = 0/36 (0%)
 Frame = +2

Query  458  SDVLPIQTLYSINGWDCYPWAFQAENPQAEIIIHNP  565
            SD + IQT+Y+ +GWD Y WAF A +    + IHNP
Sbjct  130  SDEISIQTVYTSSGWDSYCWAFLATDGVMTLTIHNP  165



>dbj|BAJ97095.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=365

 Score =   122 bits (307),  Expect(2) = 2e-32, Method: Compositional matrix adjust.
 Identities = 57/103 (55%), Positives = 75/103 (73%), Gaps = 0/103 (0%)
 Frame = +1

Query  145  DGLLVNGNFEAPVKKTDLNGTIVTRHDAVPGWTVTGFVEYIQAGQKQGDMQLVVPEGFAA  324
            DGLL NG+F     K+ +NG +VT   A+P W ++GFVEYI++G  Q DM L VP G  A
Sbjct  27   DGLLPNGDFRNGPDKSQMNGPVVTGKHAIPNWELSGFVEYIESGHTQEDMILPVPVGANA  86

Query  325  VRLGNEASIKQTLNVSKGMYYSITFCAARTCAQEERLNITVAP  453
            VRLGN+A+I+Q L VS+  YYSI+F AAR+CAQ E+LN++V P
Sbjct  87   VRLGNDATIRQQLKVSRHTYYSISFIAARSCAQAEKLNVSVDP  129


 Score = 43.1 bits (100),  Expect(2) = 2e-32, Method: Compositional matrix adjust.
 Identities = 18/36 (50%), Positives = 24/36 (67%), Gaps = 0/36 (0%)
 Frame = +2

Query  464  VLPIQTLYSINGWDCYPWAFQAENPQAEIIIHNPGV  571
            VLPIQT+Y+  GWD Y WAF+  +    + IHN G+
Sbjct  133  VLPIQTVYTNTGWDTYSWAFKPRHSTVWLSIHNTGI  168



>ref|XP_008363312.1| PREDICTED: uncharacterized protein LOC103427013 [Malus domestica]
Length=367

 Score =   117 bits (294),  Expect(2) = 4e-32, Method: Compositional matrix adjust.
 Identities = 55/103 (53%), Positives = 69/103 (67%), Gaps = 0/103 (0%)
 Frame = +1

Query  145  DGLLVNGNFEAPVKKTDLNGTIVTRHDAVPGWTVTGFVEYIQAGQKQGDMQLVVPEGFAA  324
            DGLL NGNFE P K TDL  T++   +++P W + G VEYI AG + G M   V  G  A
Sbjct  30   DGLLANGNFEEPPKPTDLKKTVIIGKNSLPKWEIDGLVEYISAGPQPGGMYFDVAHGVHA  89

Query  325  VRLGNEASIKQTLNVSKGMYYSITFCAARTCAQEERLNITVAP  453
            VRLGN+ASI QT+ V  G  Y++TF A+RTCAQEE L ++V P
Sbjct  90   VRLGNDASISQTIKVKLGSLYALTFGASRTCAQEEVLRVSVPP  132


 Score = 47.4 bits (111),  Expect(2) = 4e-32, Method: Compositional matrix adjust.
 Identities = 18/35 (51%), Positives = 24/35 (69%), Gaps = 0/35 (0%)
 Frame = +2

Query  467  LPIQTLYSINGWDCYPWAFQAENPQAEIIIHNPGV  571
            LP+QTLYS NG D Y W F+A +   ++  HNPG+
Sbjct  137  LPLQTLYSSNGGDTYAWGFRATSETVKVTFHNPGI  171



>ref|XP_006356190.1| PREDICTED: uncharacterized protein LOC102589576 [Solanum tuberosum]
Length=371

 Score =   129 bits (324),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 63/124 (51%), Positives = 86/124 (69%), Gaps = 9/124 (7%)
 Frame = +1

Query  145  DGLLVNGNFEAPVKKTDLNGTIVTRHDAVPGWTVTGFVEYIQAGQKQGDMQLVVPEGFAA  324
            DGLL NGNFE   K + + GT V    A+P W ++G+VEYI++GQ QGDM L VP+G  A
Sbjct  22   DGLLSNGNFELGPKPSQMKGTKVVDRHAIPNWEISGYVEYIKSGQTQGDMLLPVPQGDYA  81

Query  325  VRLGNEASIKQTLNVSKGMYYSITFCAARTCAQEERLNITVAPGLRRAAHPNAVQYQRLG  504
            VRLG +ASIK  + ++KG++YSI+F  ARTCAQEE+LN++V+P     + PN       G
Sbjct  82   VRLGEDASIKTKVKLTKGVFYSISFVFARTCAQEEKLNVSVSPN----SEPN-----DWG  132

Query  505  LLPV  516
            +LP+
Sbjct  133  ILPL  136


 Score = 51.6 bits (122),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 20/36 (56%), Positives = 26/36 (72%), Gaps = 0/36 (0%)
 Frame = +2

Query  464  VLPIQTLYSINGWDCYPWAFQAENPQAEIIIHNPGV  571
            +LP+QT+YS  GWD Y W F AE  + +I+IHNP V
Sbjct  133  ILPLQTMYSSEGWDSYSWGFLAEADEIDIVIHNPAV  168



>ref|XP_008375195.1| PREDICTED: uncharacterized protein LOC103438421 [Malus domestica]
Length=367

 Score =   116 bits (290),  Expect(2) = 8e-32, Method: Compositional matrix adjust.
 Identities = 57/103 (55%), Positives = 66/103 (64%), Gaps = 0/103 (0%)
 Frame = +1

Query  145  DGLLVNGNFEAPVKKTDLNGTIVTRHDAVPGWTVTGFVEYIQAGQKQGDMQLVVPEGFAA  324
            DGLL NGNFE P K T L  T++    A+P W + G VEYI AG + G M   V  G  A
Sbjct  30   DGLLANGNFEEPPKPTSLKKTVLVGKYALPKWEINGLVEYISAGPQPGGMYFHVAHGVHA  89

Query  325  VRLGNEASIKQTLNVSKGMYYSITFCAARTCAQEERLNITVAP  453
            VRLGNEASI QTL V  G  Y++TF A+RTCAQEE L + V P
Sbjct  90   VRLGNEASISQTLKVKPGSLYALTFGASRTCAQEEVLRVLVPP  132


 Score = 47.4 bits (111),  Expect(2) = 8e-32, Method: Compositional matrix adjust.
 Identities = 19/35 (54%), Positives = 24/35 (69%), Gaps = 0/35 (0%)
 Frame = +2

Query  467  LPIQTLYSINGWDCYPWAFQAENPQAEIIIHNPGV  571
            LP+QTLYS NG D Y W F+A +   ++  HNPGV
Sbjct  137  LPMQTLYSSNGGDTYAWGFRATSETVKVTFHNPGV  171



>ref|XP_004307221.1| PREDICTED: uncharacterized protein LOC101292742 [Fragaria vesca 
subsp. vesca]
Length=368

 Score =   116 bits (291),  Expect(2) = 9e-32, Method: Compositional matrix adjust.
 Identities = 54/103 (52%), Positives = 68/103 (66%), Gaps = 0/103 (0%)
 Frame = +1

Query  145  DGLLVNGNFEAPVKKTDLNGTIVTRHDAVPGWTVTGFVEYIQAGQKQGDMQLVVPEGFAA  324
            +GLL NGNFE P K + L  T++   +A+P W + GFVEYI  G + G M   V  G  A
Sbjct  29   EGLLANGNFEEPPKPSSLKKTVLIGKNALPKWEINGFVEYISGGPQPGGMYFAVAHGVHA  88

Query  325  VRLGNEASIKQTLNVSKGMYYSITFCAARTCAQEERLNITVAP  453
            VRLGNEASI QT+ V  G  Y++TF A+RTCAQEE L ++V P
Sbjct  89   VRLGNEASISQTIKVKPGSLYALTFGASRTCAQEEVLRVSVPP  131


 Score = 47.0 bits (110),  Expect(2) = 9e-32, Method: Compositional matrix adjust.
 Identities = 18/35 (51%), Positives = 24/35 (69%), Gaps = 0/35 (0%)
 Frame = +2

Query  467  LPIQTLYSINGWDCYPWAFQAENPQAEIIIHNPGV  571
            LP+QTLYS NG D Y W F+A +   ++  HNPG+
Sbjct  136  LPLQTLYSSNGGDTYAWGFKATSNTVKVTFHNPGI  170



>ref|XP_008364711.1| PREDICTED: uncharacterized protein LOC103428382 [Malus domestica]
Length=367

 Score =   116 bits (290),  Expect(2) = 9e-32, Method: Compositional matrix adjust.
 Identities = 57/103 (55%), Positives = 66/103 (64%), Gaps = 0/103 (0%)
 Frame = +1

Query  145  DGLLVNGNFEAPVKKTDLNGTIVTRHDAVPGWTVTGFVEYIQAGQKQGDMQLVVPEGFAA  324
            DGLL NGNFE P K T L  T++    A+P W + G VEYI AG + G M   V  G  A
Sbjct  30   DGLLANGNFEEPPKPTSLKKTVLVGKYALPKWEINGLVEYISAGPQPGGMYFHVAHGVHA  89

Query  325  VRLGNEASIKQTLNVSKGMYYSITFCAARTCAQEERLNITVAP  453
            VRLGNEASI QTL V  G  Y++TF A+RTCAQEE L + V P
Sbjct  90   VRLGNEASISQTLKVKPGSLYALTFGASRTCAQEEVLRVLVPP  132


 Score = 47.4 bits (111),  Expect(2) = 9e-32, Method: Compositional matrix adjust.
 Identities = 19/35 (54%), Positives = 24/35 (69%), Gaps = 0/35 (0%)
 Frame = +2

Query  467  LPIQTLYSINGWDCYPWAFQAENPQAEIIIHNPGV  571
            LP+QTLYS NG D Y W F+A +   ++  HNPGV
Sbjct  137  LPMQTLYSSNGGDTYAWGFRATSETVKVTFHNPGV  171



>ref|XP_008669230.1| PREDICTED: uncharacterized protein LOC103646278 [Zea mays]
 tpg|DAA37153.1| TPA: hypothetical protein ZEAMMB73_847781 [Zea mays]
Length=397

 Score =   124 bits (310),  Expect(2) = 1e-31, Method: Compositional matrix adjust.
 Identities = 55/103 (53%), Positives = 79/103 (77%), Gaps = 0/103 (0%)
 Frame = +1

Query  145  DGLLVNGNFEAPVKKTDLNGTIVTRHDAVPGWTVTGFVEYIQAGQKQGDMQLVVPEGFAA  324
            DG L+NGNFE P  ++ ++G++VT   AV  W  +G +E+I +GQKQGDM L VP+G  A
Sbjct  33   DGPLLNGNFEDPPNQSQMSGSVVTGEHAVSYWKTSGHIEFICSGQKQGDMVLTVPDGSHA  92

Query  325  VRLGNEASIKQTLNVSKGMYYSITFCAARTCAQEERLNITVAP  453
            +RLG+ ASI+Q ++++KG+YYS+TF A+RTC+Q E LN+T AP
Sbjct  93   LRLGSGASIQQQISLTKGLYYSLTFSASRTCSQNEMLNVTAAP  135


 Score = 38.9 bits (89),  Expect(2) = 1e-31, Method: Compositional matrix adjust.
 Identities = 18/35 (51%), Positives = 23/35 (66%), Gaps = 1/35 (3%)
 Frame = +2

Query  467  LPIQTLYSINGWDCYPWAFQAENPQAEI-IIHNPG  568
            LP QT+Y+ +GWD Y WAF+AE     I + HN G
Sbjct  146  LPTQTVYTSSGWDSYSWAFRAEAGLMSITVTHNCG  180



>ref|XP_007218160.1| hypothetical protein PRUPE_ppa007461mg [Prunus persica]
 gb|EMJ19359.1| hypothetical protein PRUPE_ppa007461mg [Prunus persica]
Length=367

 Score =   116 bits (290),  Expect(2) = 2e-31, Method: Compositional matrix adjust.
 Identities = 56/103 (54%), Positives = 68/103 (66%), Gaps = 0/103 (0%)
 Frame = +1

Query  145  DGLLVNGNFEAPVKKTDLNGTIVTRHDAVPGWTVTGFVEYIQAGQKQGDMQLVVPEGFAA  324
            DGLL NGNFE P K T+L  T++    A+P W + GFVEYI  G + G M   V  G  A
Sbjct  28   DGLLNNGNFEEPPKPTNLKKTVLIGKYALPKWEINGFVEYISGGPQPGGMYFSVAHGVHA  87

Query  325  VRLGNEASIKQTLNVSKGMYYSITFCAARTCAQEERLNITVAP  453
            VRLGNEASI QT+ V  G  Y++TF A+RTCAQEE L ++V P
Sbjct  88   VRLGNEASISQTIKVKPGSLYALTFGASRTCAQEEVLRVSVPP  130


 Score = 46.2 bits (108),  Expect(2) = 2e-31, Method: Compositional matrix adjust.
 Identities = 19/35 (54%), Positives = 24/35 (69%), Gaps = 0/35 (0%)
 Frame = +2

Query  467  LPIQTLYSINGWDCYPWAFQAENPQAEIIIHNPGV  571
            LP+QTLYS NG D Y W F+A +   ++  HNPGV
Sbjct  135  LPLQTLYSSNGGDTYAWGFRATSNVVKVTFHNPGV  169



>gb|EEE56530.1| hypothetical protein OsJ_05823 [Oryza sativa Japonica Group]
Length=379

 Score =   118 bits (295),  Expect(2) = 2e-31, Method: Compositional matrix adjust.
 Identities = 62/104 (60%), Positives = 75/104 (72%), Gaps = 1/104 (1%)
 Frame = +1

Query  142  TDGLLVNGNFEAPVKKTDLNGTIVTRHDAVPGWTVTGFVEYIQAGQKQGDMQLVVPEGFA  321
            TDGLL NGNFE     + L GT V    A+P W  +GFVEYI +G+KQGDM LVVPEG  
Sbjct  28   TDGLLANGNFERGPAPSQLRGTRVVGASAIPSWRTSGFVEYIPSGRKQGDMVLVVPEGSH  87

Query  322  AVRLGNEASIKQTL-NVSKGMYYSITFCAARTCAQEERLNITVA  450
            AVRLGNEASI+Q L   ++G  Y++TF AARTCAQ ERLN++ +
Sbjct  88   AVRLGNEASIRQRLAGAARGARYALTFSAARTCAQAERLNVSAS  131


 Score = 44.3 bits (103),  Expect(2) = 2e-31, Method: Compositional matrix adjust.
 Identities = 21/36 (58%), Positives = 27/36 (75%), Gaps = 0/36 (0%)
 Frame = +2

Query  464  VLPIQTLYSINGWDCYPWAFQAENPQAEIIIHNPGV  571
            VLP+QT+YS NGWD Y WA+ A     +++IHNPGV
Sbjct  136  VLPMQTMYSSNGWDSYAWAWDAAADAFDVVIHNPGV  171



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 669314531515