BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFF037J06

Length=570
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_011075896.1|  PREDICTED: subtilisin-like protease SBT3.5         225   2e-65   Sesamum indicum [beniseed]
ref|XP_007210025.1|  hypothetical protein PRUPE_ppa018629mg             220   1e-63   Prunus persica
ref|XP_007210725.1|  hypothetical protein PRUPE_ppa022363mg             218   7e-63   Prunus persica
ref|XP_008239249.1|  PREDICTED: subtilisin-like protease                217   2e-62   Prunus mume [ume]
emb|CAN80173.1|  hypothetical protein VITISV_018392                     217   4e-62   Vitis vinifera
ref|XP_007039330.1|  Subtilase family protein, putative                 216   2e-61   
ref|XP_002273195.2|  PREDICTED: subtilisin-like protease SBT3.5         213   5e-61   Vitis vinifera
ref|XP_010318061.1|  PREDICTED: subtilisin-like protease SBT3.3 i...    212   1e-60   Solanum lycopersicum
ref|XP_010318060.1|  PREDICTED: subtilisin-like protease SBT3.3 i...    212   1e-60   Solanum lycopersicum
ref|XP_007039203.1|  Subtilase family protein, putative                 211   2e-60   
ref|XP_003634152.2|  PREDICTED: subtilisin-like protease SBT3.5         210   6e-60   Vitis vinifera
ref|XP_002317663.1|  subtilase family protein                           210   6e-60   Populus trichocarpa [western balsam poplar]
ref|XP_002518937.1|  Cucumisin precursor, putative                      210   7e-60   Ricinus communis
ref|XP_006287119.1|  hypothetical protein CARUB_v10000289mg             210   7e-60   
ref|XP_010661922.1|  PREDICTED: LOW QUALITY PROTEIN: subtilisin-l...    213   9e-60   
ref|XP_011470878.1|  PREDICTED: uncharacterized protein LOC101314621    213   1e-59   Fragaria vesca subsp. vesca
ref|XP_003634153.1|  PREDICTED: subtilisin-like protease SBT3.5         209   1e-59   Vitis vinifera
emb|CBI34614.3|  unnamed protein product                                213   1e-59   Vitis vinifera
ref|XP_011040610.1|  PREDICTED: subtilisin-like protease SBT3.3         209   2e-59   Populus euphratica
gb|KJB52411.1|  hypothetical protein B456_008G260500                    208   3e-59   Gossypium raimondii
emb|CBI23085.3|  unnamed protein product                                211   5e-59   Vitis vinifera
ref|XP_011038008.1|  PREDICTED: subtilisin-like protease SBT3.5 i...    207   6e-59   Populus euphratica
emb|CBI23086.3|  unnamed protein product                                206   3e-58   Vitis vinifera
ref|XP_006306822.1|  hypothetical protein CARUB_v10008364mg             205   5e-58   Capsella rubella
ref|XP_002872522.1|  subtilase family protein                           204   7e-58   
gb|KFK31853.1|  hypothetical protein AALP_AA6G166900                    204   1e-57   Arabis alpina [alpine rockcress]
gb|KFK45040.1|  hypothetical protein AALP_AA1G336300                    203   2e-57   Arabis alpina [alpine rockcress]
ref|NP_567360.1|  Subtilase family protein                              202   3e-57   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010421967.1|  PREDICTED: subtilisin-like protease SBT3.3         201   8e-57   Camelina sativa [gold-of-pleasure]
ref|XP_010461117.1|  PREDICTED: LOW QUALITY PROTEIN: subtilisin-l...    201   1e-56   Camelina sativa [gold-of-pleasure]
ref|XP_009128704.1|  PREDICTED: subtilisin-like protease SBT5.3 i...    201   2e-56   Brassica rapa
emb|CDY67954.1|  BnaAnng25710D                                          200   2e-56   Brassica napus [oilseed rape]
ref|XP_002891022.1|  subtilase family protein                           200   2e-56   Arabidopsis lyrata subsp. lyrata
ref|XP_011081355.1|  PREDICTED: subtilisin-like protease SBT3.5 i...    200   2e-56   Sesamum indicum [beniseed]
ref|XP_011081356.1|  PREDICTED: subtilisin-like protease SBT3.5 i...    200   3e-56   Sesamum indicum [beniseed]
ref|XP_006287107.1|  hypothetical protein CARUB_v10000269mg             200   3e-56   
ref|XP_010318062.1|  PREDICTED: subtilisin-like protease SBT3.3 i...    199   3e-56   Solanum lycopersicum
ref|XP_010455451.1|  PREDICTED: subtilisin-like protease SBT3.5         202   5e-56   
ref|XP_010056036.1|  PREDICTED: subtilisin-like protease SBT5.3         199   7e-56   Eucalyptus grandis [rose gum]
gb|AAD03431.1|  similar to the subtilase family of serine proteas...    198   8e-56   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010056037.1|  PREDICTED: subtilisin-like protease SBT5.3         198   9e-56   Eucalyptus grandis [rose gum]
ref|XP_009128710.1|  PREDICTED: subtilisin-like protease SBT5.3         198   1e-55   Brassica rapa
ref|NP_567362.1|  subtilisin-like protease                              198   1e-55   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006397045.1|  hypothetical protein EUTSA_v10028448mg             198   1e-55   Eutrema salsugineum [saltwater cress]
ref|XP_011470880.1|  PREDICTED: subtilisin-like protease SBT3.3         198   1e-55   Fragaria vesca subsp. vesca
gb|EYU19440.1|  hypothetical protein MIMGU_mgv1a001654mg                197   2e-55   Erythranthe guttata [common monkey flower]
ref|NP_001190697.1|  subtilisin-like protease                           197   2e-55   Arabidopsis thaliana [mouse-ear cress]
emb|CDX94251.1|  BnaC02g29110D                                          197   2e-55   
ref|NP_567359.1|  Subtilase family protein                              197   3e-55   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006286455.1|  hypothetical protein CARUB_v10000290mg             194   3e-55   
ref|NP_564414.2|  Subtilase family protein SBT3.3                       197   3e-55   Arabidopsis thaliana [mouse-ear cress]
emb|CDX93811.1|  BnaA09g24110D                                          196   5e-55   
ref|XP_011038011.1|  PREDICTED: subtilisin-like protease SBT3.5         196   5e-55   Populus euphratica
emb|CBI23066.3|  unnamed protein product                                196   6e-55   Vitis vinifera
ref|XP_009114847.1|  PREDICTED: subtilisin-like protease SBT5.3         196   6e-55   Brassica rapa
ref|XP_010436935.1|  PREDICTED: subtilisin-like protease SBT3.3         196   7e-55   Camelina sativa [gold-of-pleasure]
ref|XP_010451309.1|  PREDICTED: subtilisin-like protease SBT3.3         185   9e-55   Camelina sativa [gold-of-pleasure]
ref|XP_010437005.1|  PREDICTED: subtilisin-like protease SBT3.3 i...    195   1e-54   Camelina sativa [gold-of-pleasure]
ref|XP_007039327.1|  Subtilase family protein, putative isoform 1       196   1e-54   
ref|XP_002891021.1|  predicted protein                                  195   1e-54   Arabidopsis lyrata subsp. lyrata
gb|KFK45042.1|  hypothetical protein AALP_AA1G336600                    195   1e-54   Arabis alpina [alpine rockcress]
gb|KCW72614.1|  hypothetical protein EUGRSUZ_E01074                     195   1e-54   Eucalyptus grandis [rose gum]
emb|CDY25259.1|  BnaA02g21970D                                          195   1e-54   Brassica napus [oilseed rape]
ref|XP_006286454.1|  hypothetical protein CARUB_v10000290mg             195   1e-54   Capsella rubella
emb|CDY54842.1|  BnaC05g51310D                                          198   2e-54   Brassica napus [oilseed rape]
ref|XP_009344068.1|  PREDICTED: subtilisin-like protease SBT5.3         195   2e-54   
ref|XP_002298973.2|  subtilase family protein                           195   2e-54   
ref|XP_002874635.1|  subtilase family protein                           195   2e-54   
ref|XP_010421966.1|  PREDICTED: subtilisin-like protease SBT3.3         194   2e-54   Camelina sativa [gold-of-pleasure]
ref|XP_006397048.1|  hypothetical protein EUTSA_v10028454mg             194   2e-54   Eutrema salsugineum [saltwater cress]
ref|XP_002874634.1|  subtilase family protein                           194   2e-54   
ref|XP_006351094.1|  PREDICTED: cucumisin-like                          194   3e-54   Solanum tuberosum [potatoes]
gb|KJB74658.1|  hypothetical protein B456_012G000900                    194   4e-54   Gossypium raimondii
ref|XP_010499843.1|  PREDICTED: LOW QUALITY PROTEIN: subtilisin-l...    196   5e-54   
ref|XP_002891020.1|  subtilase family protein                           193   6e-54   
ref|XP_006289363.1|  hypothetical protein CARUB_v10002849mg             193   7e-54   
gb|KFK31852.1|  hypothetical protein AALP_AA6G166800                    196   1e-53   Arabis alpina [alpine rockcress]
gb|KCW72613.1|  hypothetical protein EUGRSUZ_E01073                     196   1e-53   Eucalyptus grandis [rose gum]
ref|XP_010455450.1|  PREDICTED: subtilisin-like protease SBT3.3         192   1e-53   Camelina sativa [gold-of-pleasure]
gb|AAD03430.1|  similar to the subtilase family of serine proteas...    192   1e-53   Arabidopsis thaliana [mouse-ear cress]
ref|NP_564413.2|  subtilase family protein                              192   1e-53   Arabidopsis thaliana [mouse-ear cress]
gb|AAF31277.1|AC006424_6  Second of four adjacent putative subtil...    192   1e-53   Arabidopsis thaliana [mouse-ear cress]
ref|NP_567361.1|  Subtilase family protein                              192   2e-53   Arabidopsis thaliana [mouse-ear cress]
ref|NP_564412.1|  Subtilase 3.5                                         191   4e-53   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006358675.1|  PREDICTED: xylem serine proteinase 1-like          193   5e-53   
ref|XP_009114844.1|  PREDICTED: subtilisin-like protease SBT5.3         191   6e-53   Brassica rapa
ref|XP_007039328.1|  Subtilase family protein, putative isoform 2       190   7e-53   
ref|XP_006286616.1|  hypothetical protein CARUB_v10002407mg             190   8e-53   
ref|XP_010542096.1|  PREDICTED: LOW QUALITY PROTEIN: subtilisin-l...    190   1e-52   
ref|XP_010919043.1|  PREDICTED: subtilisin-like protease SBT3.3 i...    188   4e-52   
ref|XP_010919042.1|  PREDICTED: subtilisin-like protease SBT3.3 i...    188   4e-52   Elaeis guineensis
ref|XP_006415136.1|  hypothetical protein EUTSA_v10006855mg             188   4e-52   Eutrema salsugineum [saltwater cress]
ref|XP_010470495.1|  PREDICTED: subtilisin-like protease SBT3.5 i...    187   5e-52   Camelina sativa [gold-of-pleasure]
ref|XP_002278450.2|  PREDICTED: subtilisin-like protease SBT3.3         187   1e-51   Vitis vinifera
gb|ABE66081.1|  subtilase family protein                                179   1e-51   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010470055.1|  PREDICTED: subtilisin-like protease SBT3.3         186   2e-51   
ref|XP_010421968.1|  PREDICTED: subtilisin-like protease SBT3.3         186   2e-51   Camelina sativa [gold-of-pleasure]
gb|KFK25462.1|  hypothetical protein AALP_AA8G118000                    183   2e-51   Arabis alpina [alpine rockcress]
ref|XP_010551747.1|  PREDICTED: subtilisin-like protease SBT3.5         186   2e-51   Tarenaya hassleriana [spider flower]
ref|XP_010920365.1|  PREDICTED: subtilisin-like protease SBT3.5         186   3e-51   
ref|XP_002872521.1|  predicted protein                                  185   3e-51   Arabidopsis lyrata subsp. lyrata
ref|XP_006286458.1|  hypothetical protein CARUB_v10000288mg             185   4e-51   Capsella rubella
ref|NP_567633.2|  Subtilase family protein                              185   4e-51   Arabidopsis thaliana [mouse-ear cress]
ref|XP_011040612.1|  PREDICTED: subtilisin-like protease SBT3.5         185   4e-51   Populus euphratica
ref|XP_004146562.1|  PREDICTED: subtilisin-like protease-like           185   4e-51   Cucumis sativus [cucumbers]
ref|NP_568255.1|  Subtilase family protein                              184   7e-51   Arabidopsis thaliana [mouse-ear cress]
emb|CAH66109.1|  OSIGBa0115D20.2                                        177   9e-51   Oryza sativa [red rice]
ref|XP_004978766.1|  PREDICTED: subtilisin-like protease-like           184   9e-51   Setaria italica
emb|CAB40021.1|  subtilisin-like protease-like protein                  184   9e-51   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009114845.1|  PREDICTED: subtilisin-like protease SBT5.3         184   1e-50   Brassica rapa
ref|XP_006289915.1|  hypothetical protein CARUB_v10003531mg             184   1e-50   
ref|XP_011012404.1|  PREDICTED: subtilisin-like protease SBT3.5         184   1e-50   Populus euphratica
ref|XP_011038012.1|  PREDICTED: subtilisin-like protease SBT3.5         184   1e-50   Populus euphratica
ref|XP_002518939.1|  Cucumisin precursor, putative                      184   1e-50   
emb|CAH66112.1|  OSIGBa0115D20.5                                        177   1e-50   Oryza sativa [red rice]
ref|XP_006413752.1|  hypothetical protein EUTSA_v10027359mg             183   1e-50   
ref|XP_002888489.1|  subtilase family protein                           184   1e-50   
ref|XP_009348696.1|  PREDICTED: subtilisin-like protease SBT5.4         183   2e-50   
ref|XP_010437025.1|  PREDICTED: subtilisin-like protease SBT3.5         183   2e-50   Camelina sativa [gold-of-pleasure]
ref|XP_006306827.1|  hypothetical protein CARUB_v10008369mg             183   2e-50   
ref|XP_010554964.1|  PREDICTED: subtilisin-like protease SBT3.3         183   2e-50   
ref|XP_006662913.1|  PREDICTED: cucumisin-like                          183   2e-50   Oryza brachyantha
ref|XP_010436973.1|  PREDICTED: subtilisin-like protease SBT3.3 i...    183   2e-50   Camelina sativa [gold-of-pleasure]
ref|XP_002871506.1|  subtilase family protein                           183   3e-50   Arabidopsis lyrata subsp. lyrata
ref|XP_008775642.1|  PREDICTED: subtilisin-like protease SBT5.3         182   4e-50   
ref|XP_010529677.1|  PREDICTED: subtilisin-like protease SBT3.3         182   4e-50   Tarenaya hassleriana [spider flower]
ref|NP_564868.2|  Subtilisin-like serine endopeptidase family pro...    182   5e-50   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006301525.1|  hypothetical protein CARUB_v10021953mg             182   5e-50   Capsella rubella
gb|AAG51763.1|AC066691_3  hypothetical protein; 8963-6048               182   6e-50   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010931718.1|  PREDICTED: subtilisin-like protease SBT3.5         181   8e-50   
ref|XP_010511549.1|  PREDICTED: subtilisin-like protease SBT3.5 i...    181   8e-50   Camelina sativa [gold-of-pleasure]
gb|KFK41045.1|  hypothetical protein AALP_AA2G078300                    181   1e-49   Arabis alpina [alpine rockcress]
ref|XP_010480961.1|  PREDICTED: subtilisin-like protease SBT3.5         181   1e-49   
ref|NP_567358.1|  Subtilase family protein                              181   1e-49   Arabidopsis thaliana [mouse-ear cress]
gb|AAD03438.1|  similar to the subtilase family of serine proteas...    181   2e-49   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006306820.1|  hypothetical protein CARUB_v10008362mg             181   2e-49   Capsella rubella
ref|XP_006399712.1|  hypothetical protein EUTSA_v10012766mg             181   2e-49   Eutrema salsugineum [saltwater cress]
gb|EEC67681.1|  hypothetical protein OsI_35120                          181   2e-49   Oryza sativa Indica Group [Indian rice]
emb|CAE01679.2|  OSJNBb0089K24.4                                        181   2e-49   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010461118.1|  PREDICTED: subtilisin-like protease SBT3.5         181   2e-49   Camelina sativa [gold-of-pleasure]
ref|XP_002867836.1|  subtilase family protein                           180   2e-49   
ref|XP_010463200.1|  PREDICTED: subtilisin-like protease SBT3.5         180   2e-49   
ref|XP_006415135.1|  hypothetical protein EUTSA_v10006863mg             180   3e-49   Eutrema salsugineum [saltwater cress]
emb|CAH66111.1|  OSIGBa0115D20.4                                        180   3e-49   Oryza sativa [red rice]
gb|EEC68285.1|  hypothetical protein OsI_36335                          180   3e-49   Oryza sativa Indica Group [Indian rice]
gb|EMS63596.1|  Cucumisin                                               180   3e-49   Triticum urartu
ref|XP_009135013.1|  PREDICTED: subtilisin-like protease SBT5.3         180   3e-49   Brassica rapa
gb|EMT17675.1|  Subtilisin-like protease                                179   4e-49   
ref|XP_010478712.1|  PREDICTED: subtilisin-like protease SBT3.5 i...    179   4e-49   Camelina sativa [gold-of-pleasure]
ref|XP_010499844.1|  PREDICTED: subtilisin-like protease SBT3.5 i...    179   6e-49   
ref|NP_193895.2|  Subtilase family protein                              179   7e-49   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010445228.1|  PREDICTED: subtilisin-like protease SBT3.3         180   7e-49   
ref|XP_006653124.1|  PREDICTED: subtilisin-like protease-like           179   8e-49   Oryza brachyantha
ref|XP_004951230.1|  PREDICTED: subtilisin-like protease-like           179   8e-49   Setaria italica
gb|KFK45041.1|  hypothetical protein AALP_AA1G336500                    178   8e-49   Arabis alpina [alpine rockcress]
ref|XP_002298975.2|  hypothetical protein POPTR_0001s45490g             179   1e-48   
ref|XP_009132975.1|  PREDICTED: subtilisin-like protease SBT5.3         178   1e-48   Brassica rapa
ref|XP_002447443.1|  hypothetical protein SORBIDRAFT_06g001140          178   1e-48   
emb|CDX84657.1|  BnaA03g15730D                                          178   1e-48   
ref|XP_002317660.2|  hypothetical protein POPTR_0011s15400g             178   1e-48   
ref|XP_010263869.1|  PREDICTED: subtilisin-like protease SBT3.5         177   3e-48   Nelumbo nucifera [Indian lotus]
ref|NP_001044510.1|  Os01g0795400                                       172   3e-48   
ref|XP_006304869.1|  hypothetical protein CARUB_v10012621mg             177   4e-48   
emb|CDX79081.1|  BnaA01g11480D                                          177   4e-48   
emb|CBI34615.3|  unnamed protein product                                176   4e-48   Vitis vinifera
ref|XP_009391853.1|  PREDICTED: subtilisin-like protease SBT5.3         176   5e-48   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010529408.1|  PREDICTED: subtilisin-like protease SBT3.3 i...    176   6e-48   Tarenaya hassleriana [spider flower]
emb|CAE01678.2|  OSJNBb0089K24.3                                        176   8e-48   Oryza sativa Japonica Group [Japonica rice]
gb|EEE60418.1|  hypothetical protein OsJ_13612                          176   9e-48   Oryza sativa Japonica Group [Japonica rice]
gb|EEE63324.1|  hypothetical protein OsJ_18135                          174   9e-48   Oryza sativa Japonica Group [Japonica rice]
gb|KJB18900.1|  hypothetical protein B456_003G074100                    176   1e-47   Gossypium raimondii
ref|XP_010449025.1|  PREDICTED: subtilisin-like protease SBT3.3 i...    176   1e-47   
ref|XP_009420612.1|  PREDICTED: subtilisin-like protease SBT5.4         175   1e-47   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010491948.1|  PREDICTED: subtilisin-like protease SBT3.3         171   1e-47   
gb|EMS63058.1|  Subtilisin-like protease                                175   1e-47   Triticum urartu
ref|XP_010104913.1|  Subtilisin-like protease                           176   1e-47   
ref|XP_009137200.1|  PREDICTED: subtilisin-like protease SBT5.3         175   1e-47   Brassica rapa
ref|XP_006413792.1|  hypothetical protein EUTSA_v10024501mg             175   2e-47   Eutrema salsugineum [saltwater cress]
ref|XP_003581342.1|  PREDICTED: subtilisin-like protease SBT3.3         175   2e-47   
ref|NP_001046518.1|  Os02g0270200                                       172   2e-47   
ref|XP_008351708.1|  PREDICTED: cucumisin-like                          166   2e-47   
ref|XP_010470046.1|  PREDICTED: subtilisin-like protease SBT3.3         171   2e-47   
emb|CDX91186.1|  BnaC02g04110D                                          174   3e-47   
ref|XP_008804316.1|  PREDICTED: subtilisin-like protease SBT5.4         174   3e-47   Phoenix dactylifera
gb|KFK28745.1|  hypothetical protein AALP_AA7G041500                    174   4e-47   Arabis alpina [alpine rockcress]
ref|XP_006476262.1|  PREDICTED: subtilisin-like protease SDD1-like      174   5e-47   Citrus sinensis [apfelsine]
ref|XP_010028643.1|  PREDICTED: subtilisin-like protease SBT5.3         174   5e-47   Eucalyptus grandis [rose gum]
gb|KCW55411.1|  hypothetical protein EUGRSUZ_I01318                     174   6e-47   Eucalyptus grandis [rose gum]
ref|NP_001046517.1|  Os02g0269600                                       173   6e-47   
gb|AHJ61058.1|  Hwi2                                                    173   6e-47   Oryza sativa Indica Group [Indian rice]
gb|EAZ29545.1|  hypothetical protein OsJ_13620                          173   6e-47   Oryza sativa Japonica Group [Japonica rice]
ref|XP_009137202.1|  PREDICTED: subtilisin-like protease SBT5.3         174   6e-47   Brassica rapa
ref|XP_009125836.1|  PREDICTED: subtilisin-like protease SBT5.4         173   6e-47   Brassica rapa
emb|CDY07491.1|  BnaA07g25700D                                          173   6e-47   Brassica napus [oilseed rape]
ref|XP_006439186.1|  hypothetical protein CICLE_v10018942mg             174   6e-47   Citrus clementina [clementine]
ref|XP_009105192.1|  PREDICTED: subtilisin-like protease SBT5.3         173   6e-47   Brassica rapa
ref|XP_002887016.1|  subtilase family protein                           173   8e-47   Arabidopsis lyrata subsp. lyrata
gb|EMT13355.1|  Subtilisin-like protease                                173   8e-47   
ref|XP_006644839.1|  PREDICTED: subtilisin-like protease SDD1-like      173   8e-47   Oryza brachyantha
ref|NP_001046522.1|  Os02g0271000                                       173   9e-47   
ref|XP_006301478.1|  hypothetical protein CARUB_v10021900mg             172   1e-46   
emb|CDX94043.1|  BnaC07g36770D                                          173   1e-46   
emb|CDX94033.1|  BnaC07g36670D                                          173   1e-46   
ref|XP_004954566.1|  PREDICTED: LOW QUALITY PROTEIN: xylem serine...    172   1e-46   
ref|NP_564869.1|  Subtilase-like protein                                172   1e-46   Arabidopsis thaliana [mouse-ear cress]
gb|EEC72887.1|  hypothetical protein OsI_06697                          173   1e-46   Oryza sativa Indica Group [Indian rice]
gb|KDO76781.1|  hypothetical protein CISIN_1g042478mg                   174   1e-46   Citrus sinensis [apfelsine]
gb|EEE56708.1|  hypothetical protein OsJ_06199                          172   1e-46   Oryza sativa Japonica Group [Japonica rice]
dbj|BAJ93156.1|  predicted protein                                      172   1e-46   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|KDP25228.1|  hypothetical protein JCGZ_20384                         167   2e-46   Jatropha curcas
ref|XP_009391860.1|  PREDICTED: subtilisin-like protease SBT5.3         172   2e-46   Musa acuminata subsp. malaccensis [pisang utan]
emb|CDY61569.1|  BnaCnng38020D                                          174   2e-46   Brassica napus [oilseed rape]
gb|EMS61069.1|  Subtilisin-like protease                                172   2e-46   Triticum urartu
ref|XP_006829610.1|  hypothetical protein AMTR_s00122p00026080          172   2e-46   
gb|EMS68678.1|  Subtilisin-like protease                                172   2e-46   Triticum urartu
emb|CDY70485.1|  BnaA03g58450D                                          172   2e-46   Brassica napus [oilseed rape]
gb|EMT21267.1|  Subtilisin-like protease                                171   3e-46   
ref|XP_010647672.1|  PREDICTED: subtilisin-like protease SBT3.5         172   3e-46   Vitis vinifera
ref|XP_010456502.1|  PREDICTED: subtilisin-like protease SBT3.3         172   3e-46   
ref|XP_009391854.1|  PREDICTED: subtilisin-like protease SBT5.3 i...    171   3e-46   
ref|XP_006413751.1|  hypothetical protein EUTSA_v10024480mg             171   3e-46   Eutrema salsugineum [saltwater cress]
emb|CBI38006.3|  unnamed protein product                                172   3e-46   Vitis vinifera
ref|XP_009392092.1|  PREDICTED: subtilisin-like protease                170   4e-46   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010513580.1|  PREDICTED: subtilisin-like protease SBT3.3         171   4e-46   
ref|XP_008663777.1|  PREDICTED: subtilisin-like protease SBT5.3         171   4e-46   
emb|CDX94252.1|  BnaC02g29120D                                          171   4e-46   
ref|NP_567632.1|  Subtilase family protein                              171   5e-46   
emb|CDM82077.1|  unnamed protein product                                171   5e-46   Triticum aestivum [Canadian hard winter wheat]
ref|XP_003572336.1|  PREDICTED: subtilisin-like protease SBT3.5         171   6e-46   Brachypodium distachyon [annual false brome]
emb|CDM84531.1|  unnamed protein product                                170   7e-46   Triticum aestivum [Canadian hard winter wheat]
emb|CDX82843.1|  BnaC01g12930D                                          170   8e-46   
gb|EMS53237.1|  Subtilisin-like protease                                170   9e-46   Triticum urartu
ref|NP_001130788.1|  putative subtilase family protein precursor        170   9e-46   Zea mays [maize]
ref|XP_006487361.1|  PREDICTED: subtilisin-like protease SDD1-lik...    170   1e-45   Citrus sinensis [apfelsine]
gb|EMT29371.1|  Cucumisin                                               164   1e-45   
ref|XP_010931731.1|  PREDICTED: subtilisin-like protease SBT3.5         169   1e-45   
ref|XP_007042045.1|  Subtilase family protein, putative isoform 4       168   1e-45   
ref|XP_009387964.1|  PREDICTED: subtilisin-like protease SBT5.3         169   2e-45   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_007131420.1|  hypothetical protein PHAVU_011G012100g             167   2e-45   Phaseolus vulgaris [French bean]
ref|XP_009350314.1|  PREDICTED: subtilisin-like protease SBT5.3         169   2e-45   
ref|XP_009391852.1|  PREDICTED: subtilisin-like protease SBT5.3         169   2e-45   
ref|XP_008236858.1|  PREDICTED: subtilisin-like protease                169   2e-45   Prunus mume [ume]
ref|XP_009137186.1|  PREDICTED: subtilisin-like protease SBT5.3         169   2e-45   Brassica rapa
ref|XP_006653122.1|  PREDICTED: xylem serine proteinase 1-like          169   2e-45   
ref|XP_006391366.1|  hypothetical protein EUTSA_v10018188mg             169   3e-45   
ref|XP_007131422.1|  hypothetical protein PHAVU_011G012100g             167   3e-45   Phaseolus vulgaris [French bean]
ref|XP_009392091.1|  PREDICTED: subtilisin-like protease SBT5.3         167   3e-45   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_003572330.1|  PREDICTED: subtilisin-like protease SBT3.5         169   3e-45   Brachypodium distachyon [annual false brome]
ref|XP_006283179.1|  hypothetical protein CARUB_v10004209mg             169   3e-45   Capsella rubella
emb|CAB87667.1|  subtilisin-like protease-like protein                  169   3e-45   Arabidopsis thaliana [mouse-ear cress]
emb|CDY49641.1|  BnaCnng17930D                                          168   4e-45   Brassica napus [oilseed rape]
ref|XP_010419003.1|  PREDICTED: subtilisin-like protease SBT3.3         168   4e-45   
ref|XP_006423459.1|  hypothetical protein CICLE_v10027857mg             168   5e-45   Citrus clementina [clementine]
ref|XP_010271499.1|  PREDICTED: subtilisin-like protease SBT3.5 i...    168   6e-45   Nelumbo nucifera [Indian lotus]
ref|XP_007042042.1|  Subtilase family protein, putative isoform 1       168   8e-45   
dbj|BAJ96374.1|  predicted protein                                      167   8e-45   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_003581117.1|  PREDICTED: subtilisin-like protease SBT3.3         167   8e-45   Brachypodium distachyon [annual false brome]
ref|XP_010449086.1|  PREDICTED: subtilisin-like protease SBT3.5 i...    167   8e-45   Camelina sativa [gold-of-pleasure]
ref|XP_007131421.1|  hypothetical protein PHAVU_011G012100g             167   9e-45   Phaseolus vulgaris [French bean]
ref|XP_009407970.1|  PREDICTED: subtilisin-like protease SBT5.3 i...    167   9e-45   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_007042044.1|  Subtilase family protein, putative isoform 3       168   9e-45   
gb|EMT21268.1|  Subtilisin-like protease                                167   9e-45   
ref|XP_008452040.1|  PREDICTED: subtilisin-like protease                167   9e-45   Cucumis melo [Oriental melon]
ref|XP_009348700.1|  PREDICTED: subtilisin-like protease SBT5.3         167   1e-44   
ref|XP_010474133.1|  PREDICTED: subtilisin-like protease SBT3.3         167   1e-44   Camelina sativa [gold-of-pleasure]
ref|XP_006287131.1|  hypothetical protein CARUB_v10000302mg             167   1e-44   Capsella rubella
ref|XP_010445236.1|  PREDICTED: subtilisin-like protease SBT3.5         167   2e-44   
emb|CDX98693.1|  BnaA03g44780D                                          166   2e-44   
emb|CDY49640.1|  BnaCnng17920D                                          166   3e-44   Brassica napus [oilseed rape]
ref|XP_004504377.1|  PREDICTED: subtilisin-like protease SDD1-lik...    165   3e-44   
ref|XP_008392654.1|  PREDICTED: subtilisin-like protease SDD1           166   3e-44   Malus domestica [apple tree]
ref|XP_010092449.1|  Subtilisin-like protease SDD1                      162   4e-44   
ref|XP_003572346.1|  PREDICTED: subtilisin-like protease SBT3.5         166   4e-44   Brachypodium distachyon [annual false brome]
dbj|BAJ90143.1|  predicted protein                                      166   4e-44   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_010436465.1|  PREDICTED: subtilisin-like protease SBT3.5         165   4e-44   
gb|KJB79079.1|  hypothetical protein B456_013G033000                    164   5e-44   Gossypium raimondii
gb|AID21653.1|  At4g21326p-like protein                                 165   5e-44   Arabidopsis lyrata [lyrate rockcress]
emb|CDY36894.1|  BnaC07g01060D                                          164   6e-44   Brassica napus [oilseed rape]
ref|XP_004504376.1|  PREDICTED: subtilisin-like protease SDD1-lik...    165   7e-44   Cicer arietinum [garbanzo]
ref|XP_010529409.1|  PREDICTED: subtilisin-like protease SBT3.3 i...    165   7e-44   
ref|NP_001078370.1|  subtilisin-like protease                           164   7e-44   
gb|KJB79078.1|  hypothetical protein B456_013G033000                    164   8e-44   
ref|NP_001172893.1|  Os02g0270933                                       167   9e-44   
gb|AID21603.1|  At4g21326p-like protein                                 164   1e-43   
ref|XP_008245809.1|  PREDICTED: subtilisin-like protease SDD1           165   1e-43   
gb|AJP61136.1|  At4g21326p-like protein                                 164   1e-43   
gb|AID21581.1|  AT4G21326p                                              164   1e-43   
gb|AID21685.1|  At4g21326p-like protein                                 164   1e-43   
ref|XP_010528996.1|  PREDICTED: subtilisin-like protease SBT3.5         164   1e-43   
gb|KFK41050.1|  hypothetical protein AALP_AA2G078900                    164   2e-43   
gb|KJB79076.1|  hypothetical protein B456_013G033000                    164   2e-43   
ref|XP_009387941.1|  PREDICTED: subtilisin-like protease Glyma18g...    162   2e-43   
gb|KJB79071.1|  hypothetical protein B456_013G033000                    164   2e-43   
gb|KDP41723.1|  hypothetical protein JCGZ_26741                         164   2e-43   
ref|XP_003524182.2|  PREDICTED: subtilisin-like protease SDD1-lik...    164   2e-43   
dbj|BAE98849.1|  subtilisin-like protease -like protein                 163   3e-43   
gb|AJP61119.1|  At4g21326p-like protein                                 163   3e-43   
emb|CCI61494.1|  unnamed protein product                                163   3e-43   
gb|AID21628.1|  At4g21326p-like protein                                 163   3e-43   
ref|XP_008342302.1|  PREDICTED: subtilisin-like protease                163   3e-43   
ref|XP_006397047.1|  hypothetical protein EUTSA_v10028468mg             162   4e-43   
ref|XP_009105193.1|  PREDICTED: subtilisin-like protease SBT5.3         163   4e-43   
emb|CDY07492.1|  BnaA07g25710D                                          163   4e-43   
ref|XP_007209077.1|  hypothetical protein PRUPE_ppa001674mg             163   5e-43   
ref|XP_010271498.1|  PREDICTED: subtilisin-like protease SBT3.5 i...    163   5e-43   
ref|XP_011079238.1|  PREDICTED: LOW QUALITY PROTEIN: subtilisin-l...    162   6e-43   
gb|AET04097.2|  subtilisin-like serine protease                         162   6e-43   
ref|XP_010542106.1|  PREDICTED: LOW QUALITY PROTEIN: subtilisin-l...    162   7e-43   
ref|XP_003629621.1|  Subtilisin-like protease                           162   7e-43   
gb|EMS49419.1|  Cucumisin                                               162   9e-43   
ref|XP_006647148.1|  PREDICTED: subtilisin-like protease-like           162   1e-42   
gb|EMS46832.1|  Cucumisin                                               157   1e-42   
gb|AID21678.1|  At4g21326p-like protein                                 161   1e-42   
ref|XP_010100157.1|  Subtilisin-like protease SDD1                      162   1e-42   
ref|XP_009128705.1|  PREDICTED: subtilisin-like protease SBT5.3 i...    161   1e-42   
emb|CDX94044.1|  BnaC07g36780D                                          161   2e-42   
ref|XP_007201744.1|  hypothetical protein PRUPE_ppa001956mg             161   2e-42   
ref|XP_006370729.1|  hypothetical protein POPTR_0001s45480g             160   2e-42   
ref|XP_006644838.1|  PREDICTED: subtilisin-like protease-like           161   2e-42   
gb|KHG28029.1|  Subtilisin-like protease SDD1                           161   3e-42   
ref|XP_002512984.1|  Xylem serine proteinase 1 precursor, putative      160   4e-42   
ref|XP_002869894.1|  hypothetical protein ARALYDRAFT_329472             163   4e-42   
ref|XP_009391857.1|  PREDICTED: subtilisin-like protease SBT5.4         160   4e-42   
ref|NP_567625.4|  subtilase 3.12                                        160   5e-42   
emb|CDM80018.1|  unnamed protein product                                159   7e-42   
dbj|BAJ94791.1|  predicted protein                                      159   8e-42   
gb|AGN12874.1|  putative transcription factor DYSFUNCTIONAL TAPET...    159   8e-42   
gb|EAZ13817.1|  hypothetical protein OsJ_03742                          159   8e-42   
ref|NP_001044505.1|  Os01g0794800                                       159   8e-42   
ref|XP_002893749.1|  hypothetical protein ARALYDRAFT_473479             159   1e-41   
ref|XP_009351288.1|  PREDICTED: subtilisin-like protease SBT5.3 i...    159   1e-41   
ref|XP_009351289.1|  PREDICTED: subtilisin-like protease SBT5.3 i...    159   1e-41   
ref|XP_002456475.1|  hypothetical protein SORBIDRAFT_03g037010          158   1e-41   
emb|CAE76061.1|  B1248C03.20                                            159   2e-41   
ref|XP_010104911.1|  Subtilisin-like protease SDD1                      158   2e-41   
gb|KJB79077.1|  hypothetical protein B456_013G033000                    158   2e-41   
ref|XP_002451014.1|  hypothetical protein SORBIDRAFT_05g022620          157   3e-41   
dbj|BAJ94815.1|  predicted protein                                      157   3e-41   
gb|EEC76686.1|  hypothetical protein OsI_14683                          157   4e-41   
ref|XP_010538146.1|  PREDICTED: subtilisin-like protease SBT3.5         158   4e-41   
ref|XP_007210133.1|  hypothetical protein PRUPE_ppa022964mg             156   6e-41   
ref|XP_011038010.1|  PREDICTED: subtilisin-like protease SBT3.3 i...    156   6e-41   
gb|EEC71630.1|  hypothetical protein OsI_04057                          159   7e-41   
tpg|DAA57282.1|  TPA: putative subtilase family protein                 155   1e-40   
emb|CDX99526.1|  BnaC09g24660D                                          156   1e-40   
ref|XP_009344070.1|  PREDICTED: subtilisin-like protease SBT5.3         155   1e-40   
ref|XP_008783547.1|  PREDICTED: subtilisin-like protease SBT5.3         154   2e-40   
ref|XP_008667736.1|  PREDICTED: uncharacterized protein LOC100278...    155   3e-40   
emb|CDX86874.1|  BnaA09g22640D                                          155   3e-40   
ref|XP_008674940.1|  PREDICTED: subtilisin-like protease SBT5.3         155   3e-40   
ref|XP_008676247.1|  PREDICTED: subtilisin-like protease SBT5.3         154   3e-40   
tpg|DAA57275.1|  TPA: putative subtilase family protein                 154   3e-40   
ref|XP_004970244.1|  PREDICTED: cucumisin-like                          154   4e-40   
ref|XP_008667730.1|  PREDICTED: uncharacterized protein LOC100278...    155   4e-40   
gb|EMT05073.1|  Subtilisin-like protease                                155   4e-40   
ref|XP_008667735.1|  PREDICTED: uncharacterized protein LOC100278...    155   4e-40   
gb|EMS50759.1|  Subtilisin-like protease                                155   4e-40   
gb|EMS50761.1|  Subtilisin-like protease                                154   5e-40   
gb|KJB79075.1|  hypothetical protein B456_013G033000                    154   8e-40   
emb|CBI38460.3|  unnamed protein product                                154   1e-39   
ref|XP_002305456.2|  hypothetical protein POPTR_0004s16850g             153   1e-39   
ref|XP_011037192.1|  PREDICTED: subtilisin-like protease SBT3.5         153   1e-39   
emb|CAA20197.1|  putative protein                                       155   2e-39   
gb|EMT19033.1|  Subtilisin-like protease                                153   2e-39   
ref|XP_006660880.1|  PREDICTED: subtilisin-like protease-like           152   2e-39   
tpg|DAA41966.1|  TPA: putative subtilase family protein                 151   2e-39   
ref|XP_006829160.1|  hypothetical protein AMTR_s00001p00269990          152   3e-39   
gb|EMT05074.1|  Subtilisin-like protease                                154   4e-39   
ref|NP_001044509.1|  Os01g0795200                                       152   4e-39   
gb|EAZ29546.1|  hypothetical protein OsJ_13621                          152   4e-39   
dbj|BAD53015.1|  putative subtilisin-like serine protease               152   4e-39   
gb|AID21654.1|  At4g21323p-like protein                                 152   4e-39   
ref|XP_006391365.1|  hypothetical protein EUTSA_v10018142mg             152   5e-39   
ref|XP_010529681.1|  PREDICTED: subtilisin-like protease SBT3.5 i...    151   5e-39   
ref|XP_010529679.1|  PREDICTED: subtilisin-like protease SBT3.5 i...    151   6e-39   
ref|XP_010529680.1|  PREDICTED: subtilisin-like protease SBT3.5 i...    151   6e-39   
dbj|BAJ96317.1|  predicted protein                                      151   7e-39   
ref|XP_004970240.1|  PREDICTED: subtilisin-like protease SDD1-lik...    151   7e-39   
ref|XP_004970241.1|  PREDICTED: subtilisin-like protease SDD1-lik...    151   8e-39   
ref|XP_011458287.1|  PREDICTED: subtilisin-like protease SBT3.5 i...    151   8e-39   
ref|XP_011458288.1|  PREDICTED: subtilisin-like protease SBT3.5 i...    151   1e-38   
ref|XP_008667162.1|  PREDICTED: putative subtilase family protein...    151   1e-38   
gb|ACF86497.1|  unknown                                                 150   1e-38   
gb|AID21627.1|  At4g21323p-like protein                                 151   1e-38   
ref|XP_010113170.1|  Subtilisin-like protease SDD1                      145   1e-38   
ref|NP_567624.1|  Subtilase family protein                              150   2e-38   
ref|XP_008804320.1|  PREDICTED: subtilisin-like protease SBT5.3         150   2e-38   
gb|AID21619.1|  At4g21323p-like protein                                 150   3e-38   
emb|CDM80022.1|  unnamed protein product                                149   3e-38   
ref|XP_006413795.1|  hypothetical protein EUTSA_v10024459mg             149   4e-38   
ref|XP_006580141.1|  PREDICTED: subtilisin-like protease SDD1-lik...    149   4e-38   
emb|CCI61493.1|  unnamed protein product                                149   5e-38   
gb|EMS55531.1|  Subtilisin-like protease                                148   7e-38   
ref|XP_004970239.1|  PREDICTED: subtilisin-like protease-like           148   7e-38   
ref|XP_004970242.1|  PREDICTED: subtilisin-like protease SDD1-like      148   8e-38   
ref|XP_002451012.1|  hypothetical protein SORBIDRAFT_05g022600          148   8e-38   
ref|XP_002971605.1|  hypothetical protein SELMODRAFT_95668              149   8e-38   
gb|AID21686.1|  At4g21323p-like protein                                 148   9e-38   
ref|XP_010436456.1|  PREDICTED: subtilisin-like protease SBT3.5         146   1e-37   
emb|CDX93810.1|  BnaA09g24100D                                          148   1e-37   
dbj|BAJ97332.1|  predicted protein                                      148   1e-37   
gb|AID21679.1|  At4g21323p-like protein                                 148   1e-37   
gb|EMT05336.1|  Subtilisin-like protease                                147   2e-37   
ref|XP_010647020.1|  PREDICTED: subtilisin-like protease SBT5.3 i...    147   2e-37   
gb|AAL24366.1|  subtilisin proteinase-like                              146   2e-37   
gb|EAZ09847.1|  hypothetical protein OsI_32138                          147   2e-37   
emb|CBI38458.3|  unnamed protein product                                147   2e-37   
ref|NP_001063751.1|  Os09g0530800                                       147   3e-37   
ref|XP_010449088.1|  PREDICTED: subtilisin-like protease SBT3.5         147   3e-37   
emb|CAB36809.1|  subtilisin proteinase-like                             146   3e-37   
gb|EMS67122.1|  Subtilisin-like protease                                147   3e-37   
ref|XP_010647022.1|  PREDICTED: subtilisin-like protease SBT5.3         147   3e-37   
ref|XP_002867837.1|  subtilase family protein                           145   3e-37   
gb|EMT03493.1|  Cucumisin                                               140   8e-37   
ref|XP_010434192.1|  PREDICTED: subtilisin-like protease SBT3.5 i...    145   1e-36   
ref|XP_002965274.1|  hypothetical protein SELMODRAFT_406544             144   1e-36   
ref|XP_010934029.1|  PREDICTED: subtilisin-like protease SBT3.5         144   1e-36   
gb|AID21582.1|  AT4G21323p                                              145   1e-36   
ref|XP_010439493.1|  PREDICTED: subtilisin-like protease SBT3.5         145   1e-36   
gb|AJP61138.1|  At4g21323p-like protein                                 145   1e-36   
gb|EAY76129.1|  hypothetical protein OsI_04058                          145   1e-36   
ref|XP_008353281.1|  PREDICTED: subtilisin-like protease                145   1e-36   
gb|AID21602.1|  At4g21323p-like protein                                 145   2e-36   
ref|XP_010934028.1|  PREDICTED: subtilisin-like protease SBT3.5         144   2e-36   
ref|XP_002867838.1|  subtilase family protein                           144   2e-36   
ref|XP_002985983.1|  hypothetical protein SELMODRAFT_234928             144   2e-36   
emb|CAN72966.1|  hypothetical protein VITISV_025342                     144   2e-36   
ref|XP_010109770.1|  hypothetical protein L484_008446                   144   2e-36   
ref|XP_002262979.2|  PREDICTED: cucumisin-like                          144   2e-36   
ref|XP_008384613.1|  PREDICTED: subtilisin-like protease                144   3e-36   
emb|CDM80019.1|  unnamed protein product                                144   3e-36   
ref|XP_002965730.1|  hypothetical protein SELMODRAFT_407350             144   3e-36   
ref|XP_006646404.1|  PREDICTED: subtilisin-like protease SDD1-like      143   4e-36   
gb|EAY91723.1|  hypothetical protein OsI_13365                          133   8e-36   
ref|XP_004492916.1|  PREDICTED: subtilisin-like protease-like           143   9e-36   
ref|XP_006283138.1|  hypothetical protein CARUB_v10004165mg             141   1e-35   
gb|KJB25735.1|  hypothetical protein B456_004G206800                    142   1e-35   
ref|XP_010662562.1|  PREDICTED: cucumisin-like                          142   2e-35   
tpg|DAA41968.1|  TPA: putative subtilase family protein                 141   2e-35   
ref|XP_010691741.1|  PREDICTED: LOW QUALITY PROTEIN: subtilisin-l...    140   2e-35   
gb|EEE55521.1|  hypothetical protein OsJ_03744                          141   2e-35   
ref|XP_004499342.1|  PREDICTED: subtilisin-like protease-like           141   3e-35   
ref|XP_009339280.1|  PREDICTED: subtilisin-like protease SBT5.4         142   3e-35   
ref|NP_001044508.1|  Os01g0795100                                       141   3e-35   
gb|EMT17678.1|  Xylem serine proteinase 1                               140   4e-35   
dbj|BAK05842.1|  predicted protein                                      140   4e-35   
emb|CAE01301.2|  OSJNBa0020P07.18                                       140   4e-35   
ref|XP_006283139.1|  hypothetical protein CARUB_v10004165mg             140   5e-35   
ref|XP_011081159.1|  PREDICTED: cucumisin-like                          140   7e-35   
ref|XP_002978893.1|  hypothetical protein SELMODRAFT_110049             140   7e-35   
emb|CAB36808.1|  subtilisin-like protease                               140   7e-35   
ref|XP_010647021.1|  PREDICTED: subtilisin-like protease SBT5.3 i...    140   8e-35   
ref|XP_007158047.1|  hypothetical protein PHAVU_002G119700g             140   1e-34   
ref|XP_004492921.1|  PREDICTED: subtilisin-like protease-like           140   1e-34   
gb|KHN39834.1|  Cucumisin                                               140   1e-34   
ref|XP_003537841.1|  PREDICTED: cucumisin-like                          140   1e-34   
ref|XP_006370742.1|  hypothetical protein POPTR_0001s460001g            135   1e-34   
emb|CDX94032.1|  BnaC07g36660D                                          139   1e-34   
ref|XP_004957446.1|  PREDICTED: subtilisin-like protease SDD1-like      139   2e-34   
emb|CDX98690.1|  BnaA03g44750D                                          139   2e-34   
ref|XP_009761710.1|  PREDICTED: subtilisin-like protease SBT5.3         137   2e-34   
ref|XP_002984931.1|  hypothetical protein SELMODRAFT_424020             139   2e-34   
ref|XP_009137185.1|  PREDICTED: subtilisin-like protease SBT5.4         139   2e-34   
ref|XP_002509690.1|  Cucumisin precursor, putative                      139   2e-34   
ref|XP_002984832.1|  hypothetical protein SELMODRAFT_121107             138   2e-34   
ref|XP_008344175.1|  PREDICTED: subtilisin-like protease isoform X1     139   3e-34   
ref|XP_008344176.1|  PREDICTED: subtilisin-like protease isoform X2     138   3e-34   
ref|XP_008794749.1|  PREDICTED: subtilisin-like protease SBT5.3         139   3e-34   
ref|XP_010942533.1|  PREDICTED: subtilisin-like protease SBT5.3 i...    139   3e-34   
ref|XP_002984936.1|  hypothetical protein SELMODRAFT_121213             138   3e-34   
ref|XP_011048158.1|  PREDICTED: subtilisin-like protease SBT3.5 i...    139   3e-34   
ref|XP_010942535.1|  PREDICTED: subtilisin-like protease SBT5.3 i...    138   3e-34   
ref|XP_010942695.1|  PREDICTED: subtilisin-like protease SBT5.3         138   3e-34   
ref|XP_011048159.1|  PREDICTED: subtilisin-like protease SBT3.5 i...    139   3e-34   
ref|NP_001044507.1|  Os01g0795000                                       138   4e-34   
ref|XP_002460565.1|  hypothetical protein SORBIDRAFT_02g030760          138   4e-34   
emb|CDY58475.1|  BnaA03g58460D                                          138   5e-34   
ref|XP_002986601.1|  hypothetical protein SELMODRAFT_425502             136   6e-34   
gb|EEE55520.1|  hypothetical protein OsJ_03743                          137   6e-34   
ref|XP_010466978.1|  PREDICTED: subtilisin-like protease SBT5.3         137   7e-34   
ref|XP_007204641.1|  hypothetical protein PRUPE_ppa001800mg             137   7e-34   
ref|XP_008359025.1|  PREDICTED: subtilisin-like protease                136   8e-34   
ref|XP_003538919.1|  PREDICTED: subtilisin-like protease-like           137   8e-34   
gb|EMT10181.1|  Cucumisin                                               128   8e-34   
ref|XP_006857645.1|  hypothetical protein AMTR_s00061p00140690          137   8e-34   
ref|XP_007131764.1|  hypothetical protein PHAVU_011G039900g             137   9e-34   
ref|XP_011038086.1|  PREDICTED: subtilisin-like protease SBT3.5         137   9e-34   
ref|XP_009359651.1|  PREDICTED: subtilisin-like protease SBT5.4         137   1e-33   
ref|XP_006477361.1|  PREDICTED: cucumisin-like                          137   1e-33   
ref|XP_009369762.1|  PREDICTED: subtilisin-like protease SBT5.4         137   1e-33   
gb|KDP25659.1|  hypothetical protein JCGZ_20815                         137   1e-33   
ref|XP_010434193.1|  PREDICTED: subtilisin-like protease SBT3.5 i...    136   1e-33   
ref|XP_011461611.1|  PREDICTED: subtilisin-like protease SBT5.4         137   1e-33   
emb|CBI38463.3|  unnamed protein product                                137   1e-33   
ref|XP_010942534.1|  PREDICTED: subtilisin-like protease SBT5.3 i...    136   2e-33   
ref|XP_008668394.1|  PREDICTED: putative subtilase family protein...    135   2e-33   
ref|XP_010942532.1|  PREDICTED: subtilisin-like protease SBT5.3 i...    136   2e-33   
ref|XP_010087079.1|  hypothetical protein L484_010451                   127   2e-33   
ref|XP_002306266.2|  hypothetical protein POPTR_0005s06820g             136   2e-33   
ref|XP_007141642.1|  hypothetical protein PHAVU_008G213300g             134   2e-33   



>ref|XP_011075896.1| PREDICTED: subtilisin-like protease SBT3.5 [Sesamum indicum]
Length=783

 Score =   225 bits (573),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 101/143 (71%), Positives = 120/143 (84%), Gaps = 0/143 (0%)
 Frame = +2

Query  140  KVYIVYMGARQHDDVDLITSTHHDMLATVLGSKEAAADSMIYSYRHGFSGFAAMMTKSHA  319
            K YIVYMG R+H DV+L+T +HH+MLA+VLGSKEA  DSMIYSYRHGFSGFAA MT S A
Sbjct  47   KAYIVYMGERKHKDVELVTKSHHEMLASVLGSKEATLDSMIYSYRHGFSGFAAKMTDSQA  106

Query  320  QTFQDLPGVVKVIPNSLYKLRTTRSWDYLGLSLNSATNLLHDTKMGDGTIVAVLDTGVTP  499
            +   +LPGVV+V+PN LYK+ TTRSWDYLGLS +S TNLLHDT  GDG I+ V DTGV P
Sbjct  107  RYIAELPGVVQVLPNRLYKMHTTRSWDYLGLSPHSTTNLLHDTNQGDGAIIGVFDTGVWP  166

Query  500  ENEAYNDRGLGPIPSKWKGYCES  568
            E+E++ND+GLGPIP+KWKG+C S
Sbjct  167  ESESFNDKGLGPIPAKWKGFCTS  189



>ref|XP_007210025.1| hypothetical protein PRUPE_ppa018629mg [Prunus persica]
 gb|EMJ11224.1| hypothetical protein PRUPE_ppa018629mg [Prunus persica]
Length=773

 Score =   220 bits (560),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 98/162 (60%), Positives = 130/162 (80%), Gaps = 1/162 (1%)
 Frame = +2

Query  86   CLLVFQNALVHTSALSE-PKVYIVYMGARQHDDVDLITSTHHDMLATVLGSKEAAADSMI  262
            CLL F N     + ++E  +V+IVY+G RQHD+  L+T +HHD+LAT+ GSKE A++ M+
Sbjct  12   CLLCFLNGQGMIAKVAENSQVHIVYLGERQHDNPKLLTDSHHDLLATIAGSKELASELMV  71

Query  263  YSYRHGFSGFAAMMTKSHAQTFQDLPGVVKVIPNSLYKLRTTRSWDYLGLSLNSATNLLH  442
            YSYRHGFSGFAA +T+S AQ   +LPGVV+VIPNSL+KL+TTRSWD+LGLS  S +N+LH
Sbjct  72   YSYRHGFSGFAAKLTESQAQKLSELPGVVRVIPNSLHKLQTTRSWDFLGLSSQSPSNILH  131

Query  443  DTKMGDGTIVAVLDTGVTPENEAYNDRGLGPIPSKWKGYCES  568
             + MGDG I+ VLDTG+ PE+E++N++GLGP+PS WKG CES
Sbjct  132  KSSMGDGVIIGVLDTGIWPESESFNEKGLGPVPSHWKGVCES  173



>ref|XP_007210725.1| hypothetical protein PRUPE_ppa022363mg [Prunus persica]
 gb|EMJ11924.1| hypothetical protein PRUPE_ppa022363mg [Prunus persica]
Length=783

 Score =   218 bits (556),  Expect = 7e-63, Method: Compositional matrix adjust.
 Identities = 100/183 (55%), Positives = 137/183 (75%), Gaps = 3/183 (2%)
 Frame = +2

Query  20   SCVIQNMDKNQNELILFSFFFGCLLVFQNALVHTSALSEPKVYIVYMGARQHDDVDLITS  199
            S +++ M    +  + F+ F   +L  QN ++ T   +  KV+IVYMG + H D +++TS
Sbjct  3    SLLLKKMSNKVSVFVTFNIFL--VLCTQNTMIRT-VHANSKVHIVYMGEKHHHDPEVVTS  59

Query  200  THHDMLATVLGSKEAAADSMIYSYRHGFSGFAAMMTKSHAQTFQDLPGVVKVIPNSLYKL  379
             HHDMLA+VLGSKEAA DSM+YSY+HGFSGFAA +T+S AQ   +LPGV++V+P+  Y L
Sbjct  60   LHHDMLASVLGSKEAAYDSMVYSYKHGFSGFAAKVTESQAQKIAELPGVIRVMPSHFYSL  119

Query  380  RTTRSWDYLGLSLNSATNLLHDTKMGDGTIVAVLDTGVTPENEAYNDRGLGPIPSKWKGY  559
            +TTRSWDYLGLS +S TNLLHDT +GDG ++ +LDTG+ PE++ +ND GLGPIP++WKG 
Sbjct  120  QTTRSWDYLGLSPSSPTNLLHDTNLGDGIVIGLLDTGIWPESKVFNDEGLGPIPNQWKGQ  179

Query  560  CES  568
            C S
Sbjct  180  CVS  182



>ref|XP_008239249.1| PREDICTED: subtilisin-like protease [Prunus mume]
 ref|XP_008239250.1| PREDICTED: subtilisin-like protease [Prunus mume]
 ref|XP_008239251.1| PREDICTED: subtilisin-like protease [Prunus mume]
Length=772

 Score =   217 bits (552),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 98/164 (60%), Positives = 130/164 (79%), Gaps = 5/164 (3%)
 Frame = +2

Query  86   CLLVF---QNALVHTSALSEPKVYIVYMGARQHDDVDLITSTHHDMLATVLGSKEAAADS  256
            CLL F   Q  +   +A S+  V+IVY+G +QHD+  L+T +HHD+LAT+ GSKE A++ 
Sbjct  12   CLLCFLNGQGMIAKVAANSQ--VHIVYLGEKQHDNPKLLTDSHHDLLATIAGSKELASEL  69

Query  257  MIYSYRHGFSGFAAMMTKSHAQTFQDLPGVVKVIPNSLYKLRTTRSWDYLGLSLNSATNL  436
            M+YSYRHGFSGFAA +T+S AQ   +LPGVV+VIPNSL+KL+TTRSWD+LGLS  S +N+
Sbjct  70   MVYSYRHGFSGFAAKLTESQAQKLSELPGVVRVIPNSLHKLQTTRSWDFLGLSSQSPSNI  129

Query  437  LHDTKMGDGTIVAVLDTGVTPENEAYNDRGLGPIPSKWKGYCES  568
            LH + MGDG I+ VLDTG+ PE+E++N++GLGP+PS WKG CES
Sbjct  130  LHKSSMGDGVIIGVLDTGIWPESESFNEKGLGPVPSHWKGVCES  173



>emb|CAN80173.1| hypothetical protein VITISV_018392 [Vitis vinifera]
Length=928

 Score =   217 bits (553),  Expect = 4e-62, Method: Compositional matrix adjust.
 Identities = 99/169 (59%), Positives = 133/169 (79%), Gaps = 1/169 (1%)
 Frame = +2

Query  65   LFSFFFGCLLVFQNALVHTSAL-SEPKVYIVYMGARQHDDVDLITSTHHDMLATVLGSKE  241
            L+      LL+  + +   +A+ ++  VYIVYMG RQH ++DLIT  HH ML+ VLGS E
Sbjct  14   LWFVIVSVLLILHDQVFFPAAVDAKSNVYIVYMGERQHGNLDLITDGHHRMLSEVLGSDE  73

Query  242  AAADSMIYSYRHGFSGFAAMMTKSHAQTFQDLPGVVKVIPNSLYKLRTTRSWDYLGLSLN  421
            A+ +SM+YSY+HGFSGFAA +T++ AQ F +LP VV+VIPN L+KL+TTRSWDYLGL L+
Sbjct  74   ASVESMVYSYKHGFSGFAAKLTEAQAQMFAELPDVVQVIPNRLHKLQTTRSWDYLGLPLD  133

Query  422  SATNLLHDTKMGDGTIVAVLDTGVTPENEAYNDRGLGPIPSKWKGYCES  568
            S T+LLH+TKMGDGTI+ +LDTG+ PE+E ++++GLGPIPS+W G CES
Sbjct  134  SPTSLLHETKMGDGTIIGLLDTGIWPESEVFSEKGLGPIPSRWNGVCES  182


 Score = 96.3 bits (238),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 45/73 (62%), Positives = 57/73 (78%), Gaps = 1/73 (1%)
 Frame = +2

Query  125  ALSEPKVYIVYMGARQHDDVDLITSTHHDMLATVLGSKEAAADSMIYSYRHGFSGFAAMM  304
             +S   V+IVY+G RQH D + IT+THH+ML TVLGSKEA+ DSM+YSYRHGFSGFAA +
Sbjct  847  GISTSPVHIVYLGKRQHHDPEFITNTHHEMLTTVLGSKEASVDSMLYSYRHGFSGFAAKL  906

Query  305  TKSHAQTFQ-DLP  340
            T++ AQ    +LP
Sbjct  907  TEAQAQAVSGNLP  919



>ref|XP_007039330.1| Subtilase family protein, putative [Theobroma cacao]
 gb|EOY23831.1| Subtilase family protein, putative [Theobroma cacao]
Length=1029

 Score =   216 bits (550),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 98/172 (57%), Positives = 133/172 (77%), Gaps = 0/172 (0%)
 Frame = +2

Query  53   NELILFSFFFGCLLVFQNALVHTSALSEPKVYIVYMGARQHDDVDLITSTHHDMLATVLG  232
            N +  F   F  L++  + L+ T   ++  V+IVY+G RQ DD  L+T +HHD+LATV+G
Sbjct  3    NPMPFFVTVFILLVLNGHGLMTTKVEAKSNVHIVYLGERQLDDPKLVTDSHHDLLATVVG  62

Query  233  SKEAAADSMIYSYRHGFSGFAAMMTKSHAQTFQDLPGVVKVIPNSLYKLRTTRSWDYLGL  412
            SKE A+D M+YSYRHGFSGFAA +T+S AQ   +LPGVV+VIPNSL++L+TTRSWD+LGL
Sbjct  63   SKEVASDLMVYSYRHGFSGFAAKLTESQAQKLSELPGVVRVIPNSLHRLQTTRSWDFLGL  122

Query  413  SLNSATNLLHDTKMGDGTIVAVLDTGVTPENEAYNDRGLGPIPSKWKGYCES  568
            S +  TN+L ++KMGDG I+ V DTG+ PE++A++D GLGPIPS+WKG C+S
Sbjct  123  SSHYPTNILQNSKMGDGVIIGVFDTGIWPESKAFSDEGLGPIPSRWKGVCKS  174


 Score =   201 bits (512),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 98/173 (57%), Positives = 124/173 (72%), Gaps = 2/173 (1%)
 Frame = +2

Query  50   QNELILFSFFFGCLLVFQNALVHTSALSEPKVYIVYMGARQHDDVDLITSTHHDMLATVL  229
            +  LIL    F  +L  QN     +  +E +V+IVYMG RQ +D  LIT  HHD+LAT++
Sbjct  756  RTSLILLVNLF-LILNGQNRFA-AAVNAESRVHIVYMGERQQNDPKLITEFHHDLLATIV  813

Query  230  GSKEAAADSMIYSYRHGFSGFAAMMTKSHAQTFQDLPGVVKVIPNSLYKLRTTRSWDYLG  409
            GSKEAA DSM+Y+Y+HGFSGFAA +T+S AQ   +LP VV VIPN  + L+TTR+WDYL 
Sbjct  814  GSKEAAVDSMVYTYKHGFSGFAAKLTESQAQQISELPEVVHVIPNRFHSLQTTRTWDYLD  873

Query  410  LSLNSATNLLHDTKMGDGTIVAVLDTGVTPENEAYNDRGLGPIPSKWKGYCES  568
            +S  S  NLLHDT MGDG I+ +LDTGV PE+  +ND GL PIP++WKG CES
Sbjct  874  ISSYSPFNLLHDTDMGDGIIIGLLDTGVWPESVVFNDEGLEPIPARWKGLCES  926



>ref|XP_002273195.2| PREDICTED: subtilisin-like protease SBT3.5 [Vitis vinifera]
Length=776

 Score =   213 bits (542),  Expect = 5e-61, Method: Compositional matrix adjust.
 Identities = 100/171 (58%), Positives = 134/171 (78%), Gaps = 3/171 (2%)
 Frame = +2

Query  65   LFSFFFGCLLVFQNALVH--TSALSEPKVYIVYMGARQHDDVDLITSTHHDMLATVLGSK  238
            L   F   L++  N  V   T A ++ K++IVY+G RQH D +LIT+THH+ML TVLGSK
Sbjct  9    LIFIFLASLILILNEKVSSVTPAQAKSKIHIVYLGMRQHHDPELITNTHHEMLTTVLGSK  68

Query  239  EAAADSMIYSYRHGFSGFAAMMTKSHAQTFQDLPGVVKVIPNSLYKLRTTRSWDYLGLSL  418
            EA+ DSM+YSYRHGFSGFAA +T++ AQ   +LP VV+V+P+ L+KL+TTRSWDYLGLS 
Sbjct  69   EASVDSMLYSYRHGFSGFAAKLTEAQAQAVSELPDVVQVMPSRLHKLKTTRSWDYLGLSS  128

Query  419  N-SATNLLHDTKMGDGTIVAVLDTGVTPENEAYNDRGLGPIPSKWKGYCES  568
            + S+TNLLH+T MGDG I+ +LD+G+ PE++ ++D+GLGPIPS+WKG C S
Sbjct  129  SHSSTNLLHETNMGDGIIIGLLDSGIWPESKVFSDKGLGPIPSRWKGGCSS  179



>ref|XP_010318061.1| PREDICTED: subtilisin-like protease SBT3.3 isoform X2 [Solanum 
lycopersicum]
Length=764

 Score =   212 bits (540),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 97/151 (64%), Positives = 123/151 (81%), Gaps = 1/151 (1%)
 Frame = +2

Query  119  TSALSEPKVYIVYMGARQHDDVDLITSTHHDMLATVLGSKEAAADSMIYSYRHGFSGFAA  298
            + A +E KV+IVYMG RQHDDV+L TS HH +L +V+GS++AA DS+IYSY+HGFSGFAA
Sbjct  28   SQANAESKVHIVYMGRRQHDDVELATSAHHQLLTSVMGSQKAARDSIIYSYKHGFSGFAA  87

Query  299  MMTKSHAQTFQDLPGVVKVIPNSLYKLRTTRSWDYLGLSLNS-ATNLLHDTKMGDGTIVA  475
             +TKS A+   +LP VV V+PN  +KL T RSWDYLGLS +S  TNLLH+  MGDG I+ 
Sbjct  88   RLTKSQAKKIAELPDVVHVVPNHFFKLHTRRSWDYLGLSESSPPTNLLHEANMGDGIIIG  147

Query  476  VLDTGVTPENEAYNDRGLGPIPSKWKGYCES  568
            VLDTG+ PE+EA+ND+GLGPIPS+WKG+C+S
Sbjct  148  VLDTGIWPESEAFNDKGLGPIPSRWKGHCQS  178



>ref|XP_010318060.1| PREDICTED: subtilisin-like protease SBT3.3 isoform X1 [Solanum 
lycopersicum]
Length=772

 Score =   212 bits (540),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 97/151 (64%), Positives = 123/151 (81%), Gaps = 1/151 (1%)
 Frame = +2

Query  119  TSALSEPKVYIVYMGARQHDDVDLITSTHHDMLATVLGSKEAAADSMIYSYRHGFSGFAA  298
            + A +E KV+IVYMG RQHDDV+L TS HH +L +V+GS++AA DS+IYSY+HGFSGFAA
Sbjct  28   SQANAESKVHIVYMGRRQHDDVELATSAHHQLLTSVMGSQKAARDSIIYSYKHGFSGFAA  87

Query  299  MMTKSHAQTFQDLPGVVKVIPNSLYKLRTTRSWDYLGLSLNS-ATNLLHDTKMGDGTIVA  475
             +TKS A+   +LP VV V+PN  +KL T RSWDYLGLS +S  TNLLH+  MGDG I+ 
Sbjct  88   RLTKSQAKKIAELPDVVHVVPNHFFKLHTRRSWDYLGLSESSPPTNLLHEANMGDGIIIG  147

Query  476  VLDTGVTPENEAYNDRGLGPIPSKWKGYCES  568
            VLDTG+ PE+EA+ND+GLGPIPS+WKG+C+S
Sbjct  148  VLDTGIWPESEAFNDKGLGPIPSRWKGHCQS  178



>ref|XP_007039203.1| Subtilase family protein, putative [Theobroma cacao]
 gb|EOY23704.1| Subtilase family protein, putative [Theobroma cacao]
Length=776

 Score =   211 bits (537),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 101/171 (59%), Positives = 126/171 (74%), Gaps = 2/171 (1%)
 Frame = +2

Query  62   ILFSFFFGCLLVFQNALVHTSAL--SEPKVYIVYMGARQHDDVDLITSTHHDMLATVLGS  235
            I+ SF    LL+  N      AL  S   VYIVYMG RQH DV+ +T THH+ML+TVL S
Sbjct  11   IIMSFVLVPLLLILNVHYMLPALADSNSNVYIVYMGKRQHPDVERLTRTHHEMLSTVLVS  70

Query  236  KEAAADSMIYSYRHGFSGFAAMMTKSHAQTFQDLPGVVKVIPNSLYKLRTTRSWDYLGLS  415
            +E + +SM+YSY+HGFSGFAA MT++ AQ    LPGVV V  N  YKL+TTRSWDYLGLS
Sbjct  71   EETSKESMVYSYKHGFSGFAAKMTEAQAQKLSKLPGVVHVTRNGFYKLQTTRSWDYLGLS  130

Query  416  LNSATNLLHDTKMGDGTIVAVLDTGVTPENEAYNDRGLGPIPSKWKGYCES  568
             NS +NLL+ +KMG+G I+ +LDTG+ PE+E ++D GLGPIPS+WKG CES
Sbjct  131  TNSPSNLLNKSKMGNGVIIGLLDTGIWPESEVFSDEGLGPIPSRWKGVCES  181



>ref|XP_003634152.2| PREDICTED: subtilisin-like protease SBT3.5 [Vitis vinifera]
Length=776

 Score =   210 bits (535),  Expect = 6e-60, Method: Compositional matrix adjust.
 Identities = 97/171 (57%), Positives = 133/171 (78%), Gaps = 2/171 (1%)
 Frame = +2

Query  62   ILFSFFFGCLLVFQNALVHTS-ALSEPKVYIVYMGARQHDDVDLITSTHHDMLATVLGSK  238
            ++  F    +L+    +   S A ++ KV+IVY+G RQH D + IT+THH+ML TVLGSK
Sbjct  9    LMLIFLASSILILNEKVSSVSPAQAKSKVHIVYLGKRQHHDPEFITNTHHEMLTTVLGSK  68

Query  239  EAAADSMIYSYRHGFSGFAAMMTKSHAQTFQDLPGVVKVIPNSLYKLRTTRSWDYLGLSL  418
            EA+ DSM+YSYRHGFSGFAA +T++ AQ   +LP VV+V+P+ L+KL+TTRSWDYLGLS 
Sbjct  69   EASVDSMLYSYRHGFSGFAAKLTEAQAQAVSELPDVVQVMPSRLHKLKTTRSWDYLGLSS  128

Query  419  N-SATNLLHDTKMGDGTIVAVLDTGVTPENEAYNDRGLGPIPSKWKGYCES  568
            + S+TNLLH+T MGDG I+ +LD+G+ PE++ ++D+GLGPIPS+WKG C S
Sbjct  129  SHSSTNLLHETNMGDGIIIGLLDSGIWPESKVFSDKGLGPIPSRWKGGCSS  179



>ref|XP_002317663.1| subtilase family protein [Populus trichocarpa]
 gb|EEE98275.1| subtilase family protein [Populus trichocarpa]
Length=770

 Score =   210 bits (534),  Expect = 6e-60, Method: Compositional matrix adjust.
 Identities = 95/162 (59%), Positives = 128/162 (79%), Gaps = 1/162 (1%)
 Frame = +2

Query  86   CLL-VFQNALVHTSALSEPKVYIVYMGARQHDDVDLITSTHHDMLATVLGSKEAAADSMI  262
            CLL ++   ++ T   +   V+IVY+G +QHDD  L T++HHDMLA+V+GSKE A + M+
Sbjct  12   CLLFLWGQGMLMTKVEATSSVHIVYLGGKQHDDHILTTNSHHDMLASVVGSKEMATELMV  71

Query  263  YSYRHGFSGFAAMMTKSHAQTFQDLPGVVKVIPNSLYKLRTTRSWDYLGLSLNSATNLLH  442
            YSY+HGFSGFAA +T+S AQ   +LPGV++VIPNSL++L+TTRSWD+LGLS +S  N LH
Sbjct  72   YSYKHGFSGFAAKLTESQAQKVSELPGVIRVIPNSLHRLQTTRSWDFLGLSSHSPVNTLH  131

Query  443  DTKMGDGTIVAVLDTGVTPENEAYNDRGLGPIPSKWKGYCES  568
             + MGDG I+ VLDTG+ PE++A++D+GLGPIPS WKG CES
Sbjct  132  KSNMGDGVIIGVLDTGIWPESKAFSDKGLGPIPSHWKGVCES  173



>ref|XP_002518937.1| Cucumisin precursor, putative [Ricinus communis]
 gb|EEF43470.1| Cucumisin precursor, putative [Ricinus communis]
Length=778

 Score =   210 bits (534),  Expect = 7e-60, Method: Compositional matrix adjust.
 Identities = 97/160 (61%), Positives = 126/160 (79%), Gaps = 1/160 (1%)
 Frame = +2

Query  89   LLVFQNALVHTSALSEPKVYIVYMGARQHDDVDLITSTHHDMLATVLGSKEAAADSMIYS  268
            LL  Q  LV T   +   V+IVY+G +QHDD+ LIT +HHDMLA ++GSKE A++ M+YS
Sbjct  19   LLCGQGVLV-TKVEATSNVHIVYLGEKQHDDLKLITDSHHDMLANIVGSKELASELMVYS  77

Query  269  YRHGFSGFAAMMTKSHAQTFQDLPGVVKVIPNSLYKLRTTRSWDYLGLSLNSATNLLHDT  448
            Y+HGFSGFAA +T+S AQ   +LPGVV+VIPNSL+KL+TTRSW++LGLS +S TN LH++
Sbjct  78   YKHGFSGFAAKLTESQAQKLSELPGVVRVIPNSLHKLQTTRSWNFLGLSSHSPTNALHNS  137

Query  449  KMGDGTIVAVLDTGVTPENEAYNDRGLGPIPSKWKGYCES  568
             MGDG I+ V DTG+ PE++A++D GLGPIPS WKG C S
Sbjct  138  SMGDGVIIGVFDTGIWPESKAFSDEGLGPIPSHWKGVCIS  177



>ref|XP_006287119.1| hypothetical protein CARUB_v10000289mg, partial [Capsella rubella]
 gb|EOA20017.1| hypothetical protein CARUB_v10000289mg, partial [Capsella rubella]
Length=758

 Score =   210 bits (534),  Expect = 7e-60, Method: Compositional matrix adjust.
 Identities = 92/169 (54%), Positives = 128/169 (76%), Gaps = 4/169 (2%)
 Frame = +2

Query  59   LILFSFFFGCLLVFQNALVHTSALSEPKVYIVYMGARQHDDVDLITSTHHDMLATVLGSK  238
            ++L + F   +L  Q + V    ++E KVY+VY+G ++HDD++ +T +HH +L ++LGSK
Sbjct  5    IVLLALFLAIVLNVQTSFV----VAETKVYVVYLGEKKHDDIESVTESHHQILWSLLGSK  60

Query  239  EAAADSMIYSYRHGFSGFAAMMTKSHAQTFQDLPGVVKVIPNSLYKLRTTRSWDYLGLSL  418
            EA  DS++YSYRHGFSGFAA +T+S AQ   ++PGVV+VIPN+LY+L TTR+WDYLGLS 
Sbjct  61   EAVQDSIVYSYRHGFSGFAAKLTESQAQQISEIPGVVQVIPNALYELTTTRTWDYLGLSP  120

Query  419  NSATNLLHDTKMGDGTIVAVLDTGVTPENEAYNDRGLGPIPSKWKGYCE  565
             ++ +LL  T MG   IV V+DTGV PE+E +ND+G GPIPS+WKG CE
Sbjct  121  GNSQSLLQKTNMGSSVIVGVIDTGVWPESEMFNDKGYGPIPSRWKGVCE  169



>ref|XP_010661922.1| PREDICTED: LOW QUALITY PROTEIN: subtilisin-like protease SBT3.5 
[Vitis vinifera]
Length=1488

 Score =   213 bits (542),  Expect = 9e-60, Method: Compositional matrix adjust.
 Identities = 99/176 (56%), Positives = 130/176 (74%), Gaps = 7/176 (4%)
 Frame = +2

Query  41   DKNQNELILFSFFFGCLLVFQNALVHTSALSEPKVYIVYMGARQHDDVDLITSTHHDMLA  220
            D   N    F  F  CLL    AL    A +   V+IVY+G RQH+D +L+  +HHDMLA
Sbjct  15   DSMSNSTPFFVLF--CLLF---ALAQ--AETRTNVHIVYLGERQHNDPELVRDSHHDMLA  67

Query  221  TVLGSKEAAADSMIYSYRHGFSGFAAMMTKSHAQTFQDLPGVVKVIPNSLYKLRTTRSWD  400
            +++GSKE A++ M+YSY+HGFSGFAA +T+S AQ   +LPGV++VIPNSL++L+TTRSWD
Sbjct  68   SIVGSKEVASELMVYSYKHGFSGFAAKLTESQAQRIAELPGVLRVIPNSLHQLQTTRSWD  127

Query  401  YLGLSLNSATNLLHDTKMGDGTIVAVLDTGVTPENEAYNDRGLGPIPSKWKGYCES  568
            YLGLS  S  N+LH + MGDG I+ VLDTG+ PE++++ND G GPIPS+WKG CES
Sbjct  128  YLGLSFQSPKNILHSSNMGDGVIIGVLDTGIWPESKSFNDEGFGPIPSQWKGVCES  183


 Score =   162 bits (411),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 74/110 (67%), Positives = 86/110 (78%), Gaps = 0/110 (0%)
 Frame = +2

Query  239  EAAADSMIYSYRHGFSGFAAMMTKSHAQTFQDLPGVVKVIPNSLYKLRTTRSWDYLGLSL  418
            + A DSM+YSY+HGFSGFAA +T S AQ   DLPGVV VIPN L+KL+TTRSWDYLGLS 
Sbjct  783  DTAFDSMVYSYKHGFSGFAAKLTDSQAQKVADLPGVVHVIPNRLHKLQTTRSWDYLGLSS  842

Query  419  NSATNLLHDTKMGDGTIVAVLDTGVTPENEAYNDRGLGPIPSKWKGYCES  568
             S +NLLH+T MG G I+ +LDTGV PE+E +ND G GPIPS WKG C S
Sbjct  843  QSPSNLLHETNMGGGIIIGLLDTGVCPESEVFNDEGFGPIPSHWKGGCVS  892



>ref|XP_011470878.1| PREDICTED: uncharacterized protein LOC101314621 [Fragaria vesca 
subsp. vesca]
Length=1534

 Score =   213 bits (542),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 97/183 (53%), Positives = 134/183 (73%), Gaps = 3/183 (2%)
 Frame = +2

Query  20   SCVIQNMDKNQNELILFSFFFGCLLVFQNALVHTSALSEPKVYIVYMGARQHDDVDLITS  199
            S +++   +  +  + F+ FF  +L  QN+++ T   ++ KV+IVYMG + H D +++T 
Sbjct  3    SLLMKKKSQKVSLFVTFNLFF--ILCSQNSIIRT-VDAKSKVHIVYMGEKHHHDPEVVTC  59

Query  200  THHDMLATVLGSKEAAADSMIYSYRHGFSGFAAMMTKSHAQTFQDLPGVVKVIPNSLYKL  379
             HHDMLA+V+GSKEAA D+M+YSY+HGFSGFAA  T+S  +   D PGV++VIPN  + L
Sbjct  60   LHHDMLASVVGSKEAATDAMVYSYKHGFSGFAAKFTESQVKKIADFPGVIRVIPNQFHSL  119

Query  380  RTTRSWDYLGLSLNSATNLLHDTKMGDGTIVAVLDTGVTPENEAYNDRGLGPIPSKWKGY  559
            +TTRSWDYLGLS NS  NLL+DT +GDG I+ +LDTG+ PE+E +ND  LGPIPS+WKG 
Sbjct  120  QTTRSWDYLGLSPNSPKNLLNDTNLGDGIIIGLLDTGIRPESEVFNDEDLGPIPSQWKGQ  179

Query  560  CES  568
            C S
Sbjct  180  CVS  182


 Score =   173 bits (438),  Expect = 8e-46, Method: Compositional matrix adjust.
 Identities = 76/142 (54%), Positives = 108/142 (76%), Gaps = 1/142 (1%)
 Frame = +2

Query  140  KVYIVYMGARQHDDVDLITSTHHDMLATVLGSKEAAADSMIYSYRHGFSGFAAMMTKSHA  319
            +V+IVY+G ++H+D       HH ML  +LGSKEAA +S++YSY+HGFSGFAA +T+S A
Sbjct  797  QVHIVYLGEKKHEDPAFTKKFHHKMLTNLLGSKEAAYNSILYSYKHGFSGFAARLTESQA  856

Query  320  QTFQDLPGVVKVIPNSLYKLRTTRSWDYLGLSLNSATNLLHDTKMGDGTIVAVLDTGVTP  499
            +T  + PGV++VIPN ++KL TTRSWD++G+  +S  N L  + MG GTI+ V+D+GV P
Sbjct  857  ETIAEFPGVLQVIPNRVHKLHTTRSWDFIGIHQHSPENHLRRS-MGKGTIIGVIDSGVWP  915

Query  500  ENEAYNDRGLGPIPSKWKGYCE  565
            E+E++ND G+ PIPS WKG C+
Sbjct  916  ESESFNDEGMDPIPSHWKGICQ  937



>ref|XP_003634153.1| PREDICTED: subtilisin-like protease SBT3.5 [Vitis vinifera]
Length=776

 Score =   209 bits (532),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 99/171 (58%), Positives = 132/171 (77%), Gaps = 3/171 (2%)
 Frame = +2

Query  65   LFSFFFGCLLVFQNALVHTSALSEPK--VYIVYMGARQHDDVDLITSTHHDMLATVLGSK  238
            L   F    ++  N  V + + ++PK  V+IVY+G RQH D +LIT+ HH+ML TVLGSK
Sbjct  9    LILIFLASFILILNEKVSSVSPAQPKSKVHIVYLGKRQHHDPELITNIHHEMLTTVLGSK  68

Query  239  EAAADSMIYSYRHGFSGFAAMMTKSHAQTFQDLPGVVKVIPNSLYKLRTTRSWDYLGLSL  418
            EA+ DSMIYSYRHGFSGFAA +T++ AQ   +LPGVV+V+ + L+KL+TTRSWDYLGLS 
Sbjct  69   EASVDSMIYSYRHGFSGFAAKLTEAQAQAVSELPGVVQVMSSRLHKLKTTRSWDYLGLSS  128

Query  419  N-SATNLLHDTKMGDGTIVAVLDTGVTPENEAYNDRGLGPIPSKWKGYCES  568
            + S+TNLL++T  GDG I+ +LDTG+ PE+E ++D+GLGPIPS+WKG C S
Sbjct  129  SHSSTNLLYETNNGDGIIIGLLDTGIWPESEVFSDKGLGPIPSRWKGGCSS  179



>emb|CBI34614.3| unnamed protein product [Vitis vinifera]
Length=2139

 Score =   213 bits (543),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 97/176 (55%), Positives = 128/176 (73%), Gaps = 7/176 (4%)
 Frame = +2

Query  41   DKNQNELILFSFFFGCLLVFQNALVHTSALSEPKVYIVYMGARQHDDVDLITSTHHDMLA  220
            D   N    F  F  CLL          A +   V+IVY+G RQH+D +L+  +HHDMLA
Sbjct  741  DSMSNSTPFFVLF--CLL-----FALAQAETRTNVHIVYLGERQHNDPELVRDSHHDMLA  793

Query  221  TVLGSKEAAADSMIYSYRHGFSGFAAMMTKSHAQTFQDLPGVVKVIPNSLYKLRTTRSWD  400
            +++GSKE A++ M+YSY+HGFSGFAA +T+S AQ   +LPGV++VIPNSL++L+TTRSWD
Sbjct  794  SIVGSKEVASELMVYSYKHGFSGFAAKLTESQAQRIAELPGVLRVIPNSLHQLQTTRSWD  853

Query  401  YLGLSLNSATNLLHDTKMGDGTIVAVLDTGVTPENEAYNDRGLGPIPSKWKGYCES  568
            YLGLS  S  N+LH + MGDG I+ VLDTG+ PE++++ND G GPIPS+WKG CES
Sbjct  854  YLGLSFQSPKNILHSSNMGDGVIIGVLDTGIWPESKSFNDEGFGPIPSQWKGVCES  909


 Score =   200 bits (508),  Expect = 6e-55, Method: Compositional matrix adjust.
 Identities = 93/143 (65%), Positives = 112/143 (78%), Gaps = 1/143 (1%)
 Frame = +2

Query  143   VYIVYMGARQHDDVDLITSTHHDMLATVLGSKEAAA-DSMIYSYRHGFSGFAAMMTKSHA  319
             V+IVY+G RQ+ D  L+T +HHD+LA+VLG K  +A DSM+YSY+HGFSGFAA +T S A
Sbjct  1524  VHIVYLGDRQNSDPRLVTDSHHDILASVLGRKSKSAFDSMVYSYKHGFSGFAAKLTDSQA  1583

Query  320   QTFQDLPGVVKVIPNSLYKLRTTRSWDYLGLSLNSATNLLHDTKMGDGTIVAVLDTGVTP  499
             Q   DLPGVV VIPN L+KL+TTRSWDYLGLS  S +NLLH+T MG G I+ +LDTGV P
Sbjct  1584  QKVADLPGVVHVIPNRLHKLQTTRSWDYLGLSSQSPSNLLHETNMGGGIIIGLLDTGVCP  1643

Query  500   ENEAYNDRGLGPIPSKWKGYCES  568
             E+E +ND G GPIPS WKG C S
Sbjct  1644  ESEVFNDEGFGPIPSHWKGGCVS  1666



>ref|XP_011040610.1| PREDICTED: subtilisin-like protease SBT3.3 [Populus euphratica]
Length=770

 Score =   209 bits (531),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 95/162 (59%), Positives = 128/162 (79%), Gaps = 1/162 (1%)
 Frame = +2

Query  86   CLL-VFQNALVHTSALSEPKVYIVYMGARQHDDVDLITSTHHDMLATVLGSKEAAADSMI  262
            CLL ++   ++ T   +   V+IVY+G +QHDD  L T++HHDMLA+V+GSK+ AA+ M+
Sbjct  12   CLLFLWGQGMLMTKVEATSSVHIVYLGGKQHDDHILTTNSHHDMLASVVGSKDMAAELMV  71

Query  263  YSYRHGFSGFAAMMTKSHAQTFQDLPGVVKVIPNSLYKLRTTRSWDYLGLSLNSATNLLH  442
            YSY+HGFSGFAA +T S AQ   +LPGV++VIPNSL++L+TTRSWD+LGLS +S  N LH
Sbjct  72   YSYKHGFSGFAAKLTVSQAQKVSELPGVIRVIPNSLHRLQTTRSWDFLGLSSHSPVNTLH  131

Query  443  DTKMGDGTIVAVLDTGVTPENEAYNDRGLGPIPSKWKGYCES  568
             + MGDG I+ VLDTG+ PE++A++D+GLGPIPS WKG CES
Sbjct  132  KSNMGDGVIIGVLDTGIWPESKAFSDKGLGPIPSHWKGVCES  173



>gb|KJB52411.1| hypothetical protein B456_008G260500 [Gossypium raimondii]
Length=822

 Score =   208 bits (530),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 100/181 (55%), Positives = 133/181 (73%), Gaps = 6/181 (3%)
 Frame = +2

Query  32   QNMDKNQNELILFSFFFGCLLVFQNALVHTSALSEPK--VYIVYMGARQHDDVDLITSTH  205
            QNM  N     L SF    +L+  N     +A  E K  V+IVY+G RQHDD   +T +H
Sbjct  45   QNMGSNP----LPSFVIVLILLVLNGQGPMTAKVEAKSTVHIVYLGERQHDDPKRVTDSH  100

Query  206  HDMLATVLGSKEAAADSMIYSYRHGFSGFAAMMTKSHAQTFQDLPGVVKVIPNSLYKLRT  385
            HD+LAT++GSKE A+D M+YSYRHGFSGFAA +T+S A+   +LPGVV+VIPNSL++L+T
Sbjct  101  HDLLATLVGSKEVASDLMVYSYRHGFSGFAAKLTESQAKKLSELPGVVRVIPNSLHRLQT  160

Query  386  TRSWDYLGLSLNSATNLLHDTKMGDGTIVAVLDTGVTPENEAYNDRGLGPIPSKWKGYCE  565
            TRSWD+LGLS +   ++L ++KMGDG I+ V DTG+ PE++A++D GLGPIPS WKG C+
Sbjct  161  TRSWDFLGLSSHYPNHVLQNSKMGDGVIIGVFDTGIWPESKAFSDEGLGPIPSHWKGVCK  220

Query  566  S  568
            S
Sbjct  221  S  221



>emb|CBI23085.3| unnamed protein product [Vitis vinifera]
Length=1884

 Score =   211 bits (538),  Expect = 5e-59, Method: Compositional matrix adjust.
 Identities = 100/186 (54%), Positives = 137/186 (74%), Gaps = 2/186 (1%)
 Frame = +2

Query  17    ISCVIQNMDKNQNELILFSFFFGCLLVFQNALVHTS-ALSEPKVYIVYMGARQHDDVDLI  193
             IS     M    +  ++  F    +L+    +   S A ++ KV+IVY+G RQH D + I
Sbjct  1122  ISVRTHTMSSLHHGSLMLIFLASSILILNEKVSSVSPAQAKSKVHIVYLGKRQHHDPEFI  1181

Query  194   TSTHHDMLATVLGSKEAAADSMIYSYRHGFSGFAAMMTKSHAQTFQDLPGVVKVIPNSLY  373
             T+THH+ML TVLGSKEA+ DSM+YSYRHGFSGFAA +T++ AQ   +LP VV+V+P+ L+
Sbjct  1182  TNTHHEMLTTVLGSKEASVDSMLYSYRHGFSGFAAKLTEAQAQAVSELPDVVQVMPSRLH  1241

Query  374   KLRTTRSWDYLGLSLN-SATNLLHDTKMGDGTIVAVLDTGVTPENEAYNDRGLGPIPSKW  550
             KL+TTRSWDYLGLS + S+TNLLH+T MGDG I+ +LD+G+ PE++ ++D+GLGPIPS+W
Sbjct  1242  KLKTTRSWDYLGLSSSHSSTNLLHETNMGDGIIIGLLDSGIWPESKVFSDKGLGPIPSRW  1301

Query  551   KGYCES  568
             KG C S
Sbjct  1302  KGGCSS  1307


 Score =   189 bits (480),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 97/183 (53%), Positives = 127/183 (69%), Gaps = 11/183 (6%)
 Frame = +2

Query  17   ISCVIQNMDKNQNELILFSFFFGCLL---VFQNALVHTSALSEP-------KVYIVYMGA  166
            I  +I++M +  +EL+ F  F G  L   +     V    + E         VYIVYMG 
Sbjct  441  IEYLIEDMGREVDELLAFPAFLGYKLDDRIKHRYEVKKKIIGEGMSLNKLLSVYIVYMGE  500

Query  167  RQHDDVDLITSTHHDMLATVLGSKEAAADSMIYSYRHGFSGFAAMMTKSHAQTFQDLPGV  346
            RQH ++DLIT  HH ML+ VLGS EA+ +SM+YSY+HGFSGFAA +T++ AQ F +LP V
Sbjct  501  RQHGNLDLITDGHHRMLSEVLGSDEASVESMVYSYKHGFSGFAAKLTEAQAQMFAELPDV  560

Query  347  VKVIPNSLYKLRTTRSWDYLGLSLNSATNLLHDTKMGDGTIVAVLDTGVTPENEAYNDRG  526
            V+VIPN L+KL+TTRSWDYLGL L+S T+LLH+TKMGDGTI+ +LDTG+ PE+E +  RG
Sbjct  561  VQVIPNRLHKLQTTRSWDYLGLPLDSPTSLLHETKMGDGTIIGLLDTGIWPESEVFM-RG  619

Query  527  LGP  535
              P
Sbjct  620  GAP  622



>ref|XP_011038008.1| PREDICTED: subtilisin-like protease SBT3.5 isoform X1 [Populus 
euphratica]
 ref|XP_011038009.1| PREDICTED: subtilisin-like protease SBT3.5 isoform X1 [Populus 
euphratica]
Length=775

 Score =   207 bits (527),  Expect = 6e-59, Method: Compositional matrix adjust.
 Identities = 96/164 (59%), Positives = 125/164 (76%), Gaps = 3/164 (2%)
 Frame = +2

Query  86   CLLVF---QNALVHTSALSEPKVYIVYMGARQHDDVDLITSTHHDMLATVLGSKEAAADS  256
            CL +F   Q  L  T   +   V+IVY+G +QHDD  L T +HHDMLA V+GSKE A++ 
Sbjct  12   CLFLFLCGQVILTITKVEATSNVHIVYLGGKQHDDPILKTDSHHDMLANVVGSKEIASEL  71

Query  257  MIYSYRHGFSGFAAMMTKSHAQTFQDLPGVVKVIPNSLYKLRTTRSWDYLGLSLNSATNL  436
            M+YSY+HGF GFAA +T+S AQ   +LPGVV+VIPNSL++L+T+RSWD+LGLS +S  N 
Sbjct  72   MVYSYKHGFYGFAAKLTESQAQKVAELPGVVRVIPNSLHRLQTSRSWDFLGLSAHSPANT  131

Query  437  LHDTKMGDGTIVAVLDTGVTPENEAYNDRGLGPIPSKWKGYCES  568
            LH++ MGDG I+ VLDTG+ PE +A++D+GLGPIPS WKG CES
Sbjct  132  LHNSSMGDGVIIGVLDTGIWPEAKAFSDKGLGPIPSHWKGVCES  175



>emb|CBI23086.3| unnamed protein product [Vitis vinifera]
Length=842

 Score =   206 bits (523),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 97/163 (60%), Positives = 130/163 (80%), Gaps = 3/163 (2%)
 Frame = +2

Query  89   LLVFQNALVHTSALSEPK--VYIVYMGARQHDDVDLITSTHHDMLATVLGSKEAAADSMI  262
             ++  N  V + + ++PK  V+IVY+G RQH D +LIT+ HH+ML TVLGSKEA+ DSMI
Sbjct  83   FILILNEKVSSVSPAQPKSKVHIVYLGKRQHHDPELITNIHHEMLTTVLGSKEASVDSMI  142

Query  263  YSYRHGFSGFAAMMTKSHAQTFQDLPGVVKVIPNSLYKLRTTRSWDYLGLSLN-SATNLL  439
            YSYRHGFSGFAA +T++ AQ   +LPGVV+V+ + L+KL+TTRSWDYLGLS + S+TNLL
Sbjct  143  YSYRHGFSGFAAKLTEAQAQAVSELPGVVQVMSSRLHKLKTTRSWDYLGLSSSHSSTNLL  202

Query  440  HDTKMGDGTIVAVLDTGVTPENEAYNDRGLGPIPSKWKGYCES  568
            ++T  GDG I+ +LDTG+ PE+E ++D+GLGPIPS+WKG C S
Sbjct  203  YETNNGDGIIIGLLDTGIWPESEVFSDKGLGPIPSRWKGGCSS  245



>ref|XP_006306822.1| hypothetical protein CARUB_v10008364mg [Capsella rubella]
 gb|EOA39720.1| hypothetical protein CARUB_v10008364mg [Capsella rubella]
Length=770

 Score =   205 bits (521),  Expect = 5e-58, Method: Compositional matrix adjust.
 Identities = 93/148 (63%), Positives = 119/148 (80%), Gaps = 0/148 (0%)
 Frame = +2

Query  125  ALSEPKVYIVYMGARQHDDVDLITSTHHDMLATVLGSKEAAADSMIYSYRHGFSGFAAMM  304
            A +E KV+IVY+G +QHDD + +T +HH ML+T+LGSK+ A DSM+YSYRHGFSGFAA +
Sbjct  23   AGAEVKVHIVYLGEKQHDDPEFVTESHHQMLSTLLGSKKDAHDSMVYSYRHGFSGFAAKL  82

Query  305  TKSHAQTFQDLPGVVKVIPNSLYKLRTTRSWDYLGLSLNSATNLLHDTKMGDGTIVAVLD  484
            TKS A+T  +LP VV VIP+ +Y+L TTR+WDYLGLS  +  NLL DT MGD  I+ V+D
Sbjct  83   TKSQARTIAELPEVVHVIPDGVYELATTRTWDYLGLSGANPNNLLTDTNMGDQVIIGVID  142

Query  485  TGVTPENEAYNDRGLGPIPSKWKGYCES  568
            TGV PE+E++ND+G+GPIP KWKG CES
Sbjct  143  TGVWPESESFNDKGVGPIPRKWKGGCES  170



>ref|XP_002872522.1| subtilase family protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH48781.1| subtilase family protein [Arabidopsis lyrata subsp. lyrata]
Length=737

 Score =   204 bits (519),  Expect = 7e-58, Method: Compositional matrix adjust.
 Identities = 93/170 (55%), Positives = 129/170 (76%), Gaps = 4/170 (2%)
 Frame = +2

Query  59   LILFSFFFGCLLVFQNALVHTSALSEPKVYIVYMGARQHDDVDLITSTHHDMLATVLGSK  238
            +ILF+ F   +L  Q + V    ++E KVYIVY+G ++HD+ + +T +HH ML+++LGSK
Sbjct  5    IILFALFLSIVLNVQISFV----VAESKVYIVYLGEKEHDNPESVTESHHQMLSSLLGSK  60

Query  239  EAAADSMIYSYRHGFSGFAAMMTKSHAQTFQDLPGVVKVIPNSLYKLRTTRSWDYLGLSL  418
            +A  DS++YSYRHGFSGFAA +T+S AQ   +LP VV+VIPN+LY++ TTR+WDYLG+S 
Sbjct  61   KAVLDSIVYSYRHGFSGFAAKLTESQAQQISELPEVVQVIPNTLYEMTTTRTWDYLGISP  120

Query  419  NSATNLLHDTKMGDGTIVAVLDTGVTPENEAYNDRGLGPIPSKWKGYCES  568
             ++ +LL   +MG   IV VLDTGV PE+E +ND+G GPIPS+WKG CES
Sbjct  121  GNSDSLLEKARMGYQVIVGVLDTGVWPESEMFNDKGYGPIPSRWKGGCES  170



>gb|KFK31853.1| hypothetical protein AALP_AA6G166900 [Arabis alpina]
Length=787

 Score =   204 bits (518),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 93/156 (60%), Positives = 120/156 (77%), Gaps = 1/156 (1%)
 Frame = +2

Query  101  QNALVHTSALSEPKVYIVYMGARQHDDVDLITSTHHDMLATVLGSKEAAADSMIYSYRHG  280
            QN+ +   A  + KV+IVY+G +QHDD + +T +HH ML ++LGSKE A DSM+YSYRHG
Sbjct  29   QNSFM-ARASPDSKVHIVYLGEKQHDDPEFVTESHHQMLWSLLGSKEDARDSMVYSYRHG  87

Query  281  FSGFAAMMTKSHAQTFQDLPGVVKVIPNSLYKLRTTRSWDYLGLSLNSATNLLHDTKMGD  460
            FSGFAA +TKS A+   DLPGVV VIP+S YKL TTR+WDYLGLS  +  NLL++T MG+
Sbjct  88   FSGFAAKLTKSQAKKLADLPGVVHVIPHSFYKLSTTRTWDYLGLSAANPKNLLNETNMGE  147

Query  461  GTIVAVLDTGVTPENEAYNDRGLGPIPSKWKGYCES  568
              I+ ++DTGV PE+E +ND G+GP+PS WKG CES
Sbjct  148  QMIIGIIDTGVWPESEVFNDNGIGPVPSHWKGGCES  183



>gb|KFK45040.1| hypothetical protein AALP_AA1G336300 [Arabis alpina]
Length=776

 Score =   203 bits (516),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 91/147 (62%), Positives = 116/147 (79%), Gaps = 0/147 (0%)
 Frame = +2

Query  128  LSEPKVYIVYMGARQHDDVDLITSTHHDMLATVLGSKEAAADSMIYSYRHGFSGFAAMMT  307
            +S  KV+IVY+G +QHDD + +T +HH ML+++LGSKE A DSM++SYRHGFSGFAA +T
Sbjct  26   ISSSKVHIVYLGEKQHDDPEFVTDSHHQMLSSLLGSKEDAHDSMVHSYRHGFSGFAAKLT  85

Query  308  KSHAQTFQDLPGVVKVIPNSLYKLRTTRSWDYLGLSLNSATNLLHDTKMGDGTIVAVLDT  487
            +S A+   D PGVV V+P+SLYKL TTR+WDYLGLS  +  NLL D  MGD  I+  +DT
Sbjct  86   ESQAKKIADSPGVVHVVPDSLYKLATTRTWDYLGLSAPNPKNLLDDVNMGDQVIIGFIDT  145

Query  488  GVTPENEAYNDRGLGPIPSKWKGYCES  568
            GV PE+E++ND G+GPIPSKWKG CES
Sbjct  146  GVWPESESFNDNGVGPIPSKWKGGCES  172



>ref|NP_567360.1| Subtilase family protein [Arabidopsis thaliana]
 gb|AAD03437.1| similar to the subtilase family of serine proteases (Pfam: PF00082, 
Score=50.7, E=4.7e-13, n=3) [Arabidopsis thaliana]
 emb|CAB40046.1| putative subtilisin-like protease [Arabidopsis thaliana]
 emb|CAB78176.1| putative subtilisin-like protease [Arabidopsis thaliana]
 gb|AEE82894.1| Subtilase family protein [Arabidopsis thaliana]
Length=747

 Score =   202 bits (514),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 92/170 (54%), Positives = 127/170 (75%), Gaps = 4/170 (2%)
 Frame = +2

Query  59   LILFSFFFGCLLVFQNALVHTSALSEPKVYIVYMGARQHDDVDLITSTHHDMLATVLGSK  238
            +IL +FF   +L  Q + V    ++E KVY+VY+G ++HD+ + +T +HH ML ++LGSK
Sbjct  5    IILLAFFLSIVLNVQISFV----VAESKVYVVYLGEKEHDNPESVTESHHQMLWSLLGSK  60

Query  239  EAAADSMIYSYRHGFSGFAAMMTKSHAQTFQDLPGVVKVIPNSLYKLRTTRSWDYLGLSL  418
            EA  DS++YSYRHGFSGFAA +T+S AQ   +LP VV+VIPN+LY++ TTR+WDYLG+S 
Sbjct  61   EAVLDSIVYSYRHGFSGFAAKLTESQAQQISELPEVVQVIPNTLYEMTTTRTWDYLGVSP  120

Query  419  NSATNLLHDTKMGDGTIVAVLDTGVTPENEAYNDRGLGPIPSKWKGYCES  568
             ++ +LL    MG   IV V+DTGV PE+E +ND+G GPIPS+WKG CES
Sbjct  121  GNSDSLLQKANMGYNVIVGVIDTGVWPESEMFNDKGYGPIPSRWKGGCES  170



>ref|XP_010421967.1| PREDICTED: subtilisin-like protease SBT3.3 [Camelina sativa]
Length=761

 Score =   201 bits (512),  Expect = 8e-57, Method: Compositional matrix adjust.
 Identities = 90/170 (53%), Positives = 127/170 (75%), Gaps = 4/170 (2%)
 Frame = +2

Query  59   LILFSFFFGCLLVFQNALVHTSALSEPKVYIVYMGARQHDDVDLITSTHHDMLATVLGSK  238
            +IL + F   +L  Q +     A++E KVY+VY+G ++HD+ + +T +HH +L ++LGSK
Sbjct  5    IILLALFLSIVLNVQISF----AVAERKVYVVYLGEKEHDNPESVTESHHQILWSLLGSK  60

Query  239  EAAADSMIYSYRHGFSGFAAMMTKSHAQTFQDLPGVVKVIPNSLYKLRTTRSWDYLGLSL  418
            E+  DS++YSYRHGFSGFAA +T+S AQ   +LP VV+VIPN+LY++ TTR+WDYLGLS 
Sbjct  61   ESVHDSIVYSYRHGFSGFAAKLTESQAQQISELPEVVQVIPNTLYEMTTTRTWDYLGLSP  120

Query  419  NSATNLLHDTKMGDGTIVAVLDTGVTPENEAYNDRGLGPIPSKWKGYCES  568
             +  +LLH   MG+  IV V+D+GV PE+E +ND+G GPIPS+WKG CES
Sbjct  121  GTPKSLLHKANMGNSVIVGVIDSGVWPESEMFNDKGYGPIPSRWKGGCES  170



>ref|XP_010461117.1| PREDICTED: LOW QUALITY PROTEIN: subtilisin-like protease SBT3.3 
[Camelina sativa]
Length=755

 Score =   201 bits (510),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 92/148 (62%), Positives = 115/148 (78%), Gaps = 0/148 (0%)
 Frame = +2

Query  125  ALSEPKVYIVYMGARQHDDVDLITSTHHDMLATVLGSKEAAADSMIYSYRHGFSGFAAMM  304
            A +E KV+IVY+G +QH D + +T +HH ML ++LGSK+ A DSM+YSYRHGFSGFAA +
Sbjct  23   AGAESKVHIVYLGEKQHHDPEFVTKSHHQMLWSLLGSKKDAHDSMVYSYRHGFSGFAAKL  82

Query  305  TKSHAQTFQDLPGVVKVIPNSLYKLRTTRSWDYLGLSLNSATNLLHDTKMGDGTIVAVLD  484
            TKS A+   DLP VV VIP+  Y+L TTR+WDYLGLS  S  NLL+DT MGD  I+ V+D
Sbjct  83   TKSQAKKIADLPEVVHVIPDGFYELATTRTWDYLGLSAASPKNLLNDTNMGDQVIIGVID  142

Query  485  TGVTPENEAYNDRGLGPIPSKWKGYCES  568
            TGV PE+E++ND G+GPIP KWKG CES
Sbjct  143  TGVWPESESFNDNGVGPIPRKWKGGCES  170



>ref|XP_009128704.1| PREDICTED: subtilisin-like protease SBT5.3 isoform X1 [Brassica 
rapa]
Length=779

 Score =   201 bits (510),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 92/167 (55%), Positives = 125/167 (75%), Gaps = 2/167 (1%)
 Frame = +2

Query  74   FFFGCLLVFQN--ALVHTSALSEPKVYIVYMGARQHDDVDLITSTHHDMLATVLGSKEAA  247
            F    L++F N  ++    A++E KV+IVY+G +QHDD + +T +HH ML ++LGSKE A
Sbjct  9    FVVLSLIIFLNGQSIFVARAVAESKVHIVYLGQKQHDDPEFVTESHHQMLCSLLGSKEDA  68

Query  248  ADSMIYSYRHGFSGFAAMMTKSHAQTFQDLPGVVKVIPNSLYKLRTTRSWDYLGLSLNSA  427
              SM+YSYRHGFSGFAA +TKS A+   +LP VV VIP+S YKL+TTR+WDYLGLS +S 
Sbjct  69   HGSMVYSYRHGFSGFAAKLTKSQAKKIANLPEVVHVIPDSFYKLKTTRTWDYLGLSASSP  128

Query  428  TNLLHDTKMGDGTIVAVLDTGVTPENEAYNDRGLGPIPSKWKGYCES  568
             NLL++T MG+  I+ ++DTGV PE+E +ND G+G +PS WKG C+S
Sbjct  129  KNLLNETNMGEQIIIGIIDTGVWPESEVFNDDGIGSVPSHWKGGCQS  175



>emb|CDY67954.1| BnaAnng25710D [Brassica napus]
Length=775

 Score =   200 bits (509),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 92/167 (55%), Positives = 125/167 (75%), Gaps = 2/167 (1%)
 Frame = +2

Query  74   FFFGCLLVFQN--ALVHTSALSEPKVYIVYMGARQHDDVDLITSTHHDMLATVLGSKEAA  247
            F    L++F N  ++    A++E KV+IVY+G +QHDD + +T +HH ML ++LGSKE A
Sbjct  9    FVVLSLIIFLNGQSIFVARAVAESKVHIVYLGQKQHDDPEFVTESHHQMLCSLLGSKEDA  68

Query  248  ADSMIYSYRHGFSGFAAMMTKSHAQTFQDLPGVVKVIPNSLYKLRTTRSWDYLGLSLNSA  427
              SM+YSYRHGFSGFAA +TKS A+   +LP VV VIP+S YKL+TTR+WDYLGLS +S 
Sbjct  69   HGSMVYSYRHGFSGFAAKLTKSQAKKIANLPEVVHVIPDSFYKLKTTRTWDYLGLSASSP  128

Query  428  TNLLHDTKMGDGTIVAVLDTGVTPENEAYNDRGLGPIPSKWKGYCES  568
             NLL++T MG+  I+ ++DTGV PE+E +ND G+G +PS WKG C+S
Sbjct  129  KNLLNETNMGEQIIIGIIDTGVWPESEVFNDDGIGSVPSHWKGGCQS  175



>ref|XP_002891022.1| subtilase family protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH67281.1| subtilase family protein [Arabidopsis lyrata subsp. lyrata]
Length=774

 Score =   200 bits (509),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 91/148 (61%), Positives = 115/148 (78%), Gaps = 0/148 (0%)
 Frame = +2

Query  125  ALSEPKVYIVYMGARQHDDVDLITSTHHDMLATVLGSKEAAADSMIYSYRHGFSGFAAMM  304
            A SE KV+IVY+G +QH D + +T +HH ML ++LGSK+ A DSM+YSYRHGFSGFAA +
Sbjct  23   AGSESKVHIVYLGEKQHHDPEFVTKSHHQMLVSLLGSKKDADDSMVYSYRHGFSGFAAKL  82

Query  305  TKSHAQTFQDLPGVVKVIPNSLYKLRTTRSWDYLGLSLNSATNLLHDTKMGDGTIVAVLD  484
            TKS A+   DLP VV VIP+  ++L TTR+WDYLGLS  +  NLL+DT MGD  I+ V+D
Sbjct  83   TKSQAKKIADLPEVVHVIPDGFHELATTRTWDYLGLSAANPKNLLNDTNMGDQVIIGVID  142

Query  485  TGVTPENEAYNDRGLGPIPSKWKGYCES  568
            TGV PE+E++ND G+GPIP KWKG CES
Sbjct  143  TGVWPESESFNDNGVGPIPRKWKGGCES  170



>ref|XP_011081355.1| PREDICTED: subtilisin-like protease SBT3.5 isoform X1 [Sesamum 
indicum]
Length=805

 Score =   200 bits (509),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 90/146 (62%), Positives = 112/146 (77%), Gaps = 0/146 (0%)
 Frame = +2

Query  131  SEPKVYIVYMGARQHDDVDLITSTHHDMLATVLGSKEAAADSMIYSYRHGFSGFAAMMTK  310
            S   VYIVY+G RQH+D  L+T +HHDML  ++GSKE A +SM+YSYRHGFSGFAA +T 
Sbjct  38   SNVSVYIVYLGERQHNDPKLVTDSHHDMLTNLMGSKELAKESMVYSYRHGFSGFAAKLTA  97

Query  311  SHAQTFQDLPGVVKVIPNSLYKLRTTRSWDYLGLSLNSATNLLHDTKMGDGTIVAVLDTG  490
            S AQ   + P VV V+PNS YKL+TTRSWDYLGLS  +  NLL+ + MGDG I+ VLDTG
Sbjct  98   SQAQQLSEHPDVVGVMPNSFYKLQTTRSWDYLGLSPQTPNNLLNKSNMGDGVIIGVLDTG  157

Query  491  VTPENEAYNDRGLGPIPSKWKGYCES  568
            + PE++A+ D GLG IPS WKG+C+S
Sbjct  158  IWPESKAFRDEGLGEIPSGWKGFCQS  183



>ref|XP_011081356.1| PREDICTED: subtilisin-like protease SBT3.5 isoform X2 [Sesamum 
indicum]
Length=782

 Score =   200 bits (508),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 90/146 (62%), Positives = 112/146 (77%), Gaps = 0/146 (0%)
 Frame = +2

Query  131  SEPKVYIVYMGARQHDDVDLITSTHHDMLATVLGSKEAAADSMIYSYRHGFSGFAAMMTK  310
            S   VYIVY+G RQH+D  L+T +HHDML  ++GSKE A +SM+YSYRHGFSGFAA +T 
Sbjct  38   SNVSVYIVYLGERQHNDPKLVTDSHHDMLTNLMGSKELAKESMVYSYRHGFSGFAAKLTA  97

Query  311  SHAQTFQDLPGVVKVIPNSLYKLRTTRSWDYLGLSLNSATNLLHDTKMGDGTIVAVLDTG  490
            S AQ   + P VV V+PNS YKL+TTRSWDYLGLS  +  NLL+ + MGDG I+ VLDTG
Sbjct  98   SQAQQLSEHPDVVGVMPNSFYKLQTTRSWDYLGLSPQTPNNLLNKSNMGDGVIIGVLDTG  157

Query  491  VTPENEAYNDRGLGPIPSKWKGYCES  568
            + PE++A+ D GLG IPS WKG+C+S
Sbjct  158  IWPESKAFRDEGLGEIPSGWKGFCQS  183



>ref|XP_006287107.1| hypothetical protein CARUB_v10000269mg [Capsella rubella]
 gb|EOA20005.1| hypothetical protein CARUB_v10000269mg [Capsella rubella]
Length=780

 Score =   200 bits (508),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 92/160 (58%), Positives = 121/160 (76%), Gaps = 1/160 (1%)
 Frame = +2

Query  89   LLVFQNALVHTSALSEPKVYIVYMGARQHDDVDLITSTHHDMLATVLGSKEAAADSMIYS  268
             L  Q + V   A+ E KV+IVY+G +QHDD + +T +HH ML ++LGSKE A +S++YS
Sbjct  18   FLNVQRSFV-AQAIVERKVHIVYLGEKQHDDPEFVTESHHQMLWSLLGSKEDAHESLVYS  76

Query  269  YRHGFSGFAAMMTKSHAQTFQDLPGVVKVIPNSLYKLRTTRSWDYLGLSLNSATNLLHDT  448
            YRHGFSGFAA +TKS A+   D+P VV VIP+S YKL+TTR+WDYLGLS  +  NLL++T
Sbjct  77   YRHGFSGFAAKLTKSQAKKIADVPEVVHVIPDSFYKLKTTRTWDYLGLSAANPKNLLNET  136

Query  449  KMGDGTIVAVLDTGVTPENEAYNDRGLGPIPSKWKGYCES  568
             MG  +I+ V+DTGV PE+E +ND G+GP+PS WKG CES
Sbjct  137  NMGAQSIIGVIDTGVWPESEVFNDHGIGPVPSHWKGGCES  176



>ref|XP_010318062.1| PREDICTED: subtilisin-like protease SBT3.3 isoform X3 [Solanum 
lycopersicum]
 ref|XP_010318063.1| PREDICTED: subtilisin-like protease SBT3.3 isoform X3 [Solanum 
lycopersicum]
Length=732

 Score =   199 bits (507),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 90/138 (65%), Positives = 113/138 (82%), Gaps = 1/138 (1%)
 Frame = +2

Query  158  MGARQHDDVDLITSTHHDMLATVLGSKEAAADSMIYSYRHGFSGFAAMMTKSHAQTFQDL  337
            MG RQHDDV+L TS HH +L +V+GS++AA DS+IYSY+HGFSGFAA +TKS A+   +L
Sbjct  1    MGRRQHDDVELATSAHHQLLTSVMGSQKAARDSIIYSYKHGFSGFAARLTKSQAKKIAEL  60

Query  338  PGVVKVIPNSLYKLRTTRSWDYLGLSLNS-ATNLLHDTKMGDGTIVAVLDTGVTPENEAY  514
            P VV V+PN  +KL T RSWDYLGLS +S  TNLLH+  MGDG I+ VLDTG+ PE+EA+
Sbjct  61   PDVVHVVPNHFFKLHTRRSWDYLGLSESSPPTNLLHEANMGDGIIIGVLDTGIWPESEAF  120

Query  515  NDRGLGPIPSKWKGYCES  568
            ND+GLGPIPS+WKG+C+S
Sbjct  121  NDKGLGPIPSRWKGHCQS  138



>ref|XP_010455451.1| PREDICTED: subtilisin-like protease SBT3.5 [Camelina sativa]
Length=1533

 Score =   202 bits (515),  Expect = 5e-56, Method: Compositional matrix adjust.
 Identities = 96/168 (57%), Positives = 124/168 (74%), Gaps = 2/168 (1%)
 Frame = +2

Query  71   SFFFGCLLVFQNALVHTSAL--SEPKVYIVYMGARQHDDVDLITSTHHDMLATVLGSKEA  244
            S F   L++F N   +  A   +E KV+IV++G +QHDD D +T THH ML ++LGSKE 
Sbjct  7    SIFVLSLVIFLNVQRNFVAQGSAERKVHIVHLGEKQHDDPDFVTETHHQMLWSLLGSKED  66

Query  245  AADSMIYSYRHGFSGFAAMMTKSHAQTFQDLPGVVKVIPNSLYKLRTTRSWDYLGLSLNS  424
              DSM+YSYRHGFSGFAA +TK+ A+   DLP VV VIP+S YKL+TTR+WDYLGLS  +
Sbjct  67   VHDSMVYSYRHGFSGFAAKLTKTQAKKIADLPEVVHVIPDSFYKLKTTRTWDYLGLSAAN  126

Query  425  ATNLLHDTKMGDGTIVAVLDTGVTPENEAYNDRGLGPIPSKWKGYCES  568
              NLL +T MG+ +I+ V+DTGV PE+E +ND G+GP+PS WKG CES
Sbjct  127  PRNLLDETNMGEQSIIGVIDTGVWPESEVFNDYGIGPVPSHWKGGCES  174


 Score =   186 bits (472),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 88/160 (55%), Positives = 120/160 (75%), Gaps = 1/160 (1%)
 Frame = +2

Query  89   LLVFQNALVHTSALSEPKVYIVYMGARQHDDVDLITSTHHDMLATVLGSKEAAADSMIYS  268
            +L  Q+A V   A +E KV+IVY+G +QHDD + +T +HH ML ++LGSK+ A +S+++S
Sbjct  771  ILNGQSAFV-AQAGAESKVHIVYLGEKQHDDPESVTESHHQMLWSLLGSKKDADNSLVHS  829

Query  269  YRHGFSGFAAMMTKSHAQTFQDLPGVVKVIPNSLYKLRTTRSWDYLGLSLNSATNLLHDT  448
            YRHGFSGFAA +TKS A+   DLP VV V P+S Y+L TT++WDYLGLS  +  NLL+DT
Sbjct  830  YRHGFSGFAAKLTKSQAKKIADLPEVVHVTPDSFYELATTQTWDYLGLSAANPKNLLNDT  889

Query  449  KMGDGTIVAVLDTGVTPENEAYNDRGLGPIPSKWKGYCES  568
             MG+  I+ V+D+GV PE+E +ND  +GPIPS WKG CE+
Sbjct  890  NMGEDVIIGVVDSGVWPESEVFNDNVIGPIPSHWKGGCEA  929



>ref|XP_010056036.1| PREDICTED: subtilisin-like protease SBT5.3 [Eucalyptus grandis]
Length=774

 Score =   199 bits (505),  Expect = 7e-56, Method: Compositional matrix adjust.
 Identities = 93/166 (56%), Positives = 126/166 (76%), Gaps = 2/166 (1%)
 Frame = +2

Query  71   SFFFGCLLVFQNALVHTSALSEPKVYIVYMGARQHDDVDLITSTHHDMLATVLGSKEAAA  250
            S    C L+ Q  +  T   ++  VYIVY G R+  D  + T +HHDMLA+VLGSKEAAA
Sbjct  7    SLVVACFLLGQWGITRT-VKAKSNVYIVYFGVRKQGDPTVETDSHHDMLASVLGSKEAAA  65

Query  251  DSMIYSYRHGFSGFAAMMTKSHAQTFQDLPGVVKVIPNSLYKLRTTRSWDYLGLSLN-SA  427
             S++YSYRHGFSGFAA +T+S AQ     PGVV+V+PN+L++L+TTRSWD+LGLS + S 
Sbjct  66   ISILYSYRHGFSGFAAKLTESQAQELAGFPGVVRVMPNTLFRLQTTRSWDFLGLSPSHSP  125

Query  428  TNLLHDTKMGDGTIVAVLDTGVTPENEAYNDRGLGPIPSKWKGYCE  565
            T+LL+ ++MGDG IV ++DTG+ PE+++++D GLGPIPS+WKG CE
Sbjct  126  TSLLYKSRMGDGVIVGMIDTGIWPESKSFSDEGLGPIPSRWKGGCE  171



>gb|AAD03431.1| similar to the subtilase family of serine proteases (Pfam: PF00082, 
score; 45.8, E=1.1e-11, n=2) [Arabidopsis thaliana]
Length=751

 Score =   198 bits (504),  Expect = 8e-56, Method: Compositional matrix adjust.
 Identities = 92/160 (58%), Positives = 120/160 (75%), Gaps = 1/160 (1%)
 Frame = +2

Query  89   LLVFQNALVHTSALSEPKVYIVYMGARQHDDVDLITSTHHDMLATVLGSKEAAADSMIYS  268
             L  Q + V  S+ ++ KV+IVY+G +QHDD + +T +HH ML ++LGSKE A DSM+YS
Sbjct  17   FLNVQRSFVAESS-AKRKVHIVYLGEKQHDDPEFVTESHHRMLWSLLGSKEDANDSMVYS  75

Query  269  YRHGFSGFAAMMTKSHAQTFQDLPGVVKVIPNSLYKLRTTRSWDYLGLSLNSATNLLHDT  448
            YRHGFSGFAA +T+S A+   DLP VV VIP+S YKL TTR+WDYLGLS  +  +LLH+T
Sbjct  76   YRHGFSGFAAKLTESQAKKIADLPDVVHVIPDSFYKLATTRTWDYLGLSAANPKSLLHET  135

Query  449  KMGDGTIVAVLDTGVTPENEAYNDRGLGPIPSKWKGYCES  568
             MG+  I+ V+DTGV PE+E +ND G GP+PS WKG CE+
Sbjct  136  NMGEQIIIGVIDTGVWPESEVFNDSGFGPVPSHWKGGCET  175



>ref|XP_010056037.1| PREDICTED: subtilisin-like protease SBT5.3 [Eucalyptus grandis]
Length=773

 Score =   198 bits (504),  Expect = 9e-56, Method: Compositional matrix adjust.
 Identities = 92/161 (57%), Positives = 126/161 (78%), Gaps = 2/161 (1%)
 Frame = +2

Query  86   CLLVFQNALVHTSALSEPKVYIVYMGARQHDDVDLITSTHHDMLATVLGSKEAAADSMIY  265
            C L+ Q  +  T   ++  VYIVY GAR+  D  + T++HHDMLA+VLGSKEAAA S++Y
Sbjct  12   CFLLGQWGITRT-VKAKSNVYIVYFGARKQGDPTVETNSHHDMLASVLGSKEAAAKSILY  70

Query  266  SYRHGFSGFAAMMTKSHAQTFQDLPGVVKVIPNSLYKLRTTRSWDYLGLSLN-SATNLLH  442
            SY HGFSGFAA +T+S AQ     PGVV+V+PN+L++L+TTRSWD+LGLS + S T+LL+
Sbjct  71   SYSHGFSGFAAKLTESQAQELAGFPGVVRVMPNTLFRLQTTRSWDFLGLSPSHSPTSLLY  130

Query  443  DTKMGDGTIVAVLDTGVTPENEAYNDRGLGPIPSKWKGYCE  565
             ++MGDG IV ++DTG+ PE+++++D GLGPIPS+WKG CE
Sbjct  131  KSRMGDGVIVGMIDTGIWPESKSFSDEGLGPIPSRWKGGCE  171



>ref|XP_009128710.1| PREDICTED: subtilisin-like protease SBT5.3 [Brassica rapa]
Length=764

 Score =   198 bits (504),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 93/170 (55%), Positives = 123/170 (72%), Gaps = 1/170 (1%)
 Frame = +2

Query  59   LILFSFFFGCLLVFQNALVHTSALSEPKVYIVYMGARQHDDVDLITSTHHDMLATVLGSK  238
            +IL +     ++  Q+  V   A +E KVY+VY+G ++HDD   +T  HH ML ++LGSK
Sbjct  5    IILVAIILTVVMNAQSTFVVGDA-AERKVYVVYLGEKEHDDPASVTEYHHQMLWSLLGSK  63

Query  239  EAAADSMIYSYRHGFSGFAAMMTKSHAQTFQDLPGVVKVIPNSLYKLRTTRSWDYLGLSL  418
            E+  DS++YSYRHGFSGFAA +T+S AQ   +LP VV VIPN+LY+L TTR+WDYLGLS 
Sbjct  64   ESVHDSIVYSYRHGFSGFAAKLTESQAQQLSELPEVVHVIPNTLYELTTTRTWDYLGLSP  123

Query  419  NSATNLLHDTKMGDGTIVAVLDTGVTPENEAYNDRGLGPIPSKWKGYCES  568
             ++ +L+H   MG   IV V+DTGV PE+E YND+G GPIPS+WKG CES
Sbjct  124  GTSKSLVHKADMGRKIIVGVIDTGVWPESEMYNDKGYGPIPSRWKGSCES  173



>ref|NP_567362.1| subtilisin-like protease [Arabidopsis thaliana]
 gb|AAM91616.1| putative subtilisin serine protease [Arabidopsis thaliana]
 gb|AEE82896.1| subtilisin-like protease [Arabidopsis thaliana]
Length=778

 Score =   198 bits (503),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 92/160 (58%), Positives = 120/160 (75%), Gaps = 1/160 (1%)
 Frame = +2

Query  89   LLVFQNALVHTSALSEPKVYIVYMGARQHDDVDLITSTHHDMLATVLGSKEAAADSMIYS  268
             L  Q + V  S+ ++ KV+IVY+G +QHDD + +T +HH ML ++LGSKE A DSM+YS
Sbjct  17   FLNVQRSFVAESS-AKRKVHIVYLGEKQHDDPEFVTESHHRMLWSLLGSKEDANDSMVYS  75

Query  269  YRHGFSGFAAMMTKSHAQTFQDLPGVVKVIPNSLYKLRTTRSWDYLGLSLNSATNLLHDT  448
            YRHGFSGFAA +T+S A+   DLP VV VIP+S YKL TTR+WDYLGLS  +  +LLH+T
Sbjct  76   YRHGFSGFAAKLTESQAKKIADLPDVVHVIPDSFYKLATTRTWDYLGLSAANPKSLLHET  135

Query  449  KMGDGTIVAVLDTGVTPENEAYNDRGLGPIPSKWKGYCES  568
             MG+  I+ V+DTGV PE+E +ND G GP+PS WKG CE+
Sbjct  136  NMGEQIIIGVIDTGVWPESEVFNDSGFGPVPSHWKGGCET  175



>ref|XP_006397045.1| hypothetical protein EUTSA_v10028448mg [Eutrema salsugineum]
 gb|ESQ38498.1| hypothetical protein EUTSA_v10028448mg [Eutrema salsugineum]
Length=777

 Score =   198 bits (503),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 91/165 (55%), Positives = 118/165 (72%), Gaps = 0/165 (0%)
 Frame = +2

Query  74   FFFGCLLVFQNALVHTSALSEPKVYIVYMGARQHDDVDLITSTHHDMLATVLGSKEAAAD  253
            F    L++F N  +  +   + KV+IVY+G +QHDD + +T +HH ML ++LGSKE A D
Sbjct  9    FVVLILVIFLNGQISLTVADQSKVHIVYLGEKQHDDPEFVTESHHQMLWSLLGSKEDAHD  68

Query  254  SMIYSYRHGFSGFAAMMTKSHAQTFQDLPGVVKVIPNSLYKLRTTRSWDYLGLSLNSATN  433
            SM+YSYRHGFSGFAA +TKS A+    LP VV V  +S YKL+TTR+WDYLGLS  +  N
Sbjct  69   SMVYSYRHGFSGFAAKLTKSQAKKIAGLPEVVHVTRDSFYKLKTTRTWDYLGLSAANPKN  128

Query  434  LLHDTKMGDGTIVAVLDTGVTPENEAYNDRGLGPIPSKWKGYCES  568
            LL+D  MG   I+ V+DTGV PE+E +ND G+GP+PS WKG CES
Sbjct  129  LLNDANMGGQIIIGVVDTGVWPESEVFNDNGIGPVPSHWKGGCES  173



>ref|XP_011470880.1| PREDICTED: subtilisin-like protease SBT3.3 [Fragaria vesca subsp. 
vesca]
Length=780

 Score =   198 bits (503),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 87/150 (58%), Positives = 122/150 (81%), Gaps = 1/150 (1%)
 Frame = +2

Query  122  SALSEPKVYIVYMGARQHDDVDLITSTHHDMLATVLGSKEAAADSMIYSYRHGFSGFAAM  301
            +A +   V+IVY+G RQHD+  LIT +HHD+LAT++GSK  A+  M+YSYRHGFSGFAA 
Sbjct  30   AAKTNSHVHIVYLGERQHDNPKLITDSHHDLLATIVGSKSLASKLMVYSYRHGFSGFAAK  89

Query  302  MTKSHAQTFQDLPGVVKVIPNSLYKLRTTRSWDYLGLS-LNSATNLLHDTKMGDGTIVAV  478
            +T + AQ F +LP VV+VIPN+L+KL+T+RSWD+LGLS L+ ++N+LH + MGDG I+ V
Sbjct  90   LTAAQAQKFAELPDVVRVIPNTLHKLQTSRSWDFLGLSPLSPSSNILHSSNMGDGVIIGV  149

Query  479  LDTGVTPENEAYNDRGLGPIPSKWKGYCES  568
            LDTG+ PE++++N+ GLG +PS+WKG C+S
Sbjct  150  LDTGIWPESKSFNEEGLGSVPSRWKGVCKS  179



>gb|EYU19440.1| hypothetical protein MIMGU_mgv1a001654mg [Erythranthe guttata]
Length=778

 Score =   197 bits (502),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 88/143 (62%), Positives = 108/143 (76%), Gaps = 0/143 (0%)
 Frame = +2

Query  140  KVYIVYMGARQHDDVDLITSTHHDMLATVLGSKEAAADSMIYSYRHGFSGFAAMMTKSHA  319
             VYIVY+G RQHDD  L+T +HHDML T++GSK+ A ++M+YSYRHGFSGFAA +T S A
Sbjct  35   NVYIVYLGERQHDDPKLVTDSHHDMLTTLMGSKQLALEAMVYSYRHGFSGFAAKITASQA  94

Query  320  QTFQDLPGVVKVIPNSLYKLRTTRSWDYLGLSLNSATNLLHDTKMGDGTIVAVLDTGVTP  499
            Q   + P VV V+PNS Y L+TTRSWDYL LS     NL   + MGDG I+ VLDTG+ P
Sbjct  95   QQLSEHPDVVSVMPNSFYNLQTTRSWDYLRLSAQIPNNLASKSNMGDGIIIGVLDTGIWP  154

Query  500  ENEAYNDRGLGPIPSKWKGYCES  568
            E+EA+ D GLGPIPS WKG+C+S
Sbjct  155  ESEAFRDEGLGPIPSGWKGFCQS  177



>ref|NP_001190697.1| subtilisin-like protease [Arabidopsis thaliana]
 gb|AEE82898.1| subtilisin-like protease [Arabidopsis thaliana]
Length=794

 Score =   197 bits (502),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 88/143 (62%), Positives = 112/143 (78%), Gaps = 0/143 (0%)
 Frame = +2

Query  140  KVYIVYMGARQHDDVDLITSTHHDMLATVLGSKEAAADSMIYSYRHGFSGFAAMMTKSHA  319
            KV+IVY+G +QHDD + +T +HH ML ++LGSKE A DSM+YSYRHGFSGFAA +T+S A
Sbjct  49   KVHIVYLGEKQHDDPEFVTESHHRMLWSLLGSKEDANDSMVYSYRHGFSGFAAKLTESQA  108

Query  320  QTFQDLPGVVKVIPNSLYKLRTTRSWDYLGLSLNSATNLLHDTKMGDGTIVAVLDTGVTP  499
            +   DLP VV VIP+S YKL TTR+WDYLGLS  +  +LLH+T MG+  I+ V+DTGV P
Sbjct  109  KKIADLPDVVHVIPDSFYKLATTRTWDYLGLSAANPKSLLHETNMGEQIIIGVIDTGVWP  168

Query  500  ENEAYNDRGLGPIPSKWKGYCES  568
            E+E +ND G GP+PS WKG CE+
Sbjct  169  ESEVFNDSGFGPVPSHWKGGCET  191



>emb|CDX94251.1| BnaC02g29110D [Brassica napus]
Length=761

 Score =   197 bits (501),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 91/167 (54%), Positives = 124/167 (74%), Gaps = 2/167 (1%)
 Frame = +2

Query  74   FFFGCLLVFQN--ALVHTSALSEPKVYIVYMGARQHDDVDLITSTHHDMLATVLGSKEAA  247
            F    L++F N  ++    A++E KV+IVY+G +QHDD + +T +HH ML ++LGSKE A
Sbjct  9    FVVLSLIIFLNGQSIFVARAVAESKVHIVYLGEKQHDDPEFVTESHHQMLCSLLGSKEDA  68

Query  248  ADSMIYSYRHGFSGFAAMMTKSHAQTFQDLPGVVKVIPNSLYKLRTTRSWDYLGLSLNSA  427
              SM+YSYRHGFSGFAA +TKS A+   +LP VV VIP+S YKL+TTR+WDYLGLS +S 
Sbjct  69   HGSMVYSYRHGFSGFAAKLTKSQAKKIANLPEVVHVIPDSFYKLKTTRTWDYLGLSASSP  128

Query  428  TNLLHDTKMGDGTIVAVLDTGVTPENEAYNDRGLGPIPSKWKGYCES  568
             N L++T MG+  I+ ++DTGV PE+E +ND G+G +PS WKG C+S
Sbjct  129  KNHLNETNMGEQIIIGIIDTGVWPESEVFNDDGIGSVPSHWKGGCQS  175



>ref|NP_567359.1| Subtilase family protein [Arabidopsis thaliana]
 gb|AAD03440.1| similar to the subtilase family of serine proteases (Pfam: PF00082, 
Score=48.3, E=2.3e-12, n=4) [Arabidopsis thaliana]
 emb|CAB40045.1| putative subtilisin-like protease [Arabidopsis thaliana]
 emb|CAB78175.1| putative subtilisin-like protease [Arabidopsis thaliana]
 gb|AEE82893.1| Subtilase family protein [Arabidopsis thaliana]
Length=756

 Score =   197 bits (500),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 88/170 (52%), Positives = 125/170 (74%), Gaps = 4/170 (2%)
 Frame = +2

Query  59   LILFSFFFGCLLVFQNALVHTSALSEPKVYIVYMGARQHDDVDLITSTHHDMLATVLGSK  238
            ++  + F   +L  Q + V    ++E KVY+VY+G ++HD+ + +T +HH ML ++LGSK
Sbjct  5    ILFLALFLSIVLNVQISFV----VAESKVYVVYLGEKEHDNPESVTESHHQMLWSLLGSK  60

Query  239  EAAADSMIYSYRHGFSGFAAMMTKSHAQTFQDLPGVVKVIPNSLYKLRTTRSWDYLGLSL  418
            EA  DS++YSYRHGFSGFAA +T+S AQ   +LP VV+VIPN+LY++ TTR+WDYLG+S 
Sbjct  61   EAVLDSIVYSYRHGFSGFAAKLTESQAQQISELPEVVQVIPNTLYEMTTTRTWDYLGVSP  120

Query  419  NSATNLLHDTKMGDGTIVAVLDTGVTPENEAYNDRGLGPIPSKWKGYCES  568
             ++ +LL    MG   IV V+D+GV PE+E +ND+G GPIPS+WKG CES
Sbjct  121  GNSDSLLQKANMGYNVIVGVIDSGVWPESEMFNDKGFGPIPSRWKGGCES  170



>ref|XP_006286455.1| hypothetical protein CARUB_v10000290mg [Capsella rubella]
 gb|EOA19353.1| hypothetical protein CARUB_v10000290mg [Capsella rubella]
Length=574

 Score =   194 bits (494),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 91/169 (54%), Positives = 121/169 (72%), Gaps = 4/169 (2%)
 Frame = +2

Query  62   ILFSFFFGCLLVFQNALVHTSALSEPKVYIVYMGARQHDDVDLITSTHHDMLATVLGSKE  241
            IL + F   +L  Q +LV     +E KVYIVYMG + H+D + +T +HH +L   LGSKE
Sbjct  6    ILIAMFLTIVLNLQISLV----FAETKVYIVYMGKKTHEDPESVTESHHQLLWPFLGSKE  61

Query  242  AAADSMIYSYRHGFSGFAAMMTKSHAQTFQDLPGVVKVIPNSLYKLRTTRSWDYLGLSLN  421
            A  DS++YSYRHGFSGFAA +T++ AQ   +LP VV+V PN+LY+L TTR+WDYLGLS  
Sbjct  62   AVHDSIVYSYRHGFSGFAAKLTETQAQQISELPEVVQVAPNTLYELTTTRTWDYLGLSPG  121

Query  422  SATNLLHDTKMGDGTIVAVLDTGVTPENEAYNDRGLGPIPSKWKGYCES  568
            ++ +LL    MG   IV V+D+GV PE++ +ND+G GPIPS+WKG CES
Sbjct  122  NSQSLLQKANMGSSVIVGVIDSGVWPESDMFNDKGYGPIPSRWKGGCES  170



>ref|NP_564414.2| Subtilase family protein SBT3.3 [Arabidopsis thaliana]
 sp|Q9MAP5.1|SBT33_ARATH RecName: Full=Subtilisin-like protease SBT3.3; AltName: Full=Subtilase 
subfamily 3 member 3; Short=AtSBT3.3; Flags: Precursor 
[Arabidopsis thaliana]
 gb|AAF31276.1|AC006424_5 Third of four adjacent putative subtilase family > [Arabidopsis 
thaliana]
 gb|AAM20591.1| subtilase, putative [Arabidopsis thaliana]
 gb|AAQ56790.1| At1g32960 [Arabidopsis thaliana]
 gb|AEE31544.1| Subtilase family protein SBT3.3 [Arabidopsis thaliana]
Length=777

 Score =   197 bits (500),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 88/146 (60%), Positives = 115/146 (79%), Gaps = 0/146 (0%)
 Frame = +2

Query  131  SEPKVYIVYMGARQHDDVDLITSTHHDMLATVLGSKEAAADSMIYSYRHGFSGFAAMMTK  310
            +E KV+IVY+G ++H D + +T +HH MLA++LGSK+ A DSM+YSYRHGFSGFAA +TK
Sbjct  28   TESKVHIVYLGEKKHHDPEFVTESHHQMLASLLGSKKDADDSMVYSYRHGFSGFAAKLTK  87

Query  311  SHAQTFQDLPGVVKVIPNSLYKLRTTRSWDYLGLSLNSATNLLHDTKMGDGTIVAVLDTG  490
            S A+   DLP VV VIP+  ++L TTR+W+YLGLS  +  NLL+DT MGD  I+ V+DTG
Sbjct  88   SQAKKIADLPEVVHVIPDGFHELATTRTWEYLGLSSANPKNLLNDTNMGDQVIIGVIDTG  147

Query  491  VTPENEAYNDRGLGPIPSKWKGYCES  568
            V PE+E++ND G+GPIP KWKG CES
Sbjct  148  VWPESESFNDNGVGPIPRKWKGGCES  173



>emb|CDX93811.1| BnaA09g24110D [Brassica napus]
Length=752

 Score =   196 bits (499),  Expect = 5e-55, Method: Compositional matrix adjust.
 Identities = 90/172 (52%), Positives = 126/172 (73%), Gaps = 4/172 (2%)
 Frame = +2

Query  53   NELILFSFFFGCLLVFQNALVHTSALSEPKVYIVYMGARQHDDVDLITSTHHDMLATVLG  232
            N  +LF+     ++V + A     A +E KV+IVY+G +QHDD   +T +HH ML+++LG
Sbjct  3    NSRLLFALVLNLIIVLKVA----RAGAESKVHIVYLGEKQHDDPKHVTESHHQMLSSLLG  58

Query  233  SKEAAADSMIYSYRHGFSGFAAMMTKSHAQTFQDLPGVVKVIPNSLYKLRTTRSWDYLGL  412
            S+  A DSM++SYRHGFSGFAA +T+S A+   D P VV VIP+S Y+L TTR+WDYLGL
Sbjct  59   SEVEAHDSMVHSYRHGFSGFAAKLTESQAKKIADSPDVVHVIPDSFYELATTRTWDYLGL  118

Query  413  SLNSATNLLHDTKMGDGTIVAVLDTGVTPENEAYNDRGLGPIPSKWKGYCES  568
            S+++  NLL+DT MGD  I+  +D+GV PE+E++ND G+GP+PS WKG C+S
Sbjct  119  SVSNPKNLLNDTNMGDQVIIGFIDSGVWPESESFNDNGVGPVPSHWKGECQS  170



>ref|XP_011038011.1| PREDICTED: subtilisin-like protease SBT3.5 [Populus euphratica]
Length=781

 Score =   196 bits (499),  Expect = 5e-55, Method: Compositional matrix adjust.
 Identities = 98/181 (54%), Positives = 132/181 (73%), Gaps = 6/181 (3%)
 Frame = +2

Query  35   NMDKNQNE---LILFSFFFGCLLVFQNALVHTSALSEPKVYIVYMGARQHDDVDLITSTH  205
            +M KN++    L+L S  F  +L  +N+LV  SA +  KV+IVYMG +QH ++ LIT +H
Sbjct  5    SMRKNRSTTSMLVLLSTLF--ILNDRNSLV-VSADNTRKVHIVYMGEKQHSNLKLITDSH  61

Query  206  HDMLATVLGSKEAAADSMIYSYRHGFSGFAAMMTKSHAQTFQDLPGVVKVIPNSLYKLRT  385
             DMLA+V+GSKEAA  SMIYSY+HGFSGFAAM++K  A+   +LPGVV V  N L+ L+T
Sbjct  62   IDMLASVVGSKEAAVKSMIYSYQHGFSGFAAMLSKDQAKMIAELPGVVHVTRNQLHSLQT  121

Query  386  TRSWDYLGLSLNSATNLLHDTKMGDGTIVAVLDTGVTPENEAYNDRGLGPIPSKWKGYCE  565
            TRSWDYLGLS +  +NL H  K GDG I+   D+GV PE+E ++D G GP+P++WKG+C+
Sbjct  122  TRSWDYLGLSTHYPSNLSHKAKKGDGIIIGFFDSGVWPESEVFDDEGYGPVPTRWKGHCD  181

Query  566  S  568
            S
Sbjct  182  S  182



>emb|CBI23066.3| unnamed protein product [Vitis vinifera]
Length=699

 Score =   196 bits (497),  Expect = 6e-55, Method: Compositional matrix adjust.
 Identities = 88/135 (65%), Positives = 115/135 (85%), Gaps = 1/135 (1%)
 Frame = +2

Query  167  RQHDDVDLITSTHHDMLATVLGSKEAAADSMIYSYRHGFSGFAAMMTKSHAQTFQDLPGV  346
            RQH D +LIT+THH+ML TVLGSKEA+ DSM+YSYRHGFSGFAA +T++ AQ   +LP V
Sbjct  2    RQHHDPELITNTHHEMLTTVLGSKEASVDSMLYSYRHGFSGFAAKLTEAQAQAVSELPDV  61

Query  347  VKVIPNSLYKLRTTRSWDYLGLSLN-SATNLLHDTKMGDGTIVAVLDTGVTPENEAYNDR  523
            V+V+P+ L+KL+TTRSWDYLGLS + S+TNLLH+T MGDG I+ +LD+G+ PE++ ++D+
Sbjct  62   VQVMPSRLHKLKTTRSWDYLGLSSSHSSTNLLHETNMGDGIIIGLLDSGIWPESKVFSDK  121

Query  524  GLGPIPSKWKGYCES  568
            GLGPIPS+WKG C S
Sbjct  122  GLGPIPSRWKGGCSS  136



>ref|XP_009114847.1| PREDICTED: subtilisin-like protease SBT5.3 [Brassica rapa]
Length=774

 Score =   196 bits (498),  Expect = 6e-55, Method: Compositional matrix adjust.
 Identities = 90/172 (52%), Positives = 126/172 (73%), Gaps = 4/172 (2%)
 Frame = +2

Query  53   NELILFSFFFGCLLVFQNALVHTSALSEPKVYIVYMGARQHDDVDLITSTHHDMLATVLG  232
            N  +LF+     ++V + A     A +E KV+IVY+G +QHDD   +T +HH ML+++LG
Sbjct  3    NSRLLFALVLNLIIVLKVA----RAGAESKVHIVYLGEKQHDDPKHVTESHHQMLSSLLG  58

Query  233  SKEAAADSMIYSYRHGFSGFAAMMTKSHAQTFQDLPGVVKVIPNSLYKLRTTRSWDYLGL  412
            S+  A DSM++SYRHGFSGFAA +T+S A+   D P VV VIP+S Y+L TTR+WDYLGL
Sbjct  59   SEVEAHDSMVHSYRHGFSGFAAKLTESQAKKIADSPDVVHVIPDSFYELATTRTWDYLGL  118

Query  413  SLNSATNLLHDTKMGDGTIVAVLDTGVTPENEAYNDRGLGPIPSKWKGYCES  568
            S+++  NLL+DT MGD  I+  +D+GV PE+E++ND G+GP+PS WKG C+S
Sbjct  119  SVSNPKNLLNDTNMGDQVIIGFIDSGVWPESESFNDNGVGPVPSHWKGECQS  170



>ref|XP_010436935.1| PREDICTED: subtilisin-like protease SBT3.3 [Camelina sativa]
Length=761

 Score =   196 bits (497),  Expect = 7e-55, Method: Compositional matrix adjust.
 Identities = 89/170 (52%), Positives = 126/170 (74%), Gaps = 4/170 (2%)
 Frame = +2

Query  59   LILFSFFFGCLLVFQNALVHTSALSEPKVYIVYMGARQHDDVDLITSTHHDMLATVLGSK  238
            +IL S F   +L  Q +     A++E KVY+VY+G ++H++ + +T +HH +L ++LGSK
Sbjct  5    IILLSLFLSIVLNVQISF----AVAERKVYVVYLGEKEHNNPESVTESHHQILWSLLGSK  60

Query  239  EAAADSMIYSYRHGFSGFAAMMTKSHAQTFQDLPGVVKVIPNSLYKLRTTRSWDYLGLSL  418
            ++  DS++YSYRHGFSGFAA +T+S AQ   +LP VV+VIPN+LY++ TTR+W+YLGLS 
Sbjct  61   KSVHDSIVYSYRHGFSGFAAKLTESQAQQISELPEVVQVIPNTLYEMTTTRTWNYLGLSP  120

Query  419  NSATNLLHDTKMGDGTIVAVLDTGVTPENEAYNDRGLGPIPSKWKGYCES  568
             ++  LLH   MG   IV V+DTGV PE+E +ND+G GPIPS+WKG CES
Sbjct  121  GNSNGLLHKANMGYQVIVGVIDTGVWPESEMFNDKGYGPIPSRWKGGCES  170



>ref|XP_010451309.1| PREDICTED: subtilisin-like protease SBT3.3 [Camelina sativa]
Length=230

 Score =   185 bits (469),  Expect = 9e-55, Method: Compositional matrix adjust.
 Identities = 86/168 (51%), Positives = 120/168 (71%), Gaps = 10/168 (6%)
 Frame = +2

Query  89   LLVFQNALVHTSALSEPKVYIVYMGARQHDDVDLITSTHHDMLATVLGSKEAAADSMIYS  268
            LL+     + T+  S+P +YIVY+G  +HDD DL+T++HH ML ++L SKE A +SMIYS
Sbjct  30   LLIIAKGALDTN--SKPGLYIVYLGQPEHDDPDLVTASHHQMLESLLQSKEDARNSMIYS  87

Query  269  YRHGFSGFAAMMTKSHAQTFQDLPGVVKVIPNSLYKLRTTRSWDYLGLSL--------NS  424
            Y+HGFSGFAA++T S A+   + P VV VIPN + KL+TTR+WD+LG+S         ++
Sbjct  88   YQHGFSGFAALLTSSQAKEISEHPAVVHVIPNRILKLKTTRTWDHLGISPIPTPFSSSSA  147

Query  425  ATNLLHDTKMGDGTIVAVLDTGVTPENEAYNDRGLGPIPSKWKGYCES  568
               LLHDT +G   I+ VLDTG+ PE++ +ND+GLGPIP +W+G CES
Sbjct  148  VKGLLHDTNLGSEAIIGVLDTGIWPESKVFNDQGLGPIPKRWRGKCES  195



>ref|XP_010437005.1| PREDICTED: subtilisin-like protease SBT3.3 isoform X1 [Camelina 
sativa]
Length=762

 Score =   195 bits (496),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 89/170 (52%), Positives = 122/170 (72%), Gaps = 4/170 (2%)
 Frame = +2

Query  59   LILFSFFFGCLLVFQNALVHTSALSEPKVYIVYMGARQHDDVDLITSTHHDMLATVLGSK  238
            +IL        L+ Q+  V    ++E KVY+VY+G ++H D+  +T +HH ML  +LGS 
Sbjct  5    IILMPLILTVALIVQSCFV----VAETKVYVVYLGEKEHADIKSVTDSHHRMLWALLGSI  60

Query  239  EAAADSMIYSYRHGFSGFAAMMTKSHAQTFQDLPGVVKVIPNSLYKLRTTRSWDYLGLSL  418
            EAA DS++YSYRHGFSGFAA +T+S AQ   +LP V++VIP+++Y+L TTR+WDYLGLS 
Sbjct  61   EAAHDSIVYSYRHGFSGFAAKLTESQAQEISELPEVMQVIPDTIYELTTTRTWDYLGLSP  120

Query  419  NSATNLLHDTKMGDGTIVAVLDTGVTPENEAYNDRGLGPIPSKWKGYCES  568
             +  +LLH T +G   IV V+DTGV PE+E +ND G GPIPS+WKG CE+
Sbjct  121  GTPQSLLHKTDLGSSVIVGVIDTGVWPESEMFNDNGYGPIPSRWKGACET  170



>ref|XP_007039327.1| Subtilase family protein, putative isoform 1 [Theobroma cacao]
 gb|EOY23828.1| Subtilase family protein, putative isoform 1 [Theobroma cacao]
Length=869

 Score =   196 bits (498),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 89/164 (54%), Positives = 124/164 (76%), Gaps = 6/164 (4%)
 Frame = +2

Query  74   FFFGCLLVFQNALVHTSALSEPKVYIVYMGARQHDDVDLITSTHHDMLATVLGSKEAAAD  253
            FFF    +    LVH +A+S+  V+IVYMG ++H D      +HH ML+T+LGSKEAA +
Sbjct  111  FFFSPTSI----LVHLNAMSQ--VHIVYMGEKKHQDPATTKMSHHKMLSTLLGSKEAAKN  164

Query  254  SMIYSYRHGFSGFAAMMTKSHAQTFQDLPGVVKVIPNSLYKLRTTRSWDYLGLSLNSATN  433
            SM+YSY+HGFSGFAA +T+S A+     PGVV VIPN +++L TTRSW+++GL  +S+ N
Sbjct  165  SMLYSYKHGFSGFAARLTESQAEEIAAFPGVVHVIPNRIHRLHTTRSWEFMGLKYHSSKN  224

Query  434  LLHDTKMGDGTIVAVLDTGVTPENEAYNDRGLGPIPSKWKGYCE  565
            LL  + MG+GTI+ V+D+GV PE+E++NDRG+GPIPS+WKG C+
Sbjct  225  LLTQSNMGEGTIIGVIDSGVWPESESFNDRGMGPIPSRWKGTCQ  268



>ref|XP_002891021.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH67280.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
Length=774

 Score =   195 bits (496),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 87/147 (59%), Positives = 116/147 (79%), Gaps = 0/147 (0%)
 Frame = +2

Query  125  ALSEPKVYIVYMGARQHDDVDLITSTHHDMLATVLGSKEAAADSMIYSYRHGFSGFAAMM  304
            A ++ KV+IVY+G +QHDD + +T +HH ML+++LGSK+ A  SM+YSYRHGFSGFAA +
Sbjct  23   ASAKSKVHIVYLGEKQHDDPEFVTESHHQMLSSLLGSKDDAHKSMVYSYRHGFSGFAAKL  82

Query  305  TKSHAQTFQDLPGVVKVIPNSLYKLRTTRSWDYLGLSLNSATNLLHDTKMGDGTIVAVLD  484
            TKS A+   D P V+ VIP+  Y+L TTR+WDYLGLS +++ NLL+D  MGD TI+ V+D
Sbjct  83   TKSQAKKIADSPEVIHVIPDGYYELATTRTWDYLGLSADNSKNLLNDKNMGDQTIIGVID  142

Query  485  TGVTPENEAYNDRGLGPIPSKWKGYCE  565
            TGV PE+E++ND G+GPIPS WKG CE
Sbjct  143  TGVWPESESFNDNGVGPIPSHWKGGCE  169



>gb|KFK45042.1| hypothetical protein AALP_AA1G336600 [Arabis alpina]
Length=741

 Score =   195 bits (496),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 88/143 (62%), Positives = 112/143 (78%), Gaps = 0/143 (0%)
 Frame = +2

Query  140  KVYIVYMGARQHDDVDLITSTHHDMLATVLGSKEAAADSMIYSYRHGFSGFAAMMTKSHA  319
            KV+IVY+G +QH D D +T +HH ML++++GS+E A DSM++SYRHGFSGFAA +T+S A
Sbjct  23   KVHIVYLGEKQHHDPDFVTDSHHQMLSSLIGSEEDAHDSMLHSYRHGFSGFAAKLTESQA  82

Query  320  QTFQDLPGVVKVIPNSLYKLRTTRSWDYLGLSLNSATNLLHDTKMGDGTIVAVLDTGVTP  499
            +   D PGVV VIP+S Y+L TTR+WDYLGLS  S  NLL+D  MGD  I+ V+DTGV P
Sbjct  83   KKIADSPGVVHVIPDSFYELATTRTWDYLGLSAPSPKNLLNDVNMGDQVIIGVIDTGVWP  142

Query  500  ENEAYNDRGLGPIPSKWKGYCES  568
            E+E++ND G G IPSKWKG CES
Sbjct  143  ESESFNDNGFGTIPSKWKGGCES  165



>gb|KCW72614.1| hypothetical protein EUGRSUZ_E01074 [Eucalyptus grandis]
Length=758

 Score =   195 bits (496),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 88/142 (62%), Positives = 117/142 (82%), Gaps = 1/142 (1%)
 Frame = +2

Query  143  VYIVYMGARQHDDVDLITSTHHDMLATVLGSKEAAADSMIYSYRHGFSGFAAMMTKSHAQ  322
            VYIVY G R+  D  + T +HHDMLA+VLGSKEAAA S++YSYRHGFSGFAA +T+S AQ
Sbjct  14   VYIVYFGVRKQGDPTVETDSHHDMLASVLGSKEAAAISILYSYRHGFSGFAAKLTESQAQ  73

Query  323  TFQDLPGVVKVIPNSLYKLRTTRSWDYLGLSLN-SATNLLHDTKMGDGTIVAVLDTGVTP  499
                 PGVV+V+PN+L++L+TTRSWD+LGLS + S T+LL+ ++MGDG IV ++DTG+ P
Sbjct  74   ELAGFPGVVRVMPNTLFRLQTTRSWDFLGLSPSHSPTSLLYKSRMGDGVIVGMIDTGIWP  133

Query  500  ENEAYNDRGLGPIPSKWKGYCE  565
            E+++++D GLGPIPS+WKG CE
Sbjct  134  ESKSFSDEGLGPIPSRWKGGCE  155



>emb|CDY25259.1| BnaA02g21970D [Brassica napus]
Length=742

 Score =   195 bits (495),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 88/146 (60%), Positives = 113/146 (77%), Gaps = 0/146 (0%)
 Frame = +2

Query  131  SEPKVYIVYMGARQHDDVDLITSTHHDMLATVLGSKEAAADSMIYSYRHGFSGFAAMMTK  310
            +E KVY+VY+G ++HDD   +T  HH ML ++LGSKE+  DS++YSYRHGFSGFAA +T+
Sbjct  28   AERKVYVVYLGEKEHDDPASVTEYHHQMLWSLLGSKESVHDSIVYSYRHGFSGFAAKLTE  87

Query  311  SHAQTFQDLPGVVKVIPNSLYKLRTTRSWDYLGLSLNSATNLLHDTKMGDGTIVAVLDTG  490
            S AQ   +LP VV VIPN+LY+L TTR+WDYLGLS  ++ +L+H   MG   IV V+DTG
Sbjct  88   SQAQQLSELPEVVHVIPNTLYELTTTRTWDYLGLSPGTSKSLVHKADMGRKIIVGVIDTG  147

Query  491  VTPENEAYNDRGLGPIPSKWKGYCES  568
            V PE+E YND+G GPIPS+WKG CES
Sbjct  148  VWPESEMYNDKGYGPIPSRWKGSCES  173



>ref|XP_006286454.1| hypothetical protein CARUB_v10000290mg [Capsella rubella]
 gb|EOA19352.1| hypothetical protein CARUB_v10000290mg [Capsella rubella]
Length=754

 Score =   195 bits (495),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 91/169 (54%), Positives = 121/169 (72%), Gaps = 4/169 (2%)
 Frame = +2

Query  62   ILFSFFFGCLLVFQNALVHTSALSEPKVYIVYMGARQHDDVDLITSTHHDMLATVLGSKE  241
            IL + F   +L  Q +LV     +E KVYIVYMG + H+D + +T +HH +L   LGSKE
Sbjct  6    ILIAMFLTIVLNLQISLV----FAETKVYIVYMGKKTHEDPESVTESHHQLLWPFLGSKE  61

Query  242  AAADSMIYSYRHGFSGFAAMMTKSHAQTFQDLPGVVKVIPNSLYKLRTTRSWDYLGLSLN  421
            A  DS++YSYRHGFSGFAA +T++ AQ   +LP VV+V PN+LY+L TTR+WDYLGLS  
Sbjct  62   AVHDSIVYSYRHGFSGFAAKLTETQAQQISELPEVVQVAPNTLYELTTTRTWDYLGLSPG  121

Query  422  SATNLLHDTKMGDGTIVAVLDTGVTPENEAYNDRGLGPIPSKWKGYCES  568
            ++ +LL    MG   IV V+D+GV PE++ +ND+G GPIPS+WKG CES
Sbjct  122  NSQSLLQKANMGSSVIVGVIDSGVWPESDMFNDKGYGPIPSRWKGGCES  170



>emb|CDY54842.1| BnaC05g51310D [Brassica napus]
Length=1424

 Score =   198 bits (503),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 92/172 (53%), Positives = 126/172 (73%), Gaps = 4/172 (2%)
 Frame = +2

Query  53   NELILFSFFFGCLLVFQNALVHTSALSEPKVYIVYMGARQHDDVDLITSTHHDMLATVLG  232
            N  +LF+     ++V + A     A +E KV+IVY+G +QHDD   +T +HH ML+++LG
Sbjct  3    NSRLLFAVVLNLIIVLKVA----RAGAESKVHIVYLGEKQHDDPKHVTESHHQMLSSLLG  58

Query  233  SKEAAADSMIYSYRHGFSGFAAMMTKSHAQTFQDLPGVVKVIPNSLYKLRTTRSWDYLGL  412
            S+  A DSM++SYRHGFSGFAA +T+S A+   D P VV VIP+S YKL TTR+WDYLGL
Sbjct  59   SEVEADDSMVHSYRHGFSGFAAKLTESQAKKIADSPDVVHVIPDSFYKLATTRTWDYLGL  118

Query  413  SLNSATNLLHDTKMGDGTIVAVLDTGVTPENEAYNDRGLGPIPSKWKGYCES  568
            S+ + TNLL+DT MGD  I+  +D+GV PE+E++ND G+GP+PS WKG C+S
Sbjct  119  SVGNLTNLLNDTNMGDQVIIGFIDSGVWPESESFNDNGVGPVPSHWKGGCQS  170


 Score =   152 bits (385),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 76/141 (54%), Positives = 99/141 (70%), Gaps = 5/141 (4%)
 Frame = +2

Query  74   FFFGCLLVFQNALVHTSALSEPKVYIVYMGARQHDDVDLITSTHHDMLATVLGSKEAAAD  253
            F+FG L+   +  VH   +    V+IVY+G +QHDD   +T  HH ML+++LGSKE A D
Sbjct  682  FYFGSLIWRDS--VHNVTI---PVHIVYLGEKQHDDPKHVTEYHHQMLSSLLGSKEDAHD  736

Query  254  SMIYSYRHGFSGFAAMMTKSHAQTFQDLPGVVKVIPNSLYKLRTTRSWDYLGLSLNSATN  433
            SM+YSYRHGFSGFAA +TKS A+   D P VV V+P+  Y+L TTR+WDYLGLS     N
Sbjct  737  SMVYSYRHGFSGFAARLTKSQAKKLADSPEVVHVMPDGYYELATTRTWDYLGLSAAHPKN  796

Query  434  LLHDTKMGDGTIVAVLDTGVT  496
            LL+DT MGD  I+ V+DTG++
Sbjct  797  LLNDTNMGDHVIIGVIDTGIS  817



>ref|XP_009344068.1| PREDICTED: subtilisin-like protease SBT5.3, partial [Pyrus x 
bretschneideri]
Length=758

 Score =   195 bits (495),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 83/143 (58%), Positives = 116/143 (81%), Gaps = 0/143 (0%)
 Frame = +2

Query  140  KVYIVYMGARQHDDVDLITSTHHDMLATVLGSKEAAADSMIYSYRHGFSGFAAMMTKSHA  319
             V+IVY+G  QHD+ +L+   HH++LA+V+ SKE A++ M+YSY+HGFSGFAA +T+S  
Sbjct  28   NVHIVYLGETQHDNPELVVDLHHELLASVVRSKELASELMVYSYKHGFSGFAAKLTESQV  87

Query  320  QTFQDLPGVVKVIPNSLYKLRTTRSWDYLGLSLNSATNLLHDTKMGDGTIVAVLDTGVTP  499
            Q   +LPGVV++IPNSL+KL TTRSW++LGLS +S +N+L  +KMGDG I+ VLDTG+ P
Sbjct  88   QQLSELPGVVRIIPNSLHKLETTRSWNFLGLSPHSPSNILPKSKMGDGVIIGVLDTGIWP  147

Query  500  ENEAYNDRGLGPIPSKWKGYCES  568
            E+E++N++GLGP+P  WKG CES
Sbjct  148  ESESFNEKGLGPVPFHWKGVCES  170



>ref|XP_002298973.2| subtilase family protein [Populus trichocarpa]
 gb|EEE83778.2| subtilase family protein [Populus trichocarpa]
Length=786

 Score =   195 bits (495),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 94/164 (57%), Positives = 122/164 (74%), Gaps = 10/164 (6%)
 Frame = +2

Query  86   CLLVF---QNALVHTSALSEPKVYIVYMGARQHDDVDLITSTHHDMLATVLGSKEAAADS  256
            CL +F   Q  L+ T   +   V+IVY+G +QHDD  L T +HHDMLA+V+GSKE A++ 
Sbjct  12   CLFLFLCGQVILMITKVEATSNVHIVYLGGKQHDDPMLKTDSHHDMLASVVGSKEIASEL  71

Query  257  MIYSYRHGFSGFAAMMTKSHAQTFQDLPGVVKVIPNSLYKLRTTRSWDYLGLSLNSATNL  436
            M+YSY+HGFSGFAA +T+S AQ        V VIPNSL++L+TTRSWD+LGLS +S  N 
Sbjct  72   MVYSYKHGFSGFAAKLTESQAQK-------VAVIPNSLHRLQTTRSWDFLGLSAHSPANT  124

Query  437  LHDTKMGDGTIVAVLDTGVTPENEAYNDRGLGPIPSKWKGYCES  568
            LH++ MGDG I+ VLDTG+ PE +A++D+GLGPIPS WKG CES
Sbjct  125  LHNSSMGDGVIIGVLDTGIWPEAKAFSDKGLGPIPSHWKGVCES  168



>ref|XP_002874635.1| subtilase family protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH50894.1| subtilase family protein [Arabidopsis lyrata subsp. lyrata]
Length=774

 Score =   195 bits (495),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 93/160 (58%), Positives = 120/160 (75%), Gaps = 4/160 (3%)
 Frame = +2

Query  89   LLVFQNALVHTSALSEPKV-YIVYMGARQHDDVDLITSTHHDMLATVLGSKEAAADSMIY  265
            L++F N      A SE KV +IVY+G +QHDD + +T +HH ML ++LGSKE A +SM++
Sbjct  14   LVIFLNV---ARAGSERKVVHIVYLGEKQHDDPEFVTESHHRMLWSLLGSKEDAHNSMVH  70

Query  266  SYRHGFSGFAAMMTKSHAQTFQDLPGVVKVIPNSLYKLRTTRSWDYLGLSLNSATNLLHD  445
            SYRHGFSGFAA +TKS A+   DLP VV VIP+S YKL TTR+WDYLGLS  +  +LLH+
Sbjct  71   SYRHGFSGFAAKLTKSQAKKIADLPDVVHVIPDSFYKLATTRTWDYLGLSAANPKSLLHE  130

Query  446  TKMGDGTIVAVLDTGVTPENEAYNDRGLGPIPSKWKGYCE  565
            T MG+ +I+ V+DTGV PE+E +ND G GP+PS WKG CE
Sbjct  131  TNMGEQSIIGVIDTGVWPESEVFNDNGFGPVPSHWKGGCE  170



>ref|XP_010421966.1| PREDICTED: subtilisin-like protease SBT3.3 [Camelina sativa]
Length=762

 Score =   194 bits (494),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 89/169 (53%), Positives = 121/169 (72%), Gaps = 4/169 (2%)
 Frame = +2

Query  59   LILFSFFFGCLLVFQNALVHTSALSEPKVYIVYMGARQHDDVDLITSTHHDMLATVLGSK  238
            +IL        L+ Q   V    ++E KVY+VY+G +++ ++  +T +HH ML ++LGS 
Sbjct  5    IILMPLILTVALIVQTCFV----VAETKVYVVYLGEKENANIKSVTDSHHQMLWSLLGSI  60

Query  239  EAAADSMIYSYRHGFSGFAAMMTKSHAQTFQDLPGVVKVIPNSLYKLRTTRSWDYLGLSL  418
            EAA DS++YSYRHGFSGFAA +T+S AQ   +LP VV+VIP+++Y+L TTR+WDYLGLS 
Sbjct  61   EAAHDSIVYSYRHGFSGFAAKLTESQAQEISELPEVVQVIPDTIYELTTTRTWDYLGLSP  120

Query  419  NSATNLLHDTKMGDGTIVAVLDTGVTPENEAYNDRGLGPIPSKWKGYCE  565
             +  +LLH T MG   IV V+DTGV PE+E +ND G GPIPS+WKG CE
Sbjct  121  GTPQSLLHKTNMGSSVIVGVIDTGVWPESEMFNDNGYGPIPSRWKGACE  169



>ref|XP_006397048.1| hypothetical protein EUTSA_v10028454mg [Eutrema salsugineum]
 gb|ESQ38501.1| hypothetical protein EUTSA_v10028454mg [Eutrema salsugineum]
Length=764

 Score =   194 bits (494),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 90/169 (53%), Positives = 122/169 (72%), Gaps = 1/169 (1%)
 Frame = +2

Query  62   ILFSFFFGCLLVFQNALVHTSALSEPKVYIVYMGARQHDDVDLITSTHHDMLATVLGSKE  241
            IL +     ++  Q++ V      + KVY+VY+G ++HDD   +T +HH ML ++LGSKE
Sbjct  6    ILVAIILTIVMNAQSSFVAGDT-PDSKVYVVYLGEKEHDDPTSVTESHHQMLWSLLGSKE  64

Query  242  AAADSMIYSYRHGFSGFAAMMTKSHAQTFQDLPGVVKVIPNSLYKLRTTRSWDYLGLSLN  421
            +  DS++YSYRHGFSGFAA +T+S AQ   +LP VV VIPN+LY+L TTR+WDYLGLS  
Sbjct  65   SVHDSIVYSYRHGFSGFAAKLTESQAQQLSELPEVVHVIPNTLYELTTTRTWDYLGLSPG  124

Query  422  SATNLLHDTKMGDGTIVAVLDTGVTPENEAYNDRGLGPIPSKWKGYCES  568
            ++ +L H  KMG   IV V+DTGV PE++ +ND+G GPIPS+WKG CES
Sbjct  125  TSKSLQHKAKMGSQVIVGVIDTGVWPESQMFNDKGYGPIPSRWKGGCES  173



>ref|XP_002874634.1| subtilase family protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH50893.1| subtilase family protein [Arabidopsis lyrata subsp. lyrata]
Length=781

 Score =   194 bits (494),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 91/164 (55%), Positives = 121/164 (74%), Gaps = 4/164 (2%)
 Frame = +2

Query  89   LLVFQNAL----VHTSALSEPKVYIVYMGARQHDDVDLITSTHHDMLATVLGSKEAAADS  256
            L++  N L    V   A +E KV+IVY+G +QHDD + +T +HH ML ++LGSKE A +S
Sbjct  14   LVIILNGLSTFVVVVQAGAESKVHIVYLGEKQHDDPEFVTKSHHRMLWSLLGSKEDAHNS  73

Query  257  MIYSYRHGFSGFAAMMTKSHAQTFQDLPGVVKVIPNSLYKLRTTRSWDYLGLSLNSATNL  436
            M++SYRHGFSGFAA +TKS A+   DLP VV V P+S Y+L TTR+WDYLGLS+ +  NL
Sbjct  74   MVHSYRHGFSGFAAKLTKSQAKKLADLPEVVHVTPDSFYELATTRTWDYLGLSVANPKNL  133

Query  437  LHDTKMGDGTIVAVLDTGVTPENEAYNDRGLGPIPSKWKGYCES  568
            L+DT MG+  I+ V+D+GV PE+E + D G+GP+PS WKG CES
Sbjct  134  LNDTNMGEEVIIGVVDSGVWPESEVFKDNGIGPVPSHWKGGCES  177



>ref|XP_006351094.1| PREDICTED: cucumisin-like [Solanum tuberosum]
Length=803

 Score =   194 bits (493),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 87/170 (51%), Positives = 121/170 (71%), Gaps = 4/170 (2%)
 Frame = +2

Query  59   LILFSFFFGCLLVFQNALVHTSALSEPKVYIVYMGARQHDDVDLITSTHHDMLATVLGSK  238
            L+LF   F CL      ++  +  ++ K+YI+Y+G + HDD +LIT +HHD+L  V+GSK
Sbjct  10   LLLFLLIFTCL----REIIAKAEEADTKLYIIYLGHKPHDDHELITDSHHDILGQVIGSK  65

Query  239  EAAADSMIYSYRHGFSGFAAMMTKSHAQTFQDLPGVVKVIPNSLYKLRTTRSWDYLGLSL  418
            E    +M+YSYRHGFSGFAA +T S A+  ++LPGV++VI N +YK  TTRSWD+LGLS 
Sbjct  66   EEGKKNMVYSYRHGFSGFAAKLTDSQAKQIRELPGVIRVIQNQIYKTHTTRSWDFLGLSK  125

Query  419  NSATNLLHDTKMGDGTIVAVLDTGVTPENEAYNDRGLGPIPSKWKGYCES  568
            +   NLL+ T  GDG I+ V+DTG+  + E +ND+ LGPIPS+WKG C+S
Sbjct  126  SDPNNLLNKTNQGDGIIIGVVDTGIWGDLEGFNDKELGPIPSRWKGSCKS  175



>gb|KJB74658.1| hypothetical protein B456_012G000900 [Gossypium raimondii]
Length=778

 Score =   194 bits (492),  Expect = 4e-54, Method: Compositional matrix adjust.
 Identities = 99/177 (56%), Positives = 127/177 (72%), Gaps = 3/177 (2%)
 Frame = +2

Query  47   NQNELILFSFFFGCLLVFQNA---LVHTSALSEPKVYIVYMGARQHDDVDLITSTHHDML  217
            +Q   ++ SF    LL+  N    ++   A S+  VYIVYMG RQH DV+L+T THHDML
Sbjct  7    DQKNTMIMSFVLVPLLLILNMHYYMLPALADSKRNVYIVYMGKRQHLDVELLTRTHHDML  66

Query  218  ATVLGSKEAAADSMIYSYRHGFSGFAAMMTKSHAQTFQDLPGVVKVIPNSLYKLRTTRSW  397
             TVLGS+E + DS++YSY+HGFSGFAA MTK+ A     LPGV+ V  N  YK++TTRSW
Sbjct  67   VTVLGSEETSEDSIVYSYKHGFSGFAAKMTKAQALKLSKLPGVIHVTRNRFYKVQTTRSW  126

Query  398  DYLGLSLNSATNLLHDTKMGDGTIVAVLDTGVTPENEAYNDRGLGPIPSKWKGYCES  568
            DYLGLS  S +NLL+ +KMG+G I+ +LDTG+ PE E +ND  LGPIPS+W+G CES
Sbjct  127  DYLGLSSTSLSNLLNKSKMGNGVIIGLLDTGIWPELEVFNDENLGPIPSRWRGVCES  183



>ref|XP_010499843.1| PREDICTED: LOW QUALITY PROTEIN: subtilisin-like protease SBT3.5 
[Camelina sativa]
Length=1161

 Score =   196 bits (498),  Expect = 5e-54, Method: Compositional matrix adjust.
 Identities = 90/147 (61%), Positives = 114/147 (78%), Gaps = 0/147 (0%)
 Frame = +2

Query  125  ALSEPKVYIVYMGARQHDDVDLITSTHHDMLATVLGSKEAAADSMIYSYRHGFSGFAAMM  304
            A +E KV+IVY+G +QH D + +T +HH ML+++LGSK+ A DSM+YSYRHGFSGFAA +
Sbjct  774  AGAESKVHIVYLGEKQHHDPEFVTKSHHQMLSSLLGSKKDAHDSMVYSYRHGFSGFAAKL  833

Query  305  TKSHAQTFQDLPGVVKVIPNSLYKLRTTRSWDYLGLSLNSATNLLHDTKMGDGTIVAVLD  484
            TKS A+   DLP VV VI +  YKL TTR+WDYLGLS  +  NLL+DT MGD  I+ V+D
Sbjct  834  TKSQAKKIADLPEVVHVILDVFYKLATTRTWDYLGLSAANPKNLLNDTNMGDQVIIGVID  893

Query  485  TGVTPENEAYNDRGLGPIPSKWKGYCE  565
            TGV PE+E++ND G+GPIP KWKG CE
Sbjct  894  TGVWPESESFNDNGVGPIPRKWKGGCE  920


 Score =   189 bits (479),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 85/144 (59%), Positives = 109/144 (76%), Gaps = 0/144 (0%)
 Frame = +2

Query  134  EPKVYIVYMGARQHDDVDLITSTHHDMLATVLGSKEAAADSMIYSYRHGFSGFAAMMTKS  313
            E KV++VY+G +QHDD + +T +HH ML ++LGSK  A DSM+YSYRHGFSGFAA +T S
Sbjct  27   ESKVHVVYLGEKQHDDPEFVTESHHQMLLSLLGSKADAHDSMVYSYRHGFSGFAAKLTDS  86

Query  314  HAQTFQDLPGVVKVIPNSLYKLRTTRSWDYLGLSLNSATNLLHDTKMGDGTIVAVLDTGV  493
             A+   D P VV V+ +S Y+L TTR+WDYLGLS  +  NLL+DT MGD  I+  +DTGV
Sbjct  87   QAKKLADSPEVVHVMADSFYELATTRTWDYLGLSAANPINLLNDTNMGDQVIIGFIDTGV  146

Query  494  TPENEAYNDRGLGPIPSKWKGYCE  565
             PE+E++ND G+GPIPS WKG CE
Sbjct  147  WPESESFNDNGVGPIPSHWKGGCE  170



>ref|XP_002891020.1| subtilase family protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH67279.1| subtilase family protein [Arabidopsis lyrata subsp. lyrata]
Length=774

 Score =   193 bits (491),  Expect = 6e-54, Method: Compositional matrix adjust.
 Identities = 90/154 (58%), Positives = 116/154 (75%), Gaps = 0/154 (0%)
 Frame = +2

Query  107  ALVHTSALSEPKVYIVYMGARQHDDVDLITSTHHDMLATVLGSKEAAADSMIYSYRHGFS  286
            AL    A  E KV+IVY+G +QHDD + +T +HH ML+++LGSK  A DSM+YSYRHGFS
Sbjct  17   ALNVVRASDESKVHIVYLGEKQHDDPEFVTESHHQMLSSLLGSKVDAHDSMVYSYRHGFS  76

Query  287  GFAAMMTKSHAQTFQDLPGVVKVIPNSLYKLRTTRSWDYLGLSLNSATNLLHDTKMGDGT  466
            GFAA +T+S A+   D P VV V+ +SLY+L TTR+WDYLGLS  +  NLL+DT MGD  
Sbjct  77   GFAAKLTESQAKKLADSPEVVHVMADSLYELATTRTWDYLGLSAANPNNLLNDTNMGDQV  136

Query  467  IVAVLDTGVTPENEAYNDRGLGPIPSKWKGYCES  568
            I+  +DTGV PE+E++ND G+GP+PS WKG CES
Sbjct  137  IIGFIDTGVWPESESFNDNGVGPLPSHWKGGCES  170



>ref|XP_006289363.1| hypothetical protein CARUB_v10002849mg, partial [Capsella rubella]
 gb|EOA22261.1| hypothetical protein CARUB_v10002849mg, partial [Capsella rubella]
Length=789

 Score =   193 bits (490),  Expect = 7e-54, Method: Compositional matrix adjust.
 Identities = 87/148 (59%), Positives = 114/148 (77%), Gaps = 0/148 (0%)
 Frame = +2

Query  125  ALSEPKVYIVYMGARQHDDVDLITSTHHDMLATVLGSKEAAADSMIYSYRHGFSGFAAMM  304
            A SE KV+IVY+G +QHDD + +T +HH ML ++LGSKE   +SM++SYRHGFSGFAA +
Sbjct  41   AGSESKVHIVYLGEKQHDDRESVTESHHQMLWSLLGSKEDVHNSMVHSYRHGFSGFAAKL  100

Query  305  TKSHAQTFQDLPGVVKVIPNSLYKLRTTRSWDYLGLSLNSATNLLHDTKMGDGTIVAVLD  484
            TKS A+   DLP VV V P+S Y+L TTR+WDYLGLS  +  NLL+DT MG+  I+ ++D
Sbjct  101  TKSQAKKIADLPEVVHVTPDSFYELATTRTWDYLGLSAATPKNLLNDTNMGEEVIIGIVD  160

Query  485  TGVTPENEAYNDRGLGPIPSKWKGYCES  568
            +GV PE+E +ND G+GP+PS WKG CES
Sbjct  161  SGVWPESEVFNDNGIGPVPSHWKGDCES  188



>gb|KFK31852.1| hypothetical protein AALP_AA6G166800 [Arabis alpina]
Length=1462

 Score =   196 bits (497),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 91/175 (52%), Positives = 122/175 (70%), Gaps = 0/175 (0%)
 Frame = +2

Query  44   KNQNELILFSFFFGCLLVFQNALVHTSALSEPKVYIVYMGARQHDDVDLITSTHHDMLAT  223
            +N    I+       +L    + V  +A +E KV+IVY+G +QHDD + +T +HH ML +
Sbjct  2    RNHRRSIIVVLSLVIVLSADISFVAHAAGAESKVHIVYLGEKQHDDPEFVTESHHQMLWS  61

Query  224  VLGSKEAAADSMIYSYRHGFSGFAAMMTKSHAQTFQDLPGVVKVIPNSLYKLRTTRSWDY  403
             LGSKE A DSM++S+RHGFSGFAA +T S A+   DLP VV VIP+  YKL TTR+WDY
Sbjct  62   FLGSKENAHDSMVHSFRHGFSGFAAKLTNSEAKKIADLPEVVHVIPDRFYKLATTRTWDY  121

Query  404  LGLSLNSATNLLHDTKMGDGTIVAVLDTGVTPENEAYNDRGLGPIPSKWKGYCES  568
            LG+S  +  NLL+DT +G+  I+ V+DTGV PE+E +ND G+GP+PS WKG CES
Sbjct  122  LGVSTANPKNLLNDTNLGEQMIIGVIDTGVWPESEVFNDNGIGPVPSHWKGGCES  176


 Score =   191 bits (484),  Expect = 6e-52, Method: Compositional matrix adjust.
 Identities = 85/143 (59%), Positives = 111/143 (78%), Gaps = 0/143 (0%)
 Frame = +2

Query  140  KVYIVYMGARQHDDVDLITSTHHDMLATVLGSKEAAADSMIYSYRHGFSGFAAMMTKSHA  319
            KVY+VY+G ++HDD + +T +HH +L ++LGSKEAA DS++YSYRHGFSGFAA +T+S A
Sbjct  734  KVYVVYLGEKEHDDPESVTKSHHQLLWSLLGSKEAALDSIVYSYRHGFSGFAAKLTESQA  793

Query  320  QTFQDLPGVVKVIPNSLYKLRTTRSWDYLGLSLNSATNLLHDTKMGDGTIVAVLDTGVTP  499
            Q   +LP VV VI N+LY+L TTR+WD+LGLS  +  +LL    MG   IV V+DTGV P
Sbjct  794  QQISELPEVVHVIQNTLYELTTTRTWDFLGLSPGNPKSLLQKANMGSDVIVGVVDTGVWP  853

Query  500  ENEAYNDRGLGPIPSKWKGYCES  568
            E+E +ND+G GPIPS+WKG CES
Sbjct  854  ESEMFNDKGFGPIPSRWKGGCES  876



>gb|KCW72613.1| hypothetical protein EUGRSUZ_E01073, partial [Eucalyptus grandis]
Length=1447

 Score =   196 bits (497),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 88/142 (62%), Positives = 118/142 (83%), Gaps = 1/142 (1%)
 Frame = +2

Query  143  VYIVYMGARQHDDVDLITSTHHDMLATVLGSKEAAADSMIYSYRHGFSGFAAMMTKSHAQ  322
            VYIVY GAR+  D  + T++HHDMLA+VLGSKEAAA S++YSY HGFSGFAA +T+S AQ
Sbjct  738  VYIVYFGARKQGDPTVETNSHHDMLASVLGSKEAAAKSILYSYSHGFSGFAAKLTESQAQ  797

Query  323  TFQDLPGVVKVIPNSLYKLRTTRSWDYLGLSLN-SATNLLHDTKMGDGTIVAVLDTGVTP  499
                 PGVV+V+PN+L++L+TTRSWD+LGLS + S T+LL+ ++MGDG IV ++DTG+ P
Sbjct  798  ELAGFPGVVRVMPNTLFRLQTTRSWDFLGLSPSHSPTSLLYKSRMGDGVIVGMIDTGIWP  857

Query  500  ENEAYNDRGLGPIPSKWKGYCE  565
            E+++++D GLGPIPS+WKG CE
Sbjct  858  ESKSFSDEGLGPIPSRWKGGCE  879



>ref|XP_010455450.1| PREDICTED: subtilisin-like protease SBT3.3 [Camelina sativa]
Length=763

 Score =   192 bits (489),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 88/159 (55%), Positives = 114/159 (72%), Gaps = 0/159 (0%)
 Frame = +2

Query  92   LVFQNALVHTSALSEPKVYIVYMGARQHDDVDLITSTHHDMLATVLGSKEAAADSMIYSY  271
            LV    ++ +    E KVY+VY+G + HDD + +T +HH +L  +LGSK A  DS++YSY
Sbjct  14   LVLNLQMISSVFAHETKVYVVYLGKKTHDDPESVTESHHQLLRPLLGSKNAVHDSVVYSY  73

Query  272  RHGFSGFAAMMTKSHAQTFQDLPGVVKVIPNSLYKLRTTRSWDYLGLSLNSATNLLHDTK  451
            RHGFSGFAA +TK  AQ   +LP VV VIPN+LY+L TTR+WDYLGLS  +  +LLH   
Sbjct  74   RHGFSGFAAKLTKFQAQQISELPEVVHVIPNTLYELTTTRTWDYLGLSPGTPKSLLHKAN  133

Query  452  MGDGTIVAVLDTGVTPENEAYNDRGLGPIPSKWKGYCES  568
            MG   IV V+D+GV PE+E +ND+G GPIPS+WKG CES
Sbjct  134  MGSSVIVGVIDSGVWPESEMFNDKGYGPIPSRWKGGCES  172



>gb|AAD03430.1| similar to the subtilase family of serine proteases (Pfam: PF00082, 
score; 47.5, E=3.8e-12, n=2) [Arabidopsis thaliana]
Length=685

 Score =   192 bits (488),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 92/175 (53%), Positives = 122/175 (70%), Gaps = 5/175 (3%)
 Frame = +2

Query  44   KNQNELILFSFFFGCLLVFQNALVHTSALSEPKVYIVYMGARQHDDVDLITSTHHDMLAT  223
            K+   LI  +     L  F   + H  A  E KV+IVY+G +QHDD + +T +HH ML +
Sbjct  10   KSCRTLIFVAIILNGLSTF---VAHAGA--ESKVHIVYLGEKQHDDPEFVTESHHRMLWS  64

Query  224  VLGSKEAAADSMIYSYRHGFSGFAAMMTKSHAQTFQDLPGVVKVIPNSLYKLRTTRSWDY  403
            +LGSKE A  SM++SYRHGFSGFAA +TKS A+   DLP VV V P+S Y+L TTR+WDY
Sbjct  65   LLGSKEDAHSSMVHSYRHGFSGFAAKLTKSQAKKLADLPEVVHVTPDSFYQLDTTRTWDY  124

Query  404  LGLSLNSATNLLHDTKMGDGTIVAVLDTGVTPENEAYNDRGLGPIPSKWKGYCES  568
            LGLS+ +  NLL+DT MG+  I+ ++D+GV PE+E +ND G+GP+PS WKG C S
Sbjct  125  LGLSVANPKNLLNDTNMGEEVIIGIVDSGVWPESEVFNDNGIGPVPSHWKGGCVS  179



>ref|NP_564413.2| subtilase family protein [Arabidopsis thaliana]
 gb|AEE31543.1| subtilase family protein [Arabidopsis thaliana]
Length=773

 Score =   192 bits (488),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 86/147 (59%), Positives = 115/147 (78%), Gaps = 0/147 (0%)
 Frame = +2

Query  125  ALSEPKVYIVYMGARQHDDVDLITSTHHDMLATVLGSKEAAADSMIYSYRHGFSGFAAMM  304
            A ++ KV+IVY+G +QHDD   +T +HH ML+++LGSK+ A +SM+YSYRHGFSGFAA +
Sbjct  23   ASAKSKVHIVYLGEKQHDDPKFVTESHHQMLSSLLGSKDDAHESMVYSYRHGFSGFAAKL  82

Query  305  TKSHAQTFQDLPGVVKVIPNSLYKLRTTRSWDYLGLSLNSATNLLHDTKMGDGTIVAVLD  484
            TKS A+   D P V+ VIP+S Y+L TTR WDYLG S +++ NL+ DT MGD TI+ V+D
Sbjct  83   TKSQAKKIADSPEVIHVIPDSYYELATTRIWDYLGPSADNSKNLVSDTNMGDQTIIGVID  142

Query  485  TGVTPENEAYNDRGLGPIPSKWKGYCE  565
            TGV PE+E++ND G+GP+PS WKG CE
Sbjct  143  TGVWPESESFNDYGVGPVPSHWKGGCE  169



>gb|AAF31277.1|AC006424_6 Second of four adjacent putative subtilase family> [Arabidopsis 
thaliana]
Length=763

 Score =   192 bits (488),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 86/147 (59%), Positives = 115/147 (78%), Gaps = 0/147 (0%)
 Frame = +2

Query  125  ALSEPKVYIVYMGARQHDDVDLITSTHHDMLATVLGSKEAAADSMIYSYRHGFSGFAAMM  304
            A ++ KV+IVY+G +QHDD   +T +HH ML+++LGSK+ A +SM+YSYRHGFSGFAA +
Sbjct  23   ASAKSKVHIVYLGEKQHDDPKFVTESHHQMLSSLLGSKDDAHESMVYSYRHGFSGFAAKL  82

Query  305  TKSHAQTFQDLPGVVKVIPNSLYKLRTTRSWDYLGLSLNSATNLLHDTKMGDGTIVAVLD  484
            TKS A+   D P V+ VIP+S Y+L TTR WDYLG S +++ NL+ DT MGD TI+ V+D
Sbjct  83   TKSQAKKIADSPEVIHVIPDSYYELATTRIWDYLGPSADNSKNLVSDTNMGDQTIIGVID  142

Query  485  TGVTPENEAYNDRGLGPIPSKWKGYCE  565
            TGV PE+E++ND G+GP+PS WKG CE
Sbjct  143  TGVWPESESFNDYGVGPVPSHWKGGCE  169



>ref|NP_567361.1| Subtilase family protein [Arabidopsis thaliana]
 emb|CAB40047.1| putative subtilisin-like protease [Arabidopsis thaliana]
 emb|CAB78177.1| putative subtilisin-like protease [Arabidopsis thaliana]
 gb|AEE82895.1| Subtilase family protein [Arabidopsis thaliana]
Length=775

 Score =   192 bits (487),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 92/175 (53%), Positives = 122/175 (70%), Gaps = 5/175 (3%)
 Frame = +2

Query  44   KNQNELILFSFFFGCLLVFQNALVHTSALSEPKVYIVYMGARQHDDVDLITSTHHDMLAT  223
            K+   LI  +     L  F   + H  A  E KV+IVY+G +QHDD + +T +HH ML +
Sbjct  2    KSCRTLIFVAIILNGLSTF---VAHAGA--ESKVHIVYLGEKQHDDPEFVTESHHRMLWS  56

Query  224  VLGSKEAAADSMIYSYRHGFSGFAAMMTKSHAQTFQDLPGVVKVIPNSLYKLRTTRSWDY  403
            +LGSKE A  SM++SYRHGFSGFAA +TKS A+   DLP VV V P+S Y+L TTR+WDY
Sbjct  57   LLGSKEDAHSSMVHSYRHGFSGFAAKLTKSQAKKLADLPEVVHVTPDSFYQLDTTRTWDY  116

Query  404  LGLSLNSATNLLHDTKMGDGTIVAVLDTGVTPENEAYNDRGLGPIPSKWKGYCES  568
            LGLS+ +  NLL+DT MG+  I+ ++D+GV PE+E +ND G+GP+PS WKG C S
Sbjct  117  LGLSVANPKNLLNDTNMGEEVIIGIVDSGVWPESEVFNDNGIGPVPSHWKGGCVS  171



>ref|NP_564412.1| Subtilase 3.5 [Arabidopsis thaliana]
 sp|Q9MAP7.1|SBT35_ARATH RecName: Full=Subtilisin-like protease SBT3.5; AltName: Full=Subtilase 
subfamily 3 member 5; Short=AtSBT3.5; Flags: Precursor 
[Arabidopsis thaliana]
 gb|AAF31278.1|AC006424_7 First of four adjacent putative subtilase family > [Arabidopsis 
thaliana]
 gb|AAL67022.1| putative subtilisin serine protease [Arabidopsis thaliana]
 gb|AAP04132.1| putative subtilisin serine protease [Arabidopsis thaliana]
 gb|AEE31542.1| Subtilase 3.5 [Arabidopsis thaliana]
Length=774

 Score =   191 bits (485),  Expect = 4e-53, Method: Compositional matrix adjust.
 Identities = 86/148 (58%), Positives = 114/148 (77%), Gaps = 0/148 (0%)
 Frame = +2

Query  125  ALSEPKVYIVYMGARQHDDVDLITSTHHDMLATVLGSKEAAADSMIYSYRHGFSGFAAMM  304
            A  E KV+IVY+G +QHDD + ++ +HH ML+++LGSK  A +SM+YSYRHGFSGFAA +
Sbjct  23   ASDESKVHIVYLGEKQHDDPEFVSESHHQMLSSLLGSKVDAHESMVYSYRHGFSGFAAKL  82

Query  305  TKSHAQTFQDLPGVVKVIPNSLYKLRTTRSWDYLGLSLNSATNLLHDTKMGDGTIVAVLD  484
            T+S A+   D P VV V+ +S Y+L TTR+WDYLGLS+ +  NLL+DT MGD  I+  +D
Sbjct  83   TESQAKKLADSPEVVHVMADSFYELATTRTWDYLGLSVANPNNLLNDTNMGDQVIIGFID  142

Query  485  TGVTPENEAYNDRGLGPIPSKWKGYCES  568
            TGV PE+E++ND G+GPIPS WKG CES
Sbjct  143  TGVWPESESFNDNGVGPIPSHWKGGCES  170



>ref|XP_006358675.1| PREDICTED: xylem serine proteinase 1-like [Solanum tuberosum]
Length=1174

 Score =   193 bits (490),  Expect = 5e-53, Method: Compositional matrix adjust.
 Identities = 87/161 (54%), Positives = 116/161 (72%), Gaps = 0/161 (0%)
 Frame = +2

Query  86   CLLVFQNALVHTSALSEPKVYIVYMGARQHDDVDLITSTHHDMLATVLGSKEAAADSMIY  265
            C +    ++   +   + KVYI+Y+G + HDD +LIT +HHD+L+ V GSKE A   M+Y
Sbjct  413  CEVTLPVSVFSDNEADDSKVYIIYLGHKPHDDHELITDSHHDILSQVAGSKEEAKKMMMY  472

Query  266  SYRHGFSGFAAMMTKSHAQTFQDLPGVVKVIPNSLYKLRTTRSWDYLGLSLNSATNLLHD  445
            SYRHGFSGFAA +T S A+   +LP VV+VI N LY   T+RSWD+LGLS NS  NLL+ 
Sbjct  473  SYRHGFSGFAAKLTNSQAKQIGELPDVVRVIKNPLYTTHTSRSWDFLGLSRNSPNNLLNK  532

Query  446  TKMGDGTIVAVLDTGVTPENEAYNDRGLGPIPSKWKGYCES  568
            T  GDG I+ VLD+G++ E+EA+ND G+GPIPS+WKG C+S
Sbjct  533  TNQGDGMIIGVLDSGISGESEAFNDNGMGPIPSRWKGICKS  573



>ref|XP_009114844.1| PREDICTED: subtilisin-like protease SBT5.3 [Brassica rapa]
Length=774

 Score =   191 bits (484),  Expect = 6e-53, Method: Compositional matrix adjust.
 Identities = 87/146 (60%), Positives = 113/146 (77%), Gaps = 0/146 (0%)
 Frame = +2

Query  125  ALSEPKVYIVYMGARQHDDVDLITSTHHDMLATVLGSKEAAADSMIYSYRHGFSGFAAMM  304
            A +E K++IVY+G +QHDD  L+T +HH ML+++LGSKE A DSM+YSYRHGFSGFAA +
Sbjct  23   ASAETKIHIVYLGEKQHDDPKLVTESHHQMLSSLLGSKEDAHDSMVYSYRHGFSGFAARL  82

Query  305  TKSHAQTFQDLPGVVKVIPNSLYKLRTTRSWDYLGLSLNSATNLLHDTKMGDGTIVAVLD  484
            TKS A+     P VV V+P+S Y+L TTR+WDYLGL   +  NLL++T MGD  I+ V+D
Sbjct  83   TKSQAKKISYSPEVVHVMPDSYYELATTRTWDYLGLGTANPKNLLNNTNMGDQVIIGVVD  142

Query  485  TGVTPENEAYNDRGLGPIPSKWKGYC  562
            TGV PE+E++ND G+GPIPS WKG C
Sbjct  143  TGVWPESESFNDDGVGPIPSHWKGGC  168



>ref|XP_007039328.1| Subtilase family protein, putative isoform 2 [Theobroma cacao]
 gb|EOY23829.1| Subtilase family protein, putative isoform 2 [Theobroma cacao]
Length=776

 Score =   190 bits (483),  Expect = 7e-53, Method: Compositional matrix adjust.
 Identities = 81/145 (56%), Positives = 114/145 (79%), Gaps = 0/145 (0%)
 Frame = +2

Query  131  SEPKVYIVYMGARQHDDVDLITSTHHDMLATVLGSKEAAADSMIYSYRHGFSGFAAMMTK  310
            ++  V+IVYMG ++H D      +HH ML+T+LGSKEAA +SM+YSY+HGFSGFAA +T+
Sbjct  31   AKSNVHIVYMGEKKHQDPATTKMSHHKMLSTLLGSKEAAKNSMLYSYKHGFSGFAARLTE  90

Query  311  SHAQTFQDLPGVVKVIPNSLYKLRTTRSWDYLGLSLNSATNLLHDTKMGDGTIVAVLDTG  490
            S A+     PGVV VIPN +++L TTRSW+++GL  +S+ NLL  + MG+GTI+ V+D+G
Sbjct  91   SQAEEIAAFPGVVHVIPNRIHRLHTTRSWEFMGLKYHSSKNLLTQSNMGEGTIIGVIDSG  150

Query  491  VTPENEAYNDRGLGPIPSKWKGYCE  565
            V PE+E++NDRG+GPIPS+WKG C+
Sbjct  151  VWPESESFNDRGMGPIPSRWKGTCQ  175



>ref|XP_006286616.1| hypothetical protein CARUB_v10002407mg, partial [Capsella rubella]
 gb|EOA19514.1| hypothetical protein CARUB_v10002407mg, partial [Capsella rubella]
Length=719

 Score =   190 bits (482),  Expect = 8e-53, Method: Compositional matrix adjust.
 Identities = 87/162 (54%), Positives = 120/162 (74%), Gaps = 2/162 (1%)
 Frame = +2

Query  89   LLVFQNALVHTSAL--SEPKVYIVYMGARQHDDVDLITSTHHDMLATVLGSKEAAADSMI  262
            +L+   +L + S L   E  VY+VY+G ++HD+ D +T +HH ML  +LGSK+ A DS++
Sbjct  5    VLILSISLENNSELLKIENPVYVVYLGEKEHDNPDSVTESHHQMLWPILGSKKDAHDSIV  64

Query  263  YSYRHGFSGFAAMMTKSHAQTFQDLPGVVKVIPNSLYKLRTTRSWDYLGLSLNSATNLLH  442
            YSYRHGFSGFAA +T+S AQ   +LP VV+VIPN+LY++ TTR+W+YLG+S  ++ +LL 
Sbjct  65   YSYRHGFSGFAAKLTESQAQQISELPEVVQVIPNTLYEMTTTRTWEYLGISPANSNSLLQ  124

Query  443  DTKMGDGTIVAVLDTGVTPENEAYNDRGLGPIPSKWKGYCES  568
               MG   IV V+DTGV PE+E +ND+G GPIPS+WKG CES
Sbjct  125  KANMGSQVIVGVIDTGVWPESEMFNDKGYGPIPSRWKGGCES  166



>ref|XP_010542096.1| PREDICTED: LOW QUALITY PROTEIN: subtilisin-like protease SBT3.5 
[Tarenaya hassleriana]
Length=812

 Score =   190 bits (482),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 84/163 (52%), Positives = 119/163 (73%), Gaps = 2/163 (1%)
 Frame = +2

Query  86   CLLVFQNALVHT--SALSEPKVYIVYMGARQHDDVDLITSTHHDMLATVLGSKEAAADSM  259
            CL++  N    +   A +E KV+IVY+G +QH+D + +T +HH +L ++LGS E A  SM
Sbjct  44   CLIILLNGQSSSFARANAEKKVHIVYLGEKQHEDPNTVTESHHQILCSLLGSNETAHKSM  103

Query  260  IYSYRHGFSGFAAMMTKSHAQTFQDLPGVVKVIPNSLYKLRTTRSWDYLGLSLNSATNLL  439
            +YSYRHGFSGFAA +T S A+   +LP V+ V P+S Y++ TTR+WDYLGLS  +  NLL
Sbjct  104  VYSYRHGFSGFAAKLTASQAKELAELPEVIHVTPDSFYQVATTRTWDYLGLSAANPKNLL  163

Query  440  HDTKMGDGTIVAVLDTGVTPENEAYNDRGLGPIPSKWKGYCES  568
            ++T MG+  I+ V+DTGV PE+E +ND G+GPIPS+W+G C+S
Sbjct  164  NETDMGEQVIIGVIDTGVWPESEVFNDNGIGPIPSRWRGGCQS  206



>ref|XP_010919043.1| PREDICTED: subtilisin-like protease SBT3.3 isoform X2 [Elaeis 
guineensis]
Length=741

 Score =   188 bits (477),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 89/170 (52%), Positives = 124/170 (73%), Gaps = 5/170 (3%)
 Frame = +2

Query  59   LILFSFFFGCLLVFQNALVHTSALSEPKVYIVYMGARQHDD-VDLITSTHHDMLATVLGS  235
            L+LF+  F  L     +L+  +  S   V+IVYMGAR H+D    + S+HHD+L T+LGS
Sbjct  28   LVLFASLF--LNFHLTSLIFLAEAS--NVHIVYMGARDHEDSTTTVESSHHDVLTTLLGS  83

Query  236  KEAAADSMIYSYRHGFSGFAAMMTKSHAQTFQDLPGVVKVIPNSLYKLRTTRSWDYLGLS  415
            KEAA DS++YSY+H FSGFAA +TKS A+   + PG+V+VIPN + KL TTRSWD++GL 
Sbjct  84   KEAAKDSILYSYKHSFSGFAARLTKSQAERLAEFPGIVQVIPNKVRKLHTTRSWDFIGLH  143

Query  416  LNSATNLLHDTKMGDGTIVAVLDTGVTPENEAYNDRGLGPIPSKWKGYCE  565
             NS  +LL +++MG   I+ V+D+G+ PE+E++ND G+GPIPS+WKG CE
Sbjct  144  PNSRDSLLSESRMGKELIIGVIDSGIWPESESFNDEGMGPIPSRWKGTCE  193



>ref|XP_010919042.1| PREDICTED: subtilisin-like protease SBT3.3 isoform X1 [Elaeis 
guineensis]
Length=792

 Score =   188 bits (478),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 89/170 (52%), Positives = 124/170 (73%), Gaps = 5/170 (3%)
 Frame = +2

Query  59   LILFSFFFGCLLVFQNALVHTSALSEPKVYIVYMGARQHDD-VDLITSTHHDMLATVLGS  235
            L+LF+  F  L     +L+  +  S   V+IVYMGAR H+D    + S+HHD+L T+LGS
Sbjct  28   LVLFASLF--LNFHLTSLIFLAEAS--NVHIVYMGARDHEDSTTTVESSHHDVLTTLLGS  83

Query  236  KEAAADSMIYSYRHGFSGFAAMMTKSHAQTFQDLPGVVKVIPNSLYKLRTTRSWDYLGLS  415
            KEAA DS++YSY+H FSGFAA +TKS A+   + PG+V+VIPN + KL TTRSWD++GL 
Sbjct  84   KEAAKDSILYSYKHSFSGFAARLTKSQAERLAEFPGIVQVIPNKVRKLHTTRSWDFIGLH  143

Query  416  LNSATNLLHDTKMGDGTIVAVLDTGVTPENEAYNDRGLGPIPSKWKGYCE  565
             NS  +LL +++MG   I+ V+D+G+ PE+E++ND G+GPIPS+WKG CE
Sbjct  144  PNSRDSLLSESRMGKELIIGVIDSGIWPESESFNDEGMGPIPSRWKGTCE  193



>ref|XP_006415136.1| hypothetical protein EUTSA_v10006855mg [Eutrema salsugineum]
 gb|ESQ33489.1| hypothetical protein EUTSA_v10006855mg [Eutrema salsugineum]
Length=782

 Score =   188 bits (477),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 85/148 (57%), Positives = 114/148 (77%), Gaps = 0/148 (0%)
 Frame = +2

Query  119  TSALSEPKVYIVYMGARQHDDVDLITSTHHDMLATVLGSKEAAADSMIYSYRHGFSGFAA  298
            + A ++ KV+IVY+G +QHDD D +T +HH +L++VLGSKE A DSM++SYRHGFSGFAA
Sbjct  29   SRADAKSKVHIVYLGEKQHDDPDFVTESHHQILSSVLGSKEDAHDSMVHSYRHGFSGFAA  88

Query  299  MMTKSHAQTFQDLPGVVKVIPNSLYKLRTTRSWDYLGLSLNSATNLLHDTKMGDGTIVAV  478
             +T+S A+   D   VV VIP+S Y+L TTR+WDYLGLS+ +  NLL+DT MG   I+  
Sbjct  89   KLTESQAKILADSREVVHVIPDSFYELATTRTWDYLGLSVANPKNLLNDTNMGGQVIIGF  148

Query  479  LDTGVTPENEAYNDRGLGPIPSKWKGYC  562
            +D+GV PE+E++ND G+GPIPS WKG C
Sbjct  149  IDSGVWPESESFNDNGVGPIPSHWKGKC  176



>ref|XP_010470495.1| PREDICTED: subtilisin-like protease SBT3.5 isoform X1 [Camelina 
sativa]
Length=760

 Score =   187 bits (476),  Expect = 5e-52, Method: Compositional matrix adjust.
 Identities = 89/174 (51%), Positives = 122/174 (70%), Gaps = 1/174 (1%)
 Frame = +2

Query  47   NQNELILFSFFFGCLLVFQNALVHTSALSEPKVYIVYMGARQHDDVDLITSTHHDMLATV  226
            + NE      F G +L+F+ AL+ T+A  + ++Y V++G RQHDD DL+T +HHD+L  +
Sbjct  9    SNNEKHFVVLFIGLVLIFKIALI-TAANEDNQIYTVHLGKRQHDDPDLVTESHHDILGPL  67

Query  227  LGSKEAAADSMIYSYRHGFSGFAAMMTKSHAQTFQDLPGVVKVIPNSLYKLRTTRSWDYL  406
            LGSKEA+ +SMIYSYRHGFSGFAA +T S A+   + P VV V  +   KL TTR  DYL
Sbjct  68   LGSKEASRESMIYSYRHGFSGFAAKLTSSQARELSEHPDVVHVTRSKNMKLTTTRVNDYL  127

Query  407  GLSLNSATNLLHDTKMGDGTIVAVLDTGVTPENEAYNDRGLGPIPSKWKGYCES  568
            GL+  + T LLH+T MG G I+ ++D+GV P++ ++ND GLGPIP +WKG C S
Sbjct  128  GLTPTAPTGLLHETDMGSGVIIGIVDSGVWPDSPSFNDNGLGPIPRRWKGRCVS  181



>ref|XP_002278450.2| PREDICTED: subtilisin-like protease SBT3.3 [Vitis vinifera]
Length=787

 Score =   187 bits (474),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 80/141 (57%), Positives = 110/141 (78%), Gaps = 0/141 (0%)
 Frame = +2

Query  143  VYIVYMGARQHDDVDLITSTHHDMLATVLGSKEAAADSMIYSYRHGFSGFAAMMTKSHAQ  322
            VYIVYMG ++H+D   I   HH+ML+T+LGSKEAA  S++YSY+HGFSGFAA +T+S A+
Sbjct  46   VYIVYMGEKKHEDPATIKKCHHEMLSTLLGSKEAAKSSILYSYKHGFSGFAAKLTESQAE  105

Query  323  TFQDLPGVVKVIPNSLYKLRTTRSWDYLGLSLNSATNLLHDTKMGDGTIVAVLDTGVTPE  502
                 PGVV+VIPN +++L TTRSWD+LGL  +  TN+L +T +G G I+ V+D+GV PE
Sbjct  106  DIAGFPGVVQVIPNRIHRLHTTRSWDFLGLQHDYPTNVLTETNLGRGVIIGVIDSGVWPE  165

Query  503  NEAYNDRGLGPIPSKWKGYCE  565
            +E++ D G+GPIPS+WKG C+
Sbjct  166  SESFKDEGMGPIPSRWKGICQ  186



>gb|ABE66081.1| subtilase family protein [Arabidopsis thaliana]
Length=301

 Score =   179 bits (454),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 82/156 (53%), Positives = 111/156 (71%), Gaps = 10/156 (6%)
 Frame = +2

Query  131  SEPKVYIVYMGARQHDDVDLITSTHHDMLATVLGSKEAAADSMIYSYRHGFSGFAAMMTK  310
            S  KVYIVY+G R+HDD +L+T++HH ML ++L SKE A +SMIYSY+HGFSGFAA++T 
Sbjct  37   SNSKVYIVYLGQREHDDPELLTASHHQMLESLLQSKEDAHNSMIYSYQHGFSGFAALLTS  96

Query  311  SHAQTFQDLPGVVKVIPNSLYKLRTTRSWDYLGLS----------LNSATNLLHDTKMGD  460
            S A+   + P V+ VIPN + KL+TTR WD+LGLS             A  LLH+T MG 
Sbjct  97   SQAKKISEHPEVIHVIPNRILKLKTTRIWDHLGLSPIPTSFSSSSSAKAKGLLHNTSMGS  156

Query  461  GTIVAVLDTGVTPENEAYNDRGLGPIPSKWKGYCES  568
              I+ V+D+G+ PE++ +ND+GLGPIP +W+G C S
Sbjct  157  EAIIGVVDSGIWPESKVFNDQGLGPIPKRWRGKCRS  192



>ref|XP_010470055.1| PREDICTED: subtilisin-like protease SBT3.3 [Camelina sativa]
Length=750

 Score =   186 bits (473),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 84/145 (58%), Positives = 108/145 (74%), Gaps = 0/145 (0%)
 Frame = +2

Query  134  EPKVYIVYMGARQHDDVDLITSTHHDMLATVLGSKEAAADSMIYSYRHGFSGFAAMMTKS  313
            E KVY+VY+G + HD  + +T +HH +L  +LGSK+   DS++YSYRHGFSGFAA +T+S
Sbjct  18   ETKVYVVYLGKKTHDHPESVTESHHQLLRPLLGSKKEVHDSIVYSYRHGFSGFAAKLTES  77

Query  314  HAQTFQDLPGVVKVIPNSLYKLRTTRSWDYLGLSLNSATNLLHDTKMGDGTIVAVLDTGV  493
             AQ    LP VV VIPN+LY+L TTR+WDYLGLS  ++ +LLH   MG   IV V+DTGV
Sbjct  78   QAQQISQLPEVVHVIPNTLYELTTTRTWDYLGLSPGTSKSLLHKANMGSQVIVGVIDTGV  137

Query  494  TPENEAYNDRGLGPIPSKWKGYCES  568
             PE+E +ND+G GPIPS+WKG C S
Sbjct  138  WPESEMFNDKGYGPIPSRWKGGCVS  162



>ref|XP_010421968.1| PREDICTED: subtilisin-like protease SBT3.3 [Camelina sativa]
Length=759

 Score =   186 bits (473),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 84/145 (58%), Positives = 108/145 (74%), Gaps = 0/145 (0%)
 Frame = +2

Query  134  EPKVYIVYMGARQHDDVDLITSTHHDMLATVLGSKEAAADSMIYSYRHGFSGFAAMMTKS  313
            E KVY+VY+G + HD  + +T +HH +L  +LGSK+   DS++YSYRHGFSGFAA +T+S
Sbjct  27   ETKVYVVYLGKKTHDHPESVTESHHQLLRPLLGSKKEVHDSVVYSYRHGFSGFAAKLTES  86

Query  314  HAQTFQDLPGVVKVIPNSLYKLRTTRSWDYLGLSLNSATNLLHDTKMGDGTIVAVLDTGV  493
             AQ    LP VV VIPN+LY+L TTR+WDYLGLS  ++ +LLH   MG   IV V+DTGV
Sbjct  87   QAQQISQLPEVVHVIPNTLYELTTTRTWDYLGLSPGTSKSLLHKANMGSQVIVGVIDTGV  146

Query  494  TPENEAYNDRGLGPIPSKWKGYCES  568
             PE+E +ND+G GPIPS+WKG C S
Sbjct  147  WPESEMFNDKGYGPIPSRWKGGCVS  171



>gb|KFK25462.1| hypothetical protein AALP_AA8G118000 [Arabis alpina]
Length=484

 Score =   183 bits (464),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 81/151 (54%), Positives = 118/151 (78%), Gaps = 0/151 (0%)
 Frame = +2

Query  110  LVHTSALSEPKVYIVYMGARQHDDVDLITSTHHDMLATVLGSKEAAADSMIYSYRHGFSG  289
            +    A  E KV+IVY+G  +H+D +L+T++H DML ++LGSK+ A++SM++SYRH FSG
Sbjct  13   IAEGGACEETKVHIVYLGEPEHNDPELVTASHLDMLESLLGSKKDASESMVHSYRHAFSG  72

Query  290  FAAMMTKSHAQTFQDLPGVVKVIPNSLYKLRTTRSWDYLGLSLNSATNLLHDTKMGDGTI  469
            FA  +T S A+   + P V++V+PN LY+L+TTR++DYLG+S ++   LLHD KMG+ TI
Sbjct  73   FAVHLTDSQAEKIAEHPDVLEVMPNHLYELQTTRTFDYLGVSQSNPKGLLHDAKMGEDTI  132

Query  470  VAVLDTGVTPENEAYNDRGLGPIPSKWKGYC  562
            + VLD+GV PE+E+++DRGLGPIP+KWKG C
Sbjct  133  IGVLDSGVWPESESFSDRGLGPIPAKWKGKC  163



>ref|XP_010551747.1| PREDICTED: subtilisin-like protease SBT3.5 [Tarenaya hassleriana]
Length=761

 Score =   186 bits (471),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 86/164 (52%), Positives = 115/164 (70%), Gaps = 1/164 (1%)
 Frame = +2

Query  80   FGCLLVFQNALVHTSALSE-PKVYIVYMGARQHDDVDLITSTHHDMLATVLGSKEAAADS  256
             G  L+   AL   +   E  K++IVY+GARQH+D +L+T++HH +L +V GSK+AA  S
Sbjct  20   IGFALILNGALSSAAGTGEISKIHIVYLGARQHEDPELVTASHHTILESVFGSKDAARKS  79

Query  257  MIYSYRHGFSGFAAMMTKSHAQTFQDLPGVVKVIPNSLYKLRTTRSWDYLGLSLNSATNL  436
            MIYSYRHGFSGFAA +  S  +     P VV V PN + +L+TTRS+DYLGLS N+   L
Sbjct  80   MIYSYRHGFSGFAAKLNSSQVKALSAHPDVVHVAPNRILQLKTTRSFDYLGLSPNAPKGL  139

Query  437  LHDTKMGDGTIVAVLDTGVTPENEAYNDRGLGPIPSKWKGYCES  568
            LHDT MG   I+ V+D+G+ PE E++ND+GL PIP++WKG C S
Sbjct  140  LHDTNMGSDAIIGVIDSGIWPEAESFNDKGLSPIPTRWKGGCVS  183



>ref|XP_010920365.1| PREDICTED: subtilisin-like protease SBT3.5 [Elaeis guineensis]
Length=722

 Score =   186 bits (471),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 79/144 (55%), Positives = 112/144 (78%), Gaps = 2/144 (1%)
 Frame = +2

Query  140  KVYIVYMGARQHDDVDLITSTHHDMLATVLGSKEAAADSMIYSYRHGFSGFAAMMTKSHA  319
            K+YIVYMG +QH+D +L+T++HHDML ++LGSKE A +S++YSY+HGFSGFAA +TKS A
Sbjct  10   KLYIVYMGEKQHEDPNLVTASHHDMLTSLLGSKEKALNSIVYSYKHGFSGFAAWLTKSQA  69

Query  320  QTFQDLPGVVKVIPNSLYKLRTTRSWDYLGLSL--NSATNLLHDTKMGDGTIVAVLDTGV  493
                D PGV+ V+PN  +++ TTRSWD+LGL+    +AT LLH    G+  I+ V+D+G+
Sbjct  70   NKISDFPGVLSVMPNRKHRVHTTRSWDFLGLNYYHPTATGLLHKANYGENVIIGVIDSGI  129

Query  494  TPENEAYNDRGLGPIPSKWKGYCE  565
             PE++++ND G GP+PS+WKG CE
Sbjct  130  WPESKSFNDHGFGPVPSRWKGKCE  153



>ref|XP_002872521.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH48780.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
Length=766

 Score =   185 bits (470),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 82/142 (58%), Positives = 110/142 (77%), Gaps = 0/142 (0%)
 Frame = +2

Query  143  VYIVYMGARQHDDVDLITSTHHDMLATVLGSKEAAADSMIYSYRHGFSGFAAMMTKSHAQ  322
            V+IVY+G +QHDD +L+T +HH ML ++LGSKE A +SM++++RHGFSGFAA +T+S A+
Sbjct  22   VHIVYLGEKQHDDPELVTKSHHRMLWSLLGSKEDAHNSMVHNFRHGFSGFAAKLTESQAK  81

Query  323  TFQDLPGVVKVIPNSLYKLRTTRSWDYLGLSLNSATNLLHDTKMGDGTIVAVLDTGVTPE  502
               DLP VV VIP+  YK  TTR+WDYLGLS  +  NLL +T MG+  I+ ++DTGV PE
Sbjct  82   KIADLPEVVHVIPDKFYKPATTRTWDYLGLSATNPKNLLSETIMGEQMIIGIIDTGVWPE  141

Query  503  NEAYNDRGLGPIPSKWKGYCES  568
            +E +ND G+GP+PS WKG CES
Sbjct  142  SEVFNDNGIGPVPSHWKGGCES  163



>ref|XP_006286458.1| hypothetical protein CARUB_v10000288mg [Capsella rubella]
 gb|EOA19356.1| hypothetical protein CARUB_v10000288mg [Capsella rubella]
Length=759

 Score =   185 bits (470),  Expect = 4e-51, Method: Compositional matrix adjust.
 Identities = 89/172 (52%), Positives = 121/172 (70%), Gaps = 4/172 (2%)
 Frame = +2

Query  53   NELILFSFFFGCLLVFQNALVHTSALSEPKVYIVYMGARQHDDVDLITSTHHDMLATVLG  232
            N  I+ +     +L  Q +LV     +E KVY+VYMG + HDD + +T +HH +L  +LG
Sbjct  3    NISIIIAMVLTIVLNLQVSLV----FAETKVYVVYMGKKIHDDPESVTESHHQLLWPLLG  58

Query  233  SKEAAADSMIYSYRHGFSGFAAMMTKSHAQTFQDLPGVVKVIPNSLYKLRTTRSWDYLGL  412
            SK+A   S++YSY HGFSGFAA +T+S AQ   +LP VV+V  NSLY+L TTR+WDYLG+
Sbjct  59   SKKAVHGSIVYSYLHGFSGFAAKLTESQAQQISELPNVVQVTANSLYELTTTRTWDYLGI  118

Query  413  SLNSATNLLHDTKMGDGTIVAVLDTGVTPENEAYNDRGLGPIPSKWKGYCES  568
            S  ++ +LL++ KMG   IV V+DTGV PE+E +ND+G GPIPS+WKG C S
Sbjct  119  SPGNSQSLLNEAKMGSPVIVGVIDTGVWPESEMFNDKGYGPIPSRWKGGCVS  170



>ref|NP_567633.2| Subtilase family protein [Arabidopsis thaliana]
 gb|AAO00797.1| subtilisin proteinase - like [Arabidopsis thaliana]
 gb|AEE84485.1| Subtilase family protein [Arabidopsis thaliana]
Length=766

 Score =   185 bits (470),  Expect = 4e-51, Method: Compositional matrix adjust.
 Identities = 83/153 (54%), Positives = 115/153 (75%), Gaps = 8/153 (5%)
 Frame = +2

Query  131  SEPKVYIVYMGARQHDDVDLITSTHHDMLATVLGSKEAAADSMIYSYRHGFSGFAAMMTK  310
            S+ KVYIVY+G R+HDD +L+T++HH ML ++L SKE A +S+IYSY+HGFSGFAA++T 
Sbjct  37   SDSKVYIVYLGEREHDDPELVTASHHQMLESLLQSKEDAQNSLIYSYQHGFSGFAALLTS  96

Query  311  SHAQTFQDLPGVVKVIPNSLYKLRTTRSWDYLGL--------SLNSATNLLHDTKMGDGT  466
            S A+   + P V+ VIPN + KL+TTR+WD+LGL        SL+S   LLHDT +G   
Sbjct  97   SQAKKISEHPEVIHVIPNRIRKLKTTRAWDHLGLSPIPTSFSSLSSVKGLLHDTNLGSEA  156

Query  467  IVAVLDTGVTPENEAYNDRGLGPIPSKWKGYCE  565
            I+ V+D+G+ PE++A ND+GLGPIP +W+G CE
Sbjct  157  IIGVIDSGIWPESKAVNDQGLGPIPKRWRGKCE  189



>ref|XP_011040612.1| PREDICTED: subtilisin-like protease SBT3.5 [Populus euphratica]
Length=778

 Score =   185 bits (470),  Expect = 4e-51, Method: Compositional matrix adjust.
 Identities = 87/168 (52%), Positives = 124/168 (74%), Gaps = 6/168 (4%)
 Frame = +2

Query  77   FFGCLLVF--QNALVHTS---ALSEPKVYIVYMGARQHDDVDLITSTHHDMLATVLGSKE  241
            FF  + VF  Q+ L H S   A +  KV+IVYMG ++H+D  +    H++ML T+LGSKE
Sbjct  16   FFTIIAVFLIQHQL-HVSVKCAEATKKVHIVYMGEKEHEDPAITKKIHYEMLLTLLGSKE  74

Query  242  AAADSMIYSYRHGFSGFAAMMTKSHAQTFQDLPGVVKVIPNSLYKLRTTRSWDYLGLSLN  421
            AA  S++YSYRHGFSGFAA +T+S A+   + PGVV+VIPN ++KL TTRSW+++GL+ +
Sbjct  75   AARSSILYSYRHGFSGFAAKLTESQAEDIAEFPGVVQVIPNGIHKLHTTRSWEFIGLNHH  134

Query  422  SATNLLHDTKMGDGTIVAVLDTGVTPENEAYNDRGLGPIPSKWKGYCE  565
            S  NLL  + MG GTI+ V+D+GV PE+++++D G+GP+PS WKG C+
Sbjct  135  SPQNLLKQSNMGQGTIIGVIDSGVWPESKSFHDEGMGPVPSHWKGICQ  182



>ref|XP_004146562.1| PREDICTED: subtilisin-like protease-like [Cucumis sativus]
 ref|XP_004160980.1| PREDICTED: subtilisin-like protease-like [Cucumis sativus]
 gb|KGN53334.1| hypothetical protein Csa_4G047950 [Cucumis sativus]
Length=764

 Score =   185 bits (470),  Expect = 4e-51, Method: Compositional matrix adjust.
 Identities = 86/172 (50%), Positives = 122/172 (71%), Gaps = 5/172 (3%)
 Frame = +2

Query  59   LILFSFFFGCLLVFQNALVHTSALSEPKVYIVYMGARQHDDVDLITSTHHDMLATVLGSK  238
            LI+    F CL  F+  L        PKV+IVY+G + H D      +HH +L+T+LGSK
Sbjct  10   LIVGFIIFDCL--FKPILAEADD-QNPKVHIVYLGEKPHHDTKFTIDSHHQLLSTILGSK  66

Query  239  EAAADSMIYSYRHGFSGFAAMMTKSHAQTFQDLPGVVKVIPNSLYKLRTTRSWDYLGLSL  418
            E + ++M+YSY+HGFSGFAA +TKS AQ   ++  VV+V+P+SLYK+ TTRSWD+LGLS 
Sbjct  67   EKSMEAMVYSYKHGFSGFAAKLTKSQAQKLSEMSRVVRVVPSSLYKVHTTRSWDFLGLSS  126

Query  419  N--SATNLLHDTKMGDGTIVAVLDTGVTPENEAYNDRGLGPIPSKWKGYCES  568
            +   ++NLLH  +MG+  I+ V+DTG+ PE+E++ D+G+G IPS+WKG CES
Sbjct  127  SPFESSNLLHRAQMGENVIIGVIDTGIWPESESFKDKGVGSIPSRWKGTCES  178



>ref|NP_568255.1| Subtilase family protein [Arabidopsis thaliana]
 gb|ABE66153.1| subtilase family protein [Arabidopsis thaliana]
 gb|AED91742.1| Subtilase family protein [Arabidopsis thaliana]
Length=762

 Score =   184 bits (468),  Expect = 7e-51, Method: Compositional matrix adjust.
 Identities = 81/159 (51%), Positives = 122/159 (77%), Gaps = 0/159 (0%)
 Frame = +2

Query  86   CLLVFQNALVHTSALSEPKVYIVYMGARQHDDVDLITSTHHDMLATVLGSKEAAADSMIY  265
            C+L  +  +V   A  E KV+IVY+G ++H+D +L+TS+H  ML ++LGSK+ A++S+++
Sbjct  18   CILKVEFNIVEGGAYEETKVHIVYLGEKEHNDPELVTSSHLRMLESLLGSKKDASESIVH  77

Query  266  SYRHGFSGFAAMMTKSHAQTFQDLPGVVKVIPNSLYKLRTTRSWDYLGLSLNSATNLLHD  445
            SYR+GFSGFAA +T S A+   + P VV+V PN+ Y+L+TTR++DYLGLS ++   LLH+
Sbjct  78   SYRNGFSGFAAHLTDSQAEQISEHPDVVQVTPNTFYELQTTRTFDYLGLSHSTPKGLLHE  137

Query  446  TKMGDGTIVAVLDTGVTPENEAYNDRGLGPIPSKWKGYC  562
             KMG+  I+ VLD+GV PE++++ND+GLGPIP +WKG C
Sbjct  138  AKMGEDIIIGVLDSGVWPESQSFNDKGLGPIPKRWKGMC  176



>emb|CAH66109.1| OSIGBa0115D20.2 [Oryza sativa Indica Group]
 emb|CAH65954.1| H0716A07.12 [Oryza sativa Indica Group]
Length=323

 Score =   177 bits (450),  Expect = 9e-51, Method: Compositional matrix adjust.
 Identities = 76/142 (54%), Positives = 105/142 (74%), Gaps = 0/142 (0%)
 Frame = +2

Query  140  KVYIVYMGARQHDDVDLITSTHHDMLATVLGSKEAAADSMIYSYRHGFSGFAAMMTKSHA  319
            K+YIVY+G R+HDD D++T +HHDMLA+VLGSKE A +S++YSYRH FSGFAA +T++ A
Sbjct  38   KIYIVYLGERRHDDADVVTGSHHDMLASVLGSKEVALESIVYSYRHSFSGFAARLTEAQA  97

Query  320  QTFQDLPGVVKVIPNSLYKLRTTRSWDYLGLSLNSATNLLHDTKMGDGTIVAVLDTGVTP  499
             T + LP V+ V  N +++L T+RSWD+LG+       LL   K G+  I+ V+DTG+TP
Sbjct  98   STIRGLPDVISVRENQIHRLHTSRSWDFLGMDYRQPNGLLDKAKYGEDIIIGVIDTGITP  157

Query  500  ENEAYNDRGLGPIPSKWKGYCE  565
            E+ ++ D G GP PSKWKG C+
Sbjct  158  ESPSFADDGYGPPPSKWKGVCQ  179



>ref|XP_004978766.1| PREDICTED: subtilisin-like protease-like [Setaria italica]
Length=743

 Score =   184 bits (467),  Expect = 9e-51, Method: Compositional matrix adjust.
 Identities = 80/144 (56%), Positives = 114/144 (79%), Gaps = 2/144 (1%)
 Frame = +2

Query  140  KVYIVYMGARQHDDVDLITSTHHDMLATVLGSKEAAADSMIYSYRHGFSGFAAMMTKSHA  319
            K+YIVYMG ++HDD  ++T++HHD+LA+VLGSK+ A  S++YSY+HGFSGFAAM+TKS A
Sbjct  28   KLYIVYMGEKKHDDPSVVTASHHDVLASVLGSKDEAMKSIVYSYKHGFSGFAAMLTKSQA  87

Query  320  QTFQDLPGVVKVIPNSLYKLRTTRSWDYLGLSL--NSATNLLHDTKMGDGTIVAVLDTGV  493
            +T ++LPGVV V PN+ Y+  TTRSWD+LGL    +SA +LL   K G+  IV V+DTG+
Sbjct  88   ETIKNLPGVVSVKPNTRYQTATTRSWDFLGLDYYQSSAPDLLRKAKYGEDIIVGVVDTGI  147

Query  494  TPENEAYNDRGLGPIPSKWKGYCE  565
             PE+ +++D G GP+P++W+G C+
Sbjct  148  WPESRSFDDSGYGPVPARWRGVCQ  171



>emb|CAB40021.1| subtilisin-like protease-like protein [Arabidopsis thaliana]
 emb|CAB78178.1| subtilisin-like protease-like protein [Arabidopsis thaliana]
Length=803

 Score =   184 bits (468),  Expect = 9e-51, Method: Compositional matrix adjust.
 Identities = 92/185 (50%), Positives = 120/185 (65%), Gaps = 26/185 (14%)
 Frame = +2

Query  89   LLVFQNALVHTSALSEPKVYIVYMGARQHDDVDLITSTHHDMLATVLGSKEAAADSMIYS  268
             L  Q + V  S+ ++ KV+IVY+G +QHDD + +T +HH ML ++LGSKE A DSM+YS
Sbjct  17   FLNVQRSFVAESS-AKRKVHIVYLGEKQHDDPEFVTESHHRMLWSLLGSKEDANDSMVYS  75

Query  269  YRHGFSGFAAMMTKSHAQTFQDLPGVVKVIPNSLYKLRTTRSWDYLGLSLNSATNLLHDT  448
            YRHGFSGFAA +T+S A+   DLP VV VIP+S YKL TTR+WDYLGLS  +  +LLH+T
Sbjct  76   YRHGFSGFAAKLTESQAKKIADLPDVVHVIPDSFYKLATTRTWDYLGLSAANPKSLLHET  135

Query  449  KMGDGTIVAVLDT-------------------------GVTPENEAYNDRGLGPIPSKWK  553
             MG+  I+ V+DT                         GV PE+E +ND G GP+PS WK
Sbjct  136  NMGEQIIIGVIDTDFLSLVLLLIPFLSASMTKMLSVVAGVWPESEVFNDSGFGPVPSHWK  195

Query  554  GYCES  568
            G CE+
Sbjct  196  GGCET  200



>ref|XP_009114845.1| PREDICTED: subtilisin-like protease SBT5.3 [Brassica rapa]
Length=772

 Score =   184 bits (467),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 84/142 (59%), Positives = 108/142 (76%), Gaps = 0/142 (0%)
 Frame = +2

Query  140  KVYIVYMGARQHDDVDLITSTHHDMLATVLGSKEAAADSMIYSYRHGFSGFAAMMTKSHA  319
            KV+IVY+G +QHDD   +T  HH ML+++LGSKE A DSM+YSYRHGFSGFAA +TKS A
Sbjct  26   KVHIVYLGEKQHDDPKHVTEYHHQMLSSLLGSKEDAHDSMVYSYRHGFSGFAARLTKSQA  85

Query  320  QTFQDLPGVVKVIPNSLYKLRTTRSWDYLGLSLNSATNLLHDTKMGDGTIVAVLDTGVTP  499
            +   D P VV V+P+  Y+L TTR+WDYLGLS     NLL+DT MG+  I+ V+DTGV P
Sbjct  86   KELADSPEVVHVMPDGYYELATTRTWDYLGLSAAHPKNLLNDTNMGEHVIIGVIDTGVWP  145

Query  500  ENEAYNDRGLGPIPSKWKGYCE  565
            E+E+++D G+G IP +WKG CE
Sbjct  146  ESESFSDNGVGAIPKRWKGGCE  167



>ref|XP_006289915.1| hypothetical protein CARUB_v10003531mg, partial [Capsella rubella]
 gb|EOA22813.1| hypothetical protein CARUB_v10003531mg, partial [Capsella rubella]
Length=748

 Score =   184 bits (467),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 81/143 (57%), Positives = 110/143 (77%), Gaps = 0/143 (0%)
 Frame = +2

Query  140  KVYIVYMGARQHDDVDLITSTHHDMLATVLGSKEAAADSMIYSYRHGFSGFAAMMTKSHA  319
            +V+IVY+G +QHDD   +T +HH ML ++LGSKE A DSM++S+RHGFSGFAA +T+S A
Sbjct  37   EVHIVYLGEKQHDDPKFVTESHHRMLWSLLGSKEEAYDSMVHSFRHGFSGFAAKLTESQA  96

Query  320  QTFQDLPGVVKVIPNSLYKLRTTRSWDYLGLSLNSATNLLHDTKMGDGTIVAVLDTGVTP  499
            +   +LP VV VIP+  YK  TTR+WDYLGLS ++  NLL++T MG+  I+ ++DTGV P
Sbjct  97   KKIANLPEVVHVIPDRFYKPATTRTWDYLGLSASNPKNLLNETNMGEDMIIGIIDTGVWP  156

Query  500  ENEAYNDRGLGPIPSKWKGYCES  568
            E+E +ND G+G +PS WKG CES
Sbjct  157  ESEVFNDNGIGQVPSHWKGGCES  179



>ref|XP_011012404.1| PREDICTED: subtilisin-like protease SBT3.5 [Populus euphratica]
Length=789

 Score =   184 bits (467),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 89/174 (51%), Positives = 121/174 (70%), Gaps = 4/174 (2%)
 Frame = +2

Query  44   KNQNELILFSFFFGCLLVFQNALVHTSALSEPKVYIVYMGARQHDDVDLITSTHHDMLAT  223
            KNQ  +IL       LL  Q     T A +  KV+IVYMG ++H+D      TH +ML+T
Sbjct  13   KNQFFMILAII----LLQHQLQFPVTYAETAKKVHIVYMGEKRHEDPATTKKTHFEMLST  68

Query  224  VLGSKEAAADSMIYSYRHGFSGFAAMMTKSHAQTFQDLPGVVKVIPNSLYKLRTTRSWDY  403
            +LGSKEAA  S++YSYRHGFSGFAA +T S A    + PGVV+VIPN ++KL TTRSW++
Sbjct  69   LLGSKEAAQSSILYSYRHGFSGFAARITASQAAEIAEFPGVVQVIPNGIHKLHTTRSWEF  128

Query  404  LGLSLNSATNLLHDTKMGDGTIVAVLDTGVTPENEAYNDRGLGPIPSKWKGYCE  565
            +GL  +S  NLL  + MG GTI+ V+D+GV PE+++++D G+GP+PS WKG C+
Sbjct  129  IGLEHHSPQNLLTQSNMGQGTIIGVIDSGVWPESKSFHDEGMGPVPSHWKGICQ  182



>ref|XP_011038012.1| PREDICTED: subtilisin-like protease SBT3.5 [Populus euphratica]
Length=778

 Score =   184 bits (467),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 89/174 (51%), Positives = 121/174 (70%), Gaps = 4/174 (2%)
 Frame = +2

Query  44   KNQNELILFSFFFGCLLVFQNALVHTSALSEPKVYIVYMGARQHDDVDLITSTHHDMLAT  223
            KNQ  +IL       LL  Q     T A +  KV+IVYMG ++H+D      TH +ML+T
Sbjct  13   KNQFFMILAII----LLQHQLQFPVTYAETAKKVHIVYMGEKRHEDPATTKKTHFEMLST  68

Query  224  VLGSKEAAADSMIYSYRHGFSGFAAMMTKSHAQTFQDLPGVVKVIPNSLYKLRTTRSWDY  403
            +LGSKEAA  S++YSYRHGFSGFAA +T S A    + PGVV+VIPN ++KL TTRSW++
Sbjct  69   LLGSKEAAQSSILYSYRHGFSGFAARITASQAAEIAEFPGVVQVIPNGIHKLHTTRSWEF  128

Query  404  LGLSLNSATNLLHDTKMGDGTIVAVLDTGVTPENEAYNDRGLGPIPSKWKGYCE  565
            +GL  +S  NLL  + MG GTI+ V+D+GV PE+++++D G+GP+PS WKG C+
Sbjct  129  IGLEHHSPQNLLTQSNMGQGTIIGVIDSGVWPESKSFHDEGMGPVPSHWKGICQ  182



>ref|XP_002518939.1| Cucumisin precursor, putative [Ricinus communis]
 gb|EEF43472.1| Cucumisin precursor, putative [Ricinus communis]
Length=752

 Score =   184 bits (466),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 76/142 (54%), Positives = 114/142 (80%), Gaps = 0/142 (0%)
 Frame = +2

Query  140  KVYIVYMGARQHDDVDLITSTHHDMLATVLGSKEAAADSMIYSYRHGFSGFAAMMTKSHA  319
            KV+IVYMG ++++D      +HH ML+T+LGSKEAA  S++YSY+HGFSGFAA +T++ A
Sbjct  8    KVHIVYMGEKKYEDPATTKKSHHQMLSTLLGSKEAAKSSILYSYKHGFSGFAARLTEAQA  67

Query  320  QTFQDLPGVVKVIPNSLYKLRTTRSWDYLGLSLNSATNLLHDTKMGDGTIVAVLDTGVTP  499
                + PGV++VIPN ++KL TTRSW+++GL+ +S+ NLL  + MG+GTI+ V+D+G+ P
Sbjct  68   VKIAEFPGVIQVIPNRIHKLHTTRSWEFIGLNHHSSKNLLAQSNMGEGTIIGVIDSGIWP  127

Query  500  ENEAYNDRGLGPIPSKWKGYCE  565
            E++++NDRG+GP+PS WKG C+
Sbjct  128  ESKSFNDRGMGPVPSHWKGICQ  149



>emb|CAH66112.1| OSIGBa0115D20.5 [Oryza sativa Indica Group]
Length=333

 Score =   177 bits (449),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 80/170 (47%), Positives = 112/170 (66%), Gaps = 2/170 (1%)
 Frame = +2

Query  56   ELILFSFFFGCLLVFQNALVHTSALSEPKVYIVYMGARQHDDVDLITSTHHDMLATVLGS  235
            + +   F F   L  Q+   +     + ++YIVY+G RQ +D DL+T++HHDML ++LGS
Sbjct  8    QALFLVFLF--QLNLQSQWSYGLQRDQSRLYIVYLGERQQEDADLVTASHHDMLTSILGS  65

Query  236  KEAAADSMIYSYRHGFSGFAAMMTKSHAQTFQDLPGVVKVIPNSLYKLRTTRSWDYLGLS  415
            KE    S++YSYRHGFSGF+AM+T+S A+    LPGV+ V  N  YK  TTRSWD+LGL 
Sbjct  66   KEETLRSIVYSYRHGFSGFSAMLTQSQARKIAGLPGVLSVTENQTYKTHTTRSWDFLGLD  125

Query  416  LNSATNLLHDTKMGDGTIVAVLDTGVTPENEAYNDRGLGPIPSKWKGYCE  565
                  LL   + G+G I+ V+DTG+TPE+ +++D G G  PSKWKG C+
Sbjct  126  YKPTNGLLAKARYGEGVIIGVVDTGITPESSSFDDAGYGTPPSKWKGICQ  175



>ref|XP_006413752.1| hypothetical protein EUTSA_v10027359mg, partial [Eutrema salsugineum]
 gb|ESQ55205.1| hypothetical protein EUTSA_v10027359mg, partial [Eutrema salsugineum]
Length=714

 Score =   183 bits (465),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 84/149 (56%), Positives = 109/149 (73%), Gaps = 7/149 (5%)
 Frame = +2

Query  143  VYIVYMGARQHDDVDLITSTHHDMLATVLGSKEAAADSMIYSYRHGFSGFAAMMTKSHAQ  322
            VYIVY+G R+HDD  L+T++HH ML ++L SKE A  SMIYSY+HGFSGFAA++T S A+
Sbjct  33   VYIVYLGEREHDDPKLVTASHHQMLESLLESKEDAQKSMIYSYKHGFSGFAALLTSSQAK  92

Query  323  TFQDLPGVVKVIPNSLYKLRTTRSWDYLGLSL-------NSATNLLHDTKMGDGTIVAVL  481
               + P VV VIPN + KL+TTR+WDYLGLS        +SA  LLH+T MG   I+ V+
Sbjct  93   KISEHPEVVHVIPNRILKLKTTRTWDYLGLSPIPTSFSSSSAKGLLHNTNMGSEAIIGVI  152

Query  482  DTGVTPENEAYNDRGLGPIPSKWKGYCES  568
            D+G+ PE+E  ND+G GPIP +W+G CES
Sbjct  153  DSGIWPESEVVNDQGFGPIPERWRGKCES  181



>ref|XP_002888489.1| subtilase family protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH64748.1| subtilase family protein [Arabidopsis lyrata subsp. lyrata]
Length=760

 Score =   184 bits (466),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 86/164 (52%), Positives = 119/164 (73%), Gaps = 1/164 (1%)
 Frame = +2

Query  77   FFGCLLVFQNALVHTSALSEPKVYIVYMGARQHDDVDLITSTHHDMLATVLGSKEAAADS  256
            F G +L+F  AL+ T+A  + ++Y V++G RQHDD +L+T +HHD+L  +LGSKEA+ +S
Sbjct  19   FIGLVLIFNIALI-TAANEKSQIYTVHLGERQHDDPNLVTESHHDILGPLLGSKEASRES  77

Query  257  MIYSYRHGFSGFAAMMTKSHAQTFQDLPGVVKVIPNSLYKLRTTRSWDYLGLSLNSATNL  436
            MIYSYRHGFSGFAA +T S A+     P VV V  +   KL+TTR  DYLGL+  + T L
Sbjct  78   MIYSYRHGFSGFAAKLTSSQARELSGHPDVVHVTKSKNMKLKTTRVNDYLGLTPTAPTGL  137

Query  437  LHDTKMGDGTIVAVLDTGVTPENEAYNDRGLGPIPSKWKGYCES  568
            LH+T MG   IV +LD+G+ P+++++ND GLGPIP++WKG C S
Sbjct  138  LHETAMGSEAIVGILDSGIWPDSKSFNDNGLGPIPARWKGQCVS  181



>ref|XP_009348696.1| PREDICTED: subtilisin-like protease SBT5.4 [Pyrus x bretschneideri]
Length=759

 Score =   183 bits (465),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 82/143 (57%), Positives = 109/143 (76%), Gaps = 0/143 (0%)
 Frame = +2

Query  140  KVYIVYMGARQHDDVDLITSTHHDMLATVLGSKEAAADSMIYSYRHGFSGFAAMMTKSHA  319
             V+IVY+GA+ ++D + +T  HHDMLA+V+GSKEAA +SM+YSY+HGF GFAA +T S A
Sbjct  10   NVHIVYLGAKHNEDPERLTDLHHDMLASVVGSKEAAIESMVYSYKHGFFGFAAKLTGSQA  69

Query  320  QTFQDLPGVVKVIPNSLYKLRTTRSWDYLGLSLNSATNLLHDTKMGDGTIVAVLDTGVTP  499
            +   +  GVV V PNS Y   TTRSWDYLGLS +S TNL+H+T MGDG I+ ++DTG+ P
Sbjct  70   KKISECSGVVHVRPNSFYTPHTTRSWDYLGLSSHSPTNLMHETNMGDGVIIGIIDTGIWP  129

Query  500  ENEAYNDRGLGPIPSKWKGYCES  568
            E++   D G+GPIP++WKG C S
Sbjct  130  ESKMLKDDGVGPIPTRWKGRCVS  152



>ref|XP_010437025.1| PREDICTED: subtilisin-like protease SBT3.5 [Camelina sativa]
Length=778

 Score =   183 bits (465),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 87/168 (52%), Positives = 119/168 (71%), Gaps = 2/168 (1%)
 Frame = +2

Query  71   SFFFGCLLVFQNALVHTSALSEP--KVYIVYMGARQHDDVDLITSTHHDMLATVLGSKEA  244
            +F    L++  NA     A + P  KV+IVY+G +QHDD + +T +HH ML ++LGSKE 
Sbjct  8    TFIVLTLVIILNAQTGFWAGAGPVSKVHIVYLGEKQHDDPEFVTESHHRMLWSLLGSKEQ  67

Query  245  AADSMIYSYRHGFSGFAAMMTKSHAQTFQDLPGVVKVIPNSLYKLRTTRSWDYLGLSLNS  424
            A DSM++S+RHGFSGFAA +T+S A+   D P VV VIP+  YK  TTR+WDYLG+S  +
Sbjct  68   AHDSMVHSFRHGFSGFAAKLTESQAKKIADSPEVVHVIPDRFYKPTTTRTWDYLGVSAAN  127

Query  425  ATNLLHDTKMGDGTIVAVLDTGVTPENEAYNDRGLGPIPSKWKGYCES  568
              NLL++T MG+  I+ ++DTGV PE+E +ND G+GP+PS WKG  ES
Sbjct  128  PKNLLNETNMGEQMIIGIIDTGVWPESEVFNDNGIGPVPSHWKGGRES  175



>ref|XP_006306827.1| hypothetical protein CARUB_v10008369mg [Capsella rubella]
 gb|EOA39725.1| hypothetical protein CARUB_v10008369mg [Capsella rubella]
Length=769

 Score =   183 bits (465),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 83/143 (58%), Positives = 107/143 (75%), Gaps = 0/143 (0%)
 Frame = +2

Query  140  KVYIVYMGARQHDDVDLITSTHHDMLATVLGSKEAAADSMIYSYRHGFSGFAAMMTKSHA  319
            +V+IVY+G +QHDD + +T +HH ML+++LGSK  A DSM+YSYRHGFSGFAA +T S A
Sbjct  23   EVHIVYLGEKQHDDPEFVTESHHQMLSSLLGSKADAHDSMVYSYRHGFSGFAAKLTDSQA  82

Query  320  QTFQDLPGVVKVIPNSLYKLRTTRSWDYLGLSLNSATNLLHDTKMGDGTIVAVLDTGVTP  499
            +   D P VV V+ +S Y+L TTR+WDYLGLS     NLL+DT MGD  I+  +DTGV P
Sbjct  83   KKLADSPEVVHVMADSFYELATTRTWDYLGLSAAYPNNLLNDTNMGDQVIIGFIDTGVWP  142

Query  500  ENEAYNDRGLGPIPSKWKGYCES  568
            E+E++ND G+ PIP  WKG CES
Sbjct  143  ESESFNDNGVEPIPGHWKGGCES  165



>ref|XP_010554964.1| PREDICTED: subtilisin-like protease SBT3.3 [Tarenaya hassleriana]
Length=762

 Score =   183 bits (464),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 87/180 (48%), Positives = 120/180 (67%), Gaps = 5/180 (3%)
 Frame = +2

Query  26   VIQNMDKNQNELILFSFFFGCLLVFQNALVHTSALSE-PKVYIVYMGARQHDDVDLITST  202
            +I   +   N LIL  F     L+   AL+  S L E  K++IVYMGAR+H+D DL+T++
Sbjct  6    LISGRNSGANVLILVGF----ALILNGALIPASGLDETSKIHIVYMGARRHEDPDLVTAS  61

Query  203  HHDMLATVLGSKEAAADSMIYSYRHGFSGFAAMMTKSHAQTFQDLPGVVKVIPNSLYKLR  382
            HH +L  V GSK+AA  SMIYSYRHGFSGFAA +  S  +   + P V  V PN + +L+
Sbjct  62   HHRILELVFGSKDAARKSMIYSYRHGFSGFAATLNSSQVKILSEHPEVAHVAPNRILQLK  121

Query  383  TTRSWDYLGLSLNSATNLLHDTKMGDGTIVAVLDTGVTPENEAYNDRGLGPIPSKWKGYC  562
            TTRS++Y+GL  ++   LL DT MG   I+ VLD+G+ PE+E++ND+ +GPIP +WKG C
Sbjct  122  TTRSFEYMGLLPSAPKGLLQDTNMGSEAIIGVLDSGIWPESESFNDKDVGPIPKRWKGEC  181



>ref|XP_006662913.1| PREDICTED: cucumisin-like [Oryza brachyantha]
Length=760

 Score =   183 bits (464),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 82/170 (48%), Positives = 119/170 (70%), Gaps = 8/170 (5%)
 Frame = +2

Query  83   GCLLVFQNAL-VHTSALSEPK-------VYIVYMGARQHDDVDLITSTHHDMLATVLGSK  238
             C L+F   L +H    + P+       +YIVY+G RQH+D DL+T++HH MLA++LGSK
Sbjct  10   ACALIFAAILALHGPCFASPEASGEAKELYIVYLGERQHEDADLVTASHHTMLASLLGSK  69

Query  239  EAAADSMIYSYRHGFSGFAAMMTKSHAQTFQDLPGVVKVIPNSLYKLRTTRSWDYLGLSL  418
            E A++S++YSY+HGFSGF+AM+T+S A+  + LPGVV V  N ++ + TTRSWD++GL  
Sbjct  70   ELASESIVYSYKHGFSGFSAMLTESQARNIRGLPGVVSVWMNQMHTMVTTRSWDFMGLPY  129

Query  419  NSATNLLHDTKMGDGTIVAVLDTGVTPENEAYNDRGLGPIPSKWKGYCES  568
            N    LL D  MGDG I+ V+D+G+ PE+ +++D G  P  +KWKG C+S
Sbjct  130  NQKNGLLADANMGDGIIIGVIDSGIWPESPSFDDTGYAPPAAKWKGICQS  179



>ref|XP_010436973.1| PREDICTED: subtilisin-like protease SBT3.3 isoform X1 [Camelina 
sativa]
Length=758

 Score =   183 bits (464),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 83/143 (58%), Positives = 108/143 (76%), Gaps = 0/143 (0%)
 Frame = +2

Query  140  KVYIVYMGARQHDDVDLITSTHHDMLATVLGSKEAAADSMIYSYRHGFSGFAAMMTKSHA  319
            KVY+VY+G   HDD +  T +HH +L  +LGSK+A  DS++YSYRHGFSGFAA +T+S A
Sbjct  29   KVYVVYLGKMTHDDPESATDSHHHLLWPLLGSKKAVHDSIVYSYRHGFSGFAAKLTESQA  88

Query  320  QTFQDLPGVVKVIPNSLYKLRTTRSWDYLGLSLNSATNLLHDTKMGDGTIVAVLDTGVTP  499
            Q   +LP VV+V PN+LY+L TTR+WDYLGLS  ++ +LLH   MG   IV V+D+GV P
Sbjct  89   QQISELPEVVQVTPNTLYELTTTRTWDYLGLSPGNSESLLHKANMGSPVIVGVIDSGVWP  148

Query  500  ENEAYNDRGLGPIPSKWKGYCES  568
            E+E +ND+G GPIPS+WKG C S
Sbjct  149  ESEMFNDKGYGPIPSRWKGGCVS  171



>ref|XP_002871506.1| subtilase family protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH47765.1| subtilase family protein [Arabidopsis lyrata subsp. lyrata]
Length=762

 Score =   183 bits (464),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 81/159 (51%), Positives = 120/159 (75%), Gaps = 0/159 (0%)
 Frame = +2

Query  86   CLLVFQNALVHTSALSEPKVYIVYMGARQHDDVDLITSTHHDMLATVLGSKEAAADSMIY  265
            C+L  +  +V   A  E KV+IVY+G ++H+D +L+T++H  ML ++LGSK+ A++S+++
Sbjct  18   CILNVEFNIVEGGAYEETKVHIVYLGEKEHNDPELVTASHLRMLESLLGSKKDASESIVH  77

Query  266  SYRHGFSGFAAMMTKSHAQTFQDLPGVVKVIPNSLYKLRTTRSWDYLGLSLNSATNLLHD  445
            SYRHGFSGFAA +T S A+   + P VV+V PNS Y+L+TTR++DYLGLS ++   LLH 
Sbjct  78   SYRHGFSGFAAHLTDSQAKKISEHPDVVQVTPNSFYELQTTRTFDYLGLSQSTPKGLLHK  137

Query  446  TKMGDGTIVAVLDTGVTPENEAYNDRGLGPIPSKWKGYC  562
             KMG   I+ VLD+GV PE+++++D+GLGPIP +WKG C
Sbjct  138  AKMGKDIIIGVLDSGVWPESQSFSDKGLGPIPKRWKGMC  176



>ref|XP_008775642.1| PREDICTED: subtilisin-like protease SBT5.3 [Phoenix dactylifera]
Length=737

 Score =   182 bits (462),  Expect = 4e-50, Method: Compositional matrix adjust.
 Identities = 76/136 (56%), Positives = 108/136 (79%), Gaps = 0/136 (0%)
 Frame = +2

Query  158  MGARQHDDVDLITSTHHDMLATVLGSKEAAADSMIYSYRHGFSGFAAMMTKSHAQTFQDL  337
            MGAR H+D   + S+HH++L T+LGSKEAA DS++YSY+HGFSGFAA +TKS A    + 
Sbjct  1    MGARHHEDSTTVESSHHEVLTTLLGSKEAAQDSILYSYKHGFSGFAAKLTKSQADRVAEF  60

Query  338  PGVVKVIPNSLYKLRTTRSWDYLGLSLNSATNLLHDTKMGDGTIVAVLDTGVTPENEAYN  517
            PG+++VIPN + KL TTRSWD++GL  +S  +LL +++MG   I+ V+D+G+ PE+E++N
Sbjct  61   PGIIQVIPNRVRKLHTTRSWDFIGLHRSSGRSLLSESRMGREMIIGVIDSGIWPESESFN  120

Query  518  DRGLGPIPSKWKGYCE  565
            DRG+GP+PS+WKG CE
Sbjct  121  DRGMGPVPSRWKGACE  136



>ref|XP_010529677.1| PREDICTED: subtilisin-like protease SBT3.3 [Tarenaya hassleriana]
Length=767

 Score =   182 bits (463),  Expect = 4e-50, Method: Compositional matrix adjust.
 Identities = 83/150 (55%), Positives = 113/150 (75%), Gaps = 0/150 (0%)
 Frame = +2

Query  119  TSALSEPKVYIVYMGARQHDDVDLITSTHHDMLATVLGSKEAAADSMIYSYRHGFSGFAA  298
            T A ++ KV+IVY+G R+HDD + +T +HH ML ++LGSKE A DSM+YSYRHGFSGFAA
Sbjct  22   TRADAKKKVHIVYLGERRHDDPEFVTESHHQMLWSILGSKEDAHDSMVYSYRHGFSGFAA  81

Query  299  MMTKSHAQTFQDLPGVVKVIPNSLYKLRTTRSWDYLGLSLNSATNLLHDTKMGDGTIVAV  478
             +T   A+    LP V+ V+ +  Y+L TTRSWDYLGLS  +++NLL +T +G   I+ +
Sbjct  82   KLTDFQAEQISGLPEVIHVMADRSYELATTRSWDYLGLSSVNSSNLLRNTHLGHQVIIGI  141

Query  479  LDTGVTPENEAYNDRGLGPIPSKWKGYCES  568
            +DTGV PE+E ++D G+GPIPS+WKG CES
Sbjct  142  VDTGVWPESEMFSDEGIGPIPSRWKGNCES  171



>ref|NP_564868.2| Subtilisin-like serine endopeptidase family protein [Arabidopsis 
thaliana]
 dbj|BAC43166.1| unknown protein [Arabidopsis thaliana]
 gb|AAO64891.1| At1g66210 [Arabidopsis thaliana]
 gb|AEE34477.1| Subtilisin-like serine endopeptidase family protein [Arabidopsis 
thaliana]
Length=759

 Score =   182 bits (462),  Expect = 5e-50, Method: Compositional matrix adjust.
 Identities = 84/164 (51%), Positives = 121/164 (74%), Gaps = 1/164 (1%)
 Frame = +2

Query  77   FFGCLLVFQNALVHTSALSEPKVYIVYMGARQHDDVDLITSTHHDMLATVLGSKEAAADS  256
            F G +L+F+ AL+ T+A  + ++Y V++G RQHDD +++T +HHD+L  +LGSK+A+ +S
Sbjct  19   FIGLVLIFKIALI-TAANEKSQIYTVHLGERQHDDPNIVTESHHDILGPLLGSKKASHES  77

Query  257  MIYSYRHGFSGFAAMMTKSHAQTFQDLPGVVKVIPNSLYKLRTTRSWDYLGLSLNSATNL  436
            MIYSYRHGFSGFAA +T S A+     P VV+V  +   KL+TTR  DYLGL+  + T L
Sbjct  78   MIYSYRHGFSGFAAKLTSSQARELSGHPDVVRVTRSKNMKLKTTRVSDYLGLTSAAPTGL  137

Query  437  LHDTKMGDGTIVAVLDTGVTPENEAYNDRGLGPIPSKWKGYCES  568
            LH+T MG   IV +LD+G+ P+++++ND GLGPIP++WKG C S
Sbjct  138  LHETDMGSEAIVGILDSGIWPDSKSFNDNGLGPIPTRWKGKCVS  181



>ref|XP_006301525.1| hypothetical protein CARUB_v10021953mg [Capsella rubella]
 gb|EOA34423.1| hypothetical protein CARUB_v10021953mg [Capsella rubella]
Length=757

 Score =   182 bits (462),  Expect = 5e-50, Method: Compositional matrix adjust.
 Identities = 87/165 (53%), Positives = 117/165 (71%), Gaps = 1/165 (1%)
 Frame = +2

Query  74   FFFGCLLVFQNALVHTSALSEPKVYIVYMGARQHDDVDLITSTHHDMLATVLGSKEAAAD  253
             F G +L+F  AL+ TSA  E ++Y V++G RQHDD DL+T +HHD+L  +LGSKEA+ +
Sbjct  19   LFIGLVLIFNIALI-TSANEESQIYTVHLGMRQHDDPDLVTESHHDILGPLLGSKEASRE  77

Query  254  SMIYSYRHGFSGFAAMMTKSHAQTFQDLPGVVKVIPNSLYKLRTTRSWDYLGLSLNSATN  433
            SMIYSYRHGFSGFAA +T S A+     P VV V  +   KL+TTR  DYLGL+  + T 
Sbjct  78   SMIYSYRHGFSGFAAKLTSSQARELSAHPHVVHVTRSRNMKLKTTRVNDYLGLTPTAPTG  137

Query  434  LLHDTKMGDGTIVAVLDTGVTPENEAYNDRGLGPIPSKWKGYCES  568
            L+H+T MG   IV ++D+GV P++ +++D GLGPIP +WKG C S
Sbjct  138  LMHETDMGSEAIVGIVDSGVWPDSPSFSDNGLGPIPRRWKGRCVS  182



>gb|AAG51763.1|AC066691_3 hypothetical protein; 8963-6048 [Arabidopsis thaliana]
Length=758

 Score =   182 bits (461),  Expect = 6e-50, Method: Compositional matrix adjust.
 Identities = 84/164 (51%), Positives = 121/164 (74%), Gaps = 1/164 (1%)
 Frame = +2

Query  77   FFGCLLVFQNALVHTSALSEPKVYIVYMGARQHDDVDLITSTHHDMLATVLGSKEAAADS  256
            F G +L+F+ AL+ T+A  + ++Y V++G RQHDD +++T +HHD+L  +LGSK+A+ +S
Sbjct  19   FIGLVLIFKIALI-TAANEKSQIYTVHLGERQHDDPNIVTESHHDILGPLLGSKKASHES  77

Query  257  MIYSYRHGFSGFAAMMTKSHAQTFQDLPGVVKVIPNSLYKLRTTRSWDYLGLSLNSATNL  436
            MIYSYRHGFSGFAA +T S A+     P VV+V  +   KL+TTR  DYLGL+  + T L
Sbjct  78   MIYSYRHGFSGFAAKLTSSQARELSGHPDVVRVTRSKNMKLKTTRVSDYLGLTSAAPTGL  137

Query  437  LHDTKMGDGTIVAVLDTGVTPENEAYNDRGLGPIPSKWKGYCES  568
            LH+T MG   IV +LD+G+ P+++++ND GLGPIP++WKG C S
Sbjct  138  LHETDMGSEAIVGILDSGIWPDSKSFNDNGLGPIPTRWKGKCVS  181



>ref|XP_010931718.1| PREDICTED: subtilisin-like protease SBT3.5 [Elaeis guineensis]
Length=740

 Score =   181 bits (460),  Expect = 8e-50, Method: Compositional matrix adjust.
 Identities = 79/147 (54%), Positives = 110/147 (75%), Gaps = 0/147 (0%)
 Frame = +2

Query  125  ALSEPKVYIVYMGARQHDDVDLITSTHHDMLATVLGSKEAAADSMIYSYRHGFSGFAAMM  304
            A +  K+YIVYMG R+H+D + +T++HHD+L ++LGSKE A  S++YSYRHGFSGFAAM+
Sbjct  27   AEASTKLYIVYMGERKHEDPNHVTASHHDLLTSILGSKENALSSIVYSYRHGFSGFAAML  86

Query  305  TKSHAQTFQDLPGVVKVIPNSLYKLRTTRSWDYLGLSLNSATNLLHDTKMGDGTIVAVLD  484
            T+S A+   D P V+ V P+  Y+L TTRSWD+LGL     T LL  +  GDG I+ ++D
Sbjct  87   TESQAELLADSPEVISVKPSRTYELHTTRSWDFLGLDYMHPTELLKKSNFGDGVIIGMVD  146

Query  485  TGVTPENEAYNDRGLGPIPSKWKGYCE  565
            TG+ PE++++ND G GPIPS+WKG C+
Sbjct  147  TGIWPESKSFNDDGYGPIPSRWKGICQ  173



>ref|XP_010511549.1| PREDICTED: subtilisin-like protease SBT3.5 isoform X1 [Camelina 
sativa]
Length=760

 Score =   181 bits (460),  Expect = 8e-50, Method: Compositional matrix adjust.
 Identities = 86/165 (52%), Positives = 118/165 (72%), Gaps = 1/165 (1%)
 Frame = +2

Query  74   FFFGCLLVFQNALVHTSALSEPKVYIVYMGARQHDDVDLITSTHHDMLATVLGSKEAAAD  253
             F G +L+F+ AL+ T+A  + ++Y V++G RQHDD DL+T +HHD+L  +LGSKEA+ +
Sbjct  18   LFTGLVLIFKIALI-TAANEDSQIYTVHLGKRQHDDPDLVTESHHDILGPLLGSKEASRE  76

Query  254  SMIYSYRHGFSGFAAMMTKSHAQTFQDLPGVVKVIPNSLYKLRTTRSWDYLGLSLNSATN  433
            SMIYSYRHGFSGFAA +T S A+   + P VV V  +   KL TTR  DYLGL+  + T 
Sbjct  77   SMIYSYRHGFSGFAAKLTSSQARELSEHPDVVHVTRSKNMKLTTTRVNDYLGLTPTAPTG  136

Query  434  LLHDTKMGDGTIVAVLDTGVTPENEAYNDRGLGPIPSKWKGYCES  568
            LLH+T MG G I+ ++D+GV P++ ++ND GLG IP +WKG C S
Sbjct  137  LLHETDMGSGVIIGIVDSGVWPDSPSFNDNGLGQIPRRWKGRCVS  181



>gb|KFK41045.1| hypothetical protein AALP_AA2G078300 [Arabis alpina]
Length=757

 Score =   181 bits (459),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 87/183 (48%), Positives = 125/183 (68%), Gaps = 6/183 (3%)
 Frame = +2

Query  20   SCVIQNMDKNQNELILFSFFFGCLLVFQNALVHTSALSEPKVYIVYMGARQHDDVDLITS  199
            S V+ N   N+  +++   F G ++  + AL+  +   E ++Y V++G RQHDD +L+T 
Sbjct  5    SLVVSN---NRKHIVVV--FIGLVVTLKVALI-CAVNEERQIYTVHLGERQHDDPNLVTE  58

Query  200  THHDMLATVLGSKEAAADSMIYSYRHGFSGFAAMMTKSHAQTFQDLPGVVKVIPNSLYKL  379
            +HHD+L  +LGSKEA+ +SMIYSYRHGFSGFAA +T S A+   + P V+ V    + KL
Sbjct  59   SHHDILGPLLGSKEASRESMIYSYRHGFSGFAAKLTSSQARELSEHPDVIHVTKGKIMKL  118

Query  380  RTTRSWDYLGLSLNSATNLLHDTKMGDGTIVAVLDTGVTPENEAYNDRGLGPIPSKWKGY  559
            +TTR  DYLGL+  + T L+HDT MG   IV +LD+G+ PE+E++ND GLGPIP++W G 
Sbjct  119  KTTRVSDYLGLTPTAPTGLIHDTDMGSEGIVGILDSGIWPESESFNDYGLGPIPARWMGQ  178

Query  560  CES  568
            C S
Sbjct  179  CVS  181



>ref|XP_010480961.1| PREDICTED: subtilisin-like protease SBT3.5 [Camelina sativa]
Length=747

 Score =   181 bits (459),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 80/159 (50%), Positives = 120/159 (75%), Gaps = 0/159 (0%)
 Frame = +2

Query  86   CLLVFQNALVHTSALSEPKVYIVYMGARQHDDVDLITSTHHDMLATVLGSKEAAADSMIY  265
             +L  +  +V   A  E KV+IVY+G ++H+D +L+T++H  ML ++LGSK+ A++S+++
Sbjct  5    VILNVEFNIVEGGAYEETKVHIVYLGEKEHNDPELVTASHLSMLESLLGSKKDASESIVH  64

Query  266  SYRHGFSGFAAMMTKSHAQTFQDLPGVVKVIPNSLYKLRTTRSWDYLGLSLNSATNLLHD  445
            SYRHGFSGFAA +T + A+   + P VV+V PN+ Y+L+TTR++DYLGLS ++   LL D
Sbjct  65   SYRHGFSGFAAHLTDAQAKKISEHPNVVQVTPNTYYELQTTRTFDYLGLSHSTPKGLLRD  124

Query  446  TKMGDGTIVAVLDTGVTPENEAYNDRGLGPIPSKWKGYC  562
             KMG+  I+ VLD+GV PE+E++ND+GLGPIP +WKG C
Sbjct  125  AKMGEDIIIGVLDSGVWPESESFNDKGLGPIPQRWKGMC  163



>ref|NP_567358.1| Subtilase family protein [Arabidopsis thaliana]
 emb|CAB40044.1| putative subtilisin-like protease [Arabidopsis thaliana]
 emb|CAB78174.1| putative subtilisin-like protease [Arabidopsis thaliana]
 gb|AEE82892.1| Subtilase family protein [Arabidopsis thaliana]
Length=765

 Score =   181 bits (458),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 80/142 (56%), Positives = 107/142 (75%), Gaps = 0/142 (0%)
 Frame = +2

Query  143  VYIVYMGARQHDDVDLITSTHHDMLATVLGSKEAAADSMIYSYRHGFSGFAAMMTKSHAQ  322
            V+IVY+G +QHDD + +T +HH ML ++LGSKE A  SM++S+RHGFSGFAA +T+S A+
Sbjct  22   VHIVYLGEKQHDDPEFVTESHHRMLWSLLGSKEEAHGSMVHSFRHGFSGFAAKLTESQAK  81

Query  323  TFQDLPGVVKVIPNSLYKLRTTRSWDYLGLSLNSATNLLHDTKMGDGTIVAVLDTGVTPE  502
               DLP VV VIP+  YK  TTR+WDYLGLS  +  NLL+ T MG+  I+ ++D+GV PE
Sbjct  82   KIADLPEVVHVIPDRFYKPATTRTWDYLGLSPTNPKNLLNQTNMGEQMIIGIIDSGVWPE  141

Query  503  NEAYNDRGLGPIPSKWKGYCES  568
            +E +ND  +GP+PS WKG CES
Sbjct  142  SEVFNDNEIGPVPSHWKGGCES  163



>gb|AAD03438.1| similar to the subtilase family of serine proteases (Pfam: PF00082, 
Score=49.7, E=9.2e-13, n=3) [Arabidopsis thaliana]
Length=774

 Score =   181 bits (459),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 80/142 (56%), Positives = 107/142 (75%), Gaps = 0/142 (0%)
 Frame = +2

Query  143  VYIVYMGARQHDDVDLITSTHHDMLATVLGSKEAAADSMIYSYRHGFSGFAAMMTKSHAQ  322
            V+IVY+G +QHDD + +T +HH ML ++LGSKE A  SM++S+RHGFSGFAA +T+S A+
Sbjct  22   VHIVYLGEKQHDDPEFVTESHHRMLWSLLGSKEEAHGSMVHSFRHGFSGFAAKLTESQAK  81

Query  323  TFQDLPGVVKVIPNSLYKLRTTRSWDYLGLSLNSATNLLHDTKMGDGTIVAVLDTGVTPE  502
               DLP VV VIP+  YK  TTR+WDYLGLS  +  NLL+ T MG+  I+ ++D+GV PE
Sbjct  82   KIADLPEVVHVIPDRFYKPATTRTWDYLGLSPTNPKNLLNQTNMGEQMIIGIIDSGVWPE  141

Query  503  NEAYNDRGLGPIPSKWKGYCES  568
            +E +ND  +GP+PS WKG CES
Sbjct  142  SEVFNDNEIGPVPSHWKGGCES  163



>ref|XP_006306820.1| hypothetical protein CARUB_v10008362mg [Capsella rubella]
 gb|EOA39718.1| hypothetical protein CARUB_v10008362mg [Capsella rubella]
Length=771

 Score =   181 bits (458),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 81/146 (55%), Positives = 108/146 (74%), Gaps = 0/146 (0%)
 Frame = +2

Query  131  SEPKVYIVYMGARQHDDVDLITSTHHDMLATVLGSKEAAADSMIYSYRHGFSGFAAMMTK  310
            +E KV+IVY+G RQHD+ D +T +HH ML ++LGSKEAA DSM+YSYRHGFS FAA +T 
Sbjct  20   AETKVHIVYLGERQHDNPDSVTESHHQMLWSILGSKEAAHDSMVYSYRHGFSAFAAKLTD  79

Query  311  SHAQTFQDLPGVVKVIPNSLYKLRTTRSWDYLGLSLNSATNLLHDTKMGDGTIVAVLDTG  490
            S      +LP VV VI +  Y+L+TTR+WDYL  +     NLL+ T MGD  I+ V+D+G
Sbjct  80   SQVIQLSELPEVVHVIRDRFYELQTTRTWDYLKHTSRHPKNLLNQTNMGDKVIIGVVDSG  139

Query  491  VTPENEAYNDRGLGPIPSKWKGYCES  568
            + PE+E+++D GLGPIP +WKG CE+
Sbjct  140  IWPESESFSDNGLGPIPKRWKGSCET  165



>ref|XP_006399712.1| hypothetical protein EUTSA_v10012766mg [Eutrema salsugineum]
 gb|ESQ41165.1| hypothetical protein EUTSA_v10012766mg [Eutrema salsugineum]
Length=752

 Score =   181 bits (458),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 84/162 (52%), Positives = 117/162 (72%), Gaps = 3/162 (2%)
 Frame = +2

Query  89   LLVFQN---ALVHTSALSEPKVYIVYMGARQHDDVDLITSTHHDMLATVLGSKEAAADSM  259
            L++F N   ++V      E KVYIVYMG R+HDD +L+T++H DML ++LGSK+AA+++M
Sbjct  15   LVLFLNVELSIVEGGTNEETKVYIVYMGERKHDDPELVTASHLDMLESLLGSKKAASEAM  74

Query  260  IYSYRHGFSGFAAMMTKSHAQTFQDLPGVVKVIPNSLYKLRTTRSWDYLGLSLNSATNLL  439
             ++YRHGFSGFAA +T S  +   + P VV V PN  Y+ +TTR +DYLGLS +    L 
Sbjct  75   THTYRHGFSGFAAHLTDSQVKKISEHPDVVSVTPNGHYEPQTTRMFDYLGLSQSIPKGLF  134

Query  440  HDTKMGDGTIVAVLDTGVTPENEAYNDRGLGPIPSKWKGYCE  565
            HD KMG+  I+ V D+GV PE+  ++D+GLGPIPS+WKG+CE
Sbjct  135  HDAKMGEDVIIGVFDSGVWPESPMFSDKGLGPIPSRWKGHCE  176



>gb|EEC67681.1| hypothetical protein OsI_35120 [Oryza sativa Indica Group]
Length=752

 Score =   181 bits (458),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 83/152 (55%), Positives = 110/152 (72%), Gaps = 2/152 (1%)
 Frame = +2

Query  116  HTSALSEP--KVYIVYMGARQHDDVDLITSTHHDMLATVLGSKEAAADSMIYSYRHGFSG  289
            H    SEP  K+YIVY+G R+HDD DL+T++HHDMLA+VLGSKEAA +S++YSYR+ FSG
Sbjct  26   HALKQSEPPTKLYIVYLGERRHDDADLVTASHHDMLASVLGSKEAALESIVYSYRYSFSG  85

Query  290  FAAMMTKSHAQTFQDLPGVVKVIPNSLYKLRTTRSWDYLGLSLNSATNLLHDTKMGDGTI  469
            FAA +TK+ A   + LP VV V  N +++L T+RSWD+LG+       LL   K G+  I
Sbjct  86   FAARLTKTQASIIRGLPDVVSVRENHIHQLHTSRSWDFLGMDYRQPNGLLAKAKYGEDII  145

Query  470  VAVLDTGVTPENEAYNDRGLGPIPSKWKGYCE  565
            + VLDTG+TPE+ ++ D G GP PSKWKG C+
Sbjct  146  IGVLDTGITPESPSFTDDGYGPPPSKWKGICQ  177



>emb|CAE01679.2| OSJNBb0089K24.4 [Oryza sativa Japonica Group]
 gb|EAZ29527.1| hypothetical protein OsJ_13598 [Oryza sativa Japonica Group]
Length=756

 Score =   181 bits (458),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 77/144 (53%), Positives = 106/144 (74%), Gaps = 0/144 (0%)
 Frame = +2

Query  134  EPKVYIVYMGARQHDDVDLITSTHHDMLATVLGSKEAAADSMIYSYRHGFSGFAAMMTKS  313
            + ++YIVY+G RQH+D DL+T++HHDML ++LGSKE    S++YSYRHGFSGF+AM+T+S
Sbjct  32   QSRLYIVYLGERQHEDADLVTASHHDMLTSILGSKEETLRSIVYSYRHGFSGFSAMLTQS  91

Query  314  HAQTFQDLPGVVKVIPNSLYKLRTTRSWDYLGLSLNSATNLLHDTKMGDGTIVAVLDTGV  493
             A+    LPGV+ V  N +YK  TTRSWD+LGL       LL   + G+G I+ V+DTG+
Sbjct  92   QARKIAGLPGVLSVTENQIYKTHTTRSWDFLGLDYKPTNGLLAKARYGEGVIIGVVDTGI  151

Query  494  TPENEAYNDRGLGPIPSKWKGYCE  565
            TPE+ +++D G G  PSKWKG C+
Sbjct  152  TPESPSFDDAGYGTPPSKWKGICQ  175



>ref|XP_010461118.1| PREDICTED: subtilisin-like protease SBT3.5 [Camelina sativa]
Length=771

 Score =   181 bits (458),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 81/146 (55%), Positives = 108/146 (74%), Gaps = 0/146 (0%)
 Frame = +2

Query  131  SEPKVYIVYMGARQHDDVDLITSTHHDMLATVLGSKEAAADSMIYSYRHGFSGFAAMMTK  310
            +E KV+IVY+G RQHD  D +T +HH ML ++LGSKEAA DSM+YSYRHGFS FAA +T 
Sbjct  20   AETKVHIVYLGERQHDHPDSVTESHHQMLWSILGSKEAAHDSMVYSYRHGFSAFAAKLTD  79

Query  311  SHAQTFQDLPGVVKVIPNSLYKLRTTRSWDYLGLSLNSATNLLHDTKMGDGTIVAVLDTG  490
            S      +LP VV VI +  Y+L+TTR+WDYL  +     NLL+ T MGD  I+ V+D+G
Sbjct  80   SQVIQLSELPEVVHVIRDRFYELQTTRTWDYLKHTTRHPKNLLNQTNMGDKVIIGVVDSG  139

Query  491  VTPENEAYNDRGLGPIPSKWKGYCES  568
            + PE+E+++D+GLGPIP +WKG C+S
Sbjct  140  IWPESESFSDKGLGPIPKRWKGSCDS  165



>ref|XP_002867836.1| subtilase family protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH44095.1| subtilase family protein [Arabidopsis lyrata subsp. lyrata]
Length=758

 Score =   180 bits (457),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 81/153 (53%), Positives = 113/153 (74%), Gaps = 8/153 (5%)
 Frame = +2

Query  131  SEPKVYIVYMGARQHDDVDLITSTHHDMLATVLGSKEAAADSMIYSYRHGFSGFAAMMTK  310
            S+ KVYIVY+G R+HDD +L+T++HH ML ++L SKE A +S+IYSY+HGFSGFAA++T 
Sbjct  37   SDSKVYIVYLGEREHDDPELVTASHHQMLESLLQSKEDARNSLIYSYQHGFSGFAALLTS  96

Query  311  SHAQTFQDLPGVVKVIPNSLYKLRTTRSWDYLGL--------SLNSATNLLHDTKMGDGT  466
            S A+   + P V+  IPN + KL+TTR+WD+LGL        SL+S   LLHDT +G   
Sbjct  97   SQAKKISEHPAVIHFIPNRILKLKTTRTWDHLGLSPIPTSFSSLSSVKGLLHDTNLGREA  156

Query  467  IVAVLDTGVTPENEAYNDRGLGPIPSKWKGYCE  565
            I+ V+D+G+ PE++A ND+ LGPIP +W+G CE
Sbjct  157  IIGVIDSGIWPESKALNDQWLGPIPKRWRGKCE  189



>ref|XP_010463200.1| PREDICTED: subtilisin-like protease SBT3.5 [Camelina sativa]
Length=747

 Score =   180 bits (457),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 79/159 (50%), Positives = 120/159 (75%), Gaps = 0/159 (0%)
 Frame = +2

Query  86   CLLVFQNALVHTSALSEPKVYIVYMGARQHDDVDLITSTHHDMLATVLGSKEAAADSMIY  265
             +L  +  +V   A  E KV+IVY+G ++H+D +L+T++H  ML ++LGSK+ A++S+++
Sbjct  5    VILNVEYNIVEGGAFEETKVHIVYLGEKEHNDPELVTASHLSMLESLLGSKKDASESIVH  64

Query  266  SYRHGFSGFAAMMTKSHAQTFQDLPGVVKVIPNSLYKLRTTRSWDYLGLSLNSATNLLHD  445
            SYRHGFSGFAA +T + A+   + P VV+V PN+ Y+L+TTR++DYLGLS ++   LL D
Sbjct  65   SYRHGFSGFAAHLTDAQAKKISEHPNVVQVTPNTYYELQTTRTFDYLGLSHSTPKGLLRD  124

Query  446  TKMGDGTIVAVLDTGVTPENEAYNDRGLGPIPSKWKGYC  562
             K+G+  I+ VLD+GV PE+E++ND+GLGPIP +WKG C
Sbjct  125  AKIGEDIIIGVLDSGVWPESESFNDKGLGPIPQRWKGMC  163



>ref|XP_006415135.1| hypothetical protein EUTSA_v10006863mg [Eutrema salsugineum]
 gb|ESQ33488.1| hypothetical protein EUTSA_v10006863mg [Eutrema salsugineum]
Length=776

 Score =   180 bits (457),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 84/161 (52%), Positives = 112/161 (70%), Gaps = 5/161 (3%)
 Frame = +2

Query  86   CLLVFQNALVHTSALSEPKVYIVYMGARQHDDVDLITSTHHDMLATVLGSKEAAADSMIY  265
            CL++  N      + +E KV+IVY+G RQHDD   +T +HH ML ++LGSKEAA DSM+Y
Sbjct  15   CLMLILNI-----SAAETKVHIVYLGERQHDDPASVTESHHQMLWSILGSKEAAHDSMVY  69

Query  266  SYRHGFSGFAAMMTKSHAQTFQDLPGVVKVIPNSLYKLRTTRSWDYLGLSLNSATNLLHD  445
            SY HGFS FAA +T S      +LP VV VI +  Y+L+TTR+WDYL  +     NLL+ 
Sbjct  70   SYHHGFSAFAAKLTDSQVNQLSELPEVVHVIRDRFYELQTTRTWDYLKHTSKHPKNLLNQ  129

Query  446  TKMGDGTIVAVLDTGVTPENEAYNDRGLGPIPSKWKGYCES  568
            T MGD  I+ V+D+G+ PE+E+++D GLGPIP +WKG CES
Sbjct  130  TNMGDKVIIGVVDSGIWPESESFSDNGLGPIPKRWKGSCES  170



>emb|CAH66111.1| OSIGBa0115D20.4 [Oryza sativa Indica Group]
Length=751

 Score =   180 bits (456),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 83/152 (55%), Positives = 109/152 (72%), Gaps = 2/152 (1%)
 Frame = +2

Query  116  HTSALSEP--KVYIVYMGARQHDDVDLITSTHHDMLATVLGSKEAAADSMIYSYRHGFSG  289
            H    SEP  K+YIVY+G R+HDD DL+T +HHDMLA+VLGSKEAA +S++YSYR+ FSG
Sbjct  26   HALKQSEPPTKLYIVYLGERRHDDADLVTDSHHDMLASVLGSKEAALESIVYSYRYSFSG  85

Query  290  FAAMMTKSHAQTFQDLPGVVKVIPNSLYKLRTTRSWDYLGLSLNSATNLLHDTKMGDGTI  469
            FAA +TK+ A   + LP VV V  N +++L T+RSWD+LG+       LL   K G+  I
Sbjct  86   FAARLTKTQASIIRGLPDVVSVRENHIHQLHTSRSWDFLGMDYRQPNGLLAKAKYGEDII  145

Query  470  VAVLDTGVTPENEAYNDRGLGPIPSKWKGYCE  565
            + VLDTG+TPE+ ++ D G GP PSKWKG C+
Sbjct  146  IGVLDTGITPESPSFTDDGYGPPPSKWKGICQ  177



>gb|EEC68285.1| hypothetical protein OsI_36335 [Oryza sativa Indica Group]
Length=774

 Score =   180 bits (456),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 85/179 (47%), Positives = 121/179 (68%), Gaps = 15/179 (8%)
 Frame = +2

Query  77   FFG-------CLLVFQNAL-VHTSALSEPK-------VYIVYMGARQHDDVDLITSTHHD  211
            FFG       C L+F   L +H    + P+       +YIVY+G RQH+D DL+T++HH 
Sbjct  3    FFGFGSAPTACALIFAVILALHGPCFALPEAPGEAKELYIVYLGERQHEDADLVTASHHT  62

Query  212  MLATVLGSKEAAADSMIYSYRHGFSGFAAMMTKSHAQTFQDLPGVVKVIPNSLYKLRTTR  391
            MLATVLGS+E A++S++YSY+HGFSGF+AM+T+S A+  + LPGV  V  N ++ + TTR
Sbjct  63   MLATVLGSEELASESIVYSYKHGFSGFSAMLTESQARNIRGLPGVANVWMNQMHNVVTTR  122

Query  392  SWDYLGLSLNSATNLLHDTKMGDGTIVAVLDTGVTPENEAYNDRGLGPIPSKWKGYCES  568
            SWD++GL  N    LL   KMGDG I+ V+D+G+ PE+ +++D G  P  +KWKG C+S
Sbjct  123  SWDFMGLPYNQTNGLLAHAKMGDGIIIGVIDSGIWPESPSFDDTGYAPPAAKWKGICQS  181



>gb|EMS63596.1| Cucumisin [Triticum urartu]
Length=778

 Score =   180 bits (456),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 84/160 (53%), Positives = 114/160 (71%), Gaps = 7/160 (4%)
 Frame = +2

Query  110  LVHTSALSEPKVYIVYMGARQHDDVDLITSTHHDMLATVLGSKEAAADSMIYSYRHGFSG  289
            LV +      +VYIVY+G RQ +DV L+TS HHD+LA+VLGSKEAA +S+++SYRHGFSG
Sbjct  46   LVRSIPFIANQVYIVYLGERQQEDVSLVTSLHHDLLASVLGSKEAALESIVHSYRHGFSG  105

Query  290  FAAMMTKSHAQTFQDLPGVVKVIPNSLYKLRTTRSWDYLGLSL-------NSATNLLHDT  448
            F+AM+T+S A+  Q LPGVV V  N++ ++ TTRSWD+LGLS+            LL   
Sbjct  106  FSAMLTESQARKIQKLPGVVSVKENTMVRMHTTRSWDFLGLSMGVDIKQEQQPNELLAAA  165

Query  449  KMGDGTIVAVLDTGVTPENEAYNDRGLGPIPSKWKGYCES  568
              GDG I+ V+D+GV PE++++ D G GP PSKWKG C++
Sbjct  166  NHGDGMIIGVIDSGVWPESQSFADDGYGPPPSKWKGTCQT  205



>ref|XP_009135013.1| PREDICTED: subtilisin-like protease SBT5.3 [Brassica rapa]
Length=751

 Score =   180 bits (456),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 86/179 (48%), Positives = 125/179 (70%), Gaps = 9/179 (5%)
 Frame = +2

Query  59   LILFSFFFGCLLVFQNALVHTSALSEP--KVYIVYMGARQHDDVDLITSTHHDMLATVLG  232
            ++LFSF     L  + +L+ ++  ++   KVYIVY+G R+HDD +L+T++HH ML ++  
Sbjct  12   VLLFSFSLVLFLNTELSLLASAGGTDKNTKVYIVYLGEREHDDPELVTASHHQMLESLHE  71

Query  233  SKEAAADSMIYSYRHGFSGFAAMMTKSHAQTFQDLPGVVKVIPNSLYKLRTTRSWDYLGL  412
            SKE A +SMIYSY+HGFSGFAA++T S A+   + P V+ VIPN + KL+TTR+WD+LGL
Sbjct  72   SKEEAHNSMIYSYQHGFSGFAALLTSSQAKKISEHPSVIHVIPNRIVKLKTTRTWDHLGL  131

Query  413  SLNSAT-------NLLHDTKMGDGTIVAVLDTGVTPENEAYNDRGLGPIPSKWKGYCES  568
            S    +        LL++T MG   I+ +LDTG+ PE+E +ND+G GPIP +W+G CES
Sbjct  132  SQVPTSSSPSSVKGLLNETNMGSDAIIGLLDTGIWPESEVFNDQGFGPIPKRWRGKCES  190



>gb|EMT17675.1| Subtilisin-like protease [Aegilops tauschii]
Length=738

 Score =   179 bits (455),  Expect = 4e-49, Method: Compositional matrix adjust.
 Identities = 82/157 (52%), Positives = 114/157 (73%), Gaps = 7/157 (4%)
 Frame = +2

Query  119  TSALSEPKVYIVYMGARQHDDVDLITSTHHDMLATVLGSKEAAADSMIYSYRHGFSGFAA  298
            +  L + +VYIVY+G RQH+DV L+TS HHD+L +VLGSKEAA +S+++SYR+GFSGF+A
Sbjct  28   SQGLKQRRVYIVYLGERQHEDVSLVTSLHHDLLTSVLGSKEAALESIVHSYRYGFSGFSA  87

Query  299  MMTKSHAQTFQDLPGVVKVIPNSLYKLRTTRSWDYLGLSL-------NSATNLLHDTKMG  457
            M+T+S A+  Q LPGVV V  N++ ++ TTRSWD+LGLS+            LL     G
Sbjct  88   MLTESQARKIQTLPGVVSVKENTMVRMHTTRSWDFLGLSMGVDIKQEQQPNELLAAANHG  147

Query  458  DGTIVAVLDTGVTPENEAYNDRGLGPIPSKWKGYCES  568
            DG I+ V+D+GV PE++++ D G GP PSKWKG C++
Sbjct  148  DGMIIGVIDSGVWPESQSFADDGYGPPPSKWKGTCQA  184



>ref|XP_010478712.1| PREDICTED: subtilisin-like protease SBT3.5 isoform X1 [Camelina 
sativa]
Length=771

 Score =   179 bits (455),  Expect = 4e-49, Method: Compositional matrix adjust.
 Identities = 84/161 (52%), Positives = 112/161 (70%), Gaps = 6/161 (4%)
 Frame = +2

Query  86   CLLVFQNALVHTSALSEPKVYIVYMGARQHDDVDLITSTHHDMLATVLGSKEAAADSMIY  265
            CL++  N    T      KV+IVY+G RQHD  D +T +HH ML ++LGSKEAA +SM+Y
Sbjct  11   CLMLALNIAAKT------KVHIVYLGERQHDHPDSVTESHHQMLWSILGSKEAAHESMVY  64

Query  266  SYRHGFSGFAAMMTKSHAQTFQDLPGVVKVIPNSLYKLRTTRSWDYLGLSLNSATNLLHD  445
            SYRHGFS FAA +T S      +LP VV VI +  Y+L+TTR+WDYL  +     NLL+ 
Sbjct  65   SYRHGFSAFAAKLTDSQVIQLSELPEVVHVIRDRFYELQTTRTWDYLKHTSRHPKNLLNQ  124

Query  446  TKMGDGTIVAVLDTGVTPENEAYNDRGLGPIPSKWKGYCES  568
            T MGD  I+ V+D+G+ PE+E+++D+GLGPIP +WKG CES
Sbjct  125  TNMGDKVIIGVVDSGIWPESESFSDKGLGPIPKRWKGTCES  165



>ref|XP_010499844.1| PREDICTED: subtilisin-like protease SBT3.5 isoform X1 [Camelina 
sativa]
 ref|XP_010499845.1| PREDICTED: subtilisin-like protease SBT3.5 isoform X2 [Camelina 
sativa]
Length=771

 Score =   179 bits (454),  Expect = 6e-49, Method: Compositional matrix adjust.
 Identities = 80/146 (55%), Positives = 107/146 (73%), Gaps = 0/146 (0%)
 Frame = +2

Query  131  SEPKVYIVYMGARQHDDVDLITSTHHDMLATVLGSKEAAADSMIYSYRHGFSGFAAMMTK  310
            +E KV+IVY+G RQHD  D +T +HH ML ++LGSKEAA DSM+YSYRHGFS FAA +T 
Sbjct  20   AETKVHIVYLGERQHDHPDSVTESHHQMLWSILGSKEAAHDSMVYSYRHGFSAFAAKLTD  79

Query  311  SHAQTFQDLPGVVKVIPNSLYKLRTTRSWDYLGLSLNSATNLLHDTKMGDGTIVAVLDTG  490
            S      +LP V+ VI    Y+L+TTR+WDYL  +     NLL+ T MGD  I+ V+D+G
Sbjct  80   SQVIQLSELPEVIHVIRERFYELQTTRTWDYLKHTSRHPKNLLNQTNMGDKVIIGVVDSG  139

Query  491  VTPENEAYNDRGLGPIPSKWKGYCES  568
            + PE+E+++D+GLGPIP +WKG C+S
Sbjct  140  IWPESESFSDKGLGPIPKRWKGSCDS  165



>ref|NP_193895.2| Subtilase family protein [Arabidopsis thaliana]
 gb|AEE84484.1| Subtilase family protein [Arabidopsis thaliana]
Length=733

 Score =   179 bits (453),  Expect = 7e-49, Method: Compositional matrix adjust.
 Identities = 87/179 (49%), Positives = 118/179 (66%), Gaps = 12/179 (7%)
 Frame = +2

Query  62   ILFSFFFGCLLVFQNALVHTSALSEPKVYIVYMGARQHDDVDLITSTHHDMLATVLGSKE  241
            I    F    L F  A    ++ S  KVYIVY+G R+HDD +L+T++HH ML ++L SKE
Sbjct  16   IALVLFLNTELSFLTA--EGASDSNSKVYIVYLGQREHDDPELLTASHHQMLESLLQSKE  73

Query  242  AAADSMIYSYRHGFSGFAAMMTKSHAQTFQDLPGVVKVIPNSLYKLRTTRSWDYLGLS--  415
             A +SMIYSY+HGFSGFAA++T S A+   + P V+ VIPN + KL+TTR WD+LGLS  
Sbjct  74   DAHNSMIYSYQHGFSGFAALLTSSQAKKISEHPEVIHVIPNRILKLKTTRIWDHLGLSPI  133

Query  416  --------LNSATNLLHDTKMGDGTIVAVLDTGVTPENEAYNDRGLGPIPSKWKGYCES  568
                       A  LLH+T MG   I+ V+D+G+ PE++ +ND+GLGPIP +W+G C S
Sbjct  134  PTSFSSSSSAKAKGLLHNTSMGSEAIIGVVDSGIWPESKVFNDQGLGPIPKRWRGKCRS  192



>ref|XP_010445228.1| PREDICTED: subtilisin-like protease SBT3.3 [Camelina sativa]
Length=875

 Score =   180 bits (456),  Expect = 7e-49, Method: Compositional matrix adjust.
 Identities = 90/190 (47%), Positives = 124/190 (65%), Gaps = 14/190 (7%)
 Frame = +2

Query  38   MDKNQNELILFSFFFGCLLVFQNA----LVHTSAL-SEPKVYIVYMGARQHDDVDLITST  202
            MD +     L       L++F N     L    AL ++ KVYIVY+G R+HDD +L+T++
Sbjct  1    MDNSLQSSKLMLLLAISLVLFLNTELSFLTAAGALDNDSKVYIVYLGKREHDDPELVTAS  60

Query  203  HHDMLATVLGSKEAAADSMIYSYRHGFSGFAAMMTKSHAQTFQDLPGVVKVIPNSLYKLR  382
            HH ML ++L SKE A +SMIYSY+HGFSGFAA++T S A+   + P V+ VIPN + KL+
Sbjct  61   HHQMLESLLQSKEDAHNSMIYSYQHGFSGFAALLTSSQAKEISEHPAVIHVIPNRILKLK  120

Query  383  TTRSWDYLGLSLN---------SATNLLHDTKMGDGTIVAVLDTGVTPENEAYNDRGLGP  535
            TTR+WD+LGLS           S   LLHDT +G   I+ V+D+G+ PE++  ND+GLGP
Sbjct  121  TTRTWDHLGLSPIPTSFTSSSLSVKGLLHDTNLGSEAIIGVIDSGIWPESKVVNDQGLGP  180

Query  536  IPSKWKGYCE  565
            IP +W+G CE
Sbjct  181  IPKRWRGKCE  190



>ref|XP_006653124.1| PREDICTED: subtilisin-like protease-like [Oryza brachyantha]
Length=749

 Score =   179 bits (453),  Expect = 8e-49, Method: Compositional matrix adjust.
 Identities = 78/143 (55%), Positives = 109/143 (76%), Gaps = 0/143 (0%)
 Frame = +2

Query  140  KVYIVYMGARQHDDVDLITSTHHDMLATVLGSKEAAADSMIYSYRHGFSGFAAMMTKSHA  319
            K+Y+VY+G +QHDD +  T++HHDML T+LGSKE A +S+IYSYRHGFSGFAA +T+S A
Sbjct  42   KLYVVYLGPKQHDDPEKTTASHHDMLTTILGSKEEAIESIIYSYRHGFSGFAAKLTESQA  101

Query  320  QTFQDLPGVVKVIPNSLYKLRTTRSWDYLGLSLNSATNLLHDTKMGDGTIVAVLDTGVTP  499
            Q   +LP V  +  ++++ L TT S D+LGL     T LLHD K GDG I+ ++DTG+ P
Sbjct  102  QQLSELPEVRSIKLSTVHPLHTTHSQDFLGLDYMKPTGLLHDAKHGDGVIIGIIDTGIWP  161

Query  500  ENEAYNDRGLGPIPSKWKGYCES  568
            E+++++D GLGP+PSKWKG C++
Sbjct  162  ESKSFSDNGLGPVPSKWKGICQA  184



>ref|XP_004951230.1| PREDICTED: subtilisin-like protease-like [Setaria italica]
Length=742

 Score =   179 bits (453),  Expect = 8e-49, Method: Compositional matrix adjust.
 Identities = 80/150 (53%), Positives = 114/150 (76%), Gaps = 2/150 (1%)
 Frame = +2

Query  122  SALSEPKVYIVYMGARQHDDVDLITSTHHDMLATVLGSKEAAADSMIYSYRHGFSGFAAM  301
            SA +  K+YIVYMG ++ DD  ++T++HHD+LA+VLGSK+ A  S++YSY++GFSGFAAM
Sbjct  22   SANASSKLYIVYMGEKKQDDPSVVTASHHDVLASVLGSKDEAMKSILYSYKYGFSGFAAM  81

Query  302  MTKSHAQTFQDLPGVVKVIPNSLYKLRTTRSWDYLGLSL--NSATNLLHDTKMGDGTIVA  475
            +TKS A+T + LPGVV V PN+ Y+  TTRSWD+LGL     SA +LL   K G+  IV 
Sbjct  82   LTKSQAETIKSLPGVVSVKPNTRYQTATTRSWDFLGLHYYQTSAPDLLRKAKYGEDIIVG  141

Query  476  VLDTGVTPENEAYNDRGLGPIPSKWKGYCE  565
            V+DTG+ PE+ +++D G GP+P++W+G C+
Sbjct  142  VVDTGIWPESRSFDDSGYGPVPARWRGVCQ  171



>gb|KFK45041.1| hypothetical protein AALP_AA1G336500, partial [Arabis alpina]
Length=678

 Score =   178 bits (452),  Expect = 8e-49, Method: Compositional matrix adjust.
 Identities = 79/146 (54%), Positives = 108/146 (74%), Gaps = 0/146 (0%)
 Frame = +2

Query  131  SEPKVYIVYMGARQHDDVDLITSTHHDMLATVLGSKEAAADSMIYSYRHGFSGFAAMMTK  310
            +E KV+IVY+G +QH D +++T +HH ML ++LGSKEAA DSM+YSYRHGFS FAA +T 
Sbjct  5    AESKVHIVYLGEKQHHDPEVVTESHHQMLWSILGSKEAAHDSMVYSYRHGFSAFAAKLTD  64

Query  311  SHAQTFQDLPGVVKVIPNSLYKLRTTRSWDYLGLSLNSATNLLHDTKMGDGTIVAVLDTG  490
            S      +LP VV V P+  Y+LRTTR+ DYL  +     NLL+ T MGD +I+ V+D+G
Sbjct  65   SQVNQLSELPEVVHVKPDRFYELRTTRTSDYLKHTTKHPKNLLNQTNMGDQSIIGVVDSG  124

Query  491  VTPENEAYNDRGLGPIPSKWKGYCES  568
            + PE+E++ND G+GPIP +WKG C+S
Sbjct  125  IWPESESFNDNGIGPIPKRWKGRCDS  150



>ref|XP_002298975.2| hypothetical protein POPTR_0001s45490g [Populus trichocarpa]
 gb|EEE83780.2| hypothetical protein POPTR_0001s45490g [Populus trichocarpa]
Length=786

 Score =   179 bits (453),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 89/187 (48%), Positives = 128/187 (68%), Gaps = 21/187 (11%)
 Frame = +2

Query  44   KNQNELILFSFFFGCLLVFQNAL----VHTSALSEPKVYIVYMGARQHDDVDLITSTHHD  211
            KNQ  +IL       +++ Q+ L    +H  A +  KV+IVYMG ++H+D      TH++
Sbjct  13   KNQFFMIL------AIILLQHQLHIPVIH--AETAKKVHIVYMGEKRHEDPATTKKTHYE  64

Query  212  MLATVLGSKEAAADSMIYSYRHGFSGFAAMMTKSHA---------QTFQDLPGVVKVIPN  364
            ML+T+LGSKEAA  S++YSYRHGFSGFAA +T+S A         Q     PGVV+VIPN
Sbjct  65   MLSTLLGSKEAAQSSILYSYRHGFSGFAARITESQAAEIAGTIISQNSIKFPGVVQVIPN  124

Query  365  SLYKLRTTRSWDYLGLSLNSATNLLHDTKMGDGTIVAVLDTGVTPENEAYNDRGLGPIPS  544
             ++KL TTRSW+++GL  +S  NLL  + MG GTI+ V+D+GV PE+++++D G+GP+PS
Sbjct  125  GIHKLHTTRSWEFIGLKHHSPQNLLTQSNMGQGTIIGVIDSGVWPESKSFHDEGMGPVPS  184

Query  545  KWKGYCE  565
            +WKG C+
Sbjct  185  RWKGICQ  191



>ref|XP_009132975.1| PREDICTED: subtilisin-like protease SBT5.3 [Brassica rapa]
Length=759

 Score =   178 bits (452),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 84/174 (48%), Positives = 120/174 (69%), Gaps = 2/174 (1%)
 Frame = +2

Query  47   NQNELILFSFFFGCLLVFQNALVHTSALSEPKVYIVYMGARQHDDVDLITSTHHDMLATV  226
            NQ + I   F   CL++     + +S   E ++Y V++G RQHDD  L+T +HHD+L ++
Sbjct  10   NQGKHIALVFI--CLVLILKIALVSSVNQEIQIYTVHLGERQHDDPKLVTDSHHDILRSL  67

Query  227  LGSKEAAADSMIYSYRHGFSGFAAMMTKSHAQTFQDLPGVVKVIPNSLYKLRTTRSWDYL  406
            LGSK+A+ +SMIYSYRHGFSGFAA +T S A+   + P VV V  +   KL TTR  DYL
Sbjct  68   LGSKKASRESMIYSYRHGFSGFAAKLTPSQARELSEHPDVVHVTRSKYMKLATTRVSDYL  127

Query  407  GLSLNSATNLLHDTKMGDGTIVAVLDTGVTPENEAYNDRGLGPIPSKWKGYCES  568
            GL+  + T L+H+T MG G I+ +LDTG+ P++++++D GLGPIP++WKG C S
Sbjct  128  GLTPTAPTGLVHETDMGSGAIIGILDTGIWPDSKSFSDNGLGPIPTRWKGKCVS  181



>ref|XP_002447443.1| hypothetical protein SORBIDRAFT_06g001140 [Sorghum bicolor]
 gb|EES11771.1| hypothetical protein SORBIDRAFT_06g001140 [Sorghum bicolor]
Length=771

 Score =   178 bits (452),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 80/147 (54%), Positives = 109/147 (74%), Gaps = 1/147 (1%)
 Frame = +2

Query  131  SEPK-VYIVYMGARQHDDVDLITSTHHDMLATVLGSKEAAADSMIYSYRHGFSGFAAMMT  307
            SEPK  YI+Y+G R+HDDVDL+T++HHD+LA++LGSKE A +S+IYSYRHGFSGF+A++T
Sbjct  44   SEPKQTYIIYLGDREHDDVDLVTASHHDLLASILGSKEEALESIIYSYRHGFSGFSALLT  103

Query  308  KSHAQTFQDLPGVVKVIPNSLYKLRTTRSWDYLGLSLNSATNLLHDTKMGDGTIVAVLDT  487
            KS ++    L GVV V  N  Y+  TTRSWD++GL  N    LL + K G+  IV V+DT
Sbjct  104  KSQSRKIAALAGVVSVTKNQFYRTHTTRSWDFVGLDYNQPNGLLTNAKNGEDIIVGVVDT  163

Query  488  GVTPENEAYNDRGLGPIPSKWKGYCES  568
            G+ PE+ ++ + G GP P KWKG C++
Sbjct  164  GIWPESLSFAEDGYGPPPPKWKGICQA  190



>emb|CDX84657.1| BnaA03g15730D [Brassica napus]
Length=759

 Score =   178 bits (452),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 81/167 (49%), Positives = 117/167 (70%), Gaps = 0/167 (0%)
 Frame = +2

Query  68   FSFFFGCLLVFQNALVHTSALSEPKVYIVYMGARQHDDVDLITSTHHDMLATVLGSKEAA  247
             +  F CL++     + +S   E ++Y V++G RQHDD  L+T +HHD+L ++LGSK+A+
Sbjct  15   IALVFICLVLILKIALVSSVNQESQIYTVHLGERQHDDPKLVTDSHHDILGSLLGSKKAS  74

Query  248  ADSMIYSYRHGFSGFAAMMTKSHAQTFQDLPGVVKVIPNSLYKLRTTRSWDYLGLSLNSA  427
             +SMIYSYRHGFSGFAA +T S A+   + P VV V  +   KL TTR  DYLGL+  + 
Sbjct  75   RESMIYSYRHGFSGFAAKLTPSQARELSEHPDVVHVTRSKYMKLATTRVSDYLGLTPTAP  134

Query  428  TNLLHDTKMGDGTIVAVLDTGVTPENEAYNDRGLGPIPSKWKGYCES  568
            T L+H+T MG G I+ +LDTG+ P++++++D GLGPIP++WKG C S
Sbjct  135  TGLVHETDMGSGAIIGILDTGIWPDSKSFSDNGLGPIPTRWKGKCVS  181



>ref|XP_002317660.2| hypothetical protein POPTR_0011s15400g [Populus trichocarpa]
 gb|EEE98272.2| hypothetical protein POPTR_0011s15400g [Populus trichocarpa]
Length=786

 Score =   178 bits (452),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 86/176 (49%), Positives = 124/176 (70%), Gaps = 14/176 (8%)
 Frame = +2

Query  77   FFGCLLVF--QNALVHTS---ALSEPKVYIVYMGARQHDDVDLITSTHHDMLATVLGSKE  241
            FF  + +F  Q+ L H S   A +  KV+IVYMG ++H+D  +    H++ML+T+LGSKE
Sbjct  16   FFTIIAIFLIQHQL-HVSVKCAEATKKVHIVYMGEKEHEDPAITKKIHYEMLSTLLGSKE  74

Query  242  AAADSMIYSYRHGFSGFAAMMTKSHAQTF--------QDLPGVVKVIPNSLYKLRTTRSW  397
            AA  S++YSYRHGFSGFAA +T+S A+             PGVV+VIPN ++KL TTRSW
Sbjct  75   AARSSILYSYRHGFSGFAARLTESQAEDIAGTIIVDNSKFPGVVQVIPNGIHKLHTTRSW  134

Query  398  DYLGLSLNSATNLLHDTKMGDGTIVAVLDTGVTPENEAYNDRGLGPIPSKWKGYCE  565
            +++GL+ +S  NLL  + MG GTI+ V+D+GV PE+++++D G+GP+PS WKG C+
Sbjct  135  EFIGLNHHSPQNLLRQSNMGQGTIIGVIDSGVWPESKSFHDEGMGPVPSHWKGICQ  190



>ref|XP_010263869.1| PREDICTED: subtilisin-like protease SBT3.5 [Nelumbo nucifera]
Length=787

 Score =   177 bits (449),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 75/147 (51%), Positives = 110/147 (75%), Gaps = 0/147 (0%)
 Frame = +2

Query  125  ALSEPKVYIVYMGARQHDDVDLITSTHHDMLATVLGSKEAAADSMIYSYRHGFSGFAAMM  304
            A+S   VYIVYMG R+H D  LI  +HH++L+T+LGS+EAA  S++YSY+HGFSGFAA++
Sbjct  36   AISSSNVYIVYMGERRHYDSQLIQDSHHEVLSTLLGSQEAARASILYSYKHGFSGFAAVL  95

Query  305  TKSHAQTFQDLPGVVKVIPNSLYKLRTTRSWDYLGLSLNSATNLLHDTKMGDGTIVAVLD  484
            ++S A+   D PGV++V+PN +  + TTRSWD+L L       +L  ++ GDG+I+ VLD
Sbjct  96   SQSQAKAIADFPGVIRVVPNRILNVHTTRSWDFLQLKSEIIDGILSRSQSGDGSIIGVLD  155

Query  485  TGVTPENEAYNDRGLGPIPSKWKGYCE  565
            TG+ PE+E++ND G+G +PS+W G C+
Sbjct  156  TGIWPESESFNDDGMGEVPSRWNGVCQ  182



>ref|NP_001044510.1| Os01g0795400 [Oryza sativa Japonica Group]
 dbj|BAF06424.1| Os01g0795400, partial [Oryza sativa Japonica Group]
Length=375

 Score =   172 bits (436),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 79/166 (48%), Positives = 110/166 (66%), Gaps = 0/166 (0%)
 Frame = +2

Query  68   FSFFFGCLLVFQNALVHTSALSEPKVYIVYMGARQHDDVDLITSTHHDMLATVLGSKEAA  247
            F  F   LL     L+        K+YI Y+G +++DD  L+T++HHDML +VLGSKE A
Sbjct  1    FQRFPAFLLFCVWLLMIRGIYGSRKLYIAYLGEKKYDDPTLVTASHHDMLTSVLGSKEEA  60

Query  248  ADSMIYSYRHGFSGFAAMMTKSHAQTFQDLPGVVKVIPNSLYKLRTTRSWDYLGLSLNSA  427
              S+ YSY+HGFSGFAAM+T+  A    DLP V+ V PN  ++L TTRSWD+LGL+    
Sbjct  61   LASIAYSYKHGFSGFAAMLTEEQADNLADLPEVISVTPNKQHELLTTRSWDFLGLNYQPP  120

Query  428  TNLLHDTKMGDGTIVAVLDTGVTPENEAYNDRGLGPIPSKWKGYCE  565
              LL  +K G+  I+ ++DTG+ PE+ +++D G GPIPS+WKG C+
Sbjct  121  NKLLQRSKYGEDVIIGMIDTGIWPESRSFSDHGYGPIPSRWKGVCQ  166



>ref|XP_006304869.1| hypothetical protein CARUB_v10012621mg, partial [Capsella rubella]
 gb|EOA37767.1| hypothetical protein CARUB_v10012621mg, partial [Capsella rubella]
Length=759

 Score =   177 bits (448),  Expect = 4e-48, Method: Compositional matrix adjust.
 Identities = 83/173 (48%), Positives = 124/173 (72%), Gaps = 1/173 (1%)
 Frame = +2

Query  44   KNQNELILFSFFFGCLLVFQNALVHTSALSEPKVYIVYMGARQHDDVDLITSTHHDMLAT  223
            K  +++    F+   ++V  N +V   A  E KV+IVY+G ++H+D  L T++H  ML +
Sbjct  3    KMSSQVSWLVFWVMIVVVILN-IVEGGADEETKVHIVYLGEKEHNDPKLETASHLRMLES  61

Query  224  VLGSKEAAADSMIYSYRHGFSGFAAMMTKSHAQTFQDLPGVVKVIPNSLYKLRTTRSWDY  403
            +LGSK+ A++S+++SYRHGFSGFAA +T + A+   + P VV+V PN  Y+L+TTR++DY
Sbjct  62   LLGSKKDASESIVHSYRHGFSGFAAHLTDAQAKKISEHPNVVQVTPNVYYELQTTRTFDY  121

Query  404  LGLSLNSATNLLHDTKMGDGTIVAVLDTGVTPENEAYNDRGLGPIPSKWKGYC  562
            LGLS ++   LL D KMG+  I+ VLD+GV PE+E++ND+GLGPIP +WKG C
Sbjct  122  LGLSHSTPKGLLRDAKMGEDVIIGVLDSGVWPESESFNDKGLGPIPKRWKGMC  174



>emb|CDX79081.1| BnaA01g11480D [Brassica napus]
Length=751

 Score =   177 bits (448),  Expect = 4e-48, Method: Compositional matrix adjust.
 Identities = 85/179 (47%), Positives = 124/179 (69%), Gaps = 9/179 (5%)
 Frame = +2

Query  59   LILFSFFFGCLLVFQNALVHTSALSEP--KVYIVYMGARQHDDVDLITSTHHDMLATVLG  232
            ++LFSF     L  + +L+ ++  ++   KVYIVY+G R+HDD +L+T++H  ML ++  
Sbjct  12   VLLFSFSLVLFLNTELSLLASAGGTDKNTKVYIVYLGEREHDDPELVTASHRQMLESLHE  71

Query  233  SKEAAADSMIYSYRHGFSGFAAMMTKSHAQTFQDLPGVVKVIPNSLYKLRTTRSWDYLGL  412
            SKE A +SMIYSY+HGFSGFAA++T S A+   + P V+ VIPN + KL+TTR+WD+LGL
Sbjct  72   SKEEAHNSMIYSYQHGFSGFAALLTSSQAKKISEHPSVIHVIPNRIVKLKTTRTWDHLGL  131

Query  413  SLNSAT-------NLLHDTKMGDGTIVAVLDTGVTPENEAYNDRGLGPIPSKWKGYCES  568
            S    +        LL++T MG   I+ +LDTG+ PE+E +ND+G GPIP +W+G CES
Sbjct  132  SQVPTSSSPSSVKGLLNETNMGSDAIIGLLDTGIWPESEVFNDQGFGPIPKRWRGKCES  190



>emb|CBI34615.3| unnamed protein product [Vitis vinifera]
Length=737

 Score =   176 bits (447),  Expect = 4e-48, Method: Compositional matrix adjust.
 Identities = 75/136 (55%), Positives = 105/136 (77%), Gaps = 0/136 (0%)
 Frame = +2

Query  158  MGARQHDDVDLITSTHHDMLATVLGSKEAAADSMIYSYRHGFSGFAAMMTKSHAQTFQDL  337
            MG ++H+D   I   HH+ML+T+LGSKEAA  S++YSY+HGFSGFAA +T+S A+     
Sbjct  1    MGEKKHEDPATIKKCHHEMLSTLLGSKEAAKSSILYSYKHGFSGFAAKLTESQAEDIAGF  60

Query  338  PGVVKVIPNSLYKLRTTRSWDYLGLSLNSATNLLHDTKMGDGTIVAVLDTGVTPENEAYN  517
            PGVV+VIPN +++L TTRSWD+LGL  +  TN+L +T +G G I+ V+D+GV PE+E++ 
Sbjct  61   PGVVQVIPNRIHRLHTTRSWDFLGLQHDYPTNVLTETNLGRGVIIGVIDSGVWPESESFK  120

Query  518  DRGLGPIPSKWKGYCE  565
            D G+GPIPS+WKG C+
Sbjct  121  DEGMGPIPSRWKGICQ  136



>ref|XP_009391853.1| PREDICTED: subtilisin-like protease SBT5.3 [Musa acuminata subsp. 
malaccensis]
Length=744

 Score =   176 bits (447),  Expect = 5e-48, Method: Compositional matrix adjust.
 Identities = 81/158 (51%), Positives = 110/158 (70%), Gaps = 2/158 (1%)
 Frame = +2

Query  98   FQNALVHTSALSEPKVYIVYMGARQHDDVDLITSTHHDMLATVLGSKEAAADSMIYSYRH  277
             Q A +  +  S   +YIVYMG RQH+D DL+T++HHD +++VLGSKE A  S++YSY+H
Sbjct  20   IQMAALGRTPSSSKLLYIVYMGGRQHEDPDLVTASHHDTMSSVLGSKEEAVSSIVYSYKH  79

Query  278  GFSGFAAMMTKSHAQTFQDLPGVVKVIPNSLYKLRTTRSWDYLGLSLN--SATNLLHDTK  451
            GFSGFAAM+T+S A    +LP V+ V P+    L TTRSWDYLGL      +T LL    
Sbjct  80   GFSGFAAMLTESQADQIAELPEVISVNPSRSVPLHTTRSWDYLGLGYKQPQSTGLLRRGN  139

Query  452  MGDGTIVAVLDTGVTPENEAYNDRGLGPIPSKWKGYCE  565
             GDG I+ V+D+G+ PE+ +++D G GP+PS+WKG CE
Sbjct  140  FGDGIIIGVVDSGIWPESRSFDDHGYGPVPSRWKGTCE  177



>ref|XP_010529408.1| PREDICTED: subtilisin-like protease SBT3.3 isoform X1 [Tarenaya 
hassleriana]
Length=765

 Score =   176 bits (447),  Expect = 6e-48, Method: Compositional matrix adjust.
 Identities = 84/182 (46%), Positives = 120/182 (66%), Gaps = 4/182 (2%)
 Frame = +2

Query  29   IQNMDKNQNELILFSFFFGCLLVFQNALVHTSALSEPKVYIVYMGARQHDDVDLITSTHH  208
            +++  ++    +L +  F   L+  N+     A  + KVYI+YMG R+ DD + +T++HH
Sbjct  1    MEDSCQSSKHCVLLAICF--FLLLDNSSFVADAHGDTKVYIIYMGERRRDDPEFVTTSHH  58

Query  209  DMLATVLGSKEAAADSMIYSYRHGFSGFAAMMTKSHAQTFQDLPGVVKVIPNSLYKLRTT  388
             ML + LGSKE A  S++YS+RHGFSGFAA +T S A    +   VV VIP+ ++K++TT
Sbjct  59   QMLESFLGSKEEALKSIVYSFRHGFSGFAAELTPSQAMEISEHEEVVHVIPSRIHKIKTT  118

Query  389  RSWDYLGLSLN--SATNLLHDTKMGDGTIVAVLDTGVTPENEAYNDRGLGPIPSKWKGYC  562
            R+WD LGLS +  S   LLHDT  G   I+ V+DTGV PE+  YND+GLGPIP +W+G+C
Sbjct  119  RTWDLLGLSPSPTSPKALLHDTNFGSEAIIGVIDTGVWPESPVYNDKGLGPIPKRWRGHC  178

Query  563  ES  568
             S
Sbjct  179  VS  180



>emb|CAE01678.2| OSJNBb0089K24.3 [Oryza sativa Japonica Group]
 gb|EAZ29525.1| hypothetical protein OsJ_13596 [Oryza sativa Japonica Group]
Length=752

 Score =   176 bits (446),  Expect = 8e-48, Method: Compositional matrix adjust.
 Identities = 81/152 (53%), Positives = 107/152 (70%), Gaps = 2/152 (1%)
 Frame = +2

Query  116  HTSALSEP--KVYIVYMGARQHDDVDLITSTHHDMLATVLGSKEAAADSMIYSYRHGFSG  289
            H     EP  K+YIVY+G R+HDD DL+T +HHDMLA+VLGSKEAA +S++YSYR+ FSG
Sbjct  26   HALKQGEPPTKLYIVYLGERRHDDADLVTDSHHDMLASVLGSKEAALESIVYSYRYSFSG  85

Query  290  FAAMMTKSHAQTFQDLPGVVKVIPNSLYKLRTTRSWDYLGLSLNSATNLLHDTKMGDGTI  469
            FAA +TK+ A   + LP VV V  N +++L T+RSWD+LG+       LL     G+  I
Sbjct  86   FAARLTKAQASIIRGLPDVVSVRENHIHQLHTSRSWDFLGMDYRQPNGLLAKANYGEDII  145

Query  470  VAVLDTGVTPENEAYNDRGLGPIPSKWKGYCE  565
            + VLDTG+TPE+ ++ D G GP PSKWKG C+
Sbjct  146  IGVLDTGITPESPSFADDGYGPPPSKWKGICQ  177



>gb|EEE60418.1| hypothetical protein OsJ_13612 [Oryza sativa Japonica Group]
Length=706

 Score =   176 bits (445),  Expect = 9e-48, Method: Compositional matrix adjust.
 Identities = 76/141 (54%), Positives = 105/141 (74%), Gaps = 0/141 (0%)
 Frame = +2

Query  140  KVYIVYMGARQHDDVDLITSTHHDMLATVLGSKEAAADSMIYSYRHGFSGFAAMMTKSHA  319
            ++Y+VY+G +QH+D +  T++HHDML  +LGSKE A DSMIYSY+HGFSGF+AM+T+S A
Sbjct  2    QLYVVYLGDKQHEDPEQTTASHHDMLTAILGSKEEAHDSMIYSYKHGFSGFSAMLTESQA  61

Query  320  QTFQDLPGVVKVIPNSLYKLRTTRSWDYLGLSLNSATNLLHDTKMGDGTIVAVLDTGVTP  499
            Q   +LP V  + P+ L+ L TTRS D+LGL    +  LLHDT  GD  I+ ++D+G+ P
Sbjct  62   QEIAELPEVHSIRPSILHPLHTTRSQDFLGLDYTQSAGLLHDTNYGDSVIIGIIDSGIWP  121

Query  500  ENEAYNDRGLGPIPSKWKGYC  562
            E+ ++ D GLGP+PSKWKG C
Sbjct  122  ESPSFKDDGLGPLPSKWKGKC  142



>gb|EEE63324.1| hypothetical protein OsJ_18135 [Oryza sativa Japonica Group]
Length=574

 Score =   174 bits (442),  Expect = 9e-48, Method: Compositional matrix adjust.
 Identities = 83/179 (46%), Positives = 120/179 (67%), Gaps = 15/179 (8%)
 Frame = +2

Query  77   FFG-------CLLVFQNAL-VHTSALSEPK-------VYIVYMGARQHDDVDLITSTHHD  211
            FFG       C L+F   L +H    + P+       +YIVY+G RQH+D DL+T++HH 
Sbjct  3    FFGFGSAPTACALIFAMILALHGPCFALPEAPGEAKELYIVYLGERQHEDADLVTASHHT  62

Query  212  MLATVLGSKEAAADSMIYSYRHGFSGFAAMMTKSHAQTFQDLPGVVKVIPNSLYKLRTTR  391
            MLATVLGS+E A++S++YSY+HGFSGF+AM+T+S A+  + LPGV  V  N ++ + TTR
Sbjct  63   MLATVLGSEELASESIVYSYKHGFSGFSAMLTESQARNIRGLPGVASVWMNQMHNVVTTR  122

Query  392  SWDYLGLSLNSATNLLHDTKMGDGTIVAVLDTGVTPENEAYNDRGLGPIPSKWKGYCES  568
            SWD++GL  N    LL   KMG+G I+ V+D+G+ PE+ +++D G     +KWKG C+S
Sbjct  123  SWDFMGLPYNQTNGLLAHAKMGEGIIIGVIDSGIWPESPSFDDTGYALPAAKWKGICQS  181



>gb|KJB18900.1| hypothetical protein B456_003G074100 [Gossypium raimondii]
Length=765

 Score =   176 bits (445),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 76/141 (54%), Positives = 107/141 (76%), Gaps = 0/141 (0%)
 Frame = +2

Query  143  VYIVYMGARQHDDVDLITSTHHDMLATVLGSKEAAADSMIYSYRHGFSGFAAMMTKSHAQ  322
            V+IVYMG ++++D  +    H+ ML+ +LGSKEAA  SM+YSY+HGFSGFAA +T S A+
Sbjct  30   VHIVYMGEKENEDPTVTKMFHYKMLSDLLGSKEAAKSSMLYSYKHGFSGFAARLTDSQAR  89

Query  323  TFQDLPGVVKVIPNSLYKLRTTRSWDYLGLSLNSATNLLHDTKMGDGTIVAVLDTGVTPE  502
              +  PGVV+VIPN ++K  TTRSWD++GL+ +S  NLL  + MG+G I+ V+D+GV PE
Sbjct  90   EIEAFPGVVQVIPNQVHKFHTTRSWDFMGLNDHSTKNLLTKSNMGEGIIIGVIDSGVWPE  149

Query  503  NEAYNDRGLGPIPSKWKGYCE  565
            +E++NDRG+ PIP  WKG C+
Sbjct  150  SESFNDRGMNPIPPHWKGICQ  170



>ref|XP_010449025.1| PREDICTED: subtilisin-like protease SBT3.3 isoform X1 [Camelina 
sativa]
Length=775

 Score =   176 bits (445),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 79/150 (53%), Positives = 108/150 (72%), Gaps = 9/150 (6%)
 Frame = +2

Query  143  VYIVYMGARQHDDVDLITSTHHDMLATVLGSKEAAADSMIYSYRHGFSGFAAMMTKSHAQ  322
            +YIVY+G R+HDD +L+T++HH ML ++L  KE A +SMIYSY+HGFSGFAA++T S A+
Sbjct  47   IYIVYLGKREHDDPELVTASHHQMLESLLQFKEDAHNSMIYSYQHGFSGFAALLTSSQAK  106

Query  323  TFQDLPGVVKVIPNSLYKLRTTRSWDYLGLS---------LNSATNLLHDTKMGDGTIVA  475
               + P V+ VIPN + KL+TTR+WD+LGLS           S   LLHDT MG   I+ 
Sbjct  107  EISEHPAVIHVIPNRILKLKTTRTWDHLGLSPIPTSFSSSSLSVKGLLHDTNMGSEAIIG  166

Query  476  VLDTGVTPENEAYNDRGLGPIPSKWKGYCE  565
            V+D+G+ PE++  ND+GLGPIP +W+G CE
Sbjct  167  VIDSGIWPESKVVNDQGLGPIPKRWRGKCE  196



>ref|XP_009420612.1| PREDICTED: subtilisin-like protease SBT5.4 [Musa acuminata subsp. 
malaccensis]
Length=741

 Score =   175 bits (444),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 75/152 (49%), Positives = 112/152 (74%), Gaps = 0/152 (0%)
 Frame = +2

Query  110  LVHTSALSEPKVYIVYMGARQHDDVDLITSTHHDMLATVLGSKEAAADSMIYSYRHGFSG  289
            L  T A +  K+YIVY+G R+H++ D +T++HHDML ++LGSKE A  S++YSY+HGFSG
Sbjct  23   LFSTEAEAGAKLYIVYLGERKHENPDHVTASHHDMLTSLLGSKEEAVSSIVYSYKHGFSG  82

Query  290  FAAMMTKSHAQTFQDLPGVVKVIPNSLYKLRTTRSWDYLGLSLNSATNLLHDTKMGDGTI  469
            FAAM+T++ A+   + P V+ V P+  Y+L+TTRSWD+LGL+    T LL  +  GDG I
Sbjct  83   FAAMLTEAQAEELAESPDVISVRPSRNYELQTTRSWDFLGLNYMHPTGLLKKSNYGDGII  142

Query  470  VAVLDTGVTPENEAYNDRGLGPIPSKWKGYCE  565
            + ++DTG+ PE+ ++ND G  P+PS+W+G C+
Sbjct  143  IGMVDTGIWPESRSFNDDGYSPVPSRWRGVCQ  174



>ref|XP_010491948.1| PREDICTED: subtilisin-like protease SBT3.3 [Camelina sativa]
Length=388

 Score =   171 bits (433),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 78/143 (55%), Positives = 107/143 (75%), Gaps = 0/143 (0%)
 Frame = +2

Query  134  EPKVYIVYMGARQHDDVDLITSTHHDMLATVLGSKEAAADSMIYSYRHGFSGFAAMMTKS  313
            + KVYIVY+GA +H   DL+T++H  MLA++ GS++ A +SMIYSYRHGFSGFAA MT  
Sbjct  29   QTKVYIVYLGAVEHSHPDLVTASHIGMLASLFGSEKDARESMIYSYRHGFSGFAAHMTDW  88

Query  314  HAQTFQDLPGVVKVIPNSLYKLRTTRSWDYLGLSLNSATNLLHDTKMGDGTIVAVLDTGV  493
             A+   + P VV+V PN  Y+++TTR++DYLGL  ++   LL D KMG+  I+ V D+GV
Sbjct  89   QAKKLSEHPDVVQVTPNHYYQMQTTRTFDYLGLYESTPKKLLLDAKMGEDVIIGVFDSGV  148

Query  494  TPENEAYNDRGLGPIPSKWKGYC  562
             PE+E++NDRGLGPIP++W G C
Sbjct  149  WPESESFNDRGLGPIPARWNGKC  171



>gb|EMS63058.1| Subtilisin-like protease [Triticum urartu]
Length=741

 Score =   175 bits (444),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 81/178 (46%), Positives = 118/178 (66%), Gaps = 5/178 (3%)
 Frame = +2

Query  38   MDKNQNELILFSFFFGCLLVFQNALVHTSALSEPKVYIVYMGARQHDDVDLITSTHHDML  217
            MD + +     ++   CL +  N    +      K+YIVY+G ++HDD  L+TS+HHDML
Sbjct  1    MDFHSSPRRFPAYLLLCLCLMINI---SRGYGSQKLYIVYLGEKKHDDPSLVTSSHHDML  57

Query  218  ATVLGSKEAAADSMIYSYRHGFSGFAAMMTKSHAQTFQDLPGVVKVIPNSLYKLRTTRSW  397
             T+LGSKE A  S+ YSY+HGFSGFAAM+T   AQ   +LP V+ V PN  + L TTRSW
Sbjct  58   TTILGSKEDALASITYSYKHGFSGFAAMLTDDQAQDLGELPEVISVTPNQHHDLMTTRSW  117

Query  398  DYLGLSLN--SATNLLHDTKMGDGTIVAVLDTGVTPENEAYNDRGLGPIPSKWKGYCE  565
            D+LG++L+    + LL  +K G+  I+ ++DTG+ PE+ +++D G GP+PS+WKG C+
Sbjct  118  DFLGMNLDHQPPSKLLQRSKYGEDVIIGIVDTGIWPESRSFSDEGYGPVPSRWKGVCQ  175



>ref|XP_010104913.1| Subtilisin-like protease [Morus notabilis]
 gb|EXC02149.1| Subtilisin-like protease [Morus notabilis]
Length=803

 Score =   176 bits (445),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 83/186 (45%), Positives = 118/186 (63%), Gaps = 41/186 (22%)
 Frame = +2

Query  134  EPKVYIVYMGARQHDDVDLITSTHHDMLATVLGSKEAAADSMIYSYRHGFSGFAAMMTKS  313
            E  V+IVYMG +QH+D  +IT +HH +LA ++GSK+ A++ M+YSY+HGFSGFAA +T+S
Sbjct  16   EANVHIVYMGEKQHNDPGMITDSHHHLLAKIVGSKQKASELMVYSYKHGFSGFAAKLTES  75

Query  314  HAQTFQDLPGVVKVIPNSLYKLRTTRSWDYLGLSLNSATNLLHDTKMGDGTIVAVLD---  484
             A+   +LPGVV+VIPN+L++L+TTRSWD LGLS  S +NLLH++  GDG I+ V D   
Sbjct  76   EAKKIAELPGVVRVIPNTLHRLQTTRSWDSLGLSYESNSNLLHNSSNGDGVIIGVFDTGL  135

Query  485  --------------------------------------TGVTPENEAYNDRGLGPIPSKW  550
                                                  TG+ PE++ +++RGLGP+PS+W
Sbjct  136  FTFPSLYRPWLLSFTGTGNGTSSERPFCHPSLFNPKNETGIWPESKFFDERGLGPVPSRW  195

Query  551  KGYCES  568
            KG C+S
Sbjct  196  KGVCKS  201



>ref|XP_009137200.1| PREDICTED: subtilisin-like protease SBT5.3 [Brassica rapa]
Length=766

 Score =   175 bits (444),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 90/193 (47%), Positives = 123/193 (64%), Gaps = 16/193 (8%)
 Frame = +2

Query  38   MDKNQNELILFSFFFGC-LLVFQNA----LVHTSAL-SEPKVYIVYMGARQHDDVDLITS  199
            M+KN          F C L++F N     L     L ++ KVYIVY+G R HDD +L+T+
Sbjct  1    MEKNTLHTYKLVLLFACSLVLFLNTELSFLASAKTLDNDSKVYIVYLGERVHDDPELVTA  60

Query  200  THHDMLATVLGSKEAAADSMIYSYRHGFSGFAAMMTKSHAQTFQDLPGVVKVIPNSLYKL  379
            +HH+ML ++L SKE A +SMIY Y+HGFSGFAA++T + A    + P V+ VIPN + KL
Sbjct  61   SHHEMLESLLESKEDAHNSMIYIYQHGFSGFAALLTSTQANKISEHPEVIHVIPNRILKL  120

Query  380  RTTRSWDYLGLS----------LNSATNLLHDTKMGDGTIVAVLDTGVTPENEAYNDRGL  529
            +TTR+WD+LGLS            S   LLHDT MG   I+ V+D+G+ PE++ +ND+GL
Sbjct  121  QTTRTWDHLGLSQISTPFSSPSSTSVKGLLHDTNMGSEAIIGVIDSGIWPESKVFNDQGL  180

Query  530  GPIPSKWKGYCES  568
            GPIP  W+G C S
Sbjct  181  GPIPKLWRGKCVS  193



>ref|XP_006413792.1| hypothetical protein EUTSA_v10024501mg [Eutrema salsugineum]
 gb|ESQ55245.1| hypothetical protein EUTSA_v10024501mg [Eutrema salsugineum]
Length=748

 Score =   175 bits (443),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 80/163 (49%), Positives = 105/163 (64%), Gaps = 0/163 (0%)
 Frame = +2

Query  74   FFFGCLLVFQNALVHTSALSEPKVYIVYMGARQHDDVDLITSTHHDMLATVLGSKEAAAD  253
             F G L +  +     S   E KVY+VY+G RQHDD  L+T +H  ML +VLGS EAA +
Sbjct  12   LFIGFLFILNHVFAQESGNEERKVYVVYLGERQHDDPKLVTKSHRKMLKSVLGSSEAARE  71

Query  254  SMIYSYRHGFSGFAAMMTKSHAQTFQDLPGVVKVIPNSLYKLRTTRSWDYLGLSLNSATN  433
            S+IY+Y+HGFSGFAA +T+S A+   D P V  V  N   +L+ TR  +Y+GLS      
Sbjct  72   SLIYNYKHGFSGFAARLTESQAKKLSDRPDVFSVASNRKVQLQATRVGEYMGLSPIYPKG  131

Query  434  LLHDTKMGDGTIVAVLDTGVTPENEAYNDRGLGPIPSKWKGYC  562
            +LHDT MG   ++ VLDTG+ PE+ A++D GLGPIP  WKG C
Sbjct  132  ILHDTNMGSEVVIGVLDTGIWPESRAFSDEGLGPIPKHWKGKC  174



>ref|XP_003581342.1| PREDICTED: subtilisin-like protease SBT3.3 [Brachypodium distachyon]
Length=740

 Score =   175 bits (443),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 77/164 (47%), Positives = 114/164 (70%), Gaps = 1/164 (1%)
 Frame = +2

Query  80   FGCLLVFQNALVHTSALSEPKVYIVYMGARQHDDVDLITSTHHDMLATVLGSKEAAADSM  259
            F C L+    L   SA +  K+YIVYMG ++HDD  ++T++HHD+L +VLGSK+ A  S+
Sbjct  7    FSCALLLATVLFPLSAHASSKLYIVYMGDKKHDDPTVVTASHHDVLTSVLGSKDEALQSI  66

Query  260  IYSYRHGFSGFAAMMTKSHAQTFQDLPGVVKVIPNSLYKLRTTRSWDYLGLS-LNSATNL  436
            +YSY+HGFSGFAAM+TKS A+T    P V+ V PN+ ++  TTRSWD+L L       +L
Sbjct  67   VYSYKHGFSGFAAMLTKSQAETIAKFPEVISVKPNTYHQAHTTRSWDFLDLDYTQQPASL  126

Query  437  LHDTKMGDGTIVAVLDTGVTPENEAYNDRGLGPIPSKWKGYCES  568
            L     G+ TI+ V+D+G+ PE+ +++D G GP+P++WKG C++
Sbjct  127  LQKANYGEDTIIGVIDSGIWPESPSFDDAGYGPVPARWKGTCQT  170



>ref|NP_001046518.1| Os02g0270200 [Oryza sativa Japonica Group]
 dbj|BAF08432.1| Os02g0270200 [Oryza sativa Japonica Group]
Length=496

 Score =   172 bits (437),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 72/143 (50%), Positives = 106/143 (74%), Gaps = 0/143 (0%)
 Frame = +2

Query  140  KVYIVYMGARQHDDVDLITSTHHDMLATVLGSKEAAADSMIYSYRHGFSGFAAMMTKSHA  319
            ++YIVYMG ++HDD  ++T++HHD L +V GSK+ A  S++YSY+HGFSGFAAM+T+S A
Sbjct  30   RLYIVYMGEKKHDDPSVVTASHHDALTSVFGSKDEAMKSIVYSYKHGFSGFAAMLTESQA  89

Query  320  QTFQDLPGVVKVIPNSLYKLRTTRSWDYLGLSLNSATNLLHDTKMGDGTIVAVLDTGVTP  499
            +    LPGVV V PN+ +K  TTRSWD+LGL+    +NLL     G+  IV V+D+G+ P
Sbjct  90   EELAKLPGVVSVKPNTYHKAHTTRSWDFLGLNYYEQSNLLKKANYGEDVIVGVIDSGIWP  149

Query  500  ENEAYNDRGLGPIPSKWKGYCES  568
             + +++D G GP+P++WKG C++
Sbjct  150  TSRSFDDNGYGPVPARWKGKCQT  172



>ref|XP_008351708.1| PREDICTED: cucumisin-like [Malus domestica]
Length=237

 Score =   166 bits (420),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 75/124 (60%), Positives = 99/124 (80%), Gaps = 0/124 (0%)
 Frame = +2

Query  119  TSALSEPKVYIVYMGARQHDDVDLITSTHHDMLATVLGSKEAAADSMIYSYRHGFSGFAA  298
            T   ++  V+IVYMG RQHD+  LIT +HHD+LATV+GS+E A++ M+YSY+HGFSGFAA
Sbjct  23   TRVAAKSHVHIVYMGDRQHDNTKLITDSHHDLLATVVGSRELASELMVYSYKHGFSGFAA  82

Query  299  MMTKSHAQTFQDLPGVVKVIPNSLYKLRTTRSWDYLGLSLNSATNLLHDTKMGDGTIVAV  478
             +T+S  Q   +LPGVV++IPNSL+KL TTRSWD+LGLS +S +N+L  + MGDG I+ V
Sbjct  83   KLTESQTQQLSELPGVVRIIPNSLHKLETTRSWDFLGLSPHSPSNILPKSNMGDGVIIGV  142

Query  479  LDTG  490
            LDTG
Sbjct  143  LDTG  146



>ref|XP_010470046.1| PREDICTED: subtilisin-like protease SBT3.3 [Camelina sativa]
Length=410

 Score =   171 bits (432),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 79/145 (54%), Positives = 104/145 (72%), Gaps = 5/145 (3%)
 Frame = +2

Query  134  EPKVYIVYMGARQHDDVDLITSTHHDMLATVLGSKEAAADSMIYSYRHGFSGFAAMMTKS  313
            E KV +VY+G + H D + +T +HH +L  +LGSK+A  DS++YSYRHGFSGFAA +T+S
Sbjct  9    ETKVNVVYLGKKTHHDPESVTESHHQLLRPLLGSKKAVHDSIVYSYRHGFSGFAAKLTES  68

Query  314  HAQTFQDLPGVVKVIPNSLYKLRTTRSWDYLGLSLNSATNLLHDTKMGDGTIVAVLDTGV  493
             AQ        V VIPN+LY+L TTR+WDYLGLS  +  +LLH   MG+  IV  +D+GV
Sbjct  69   QAQQIS-----VHVIPNTLYELTTTRTWDYLGLSPGTPKSLLHKANMGNSVIVGAIDSGV  123

Query  494  TPENEAYNDRGLGPIPSKWKGYCES  568
             PE+E +ND+G GPIPS+WKG C S
Sbjct  124  WPESEMFNDKGYGPIPSRWKGGCVS  148



>emb|CDX91186.1| BnaC02g04110D [Brassica napus]
Length=760

 Score =   174 bits (442),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 77/158 (49%), Positives = 117/158 (74%), Gaps = 0/158 (0%)
 Frame = +2

Query  89   LLVFQNALVHTSALSEPKVYIVYMGARQHDDVDLITSTHHDMLATVLGSKEAAADSMIYS  268
            +L  + ++V   A  E K++IVY+G R+H+D +L+T++H  ML ++LGS++ A + M++S
Sbjct  18   ILNLEFSVVEGGASEETKIHIVYLGEREHNDPELVTASHLRMLESLLGSQKDANEFMVHS  77

Query  269  YRHGFSGFAAMMTKSHAQTFQDLPGVVKVIPNSLYKLRTTRSWDYLGLSLNSATNLLHDT  448
            YRHGFSGFAA +T S A+   + P VV+V PNS Y+ +TTR+++YLGLS +S   LLHD 
Sbjct  78   YRHGFSGFAAHLTDSQAKKISEHPDVVQVTPNSFYEPQTTRAFEYLGLSQSSPKGLLHDA  137

Query  449  KMGDGTIVAVLDTGVTPENEAYNDRGLGPIPSKWKGYC  562
             MG+  I+ +LD+GV PE+ +++D+GLGPIP +WKG C
Sbjct  138  NMGEDVIIGILDSGVWPESPSFSDKGLGPIPKRWKGTC  175



>ref|XP_008804316.1| PREDICTED: subtilisin-like protease SBT5.4 [Phoenix dactylifera]
Length=762

 Score =   174 bits (442),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 75/142 (53%), Positives = 106/142 (75%), Gaps = 0/142 (0%)
 Frame = +2

Query  140  KVYIVYMGARQHDDVDLITSTHHDMLATVLGSKEAAADSMIYSYRHGFSGFAAMMTKSHA  319
            K+YIVY+G R+H+D +  T++HHD+L ++LGSKE A  S++YSY+HGFSG AAM+T+S A
Sbjct  54   KLYIVYLGERKHEDPNHATASHHDLLTSILGSKENALSSIVYSYKHGFSGLAAMLTESQA  113

Query  320  QTFQDLPGVVKVIPNSLYKLRTTRSWDYLGLSLNSATNLLHDTKMGDGTIVAVLDTGVTP  499
                D P V+ V P+  Y+L TTRSWD+LGL+    T +L  +  GDG I+ ++DTG+ P
Sbjct  114  ALLADSPEVISVKPSRKYELHTTRSWDFLGLNYMHPTRVLKKSNFGDGIIIGIVDTGIWP  173

Query  500  ENEAYNDRGLGPIPSKWKGYCE  565
            E++++ND G GPIPS+WKG CE
Sbjct  174  ESKSFNDDGYGPIPSRWKGICE  195



>gb|KFK28745.1| hypothetical protein AALP_AA7G041500 [Arabis alpina]
Length=764

 Score =   174 bits (441),  Expect = 4e-47, Method: Compositional matrix adjust.
 Identities = 83/164 (51%), Positives = 113/164 (69%), Gaps = 9/164 (5%)
 Frame = +2

Query  104  NALVHTSAL-SEPKVYIVYMGARQHDDVDLITSTHHDMLATVLGSKEAAADSMIYSYRHG  280
            N L    AL +  KVYIVY+G R+HDD + +T +HH ML ++  SKE A +SMIYSY+HG
Sbjct  27   NFLASVRALDNNSKVYIVYLGEREHDDPEFVTDSHHQMLESLHDSKEDAHNSMIYSYQHG  86

Query  281  FSGFAAMMTKSHAQTFQDLPGVVKVIPNSLYKLRTTRSWDYLGLS--------LNSATNL  436
            FSGFAA++T S  +   + P VV  IPN + KL+TTR+WD+LGLS         +S   L
Sbjct  87   FSGFAALLTPSQVKKISEHPAVVHAIPNQILKLKTTRTWDHLGLSPLPTSYSSSSSVKGL  146

Query  437  LHDTKMGDGTIVAVLDTGVTPENEAYNDRGLGPIPSKWKGYCES  568
            LHDT MG   I+ V+DTG+ PE++ ++D+GLGPIP +W+G C+S
Sbjct  147  LHDTNMGSEAIIGVMDTGIWPESKVFDDQGLGPIPKRWRGKCKS  190



>ref|XP_006476262.1| PREDICTED: subtilisin-like protease SDD1-like [Citrus sinensis]
Length=777

 Score =   174 bits (441),  Expect = 5e-47, Method: Compositional matrix adjust.
 Identities = 82/159 (52%), Positives = 118/159 (74%), Gaps = 5/159 (3%)
 Frame = +2

Query  98   FQNALVHTSALSEPKVYIVYMGARQHDDVDLITSTHHDMLATVLGSKEAAADSMIYSYRH  277
             Q +L+   A S   V+IVYMG ++++D   IT +HH  L+TVLGSKEAA  S++YSY+H
Sbjct  21   LQISLILVDATS--NVHIVYMGEKKYEDPVAITKSHHRFLSTVLGSKEAAKHSILYSYKH  78

Query  278  GFSGFAAMMTKSHAQTFQDLPGVVKVIPNSLYKLRTTRSWDYLGLS-LNSATNLLHDTKM  454
            GFSGFAA +TK+ A+   +LPGVV+VIPN + KL TTRSW+++GL    S+ NL  ++ M
Sbjct  79   GFSGFAARLTKTQAEKIAELPGVVQVIPNGILKLHTTRSWEFMGLHYYQSSKNLSTESNM  138

Query  455  GDGTIVAVLDTGVTPENEAYNDRGLG--PIPSKWKGYCE  565
            G+GTI+ ++DTGV PE+E+++D+G+G  P+P  WKG C+
Sbjct  139  GEGTIIGIIDTGVWPESESFSDKGMGQAPVPPHWKGICQ  177



>ref|XP_010028643.1| PREDICTED: subtilisin-like protease SBT5.3 [Eucalyptus grandis]
Length=792

 Score =   174 bits (441),  Expect = 5e-47, Method: Compositional matrix adjust.
 Identities = 79/183 (43%), Positives = 122/183 (67%), Gaps = 2/183 (1%)
 Frame = +2

Query  23   CVIQNMDKNQNELILFSFFFGCLL--VFQNALVHTSALSEPKVYIVYMGARQHDDVDLIT  196
            C   N+ +     +   + FG L+  +      +T  L+   VYIVYMGARQHD+ +L++
Sbjct  11   CFELNLRQLSVAAMTCPWMFGILVYHLLVQCCGNTGVLASSNVYIVYMGARQHDEPELVS  70

Query  197  STHHDMLATVLGSKEAAADSMIYSYRHGFSGFAAMMTKSHAQTFQDLPGVVKVIPNSLYK  376
             +HH++L+  LGS+EAA +S +YSY+HGFSGFAA++  S A+   DLPGVV+VIPN ++ 
Sbjct  71   ESHHEILSGFLGSEEAAKESTLYSYKHGFSGFAAVLNHSQAKFIADLPGVVRVIPNRIFS  130

Query  377  LRTTRSWDYLGLSLNSATNLLHDTKMGDGTIVAVLDTGVTPENEAYNDRGLGPIPSKWKG  556
            L+TTRSWD+L ++ +    +L     G G+I+ V+DTG+ PE+E++ D G+   P++WKG
Sbjct  131  LQTTRSWDFLHVNSHIQNGILSKGHSGAGSIIGVMDTGIWPESESFKDDGMADAPTRWKG  190

Query  557  YCE  565
             C+
Sbjct  191  ICQ  193



>gb|KCW55411.1| hypothetical protein EUGRSUZ_I01318 [Eucalyptus grandis]
Length=769

 Score =   174 bits (440),  Expect = 6e-47, Method: Compositional matrix adjust.
 Identities = 77/166 (46%), Positives = 117/166 (70%), Gaps = 2/166 (1%)
 Frame = +2

Query  74   FFFGCLL--VFQNALVHTSALSEPKVYIVYMGARQHDDVDLITSTHHDMLATVLGSKEAA  247
            + FG L+  +      +T  L+   VYIVYMGARQHD+ +L++ +HH++L+  LGS+EAA
Sbjct  5    WMFGILVYHLLVQCCGNTGVLASSNVYIVYMGARQHDEPELVSESHHEILSGFLGSEEAA  64

Query  248  ADSMIYSYRHGFSGFAAMMTKSHAQTFQDLPGVVKVIPNSLYKLRTTRSWDYLGLSLNSA  427
             +S +YSY+HGFSGFAA++  S A+   DLPGVV+VIPN ++ L+TTRSWD+L ++ +  
Sbjct  65   KESTLYSYKHGFSGFAAVLNHSQAKFIADLPGVVRVIPNRIFSLQTTRSWDFLHVNSHIQ  124

Query  428  TNLLHDTKMGDGTIVAVLDTGVTPENEAYNDRGLGPIPSKWKGYCE  565
              +L     G G+I+ V+DTG+ PE+E++ D G+   P++WKG C+
Sbjct  125  NGILSKGHSGAGSIIGVMDTGIWPESESFKDDGMADAPTRWKGICQ  170



>ref|NP_001046517.1| Os02g0269600 [Oryza sativa Japonica Group]
 dbj|BAD28637.1| putative subtilisin-like serine proteinase [Oryza sativa Japonica 
Group]
 dbj|BAF08431.1| Os02g0269600 [Oryza sativa Japonica Group]
 gb|EAY85318.1| hypothetical protein OsI_06696 [Oryza sativa Indica Group]
 gb|EAZ22529.1| hypothetical protein OsJ_06196 [Oryza sativa Japonica Group]
Length=735

 Score =   173 bits (439),  Expect = 6e-47, Method: Compositional matrix adjust.
 Identities = 74/149 (50%), Positives = 108/149 (72%), Gaps = 0/149 (0%)
 Frame = +2

Query  122  SALSEPKVYIVYMGARQHDDVDLITSTHHDMLATVLGSKEAAADSMIYSYRHGFSGFAAM  301
            SA +  K+YIVYMG ++HDD  ++T++HHD L  V+GSK+ A  S++YSY+HGFSGFAAM
Sbjct  23   SASASTKLYIVYMGEKKHDDPSMVTASHHDALTFVIGSKDGAMKSIVYSYKHGFSGFAAM  82

Query  302  MTKSHAQTFQDLPGVVKVIPNSLYKLRTTRSWDYLGLSLNSATNLLHDTKMGDGTIVAVL  481
            +T+S A+     PGV+ V PN+  K  TTRSWD+LGL+    + +L D   G+  I+ V+
Sbjct  83   LTESQAEELAKYPGVINVKPNTYGKAHTTRSWDFLGLNYYEKSGVLKDAMYGEDVIIGVV  142

Query  482  DTGVTPENEAYNDRGLGPIPSKWKGYCES  568
            DTG+ PE+ ++ND G GP+P++WKG C++
Sbjct  143  DTGIWPESPSFNDDGYGPVPARWKGVCQT  171



>gb|AHJ61058.1| Hwi2 [Oryza sativa Indica Group]
Length=738

 Score =   173 bits (439),  Expect = 6e-47, Method: Compositional matrix adjust.
 Identities = 82/172 (48%), Positives = 116/172 (67%), Gaps = 3/172 (2%)
 Frame = +2

Query  59   LILFSFF--FGCLLVFQNALVHTSAL-SEPKVYIVYMGARQHDDVDLITSTHHDMLATVL  229
            +IL S F  F   L+F   L+    +    K+YI Y+G +++DD  L+T++HHDML +VL
Sbjct  1    MILHSPFQRFPAFLLFCVWLLMIRGIYGSRKLYIAYLGEKKYDDPTLVTASHHDMLTSVL  60

Query  230  GSKEAAADSMIYSYRHGFSGFAAMMTKSHAQTFQDLPGVVKVIPNSLYKLRTTRSWDYLG  409
            GSKE A  S+ YSY+HGFSGFAAM+T+  A    DLP V+ V PN  ++L TTRSWD+LG
Sbjct  61   GSKEEALASIAYSYKHGFSGFAAMLTEEQADNLADLPEVISVTPNKQHELLTTRSWDFLG  120

Query  410  LSLNSATNLLHDTKMGDGTIVAVLDTGVTPENEAYNDRGLGPIPSKWKGYCE  565
            L+      LL  +K G+  I+ ++DTG+ PE+ +++D G GPIPS+WKG C+
Sbjct  121  LNYQPPNKLLQRSKYGEDVIIGMIDTGIWPESRSFSDHGYGPIPSRWKGVCQ  172



>gb|EAZ29545.1| hypothetical protein OsJ_13620 [Oryza sativa Japonica Group]
Length=738

 Score =   173 bits (439),  Expect = 6e-47, Method: Compositional matrix adjust.
 Identities = 82/172 (48%), Positives = 116/172 (67%), Gaps = 3/172 (2%)
 Frame = +2

Query  59   LILFSFF--FGCLLVFQNALVHTSAL-SEPKVYIVYMGARQHDDVDLITSTHHDMLATVL  229
            +IL S F  F   L+F   L+    +    K+YI Y+G +++DD  L+T++HHDML +VL
Sbjct  1    MILHSPFQRFPAFLLFCVWLLMIRGIYGSRKLYIAYLGEKKYDDPTLVTASHHDMLTSVL  60

Query  230  GSKEAAADSMIYSYRHGFSGFAAMMTKSHAQTFQDLPGVVKVIPNSLYKLRTTRSWDYLG  409
            GSKE A  S+ YSY+HGFSGFAAM+T+  A    DLP V+ V PN  ++L TTRSWD+LG
Sbjct  61   GSKEEALASIAYSYKHGFSGFAAMLTEEQADNLADLPEVISVTPNKQHELLTTRSWDFLG  120

Query  410  LSLNSATNLLHDTKMGDGTIVAVLDTGVTPENEAYNDRGLGPIPSKWKGYCE  565
            L+      LL  +K G+  I+ ++DTG+ PE+ +++D G GPIPS+WKG C+
Sbjct  121  LNYQPPNKLLQRSKYGEDVIIGMIDTGIWPESRSFSDHGYGPIPSRWKGVCQ  172



>ref|XP_009137202.1| PREDICTED: subtilisin-like protease SBT5.3 [Brassica rapa]
Length=771

 Score =   174 bits (440),  Expect = 6e-47, Method: Compositional matrix adjust.
 Identities = 82/151 (54%), Positives = 105/151 (70%), Gaps = 9/151 (6%)
 Frame = +2

Query  140  KVYIVYMGARQHDDVDLITSTHHDMLATVLGSKEAAADSMIYSYRHGFSGFAAMMTKSHA  319
            KVYIVY+G R++DD +L+T++HH ML + L SKE A  SMIYSY HGFSGFAA++T S A
Sbjct  40   KVYIVYLGERENDDPELVTASHHQMLESFLDSKEDAHKSMIYSYPHGFSGFAALLTSSQA  99

Query  320  QTFQDLPGVVKVIPNSLYKLRTTRSWDYLGLS---------LNSATNLLHDTKMGDGTIV  472
                D P V+ VIPN + KL+TTR+WD L LS           S   LLHDT MG   I+
Sbjct  100  NKISDHPEVIHVIPNRILKLQTTRTWDLLELSQIPTSFSSSTTSVKGLLHDTNMGSEAII  159

Query  473  AVLDTGVTPENEAYNDRGLGPIPSKWKGYCE  565
             V+DTG+ PE++ +ND+GLGPIP +W+G CE
Sbjct  160  GVIDTGIWPESKVFNDQGLGPIPKRWRGKCE  190



>ref|XP_009125836.1| PREDICTED: subtilisin-like protease SBT5.4 [Brassica rapa]
Length=760

 Score =   173 bits (439),  Expect = 6e-47, Method: Compositional matrix adjust.
 Identities = 76/158 (48%), Positives = 117/158 (74%), Gaps = 0/158 (0%)
 Frame = +2

Query  89   LLVFQNALVHTSALSEPKVYIVYMGARQHDDVDLITSTHHDMLATVLGSKEAAADSMIYS  268
            +L  + ++V   A  E K++IVY+G R+H+D +L+T++H  ML ++LGS++ A + M++S
Sbjct  18   ILNLEFSVVEGGASEETKIHIVYLGEREHNDPELVTASHLRMLESLLGSQKDANEFMVHS  77

Query  269  YRHGFSGFAAMMTKSHAQTFQDLPGVVKVIPNSLYKLRTTRSWDYLGLSLNSATNLLHDT  448
            YRHGFSGFAA +T S A+   + P VV+V PN+ Y+ +TTR+++YLGLS +S   LLHD 
Sbjct  78   YRHGFSGFAAHLTDSQAKKISEHPDVVQVTPNTFYEPQTTRAFEYLGLSQSSPKGLLHDA  137

Query  449  KMGDGTIVAVLDTGVTPENEAYNDRGLGPIPSKWKGYC  562
             MG+  I+ +LD+GV PE+ +++D+GLGPIP +WKG C
Sbjct  138  NMGEDVIIGILDSGVWPESPSFSDKGLGPIPKRWKGTC  175



>emb|CDY07491.1| BnaA07g25700D [Brassica napus]
Length=759

 Score =   173 bits (439),  Expect = 6e-47, Method: Compositional matrix adjust.
 Identities = 81/180 (45%), Positives = 121/180 (67%), Gaps = 1/180 (1%)
 Frame = +2

Query  29   IQNMDKNQNELILFSFFFGCLLVFQNALVHTSALSEPKVYIVYMGARQHDDVDLITSTHH  208
            + ++  + N   +   F   + + + AL+ + A  E ++Y V++G RQHDD  L+T +HH
Sbjct  3    LSSLTVSNNRKHIVVVFISLVFILKIALI-SCANQESQIYTVHLGKRQHDDPKLVTDSHH  61

Query  209  DMLATVLGSKEAAADSMIYSYRHGFSGFAAMMTKSHAQTFQDLPGVVKVIPNSLYKLRTT  388
            D+L ++LGSKEA+ +SMIYSYRHGFSGF+A +T S A+   + P VV V  +   KL TT
Sbjct  62   DILGSLLGSKEASRESMIYSYRHGFSGFSAKLTSSQARELSENPHVVHVTRSKNMKLTTT  121

Query  389  RSWDYLGLSLNSATNLLHDTKMGDGTIVAVLDTGVTPENEAYNDRGLGPIPSKWKGYCES  568
            R  DYLGL+  + T L+HDT MG   I+ ++D+G+ P ++++ND GLGPIP++WKG C S
Sbjct  122  RVSDYLGLTSTAPTGLVHDTDMGSDAIIGIVDSGIWPGSKSFNDNGLGPIPARWKGQCVS  181



>ref|XP_006439186.1| hypothetical protein CICLE_v10018942mg [Citrus clementina]
 gb|ESR52426.1| hypothetical protein CICLE_v10018942mg [Citrus clementina]
Length=777

 Score =   174 bits (440),  Expect = 6e-47, Method: Compositional matrix adjust.
 Identities = 78/144 (54%), Positives = 112/144 (78%), Gaps = 3/144 (2%)
 Frame = +2

Query  143  VYIVYMGARQHDDVDLITSTHHDMLATVLGSKEAAADSMIYSYRHGFSGFAAMMTKSHAQ  322
            V+IVYMG ++++D   IT +HH  L+TVLGSKEAA  S++YSY+HGFSGFAA +TK+ A+
Sbjct  34   VHIVYMGEKKYEDPVAITKSHHRFLSTVLGSKEAAKHSILYSYKHGFSGFAARLTKTQAE  93

Query  323  TFQDLPGVVKVIPNSLYKLRTTRSWDYLGLS-LNSATNLLHDTKMGDGTIVAVLDTGVTP  499
               +LPGVV+VIPN + KL TTRSW+++GL    S+ NL  ++ MG+GTI+ ++DTGV P
Sbjct  94   KIAELPGVVQVIPNGILKLHTTRSWEFMGLHYYQSSKNLSTESNMGEGTIIGIIDTGVWP  153

Query  500  ENEAYNDRGLG--PIPSKWKGYCE  565
            E+E+++D+G+G  P+P  WKG C+
Sbjct  154  ESESFSDKGMGQAPVPPHWKGICQ  177



>ref|XP_009105192.1| PREDICTED: subtilisin-like protease SBT5.3 [Brassica rapa]
Length=759

 Score =   173 bits (439),  Expect = 6e-47, Method: Compositional matrix adjust.
 Identities = 81/180 (45%), Positives = 121/180 (67%), Gaps = 1/180 (1%)
 Frame = +2

Query  29   IQNMDKNQNELILFSFFFGCLLVFQNALVHTSALSEPKVYIVYMGARQHDDVDLITSTHH  208
            + ++  + N   +   F   + + + AL+ + A  E ++Y V++G RQHDD  L+T +HH
Sbjct  3    LSSLTVSNNRKHIVVVFISLVFILKIALI-SCANQESQIYTVHLGKRQHDDPKLVTDSHH  61

Query  209  DMLATVLGSKEAAADSMIYSYRHGFSGFAAMMTKSHAQTFQDLPGVVKVIPNSLYKLRTT  388
            D+L ++LGSKEA+ +SMIYSYRHGFSGF+A +T S A+   + P VV V  +   KL TT
Sbjct  62   DILGSLLGSKEASRESMIYSYRHGFSGFSAKLTSSQARELSENPHVVHVTRSKNMKLTTT  121

Query  389  RSWDYLGLSLNSATNLLHDTKMGDGTIVAVLDTGVTPENEAYNDRGLGPIPSKWKGYCES  568
            R  DYLGL+  + T L+HDT MG   I+ ++D+G+ P ++++ND GLGPIP++WKG C S
Sbjct  122  RVSDYLGLTSTAPTGLVHDTDMGSDAIIGIVDSGIWPGSKSFNDNGLGPIPARWKGQCVS  181



>ref|XP_002887016.1| subtilase family protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH63275.1| subtilase family protein [Arabidopsis lyrata subsp. lyrata]
Length=753

 Score =   173 bits (439),  Expect = 8e-47, Method: Compositional matrix adjust.
 Identities = 78/170 (46%), Positives = 120/170 (71%), Gaps = 7/170 (4%)
 Frame = +2

Query  71   SFFFGCLLVFQNALVHTSALSEP----KVYIVYMGARQHDDVDLITSTHHDMLATVLGSK  238
            S   G +L+     +   + ++P    K++IV++GA+QHD  +L+T +H+ +L  +LGSK
Sbjct  12   SLVIGLVLILNGLFI---SAAQPNGLNKIHIVHLGAKQHDTPELVTKSHYQILEPLLGSK  68

Query  239  EAAADSMIYSYRHGFSGFAAMMTKSHAQTFQDLPGVVKVIPNSLYKLRTTRSWDYLGLSL  418
            EAA +S++Y+Y+HGFSGFAA +T S A+     P V+ V+P+ + +L+TTR++DYLGLSL
Sbjct  69   EAARNSLVYNYKHGFSGFAAKLTASQAKNLSAHPEVLSVVPSRVMRLKTTRTFDYLGLSL  128

Query  419  NSATNLLHDTKMGDGTIVAVLDTGVTPENEAYNDRGLGPIPSKWKGYCES  568
             S   LLH+T+MG   I+ V+D+G+ PE++++ND GLGPIP  WKG C S
Sbjct  129  TSPKGLLHETRMGSEAIIGVIDSGIWPESQSFNDTGLGPIPKHWKGKCVS  178



>gb|EMT13355.1| Subtilisin-like protease [Aegilops tauschii]
Length=741

 Score =   173 bits (438),  Expect = 8e-47, Method: Compositional matrix adjust.
 Identities = 75/144 (52%), Positives = 106/144 (74%), Gaps = 2/144 (1%)
 Frame = +2

Query  140  KVYIVYMGARQHDDVDLITSTHHDMLATVLGSKEAAADSMIYSYRHGFSGFAAMMTKSHA  319
            K+YIVY+G ++HDD  L+T++HHDML T+LGSKE A  S+ YSY+HGFSGFAAM+T   A
Sbjct  32   KLYIVYLGEKKHDDPSLVTASHHDMLTTILGSKEDALASITYSYKHGFSGFAAMLTDDQA  91

Query  320  QTFQDLPGVVKVIPNSLYKLRTTRSWDYLGLSLN--SATNLLHDTKMGDGTIVAVLDTGV  493
            Q   +LP V+ V PN  + L TTRSWD+LG++L+    + LL  +K G+  I+ + DTG+
Sbjct  92   QDLAELPEVISVTPNQHHDLMTTRSWDFLGMNLDHQPPSKLLQRSKYGEDVIIGIFDTGI  151

Query  494  TPENEAYNDRGLGPIPSKWKGYCE  565
             PE+ +++D G GP+PS+WKG C+
Sbjct  152  WPESRSFSDEGYGPVPSRWKGVCQ  175



>ref|XP_006644839.1| PREDICTED: subtilisin-like protease SDD1-like [Oryza brachyantha]
Length=738

 Score =   173 bits (438),  Expect = 8e-47, Method: Compositional matrix adjust.
 Identities = 78/166 (47%), Positives = 113/166 (68%), Gaps = 6/166 (4%)
 Frame = +2

Query  68   FSFFFGCLLVFQNALVHTSALSEPKVYIVYMGARQHDDVDLITSTHHDMLATVLGSKEAA  247
            +  F+ CLL+ +            K+YIVY+G ++HDD  LIT++HHDML+ VLGSKE A
Sbjct  13   YLLFWLCLLMIRGTY------GSRKLYIVYLGEKKHDDPTLITASHHDMLSKVLGSKEEA  66

Query  248  ADSMIYSYRHGFSGFAAMMTKSHAQTFQDLPGVVKVIPNSLYKLRTTRSWDYLGLSLNSA  427
              S+ YSY+HGFSGFAAM+T+  A+   DL  V+ V PN  ++L TTRSWD+LG++    
Sbjct  67   LASIAYSYKHGFSGFAAMLTEDQAENLADLHEVISVTPNKQHELLTTRSWDFLGVNYQPP  126

Query  428  TNLLHDTKMGDGTIVAVLDTGVTPENEAYNDRGLGPIPSKWKGYCE  565
            + LL  +  GD  I+ ++DTG+ PE+ +++D G GPIP++WKG C+
Sbjct  127  SKLLQRSNYGDDVIIGLIDTGIWPESRSFSDHGYGPIPARWKGVCQ  172



>ref|NP_001046522.1| Os02g0271000 [Oryza sativa Japonica Group]
 dbj|BAD29425.1| putative subtilisin-like serine proteinase [Oryza sativa Japonica 
Group]
 dbj|BAF08436.1| Os02g0271000 [Oryza sativa Japonica Group]
 gb|EAY85322.1| hypothetical protein OsI_06700 [Oryza sativa Indica Group]
 gb|EAZ22534.1| hypothetical protein OsJ_06201 [Oryza sativa Japonica Group]
 dbj|BAG92819.1| unnamed protein product [Oryza sativa Japonica Group]
Length=738

 Score =   173 bits (438),  Expect = 9e-47, Method: Compositional matrix adjust.
 Identities = 71/143 (50%), Positives = 108/143 (76%), Gaps = 0/143 (0%)
 Frame = +2

Query  140  KVYIVYMGARQHDDVDLITSTHHDMLATVLGSKEAAADSMIYSYRHGFSGFAAMMTKSHA  319
            ++YIVYMG ++HDD  ++T++HHD L +VLGSK+ A  S++YSY+HGFSGFAAM+T+S A
Sbjct  24   RLYIVYMGEKKHDDPSVVTASHHDTLTSVLGSKDGAMKSIVYSYKHGFSGFAAMLTESQA  83

Query  320  QTFQDLPGVVKVIPNSLYKLRTTRSWDYLGLSLNSATNLLHDTKMGDGTIVAVLDTGVTP  499
            +    LP V+ V PN+ ++ +TTRSWD+LGL+ N  + LL   K G+  IV V+D+G+ P
Sbjct  84   EELARLPEVISVKPNTYHQAQTTRSWDFLGLNYNEQSGLLKKAKNGEDVIVGVIDSGIWP  143

Query  500  ENEAYNDRGLGPIPSKWKGYCES  568
            E+ +++D G  P+P++WKG C++
Sbjct  144  ESRSFDDNGYSPVPARWKGKCQT  166



>ref|XP_006301478.1| hypothetical protein CARUB_v10021900mg, partial [Capsella rubella]
 gb|EOA34376.1| hypothetical protein CARUB_v10021900mg, partial [Capsella rubella]
Length=719

 Score =   172 bits (437),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 78/167 (47%), Positives = 117/167 (70%), Gaps = 1/167 (1%)
 Frame = +2

Query  71   SFFFGCLLVFQNALVHTSALS-EPKVYIVYMGARQHDDVDLITSTHHDMLATVLGSKEAA  247
            S     +L+     +    L+ + KV+IV++GA+QHD  +L+T +H+ +L ++LGSKE A
Sbjct  12   SLVISLVLILNGVFISAVQLNGKTKVHIVHLGAKQHDTPELVTKSHYRILESLLGSKETA  71

Query  248  ADSMIYSYRHGFSGFAAMMTKSHAQTFQDLPGVVKVIPNSLYKLRTTRSWDYLGLSLNSA  427
             DS++YSY++GFSGFAA +T S A+     P V+ + PN + +L+TTR++DYLGLS  + 
Sbjct  72   NDSIVYSYKYGFSGFAAKLTASQAKNLSVHPEVLSISPNRVMRLKTTRTFDYLGLSPTTP  131

Query  428  TNLLHDTKMGDGTIVAVLDTGVTPENEAYNDRGLGPIPSKWKGYCES  568
              LLHDTKMG   I+ V+D+G+ PE++++ND GLGPIP +WKG C S
Sbjct  132  KGLLHDTKMGSEVIIGVMDSGIWPESKSFNDTGLGPIPKRWKGKCVS  178



>emb|CDX94043.1| BnaC07g36770D [Brassica napus]
Length=773

 Score =   173 bits (438),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 81/150 (54%), Positives = 105/150 (70%), Gaps = 9/150 (6%)
 Frame = +2

Query  143  VYIVYMGARQHDDVDLITSTHHDMLATVLGSKEAAADSMIYSYRHGFSGFAAMMTKSHAQ  322
            VYIVY+G R++DD +L+T++HH ML + L SKE A  SMIYSY+HGFSGFAA++T S A 
Sbjct  43   VYIVYLGERENDDPELVTASHHQMLESFLDSKEDAHKSMIYSYQHGFSGFAALLTSSQAN  102

Query  323  TFQDLPGVVKVIPNSLYKLRTTRSWDYLGLS---------LNSATNLLHDTKMGDGTIVA  475
               D P V+ VIPN + KL+TTR+WD L LS           S   LLHDT MG   I+ 
Sbjct  103  KISDHPEVIHVIPNRILKLQTTRTWDLLDLSQIPTSFSSSTTSVKGLLHDTNMGSEAIIG  162

Query  476  VLDTGVTPENEAYNDRGLGPIPSKWKGYCE  565
            V+DTG+ PE++ +ND+GLGPIP +W+G CE
Sbjct  163  VIDTGIWPESKVFNDQGLGPIPKRWRGKCE  192



>emb|CDX94033.1| BnaC07g36670D [Brassica napus]
Length=799

 Score =   173 bits (438),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 75/164 (46%), Positives = 107/164 (65%), Gaps = 0/164 (0%)
 Frame = +2

Query  71   SFFFGCLLVFQNALVHTSALSEPKVYIVYMGARQHDDVDLITSTHHDMLATVLGSKEAAA  250
            +   G L +            EPKVY+V++GA+QHDD +LI ++H  ML +V  S EAA 
Sbjct  2    ALIIGFLFLLDCVFAQECTTEEPKVYVVHLGAKQHDDPELILASHQKMLESVFNSSEAAK  61

Query  251  DSMIYSYRHGFSGFAAMMTKSHAQTFQDLPGVVKVIPNSLYKLRTTRSWDYLGLSLNSAT  430
            +S++Y+YRHGFSGFAA +T S A+  +D P V  V  N    L+TTR++DYLGLS N  +
Sbjct  62   ESIVYNYRHGFSGFAARLTSSQAKKLKDRPDVFSVASNRKLTLQTTRTFDYLGLSPNQPS  121

Query  431  NLLHDTKMGDGTIVAVLDTGVTPENEAYNDRGLGPIPSKWKGYC  562
             +LHD+ MG   ++ ++D+G+ PE+  ++D GLGPIP  WKG C
Sbjct  122  GILHDSNMGSELVIGIIDSGIWPESAGFSDEGLGPIPKHWKGKC  165



>ref|XP_004954566.1| PREDICTED: LOW QUALITY PROTEIN: xylem serine proteinase 1-like 
[Setaria italica]
Length=656

 Score =   172 bits (436),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 77/145 (53%), Positives = 108/145 (74%), Gaps = 2/145 (1%)
 Frame = +2

Query  140  KVYIVYMGARQHDDVDLITSTHHDMLATVLGSKEAAADSMIYSYRHGFSGFAAMMTKSHA  319
            K+YIV MG ++HDD  ++T++HHD LA++LGSK+ A  S++YSYRHGFS FAAM+T S A
Sbjct  31   KLYIVNMGEKKHDDPSVVTASHHDALASILGSKDEAVKSIVYSYRHGFSRFAAMLTDSQA  90

Query  320  QTFQDLPGVVKVIPNSLYKLRTTRSWDYLGLS--LNSATNLLHDTKMGDGTIVAVLDTGV  493
            +T   LPGVV V P + Y++ TTRSWD+LGL    +  + LL  T  G+G IV V+DTG+
Sbjct  91   ETIMSLPGVVSVEPITHYQIGTTRSWDFLGLDDHQSPPSGLLKKTNYGEGIIVGVVDTGI  150

Query  494  TPENEAYNDRGLGPIPSKWKGYCES  568
             PE+ +++D G GP+P+KWKG C++
Sbjct  151  WPESPSFDDSGYGPVPAKWKGVCQT  175



>ref|NP_564869.1| Subtilase-like protein [Arabidopsis thaliana]
 gb|AAG51764.1|AC066691_4 subtilisin-like protein; 10849-13974 [Arabidopsis thaliana]
 gb|AEE34478.1| Subtilase-like protein [Arabidopsis thaliana]
Length=753

 Score =   172 bits (437),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 77/167 (46%), Positives = 117/167 (70%), Gaps = 1/167 (1%)
 Frame = +2

Query  71   SFFFGCLLVFQNALVHTSA-LSEPKVYIVYMGARQHDDVDLITSTHHDMLATVLGSKEAA  247
            S   G LL+     +  +      K++IV++GA+QHD  +L+T +H+ +L  +LGSKEAA
Sbjct  12   SLVIGLLLILNGVFISAAKHYGLNKIHIVHLGAKQHDTPELVTKSHYQILEPLLGSKEAA  71

Query  248  ADSMIYSYRHGFSGFAAMMTKSHAQTFQDLPGVVKVIPNSLYKLRTTRSWDYLGLSLNSA  427
             +S++Y+Y+HGFSGFAA +T S A+     P V++V+P+ + +L+TTR++DYLGL   S 
Sbjct  72   KNSLVYNYKHGFSGFAAKLTASQAKNLSAHPEVLRVVPSRVMRLKTTRTFDYLGLLPTSP  131

Query  428  TNLLHDTKMGDGTIVAVLDTGVTPENEAYNDRGLGPIPSKWKGYCES  568
             +LLH TKMG   I+ V+D+G+ PE++++ND GLGPIP +WKG C S
Sbjct  132  KSLLHKTKMGSEAIIGVIDSGIWPESQSFNDTGLGPIPKRWKGKCLS  178



>gb|EEC72887.1| hypothetical protein OsI_06697 [Oryza sativa Indica Group]
Length=785

 Score =   173 bits (438),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 72/143 (50%), Positives = 106/143 (74%), Gaps = 0/143 (0%)
 Frame = +2

Query  140  KVYIVYMGARQHDDVDLITSTHHDMLATVLGSKEAAADSMIYSYRHGFSGFAAMMTKSHA  319
            ++YIVYMG ++HDD  ++T++HHD L +V GSK+ A  S++YSY+HGFSGFAAM+T+S A
Sbjct  51   RLYIVYMGEKKHDDPSVVTASHHDALTSVFGSKDEAMKSIVYSYKHGFSGFAAMLTESQA  110

Query  320  QTFQDLPGVVKVIPNSLYKLRTTRSWDYLGLSLNSATNLLHDTKMGDGTIVAVLDTGVTP  499
            +    LPGVV V PN+ +K  TTRSWD+LGL+    +NLL     G+  IV V+D+G+ P
Sbjct  111  EELAKLPGVVSVKPNTYHKAHTTRSWDFLGLNYYEQSNLLKKANYGEDVIVGVIDSGIWP  170

Query  500  ENEAYNDRGLGPIPSKWKGYCES  568
             + +++D G GP+P++WKG C++
Sbjct  171  TSRSFDDNGYGPVPARWKGKCQT  193



>gb|KDO76781.1| hypothetical protein CISIN_1g042478mg [Citrus sinensis]
Length=954

 Score =   174 bits (441),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 78/144 (54%), Positives = 112/144 (78%), Gaps = 3/144 (2%)
 Frame = +2

Query  143  VYIVYMGARQHDDVDLITSTHHDMLATVLGSKEAAADSMIYSYRHGFSGFAAMMTKSHAQ  322
            V+IVYMG ++++D   IT +HH  L+TVLGSKEAA  S++YSY+HGFSGFAA +TK+ A+
Sbjct  34   VHIVYMGEKKYEDPVAITKSHHRFLSTVLGSKEAAKHSILYSYKHGFSGFAARLTKTQAE  93

Query  323  TFQDLPGVVKVIPNSLYKLRTTRSWDYLGLS-LNSATNLLHDTKMGDGTIVAVLDTGVTP  499
               +LPGVV+VIPN + KL TTRSW+++GL    S+ NL  ++ MG+GTI+ ++DTGV P
Sbjct  94   KIAELPGVVQVIPNGILKLHTTRSWEFMGLHYYQSSKNLSTESNMGEGTIIGIIDTGVWP  153

Query  500  ENEAYNDRGLG--PIPSKWKGYCE  565
            E+E+++D+G+G  P+P  WKG C+
Sbjct  154  ESESFSDKGMGQAPVPPHWKGICQ  177



>gb|EEE56708.1| hypothetical protein OsJ_06199 [Oryza sativa Japonica Group]
Length=755

 Score =   172 bits (437),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 72/143 (50%), Positives = 106/143 (74%), Gaps = 0/143 (0%)
 Frame = +2

Query  140  KVYIVYMGARQHDDVDLITSTHHDMLATVLGSKEAAADSMIYSYRHGFSGFAAMMTKSHA  319
            ++YIVYMG ++HDD  ++T++HHD L +V GSK+ A  S++YSY+HGFSGFAAM+T+S A
Sbjct  30   RLYIVYMGEKKHDDPSVVTASHHDALTSVFGSKDEAMKSIVYSYKHGFSGFAAMLTESQA  89

Query  320  QTFQDLPGVVKVIPNSLYKLRTTRSWDYLGLSLNSATNLLHDTKMGDGTIVAVLDTGVTP  499
            +    LPGVV V PN+ +K  TTRSWD+LGL+    +NLL     G+  IV V+D+G+ P
Sbjct  90   EELAKLPGVVSVKPNTYHKAHTTRSWDFLGLNYYEQSNLLKKANYGEDVIVGVIDSGIWP  149

Query  500  ENEAYNDRGLGPIPSKWKGYCES  568
             + +++D G GP+P++WKG C++
Sbjct  150  TSRSFDDNGYGPVPARWKGKCQT  172



>dbj|BAJ93156.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=736

 Score =   172 bits (436),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 78/166 (47%), Positives = 115/166 (69%), Gaps = 3/166 (2%)
 Frame = +2

Query  80   FGCLLVFQNALVHTSALSEPKVYIVYMGARQHDDVDLITSTHHDMLATVLGSKEAAADSM  259
            F C  +    L+  SA +  K+YIVYMG ++HDD   +T++HHD+L +VLGSK+ +  SM
Sbjct  7    FSCCALLLVTLLPLSANASSKLYIVYMGEKKHDDPSAVTASHHDILTSVLGSKDESLKSM  66

Query  260  IYSYRHGFSGFAAMMTKSHAQTFQDLPGVVKVIPNSLYKLRTTRSWDYLGLSLNSA---T  430
            +YSY+HGFSGFAA++TK+ A T    P V+ V PN+ +K  TTRSWD+LGL  N +   T
Sbjct  67   VYSYKHGFSGFAAILTKTQAGTLAKFPEVISVKPNTYHKAHTTRSWDFLGLGHNKSPQQT  126

Query  431  NLLHDTKMGDGTIVAVLDTGVTPENEAYNDRGLGPIPSKWKGYCES  568
            +LL     G+  IV V+D+G+ PE+ +++D G GP+P++WKG C++
Sbjct  127  DLLRTANYGEDIIVGVIDSGIWPESRSFDDNGYGPVPARWKGICQT  172



>gb|KDP25228.1| hypothetical protein JCGZ_20384 [Jatropha curcas]
Length=335

 Score =   167 bits (422),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 70/134 (52%), Positives = 104/134 (78%), Gaps = 0/134 (0%)
 Frame = +2

Query  164  ARQHDDVDLITSTHHDMLATVLGSKEAAADSMIYSYRHGFSGFAAMMTKSHAQTFQDLPG  343
              +++D       HH ML+T+LGSKEAA  S++YSYRHGFSGFAA +++S A    D PG
Sbjct  2    GEKYEDPATTKKFHHKMLSTLLGSKEAAKSSILYSYRHGFSGFAARLSESQAVKIADFPG  61

Query  344  VVKVIPNSLYKLRTTRSWDYLGLSLNSATNLLHDTKMGDGTIVAVLDTGVTPENEAYNDR  523
            V++VIPNS++KL TTRSW+++GL+ +S+ NLL  + MG+GTI+ V+D+G+ PE++++ND+
Sbjct  62   VIRVIPNSIHKLHTTRSWEFIGLNHHSSRNLLTQSNMGEGTIIGVIDSGIWPESKSFNDQ  121

Query  524  GLGPIPSKWKGYCE  565
            G+ P+PS WKG C+
Sbjct  122  GMRPVPSHWKGICQ  135



>ref|XP_009391860.1| PREDICTED: subtilisin-like protease SBT5.3 [Musa acuminata subsp. 
malaccensis]
Length=746

 Score =   172 bits (436),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 74/145 (51%), Positives = 109/145 (75%), Gaps = 2/145 (1%)
 Frame = +2

Query  140  KVYIVYMGARQHDDVDLITSTHHDMLATVLGSKEAAADSMIYSYRHGFSGFAAMMTKSHA  319
            K+YIVY+G R+H+D DL+T++HHD+L+++LGS E A +S++YSYRHGFSGFAAM+T+S A
Sbjct  42   KLYIVYLGERRHEDPDLVTASHHDLLSSLLGSMEEAMNSIVYSYRHGFSGFAAMLTESLA  101

Query  320  QTFQDLPGVVKVIPNSLYKLRTTRSWDYLGLSLN--SATNLLHDTKMGDGTIVAVLDTGV  493
                +LP V+ V P+    + TTRSW++LGL+ N    T LL  +  GDG I+  +DTG+
Sbjct  102  DQIAELPEVISVKPSRSVPIHTTRSWEFLGLNYNQHQPTGLLRQSNFGDGVIIGFVDTGI  161

Query  494  TPENEAYNDRGLGPIPSKWKGYCES  568
             PE+ +++D G GP+PS+WKG C++
Sbjct  162  WPESRSFDDHGYGPVPSRWKGICQT  186



>emb|CDY61569.1| BnaCnng38020D [Brassica napus]
Length=1177

 Score =   174 bits (442),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 80/167 (48%), Positives = 115/167 (69%), Gaps = 0/167 (0%)
 Frame = +2

Query  68   FSFFFGCLLVFQNALVHTSALSEPKVYIVYMGARQHDDVDLITSTHHDMLATVLGSKEAA  247
             +  F CL++       +S   E ++Y V++G RQHDD  L+T +HHD+L ++LGSK+A+
Sbjct  15   IALVFICLVLILKIAFVSSDNQESQIYTVHLGERQHDDPKLVTDSHHDILRSLLGSKKAS  74

Query  248  ADSMIYSYRHGFSGFAAMMTKSHAQTFQDLPGVVKVIPNSLYKLRTTRSWDYLGLSLNSA  427
             +SMIYSYRHGFSGFAA +T   A+   + P VV V  +   KL TTR  DYLGL+  + 
Sbjct  75   RESMIYSYRHGFSGFAAKLTPPQARELSEHPDVVHVTRSKYMKLATTRVSDYLGLTRTTP  134

Query  428  TNLLHDTKMGDGTIVAVLDTGVTPENEAYNDRGLGPIPSKWKGYCES  568
            T L+H+T MG G I+ +LDTG+ P++++++D GLGPIP++WKG C S
Sbjct  135  TGLVHETDMGSGAIIGILDTGIWPDSKSFSDNGLGPIPARWKGKCVS  181


 Score = 89.4 bits (220),  Expect = 6e-17, Method: Compositional matrix adjust.
 Identities = 44/102 (43%), Positives = 64/102 (63%), Gaps = 0/102 (0%)
 Frame = +2

Query  263  YSYRHGFSGFAAMMTKSHAQTFQDLPGVVKVIPNSLYKLRTTRSWDYLGLSLNSATNLLH  442
            +S R   S   A++    A    + P VV V  +   KL TTR  DYLGL+  + T L+H
Sbjct  498  FSSRGPNSISPAILKPDIAAPGSEHPDVVHVTRSKYMKLATTRVSDYLGLTPTAPTGLVH  557

Query  443  DTKMGDGTIVAVLDTGVTPENEAYNDRGLGPIPSKWKGYCES  568
            +T MG G I+ +LDTG+ P++++++D GLGPIP++WKG C S
Sbjct  558  ETDMGSGAIIGILDTGIWPDSKSFSDNGLGPIPTRWKGKCVS  599



>gb|EMS61069.1| Subtilisin-like protease [Triticum urartu]
Length=739

 Score =   172 bits (435),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 79/167 (47%), Positives = 113/167 (68%), Gaps = 4/167 (2%)
 Frame = +2

Query  77   FFGCLLVFQNALVHTSALSEPKVYIVYMGARQHDDVDLITSTHHDMLATVLGSKEAAADS  256
            F GC       L+  SA +  K+YIVYMG ++HDD  ++T++H DML +V GSK+ A  S
Sbjct  7    FCGCN-TLDATLLPVSANASSKLYIVYMGEKKHDDPSMVTASHRDMLTSVFGSKDEALRS  65

Query  257  MIYSYRHGFSGFAAMMTKSHAQTFQDLPGVVKVIPNSLYKLRTTRSWDYLGLSLNSA---  427
            ++YSY+HGFSGFAAM+T+S A+T    P VV V PN+ ++   TRSWD+LGL  N     
Sbjct  66   IVYSYKHGFSGFAAMLTESQAETIAKFPEVVTVKPNTYHETHKTRSWDFLGLDRNQPRQQ  125

Query  428  TNLLHDTKMGDGTIVAVLDTGVTPENEAYNDRGLGPIPSKWKGYCES  568
            + LL   K G+  IV V+DTG+ PE+ +++D G GP+P++WKG C++
Sbjct  126  SGLLRKAKYGEDVIVGVIDTGIWPESRSFDDNGYGPVPARWKGKCQT  172



>ref|XP_006829610.1| hypothetical protein AMTR_s00122p00026080 [Amborella trichopoda]
 gb|ERM97026.1| hypothetical protein AMTR_s00122p00026080 [Amborella trichopoda]
Length=732

 Score =   172 bits (435),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 73/136 (54%), Positives = 101/136 (74%), Gaps = 0/136 (0%)
 Frame = +2

Query  158  MGARQHDDVDLITSTHHDMLATVLGSKEAAADSMIYSYRHGFSGFAAMMTKSHAQTFQDL  337
            MG + H+D D++   HH +L T+LGS EAA +SM+YSYR+GFSGFAA +T++ A+     
Sbjct  1    MGEKHHEDPDVVRDLHHSVLTTLLGSAEAARESMVYSYRYGFSGFAAKLTENQAKILSGF  60

Query  338  PGVVKVIPNSLYKLRTTRSWDYLGLSLNSATNLLHDTKMGDGTIVAVLDTGVTPENEAYN  517
             GVV+V+PN +YKL TTRSWD+LGL+    + LL     GDG IV V+D+GV PE+E++N
Sbjct  61   EGVVRVLPNRMYKLHTTRSWDFLGLNPKLPSTLLRKANSGDGVIVGVIDSGVWPESESFN  120

Query  518  DRGLGPIPSKWKGYCE  565
            D+G+GPIP +WKG C+
Sbjct  121  DKGMGPIPRRWKGICQ  136



>gb|EMS68678.1| Subtilisin-like protease [Triticum urartu]
Length=738

 Score =   172 bits (435),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 77/152 (51%), Positives = 109/152 (72%), Gaps = 3/152 (2%)
 Frame = +2

Query  122  SALSEPKVYIVYMGARQHDDVDLITSTHHDMLATVLGSKEAAADSMIYSYRHGFSGFAAM  301
            SA +  K+YIVYMG ++HDD  ++T++H DML +V GSK+ A  S++YSY+HGFSGFAAM
Sbjct  21   SANASSKLYIVYMGEKKHDDPSMVTASHRDMLTSVFGSKDEALRSIVYSYKHGFSGFAAM  80

Query  302  MTKSHAQTFQDLPGVVKVIPNSLYKLRTTRSWDYLGLSLNSATN---LLHDTKMGDGTIV  472
            +T+S A+T    P VV V PN+ ++  TTRSWD+LGL  N A     LL   K G+  IV
Sbjct  81   LTESQAETIAKFPEVVTVKPNTYHETHTTRSWDFLGLDHNQARQQPGLLRKAKYGEDVIV  140

Query  473  AVLDTGVTPENEAYNDRGLGPIPSKWKGYCES  568
             V+DTG+ PE+ +++D G GP+P++WKG C++
Sbjct  141  GVIDTGIWPESRSFDDNGYGPVPARWKGKCQT  172



>emb|CDY70485.1| BnaA03g58450D, partial [Brassica napus]
Length=734

 Score =   172 bits (435),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 74/162 (46%), Positives = 107/162 (66%), Gaps = 0/162 (0%)
 Frame = +2

Query  77   FFGCLLVFQNALVHTSALSEPKVYIVYMGARQHDDVDLITSTHHDMLATVLGSKEAAADS  256
              G L +            EP+VY+V++GA+QHDD +LI ++HH ML +V  S EAA +S
Sbjct  1    IIGLLFLLDCVFAQECTTEEPQVYVVHLGAKQHDDPELILASHHKMLESVFNSSEAAKES  60

Query  257  MIYSYRHGFSGFAAMMTKSHAQTFQDLPGVVKVIPNSLYKLRTTRSWDYLGLSLNSATNL  436
            ++Y+YRHGFSGFAA +T S A+  ++ P V  V  N    L++TR++DYLGLS N  + +
Sbjct  61   IVYNYRHGFSGFAASLTSSQAKKLKERPDVFSVASNRKLTLQSTRTYDYLGLSPNQPSGI  120

Query  437  LHDTKMGDGTIVAVLDTGVTPENEAYNDRGLGPIPSKWKGYC  562
            LHD+ MG   +V ++D+G+ PE+  ++D GLGPIP  WKG C
Sbjct  121  LHDSNMGSELVVGIIDSGIWPESAGFSDEGLGPIPKHWKGKC  162



>gb|EMT21267.1| Subtilisin-like protease [Aegilops tauschii]
Length=707

 Score =   171 bits (434),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 76/152 (50%), Positives = 107/152 (70%), Gaps = 3/152 (2%)
 Frame = +2

Query  122  SALSEPKVYIVYMGARQHDDVDLITSTHHDMLATVLGSKEAAADSMIYSYRHGFSGFAAM  301
            SA +  K+YIVYMG ++HDD  ++ ++HHDML +V GSK+ A  S++YSY+HGFSGFAAM
Sbjct  21   SATASSKLYIVYMGEKKHDDPSVVIASHHDMLTSVFGSKDEAMRSIVYSYKHGFSGFAAM  80

Query  302  MTKSHAQTFQDLPGVVKVIPNSLYKLRTTRSWDYLGLSLNSATN---LLHDTKMGDGTIV  472
            +TKS A     +P VV V PN  +K+ TTRSWD+LGL  N       LL   K G+  IV
Sbjct  81   LTKSQAVAIAKIPEVVTVKPNIFHKMHTTRSWDFLGLEYNQPPQQPGLLERAKYGEDVIV  140

Query  473  AVLDTGVTPENEAYNDRGLGPIPSKWKGYCES  568
             V+D+G+ PE+ +++D G GP+P++WKG C++
Sbjct  141  GVIDSGIWPESRSFDDNGYGPVPARWKGKCQT  172



>ref|XP_010647672.1| PREDICTED: subtilisin-like protease SBT3.5 [Vitis vinifera]
Length=776

 Score =   172 bits (435),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 71/141 (50%), Positives = 109/141 (77%), Gaps = 0/141 (0%)
 Frame = +2

Query  143  VYIVYMGARQHDDVDLITSTHHDMLATVLGSKEAAADSMIYSYRHGFSGFAAMMTKSHAQ  322
            VYIVYMG R HD+ +LI  +HH +L+ +LGS+EAA +S++Y Y+HGFSGFAA++T+S A+
Sbjct  33   VYIVYMGERPHDEPELIEDSHHQILSNLLGSEEAAKESILYHYKHGFSGFAAVLTESQAK  92

Query  323  TFQDLPGVVKVIPNSLYKLRTTRSWDYLGLSLNSATNLLHDTKMGDGTIVAVLDTGVTPE  502
               D PGVV+V+PN +  L+TTRSWD+L ++ +S T +L  +  G G+I+ ++DTG+ PE
Sbjct  93   VIADFPGVVRVVPNRILSLQTTRSWDFLHVNPHSGTGILSKSLSGFGSIIGIIDTGIWPE  152

Query  503  NEAYNDRGLGPIPSKWKGYCE  565
            ++++ D+G+G IPS+W G C+
Sbjct  153  SDSFKDKGMGKIPSRWHGTCQ  173



>ref|XP_010456502.1| PREDICTED: subtilisin-like protease SBT3.3 [Camelina sativa]
Length=763

 Score =   172 bits (435),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 78/143 (55%), Positives = 107/143 (75%), Gaps = 0/143 (0%)
 Frame = +2

Query  134  EPKVYIVYMGARQHDDVDLITSTHHDMLATVLGSKEAAADSMIYSYRHGFSGFAAMMTKS  313
            + KVYIVY+GA +H   DL+T++H  MLA++ GS++ A +SMIYSYRHGFSGFAA MT  
Sbjct  29   QTKVYIVYLGAVEHSHPDLVTASHIGMLASLFGSEKDARESMIYSYRHGFSGFAAHMTDW  88

Query  314  HAQTFQDLPGVVKVIPNSLYKLRTTRSWDYLGLSLNSATNLLHDTKMGDGTIVAVLDTGV  493
             A+   + P VV+V PN  Y+++TTR++DYLGL  ++   LL D  MG+  I+ V D+GV
Sbjct  89   QAKKLSEHPDVVQVTPNHYYQMQTTRTFDYLGLYESTPKQLLLDANMGEDVIIGVFDSGV  148

Query  494  TPENEAYNDRGLGPIPSKWKGYC  562
             PE+E++NDRGLGPIP++WKG C
Sbjct  149  WPESESFNDRGLGPIPARWKGKC  171



>ref|XP_009391854.1| PREDICTED: subtilisin-like protease SBT5.3 isoform X1 [Musa acuminata 
subsp. malaccensis]
Length=744

 Score =   171 bits (434),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 82/155 (53%), Positives = 108/155 (70%), Gaps = 3/155 (2%)
 Frame = +2

Query  107  ALVHTSALSEPKVYIVYMGARQHDDVDLITSTHHDMLATVLGSKEAAADSMIYSYRHGFS  286
            AL HT + S   +YIVYMG RQH+D DL+ ++HH ML++VLGSKE A  S++YSY+HGFS
Sbjct  24   ALGHTPS-STKLLYIVYMGERQHEDPDLVIASHHHMLSSVLGSKEEAVSSIVYSYKHGFS  82

Query  287  GFAAMMTKSHAQTFQDLPGVVKVIPNSLYKLRTTRSWDY--LGLSLNSATNLLHDTKMGD  460
            GFAAM+T+S A    ++P V+ V P+    L TTRSWDY  LG      T LL     GD
Sbjct  83   GFAAMLTESQADKIAEMPEVISVNPSRSVPLLTTRSWDYLDLGFEQPQPTGLLARGNFGD  142

Query  461  GTIVAVLDTGVTPENEAYNDRGLGPIPSKWKGYCE  565
            G I+ V+DTG+ PE+ +++D G GP+PS+WKG CE
Sbjct  143  GIIIGVVDTGIWPESRSFDDHGYGPVPSRWKGTCE  177



>ref|XP_006413751.1| hypothetical protein EUTSA_v10024480mg [Eutrema salsugineum]
 gb|ESQ55204.1| hypothetical protein EUTSA_v10024480mg [Eutrema salsugineum]
Length=766

 Score =   171 bits (434),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 79/152 (52%), Positives = 108/152 (71%), Gaps = 9/152 (6%)
 Frame = +2

Query  140  KVYIVYMGARQHDDVDLITSTHHDMLATVLGSKEAAADSMIYSYRHGFSGFAAMMTKSHA  319
            KVYIVY+G R+HDD +++T++HH ML +   SKE A +S+IYSY+HGFSGFAA++T S A
Sbjct  40   KVYIVYLGEREHDDPEVVTASHHQMLESFFESKEDAHNSIIYSYQHGFSGFAAILTPSQA  99

Query  320  QTFQDLPGVVKVIPNSLYKLRTTRSWDYLGLS---------LNSATNLLHDTKMGDGTIV  472
            +   + P V+ VIPN + KL+TTR+WD+LGLS           S+  LLHDT MG   I+
Sbjct  100  KKISEHPSVIHVIPNRILKLQTTRTWDHLGLSRIPTSLSTSSTSSKGLLHDTNMGSEAII  159

Query  473  AVLDTGVTPENEAYNDRGLGPIPSKWKGYCES  568
             V+DTG+ PE++   D+GLGPIP +W+G C S
Sbjct  160  GVMDTGIWPESKVVEDQGLGPIPKRWRGKCVS  191



>emb|CBI38006.3| unnamed protein product [Vitis vinifera]
Length=805

 Score =   172 bits (435),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 71/141 (50%), Positives = 109/141 (77%), Gaps = 0/141 (0%)
 Frame = +2

Query  143  VYIVYMGARQHDDVDLITSTHHDMLATVLGSKEAAADSMIYSYRHGFSGFAAMMTKSHAQ  322
            VYIVYMG R HD+ +LI  +HH +L+ +LGS+EAA +S++Y Y+HGFSGFAA++T+S A+
Sbjct  62   VYIVYMGERPHDEPELIEDSHHQILSNLLGSEEAAKESILYHYKHGFSGFAAVLTESQAK  121

Query  323  TFQDLPGVVKVIPNSLYKLRTTRSWDYLGLSLNSATNLLHDTKMGDGTIVAVLDTGVTPE  502
               D PGVV+V+PN +  L+TTRSWD+L ++ +S T +L  +  G G+I+ ++DTG+ PE
Sbjct  122  VIADFPGVVRVVPNRILSLQTTRSWDFLHVNPHSGTGILSKSLSGFGSIIGIIDTGIWPE  181

Query  503  NEAYNDRGLGPIPSKWKGYCE  565
            ++++ D+G+G IPS+W G C+
Sbjct  182  SDSFKDKGMGKIPSRWHGTCQ  202



>ref|XP_009392092.1| PREDICTED: subtilisin-like protease [Musa acuminata subsp. malaccensis]
Length=574

 Score =   170 bits (431),  Expect = 4e-46, Method: Compositional matrix adjust.
 Identities = 79/147 (54%), Positives = 104/147 (71%), Gaps = 2/147 (1%)
 Frame = +2

Query  131  SEPKVYIVYMGARQHDDVDLITSTHHDMLATVLGSKEAAADSMIYSYRHGFSGFAAMMTK  310
            S  K+YIV +G RQ +D  L+T++HHDML++VLGSKE A DS++YSY+H FSGFAA +T 
Sbjct  42   STAKLYIVDLGERQSEDPQLVTASHHDMLSSVLGSKEKARDSIVYSYKHCFSGFAATLTP  101

Query  311  SHAQTFQDLPGVVKVIPNSLYKLRTTRSWDYLGL--SLNSATNLLHDTKMGDGTIVAVLD  484
            S A+   +L  V+ V P+  + L TTRSWDYLGL       T LL   K GDG I+ V+D
Sbjct  102  SQARQIAELAEVISVSPSRTFPLHTTRSWDYLGLRSGQQQPTGLLEKGKEGDGIIIGVVD  161

Query  485  TGVTPENEAYNDRGLGPIPSKWKGYCE  565
            TG+ PE+ ++ND G GP+PS+WKG CE
Sbjct  162  TGIWPESRSFNDDGYGPVPSRWKGKCE  188



>ref|XP_010513580.1| PREDICTED: subtilisin-like protease SBT3.3 [Camelina sativa]
Length=730

 Score =   171 bits (433),  Expect = 4e-46, Method: Compositional matrix adjust.
 Identities = 78/168 (46%), Positives = 116/168 (69%), Gaps = 2/168 (1%)
 Frame = +2

Query  71   SFFFGCLLVFQNALVHTSALSE--PKVYIVYMGARQHDDVDLITSTHHDMLATVLGSKEA  244
            S     +L+     +  + L+    K++IV++GA+QHD  +L+T +H+ +L  +LGSKEA
Sbjct  13   SLVISLVLILNGMFISAAQLNGLMSKIHIVHLGAKQHDTPELVTKSHYKILEPLLGSKEA  72

Query  245  AADSMIYSYRHGFSGFAAMMTKSHAQTFQDLPGVVKVIPNSLYKLRTTRSWDYLGLSLNS  424
            A +S++Y+Y+HGFSGFAA +T S A+     P V+ V+P+ +   +TTR++DYLGLS  S
Sbjct  73   AKNSIVYNYKHGFSGFAAKLTASQAKNLSVHPEVLSVVPSRVMWPKTTRTYDYLGLSPTS  132

Query  425  ATNLLHDTKMGDGTIVAVLDTGVTPENEAYNDRGLGPIPSKWKGYCES  568
               LLHDTKMG   I+ V+DTG+ PE++++ND GLGPIP +WKG C S
Sbjct  133  PKGLLHDTKMGSEVIIGVIDTGIWPESQSFNDTGLGPIPKRWKGKCMS  180



>ref|XP_008663777.1| PREDICTED: subtilisin-like protease SBT5.3, partial [Zea mays]
Length=779

 Score =   171 bits (434),  Expect = 4e-46, Method: Compositional matrix adjust.
 Identities = 83/175 (47%), Positives = 114/175 (65%), Gaps = 8/175 (5%)
 Frame = +2

Query  50   QNELILFSFFFGCLLVFQNALVHTSALSEPKVYIVYMGARQHDDVDLITSTHHDMLATVL  229
            QN+ I F+    CL  ++  +         ++YI+Y+G RQ DD DL+T++HHD+LA+V+
Sbjct  20   QNQQIAFNIQPACL--YREGVDGVCVF---QIYIIYLGGRQSDDADLVTASHHDLLASVV  74

Query  230  GSKEAAADSMIYSYRHGFSGFAAMMTKSHAQTFQDLPGVVKVIPNSLYKLRTTRSWDYLG  409
            GSK+ A +S+IYSYRHGFSGFAA++TKS +     LPGVV V  N ++  RTTRSWD++G
Sbjct  75   GSKQEAVESIIYSYRHGFSGFAALLTKSQSTKIAGLPGVVSVTKNRVHHTRTTRSWDFVG  134

Query  410  LSLNSATN---LLHDTKMGDGTIVAVLDTGVTPENEAYNDRGLGPIPSKWKGYCE  565
            L  N       L    K GD  IV V+D+G  PE+ +Y D G GP PS+WKG C+
Sbjct  135  LHYNDDQPNGLLAKAAKYGDDVIVGVIDSGFWPESPSYADHGYGPPPSRWKGVCQ  189



>emb|CDX94252.1| BnaC02g29120D [Brassica napus]
Length=703

 Score =   171 bits (433),  Expect = 4e-46, Method: Compositional matrix adjust.
 Identities = 87/171 (51%), Positives = 115/171 (67%), Gaps = 11/171 (6%)
 Frame = +2

Query  59   LILFSFFFGCLLVFQNALVHTSALSEPKVYIVYMGARQHDDVDLITSTHHDMLATVLGSK  238
            +IL +     ++  Q+  V   A +E KVY+VY+G ++HDD   +T  HH ML ++LGSK
Sbjct  5    IILVAIILTVVMNAQSTFVVGDA-AERKVYVVYLGEKEHDDPASVTEYHHQMLWSLLGSK  63

Query  239  EAAADSMIYSYRHGFSGFAAMMTKSHAQTFQDLPGVVKVIPNSLYKLRTTRSWDYLGLSL  418
            E+  DS++YSYRHGFSGFA            +LP VV VIPN+LY+L TTR+WD LGLS 
Sbjct  64   ESVHDSIVYSYRHGFSGFAFR---------TELPEVVHVIPNTLYELTTTRTWDCLGLSP  114

Query  419  NSATNLLHDTKMGDGTIVAVLDTGVT-PENEAYNDRGLGPIPSKWKGYCES  568
             ++ +LLH   MG   IV V+DTG+  PE+E YND+G GPIPS+WKG CES
Sbjct  115  GTSKSLLHKANMGRKIIVGVIDTGLLWPESEMYNDKGYGPIPSRWKGSCES  165



>ref|NP_567632.1| Subtilase family protein [Arabidopsis thaliana]
 emb|CAB36807.1| serine protease-like protein [Arabidopsis thaliana]
 emb|CAB81270.1| serine protease-like protein [Arabidopsis thaliana]
 gb|AEE84483.1| Subtilase family protein [Arabidopsis thaliana]
Length=772

 Score =   171 bits (433),  Expect = 5e-46, Method: Compositional matrix adjust.
 Identities = 83/167 (50%), Positives = 114/167 (68%), Gaps = 21/167 (13%)
 Frame = +2

Query  131  SEPKVYIVYMGARQHDDVDLITSTHHDMLATVLG-------------SKEAAADSMIYSY  271
            S+ KVYIVY+G R+HDD +L T++HH ML ++L              SK+ A +S+IYSY
Sbjct  35   SDSKVYIVYLGEREHDDPELFTASHHQMLESLLQRSTSLTCVSNDIYSKDDAHNSLIYSY  94

Query  272  RHGFSGFAAMMTKSHAQTFQDLPGVVKVIPNSLYKLRTTRSWDYLGLSLN--------SA  427
            ++GFSGFAA++T S A+   + P V+ VIPN + KL+TTR+WD+LGLS N        SA
Sbjct  95   QYGFSGFAALLTSSQAKKISEHPEVIHVIPNRILKLKTTRTWDHLGLSPNPTSFSSSSSA  154

Query  428  TNLLHDTKMGDGTIVAVLDTGVTPENEAYNDRGLGPIPSKWKGYCES  568
              LLH+T MG   I+ V+DTG+ PE++ +ND GLGPIP +W+G CES
Sbjct  155  KGLLHETNMGSEAIIGVVDTGIWPESKVFNDHGLGPIPQRWRGKCES  201



>emb|CDM82077.1| unnamed protein product [Triticum aestivum]
Length=736

 Score =   171 bits (433),  Expect = 5e-46, Method: Compositional matrix adjust.
 Identities = 77/166 (46%), Positives = 116/166 (70%), Gaps = 3/166 (2%)
 Frame = +2

Query  80   FGCLLVFQNALVHTSALSEPKVYIVYMGARQHDDVDLITSTHHDMLATVLGSKEAAADSM  259
            F C  +    L+  SA +  K+YIVYMG ++HDD  ++T+ HHD+L +VLGSK+ +  SM
Sbjct  7    FSCCALLLVTLLPLSANASSKLYIVYMGEKKHDDPSVVTAWHHDILTSVLGSKDESLKSM  66

Query  260  IYSYRHGFSGFAAMMTKSHAQTFQDLPGVVKVIPNSLYKLRTTRSWDYLGLSLNSA---T  430
            +YSY+HGFSGFAAM+TK+ A+T  + P V+ V PN+ +   TTRSWD+LGL  N +   T
Sbjct  67   VYSYKHGFSGFAAMLTKTQARTLANFPEVISVKPNTYHMAHTTRSWDFLGLGHNKSPQQT  126

Query  431  NLLHDTKMGDGTIVAVLDTGVTPENEAYNDRGLGPIPSKWKGYCES  568
            +LL     G+  IV V+D+G+ PE+++++D   GP+P++WKG C++
Sbjct  127  DLLRKANYGEDIIVGVIDSGIWPESQSFDDNRYGPVPARWKGICQT  172



>ref|XP_003572336.1| PREDICTED: subtilisin-like protease SBT3.5 [Brachypodium distachyon]
Length=739

 Score =   171 bits (432),  Expect = 6e-46, Method: Compositional matrix adjust.
 Identities = 74/166 (45%), Positives = 116/166 (70%), Gaps = 3/166 (2%)
 Frame = +2

Query  80   FGCLLVFQNALVHTSALSEPKVYIVYMGARQHDDVDLITSTHHDMLATVLGSKEAAADSM  259
            F C L+    L+  SA +  K+YIVY+G ++HDD  ++T++HHD+L +VLGSK+ A  S+
Sbjct  7    FSCALLLAVTLLPPSANASSKLYIVYLGEKKHDDPTVVTASHHDVLTSVLGSKDEALKSI  66

Query  260  IYSYRHGFSGFAAMMTKSHAQTFQDLPGVVKVIPNSLYKLRTTRSWDYLGLSL---NSAT  430
            +YSY+HGFSGFAAM+T+S A+     P V+ V PN+ +K  TT+SWD+LG+        +
Sbjct  67   VYSYKHGFSGFAAMLTESQAEIIAKFPEVLSVKPNTYHKAHTTQSWDFLGMDYYKPPQQS  126

Query  431  NLLHDTKMGDGTIVAVLDTGVTPENEAYNDRGLGPIPSKWKGYCES  568
             LL   K G+  I+ V+D+G+ PE+++++D G GP+P++WKG C++
Sbjct  127  GLLQKAKYGEDVIIGVIDSGIWPESQSFDDIGYGPVPARWKGTCQT  172



>emb|CDM84531.1| unnamed protein product [Triticum aestivum]
Length=741

 Score =   170 bits (431),  Expect = 7e-46, Method: Compositional matrix adjust.
 Identities = 73/144 (51%), Positives = 106/144 (74%), Gaps = 2/144 (1%)
 Frame = +2

Query  140  KVYIVYMGARQHDDVDLITSTHHDMLATVLGSKEAAADSMIYSYRHGFSGFAAMMTKSHA  319
            K+YIVY+G ++H+D  L+T++HHDML+ +LGSKE A  S+ YSY+HGFSGFAAM+T   A
Sbjct  32   KLYIVYLGEKKHEDPSLVTASHHDMLSAILGSKEDALASITYSYKHGFSGFAAMLTDDQA  91

Query  320  QTFQDLPGVVKVIPNSLYKLRTTRSWDYLGLSLN--SATNLLHDTKMGDGTIVAVLDTGV  493
            Q   +LP V+ V PN  + L TTRSWD+LG++L+    + LL  +K G+  I+ + DTG+
Sbjct  92   QDLAELPEVISVTPNQHHDLMTTRSWDFLGMNLDHQPPSKLLQRSKYGEDVIIGIFDTGI  151

Query  494  TPENEAYNDRGLGPIPSKWKGYCE  565
             PE+ +++D G GP+PS+WKG C+
Sbjct  152  WPESRSFSDEGYGPVPSRWKGVCQ  175



>emb|CDX82843.1| BnaC01g12930D [Brassica napus]
Length=766

 Score =   170 bits (431),  Expect = 8e-46, Method: Compositional matrix adjust.
 Identities = 86/196 (44%), Positives = 123/196 (63%), Gaps = 23/196 (12%)
 Frame = +2

Query  50   QNELILFSFFFGCLLVFQNALVHTSAL----SEPKVYIVYMGARQHDDVDLITSTHHDML  217
            Q+  ++  F F  +L     L H ++        KVYIVY+G R+HDD +L+T++HH ML
Sbjct  7    QSHRLVLLFSFSLVLFLNTELSHLASAGGTNKNTKVYIVYLGEREHDDPELVTASHHQML  66

Query  218  ATV------------LGSKEAAADSMIYSYRHGFSGFAAMMTKSHAQTFQDLPGVVKVIP  361
             ++            +  KE A +SMIYSY+HGFSGFAA++T S A+   + P V+ VIP
Sbjct  67   ESLHERNSSRLCFFFIFFKEEAHNSMIYSYQHGFSGFAALLTSSQAKKISENPSVIHVIP  126

Query  362  NSLYKLRTTRSWDYLGL-------SLNSATNLLHDTKMGDGTIVAVLDTGVTPENEAYND  520
            N + KL+TTR+WD+LGL       S +S   LL++T MG   I+ +LDTG+ PE+E +ND
Sbjct  127  NRIVKLKTTRTWDHLGLYQVPTSSSPSSVKGLLNETNMGSDAIIGLLDTGIWPESEVFND  186

Query  521  RGLGPIPSKWKGYCES  568
            +G GPIP +W+G CES
Sbjct  187  QGFGPIPKRWRGKCES  202



>gb|EMS53237.1| Subtilisin-like protease [Triticum urartu]
Length=739

 Score =   170 bits (431),  Expect = 9e-46, Method: Compositional matrix adjust.
 Identities = 76/166 (46%), Positives = 115/166 (69%), Gaps = 3/166 (2%)
 Frame = +2

Query  80   FGCLLVFQNALVHTSALSEPKVYIVYMGARQHDDVDLITSTHHDMLATVLGSKEAAADSM  259
            F C  +    L+  SA +  K+YIVYMG ++HDD   +T++HHD+L +VLGSK+ +  S+
Sbjct  7    FSCCALLLVTLLPLSANASSKLYIVYMGEKKHDDPSAVTASHHDILTSVLGSKDESLKSI  66

Query  260  IYSYRHGFSGFAAMMTKSHAQTFQDLPGVVKVIPNSLYKLRTTRSWDYLGLSLNSA---T  430
            +YSY+HGFSGFAAM+TK+ A+T    P V+ V PN+ +K  TTRSWD+LGL  N +   T
Sbjct  67   VYSYKHGFSGFAAMLTKTQARTLAKFPEVISVKPNTYHKAHTTRSWDFLGLGHNKSPQQT  126

Query  431  NLLHDTKMGDGTIVAVLDTGVTPENEAYNDRGLGPIPSKWKGYCES  568
            +LL     G+  I+ V+D+G+ PE+ +++D G GP+ ++WKG C++
Sbjct  127  DLLRKANYGEDIIIGVIDSGIWPESRSFDDNGYGPVQARWKGICQT  172



>ref|NP_001130788.1| putative subtilase family protein precursor [Zea mays]
 gb|ACF79142.1| unknown [Zea mays]
 gb|AFW77339.1| putative subtilase family protein [Zea mays]
Length=775

 Score =   170 bits (431),  Expect = 9e-46, Method: Compositional matrix adjust.
 Identities = 83/169 (49%), Positives = 112/169 (66%), Gaps = 5/169 (3%)
 Frame = +2

Query  74   FFFGCLLVFQNALVHTSAL-SEPK-VYIVYMGARQHDDVDLITSTHHDMLATVLGSKEAA  247
             F    +V Q    +   L +EP+ +YI+Y+G RQ DD DL+T++HHD+LA+V+GSK+ A
Sbjct  17   LFLANFVVLQLQCSYGLPLQNEPRQIYIIYLGGRQSDDADLVTASHHDLLASVVGSKQEA  76

Query  248  ADSMIYSYRHGFSGFAAMMTKSHAQTFQDLPGVVKVIPNSLYKLRTTRSWDYLGLSLNSA  427
             +S+IYSYRHGFSGFAA++TKS +     LPGVV V  N ++  RTTRSWD++GL  N  
Sbjct  77   VESIIYSYRHGFSGFAALLTKSQSTKIAGLPGVVSVTKNRVHHTRTTRSWDFVGLHYNDD  136

Query  428  TN---LLHDTKMGDGTIVAVLDTGVTPENEAYNDRGLGPIPSKWKGYCE  565
                 L    K GD  IV V+D+G  PE+ +Y D G GP PS+WKG C+
Sbjct  137  QPNGLLAKAAKYGDDVIVGVIDSGFWPESPSYADHGYGPPPSRWKGVCQ  185



>ref|XP_006487361.1| PREDICTED: subtilisin-like protease SDD1-like isoform X1 [Citrus 
sinensis]
Length=780

 Score =   170 bits (431),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 79/167 (47%), Positives = 112/167 (67%), Gaps = 5/167 (3%)
 Frame = +2

Query  65   LFSFFFGCLLVFQNALVHTSALSEPKVYIVYMGARQHDDVDLITSTHHDMLATVLGSKEA  244
            LFS    CL++   A+    A +   VYIVYMG R+ D+  L+  +HH +L+ +LGSKEA
Sbjct  9    LFSII--CLVL---AVCQPLATASSNVYIVYMGERRWDEPQLVQDSHHQILSDILGSKEA  63

Query  245  AADSMIYSYRHGFSGFAAMMTKSHAQTFQDLPGVVKVIPNSLYKLRTTRSWDYLGLSLNS  424
            A +S++YSY+HGFSGFAA++T S A+   DLPGVV+V+PN +  L TTRSWD+L L  N 
Sbjct  64   AKESILYSYKHGFSGFAAVLTHSQAKLTADLPGVVRVVPNRILSLHTTRSWDFLQLKPNV  123

Query  425  ATNLLHDTKMGDGTIVAVLDTGVTPENEAYNDRGLGPIPSKWKGYCE  565
               +L     G G+I+ V+DTG+ PE+E++ D  +G IP +W G C+
Sbjct  124  ENGILSKGHSGAGSIIGVMDTGIWPESESFKDENMGEIPPRWNGICQ  170



>gb|EMT29371.1| Cucumisin [Aegilops tauschii]
Length=321

 Score =   164 bits (415),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 77/166 (46%), Positives = 112/166 (67%), Gaps = 6/166 (4%)
 Frame = +2

Query  80   FGCLLVFQNALVHTSALSEPKVYIVYMGARQHDDVDLITSTHHDMLATVLGSKEAAADSM  259
            F C ++   A+   SA S  K+YIVYMG ++HDD  ++T +HHD+L +V GSK+ A  S+
Sbjct  7    FACTMLLA-AMSPLSASS--KLYIVYMGGKKHDDPSMVTESHHDVLTSVFGSKDEAMKSI  63

Query  260  IYSYRHGFSGFAAMMTKSHAQTFQDLPGVVKVIPNSLYKLRTTRSWDYLGLSLNSA---T  430
            +YSYRHGFSGFAAM+T+S A T      VV V PN  ++  TTRSWD+LGL  +     +
Sbjct  64   VYSYRHGFSGFAAMLTESQAATLAKCSDVVSVRPNIYHEAHTTRSWDFLGLDYDQPREDS  123

Query  431  NLLHDTKMGDGTIVAVLDTGVTPENEAYNDRGLGPIPSKWKGYCES  568
             LL   K G+  I+ V+D+G+ PE+ +++D G GP+P++WKG C++
Sbjct  124  GLLQKAKYGEDVIIGVIDSGIWPESRSFDDSGYGPVPARWKGTCQA  169



>ref|XP_010931731.1| PREDICTED: subtilisin-like protease SBT3.5 [Elaeis guineensis]
Length=712

 Score =   169 bits (429),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 73/142 (51%), Positives = 106/142 (75%), Gaps = 0/142 (0%)
 Frame = +2

Query  140  KVYIVYMGARQHDDVDLITSTHHDMLATVLGSKEAAADSMIYSYRHGFSGFAAMMTKSHA  319
            K+YIVYMG R+H+D   +T++H+DML ++L SKE A  S++YSYRHGFSGFAAM+T+S A
Sbjct  10   KLYIVYMGERKHEDPQHVTASHNDMLTSLLESKEEALASIVYSYRHGFSGFAAMLTESQA  69

Query  320  QTFQDLPGVVKVIPNSLYKLRTTRSWDYLGLSLNSATNLLHDTKMGDGTIVAVLDTGVTP  499
            +   + P V+ + P+  Y+L TTRSW++LGL+    T LL  +  GDG I+ ++DTG+ P
Sbjct  70   KLLAESPEVISIRPSRNYQLHTTRSWNFLGLNNVHPTELLRKSNFGDGVIIGIIDTGIWP  129

Query  500  ENEAYNDRGLGPIPSKWKGYCE  565
            E++++ND G GP PS+WKG C+
Sbjct  130  ESKSFNDDGYGPTPSRWKGICQ  151



>ref|XP_007042045.1| Subtilase family protein, putative isoform 4 [Theobroma cacao]
 gb|EOX97876.1| Subtilase family protein, putative isoform 4 [Theobroma cacao]
Length=535

 Score =   168 bits (426),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 71/147 (48%), Positives = 107/147 (73%), Gaps = 0/147 (0%)
 Frame = +2

Query  125  ALSEPKVYIVYMGARQHDDVDLITSTHHDMLATVLGSKEAAADSMIYSYRHGFSGFAAMM  304
            AL+   VYIVYMG R  D  +L+  +HH +L+ +LGSKE+A +S++YSY+HG SGFAA++
Sbjct  24   ALAASNVYIVYMGERHTDQPNLLEDSHHQILSDILGSKESAKESILYSYKHGLSGFAAVL  83

Query  305  TKSHAQTFQDLPGVVKVIPNSLYKLRTTRSWDYLGLSLNSATNLLHDTKMGDGTIVAVLD  484
            ++S A+   D+PGVV+V+PN +  L TTRSWD+L +       +L  +  G GTI+ V+D
Sbjct  84   SQSQAKLIADVPGVVRVVPNRILSLHTTRSWDFLHVKPQIVDGILSRSHSGVGTIIGVMD  143

Query  485  TGVTPENEAYNDRGLGPIPSKWKGYCE  565
            TG+ PE+E++ D+G+G +PS+WKG C+
Sbjct  144  TGIWPESESFKDKGMGKVPSRWKGICQ  170



>ref|XP_009387964.1| PREDICTED: subtilisin-like protease SBT5.3 [Musa acuminata subsp. 
malaccensis]
Length=744

 Score =   169 bits (429),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 80/155 (52%), Positives = 108/155 (70%), Gaps = 3/155 (2%)
 Frame = +2

Query  107  ALVHTSALSEPKVYIVYMGARQHDDVDLITSTHHDMLATVLGSKEAAADSMIYSYRHGFS  286
            AL HT + S   +YIVYMG RQH+D +L+T++HHDML++VLGSKE A  S++YSY+HGFS
Sbjct  24   ALGHTPS-STKLLYIVYMGERQHEDPNLVTASHHDMLSSVLGSKEEAVSSIVYSYKHGFS  82

Query  287  GFAAMMTKSHAQTFQDLPGVVKVIPNSLYKLRTTRSWDY--LGLSLNSATNLLHDTKMGD  460
            GFAAM+T+S A    ++P V+   P+    L TTRSWDY  LG      T LL     GD
Sbjct  83   GFAAMLTESQANKIAEMPEVISCNPSRSVPLLTTRSWDYLDLGFEQPQPTGLLVRGNFGD  142

Query  461  GTIVAVLDTGVTPENEAYNDRGLGPIPSKWKGYCE  565
              I+ ++DTG+ PE+ +++D G GP+PS+WKG CE
Sbjct  143  DIIIGIVDTGIWPESRSFDDHGYGPVPSRWKGTCE  177



>ref|XP_007131420.1| hypothetical protein PHAVU_011G012100g [Phaseolus vulgaris]
 gb|ESW03414.1| hypothetical protein PHAVU_011G012100g [Phaseolus vulgaris]
Length=510

 Score =   167 bits (424),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 71/141 (50%), Positives = 105/141 (74%), Gaps = 0/141 (0%)
 Frame = +2

Query  143  VYIVYMGARQHDDVDLITSTHHDMLATVLGSKEAAADSMIYSYRHGFSGFAAMMTKSHAQ  322
            V+IVYMG + H +  L    H+ ML+++LGSKEAA  S++YSY+HGFSGFAA +TK  A+
Sbjct  38   VHIVYMGDKIHQNPQLTKKYHNKMLSSLLGSKEAAKSSILYSYKHGFSGFAARLTKHQAE  97

Query  323  TFQDLPGVVKVIPNSLYKLRTTRSWDYLGLSLNSATNLLHDTKMGDGTIVAVLDTGVTPE  502
                 PGVV VIPN ++KL TTRSWD++G+  +++ + L ++ +G+G I+ V+DTG+ PE
Sbjct  98   AIAKFPGVVSVIPNGIHKLHTTRSWDFIGIHHSTSKSALSNSNLGEGAIIGVIDTGIWPE  157

Query  503  NEAYNDRGLGPIPSKWKGYCE  565
            + ++ND G+G IPS+WKG C+
Sbjct  158  SASFNDEGMGQIPSRWKGVCQ  178



>ref|XP_009350314.1| PREDICTED: subtilisin-like protease SBT5.3 [Pyrus x bretschneideri]
Length=718

 Score =   169 bits (428),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 74/119 (62%), Positives = 95/119 (80%), Gaps = 0/119 (0%)
 Frame = +2

Query  212  MLATVLGSKEAAADSMIYSYRHGFSGFAAMMTKSHAQTFQDLPGVVKVIPNSLYKLRTTR  391
            MLA+V+GSKEAA DSM+YSYRHGFSGFAA +T+S A+   +  GVV V PNS Y  +TTR
Sbjct  1    MLASVVGSKEAAIDSMVYSYRHGFSGFAAKLTESQAKKISEFSGVVHVTPNSFYSPQTTR  60

Query  392  SWDYLGLSLNSATNLLHDTKMGDGTIVAVLDTGVTPENEAYNDRGLGPIPSKWKGYCES  568
            SWDYLGLS +S TNL+H+T MGDG ++ ++D G+ PE++  ND G+GPIP++WKG CES
Sbjct  61   SWDYLGLSSDSPTNLMHETNMGDGIVIGIMDFGIWPESKMLNDHGVGPIPTRWKGRCES  119



>ref|XP_009391852.1| PREDICTED: subtilisin-like protease SBT5.3 [Musa acuminata subsp. 
malaccensis]
Length=746

 Score =   169 bits (429),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 83/173 (48%), Positives = 116/173 (67%), Gaps = 4/173 (2%)
 Frame = +2

Query  59   LILFSFFFGCLLVFQNALVHTSALSEP--KVYIVYMGARQHDDVDLITSTHHDMLATVLG  232
            L+++S+F    L    +   + +L  P  K+YIV +G R+++D  L+ ++HHDML+ VLG
Sbjct  7    LLIWSYFQRVPLGDNPSTKASVSLPSPTAKLYIVDLGERRYEDPQLVIASHHDMLSAVLG  66

Query  233  SKEAAADSMIYSYRHGFSGFAAMMTKSHAQTFQDLPGVVKVIPNSLYKLRTTRSWDYLGL  412
            SKE A DS++YSY+H FSGFAA +T S A+   +L  V+ V P+  + L TTRSWDYLGL
Sbjct  67   SKEKARDSIVYSYKHCFSGFAATLTPSQARQIAELAEVISVSPSRTFPLHTTRSWDYLGL  126

Query  413  --SLNSATNLLHDTKMGDGTIVAVLDTGVTPENEAYNDRGLGPIPSKWKGYCE  565
              S    T LL   K GDG I+ V+DTG+ PE+ ++ND G GP+PS+WKG CE
Sbjct  127  RYSHQQPTGLLEKGKEGDGIIIGVVDTGIWPESRSFNDDGYGPVPSRWKGTCE  179



>ref|XP_008236858.1| PREDICTED: subtilisin-like protease [Prunus mume]
Length=771

 Score =   169 bits (429),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 68/147 (46%), Positives = 112/147 (76%), Gaps = 0/147 (0%)
 Frame = +2

Query  125  ALSEPKVYIVYMGARQHDDVDLITSTHHDMLATVLGSKEAAADSMIYSYRHGFSGFAAMM  304
            + +   VYIVYMG RQH++ +L++ +HH++L+ V GSKEAA  S++YSY+HGFSGFAA++
Sbjct  25   SFASQNVYIVYMGERQHEEPELVSESHHEILSYVFGSKEAAKQSILYSYKHGFSGFAAVL  84

Query  305  TKSHAQTFQDLPGVVKVIPNSLYKLRTTRSWDYLGLSLNSATNLLHDTKMGDGTIVAVLD  484
            T+S A+   D+PG+V VIPN ++ L TTRSW++L ++ + +  +L  ++ G G+I+ ++D
Sbjct  85   TQSQAKLIADIPGIVHVIPNRVHNLHTTRSWNFLQVNSHISNGILSRSQSGAGSIIGIID  144

Query  485  TGVTPENEAYNDRGLGPIPSKWKGYCE  565
            TG+ PE+ ++ D G+G +PS+W+G C+
Sbjct  145  TGIWPESLSFRDDGMGDVPSRWRGICQ  171



>ref|XP_009137186.1| PREDICTED: subtilisin-like protease SBT5.3 [Brassica rapa]
Length=746

 Score =   169 bits (428),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 72/143 (50%), Positives = 104/143 (73%), Gaps = 0/143 (0%)
 Frame = +2

Query  134  EPKVYIVYMGARQHDDVDLITSTHHDMLATVLGSKEAAADSMIYSYRHGFSGFAAMMTKS  313
            EP+VY+V++GA+QHDD +LI ++HH ML +V  S EAA +S++Y+YRHGFSGFAA +T S
Sbjct  32   EPQVYVVHLGAKQHDDPELILASHHKMLESVFNSSEAAKESIVYNYRHGFSGFAASLTSS  91

Query  314  HAQTFQDLPGVVKVIPNSLYKLRTTRSWDYLGLSLNSATNLLHDTKMGDGTIVAVLDTGV  493
             A+  ++ P V  V  N    L++TR++DYLGLS N  + +LHD+ MG   +V ++D+G+
Sbjct  92   QAKKLKERPDVFSVASNRKLTLQSTRTYDYLGLSPNQPSGILHDSNMGSELVVGIIDSGI  151

Query  494  TPENEAYNDRGLGPIPSKWKGYC  562
             PE+  ++D GLGPIP  WKG C
Sbjct  152  WPESAGFSDEGLGPIPKHWKGKC  174



>ref|XP_006653122.1| PREDICTED: xylem serine proteinase 1-like [Oryza brachyantha]
Length=746

 Score =   169 bits (427),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 72/143 (50%), Positives = 104/143 (73%), Gaps = 0/143 (0%)
 Frame = +2

Query  140  KVYIVYMGARQHDDVDLITSTHHDMLATVLGSKEAAADSMIYSYRHGFSGFAAMMTKSHA  319
            K+Y+VY+G +QHDD +  T++HHDML  +LGS+E A DSMIYSYRHGFSGF+AM+T+S A
Sbjct  40   KLYVVYLGEKQHDDPERTTASHHDMLTAILGSEEEAHDSMIYSYRHGFSGFSAMLTESQA  99

Query  320  QTFQDLPGVVKVIPNSLYKLRTTRSWDYLGLSLNSATNLLHDTKMGDGTIVAVLDTGVTP  499
                +LP V  +  + ++ + TTRS +++GL       LLHD   G+G I+ V+D+G+ P
Sbjct  100  YDIAELPEVRSIKLSVVHPMHTTRSQEFIGLDYTKPNGLLHDANYGEGVIIGVIDSGIWP  159

Query  500  ENEAYNDRGLGPIPSKWKGYCES  568
            E+ ++ D GLGP+PSKWKG C++
Sbjct  160  ESSSFRDHGLGPVPSKWKGICQA  182



>ref|XP_006391366.1| hypothetical protein EUTSA_v10018188mg [Eutrema salsugineum]
 gb|ESQ28652.1| hypothetical protein EUTSA_v10018188mg [Eutrema salsugineum]
Length=729

 Score =   169 bits (427),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 73/160 (46%), Positives = 114/160 (71%), Gaps = 0/160 (0%)
 Frame = +2

Query  89   LLVFQNALVHTSALSEPKVYIVYMGARQHDDVDLITSTHHDMLATVLGSKEAAADSMIYS  268
            L   +  L+  +     +++IV++GA++HD  +L+T +H+ +L  VLGSKE+A  S++YS
Sbjct  4    LATIKKVLIVPNKSESKRIHIVHLGAKKHDTPELVTRSHYQILEPVLGSKESAKKSIVYS  63

Query  269  YRHGFSGFAAMMTKSHAQTFQDLPGVVKVIPNSLYKLRTTRSWDYLGLSLNSATNLLHDT  448
            Y+HGFSGFAA +T S A+     P V+ V+P+ + +L+TTR++DYLGL  ++   LLHDT
Sbjct  64   YKHGFSGFAAKLTASQAKNLSAHPEVLSVMPSRVLRLKTTRTFDYLGLLPSTPKGLLHDT  123

Query  449  KMGDGTIVAVLDTGVTPENEAYNDRGLGPIPSKWKGYCES  568
            ++G   I+ V+D+G+ PE+ ++ND GLGPIP +WKG CES
Sbjct  124  RLGSEAIIGVIDSGIWPESGSFNDTGLGPIPKRWKGKCES  163



>ref|XP_007131422.1| hypothetical protein PHAVU_011G012100g [Phaseolus vulgaris]
 gb|ESW03416.1| hypothetical protein PHAVU_011G012100g [Phaseolus vulgaris]
Length=563

 Score =   167 bits (424),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 71/141 (50%), Positives = 105/141 (74%), Gaps = 0/141 (0%)
 Frame = +2

Query  143  VYIVYMGARQHDDVDLITSTHHDMLATVLGSKEAAADSMIYSYRHGFSGFAAMMTKSHAQ  322
            V+IVYMG + H +  L    H+ ML+++LGSKEAA  S++YSY+HGFSGFAA +TK  A+
Sbjct  38   VHIVYMGDKIHQNPQLTKKYHNKMLSSLLGSKEAAKSSILYSYKHGFSGFAARLTKHQAE  97

Query  323  TFQDLPGVVKVIPNSLYKLRTTRSWDYLGLSLNSATNLLHDTKMGDGTIVAVLDTGVTPE  502
                 PGVV VIPN ++KL TTRSWD++G+  +++ + L ++ +G+G I+ V+DTG+ PE
Sbjct  98   AIAKFPGVVSVIPNGIHKLHTTRSWDFIGIHHSTSKSALSNSNLGEGAIIGVIDTGIWPE  157

Query  503  NEAYNDRGLGPIPSKWKGYCE  565
            + ++ND G+G IPS+WKG C+
Sbjct  158  SASFNDEGMGQIPSRWKGVCQ  178



>ref|XP_009392091.1| PREDICTED: subtilisin-like protease SBT5.3, partial [Musa acuminata 
subsp. malaccensis]
Length=511

 Score =   167 bits (423),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 79/158 (50%), Positives = 107/158 (68%), Gaps = 2/158 (1%)
 Frame = +2

Query  98   FQNALVHTSALSEPKVYIVYMGARQHDDVDLITSTHHDMLATVLGSKEAAADSMIYSYRH  277
             Q A +  +  S   +YIVY+G RQH+D DL+T++HH ML++VLGSKE A  S++YSY+H
Sbjct  20   IQMAALGRTPSSTKLLYIVYLGERQHEDPDLVTASHHHMLSSVLGSKEEAVSSIVYSYKH  79

Query  278  GFSGFAAMMTKSHAQTFQDLPGVVKVIPNSLYKLRTTRSWDY--LGLSLNSATNLLHDTK  451
            GFSGFAAM+T+S A    ++P V+ V P+    L TTRSWDY  LG      T LL    
Sbjct  80   GFSGFAAMLTESQADKIAEMPEVISVNPSRSVPLLTTRSWDYLDLGYEQPQPTGLLVRGN  139

Query  452  MGDGTIVAVLDTGVTPENEAYNDRGLGPIPSKWKGYCE  565
             GD  I+ V+DTG+ PE+ +++D G GP+PS+WKG CE
Sbjct  140  FGDDIIIGVVDTGIWPESRSFDDHGYGPVPSRWKGTCE  177



>ref|XP_003572330.1| PREDICTED: subtilisin-like protease SBT3.5 [Brachypodium distachyon]
Length=730

 Score =   169 bits (427),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 74/145 (51%), Positives = 104/145 (72%), Gaps = 3/145 (2%)
 Frame = +2

Query  140  KVYIVYMGARQHDDVDLITSTHHDMLATVLGSKEAAADSMIYSYRHGFSGFAAMMTKSHA  319
            KVYIVYMG +QHDD   +T +HHD+L +VLGSK+ A  S++YSYRHGFSGFAAM+T+S A
Sbjct  27   KVYIVYMGQKQHDDPSEVTVSHHDVLTSVLGSKDEALKSIVYSYRHGFSGFAAMLTESQA  86

Query  320  QTFQDLPGVVKVIPNSLYKLRTTRSWDYLGLSL---NSATNLLHDTKMGDGTIVAVLDTG  490
            +    LP V+ V PN+ +K  TTRSWD+LG+        + LL   K G+  I+ V+D+G
Sbjct  87   EILAKLPEVISVRPNTYHKAHTTRSWDFLGMDYYKPPQESGLLQKAKYGEDVIIGVVDSG  146

Query  491  VTPENEAYNDRGLGPIPSKWKGYCE  565
            + PE+ +++D G GP+P++WKG C+
Sbjct  147  IWPESRSFDDTGYGPVPARWKGTCQ  171



>ref|XP_006283179.1| hypothetical protein CARUB_v10004209mg [Capsella rubella]
 gb|EOA16077.1| hypothetical protein CARUB_v10004209mg [Capsella rubella]
Length=760

 Score =   169 bits (427),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 78/173 (45%), Positives = 113/173 (65%), Gaps = 0/173 (0%)
 Frame = +2

Query  44   KNQNELILFSFFFGCLLVFQNALVHTSALSEPKVYIVYMGARQHDDVDLITSTHHDMLAT  223
            K +++  LF  F   L          S+  + KVYIV++GAR+HDD +L++ +HH ML +
Sbjct  5    KGRSKACLFVVFLYILNCGFCVFAQESSNEKRKVYIVHLGARRHDDPELVSDSHHRMLES  64

Query  224  VLGSKEAAADSMIYSYRHGFSGFAAMMTKSHAQTFQDLPGVVKVIPNSLYKLRTTRSWDY  403
            V  S EAA +S+IY+Y HGFSGFAA +T S A+   D P V  V PN + +L++TR +DY
Sbjct  65   VFESPEAARESIIYNYHHGFSGFAASLTDSQAKQLSDRPDVFSVTPNRMLQLQSTRVYDY  124

Query  404  LGLSLNSATNLLHDTKMGDGTIVAVLDTGVTPENEAYNDRGLGPIPSKWKGYC  562
            LGLS +    +LH++ MG   ++ ++D+G+ PE+ A+ND GLGPIP  WKG C
Sbjct  125  LGLSPSLPKGILHESNMGSDLVIGLIDSGIWPESPAFNDEGLGPIPKHWKGKC  177



>emb|CAB87667.1| subtilisin-like protease-like protein [Arabidopsis thaliana]
Length=755

 Score =   169 bits (427),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 78/159 (49%), Positives = 118/159 (74%), Gaps = 7/159 (4%)
 Frame = +2

Query  86   CLLVFQNALVHTSALSEPKVYIVYMGARQHDDVDLITSTHHDMLATVLGSKEAAADSMIY  265
            C+L  +  +V   A  E KV+IVY+G ++H+D +L+TS+H  ML ++LGSK+ A++S+++
Sbjct  18   CILKVEFNIVEGGAYEETKVHIVYLGEKEHNDPELVTSSHLRMLESLLGSKKDASESIVH  77

Query  266  SYRHGFSGFAAMMTKSHAQTFQDLPGVVKVIPNSLYKLRTTRSWDYLGLSLNSATNLLHD  445
            SYR+GFSGFAA +T S A+   D   VV+V PN+ Y+L+TTR++DYLGLS ++   LLH+
Sbjct  78   SYRNGFSGFAAHLTDSQAEQISD---VVQVTPNTFYELQTTRTFDYLGLSHSTPKGLLHE  134

Query  446  TKMGDGTIVAVLDTGVTPENEAYNDRGLGPIPSKWKGYC  562
             KMG+  I+ VLD+    E++++ND+GLGPIP +WKG C
Sbjct  135  AKMGEDIIIGVLDS----ESQSFNDKGLGPIPKRWKGMC  169



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 669314531515