BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFF037H20

Length=527
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_006347869.1|  PREDICTED: probable protein S-acyltransferas...    239   4e-75   Solanum tuberosum [potatoes]
ref|XP_010325709.1|  PREDICTED: probable protein S-acyltransferas...    238   8e-75   Solanum lycopersicum
ref|XP_004248564.1|  PREDICTED: probable protein S-acyltransferas...    238   1e-74   Solanum lycopersicum
ref|XP_006364242.1|  PREDICTED: probable protein S-acyltransferas...    236   5e-74   Solanum tuberosum [potatoes]
ref|XP_009610572.1|  PREDICTED: probable protein S-acyltransferas...    236   9e-74   Nicotiana tomentosiformis
ref|XP_009616135.1|  PREDICTED: probable protein S-acyltransferas...    234   2e-73   Nicotiana tomentosiformis
ref|XP_011090630.1|  PREDICTED: probable protein S-acyltransferas...    232   2e-72   Sesamum indicum [beniseed]
ref|XP_009791941.1|  PREDICTED: probable protein S-acyltransferas...    232   2e-72   Nicotiana sylvestris
gb|EYU31985.1|  hypothetical protein MIMGU_mgv1a010704mg                232   2e-72   Erythranthe guttata [common monkey flower]
ref|XP_007052067.1|  DHHC-type zinc finger family protein isoform 2     232   4e-72   
ref|XP_002320722.2|  hypothetical protein POPTR_0014s06480g             227   7e-71   
gb|KHG00286.1|  hypothetical protein F383_19583                         228   8e-71   Gossypium arboreum [tree cotton]
gb|KDO85815.1|  hypothetical protein CISIN_1g021813mg                   226   1e-70   Citrus sinensis [apfelsine]
gb|KDP28757.1|  hypothetical protein JCGZ_14528                         228   1e-70   Jatropha curcas
emb|CDO97688.1|  unnamed protein product                                227   1e-70   Coffea canephora [robusta coffee]
gb|KJB41112.1|  hypothetical protein B456_007G090900                    226   2e-70   Gossypium raimondii
gb|KFK37316.1|  hypothetical protein AALP_AA4G241200                    227   2e-70   Arabis alpina [alpine rockcress]
gb|KJB41110.1|  hypothetical protein B456_007G090900                    227   3e-70   Gossypium raimondii
ref|XP_009346814.1|  PREDICTED: probable protein S-acyltransferas...    225   3e-70   Pyrus x bretschneideri [bai li]
ref|XP_003521795.1|  PREDICTED: probable protein S-acyltransferas...    226   4e-70   Glycine max [soybeans]
ref|XP_011034295.1|  PREDICTED: probable protein S-acyltransferas...    226   5e-70   Populus euphratica
ref|XP_010098912.1|  putative S-acyltransferase                         226   5e-70   Morus notabilis
ref|XP_002511714.1|  zinc finger protein, putative                      226   5e-70   Ricinus communis
gb|KDO85814.1|  hypothetical protein CISIN_1g021813mg                   225   6e-70   Citrus sinensis [apfelsine]
ref|XP_010544651.1|  PREDICTED: probable protein S-acyltransferas...    226   6e-70   Tarenaya hassleriana [spider flower]
ref|XP_010524364.1|  PREDICTED: probable protein S-acyltransferas...    225   1e-69   Tarenaya hassleriana [spider flower]
ref|XP_006445267.1|  hypothetical protein CICLE_v10021302mg             224   2e-69   Citrus clementina [clementine]
ref|XP_007134881.1|  hypothetical protein PHAVU_010G083900g             224   2e-69   Phaseolus vulgaris [French bean]
ref|XP_007218730.1|  hypothetical protein PRUPE_ppa009076mg             224   3e-69   Prunus persica
emb|CBI38870.3|  unnamed protein product                                224   3e-69   Vitis vinifera
ref|XP_006291552.1|  hypothetical protein CARUB_v10017708mg             224   3e-69   Capsella rubella
ref|XP_008393352.1|  PREDICTED: probable protein S-acyltransferas...    224   3e-69   
ref|XP_011469137.1|  PREDICTED: probable protein S-acyltransferas...    224   4e-69   Fragaria vesca subsp. vesca
ref|XP_002279896.1|  PREDICTED: probable protein S-acyltransferas...    224   4e-69   Vitis vinifera
ref|XP_009338113.1|  PREDICTED: probable protein S-acyltransferas...    224   4e-69   Pyrus x bretschneideri [bai li]
ref|XP_004506505.1|  PREDICTED: probable S-acyltransferase At3g60...    223   5e-69   Cicer arietinum [garbanzo]
ref|XP_002302535.2|  zinc finger family protein                         223   6e-69   
emb|CDX71777.1|  BnaC08g30970D                                          223   1e-68   
ref|XP_011469138.1|  PREDICTED: probable protein S-acyltransferas...    222   1e-68   Fragaria vesca subsp. vesca
gb|KJB09889.1|  hypothetical protein B456_001G174100                    222   1e-68   Gossypium raimondii
gb|KJB09890.1|  hypothetical protein B456_001G174100                    222   1e-68   Gossypium raimondii
ref|XP_004133913.1|  PREDICTED: probable S-acyltransferase At3g60...    222   1e-68   Cucumis sativus [cucumbers]
ref|XP_006851861.1|  hypothetical protein AMTR_s00041p00097340          222   2e-68   
ref|XP_010056317.1|  PREDICTED: probable protein S-acyltransferas...    222   2e-68   Eucalyptus grandis [rose gum]
ref|XP_010255627.1|  PREDICTED: probable protein S-acyltransferas...    222   3e-68   Nelumbo nucifera [Indian lotus]
ref|XP_010469144.1|  PREDICTED: probable protein S-acyltransferas...    221   3e-68   Camelina sativa [gold-of-pleasure]
ref|XP_010413516.1|  PREDICTED: probable protein S-acyltransferas...    221   3e-68   Camelina sativa [gold-of-pleasure]
ref|XP_011017489.1|  PREDICTED: probable protein S-acyltransferas...    221   4e-68   Populus euphratica
ref|XP_003517050.1|  PREDICTED: probable protein S-acyltransferas...    221   5e-68   Glycine max [soybeans]
ref|XP_008438165.1|  PREDICTED: probable protein S-acyltransferas...    221   6e-68   Cucumis melo [Oriental melon]
ref|XP_008343300.1|  PREDICTED: probable protein S-acyltransferas...    220   9e-68   Malus domestica [apple tree]
emb|CDY52347.1|  BnaA09g38960D                                          220   1e-67   Brassica napus [oilseed rape]
ref|XP_003605089.1|  Palmitoyltransferase pfa3                          219   1e-67   
ref|XP_010276626.1|  PREDICTED: probable protein S-acyltransferas...    220   2e-67   Nelumbo nucifera [Indian lotus]
gb|AES87286.2|  DHHC-type zinc finger protein                           219   2e-67   Medicago truncatula
ref|XP_010692246.1|  PREDICTED: probable protein S-acyltransferas...    219   2e-67   Beta vulgaris subsp. vulgaris [field beet]
gb|ACU19432.1|  unknown                                                 219   4e-67   Glycine max [soybeans]
ref|XP_007052066.1|  DHHC-type zinc finger family protein isoform 1     219   1e-66   
gb|KHN29455.1|  Putative S-acyltransferase                              217   1e-66   Glycine soja [wild soybean]
ref|XP_006587892.1|  PREDICTED: probable protein S-acyltransferas...    217   2e-66   Glycine max [soybeans]
ref|XP_008232660.1|  PREDICTED: probable protein S-acyltransferas...    224   2e-66   Prunus mume [ume]
ref|XP_002878349.1|  zinc finger family protein                         217   2e-66   Arabidopsis lyrata subsp. lyrata
ref|XP_010508175.1|  PREDICTED: probable protein S-acyltransferas...    217   2e-66   
ref|NP_191639.2|  DHHC-type zinc finger family protein                  216   5e-66   Arabidopsis thaliana [mouse-ear cress]
ref|XP_004952412.1|  PREDICTED: probable S-acyltransferase At3g60...    216   6e-66   Setaria italica
ref|XP_009138811.1|  PREDICTED: probable protein S-acyltransferas...    214   1e-65   Brassica rapa
gb|KHG30156.1|  hypothetical protein F383_14468                         214   2e-65   Gossypium arboreum [tree cotton]
ref|XP_003579517.1|  PREDICTED: probable protein S-acyltransferas...    214   3e-65   Brachypodium distachyon [annual false brome]
ref|XP_006397719.1|  hypothetical protein EUTSA_v10001560mg             214   3e-65   Eutrema salsugineum [saltwater cress]
ref|XP_006602748.1|  PREDICTED: probable protein S-acyltransferas...    214   3e-65   Glycine max [soybeans]
gb|KHN40573.1|  Putative S-acyltransferase                              215   6e-65   Glycine soja [wild soybean]
ref|XP_009143136.1|  PREDICTED: probable protein S-acyltransferas...    213   1e-64   Brassica rapa
emb|CDX89079.1|  BnaA04g01070D                                          212   1e-64   
ref|XP_002446206.1|  hypothetical protein SORBIDRAFT_06g004040          212   2e-64   Sorghum bicolor [broomcorn]
gb|EMT07089.1|  Putative S-acyltransferase                              211   2e-64   
gb|KHG01247.1|  hypothetical protein F383_23406                         209   3e-64   Gossypium arboreum [tree cotton]
dbj|BAJ93966.1|  predicted protein                                      211   4e-64   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_010053896.1|  PREDICTED: probable protein S-acyltransferas...    211   5e-64   Eucalyptus grandis [rose gum]
ref|NP_001169109.1|  palmitoyltransferase ZDHHC20                       211   6e-64   Zea mays [maize]
ref|XP_010518152.1|  PREDICTED: probable protein S-acyltransferas...    210   8e-64   Camelina sativa [gold-of-pleasure]
emb|CDX71345.1|  BnaC07g06240D                                          210   8e-64   
ref|XP_006602749.1|  PREDICTED: probable protein S-acyltransferas...    209   9e-64   Glycine max [soybeans]
ref|XP_003552340.1|  PREDICTED: probable protein S-acyltransferas...    209   1e-63   Glycine max [soybeans]
ref|XP_009116762.1|  PREDICTED: probable protein S-acyltransferas...    209   2e-63   Brassica rapa
emb|CDX74736.1|  BnaA05g04820D                                          209   2e-63   
ref|XP_004492612.1|  PREDICTED: probable S-acyltransferase At3g60...    208   3e-63   Cicer arietinum [garbanzo]
ref|XP_006402542.1|  hypothetical protein EUTSA_v10006120mg             208   3e-63   Eutrema salsugineum [saltwater cress]
ref|XP_009143135.1|  PREDICTED: probable protein S-acyltransferas...    209   4e-63   
emb|CDY51805.1|  BnaC04g53110D                                          208   5e-63   Brassica napus [oilseed rape]
ref|XP_004975099.1|  PREDICTED: probable S-acyltransferase At3g60...    207   9e-63   Setaria italica
ref|XP_010506482.1|  PREDICTED: probable protein S-acyltransferas...    207   1e-62   Camelina sativa [gold-of-pleasure]
gb|KFK35280.1|  hypothetical protein AALP_AA5G264300                    207   1e-62   Arabis alpina [alpine rockcress]
ref|XP_002882009.1|  hypothetical protein ARALYDRAFT_903981             207   2e-62   Arabidopsis lyrata subsp. lyrata
gb|ABK24332.1|  unknown                                                 207   2e-62   Picea sitchensis
ref|XP_008437153.1|  PREDICTED: probable protein S-acyltransferas...    206   3e-62   Cucumis melo [Oriental melon]
gb|KDO85816.1|  hypothetical protein CISIN_1g021813mg                   204   3e-62   Citrus sinensis [apfelsine]
gb|KJB49337.1|  hypothetical protein B456_008G114100                    205   5e-62   Gossypium raimondii
ref|XP_004147573.1|  PREDICTED: probable S-acyltransferase At3g60...    206   5e-62   Cucumis sativus [cucumbers]
gb|KCW78273.1|  hypothetical protein EUGRSUZ_D02456                     203   7e-62   Eucalyptus grandis [rose gum]
ref|XP_010108133.1|  putative S-acyltransferase                         205   8e-62   Morus notabilis
gb|KJB49335.1|  hypothetical protein B456_008G114100                    204   1e-61   Gossypium raimondii
ref|XP_009362134.1|  PREDICTED: probable protein S-acyltransferas...    204   1e-61   Pyrus x bretschneideri [bai li]
ref|XP_008345376.1|  PREDICTED: probable protein S-acyltransferas...    204   3e-61   
ref|XP_006652138.1|  PREDICTED: probable protein S-acyltransferas...    203   5e-61   Oryza brachyantha
ref|XP_009761491.1|  PREDICTED: probable protein S-acyltransferas...    198   1e-60   Nicotiana sylvestris
ref|XP_008798535.1|  PREDICTED: probable protein S-acyltransferas...    202   1e-60   Phoenix dactylifera
ref|NP_001148846.1|  palmitoyltransferase ZDHHC20                       202   2e-60   Zea mays [maize]
gb|ABF99421.1|  DHHC zinc finger domain containing protein, expre...    199   2e-60   Oryza sativa Japonica Group [Japonica rice]
ref|XP_002267258.3|  PREDICTED: probable protein S-acyltransferas...    200   3e-60   Vitis vinifera
ref|XP_003635680.2|  PREDICTED: probable protein S-acyltransferas...    201   6e-60   Vitis vinifera
gb|KGN50197.1|  hypothetical protein Csa_5G158530                       200   8e-60   Cucumis sativus [cucumbers]
ref|XP_010662159.1|  PREDICTED: probable protein S-acyltransferas...    200   9e-60   Vitis vinifera
ref|XP_007209402.1|  hypothetical protein PRUPE_ppa009226mg             199   2e-59   Prunus persica
ref|XP_008238650.1|  PREDICTED: probable protein S-acyltransferas...    199   2e-59   Prunus mume [ume]
ref|XP_009399491.1|  PREDICTED: probable protein S-acyltransferas...    199   2e-59   Musa acuminata subsp. malaccensis [pisang utan]
gb|EEE60128.1|  hypothetical protein OsJ_13009                          194   2e-59   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010918308.1|  PREDICTED: probable protein S-acyltransferas...    199   2e-59   Elaeis guineensis
ref|NP_001051618.1|  Os03g0804300                                       199   3e-59   
gb|EEC76365.1|  hypothetical protein OsI_13959                          198   3e-59   Oryza sativa Indica Group [Indian rice]
gb|KCW78272.1|  hypothetical protein EUGRSUZ_D02456                     197   5e-59   Eucalyptus grandis [rose gum]
gb|AFW57919.1|  palmitoyltransferase ZDHHC20, mRNA                      195   1e-58   
gb|EPS68199.1|  hypothetical protein M569_06570                         196   3e-58   Genlisea aurea
ref|XP_009389071.1|  PREDICTED: probable protein S-acyltransferas...    192   1e-56   Musa acuminata subsp. malaccensis [pisang utan]
gb|KDP42560.1|  hypothetical protein JCGZ_24334                         191   3e-56   Jatropha curcas
ref|XP_007039984.1|  DHHC-type zinc finger family protein               190   4e-56   
ref|XP_011463771.1|  PREDICTED: probable protein S-acyltransferas...    190   4e-56   Fragaria vesca subsp. vesca
gb|KJB49338.1|  hypothetical protein B456_008G114100                    187   1e-55   Gossypium raimondii
ref|XP_009362135.1|  PREDICTED: probable protein S-acyltransferas...    186   1e-55   
ref|XP_009398464.1|  PREDICTED: probable protein S-acyltransferas...    189   1e-55   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_006477282.1|  PREDICTED: probable protein S-acyltransferas...    187   5e-55   Citrus sinensis [apfelsine]
ref|XP_002535239.1|  zinc finger protein, putative                      184   4e-54   
ref|XP_008354779.1|  PREDICTED: uncharacterized protein LOC103418427    193   6e-54   
ref|XP_008776787.1|  PREDICTED: probable protein S-acyltransferas...    185   7e-54   Phoenix dactylifera
gb|ACU18884.1|  unknown                                                 180   9e-54   Glycine max [soybeans]
gb|AHA84213.1|  palmitoyltransferase                                    184   9e-54   Phaseolus vulgaris [French bean]
gb|KJB37585.1|  hypothetical protein B456_006G211800                    182   1e-53   Gossypium raimondii
gb|KJB09891.1|  hypothetical protein B456_001G174100                    181   2e-53   Gossypium raimondii
gb|KDO63755.1|  hypothetical protein CISIN_1g021223mg                   182   3e-53   Citrus sinensis [apfelsine]
ref|XP_001781101.1|  predicted protein                                  182   3e-53   
gb|KJB37584.1|  hypothetical protein B456_006G211800                    181   9e-53   Gossypium raimondii
gb|KDO63753.1|  hypothetical protein CISIN_1g021223mg                   181   1e-52   Citrus sinensis [apfelsine]
ref|XP_006440415.1|  hypothetical protein CICLE_v10021242mg             181   1e-52   Citrus clementina [clementine]
gb|KHG16541.1|  hypothetical protein F383_02611                         181   2e-52   Gossypium arboreum [tree cotton]
ref|XP_002304438.2|  hypothetical protein POPTR_0003s11520g             181   2e-52   Populus trichocarpa [western balsam poplar]
emb|CDX94118.1|  BnaC07g37520D                                          180   3e-52   
ref|XP_009137276.1|  PREDICTED: probable protein S-acyltransferas...    179   8e-52   Brassica rapa
emb|CDX98764.1|  BnaA03g45490D                                          179   8e-52   
ref|XP_006440414.1|  hypothetical protein CICLE_v10021242mg             177   1e-51   
ref|XP_011033891.1|  PREDICTED: probable protein S-acyltransferas...    179   2e-51   Populus euphratica
gb|KFK28858.1|  hypothetical protein AALP_AA7G057700                    177   4e-51   Arabis alpina [alpine rockcress]
ref|XP_011029092.1|  PREDICTED: probable protein S-acyltransferas...    177   4e-51   Populus euphratica
ref|XP_009136109.1|  PREDICTED: probable protein S-acyltransferas...    177   5e-51   Brassica rapa
ref|XP_009136132.1|  PREDICTED: probable protein S-acyltransferas...    177   6e-51   Brassica rapa
ref|XP_010448848.1|  PREDICTED: probable protein S-acyltransferas...    176   8e-51   Camelina sativa [gold-of-pleasure]
ref|XP_002994078.1|  hypothetical protein SELMODRAFT_449300             175   3e-50   Selaginella moellendorffii
ref|XP_010433998.1|  PREDICTED: probable protein S-acyltransferas...    175   4e-50   Camelina sativa [gold-of-pleasure]
ref|NP_567668.1|  DHHC-type zinc finger family protein                  174   5e-50   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010540019.1|  PREDICTED: probable protein S-acyltransferas...    174   6e-50   Tarenaya hassleriana [spider flower]
gb|AAM65313.1|  unknown                                                 174   7e-50   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010439292.1|  PREDICTED: probable protein S-acyltransferas...    174   8e-50   Camelina sativa [gold-of-pleasure]
dbj|BAJ34112.1|  unnamed protein product                                173   1e-49   Eutrema halophilum
ref|XP_004515766.1|  PREDICTED: probable S-acyltransferase At3g60...    173   2e-49   Cicer arietinum [garbanzo]
ref|XP_006283414.1|  hypothetical protein CARUB_v10004463mg             179   2e-49   
ref|XP_002989117.1|  hypothetical protein SELMODRAFT_184354             172   4e-49   
gb|KJB37583.1|  hypothetical protein B456_006G211800                    177   5e-49   Gossypium raimondii
emb|CDX82967.1|  BnaC01g14170D                                          177   8e-49   
ref|NP_001154264.1|  DHHC-type zinc finger family protein               172   9e-49   
ref|XP_006368710.1|  hypothetical protein POPTR_0001s08000g             171   1e-48   
ref|XP_010910146.1|  PREDICTED: probable protein S-acyltransferas...    171   1e-48   Elaeis guineensis
ref|NP_001190801.1|  sterol 4-alpha methyl oxidase 1-3                  174   1e-47   
ref|XP_006413626.1|  hypothetical protein EUTSA_v10024722mg             173   3e-47   
emb|CDY71422.1|  BnaAnng37380D                                          156   3e-44   Brassica napus [oilseed rape]
ref|XP_004306624.1|  PREDICTED: probable protein S-acyltransferas...    159   4e-44   Fragaria vesca subsp. vesca
gb|KJB25654.1|  hypothetical protein B456_004G202600                    158   8e-44   Gossypium raimondii
ref|XP_010267425.1|  PREDICTED: probable protein S-acyltransferas...    155   1e-42   Nelumbo nucifera [Indian lotus]
ref|XP_006657677.1|  PREDICTED: probable protein S-acyltransferas...    153   2e-42   Oryza brachyantha
ref|XP_006657678.1|  PREDICTED: probable protein S-acyltransferas...    152   2e-42   Oryza brachyantha
gb|KHG08036.1|  hypothetical protein F383_35334                         154   4e-42   Gossypium arboreum [tree cotton]
gb|KJB25653.1|  hypothetical protein B456_004G202600                    152   7e-42   Gossypium raimondii
gb|KJB25655.1|  hypothetical protein B456_004G202600                    150   2e-41   Gossypium raimondii
ref|XP_008233069.1|  PREDICTED: probable protein S-acyltransferas...    152   3e-41   Prunus mume [ume]
ref|XP_008376192.1|  PREDICTED: probable protein S-acyltransferas...    152   3e-41   Malus domestica [apple tree]
ref|XP_006830293.1|  hypothetical protein AMTR_s00121p00069490          153   3e-41   
ref|XP_010267431.1|  PREDICTED: probable protein S-acyltransferas...    150   7e-41   
ref|XP_009401747.1|  PREDICTED: probable protein S-acyltransferas...    150   1e-40   Musa acuminata subsp. malaccensis [pisang utan]
gb|ADE76560.1|  unknown                                                 150   1e-40   Picea sitchensis
ref|XP_007051453.1|  DHHC-type zinc finger family protein               149   2e-40   
ref|XP_002263621.1|  PREDICTED: probable protein S-acyltransferas...    149   2e-40   Vitis vinifera
ref|XP_011039097.1|  PREDICTED: probable protein S-acyltransferas...    149   2e-40   Populus euphratica
emb|CAB82684.1|  putative protein                                       148   3e-40   Arabidopsis thaliana [mouse-ear cress]
gb|EEC81995.1|  hypothetical protein OsI_25930                          149   4e-40   Oryza sativa Indica Group [Indian rice]
gb|EEE67131.1|  hypothetical protein OsJ_24176                          149   4e-40   Oryza sativa Japonica Group [Japonica rice]
ref|XP_009351330.1|  PREDICTED: probable protein S-acyltransferas...    144   7e-40   Pyrus x bretschneideri [bai li]
tpg|DAA40775.1|  TPA: hypothetical protein ZEAMMB73_782285              145   1e-39   
gb|KJB09587.1|  hypothetical protein B456_001G151300                    146   2e-39   Gossypium raimondii
ref|XP_008779828.1|  PREDICTED: probable protein S-acyltransferas...    146   4e-39   Phoenix dactylifera
ref|XP_002462839.1|  hypothetical protein SORBIDRAFT_02g032840          145   4e-39   Sorghum bicolor [broomcorn]
ref|XP_003560239.2|  PREDICTED: probable protein S-acyltransferas...    146   4e-39   Brachypodium distachyon [annual false brome]
gb|ACF85839.1|  unknown                                                 145   5e-39   Zea mays [maize]
ref|NP_567193.2|  putative S-acyltransferase                            145   6e-39   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006360644.1|  PREDICTED: probable protein S-acyltransferas...    145   7e-39   Solanum tuberosum [potatoes]
ref|XP_002867753.1|  hypothetical protein ARALYDRAFT_329352             150   1e-38   
ref|XP_006288366.1|  hypothetical protein CARUB_v10001614mg             144   1e-38   Capsella rubella
ref|XP_010456165.1|  PREDICTED: probable protein S-acyltransferas...    144   2e-38   
ref|XP_010422733.1|  PREDICTED: probable protein S-acyltransferas...    144   2e-38   Camelina sativa [gold-of-pleasure]
tpg|DAA40774.1|  TPA: hypothetical protein ZEAMMB73_782285              143   2e-38   
ref|XP_009366621.1|  PREDICTED: LOW QUALITY PROTEIN: probable pro...    144   2e-38   Pyrus x bretschneideri [bai li]
ref|XP_004240115.1|  PREDICTED: probable protein S-acyltransferas...    144   2e-38   Solanum lycopersicum
ref|XP_011039088.1|  PREDICTED: probable protein S-acyltransferas...    144   2e-38   Populus euphratica
dbj|BAK01014.1|  predicted protein                                      144   2e-38   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_004957652.1|  PREDICTED: probable S-acyltransferase At4g00...    143   4e-38   Setaria italica
ref|XP_002872926.1|  zinc ion binding protein                           143   4e-38   Arabidopsis lyrata subsp. lyrata
gb|KJB09590.1|  hypothetical protein B456_001G151300                    141   5e-38   Gossypium raimondii
emb|CDX74374.1|  BnaA03g26730D                                          142   6e-38   
ref|XP_010428132.1|  PREDICTED: probable protein S-acyltransferas...    142   8e-38   Camelina sativa [gold-of-pleasure]
emb|CBI25933.3|  unnamed protein product                                139   1e-37   Vitis vinifera
ref|XP_010691320.1|  PREDICTED: probable protein S-acyltransferas...    142   1e-37   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_006396329.1|  hypothetical protein EUTSA_v10028856mg             142   1e-37   Eutrema salsugineum [saltwater cress]
ref|XP_007218830.1|  hypothetical protein PRUPE_ppa010169mg             140   2e-37   
ref|XP_009134494.1|  PREDICTED: probable protein S-acyltransferas...    141   2e-37   Brassica rapa
ref|XP_010054971.1|  PREDICTED: probable protein S-acyltransferas...    140   5e-37   Eucalyptus grandis [rose gum]
gb|KFK30666.1|  hypothetical protein AALP_AA6G012100                    139   1e-36   Arabis alpina [alpine rockcress]
ref|XP_011082342.1|  PREDICTED: probable protein S-acyltransferas...    139   1e-36   Sesamum indicum [beniseed]
ref|XP_010238650.1|  PREDICTED: probable protein S-acyltransferas...    139   2e-36   
ref|XP_001419536.1|  predicted protein                                  139   3e-36   Ostreococcus lucimarinus CCE9901
emb|CAA16560.1|  predicted protein                                      143   5e-36   Arabidopsis thaliana [mouse-ear cress]
gb|KJB09588.1|  hypothetical protein B456_001G151300                    135   8e-36   Gossypium raimondii
emb|CDY07150.1|  BnaCnng01650D                                          137   8e-36   
ref|XP_010919145.1|  PREDICTED: probable protein S-acyltransferas...    137   1e-35   
emb|CDP08628.1|  unnamed protein product                                134   1e-35   Coffea canephora [robusta coffee]
gb|KDO86584.1|  hypothetical protein CISIN_1g021385mg                   135   2e-35   Citrus sinensis [apfelsine]
gb|KDO86583.1|  hypothetical protein CISIN_1g021385mg                   136   3e-35   Citrus sinensis [apfelsine]
ref|XP_006288365.1|  hypothetical protein CARUB_v10001614mg             133   4e-35   
emb|CDY51717.1|  BnaA09g52040D                                          135   4e-35   Brassica napus [oilseed rape]
ref|XP_009111388.1|  PREDICTED: LOW QUALITY PROTEIN: probable pro...    135   5e-35   Brassica rapa
gb|KDO86582.1|  hypothetical protein CISIN_1g021385mg                   135   6e-35   Citrus sinensis [apfelsine]
ref|XP_006491350.1|  PREDICTED: LOW QUALITY PROTEIN: probable pro...    135   6e-35   
gb|KCW73003.1|  hypothetical protein EUGRSUZ_E01439                     130   1e-34   Eucalyptus grandis [rose gum]
ref|XP_002320223.1|  hypothetical protein POPTR_0014s09980g             134   2e-34   
ref|XP_011082343.1|  PREDICTED: probable protein S-acyltransferas...    132   4e-34   
gb|KDP28430.1|  hypothetical protein JCGZ_14201                         132   7e-34   Jatropha curcas
gb|KCW71456.1|  hypothetical protein EUGRSUZ_E00018                     130   7e-34   Eucalyptus grandis [rose gum]
ref|XP_008779824.1|  PREDICTED: probable protein S-acyltransferas...    133   7e-34   Phoenix dactylifera
ref|XP_011082344.1|  PREDICTED: probable protein S-acyltransferas...    130   1e-33   
emb|CDX91862.1|  BnaC03g31640D                                          131   1e-33   
ref|XP_009607103.1|  PREDICTED: probable protein S-acyltransferas...    130   2e-33   
ref|XP_004167123.1|  PREDICTED: probable S-acyltransferase At4g00...    130   3e-33   
ref|XP_009775888.1|  PREDICTED: probable protein S-acyltransferas...    127   3e-33   Nicotiana sylvestris
ref|XP_002529972.1|  zinc finger protein, putative                      128   4e-33   
ref|XP_004133790.1|  PREDICTED: probable S-acyltransferase At4g00...    130   4e-33   Cucumis sativus [cucumbers]
ref|XP_008437841.1|  PREDICTED: probable protein S-acyltransferas...    129   1e-32   Cucumis melo [Oriental melon]
ref|NP_001059593.2|  Os07g0467800                                       126   1e-32   
gb|EYU32291.1|  hypothetical protein MIMGU_mgv1a010611mg                128   2e-32   Erythranthe guttata [common monkey flower]
ref|XP_008437835.1|  PREDICTED: probable protein S-acyltransferas...    128   3e-32   
ref|XP_003626591.1|  Palmitoyltransferase PFA4                          127   4e-32   Medicago truncatula
ref|XP_010556619.1|  PREDICTED: probable protein S-acyltransferas...    127   4e-32   Tarenaya hassleriana [spider flower]
ref|XP_003056659.1|  predicted protein                                  128   5e-32   Micromonas pusilla CCMP1545
ref|XP_011029093.1|  PREDICTED: probable protein S-acyltransferas...    125   1e-31   Populus euphratica
ref|XP_007510851.1|  predicted protein                                  128   1e-31   Bathycoccus prasinos
gb|KJB49336.1|  hypothetical protein B456_008G114100                    124   2e-31   Gossypium raimondii
emb|CEF99024.1|  Zinc finger, DHHC-type, palmitoyltransferase           125   5e-31   Ostreococcus tauri
ref|XP_004494854.1|  PREDICTED: probable S-acyltransferase At4g00...    125   6e-31   
gb|KEH24697.1|  DHHC-type zinc finger protein                           122   8e-31   Medicago truncatula
ref|XP_007147347.1|  hypothetical protein PHAVU_006G116400g             123   2e-30   Phaseolus vulgaris [French bean]
ref|XP_003081166.1|  DHHC-type Zn-finger proteins (ISS)                 124   2e-30   
ref|NP_001132254.1|  hypothetical protein                               119   3e-30   
ref|XP_006444755.1|  hypothetical protein CICLE_v10021463mg             122   3e-30   
emb|CCW28739.1|  putative zinc finger containing protein                124   4e-30   Arachis duranensis
ref|XP_006444753.1|  hypothetical protein CICLE_v10021463mg             121   6e-30   
ref|XP_006444754.1|  hypothetical protein CICLE_v10021463mg             119   6e-30   
ref|XP_006444756.1|  hypothetical protein CICLE_v10021463mg             121   7e-30   
gb|AAB62854.1|  A_TM018A10.8 gene product                               119   2e-29   Arabidopsis thaliana [mouse-ear cress]
emb|CBI29012.3|  unnamed protein product                                115   6e-29   Vitis vinifera
ref|XP_009775889.1|  PREDICTED: probable protein S-acyltransferas...    113   4e-28   Nicotiana sylvestris
ref|XP_007147348.1|  hypothetical protein PHAVU_006G116400g             114   4e-28   Phaseolus vulgaris [French bean]
ref|XP_002955185.1|  hypothetical protein VOLCADRAFT_83102              113   1e-26   Volvox carteri f. nagariensis
ref|XP_005647462.1|  zf-DHHC-domain-containing protein                  110   1e-25   Coccomyxa subellipsoidea C-169
ref|XP_001946472.2|  PREDICTED: palmitoyltransferase ZDHHC15-like...    108   8e-25   Acyrthosiphon pisum
ref|XP_008183299.1|  PREDICTED: palmitoyltransferase ZDHHC15-like...    107   1e-24   Acyrthosiphon pisum
ref|XP_008183297.1|  PREDICTED: palmitoyltransferase ZDHHC15-like...    108   1e-24   
ref|XP_008183298.1|  PREDICTED: palmitoyltransferase ZDHHC15-like...    107   2e-24   
ref|XP_001694595.1|  predicted protein                                  107   2e-24   
ref|XP_011402359.1|  putative protein S-acyltransferase 14              106   4e-24   
gb|KJA28514.1|  hypothetical protein HYPSUDRAFT_129104                  107   5e-24   
ref|XP_011196584.1|  PREDICTED: palmitoyltransferase ZDHHC15 isof...    105   7e-24   
ref|XP_011196582.1|  PREDICTED: palmitoyltransferase ZDHHC15 isof...    105   9e-24   
ref|XP_011196580.1|  PREDICTED: palmitoyltransferase ZDHHC15 isof...    105   9e-24   
ref|XP_011196583.1|  PREDICTED: palmitoyltransferase ZDHHC15 isof...    105   1e-23   
ref|XP_011196585.1|  PREDICTED: palmitoyltransferase ZDHHC15 isof...    105   1e-23   
ref|XP_001654678.1|  AAEL010581-PA                                      105   1e-23   
ref|XP_004521126.1|  PREDICTED: LOW QUALITY PROTEIN: palmitoyltra...    104   2e-23   
ref|XP_003521821.1|  PREDICTED: probable protein S-acyltransferas...    104   2e-23   
gb|KFB48082.1|  AGAP004938-PA-like protein                              104   3e-23   
ref|XP_011209774.1|  PREDICTED: palmitoyltransferase ZDHHC15 isof...    103   3e-23   
ref|XP_011209770.1|  PREDICTED: palmitoyltransferase ZDHHC15 isof...    104   4e-23   
ref|XP_011209771.1|  PREDICTED: palmitoyltransferase ZDHHC15 isof...    104   4e-23   
ref|XP_011209772.1|  PREDICTED: palmitoyltransferase ZDHHC15 isof...    103   4e-23   
ref|XP_011209773.1|  PREDICTED: palmitoyltransferase ZDHHC15 isof...    103   5e-23   
ref|XP_011209775.1|  PREDICTED: palmitoyltransferase ZDHHC15 isof...    103   5e-23   
ref|XP_001846318.1|  zinc finger protein                                103   1e-22   
ref|XP_007391026.1|  hypothetical protein PHACADRAFT_84866              102   1e-22   
gb|EFN88907.1|  Palmitoyltransferase ZDHHC2                             102   1e-22   
ref|XP_011148506.1|  PREDICTED: palmitoyltransferase ZDHHC2 isofo...    102   1e-22   
ref|XP_011148524.1|  PREDICTED: palmitoyltransferase ZDHHC2 isofo...    102   1e-22   
ref|XP_011148491.1|  PREDICTED: palmitoyltransferase ZDHHC15 isof...    102   1e-22   
gb|KIP11142.1|  hypothetical protein PHLGIDRAFT_125039                  102   2e-22   
ref|XP_011148499.1|  PREDICTED: palmitoyltransferase ZDHHC15 isof...    102   2e-22   
ref|XP_011335755.1|  PREDICTED: palmitoyltransferase ZDHHC2 isofo...    102   2e-22   
ref|XP_011148474.1|  PREDICTED: palmitoyltransferase ZDHHC15 isof...    102   2e-22   
ref|XP_011335756.1|  PREDICTED: palmitoyltransferase ZDHHC2 isofo...    101   2e-22   
ref|XP_011335758.1|  PREDICTED: palmitoyltransferase ZDHHC2 isofo...    101   2e-22   
ref|XP_011335752.1|  PREDICTED: palmitoyltransferase ZDHHC15 isof...    101   2e-22   
ref|XP_011148482.1|  PREDICTED: palmitoyltransferase ZDHHC15 isof...    101   2e-22   
ref|XP_011148457.1|  PREDICTED: palmitoyltransferase ZDHHC15 isof...    101   2e-22   
ref|XP_009384072.1|  PREDICTED: probable protein S-acyltransferas...    100   2e-22   
ref|XP_005845554.1|  hypothetical protein CHLNCDRAFT_136705             101   3e-22   
gb|EFZ20798.1|  hypothetical protein SINV_04370                         100   3e-22   
ref|XP_007378834.1|  zf-DHHC-domain-containing protein                  100   3e-22   
ref|XP_011148466.1|  PREDICTED: palmitoyltransferase ZDHHC15 isof...    101   3e-22   
ref|XP_011335753.1|  PREDICTED: palmitoyltransferase ZDHHC2 isofo...    101   3e-22   
ref|XP_011335757.1|  PREDICTED: palmitoyltransferase ZDHHC2 isofo...    100   3e-22   
ref|XP_011155434.1|  PREDICTED: palmitoyltransferase ZDHHC2             100   3e-22   
gb|EFX88381.1|  hypothetical protein DAPPUDRAFT_311398                  101   3e-22   
gb|EJY73117.1|  DHHC zinc finger domain containing protein              100   4e-22   
ref|XP_011335754.1|  PREDICTED: palmitoyltransferase ZDHHC2 isofo...    100   4e-22   
ref|XP_009541091.1|  hypothetical protein HETIRDRAFT_166687             100   4e-22   
ref|XP_011335751.1|  PREDICTED: palmitoyltransferase ZDHHC15 isof...    100   5e-22   
ref|XP_315027.4|  AGAP004938-PA                                         100   5e-22   
ref|XP_011335750.1|  PREDICTED: palmitoyltransferase ZDHHC15 isof...    100   6e-22   
gb|KIM47503.1|  hypothetical protein M413DRAFT_62143                    101   7e-22   
gb|KDR85697.1|  hypothetical protein GALMADRAFT_53290                   100   7e-22   
ref|XP_011290230.1|  PREDICTED: palmitoyltransferase ZDHHC15 isof...    100   7e-22   
gb|KDQ15704.1|  hypothetical protein BOTBODRAFT_285774                  102   7e-22   
ref|XP_011290229.1|  PREDICTED: palmitoyltransferase ZDHHC15 isof...    100   9e-22   
gb|KIJ53486.1|  hypothetical protein M422DRAFT_154773                   100   2e-21   
gb|KIM31573.1|  hypothetical protein M408DRAFT_64111                  99.4    2e-21   
ref|XP_011019840.1|  PREDICTED: probable protein S-acyltransferas...  97.8    2e-21   
gb|KDR23346.1|  Palmitoyltransferase ZDHHC2                           99.0    2e-21   
ref|XP_011055513.1|  PREDICTED: palmitoyltransferase ZDHHC2 isofo...  98.6    2e-21   
ref|XP_009526359.1|  hypothetical protein PHYSODRAFT_331293           98.6    2e-21   
emb|CDP06594.1|  unnamed protein product                              98.2    2e-21   
ref|XP_002309068.1|  zinc finger family protein                       98.2    2e-21   
ref|XP_002931837.1|  PREDICTED: palmitoyltransferase ZDHHC15 isof...  98.6    2e-21   
emb|CDY44698.1|  BnaA05g29080D                                        96.7    2e-21   
gb|KII93606.1|  hypothetical protein PLICRDRAFT_100276                99.8    2e-21   
ref|XP_007252360.1|  PREDICTED: probable palmitoyltransferase ZDH...  99.0    2e-21   
ref|XP_011055511.1|  PREDICTED: palmitoyltransferase ZDHHC2 isofo...  98.6    2e-21   
ref|XP_007271137.1|  zf-DHHC-domain-containing protein                98.6    2e-21   
ref|XP_011055506.1|  PREDICTED: palmitoyltransferase ZDHHC15 isof...  98.6    2e-21   
emb|CBK23342.2|  unnamed protein product                              97.1    2e-21   
ref|XP_011055512.1|  PREDICTED: palmitoyltransferase ZDHHC2 isofo...  98.6    3e-21   
emb|CCF53550.1|  related to PFA4-Palmitoyltransferase (N-terminal...    100   3e-21   
ref|XP_011019839.1|  PREDICTED: probable protein S-acyltransferas...  98.2    3e-21   
gb|KIM23222.1|  hypothetical protein M408DRAFT_77784                  98.2    3e-21   
ref|XP_011055510.1|  PREDICTED: palmitoyltransferase ZDHHC2 isofo...  98.2    3e-21   
ref|XP_001900929.1|  Zinc finger DHHC domain containing protein 2     98.2    3e-21   
ref|XP_001341243.3|  PREDICTED: probable palmitoyltransferase ZDH...  98.6    3e-21   
ref|XP_011055508.1|  PREDICTED: palmitoyltransferase ZDHHC2 isofo...  98.2    3e-21   
gb|KIW03977.1|  hypothetical protein PV09_04810                       99.0    3e-21   
ref|XP_008032452.1|  palmitoyltransferase PFA4                        99.0    3e-21   
ref|XP_011253754.1|  PREDICTED: palmitoyltransferase ZDHHC2 isofo...  97.8    3e-21   
ref|XP_007337392.1|  zf-DHHC-domain-containing protein                99.0    4e-21   
ref|XP_011055509.1|  PREDICTED: palmitoyltransferase ZDHHC2 isofo...  97.8    4e-21   
emb|CDY41618.1|  BnaC05g43550D                                        97.4    4e-21   
ref|XP_011253749.1|  PREDICTED: palmitoyltransferase ZDHHC15 isof...  97.8    5e-21   
emb|CBQ71848.1|  related to PFA4-Palmitoyltransferase                 99.8    5e-21   
ref|XP_011055502.1|  PREDICTED: palmitoyltransferase ZDHHC15 isof...  97.8    5e-21   
ref|XP_011055505.1|  PREDICTED: palmitoyltransferase ZDHHC15 isof...  97.8    5e-21   
ref|XP_011253753.1|  PREDICTED: palmitoyltransferase ZDHHC2 isofo...  97.4    5e-21   
ref|XP_011055507.1|  PREDICTED: palmitoyltransferase ZDHHC15 isof...  97.8    5e-21   
ref|XP_011253750.1|  PREDICTED: palmitoyltransferase ZDHHC2 isofo...  97.8    5e-21   
gb|KFV97983.1|  Palmitoyltransferase ZDHHC2                           95.5    5e-21   
ref|XP_011055503.1|  PREDICTED: palmitoyltransferase ZDHHC15 isof...  97.8    6e-21   
emb|CDY07918.1|  BnaC03g36050D                                        97.1    6e-21   
ref|XP_011253752.1|  PREDICTED: palmitoyltransferase ZDHHC2 isofo...  97.4    6e-21   
ref|NP_001089258.1|  palmitoyltransferase ZDHHC15                     97.4    7e-21   
ref|XP_007307660.1|  zf-DHHC-domain-containing protein                97.1    7e-21   
ref|XP_011253747.1|  PREDICTED: palmitoyltransferase ZDHHC15 isof...  97.4    8e-21   
gb|KFP77504.1|  putative palmitoyltransferase ZDHHC20                 97.1    8e-21   
ref|XP_011253748.1|  PREDICTED: palmitoyltransferase ZDHHC15 isof...  97.1    8e-21   
ref|XP_010047860.1|  PREDICTED: probable protein S-acyltransferas...  96.7    8e-21   
ref|XP_010047851.1|  PREDICTED: probable protein S-acyltransferas...  97.1    8e-21   
gb|KFP20998.1|  putative palmitoyltransferase ZDHHC20                 97.1    9e-21   
emb|CBN81884.1|  Probable palmitoyltransferase ZDHHC20                97.1    9e-21   
dbj|BAM20685.1|  zinc finger protein                                  96.7    9e-21   
ref|XP_009135059.1|  PREDICTED: probable protein S-acyltransferas...  96.7    9e-21   
emb|CDX73971.1|  BnaA03g30760D                                        96.7    9e-21   
gb|KIK49477.1|  hypothetical protein CY34DRAFT_796883                 96.7    1e-20   
ref|XP_003306434.1|  hypothetical protein PTT_19576                   99.0    1e-20   
ref|XP_002501627.1|  predicted protein                                97.1    1e-20   
ref|XP_002531563.1|  zinc finger protein, putative                    96.3    1e-20   
ref|XP_003402132.1|  PREDICTED: palmitoyltransferase ZDHHC2-like ...  96.7    1e-20   
ref|XP_003402134.1|  PREDICTED: palmitoyltransferase ZDHHC2-like ...  96.7    1e-20   
ref|XP_008546169.1|  PREDICTED: palmitoyltransferase ZDHHC2 isofo...  96.3    1e-20   
ref|XP_008546163.1|  PREDICTED: palmitoyltransferase ZDHHC15 isof...  96.7    1e-20   
ref|XP_010471590.1|  PREDICTED: probable protein S-acyltransferas...  95.9    1e-20   
ref|NP_724869.2|  CG1407, isoform C                                   95.5    1e-20   
ref|XP_008778963.1|  PREDICTED: probable protein S-acyltransferas...  96.3    1e-20   
ref|XP_008546167.1|  PREDICTED: palmitoyltransferase ZDHHC2 isofo...  96.3    1e-20   
ref|XP_007682462.1|  hypothetical protein COCMIDRAFT_80113            98.6    1e-20   
ref|XP_008546166.1|  PREDICTED: palmitoyltransferase ZDHHC2 isofo...  96.3    1e-20   
ref|XP_003489535.1|  PREDICTED: palmitoyltransferase ZDHHC2-like      96.7    1e-20   
ref|XP_003764500.1|  PREDICTED: probable palmitoyltransferase ZDH...  96.3    1e-20   
emb|CDS04752.1|  hypothetical protein LRAMOSA07282                    98.2    1e-20   
emb|CEI98862.1|  Putative Palmitoyltransferase                        96.3    2e-20   
ref|XP_006620545.1|  PREDICTED: palmitoyltransferase ZDHHC15-like...  96.3    2e-20   
ref|XP_001940366.1|  palmitoyltransferase PFA3                        99.0    2e-20   
ref|XP_008546168.1|  PREDICTED: palmitoyltransferase ZDHHC2 isofo...  95.9    2e-20   
ref|XP_002884727.1|  zinc finger family protein                       95.9    2e-20   
ref|XP_006988499.1|  PREDICTED: probable palmitoyltransferase ZDH...  96.3    2e-20   
ref|XP_006561434.1|  PREDICTED: palmitoyltransferase ZDHHC15 isof...  96.3    2e-20   
ref|XP_006620540.1|  PREDICTED: palmitoyltransferase ZDHHC15-like...  96.3    2e-20   
ref|XP_006561438.1|  PREDICTED: palmitoyltransferase ZDHHC15 isof...  95.9    2e-20   
emb|CDH50042.1|  zf-dhhc-domain-containing protein                    98.2    2e-20   
gb|KFU89295.1|  Palmitoyltransferase ZDHHC15                          95.9    2e-20   
gb|KIY73495.1|  zf-DHHC-domain-containing protein                     96.7    2e-20   
ref|XP_006407688.1|  hypothetical protein EUTSA_v10021264mg           95.9    2e-20   
ref|XP_005162815.1|  PREDICTED: probable palmitoyltransferase ZDH...  96.7    2e-20   
ref|XP_006561436.1|  PREDICTED: palmitoyltransferase ZDHHC15 isof...  95.9    2e-20   
ref|XP_002063518.1|  GK21953                                          96.3    2e-20   
emb|CEG78791.1|  hypothetical protein RMATCC62417_13343               96.3    2e-20   
ref|XP_008546164.1|  PREDICTED: palmitoyltransferase ZDHHC2 isofo...  95.9    2e-20   
ref|XP_010464573.1|  PREDICTED: probable protein S-acyltransferas...  95.5    2e-20   
ref|XP_006561437.1|  PREDICTED: palmitoyltransferase ZDHHC15 isof...  95.9    2e-20   
ref|XP_006561433.1|  PREDICTED: palmitoyltransferase ZDHHC15 isof...  95.9    2e-20   
gb|EMD90620.1|  hypothetical protein COCHEDRAFT_1195792               98.2    2e-20   
ref|NP_001260843.1|  CG1407, isoform D                                95.9    2e-20   
ref|XP_007252359.1|  PREDICTED: probable palmitoyltransferase ZDH...  96.3    2e-20   
ref|NP_083768.4|  probable palmitoyltransferase ZDHHC20               95.9    2e-20   
gb|AAI27441.1|  Zdhhc20 protein                                       95.9    2e-20   
gb|EDL36160.1|  zinc finger, DHHC domain containing 20, isoform C...  95.9    2e-20   
ref|XP_002412002.1|  zinc finger protein, putative                    95.9    2e-20   
gb|KFK38323.1|  hypothetical protein AALP_AA3G098900                  95.5    2e-20   
dbj|BAB30620.1|  unnamed protein product                              95.9    2e-20   
gb|KIL71551.1|  hypothetical protein M378DRAFT_19864                  95.9    2e-20   
ref|XP_002016305.1|  GL11511                                          95.9    2e-20   
ref|XP_003402133.1|  PREDICTED: palmitoyltransferase ZDHHC2-like ...  95.9    2e-20   
ref|XP_009995547.1|  PREDICTED: palmitoyltransferase ZDHHC15          95.9    2e-20   
ref|NP_610544.1|  CG1407, isoform B                                   95.9    3e-20   
gb|KFW85870.1|  Palmitoyltransferase ZDHHC15                          95.1    3e-20   
ref|XP_007662307.1|  PREDICTED: probable palmitoyltransferase ZDH...  95.9    3e-20   
ref|XP_003697900.1|  PREDICTED: palmitoyltransferase ZDHHC15-like     96.3    3e-20   
ref|XP_004514129.1|  PREDICTED: probable S-acyltransferase At3g09...  95.5    3e-20   
emb|CAN81951.1|  hypothetical protein VITISV_002072                   95.9    3e-20   
ref|XP_006620541.1|  PREDICTED: palmitoyltransferase ZDHHC15-like...  95.5    3e-20   
ref|NP_001034425.1|  probable palmitoyltransferase ZDHHC20            95.5    3e-20   
ref|XP_006561431.1|  PREDICTED: palmitoyltransferase ZDHHC15 isof...  95.5    3e-20   
ref|XP_005355480.1|  PREDICTED: probable palmitoyltransferase ZDH...  95.5    3e-20   
ref|XP_006620539.1|  PREDICTED: palmitoyltransferase ZDHHC15-like...  95.5    3e-20   
ref|XP_006561432.1|  PREDICTED: palmitoyltransferase ZDHHC15 isof...  95.5    3e-20   
gb|KIW83345.1|  hypothetical protein Z517_02590                       96.3    3e-20   
gb|KFP73662.1|  Palmitoyltransferase ZDHHC15                          92.4    3e-20   
ref|XP_005355479.1|  PREDICTED: probable palmitoyltransferase ZDH...  95.5    3e-20   
gb|KIK07277.1|  hypothetical protein K443DRAFT_87649                  95.1    3e-20   
ref|XP_007737611.1|  hypothetical protein A1O3_09327                  96.3    3e-20   
gb|KFV09957.1|  putative palmitoyltransferase ZDHHC20                 95.1    4e-20   
ref|XP_010521600.1|  PREDICTED: probable protein S-acyltransferas...  94.7    4e-20   
ref|XP_009888922.1|  PREDICTED: probable palmitoyltransferase ZDH...  95.1    4e-20   
ref|XP_008442531.1|  PREDICTED: probable protein S-acyltransferas...  94.4    4e-20   
gb|KIZ07589.1|  hypothetical protein MNEG_0358                        95.1    4e-20   
gb|KDN49126.1|  hypothetical protein RSAG8_02479                      96.3    4e-20   
gb|KGL97765.1|  putative palmitoyltransferase ZDHHC20                 95.1    4e-20   
ref|XP_005827874.1|  hypothetical protein GUITHDRAFT_142504           95.1    4e-20   
sp|Q5Y5T1.1|ZDH20_MOUSE  RecName: Full=Probable palmitoyltransfer...  95.5    4e-20   
ref|XP_006519727.1|  PREDICTED: probable palmitoyltransferase ZDH...  95.9    4e-20   
ref|XP_007860865.1|  zf-DHHC-domain-containing protein                96.3    4e-20   
ref|XP_009877265.1|  PREDICTED: palmitoyltransferase ZDHHC15-like     92.4    4e-20   
ref|XP_003705399.1|  PREDICTED: palmitoyltransferase ZDHHC2-like      95.1    4e-20   
ref|XP_010153009.1|  PREDICTED: probable palmitoyltransferase ZDH...  92.8    4e-20   
ref|XP_008475268.1|  PREDICTED: palmitoyltransferase ZDHHC15          95.1    4e-20   
emb|CDY44696.1|  BnaA05g29100D                                        94.7    5e-20   
emb|CEG81496.1|  Putative Palmitoyltransferase                        95.5    5e-20   
gb|KFO61100.1|  Palmitoyltransferase ZDHHC15                          94.4    5e-20   
ref|XP_003477288.2|  PREDICTED: probable palmitoyltransferase ZDH...  94.7    5e-20   
gb|KFQ63122.1|  putative palmitoyltransferase ZDHHC20                 94.7    5e-20   
ref|XP_010922288.1|  PREDICTED: probable protein S-acyltransferas...  94.7    5e-20   
ref|XP_005075358.1|  PREDICTED: probable palmitoyltransferase ZDH...  95.1    5e-20   
dbj|BAE41590.1|  unnamed protein product                              95.1    5e-20   
ref|XP_009558268.1|  PREDICTED: palmitoyltransferase ZDHHC15          94.7    5e-20   
ref|XP_009146937.1|  PREDICTED: probable protein S-acyltransferas...  94.7    5e-20   
gb|KFQ21151.1|  Palmitoyltransferase ZDHHC15                          94.0    5e-20   
ref|XP_005075359.1|  PREDICTED: probable palmitoyltransferase ZDH...  94.7    5e-20   
emb|CEG73937.1|  Putative Palmitoyltransferase                        95.1    5e-20   
ref|XP_007849787.1|  palmitoyltransferase pfa4                        95.5    5e-20   
gb|KFZ68756.1|  putative palmitoyltransferase ZDHHC20                 94.7    5e-20   
ref|XP_008442530.1|  PREDICTED: probable protein S-acyltransferas...  94.4    5e-20   
gb|KGL82821.1|  Palmitoyltransferase ZDHHC15                          94.4    5e-20   
ref|XP_002195966.2|  PREDICTED: palmitoyltransferase ZDHHC15          95.1    5e-20   
ref|XP_010713660.1|  PREDICTED: palmitoyltransferase ZDHHC15          94.7    5e-20   
gb|ERZ99152.1|  hypothetical protein GLOINDRAFT_70082                 94.4    5e-20   
gb|KFW75463.1|  putative palmitoyltransferase ZDHHC20                 94.7    6e-20   
gb|ENN74284.1|  hypothetical protein YQE_09256                        94.7    6e-20   
gb|KIJ66242.1|  hypothetical protein HYDPIDRAFT_86668                 95.9    6e-20   
ref|XP_009683733.1|  PREDICTED: palmitoyltransferase ZDHHC15          94.4    6e-20   
ref|XP_010221044.1|  PREDICTED: palmitoyltransferase ZDHHC15          95.1    6e-20   
gb|EMC80458.1|  putative palmitoyltransferase ZDHHC20                 94.7    6e-20   
ref|XP_004137935.1|  PREDICTED: probable S-acyltransferase At3g09...  94.4    6e-20   
ref|XP_001873429.1|  predicted protein                                94.4    6e-20   
ref|XP_005338665.1|  PREDICTED: probable palmitoyltransferase ZDH...  94.7    6e-20   
emb|CDY44697.1|  BnaA05g29090D                                        94.4    6e-20   



>ref|XP_006347869.1| PREDICTED: probable protein S-acyltransferase 14-like [Solanum 
tuberosum]
Length=309

 Score =   239 bits (610),  Expect = 4e-75, Method: Compositional matrix adjust.
 Identities = 150/175 (86%), Positives = 160/175 (91%), Gaps = 0/175 (0%)
 Frame = +1

Query  1    FYCLLVMLLWSYFSVVFTDPGSVPPNWKPASDEERGDTDPLTASEFGSLPPDTAQSRIRF  180
            F+CLLVMLLWSYFSVVFTDPGSVPPNWKP  DEER DTDPLTASEFG+ P D+   R+RF
Sbjct  69   FHCLLVMLLWSYFSVVFTDPGSVPPNWKPDLDEERDDTDPLTASEFGASPADSTNPRVRF  128

Query  181  CKKCNQLKPPRCHHCSVCGRCVLKMDHHCVWVVNCVGALNYKYfllflfytflettlvtl  360
            CKKCNQLKPPRCHHCSVCGRCVLKMDHHCVWVVNCVGALNYKYFLLFLFYTFLETT+VTL
Sbjct  129  CKKCNQLKPPRCHHCSVCGRCVLKMDHHCVWVVNCVGALNYKYFLLFLFYTFLETTVVTL  188

Query  361  SLLPNFLAFFGDVDIPGSAGDlattflafvlnlafalsvlGFLIMHISLVSRNTT  525
            +LLP F+AFF D +IPG+ G LATTFLAFV NLAFALSVLGFLIMHISLV+ NTT
Sbjct  189  ALLPQFIAFFSDGEIPGTPGTLATTFLAFVFNLAFALSVLGFLIMHISLVAGNTT  243



>ref|XP_010325709.1| PREDICTED: probable protein S-acyltransferase 14 [Solanum lycopersicum]
Length=309

 Score =   238 bits (608),  Expect = 8e-75, Method: Compositional matrix adjust.
 Identities = 150/175 (86%), Positives = 159/175 (91%), Gaps = 0/175 (0%)
 Frame = +1

Query  1    FYCLLVMLLWSYFSVVFTDPGSVPPNWKPASDEERGDTDPLTASEFGSLPPDTAQSRIRF  180
            F+CLLVMLLWSYFSVVFTDPGSVPPNWKP  DEER DTDPLT SEFG+ P D+   R+RF
Sbjct  69   FHCLLVMLLWSYFSVVFTDPGSVPPNWKPDLDEERSDTDPLTTSEFGASPADSTNPRVRF  128

Query  181  CKKCNQLKPPRCHHCSVCGRCVLKMDHHCVWVVNCVGALNYKYfllflfytflettlvtl  360
            CKKCNQLKPPRCHHCSVCGRCVLKMDHHCVWVVNCVGALNYKYFLLFLFYTFLETTLVTL
Sbjct  129  CKKCNQLKPPRCHHCSVCGRCVLKMDHHCVWVVNCVGALNYKYFLLFLFYTFLETTLVTL  188

Query  361  SLLPNFLAFFGDVDIPGSAGDlattflafvlnlafalsvlGFLIMHISLVSRNTT  525
            +LLP F+AFF D +IPG+ G LATTFLAFV NLAFALSVLGFLIMHISLV+ NTT
Sbjct  189  ALLPQFIAFFSDGEIPGTPGTLATTFLAFVFNLAFALSVLGFLIMHISLVAGNTT  243



>ref|XP_004248564.1| PREDICTED: probable protein S-acyltransferase 14 [Solanum lycopersicum]
Length=308

 Score =   238 bits (606),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 150/175 (86%), Positives = 160/175 (91%), Gaps = 0/175 (0%)
 Frame = +1

Query  1    FYCLLVMLLWSYFSVVFTDPGSVPPNWKPASDEERGDTDPLTASEFGSLPPDTAQSRIRF  180
            F+CLLVMLLW YFSVVFTDPGSVPPNW+P  DEERG+TDPLT SEFG+ P D+   RIRF
Sbjct  69   FHCLLVMLLWCYFSVVFTDPGSVPPNWRPELDEERGETDPLTTSEFGASPADSGNPRIRF  128

Query  181  CKKCNQLKPPRCHHCSVCGRCVLKMDHHCVWVVNCVGALNYKYfllflfytflettlvtl  360
            C+KCNQLKPPRCHHCSVCGRCVLKMDHHCVWVVNCVGALNYKYFLLFLFYTFLETT+VTL
Sbjct  129  CRKCNQLKPPRCHHCSVCGRCVLKMDHHCVWVVNCVGALNYKYFLLFLFYTFLETTVVTL  188

Query  361  SLLPNFLAFFGDVDIPGSAGDlattflafvlnlafalsvlGFLIMHISLVSRNTT  525
            SLLP F+AFF D +IPG+ G LATTFLAFVLNLAFALSVLGFLIMHISLVS NTT
Sbjct  189  SLLPQFIAFFSDGEIPGTPGTLATTFLAFVLNLAFALSVLGFLIMHISLVSGNTT  243



>ref|XP_006364242.1| PREDICTED: probable protein S-acyltransferase 14-like [Solanum 
tuberosum]
Length=308

 Score =   236 bits (602),  Expect = 5e-74, Method: Compositional matrix adjust.
 Identities = 148/175 (85%), Positives = 160/175 (91%), Gaps = 0/175 (0%)
 Frame = +1

Query  1    FYCLLVMLLWSYFSVVFTDPGSVPPNWKPASDEERGDTDPLTASEFGSLPPDTAQSRIRF  180
            F+CLLVMLLW YFSVVFTDPGSVPPNW+P  DEERG+ DPLT SEFG+ P D+  +RIRF
Sbjct  69   FHCLLVMLLWCYFSVVFTDPGSVPPNWRPELDEERGEADPLTTSEFGASPADSGNTRIRF  128

Query  181  CKKCNQLKPPRCHHCSVCGRCVLKMDHHCVWVVNCVGALNYKYfllflfytflettlvtl  360
            C+KCNQLKPPRCHHCSVCGRCVLKMDHHCVWVVNCVGALNYKYFLLFLFYTFLETT+VTL
Sbjct  129  CRKCNQLKPPRCHHCSVCGRCVLKMDHHCVWVVNCVGALNYKYFLLFLFYTFLETTVVTL  188

Query  361  SLLPNFLAFFGDVDIPGSAGDlattflafvlnlafalsvlGFLIMHISLVSRNTT  525
            SLLP F+AFF D +IPG+ G LATTFLAFVLNLAFALSVLGFLIMH+SLVS NTT
Sbjct  189  SLLPQFIAFFSDGEIPGTPGTLATTFLAFVLNLAFALSVLGFLIMHMSLVSGNTT  243



>ref|XP_009610572.1| PREDICTED: probable protein S-acyltransferase 14 [Nicotiana tomentosiformis]
Length=308

 Score =   236 bits (601),  Expect = 9e-74, Method: Compositional matrix adjust.
 Identities = 148/175 (85%), Positives = 160/175 (91%), Gaps = 0/175 (0%)
 Frame = +1

Query  1    FYCLLVMLLWSYFSVVFTDPGSVPPNWKPASDEERGDTDPLTASEFGSLPPDTAQSRIRF  180
            F+CLL+MLLW YFSVVFTDPGSVPPNW+P  DEERG+ DPLTASEFG+ P D+   RIRF
Sbjct  69   FHCLLLMLLWCYFSVVFTDPGSVPPNWRPELDEERGEADPLTASEFGASPADSGNPRIRF  128

Query  181  CKKCNQLKPPRCHHCSVCGRCVLKMDHHCVWVVNCVGALNYKYfllflfytflettlvtl  360
            C+KCNQLKPPRCHHCSVCGRCVLKMDHHCVWVVNCVGALNYKYFLLFLFYTFLETT+VTL
Sbjct  129  CRKCNQLKPPRCHHCSVCGRCVLKMDHHCVWVVNCVGALNYKYFLLFLFYTFLETTVVTL  188

Query  361  SLLPNFLAFFGDVDIPGSAGDlattflafvlnlafalsvlGFLIMHISLVSRNTT  525
            SLLP F+AFF D +IPG+ G LATTFLAFVLNLAFALSVLGFLIMHISLV+ NTT
Sbjct  189  SLLPQFIAFFSDGEIPGTPGTLATTFLAFVLNLAFALSVLGFLIMHISLVAGNTT  243



>ref|XP_009616135.1| PREDICTED: probable protein S-acyltransferase 14 [Nicotiana tomentosiformis]
Length=309

 Score =   234 bits (598),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 148/175 (85%), Positives = 158/175 (90%), Gaps = 0/175 (0%)
 Frame = +1

Query  1    FYCLLVMLLWSYFSVVFTDPGSVPPNWKPASDEERGDTDPLTASEFGSLPPDTAQSRIRF  180
            F+CLLVMLLWSYFSV+FTDPGSVP +W P  DEERGDTDPLTASEFG+ P D A  RIRF
Sbjct  69   FHCLLVMLLWSYFSVIFTDPGSVPQSWNPVLDEERGDTDPLTASEFGASPADPANPRIRF  128

Query  181  CKKCNQLKPPRCHHCSVCGRCVLKMDHHCVWVVNCVGALNYKYfllflfytflettlvtl  360
            CKKCNQLKPPRCHHCSVCGRCVLKMDHHCVWVVNCVGALNYKYFLLFLFYTFLETT+VTL
Sbjct  129  CKKCNQLKPPRCHHCSVCGRCVLKMDHHCVWVVNCVGALNYKYFLLFLFYTFLETTVVTL  188

Query  361  SLLPNFLAFFGDVDIPGSAGDlattflafvlnlafalsvlGFLIMHISLVSRNTT  525
            +LLP F+AFF D +IPG+   LATTFLAFV NLAFALSVLGFLIMHISLV+ NTT
Sbjct  189  ALLPQFIAFFSDGEIPGTPSTLATTFLAFVFNLAFALSVLGFLIMHISLVAGNTT  243



>ref|XP_011090630.1| PREDICTED: probable protein S-acyltransferase 14 [Sesamum indicum]
Length=302

 Score =   232 bits (592),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 147/175 (84%), Positives = 160/175 (91%), Gaps = 3/175 (2%)
 Frame = +1

Query  1    FYCLLVMLLWSYFSVVFTDPGSVPPNWKPASDEERGDTDPLTASEFGSLPPDTAQSRIRF  180
            F+CLLVMLLWSYFSVVFTDPG VPPNW+PA DEERGD+DPLT +EF +   D+   RIRF
Sbjct  67   FHCLLVMLLWSYFSVVFTDPGGVPPNWRPAVDEERGDSDPLTGTEFQA---DSENGRIRF  123

Query  181  CKKCNQLKPPRCHHCSVCGRCVLKMDHHCVWVVNCVGALNYKYfllflfytflettlvtl  360
            C+KCNQLKPPRCHHCSVCGRC+LKMDHHCVWVVNCVGALNYKYFLLFLFYTFLETTLVTL
Sbjct  124  CRKCNQLKPPRCHHCSVCGRCILKMDHHCVWVVNCVGALNYKYFLLFLFYTFLETTLVTL  183

Query  361  SLLPNFLAFFGDVDIPGSAGDlattflafvlnlafalsvlGFLIMHISLVSRNTT  525
            SLLP+F+AFF D DIPG+ G LATTFLAFVLNLAFALSV+GFLIMHISLV+ NTT
Sbjct  184  SLLPHFIAFFSDGDIPGTPGSLATTFLAFVLNLAFALSVMGFLIMHISLVTANTT  238



>ref|XP_009791941.1| PREDICTED: probable protein S-acyltransferase 14 [Nicotiana sylvestris]
Length=309

 Score =   232 bits (592),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 147/175 (84%), Positives = 157/175 (90%), Gaps = 0/175 (0%)
 Frame = +1

Query  1    FYCLLVMLLWSYFSVVFTDPGSVPPNWKPASDEERGDTDPLTASEFGSLPPDTAQSRIRF  180
            F+CLLVMLLWSYFSV+FTDPGSVP +W P  DEERGDTDPLTASEFG+ P D A  RIR 
Sbjct  69   FHCLLVMLLWSYFSVIFTDPGSVPQSWNPVLDEERGDTDPLTASEFGASPADPANPRIRI  128

Query  181  CKKCNQLKPPRCHHCSVCGRCVLKMDHHCVWVVNCVGALNYKYfllflfytflettlvtl  360
            CKKCNQLKPPRCHHCSVCGRCVLKMDHHCVWVVNCVGALNYKYFLLFLFYTFLETT+VTL
Sbjct  129  CKKCNQLKPPRCHHCSVCGRCVLKMDHHCVWVVNCVGALNYKYFLLFLFYTFLETTVVTL  188

Query  361  SLLPNFLAFFGDVDIPGSAGDlattflafvlnlafalsvlGFLIMHISLVSRNTT  525
            +LLP F+AFF D +IPG+   LATTFLAFV NLAFALSVLGFLIMHISLV+ NTT
Sbjct  189  ALLPQFIAFFSDGEIPGTPSTLATTFLAFVFNLAFALSVLGFLIMHISLVAGNTT  243



>gb|EYU31985.1| hypothetical protein MIMGU_mgv1a010704mg [Erythranthe guttata]
Length=304

 Score =   232 bits (592),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 148/175 (85%), Positives = 161/175 (92%), Gaps = 3/175 (2%)
 Frame = +1

Query  1    FYCLLVMLLWSYFSVVFTDPGSVPPNWKPASDEERGDTDPLTASEFGSLPPDTAQSRIRF  180
            F+CLLVMLLWSYFSVVFTDPG VPPNW+PA DEERGD+DPLTASEF   PP++   RIRF
Sbjct  67   FHCLLVMLLWSYFSVVFTDPGGVPPNWRPAVDEERGDSDPLTASEF---PPESENGRIRF  123

Query  181  CKKCNQLKPPRCHHCSVCGRCVLKMDHHCVWVVNCVGALNYKYfllflfytflettlvtl  360
            C+KCNQLKPPRCHHCSVCGRC+LKMDH CVWVVNCVGALNYKYFLLFLFYTFLETTLVTL
Sbjct  124  CRKCNQLKPPRCHHCSVCGRCILKMDHLCVWVVNCVGALNYKYFLLFLFYTFLETTLVTL  183

Query  361  SLLPNFLAFFGDVDIPGSAGDlattflafvlnlafalsvlGFLIMHISLVSRNTT  525
            SLLP+F+AFF D +IPG+ G LATTFLAFVLNLAFALSV+GFLIMHISLV+ NTT
Sbjct  184  SLLPHFIAFFSDGEIPGTPGTLATTFLAFVLNLAFALSVMGFLIMHISLVAGNTT  238



>ref|XP_007052067.1| DHHC-type zinc finger family protein isoform 2 [Theobroma cacao]
 gb|EOX96224.1| DHHC-type zinc finger family protein isoform 2 [Theobroma cacao]
Length=336

 Score =   232 bits (592),  Expect = 4e-72, Method: Compositional matrix adjust.
 Identities = 145/175 (83%), Positives = 158/175 (90%), Gaps = 0/175 (0%)
 Frame = +1

Query  1    FYCLLVMLLWSYFSVVFTDPGSVPPNWKPASDEERGDTDPLTASEFGSLPPDTAQSRIRF  180
            F+CLLVMLLWSYFSVV TDPGSVPPNW+PA DEERG+ DPL  SEF  L  D +  RIR+
Sbjct  67   FHCLLVMLLWSYFSVVLTDPGSVPPNWRPAMDEERGEVDPLNGSEFNGLQSDPSNQRIRY  126

Query  181  CKKCNQLKPPRCHHCSVCGRCVLKMDHHCVWVVNCVGALNYKYfllflfytflettlvtl  360
            C+KCNQLKPPRCHHCSVCGRCVLKMDHHCVWVVNCVGALNYKYFLLFLFYTFLET+LVTL
Sbjct  127  CRKCNQLKPPRCHHCSVCGRCVLKMDHHCVWVVNCVGALNYKYFLLFLFYTFLETSLVTL  186

Query  361  SLLPNFLAFFGDVDIPGSAGDlattflafvlnlafalsvlGFLIMHISLVSRNTT  525
            +LLP+F+AFF D +IPG+ G LATTFLAFVLNLAFALSVLGFLIMHISLV+ NTT
Sbjct  187  ALLPHFIAFFSDEEIPGTPGILATTFLAFVLNLAFALSVLGFLIMHISLVAANTT  241



>ref|XP_002320722.2| hypothetical protein POPTR_0014s06480g [Populus trichocarpa]
 gb|EEE99037.2| hypothetical protein POPTR_0014s06480g [Populus trichocarpa]
Length=272

 Score =   227 bits (578),  Expect = 7e-71, Method: Compositional matrix adjust.
 Identities = 144/175 (82%), Positives = 156/175 (89%), Gaps = 0/175 (0%)
 Frame = +1

Query  1    FYCLLVMLLWSYFSVVFTDPGSVPPNWKPASDEERGDTDPLTASEFGSLPPDTAQSRIRF  180
            F+ LLVMLLWSYFSVV TDPGSVPPNW+PA DEERG+ DPL  SEF  +  D +  RIR+
Sbjct  67   FHSLLVMLLWSYFSVVLTDPGSVPPNWRPAIDEERGEADPLNGSEFSGVQSDQSNQRIRY  126

Query  181  CKKCNQLKPPRCHHCSVCGRCVLKMDHHCVWVVNCVGALNYKYfllflfytflettlvtl  360
            C+KCNQLKPPRCHHCSVCGRCVLKMDHHCVWVVNCVGALNYKYFLLFLFYTFLET+LVTL
Sbjct  127  CRKCNQLKPPRCHHCSVCGRCVLKMDHHCVWVVNCVGALNYKYFLLFLFYTFLETSLVTL  186

Query  361  SLLPNFLAFFGDVDIPGSAGDlattflafvlnlafalsvlGFLIMHISLVSRNTT  525
            SL P+F+AFF D +IPG+ G LATTFLAFVLNLAFALSVLGFLIMHISLVS NTT
Sbjct  187  SLSPHFIAFFSDGEIPGTPGTLATTFLAFVLNLAFALSVLGFLIMHISLVSANTT  241



>gb|KHG00286.1| hypothetical protein F383_19583 [Gossypium arboreum]
Length=307

 Score =   228 bits (581),  Expect = 8e-71, Method: Compositional matrix adjust.
 Identities = 142/175 (81%), Positives = 158/175 (90%), Gaps = 0/175 (0%)
 Frame = +1

Query  1    FYCLLVMLLWSYFSVVFTDPGSVPPNWKPASDEERGDTDPLTASEFGSLPPDTAQSRIRF  180
            F+CLLVMLLWSYFSVV TDPGS+P NW+PA DEERG+ DPL  SEF  L  + +  RIR+
Sbjct  67   FHCLLVMLLWSYFSVVLTDPGSIPANWRPALDEERGEADPLNGSEFNGLQTNPSNQRIRY  126

Query  181  CKKCNQLKPPRCHHCSVCGRCVLKMDHHCVWVVNCVGALNYKYfllflfytflettlvtl  360
            C+KCNQLKPPRCHHCSVCGRCVLKMDHHCVWVVNCVGALNYKYFLLFLFYTFLET+LVTL
Sbjct  127  CRKCNQLKPPRCHHCSVCGRCVLKMDHHCVWVVNCVGALNYKYFLLFLFYTFLETSLVTL  186

Query  361  SLLPNFLAFFGDVDIPGSAGDlattflafvlnlafalsvlGFLIMHISLVSRNTT  525
            +LLP+F+AFF DV+IPG+ G LATTFL+FVLNLAFALSVLGFLIMHISLV+ NTT
Sbjct  187  ALLPHFIAFFSDVEIPGTPGTLATTFLSFVLNLAFALSVLGFLIMHISLVAANTT  241



>gb|KDO85815.1| hypothetical protein CISIN_1g021813mg [Citrus sinensis]
Length=246

 Score =   226 bits (575),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 142/175 (81%), Positives = 155/175 (89%), Gaps = 0/175 (0%)
 Frame = +1

Query  1    FYCLLVMLLWSYFSVVFTDPGSVPPNWKPASDEERGDTDPLTASEFGSLPPDTAQSRIRF  180
            F+CLLVMLLWSYFSVV TD GSVPPNW+PA DEERG+ DPL ASEF     D    RIR+
Sbjct  67   FHCLLVMLLWSYFSVVLTDAGSVPPNWRPALDEERGEADPLNASEFSGAQSDPLNPRIRY  126

Query  181  CKKCNQLKPPRCHHCSVCGRCVLKMDHHCVWVVNCVGALNYKYfllflfytflettlvtl  360
            C+KCNQLKPPRCHHCSVCGRC+LKMDHHCVWVVNCVGALNYKYFLLFL YTFLET+LVTL
Sbjct  127  CRKCNQLKPPRCHHCSVCGRCILKMDHHCVWVVNCVGALNYKYFLLFLLYTFLETSLVTL  186

Query  361  SLLPNFLAFFGDVDIPGSAGDlattflafvlnlafalsvlGFLIMHISLVSRNTT  525
            SLLP+F++FF + +IPG+ G LATTFLAFVLNLAFALSVLGFLIMHISLVS NTT
Sbjct  187  SLLPHFISFFSEGEIPGTPGTLATTFLAFVLNLAFALSVLGFLIMHISLVSANTT  241



>gb|KDP28757.1| hypothetical protein JCGZ_14528 [Jatropha curcas]
Length=307

 Score =   228 bits (580),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 143/175 (82%), Positives = 157/175 (90%), Gaps = 0/175 (0%)
 Frame = +1

Query  1    FYCLLVMLLWSYFSVVFTDPGSVPPNWKPASDEERGDTDPLTASEFGSLPPDTAQSRIRF  180
            F+CLLVMLLWSYFSVV TDPGSVPPNW+PA DEER + DPL  S+F  L  D++  RIR+
Sbjct  67   FHCLLVMLLWSYFSVVLTDPGSVPPNWRPAVDEERSEADPLNGSDFSGLATDSSNQRIRY  126

Query  181  CKKCNQLKPPRCHHCSVCGRCVLKMDHHCVWVVNCVGALNYKYfllflfytflettlvtl  360
            C+KCNQLKPPRCHHCSVCGRCVLKMDHHCVWVVNCVGALNYKYFLLFLFYTFLET+LVTL
Sbjct  127  CRKCNQLKPPRCHHCSVCGRCVLKMDHHCVWVVNCVGALNYKYFLLFLFYTFLETSLVTL  186

Query  361  SLLPNFLAFFGDVDIPGSAGDlattflafvlnlafalsvlGFLIMHISLVSRNTT  525
            SLLP+F+AFF D +IPG+ G LATTFLAFVLNLAFALSV+GFLIMH SLVS NTT
Sbjct  187  SLLPHFIAFFSDGEIPGTPGTLATTFLAFVLNLAFALSVMGFLIMHTSLVSANTT  241



>emb|CDO97688.1| unnamed protein product [Coffea canephora]
Length=300

 Score =   227 bits (579),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 143/175 (82%), Positives = 157/175 (90%), Gaps = 0/175 (0%)
 Frame = +1

Query  1    FYCLLVMLLWSYFSVVFTDPGSVPPNWKPASDEERGDTDPLTASEFGSLPPDTAQSRIRF  180
            F+ LLVMLLWSYFSVVFTDPGSVPPNW+P  DEERGDTDPLT SEFG+   D    R+R+
Sbjct  60   FHSLLVMLLWSYFSVVFTDPGSVPPNWRPELDEERGDTDPLTESEFGTASSDPVNLRVRY  119

Query  181  CKKCNQLKPPRCHHCSVCGRCVLKMDHHCVWVVNCVGALNYKYfllflfytflettlvtl  360
            C+KCNQ KPPRCHHCSVCGRCVLKMDHHCVWVVNCVGALNYKYFLLFLFYTFLET+L TL
Sbjct  120  CRKCNQFKPPRCHHCSVCGRCVLKMDHHCVWVVNCVGALNYKYFLLFLFYTFLETSLATL  179

Query  361  SLLPNFLAFFGDVDIPGSAGDlattflafvlnlafalsvlGFLIMHISLVSRNTT  525
            +LLP+F+AFF D +I G+ G+LATTFLAFVLNLAFALSVLGFLIMHISLV+ NTT
Sbjct  180  ALLPHFVAFFSDGEIAGTPGNLATTFLAFVLNLAFALSVLGFLIMHISLVAANTT  234



>gb|KJB41112.1| hypothetical protein B456_007G090900 [Gossypium raimondii]
Length=285

 Score =   226 bits (577),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 142/175 (81%), Positives = 155/175 (89%), Gaps = 0/175 (0%)
 Frame = +1

Query  1    FYCLLVMLLWSYFSVVFTDPGSVPPNWKPASDEERGDTDPLTASEFGSLPPDTAQSRIRF  180
            F+C L+MLLWSYFSVV TDPGSVPPNW+PA DEERG+ DPL  SEF    PD    RIR+
Sbjct  67   FHCFLIMLLWSYFSVVLTDPGSVPPNWRPAMDEERGEADPLNGSEFNGSQPDPLNQRIRY  126

Query  181  CKKCNQLKPPRCHHCSVCGRCVLKMDHHCVWVVNCVGALNYKYfllflfytflettlvtl  360
            C+KCNQLKPPRCHHCSVCGRCVLKMDHHCVWVVNCVGA NYKYFLLFLFYTFLET+LVT+
Sbjct  127  CRKCNQLKPPRCHHCSVCGRCVLKMDHHCVWVVNCVGAQNYKYFLLFLFYTFLETSLVTM  186

Query  361  SLLPNFLAFFGDVDIPGSAGDlattflafvlnlafalsvlGFLIMHISLVSRNTT  525
            +LLP+F+AFF D +IPG+ G LATTFLAFVLNLAFALSVLGFLIMHISLVS NTT
Sbjct  187  ALLPHFIAFFSDGEIPGTPGTLATTFLAFVLNLAFALSVLGFLIMHISLVSANTT  241



>gb|KFK37316.1| hypothetical protein AALP_AA4G241200 [Arabis alpina]
Length=307

 Score =   227 bits (578),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 140/175 (80%), Positives = 156/175 (89%), Gaps = 0/175 (0%)
 Frame = +1

Query  1    FYCLLVMLLWSYFSVVFTDPGSVPPNWKPASDEERGDTDPLTASEFGSLPPDTAQSRIRF  180
            F+ LL MLLWSYFSVVFTDPG VPPNW+P SDEERG++DPL + EFG L PD++  R RF
Sbjct  67   FHFLLGMLLWSYFSVVFTDPGVVPPNWRPVSDEERGESDPLNSLEFGGLLPDSSNQRTRF  126

Query  181  CKKCNQLKPPRCHHCSVCGRCVLKMDHHCVWVVNCVGALNYKYfllflfytflettlvtl  360
            C+KCNQ KPPRCHHCSVCGRCVLKMDHHCVWVVNCVGALNYKYFLLFL YTF+ETTLVTL
Sbjct  127  CRKCNQPKPPRCHHCSVCGRCVLKMDHHCVWVVNCVGALNYKYFLLFLLYTFMETTLVTL  186

Query  361  SLLPNFLAFFGDVDIPGSAGDlattflafvlnlafalsvlGFLIMHISLVSRNTT  525
             L+P+F+AFF D +IPG+ G LATTFLAFVLNLAFALSV+GFLIMHISLV+ NTT
Sbjct  187  LLMPHFIAFFSDEEIPGTPGTLATTFLAFVLNLAFALSVMGFLIMHISLVAANTT  241



>gb|KJB41110.1| hypothetical protein B456_007G090900 [Gossypium raimondii]
 gb|KJB41111.1| hypothetical protein B456_007G090900 [Gossypium raimondii]
Length=307

 Score =   227 bits (578),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 142/175 (81%), Positives = 155/175 (89%), Gaps = 0/175 (0%)
 Frame = +1

Query  1    FYCLLVMLLWSYFSVVFTDPGSVPPNWKPASDEERGDTDPLTASEFGSLPPDTAQSRIRF  180
            F+C L+MLLWSYFSVV TDPGSVPPNW+PA DEERG+ DPL  SEF    PD    RIR+
Sbjct  67   FHCFLIMLLWSYFSVVLTDPGSVPPNWRPAMDEERGEADPLNGSEFNGSQPDPLNQRIRY  126

Query  181  CKKCNQLKPPRCHHCSVCGRCVLKMDHHCVWVVNCVGALNYKYfllflfytflettlvtl  360
            C+KCNQLKPPRCHHCSVCGRCVLKMDHHCVWVVNCVGA NYKYFLLFLFYTFLET+LVT+
Sbjct  127  CRKCNQLKPPRCHHCSVCGRCVLKMDHHCVWVVNCVGAQNYKYFLLFLFYTFLETSLVTM  186

Query  361  SLLPNFLAFFGDVDIPGSAGDlattflafvlnlafalsvlGFLIMHISLVSRNTT  525
            +LLP+F+AFF D +IPG+ G LATTFLAFVLNLAFALSVLGFLIMHISLVS NTT
Sbjct  187  ALLPHFIAFFSDGEIPGTPGTLATTFLAFVLNLAFALSVLGFLIMHISLVSANTT  241



>ref|XP_009346814.1| PREDICTED: probable protein S-acyltransferase 14 [Pyrus x bretschneideri]
Length=263

 Score =   225 bits (574),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 139/175 (79%), Positives = 155/175 (89%), Gaps = 0/175 (0%)
 Frame = +1

Query  1    FYCLLVMLLWSYFSVVFTDPGSVPPNWKPASDEERGDTDPLTASEFGSLPPDTAQSRIRF  180
            F+CLLVMLLWSYFSVV TDPG VPPNW+PA DEERG+ DPLT  +F  L PD +  RIR+
Sbjct  67   FHCLLVMLLWSYFSVVLTDPGGVPPNWRPAVDEERGEADPLTGLDFNGLQPDPSNQRIRY  126

Query  181  CKKCNQLKPPRCHHCSVCGRCVLKMDHHCVWVVNCVGALNYKYfllflfytflettlvtl  360
            C+KCNQLKPPRCHHCSVCGRCVLKMDHHCVWVVNCVGALNYKYFLLFLFYTFLET++V L
Sbjct  127  CRKCNQLKPPRCHHCSVCGRCVLKMDHHCVWVVNCVGALNYKYFLLFLFYTFLETSVVAL  186

Query  361  SLLPNFLAFFGDVDIPGSAGDlattflafvlnlafalsvlGFLIMHISLVSRNTT  525
            SLLP+F+ FF + +IPG+   LATTFLAFVLNLAFALSVLGFL+MHISLV+ NTT
Sbjct  187  SLLPHFILFFSEGEIPGTPSTLATTFLAFVLNLAFALSVLGFLVMHISLVAANTT  241



>ref|XP_003521795.1| PREDICTED: probable protein S-acyltransferase 14-like isoform 
X1 [Glycine max]
 gb|KHN35648.1| Putative S-acyltransferase [Glycine soja]
Length=304

 Score =   226 bits (576),  Expect = 4e-70, Method: Compositional matrix adjust.
 Identities = 145/175 (83%), Positives = 157/175 (90%), Gaps = 1/175 (1%)
 Frame = +1

Query  1    FYCLLVMLLWSYFSVVFTDPGSVPPNWKPASDEERGDTDPLTASEFGSLPPDTAQSRIRF  180
            F+ LLVMLLWSYFSVVFTDPGSVPPNWKP  DEERG+ DPL  +EF +LP D    R+R+
Sbjct  67   FHSLLVMLLWSYFSVVFTDPGSVPPNWKPTIDEERGEADPLVGTEFSNLPSD-PNPRVRY  125

Query  181  CKKCNQLKPPRCHHCSVCGRCVLKMDHHCVWVVNCVGALNYKYfllflfytflettlvtl  360
            C+KCNQLKPPRCHHCSVCGRCVLKMDHHCVWVVNCVGALNYKYFLLFLFYTFLETTLVT 
Sbjct  126  CRKCNQLKPPRCHHCSVCGRCVLKMDHHCVWVVNCVGALNYKYFLLFLFYTFLETTLVTA  185

Query  361  SLLPNFLAFFGDVDIPGSAGDlattflafvlnlafalsvlGFLIMHISLVSRNTT  525
            SLLP+F+AFF D +IPG+ G LATTFLAFVLNLAFALSVLGFLIMHISLV+ NTT
Sbjct  186  SLLPHFIAFFSDGEIPGTPGSLATTFLAFVLNLAFALSVLGFLIMHISLVAANTT  240



>ref|XP_011034295.1| PREDICTED: probable protein S-acyltransferase 14 [Populus euphratica]
Length=307

 Score =   226 bits (576),  Expect = 5e-70, Method: Compositional matrix adjust.
 Identities = 144/175 (82%), Positives = 156/175 (89%), Gaps = 0/175 (0%)
 Frame = +1

Query  1    FYCLLVMLLWSYFSVVFTDPGSVPPNWKPASDEERGDTDPLTASEFGSLPPDTAQSRIRF  180
            F+ LLVMLLWSYFSVV TDPGSVPPNW+PA DEERG+ DPL  SEF  +  D +  RIR+
Sbjct  67   FHSLLVMLLWSYFSVVLTDPGSVPPNWRPAIDEERGEADPLNGSEFSGVQSDQSNQRIRY  126

Query  181  CKKCNQLKPPRCHHCSVCGRCVLKMDHHCVWVVNCVGALNYKYfllflfytflettlvtl  360
            C+KCNQLKPPRCHHCSVCGRCVLKMDHHCVWVVNCVGALNYKYFLLFLFYTFLET+LVTL
Sbjct  127  CRKCNQLKPPRCHHCSVCGRCVLKMDHHCVWVVNCVGALNYKYFLLFLFYTFLETSLVTL  186

Query  361  SLLPNFLAFFGDVDIPGSAGDlattflafvlnlafalsvlGFLIMHISLVSRNTT  525
            SL P+F+AFF D +IPG+ G LATTFLAFVLNLAFALSVLGFLIMHISLVS NTT
Sbjct  187  SLSPHFIAFFSDGEIPGTPGTLATTFLAFVLNLAFALSVLGFLIMHISLVSANTT  241



>ref|XP_010098912.1| putative S-acyltransferase [Morus notabilis]
 gb|EXB76214.1| putative S-acyltransferase [Morus notabilis]
Length=308

 Score =   226 bits (576),  Expect = 5e-70, Method: Compositional matrix adjust.
 Identities = 145/176 (82%), Positives = 159/176 (90%), Gaps = 1/176 (1%)
 Frame = +1

Query  1    FYCLLVMLLWSYFSVVFTDPGSVPPNWKPASDEERGDTDPLT-ASEFGSLPPDTAQSRIR  177
            F+CLLVMLLWSYFSVV TDPGSVPPNW+PA DEERG+ DPL   SEF SL  + +  RIR
Sbjct  67   FHCLLVMLLWSYFSVVLTDPGSVPPNWRPAVDEERGEADPLNNGSEFTSLQAEPSNQRIR  126

Query  178  FCKKCNQLKPPRCHHCSVCGRCVLKMDHHCVWVVNCVGALNYKYfllflfytflettlvt  357
            +C+KCNQLKPPRCHHCSVCGRCVLKMDHHCVWVVNCVGALNYKYFLLFLFYTFLET+LVT
Sbjct  127  YCRKCNQLKPPRCHHCSVCGRCVLKMDHHCVWVVNCVGALNYKYFLLFLFYTFLETSLVT  186

Query  358  lSLLPNFLAFFGDVDIPGSAGDlattflafvlnlafalsvlGFLIMHISLVSRNTT  525
            L+LLP+F+AFF D +IPG+ G LATTFLAFVLNLAFALSVLGFLIMHISLV+ NTT
Sbjct  187  LALLPHFIAFFSDDEIPGTPGTLATTFLAFVLNLAFALSVLGFLIMHISLVAANTT  242



>ref|XP_002511714.1| zinc finger protein, putative [Ricinus communis]
 gb|EEF50383.1| zinc finger protein, putative [Ricinus communis]
Length=307

 Score =   226 bits (576),  Expect = 5e-70, Method: Compositional matrix adjust.
 Identities = 143/175 (82%), Positives = 157/175 (90%), Gaps = 0/175 (0%)
 Frame = +1

Query  1    FYCLLVMLLWSYFSVVFTDPGSVPPNWKPASDEERGDTDPLTASEFGSLPPDTAQSRIRF  180
            F+CLLVMLLWSYFSVV TDPG VPPNW+PA DEERG+ DPL  S+F  +  D++  RIR+
Sbjct  67   FHCLLVMLLWSYFSVVLTDPGGVPPNWRPAIDEERGEADPLNGSDFSGVLTDSSNQRIRY  126

Query  181  CKKCNQLKPPRCHHCSVCGRCVLKMDHHCVWVVNCVGALNYKYfllflfytflettlvtl  360
            C+KCNQ KPPRCHHCSVCGRCVLKMDHHCVWVVNCVGALNYKYFLLFLFYTFLET+LVTL
Sbjct  127  CRKCNQQKPPRCHHCSVCGRCVLKMDHHCVWVVNCVGALNYKYFLLFLFYTFLETSLVTL  186

Query  361  SLLPNFLAFFGDVDIPGSAGDlattflafvlnlafalsvlGFLIMHISLVSRNTT  525
            SLLP+F+AFF D +IPG+ G LATTFLAFVLNLAFALSVLGFLIMHISLVS NTT
Sbjct  187  SLLPHFIAFFSDGEIPGTPGTLATTFLAFVLNLAFALSVLGFLIMHISLVSANTT  241



>gb|KDO85814.1| hypothetical protein CISIN_1g021813mg [Citrus sinensis]
Length=295

 Score =   225 bits (574),  Expect = 6e-70, Method: Compositional matrix adjust.
 Identities = 142/175 (81%), Positives = 155/175 (89%), Gaps = 0/175 (0%)
 Frame = +1

Query  1    FYCLLVMLLWSYFSVVFTDPGSVPPNWKPASDEERGDTDPLTASEFGSLPPDTAQSRIRF  180
            F+CLLVMLLWSYFSVV TD GSVPPNW+PA DEERG+ DPL ASEF     D    RIR+
Sbjct  67   FHCLLVMLLWSYFSVVLTDAGSVPPNWRPALDEERGEADPLNASEFSGAQSDPLNPRIRY  126

Query  181  CKKCNQLKPPRCHHCSVCGRCVLKMDHHCVWVVNCVGALNYKYfllflfytflettlvtl  360
            C+KCNQLKPPRCHHCSVCGRC+LKMDHHCVWVVNCVGALNYKYFLLFL YTFLET+LVTL
Sbjct  127  CRKCNQLKPPRCHHCSVCGRCILKMDHHCVWVVNCVGALNYKYFLLFLLYTFLETSLVTL  186

Query  361  SLLPNFLAFFGDVDIPGSAGDlattflafvlnlafalsvlGFLIMHISLVSRNTT  525
            SLLP+F++FF + +IPG+ G LATTFLAFVLNLAFALSVLGFLIMHISLVS NTT
Sbjct  187  SLLPHFISFFSEGEIPGTPGTLATTFLAFVLNLAFALSVLGFLIMHISLVSANTT  241



>ref|XP_010544651.1| PREDICTED: probable protein S-acyltransferase 14 [Tarenaya hassleriana]
Length=305

 Score =   226 bits (575),  Expect = 6e-70, Method: Compositional matrix adjust.
 Identities = 140/175 (80%), Positives = 159/175 (91%), Gaps = 0/175 (0%)
 Frame = +1

Query  1    FYCLLVMLLWSYFSVVFTDPGSVPPNWKPASDEERGDTDPLTASEFGSLPPDTAQSRIRF  180
            F+ LLVMLLWSYFSVVFTDPG+VPPNW+P++DEERG+ DPL + EFG L PD++  R+RF
Sbjct  67   FHSLLVMLLWSYFSVVFTDPGAVPPNWRPSTDEERGEADPLNSLEFGGLQPDSSNQRLRF  126

Query  181  CKKCNQLKPPRCHHCSVCGRCVLKMDHHCVWVVNCVGALNYKYfllflfytflettlvtl  360
            C+KC+Q KPPRCHHCSVCGRCVLKMDHHCVWVVNCVGALNYKYFLLFLFYTFLET LVTL
Sbjct  127  CRKCSQPKPPRCHHCSVCGRCVLKMDHHCVWVVNCVGALNYKYFLLFLFYTFLETALVTL  186

Query  361  SLLPNFLAFFGDVDIPGSAGDlattflafvlnlafalsvlGFLIMHISLVSRNTT  525
             L+P+F+AFF D +IPG+ G LATTFLAFVLNLAFALSV+GFLIMHISLV+ NTT
Sbjct  187  VLMPHFVAFFSDEEIPGTPGTLATTFLAFVLNLAFALSVMGFLIMHISLVAANTT  241



>ref|XP_010524364.1| PREDICTED: probable protein S-acyltransferase 14 [Tarenaya hassleriana]
Length=307

 Score =   225 bits (573),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 141/175 (81%), Positives = 158/175 (90%), Gaps = 0/175 (0%)
 Frame = +1

Query  1    FYCLLVMLLWSYFSVVFTDPGSVPPNWKPASDEERGDTDPLTASEFGSLPPDTAQSRIRF  180
            F+ LL+MLLWSYFSVVF DPGSVPPNW+PA+DEERG+ DPL + EFG +  D++  RIRF
Sbjct  67   FHSLLMMLLWSYFSVVFADPGSVPPNWRPATDEERGEADPLNSMEFGGIQSDSSNPRIRF  126

Query  181  CKKCNQLKPPRCHHCSVCGRCVLKMDHHCVWVVNCVGALNYKYfllflfytflettlvtl  360
            C+KCNQ KPPRCHHCSVCGRCVLKMDHHCVWVVNCVGALNYKYFLLFLFYTFLETTLVTL
Sbjct  127  CRKCNQPKPPRCHHCSVCGRCVLKMDHHCVWVVNCVGALNYKYFLLFLFYTFLETTLVTL  186

Query  361  SLLPNFLAFFGDVDIPGSAGDlattflafvlnlafalsvlGFLIMHISLVSRNTT  525
             L+P+F+AFF D +IPG+ G LATTFLAFVLNLAFALSV+GFLIMHISLV+ NTT
Sbjct  187  VLMPHFIAFFSDEEIPGTPGTLATTFLAFVLNLAFALSVMGFLIMHISLVAANTT  241



>ref|XP_006445267.1| hypothetical protein CICLE_v10021302mg [Citrus clementina]
 ref|XP_006490917.1| PREDICTED: probable protein S-acyltransferase 14-like [Citrus 
sinensis]
 gb|ESR58507.1| hypothetical protein CICLE_v10021302mg [Citrus clementina]
 gb|KDO85813.1| hypothetical protein CISIN_1g021813mg [Citrus sinensis]
Length=307

 Score =   224 bits (572),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 142/175 (81%), Positives = 155/175 (89%), Gaps = 0/175 (0%)
 Frame = +1

Query  1    FYCLLVMLLWSYFSVVFTDPGSVPPNWKPASDEERGDTDPLTASEFGSLPPDTAQSRIRF  180
            F+CLLVMLLWSYFSVV TD GSVPPNW+PA DEERG+ DPL ASEF     D    RIR+
Sbjct  67   FHCLLVMLLWSYFSVVLTDAGSVPPNWRPALDEERGEADPLNASEFSGAQSDPLNPRIRY  126

Query  181  CKKCNQLKPPRCHHCSVCGRCVLKMDHHCVWVVNCVGALNYKYfllflfytflettlvtl  360
            C+KCNQLKPPRCHHCSVCGRC+LKMDHHCVWVVNCVGALNYKYFLLFL YTFLET+LVTL
Sbjct  127  CRKCNQLKPPRCHHCSVCGRCILKMDHHCVWVVNCVGALNYKYFLLFLLYTFLETSLVTL  186

Query  361  SLLPNFLAFFGDVDIPGSAGDlattflafvlnlafalsvlGFLIMHISLVSRNTT  525
            SLLP+F++FF + +IPG+ G LATTFLAFVLNLAFALSVLGFLIMHISLVS NTT
Sbjct  187  SLLPHFISFFSEGEIPGTPGTLATTFLAFVLNLAFALSVLGFLIMHISLVSANTT  241



>ref|XP_007134881.1| hypothetical protein PHAVU_010G083900g [Phaseolus vulgaris]
 gb|ESW06875.1| hypothetical protein PHAVU_010G083900g [Phaseolus vulgaris]
Length=304

 Score =   224 bits (571),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 144/175 (82%), Positives = 157/175 (90%), Gaps = 1/175 (1%)
 Frame = +1

Query  1    FYCLLVMLLWSYFSVVFTDPGSVPPNWKPASDEERGDTDPLTASEFGSLPPDTAQSRIRF  180
            F+ LLVMLLWSYFSVVFTDPGSVPPNW+P  DEERG+ DPL  +EF ++  D  Q RIR+
Sbjct  67   FHSLLVMLLWSYFSVVFTDPGSVPPNWRPTIDEERGEADPLVGTEFSNVQTDPNQ-RIRY  125

Query  181  CKKCNQLKPPRCHHCSVCGRCVLKMDHHCVWVVNCVGALNYKYfllflfytflettlvtl  360
            C+KCNQLKPPRCHHCSVCGRCVLKMDHHCVWVVNCVGALNYKYFLLFLFYTFLETTLVT 
Sbjct  126  CRKCNQLKPPRCHHCSVCGRCVLKMDHHCVWVVNCVGALNYKYFLLFLFYTFLETTLVTA  185

Query  361  SLLPNFLAFFGDVDIPGSAGDlattflafvlnlafalsvlGFLIMHISLVSRNTT  525
            SLLP+F+AFF D +IPG+ G LATTFLAFVLNLAFALSVLGFLIMHISLV+ NTT
Sbjct  186  SLLPHFIAFFSDGEIPGTPGSLATTFLAFVLNLAFALSVLGFLIMHISLVAANTT  240



>ref|XP_007218730.1| hypothetical protein PRUPE_ppa009076mg [Prunus persica]
 ref|XP_008232661.1| PREDICTED: probable protein S-acyltransferase 14 isoform X2 [Prunus 
mume]
 gb|EMJ19929.1| hypothetical protein PRUPE_ppa009076mg [Prunus persica]
Length=307

 Score =   224 bits (571),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 141/175 (81%), Positives = 157/175 (90%), Gaps = 0/175 (0%)
 Frame = +1

Query  1    FYCLLVMLLWSYFSVVFTDPGSVPPNWKPASDEERGDTDPLTASEFGSLPPDTAQSRIRF  180
            F+CLLVMLLWSYFSVV TDPG VPPNW+PA DEERG+ DPLT S+F  L  D +  RIR+
Sbjct  67   FHCLLVMLLWSYFSVVLTDPGCVPPNWRPAVDEERGEADPLTGSDFSGLQTDPSNQRIRY  126

Query  181  CKKCNQLKPPRCHHCSVCGRCVLKMDHHCVWVVNCVGALNYKYfllflfytflettlvtl  360
            C+KCNQLKPPRCHHCSVCGRCVLKMDHHCVWVVNCVGALNYKYFLLFLFYTFLET++VTL
Sbjct  127  CRKCNQLKPPRCHHCSVCGRCVLKMDHHCVWVVNCVGALNYKYFLLFLFYTFLETSVVTL  186

Query  361  SLLPNFLAFFGDVDIPGSAGDlattflafvlnlafalsvlGFLIMHISLVSRNTT  525
            SLLP+F++FF + +IPG+   LATTFLAFVLNLAFALSVLGFLIMHISLV+ NTT
Sbjct  187  SLLPHFISFFSEGEIPGTPSTLATTFLAFVLNLAFALSVLGFLIMHISLVAANTT  241



>emb|CBI38870.3| unnamed protein product [Vitis vinifera]
Length=300

 Score =   224 bits (570),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 138/175 (79%), Positives = 158/175 (90%), Gaps = 0/175 (0%)
 Frame = +1

Query  1    FYCLLVMLLWSYFSVVFTDPGSVPPNWKPASDEERGDTDPLTASEFGSLPPDTAQSRIRF  180
            F+ LLVMLLWSYFSVV TDPG VPPNW+P  DEERG+ DPLT S+FG  P D ++ R+R+
Sbjct  60   FHGLLVMLLWSYFSVVLTDPGGVPPNWRPIMDEERGEGDPLTGSDFGVSPADASKQRVRY  119

Query  181  CKKCNQLKPPRCHHCSVCGRCVLKMDHHCVWVVNCVGALNYKYfllflfytflettlvtl  360
            C+KC+Q+KPPRCHHCSVCGRC+LKMDHHCVWVVNCVGALNYKYFLLFLFYTFLET+LVTL
Sbjct  120  CRKCSQMKPPRCHHCSVCGRCILKMDHHCVWVVNCVGALNYKYFLLFLFYTFLETSLVTL  179

Query  361  SLLPNFLAFFGDVDIPGSAGDlattflafvlnlafalsvlGFLIMHISLVSRNTT  525
            SLLP+F+AFF + +IPGS G LATTFLAFVLNLAFALSV+GFLIMHIS+V+ NTT
Sbjct  180  SLLPHFIAFFTEGEIPGSPGTLATTFLAFVLNLAFALSVMGFLIMHISMVAANTT  234



>ref|XP_006291552.1| hypothetical protein CARUB_v10017708mg [Capsella rubella]
 gb|EOA24450.1| hypothetical protein CARUB_v10017708mg [Capsella rubella]
Length=306

 Score =   224 bits (570),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 139/175 (79%), Positives = 159/175 (91%), Gaps = 0/175 (0%)
 Frame = +1

Query  1    FYCLLVMLLWSYFSVVFTDPGSVPPNWKPASDEERGDTDPLTASEFGSLPPDTAQSRIRF  180
            F+ LL MLLWSYFSVVFTDPG+VPPNW+P++DEERG++DPL + EF  L PD++  R+RF
Sbjct  68   FHFLLAMLLWSYFSVVFTDPGAVPPNWRPSTDEERGESDPLNSLEFVGLQPDSSNPRVRF  127

Query  181  CKKCNQLKPPRCHHCSVCGRCVLKMDHHCVWVVNCVGALNYKYfllflfytflettlvtl  360
            C+KCNQLKP RCHHCSVCGRCVLKMDHHCVWVVNCVGALNYKYFLLFLFYTFLET+LVTL
Sbjct  128  CRKCNQLKPSRCHHCSVCGRCVLKMDHHCVWVVNCVGALNYKYFLLFLFYTFLETSLVTL  187

Query  361  SLLPNFLAFFGDVDIPGSAGDlattflafvlnlafalsvlGFLIMHISLVSRNTT  525
             L+P+F+AFF D +IPG+ G LATTFLAFVLNLAFALSV+GFLIMHISLV+ NTT
Sbjct  188  VLMPHFIAFFSDEEIPGTPGTLATTFLAFVLNLAFALSVMGFLIMHISLVAGNTT  242



>ref|XP_008393352.1| PREDICTED: probable protein S-acyltransferase 14 [Malus domestica]
Length=307

 Score =   224 bits (570),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 139/175 (79%), Positives = 155/175 (89%), Gaps = 0/175 (0%)
 Frame = +1

Query  1    FYCLLVMLLWSYFSVVFTDPGSVPPNWKPASDEERGDTDPLTASEFGSLPPDTAQSRIRF  180
            F+CLLVMLLWSYFSVV TDPG VPPNW+PA DEERG+ DPLT S+F  L PD +  RIR+
Sbjct  67   FHCLLVMLLWSYFSVVLTDPGGVPPNWRPAVDEERGEADPLTGSDFNGLQPDPSNQRIRY  126

Query  181  CKKCNQLKPPRCHHCSVCGRCVLKMDHHCVWVVNCVGALNYKYfllflfytflettlvtl  360
            C+KCNQLKP RCHHCSVCGRCVLKMDHHCVWVVNCVGALNYKYF LFLFYTFLET++VTL
Sbjct  127  CRKCNQLKPARCHHCSVCGRCVLKMDHHCVWVVNCVGALNYKYFXLFLFYTFLETSVVTL  186

Query  361  SLLPNFLAFFGDVDIPGSAGDlattflafvlnlafalsvlGFLIMHISLVSRNTT  525
            SLLP+F+ FF + +IPG+   LATTFLAFVLNLAFALSVLGFL+MHISLV+ NTT
Sbjct  187  SLLPHFILFFSEGEIPGTPSTLATTFLAFVLNLAFALSVLGFLVMHISLVAANTT  241



>ref|XP_011469137.1| PREDICTED: probable protein S-acyltransferase 14 isoform X1 [Fragaria 
vesca subsp. vesca]
Length=319

 Score =   224 bits (571),  Expect = 4e-69, Method: Compositional matrix adjust.
 Identities = 141/175 (81%), Positives = 155/175 (89%), Gaps = 0/175 (0%)
 Frame = +1

Query  1    FYCLLVMLLWSYFSVVFTDPGSVPPNWKPASDEERGDTDPLTASEFGSLPPDTAQSRIRF  180
            F+ LLVMLLWSYFSVV TDPG VPPNW+PA DEERG+ DPL  SEF  L  D +  R+R+
Sbjct  67   FHSLLVMLLWSYFSVVLTDPGGVPPNWRPAVDEERGEADPLNGSEFSDLQTDPSNQRVRY  126

Query  181  CKKCNQLKPPRCHHCSVCGRCVLKMDHHCVWVVNCVGALNYKYfllflfytflettlvtl  360
            C+KCNQLKPPRCHHCSVCGRCVLKMDHHCVWVVNCVGALNYKYFLLFLFYTFLETT+VTL
Sbjct  127  CRKCNQLKPPRCHHCSVCGRCVLKMDHHCVWVVNCVGALNYKYFLLFLFYTFLETTVVTL  186

Query  361  SLLPNFLAFFGDVDIPGSAGDlattflafvlnlafalsvlGFLIMHISLVSRNTT  525
             LLP+F+AFF + +IPG+ G LATTFLAFVLNLAFALSVLGFLIMHISLV+ NTT
Sbjct  187  CLLPHFIAFFSEGEIPGTPGTLATTFLAFVLNLAFALSVLGFLIMHISLVAANTT  241



>ref|XP_002279896.1| PREDICTED: probable protein S-acyltransferase 14 [Vitis vinifera]
 ref|XP_010661650.1| PREDICTED: probable protein S-acyltransferase 14 [Vitis vinifera]
 emb|CAN80505.1| hypothetical protein VITISV_010744 [Vitis vinifera]
Length=307

 Score =   224 bits (570),  Expect = 4e-69, Method: Compositional matrix adjust.
 Identities = 138/175 (79%), Positives = 158/175 (90%), Gaps = 0/175 (0%)
 Frame = +1

Query  1    FYCLLVMLLWSYFSVVFTDPGSVPPNWKPASDEERGDTDPLTASEFGSLPPDTAQSRIRF  180
            F+ LLVMLLWSYFSVV TDPG VPPNW+P  DEERG+ DPLT S+FG  P D ++ R+R+
Sbjct  67   FHGLLVMLLWSYFSVVLTDPGGVPPNWRPIMDEERGEGDPLTGSDFGVSPADASKQRVRY  126

Query  181  CKKCNQLKPPRCHHCSVCGRCVLKMDHHCVWVVNCVGALNYKYfllflfytflettlvtl  360
            C+KC+Q+KPPRCHHCSVCGRC+LKMDHHCVWVVNCVGALNYKYFLLFLFYTFLET+LVTL
Sbjct  127  CRKCSQMKPPRCHHCSVCGRCILKMDHHCVWVVNCVGALNYKYFLLFLFYTFLETSLVTL  186

Query  361  SLLPNFLAFFGDVDIPGSAGDlattflafvlnlafalsvlGFLIMHISLVSRNTT  525
            SLLP+F+AFF + +IPGS G LATTFLAFVLNLAFALSV+GFLIMHIS+V+ NTT
Sbjct  187  SLLPHFIAFFTEGEIPGSPGTLATTFLAFVLNLAFALSVMGFLIMHISMVAANTT  241



>ref|XP_009338113.1| PREDICTED: probable protein S-acyltransferase 14 [Pyrus x bretschneideri]
Length=307

 Score =   224 bits (570),  Expect = 4e-69, Method: Compositional matrix adjust.
 Identities = 139/175 (79%), Positives = 155/175 (89%), Gaps = 0/175 (0%)
 Frame = +1

Query  1    FYCLLVMLLWSYFSVVFTDPGSVPPNWKPASDEERGDTDPLTASEFGSLPPDTAQSRIRF  180
            F+CLLVMLLWSYFSVV TDPG VPPNW+PA DEERG+ DPLT  +F  L PD +  RIR+
Sbjct  67   FHCLLVMLLWSYFSVVLTDPGGVPPNWRPAVDEERGEADPLTGLDFNGLQPDPSNQRIRY  126

Query  181  CKKCNQLKPPRCHHCSVCGRCVLKMDHHCVWVVNCVGALNYKYfllflfytflettlvtl  360
            C+KCNQLKPPRCHHCSVCGRCVLKMDHHCVWVVNCVGALNYKYFLLFLFYTFLET++V L
Sbjct  127  CRKCNQLKPPRCHHCSVCGRCVLKMDHHCVWVVNCVGALNYKYFLLFLFYTFLETSVVAL  186

Query  361  SLLPNFLAFFGDVDIPGSAGDlattflafvlnlafalsvlGFLIMHISLVSRNTT  525
            SLLP+F+ FF + +IPG+   LATTFLAFVLNLAFALSVLGFL+MHISLV+ NTT
Sbjct  187  SLLPHFILFFSEGEIPGTPSTLATTFLAFVLNLAFALSVLGFLVMHISLVAANTT  241



>ref|XP_004506505.1| PREDICTED: probable S-acyltransferase At3g60800-like [Cicer arietinum]
Length=305

 Score =   223 bits (569),  Expect = 5e-69, Method: Compositional matrix adjust.
 Identities = 142/175 (81%), Positives = 155/175 (89%), Gaps = 0/175 (0%)
 Frame = +1

Query  1    FYCLLVMLLWSYFSVVFTDPGSVPPNWKPASDEERGDTDPLTASEFGSLPPDTAQSRIRF  180
            F+ LLVMLLWSYFSVVF DPGSVPPNW+P  DEE G+ DPL  SEF ++  D +  RIR+
Sbjct  67   FHTLLVMLLWSYFSVVFIDPGSVPPNWRPTIDEETGEADPLVGSEFSNVQCDPSNQRIRY  126

Query  181  CKKCNQLKPPRCHHCSVCGRCVLKMDHHCVWVVNCVGALNYKYfllflfytflettlvtl  360
            C+KCNQLKPPRCHHCSVCGRCVLKMDHHCVWVVNCVGALNYKYFLLFLFYTFLETTLVT 
Sbjct  127  CRKCNQLKPPRCHHCSVCGRCVLKMDHHCVWVVNCVGALNYKYFLLFLFYTFLETTLVTA  186

Query  361  SLLPNFLAFFGDVDIPGSAGDlattflafvlnlafalsvlGFLIMHISLVSRNTT  525
            SLLP+F+AFF D +IPG+ G LATTFLAFVLNLAFALSVLGFLIMHISLV+ NTT
Sbjct  187  SLLPHFIAFFSDGEIPGTPGSLATTFLAFVLNLAFALSVLGFLIMHISLVAANTT  241



>ref|XP_002302535.2| zinc finger family protein [Populus trichocarpa]
 gb|EEE81808.2| zinc finger family protein [Populus trichocarpa]
Length=310

 Score =   223 bits (569),  Expect = 6e-69, Method: Compositional matrix adjust.
 Identities = 144/175 (82%), Positives = 155/175 (89%), Gaps = 0/175 (0%)
 Frame = +1

Query  1    FYCLLVMLLWSYFSVVFTDPGSVPPNWKPASDEERGDTDPLTASEFGSLPPDTAQSRIRF  180
            F+ LLVMLLWSYFSVV TDPGSVPPNW+PA DEERG+ DPL  SE   +  D    RIR+
Sbjct  67   FHSLLVMLLWSYFSVVLTDPGSVPPNWRPAIDEERGEADPLNGSECSGVQSDQLNQRIRY  126

Query  181  CKKCNQLKPPRCHHCSVCGRCVLKMDHHCVWVVNCVGALNYKYfllflfytflettlvtl  360
            C+KCNQLKPPRCHHCSVCGRCVLKMDHHCVWVVNCVGALNYKYFLLFLFYTFLET+LVTL
Sbjct  127  CRKCNQLKPPRCHHCSVCGRCVLKMDHHCVWVVNCVGALNYKYFLLFLFYTFLETSLVTL  186

Query  361  SLLPNFLAFFGDVDIPGSAGDlattflafvlnlafalsvlGFLIMHISLVSRNTT  525
            SLLP+F+AFF D +IPG+ G LATTFLAFVLNLAFALSVLGFLIMHISLVS NTT
Sbjct  187  SLLPHFIAFFSDGEIPGTPGTLATTFLAFVLNLAFALSVLGFLIMHISLVSANTT  241



>emb|CDX71777.1| BnaC08g30970D [Brassica napus]
Length=305

 Score =   223 bits (567),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 141/175 (81%), Positives = 158/175 (90%), Gaps = 0/175 (0%)
 Frame = +1

Query  1    FYCLLVMLLWSYFSVVFTDPGSVPPNWKPASDEERGDTDPLTASEFGSLPPDTAQSRIRF  180
            F+ LL MLLWSYFSVVFTDPG+VP NW+PASDEERG++DPLT+ EF  L  D++  R+RF
Sbjct  67   FHVLLAMLLWSYFSVVFTDPGAVPANWRPASDEERGESDPLTSLEFVGLQTDSSNPRVRF  126

Query  181  CKKCNQLKPPRCHHCSVCGRCVLKMDHHCVWVVNCVGALNYKYfllflfytflettlvtl  360
            C+KCNQ KPPRCHHCSVCGRCVLKMDHHCVWVVNCVGALNYKYFLLFLFYTFLETTLVTL
Sbjct  127  CRKCNQPKPPRCHHCSVCGRCVLKMDHHCVWVVNCVGALNYKYFLLFLFYTFLETTLVTL  186

Query  361  SLLPNFLAFFGDVDIPGSAGDlattflafvlnlafalsvlGFLIMHISLVSRNTT  525
             L+P+F+AFF D +IPG+ G LATTFLAFVLNLAFALSV+GFLIMHISLV+ NTT
Sbjct  187  VLMPHFIAFFSDEEIPGTPGTLATTFLAFVLNLAFALSVMGFLIMHISLVAGNTT  241



>ref|XP_011469138.1| PREDICTED: probable protein S-acyltransferase 14 isoform X2 [Fragaria 
vesca subsp. vesca]
Length=307

 Score =   222 bits (566),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 141/175 (81%), Positives = 155/175 (89%), Gaps = 0/175 (0%)
 Frame = +1

Query  1    FYCLLVMLLWSYFSVVFTDPGSVPPNWKPASDEERGDTDPLTASEFGSLPPDTAQSRIRF  180
            F+ LLVMLLWSYFSVV TDPG VPPNW+PA DEERG+ DPL  SEF  L  D +  R+R+
Sbjct  67   FHSLLVMLLWSYFSVVLTDPGGVPPNWRPAVDEERGEADPLNGSEFSDLQTDPSNQRVRY  126

Query  181  CKKCNQLKPPRCHHCSVCGRCVLKMDHHCVWVVNCVGALNYKYfllflfytflettlvtl  360
            C+KCNQLKPPRCHHCSVCGRCVLKMDHHCVWVVNCVGALNYKYFLLFLFYTFLETT+VTL
Sbjct  127  CRKCNQLKPPRCHHCSVCGRCVLKMDHHCVWVVNCVGALNYKYFLLFLFYTFLETTVVTL  186

Query  361  SLLPNFLAFFGDVDIPGSAGDlattflafvlnlafalsvlGFLIMHISLVSRNTT  525
             LLP+F+AFF + +IPG+ G LATTFLAFVLNLAFALSVLGFLIMHISLV+ NTT
Sbjct  187  CLLPHFIAFFSEGEIPGTPGTLATTFLAFVLNLAFALSVLGFLIMHISLVAANTT  241



>gb|KJB09889.1| hypothetical protein B456_001G174100 [Gossypium raimondii]
 gb|KJB09892.1| hypothetical protein B456_001G174100 [Gossypium raimondii]
Length=304

 Score =   222 bits (566),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 142/175 (81%), Positives = 157/175 (90%), Gaps = 3/175 (2%)
 Frame = +1

Query  1    FYCLLVMLLWSYFSVVFTDPGSVPPNWKPASDEERGDTDPLTASEFGSLPPDTAQSRIRF  180
            F+CLLVMLLWSYFSVV TDPGS+P NW+PA DEERG+ DPL  SEF   P   +  RIR+
Sbjct  67   FHCLLVMLLWSYFSVVLTDPGSIPANWRPALDEERGEADPLNGSEFNVNP---SNQRIRY  123

Query  181  CKKCNQLKPPRCHHCSVCGRCVLKMDHHCVWVVNCVGALNYKYfllflfytflettlvtl  360
            C+KCNQLKPPRCHHCSVCGRCVLKMDHHCVWVVNCVGALNYKYFLLFLFYTFLET+LVTL
Sbjct  124  CRKCNQLKPPRCHHCSVCGRCVLKMDHHCVWVVNCVGALNYKYFLLFLFYTFLETSLVTL  183

Query  361  SLLPNFLAFFGDVDIPGSAGDlattflafvlnlafalsvlGFLIMHISLVSRNTT  525
            +LLP+F+AFF DV+IPG+ G LATTFL+FVLNLAFALSVLGFLIMHISLV+ NTT
Sbjct  184  ALLPHFIAFFSDVEIPGTPGTLATTFLSFVLNLAFALSVLGFLIMHISLVAANTT  238



>gb|KJB09890.1| hypothetical protein B456_001G174100 [Gossypium raimondii]
Length=297

 Score =   222 bits (565),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 142/175 (81%), Positives = 157/175 (90%), Gaps = 3/175 (2%)
 Frame = +1

Query  1    FYCLLVMLLWSYFSVVFTDPGSVPPNWKPASDEERGDTDPLTASEFGSLPPDTAQSRIRF  180
            F+CLLVMLLWSYFSVV TDPGS+P NW+PA DEERG+ DPL  SEF   P   +  RIR+
Sbjct  60   FHCLLVMLLWSYFSVVLTDPGSIPANWRPALDEERGEADPLNGSEFNVNP---SNQRIRY  116

Query  181  CKKCNQLKPPRCHHCSVCGRCVLKMDHHCVWVVNCVGALNYKYfllflfytflettlvtl  360
            C+KCNQLKPPRCHHCSVCGRCVLKMDHHCVWVVNCVGALNYKYFLLFLFYTFLET+LVTL
Sbjct  117  CRKCNQLKPPRCHHCSVCGRCVLKMDHHCVWVVNCVGALNYKYFLLFLFYTFLETSLVTL  176

Query  361  SLLPNFLAFFGDVDIPGSAGDlattflafvlnlafalsvlGFLIMHISLVSRNTT  525
            +LLP+F+AFF DV+IPG+ G LATTFL+FVLNLAFALSVLGFLIMHISLV+ NTT
Sbjct  177  ALLPHFIAFFSDVEIPGTPGTLATTFLSFVLNLAFALSVLGFLIMHISLVAANTT  231



>ref|XP_004133913.1| PREDICTED: probable S-acyltransferase At3g60800-like [Cucumis 
sativus]
 ref|XP_004170066.1| PREDICTED: probable S-acyltransferase At3g60800-like [Cucumis 
sativus]
 gb|KGN56601.1| hypothetical protein Csa_3G126160 [Cucumis sativus]
Length=307

 Score =   222 bits (566),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 137/175 (78%), Positives = 154/175 (88%), Gaps = 0/175 (0%)
 Frame = +1

Query  1    FYCLLVMLLWSYFSVVFTDPGSVPPNWKPASDEERGDTDPLTASEFGSLPPDTAQSRIRF  180
            F+CLLVMLLWSYFSVV TDPGSVPPNW+PA DEER + DPL   EF  L P+ +  RIR+
Sbjct  67   FHCLLVMLLWSYFSVVLTDPGSVPPNWRPAVDEERAEGDPLNTMEFSILHPELSNQRIRY  126

Query  181  CKKCNQLKPPRCHHCSVCGRCVLKMDHHCVWVVNCVGALNYKYfllflfytflettlvtl  360
            C+KCN LKPPRCHHCSVCGRCVLKMDHHCVWVVNCVGALNYKYFLLFL YTFLET++VTL
Sbjct  127  CRKCNHLKPPRCHHCSVCGRCVLKMDHHCVWVVNCVGALNYKYFLLFLLYTFLETSVVTL  186

Query  361  SLLPNFLAFFGDVDIPGSAGDlattflafvlnlafalsvlGFLIMHISLVSRNTT  525
            SLLP+F+AFF + +IPG+   LATTF+AFVLNLAFALSV+GFLIMHISLV+ NTT
Sbjct  187  SLLPHFIAFFSEGEIPGTPSTLATTFIAFVLNLAFALSVMGFLIMHISLVAANTT  241



>ref|XP_006851861.1| hypothetical protein AMTR_s00041p00097340 [Amborella trichopoda]
 gb|ERN13328.1| hypothetical protein AMTR_s00041p00097340 [Amborella trichopoda]
Length=305

 Score =   222 bits (566),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 143/182 (79%), Positives = 159/182 (87%), Gaps = 7/182 (4%)
 Frame = +1

Query  1    FYCLLVMLLWSYFSVVFTDPGSVPPNWKPASDEERGDTDPLTASEFG-------SLPPDT  159
            F+ LL MLLWSYFSVVFTDPG VPPNW+P  DEERG+  PL +SEF        S+  D+
Sbjct  60   FHGLLAMLLWSYFSVVFTDPGGVPPNWRPVIDEERGENVPLASSEFSGQTMLQSSVLVDS  119

Query  160  AQSRIRFCKKCNQLKPPRCHHCSVCGRCVLKMDHHCVWVVNCVGALNYKYfllflfytfl  339
            + SRIR+C+KCNQ+KPPRCHHCSVCGRC+LKMDHHCVWVVNCVGALNYKYFLLFLFYTFL
Sbjct  120  SNSRIRYCRKCNQMKPPRCHHCSVCGRCILKMDHHCVWVVNCVGALNYKYFLLFLFYTFL  179

Query  340  ettlvtlSLLPNFLAFFGDVDIPGSAGDlattflafvlnlafalsvlGFLIMHISLVSRN  519
            ETTLV++SLLPNF+AFF D +IPG+AG LATTFLAFVLNLAFALSVLGFLIMHISLVS N
Sbjct  180  ETTLVSISLLPNFIAFFSDNEIPGTAGTLATTFLAFVLNLAFALSVLGFLIMHISLVSGN  239

Query  520  TT  525
            TT
Sbjct  240  TT  241



>ref|XP_010056317.1| PREDICTED: probable protein S-acyltransferase 14 [Eucalyptus 
grandis]
Length=307

 Score =   222 bits (566),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 140/175 (80%), Positives = 156/175 (89%), Gaps = 0/175 (0%)
 Frame = +1

Query  1    FYCLLVMLLWSYFSVVFTDPGSVPPNWKPASDEERGDTDPLTASEFGSLPPDTAQSRIRF  180
            F+CLLVMLLWSYFSVV TDPG +PPNW+P+ DEERG++DPL   +F  L  D +  RIRF
Sbjct  67   FHCLLVMLLWSYFSVVLTDPGGIPPNWRPSVDEERGESDPLNGLDFSVLQSDPSHRRIRF  126

Query  181  CKKCNQLKPPRCHHCSVCGRCVLKMDHHCVWVVNCVGALNYKYfllflfytflettlvtl  360
            C+KCNQ KPPRCHHCSVCGRCVLKMDHHCVWVVNCVGALNYKYFLLFLFYTFLET++VTL
Sbjct  127  CRKCNQPKPPRCHHCSVCGRCVLKMDHHCVWVVNCVGALNYKYFLLFLFYTFLETSVVTL  186

Query  361  SLLPNFLAFFGDVDIPGSAGDlattflafvlnlafalsvlGFLIMHISLVSRNTT  525
            SLLP+F+AFF D +IPG+ G LATTFLAFVLNLAFALSVLGFL+MHISLVS NTT
Sbjct  187  SLLPHFIAFFSDGEIPGTPGTLATTFLAFVLNLAFALSVLGFLVMHISLVSANTT  241



>ref|XP_010255627.1| PREDICTED: probable protein S-acyltransferase 14 [Nelumbo nucifera]
Length=316

 Score =   222 bits (565),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 144/184 (78%), Positives = 157/184 (85%), Gaps = 9/184 (5%)
 Frame = +1

Query  1    FYCLLVMLLWSYFSVVFTDPGSVPPNWKPASDEERGDTDPLTASEFGS---------LPP  153
            F+ LLVMLLWSYFSVV TDPGSVPPNW+P  DEERG+ DPLT  EFG+         + P
Sbjct  67   FHGLLVMLLWSYFSVVLTDPGSVPPNWRPTLDEERGENDPLTGIEFGAAGAGLQQSAMLP  126

Query  154  DTAQSRIRFCKKCNQLKPPRCHHCSVCGRCVLKMDHHCVWVVNCVGALNYKYfllflfyt  333
            D A  R R+C+KCNQLKPPRCHHCSVCGRCVLKMDHHCVWVVNCVGALNYKYFLLFLFYT
Sbjct  127  DPANPRFRYCRKCNQLKPPRCHHCSVCGRCVLKMDHHCVWVVNCVGALNYKYFLLFLFYT  186

Query  334  flettlvtlSLLPNFLAFFGDVDIPGSAGDlattflafvlnlafalsvlGFLIMHISLVS  513
            FLETTLVTLSLLP+F+AFF D +IPG+ G LATTFL FVLNLAFALSV+GFLIMHISLV+
Sbjct  187  FLETTLVTLSLLPHFIAFFSDGEIPGTPGTLATTFLTFVLNLAFALSVMGFLIMHISLVA  246

Query  514  RNTT  525
             NTT
Sbjct  247  ANTT  250



>ref|XP_010469144.1| PREDICTED: probable protein S-acyltransferase 14 [Camelina sativa]
Length=307

 Score =   221 bits (564),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 141/176 (80%), Positives = 159/176 (90%), Gaps = 1/176 (1%)
 Frame = +1

Query  1    FYCLLVMLLWSYFSVVFTDPGSVPPNWKPASDEERGDTDPLTASEF-GSLPPDTAQSRIR  177
            F+ LL MLLWSYFSVVFTDPG VPPNW+P++DEERG++DPL + EF G  PPD++  R+R
Sbjct  68   FHFLLAMLLWSYFSVVFTDPGVVPPNWRPSTDEERGESDPLNSLEFVGLQPPDSSNPRVR  127

Query  178  FCKKCNQLKPPRCHHCSVCGRCVLKMDHHCVWVVNCVGALNYKYfllflfytflettlvt  357
            FC+KCNQLKP RCHHCSVCGRCVLKMDHHCVWVVNCVGALNYKYFLLFLFYTFLETTLVT
Sbjct  128  FCRKCNQLKPSRCHHCSVCGRCVLKMDHHCVWVVNCVGALNYKYFLLFLFYTFLETTLVT  187

Query  358  lSLLPNFLAFFGDVDIPGSAGDlattflafvlnlafalsvlGFLIMHISLVSRNTT  525
            L L+P+F+AFF D +IPG+ G LATTFLAFVLNLAFALSV+GFLIMHISLV+ NTT
Sbjct  188  LVLMPHFIAFFSDEEIPGTPGTLATTFLAFVLNLAFALSVMGFLIMHISLVAGNTT  243



>ref|XP_010413516.1| PREDICTED: probable protein S-acyltransferase 14 [Camelina sativa]
Length=307

 Score =   221 bits (564),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 141/176 (80%), Positives = 159/176 (90%), Gaps = 1/176 (1%)
 Frame = +1

Query  1    FYCLLVMLLWSYFSVVFTDPGSVPPNWKPASDEERGDTDPLTASEF-GSLPPDTAQSRIR  177
            F+ LL MLLWSYFSVVFTDPG VPPNW+P++DEERG++DPL + EF G  PPD++  R+R
Sbjct  68   FHFLLAMLLWSYFSVVFTDPGVVPPNWRPSTDEERGESDPLNSLEFVGLQPPDSSNPRVR  127

Query  178  FCKKCNQLKPPRCHHCSVCGRCVLKMDHHCVWVVNCVGALNYKYfllflfytflettlvt  357
            FC+KCNQLKP RCHHCSVCGRCVLKMDHHCVWVVNCVGALNYKYFLLFLFYTFLETTLVT
Sbjct  128  FCRKCNQLKPSRCHHCSVCGRCVLKMDHHCVWVVNCVGALNYKYFLLFLFYTFLETTLVT  187

Query  358  lSLLPNFLAFFGDVDIPGSAGDlattflafvlnlafalsvlGFLIMHISLVSRNTT  525
            L L+P+F+AFF D +IPG+ G LATTFLAFVLNLAFALSV+GFLIMHISLV+ NTT
Sbjct  188  LVLMPHFIAFFSDEEIPGTPGTLATTFLAFVLNLAFALSVMGFLIMHISLVAGNTT  243



>ref|XP_011017489.1| PREDICTED: probable protein S-acyltransferase 14 [Populus euphratica]
Length=307

 Score =   221 bits (563),  Expect = 4e-68, Method: Compositional matrix adjust.
 Identities = 142/175 (81%), Positives = 154/175 (88%), Gaps = 0/175 (0%)
 Frame = +1

Query  1    FYCLLVMLLWSYFSVVFTDPGSVPPNWKPASDEERGDTDPLTASEFGSLPPDTAQSRIRF  180
            F+ LLVMLLWSYFSVV TDPGSVPPNW+PA DEERG+ D L  SE   +  D    RIR+
Sbjct  67   FHSLLVMLLWSYFSVVLTDPGSVPPNWRPAIDEERGEADALNGSECSGVQSDQLNQRIRY  126

Query  181  CKKCNQLKPPRCHHCSVCGRCVLKMDHHCVWVVNCVGALNYKYfllflfytflettlvtl  360
            C+KCNQLKPPRCHHCSVCGRCVLKMDHHCVWVVNCVGALNYKYFLLFLFYTFLET+LVTL
Sbjct  127  CRKCNQLKPPRCHHCSVCGRCVLKMDHHCVWVVNCVGALNYKYFLLFLFYTFLETSLVTL  186

Query  361  SLLPNFLAFFGDVDIPGSAGDlattflafvlnlafalsvlGFLIMHISLVSRNTT  525
            SLLP+F+AFF D +IPG+ G LATTFLAFV+NLAFALSVLGFLIMHISLVS NTT
Sbjct  187  SLLPHFIAFFSDGEIPGTPGTLATTFLAFVINLAFALSVLGFLIMHISLVSANTT  241



>ref|XP_003517050.1| PREDICTED: probable protein S-acyltransferase 14-like isoform 
1 [Glycine max]
 gb|KHN40156.1| Putative S-acyltransferase [Glycine soja]
Length=304

 Score =   221 bits (562),  Expect = 5e-68, Method: Compositional matrix adjust.
 Identities = 142/175 (81%), Positives = 155/175 (89%), Gaps = 1/175 (1%)
 Frame = +1

Query  1    FYCLLVMLLWSYFSVVFTDPGSVPPNWKPASDEERGDTDPLTASEFGSLPPDTAQSRIRF  180
            F+ LLVMLLWSYFSVVFTDPGSVPPNWKP  DEERG+ DPL  +EF ++  D  Q R+R+
Sbjct  67   FHSLLVMLLWSYFSVVFTDPGSVPPNWKPMIDEERGEADPLVGTEFSNVLSDPNQ-RVRY  125

Query  181  CKKCNQLKPPRCHHCSVCGRCVLKMDHHCVWVVNCVGALNYKYfllflfytflettlvtl  360
            C+KCNQLKPPRCHHCSVCGRCVLKMDHHCVWVVNCVGALNYK FLLFLFYTFLETTLVT 
Sbjct  126  CRKCNQLKPPRCHHCSVCGRCVLKMDHHCVWVVNCVGALNYKCFLLFLFYTFLETTLVTA  185

Query  361  SLLPNFLAFFGDVDIPGSAGDlattflafvlnlafalsvlGFLIMHISLVSRNTT  525
            SLLP+F+ FF D +IPG+ G LATTFLAFVLNLAFALSVLGFLIMHISLV+ NTT
Sbjct  186  SLLPHFITFFSDGEIPGTPGSLATTFLAFVLNLAFALSVLGFLIMHISLVAANTT  240



>ref|XP_008438165.1| PREDICTED: probable protein S-acyltransferase 14 [Cucumis melo]
Length=307

 Score =   221 bits (562),  Expect = 6e-68, Method: Compositional matrix adjust.
 Identities = 136/175 (78%), Positives = 153/175 (87%), Gaps = 0/175 (0%)
 Frame = +1

Query  1    FYCLLVMLLWSYFSVVFTDPGSVPPNWKPASDEERGDTDPLTASEFGSLPPDTAQSRIRF  180
            F+CLLVMLLWSYFSVV TDPGSVPPNW+P  DEER + DPL   EF  L P+ +  RIR+
Sbjct  67   FHCLLVMLLWSYFSVVLTDPGSVPPNWRPVVDEERAEGDPLNTMEFSILHPELSNQRIRY  126

Query  181  CKKCNQLKPPRCHHCSVCGRCVLKMDHHCVWVVNCVGALNYKYfllflfytflettlvtl  360
            C+KCN LKPPRCHHCSVCGRCVLKMDHHCVWVVNCVGALNYKYFLLFL YTFLET++VTL
Sbjct  127  CRKCNHLKPPRCHHCSVCGRCVLKMDHHCVWVVNCVGALNYKYFLLFLLYTFLETSVVTL  186

Query  361  SLLPNFLAFFGDVDIPGSAGDlattflafvlnlafalsvlGFLIMHISLVSRNTT  525
            SLLP+F+AFF + +IPG+   LATTF+AFVLNLAFALSV+GFLIMHISLV+ NTT
Sbjct  187  SLLPHFIAFFSEGEIPGTPSTLATTFIAFVLNLAFALSVMGFLIMHISLVAANTT  241



>ref|XP_008343300.1| PREDICTED: probable protein S-acyltransferase 14 [Malus domestica]
Length=307

 Score =   220 bits (561),  Expect = 9e-68, Method: Compositional matrix adjust.
 Identities = 140/175 (80%), Positives = 156/175 (89%), Gaps = 0/175 (0%)
 Frame = +1

Query  1    FYCLLVMLLWSYFSVVFTDPGSVPPNWKPASDEERGDTDPLTASEFGSLPPDTAQSRIRF  180
            F+CLLVMLLWSYFSVV TDPG VPPNW+PA DEERG  DPLT S+F  L PD +  RIR+
Sbjct  67   FHCLLVMLLWSYFSVVLTDPGGVPPNWRPAVDEERGQADPLTWSDFNGLQPDPSNLRIRY  126

Query  181  CKKCNQLKPPRCHHCSVCGRCVLKMDHHCVWVVNCVGALNYKYfllflfytflettlvtl  360
            C+KCNQLKPPRCHHCSVCGRCVLKMDHHCVWVV+CVGALNYKYFLLFLFYTFLET++VTL
Sbjct  127  CRKCNQLKPPRCHHCSVCGRCVLKMDHHCVWVVHCVGALNYKYFLLFLFYTFLETSVVTL  186

Query  361  SLLPNFLAFFGDVDIPGSAGDlattflafvlnlafalsvlGFLIMHISLVSRNTT  525
            SLLP+ ++FF + +IPG+   LATTFLAFVLNLAFALSVLGFLIMHISLV+ NTT
Sbjct  187  SLLPHLISFFNEGEIPGTPSTLATTFLAFVLNLAFALSVLGFLIMHISLVAANTT  241



>emb|CDY52347.1| BnaA09g38960D [Brassica napus]
Length=305

 Score =   220 bits (560),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 139/175 (79%), Positives = 158/175 (90%), Gaps = 0/175 (0%)
 Frame = +1

Query  1    FYCLLVMLLWSYFSVVFTDPGSVPPNWKPASDEERGDTDPLTASEFGSLPPDTAQSRIRF  180
            F+ LL MLLWSYFSVVFTDPG+VP NW+PA+DEERG++DPLT+ EF  L  D++  R+RF
Sbjct  67   FHFLLAMLLWSYFSVVFTDPGAVPANWRPAADEERGESDPLTSLEFVGLQTDSSNPRVRF  126

Query  181  CKKCNQLKPPRCHHCSVCGRCVLKMDHHCVWVVNCVGALNYKYfllflfytflettlvtl  360
            C+KCNQ KPPRCHHCSVCGRCVLKMDHHCVWVVNCVGALNYKYFLLFLFYTFLETTLVTL
Sbjct  127  CRKCNQPKPPRCHHCSVCGRCVLKMDHHCVWVVNCVGALNYKYFLLFLFYTFLETTLVTL  186

Query  361  SLLPNFLAFFGDVDIPGSAGDlattflafvlnlafalsvlGFLIMHISLVSRNTT  525
             L+P+F+AFF D +IPG+ G LATTFLAFVLNLAFALSV+GFLIMH+SLV+ NTT
Sbjct  187  VLMPHFIAFFSDEEIPGTPGTLATTFLAFVLNLAFALSVMGFLIMHMSLVAGNTT  241



>ref|XP_003605089.1| Palmitoyltransferase pfa3 [Medicago truncatula]
Length=292

 Score =   219 bits (558),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 128/175 (73%), Positives = 144/175 (82%), Gaps = 6/175 (3%)
 Frame = +1

Query  1    FYCLLVMLLWSYFSVVFTDPGSVPPNWKPASDEERGDTDPLTASEFGSLPPDTAQSRIRF  180
            F+ LLVMLLWSYFSVVF DPGSVPPNW+P  DEERG+ DPL  SEF ++  D +  RIR+
Sbjct  60   FHALLVMLLWSYFSVVFIDPGSVPPNWRPTIDEERGEEDPLVGSEFSNVQCDPSNQRIRY  119

Query  181  CKKCNQLKPPRCHHCSVCGRCVLKMDHHCVWVVNCVGALNYKYfllflfytflettlvtl  360
            C+KCNQLKPPRCHHCSVCGRCVLKMDHHCVWVVNCVGALNY +         L T+LVT 
Sbjct  120  CRKCNQLKPPRCHHCSVCGRCVLKMDHHCVWVVNCVGALNYNF------ILSLSTSLVTA  173

Query  361  SLLPNFLAFFGDVDIPGSAGDlattflafvlnlafalsvlGFLIMHISLVSRNTT  525
            SLLP+F+AFF D +IPG+   LATTFLAFVLNLAFALSV+GFLIMHISLV+ NTT
Sbjct  174  SLLPHFIAFFSDGEIPGTPSSLATTFLAFVLNLAFALSVMGFLIMHISLVAANTT  228



>ref|XP_010276626.1| PREDICTED: probable protein S-acyltransferase 14 [Nelumbo nucifera]
 ref|XP_010276634.1| PREDICTED: probable protein S-acyltransferase 14 [Nelumbo nucifera]
Length=316

 Score =   220 bits (560),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 141/184 (77%), Positives = 156/184 (85%), Gaps = 9/184 (5%)
 Frame = +1

Query  1    FYCLLVMLLWSYFSVVFTDPGSVPPNWKPASDEERGDTDPLTASEFGS---------LPP  153
            F+ LLVMLLWSYFSVV TDPG VPPNW+P  DEERG+ DPLT  EFG+         + P
Sbjct  67   FHGLLVMLLWSYFSVVLTDPGGVPPNWRPTIDEERGEGDPLTGIEFGATGAGLQQSAVLP  126

Query  154  DTAQSRIRFCKKCNQLKPPRCHHCSVCGRCVLKMDHHCVWVVNCVGALNYKYfllflfyt  333
            D A  R+R+C+KCNQLKPPRCHHCSVCGRCVLKMDHHCVWVVNCVGALNYKYFLLFL YT
Sbjct  127  DPANPRVRYCRKCNQLKPPRCHHCSVCGRCVLKMDHHCVWVVNCVGALNYKYFLLFLLYT  186

Query  334  flettlvtlSLLPNFLAFFGDVDIPGSAGDlattflafvlnlafalsvlGFLIMHISLVS  513
            FLETTLVTLSLLP+F+AFF D +IPG+ G LATTFL FVLNLAFALSV+GFLIMH+SLV+
Sbjct  187  FLETTLVTLSLLPHFVAFFSDGEIPGTPGTLATTFLTFVLNLAFALSVMGFLIMHVSLVA  246

Query  514  RNTT  525
             NTT
Sbjct  247  ANTT  250



>gb|AES87286.2| DHHC-type zinc finger protein [Medicago truncatula]
Length=299

 Score =   219 bits (558),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 128/175 (73%), Positives = 144/175 (82%), Gaps = 6/175 (3%)
 Frame = +1

Query  1    FYCLLVMLLWSYFSVVFTDPGSVPPNWKPASDEERGDTDPLTASEFGSLPPDTAQSRIRF  180
            F+ LLVMLLWSYFSVVF DPGSVPPNW+P  DEERG+ DPL  SEF ++  D +  RIR+
Sbjct  67   FHALLVMLLWSYFSVVFIDPGSVPPNWRPTIDEERGEEDPLVGSEFSNVQCDPSNQRIRY  126

Query  181  CKKCNQLKPPRCHHCSVCGRCVLKMDHHCVWVVNCVGALNYKYfllflfytflettlvtl  360
            C+KCNQLKPPRCHHCSVCGRCVLKMDHHCVWVVNCVGALNY +         L T+LVT 
Sbjct  127  CRKCNQLKPPRCHHCSVCGRCVLKMDHHCVWVVNCVGALNYNF------ILSLSTSLVTA  180

Query  361  SLLPNFLAFFGDVDIPGSAGDlattflafvlnlafalsvlGFLIMHISLVSRNTT  525
            SLLP+F+AFF D +IPG+   LATTFLAFVLNLAFALSV+GFLIMHISLV+ NTT
Sbjct  181  SLLPHFIAFFSDGEIPGTPSSLATTFLAFVLNLAFALSVMGFLIMHISLVAANTT  235



>ref|XP_010692246.1| PREDICTED: probable protein S-acyltransferase 14 [Beta vulgaris 
subsp. vulgaris]
Length=307

 Score =   219 bits (559),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 138/175 (79%), Positives = 155/175 (89%), Gaps = 0/175 (0%)
 Frame = +1

Query  1    FYCLLVMLLWSYFSVVFTDPGSVPPNWKPASDEERGDTDPLTASEFGSLPPDTAQSRIRF  180
            F+ LL MLLWSYFSVVFTDPG VP NW+P+ DEERG+ DPLTAS+F  +  D + +++R 
Sbjct  67   FHGLLAMLLWSYFSVVFTDPGGVPSNWRPSVDEERGENDPLTASDFSGVQSDPSHTKVRA  126

Query  181  CKKCNQLKPPRCHHCSVCGRCVLKMDHHCVWVVNCVGALNYKYfllflfytflettlvtl  360
            C+KCNQLKPPRCHHCSVCGRCVLKMDHHCVWVVNCVGALNYKYFLLFLFYTFLETT+VT+
Sbjct  127  CRKCNQLKPPRCHHCSVCGRCVLKMDHHCVWVVNCVGALNYKYFLLFLFYTFLETTVVTI  186

Query  361  SLLPNFLAFFGDVDIPGSAGDlattflafvlnlafalsvlGFLIMHISLVSRNTT  525
            SLLP F+AFF D +IPGS   LATTFLAFVLNLAFALSV+GFLIMHISLV+ NTT
Sbjct  187  SLLPQFIAFFSDGEIPGSPSSLATTFLAFVLNLAFALSVMGFLIMHISLVAANTT  241



>gb|ACU19432.1| unknown [Glycine max]
Length=307

 Score =   219 bits (557),  Expect = 4e-67, Method: Compositional matrix adjust.
 Identities = 132/175 (75%), Positives = 152/175 (87%), Gaps = 0/175 (0%)
 Frame = +1

Query  1    FYCLLVMLLWSYFSVVFTDPGSVPPNWKPASDEERGDTDPLTASEFGSLPPDTAQSRIRF  180
            F+CLLVMLLW YF+VVF DPG+VPPNWKPA+DEERG+ DPL   E  +L  D+A  R R+
Sbjct  67   FHCLLVMLLWCYFAVVFMDPGTVPPNWKPAADEERGEVDPLNGVELSNLQSDSANQRFRY  126

Query  181  CKKCNQLKPPRCHHCSVCGRCVLKMDHHCVWVVNCVGALNYKYfllflfytflettlvtl  360
            C+KC+Q KPPRCHHCSVCGRCVLKMDHHCVWVVNCVGALNYKYFLLFL YTFLETTLVT+
Sbjct  127  CRKCSQPKPPRCHHCSVCGRCVLKMDHHCVWVVNCVGALNYKYFLLFLVYTFLETTLVTI  186

Query  361  SLLPNFLAFFGDVDIPGSAGDlattflafvlnlafalsvlGFLIMHISLVSRNTT  525
            SLLP+F  +F D +IPG+ G LATTFL FVLNLAF+LSVLGFL++H+SLV+ NTT
Sbjct  187  SLLPHFKTYFSDGEIPGTPGTLATTFLTFVLNLAFSLSVLGFLVLHVSLVASNTT  241



>ref|XP_007052066.1| DHHC-type zinc finger family protein isoform 1 [Theobroma cacao]
 gb|EOX96223.1| DHHC-type zinc finger family protein isoform 1 [Theobroma cacao]
Length=353

 Score =   219 bits (557),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 142/175 (81%), Positives = 155/175 (89%), Gaps = 3/175 (2%)
 Frame = +1

Query  1    FYCLLVMLLWSYFSVVFTDPGSVPPNWKPASDEERGDTDPLTASEFGSLPPDTAQSRIRF  180
            F+CLLVMLLWSYFSVV TDPGSVPPNW+PA DEERG+ DPL  SEF  L  D +  RIR+
Sbjct  67   FHCLLVMLLWSYFSVVLTDPGSVPPNWRPAMDEERGEVDPLNGSEFNGLQSDPSNQRIRY  126

Query  181  CKKCNQLKPPRCHHCSVCGRCVLKMDHHCVWVVNCVGALNYKYfllflfytflettlvtl  360
            C+KCNQLKPPRCHH   CGRCVLKMDHHCVWVVNCVGALNYKYFLLFLFYTFLET+LVTL
Sbjct  127  CRKCNQLKPPRCHH---CGRCVLKMDHHCVWVVNCVGALNYKYFLLFLFYTFLETSLVTL  183

Query  361  SLLPNFLAFFGDVDIPGSAGDlattflafvlnlafalsvlGFLIMHISLVSRNTT  525
            +LLP+F+AFF D +IPG+ G LATTFLAFVLNLAFALSVLGFLIMHISLV+ NTT
Sbjct  184  ALLPHFIAFFSDEEIPGTPGILATTFLAFVLNLAFALSVLGFLIMHISLVAANTT  238



>gb|KHN29455.1| Putative S-acyltransferase [Glycine soja]
Length=307

 Score =   217 bits (553),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 132/175 (75%), Positives = 151/175 (86%), Gaps = 0/175 (0%)
 Frame = +1

Query  1    FYCLLVMLLWSYFSVVFTDPGSVPPNWKPASDEERGDTDPLTASEFGSLPPDTAQSRIRF  180
            F+CLLVMLLW YF+VVF DPG+VPPNWKPA+DEERG+ DPL   E  +L  D A  R R+
Sbjct  67   FHCLLVMLLWCYFAVVFMDPGTVPPNWKPAADEERGEVDPLNGVELSNLQSDPANQRFRY  126

Query  181  CKKCNQLKPPRCHHCSVCGRCVLKMDHHCVWVVNCVGALNYKYfllflfytflettlvtl  360
            C+KC+Q KPPRCHHCSVCGRCVLKMDHHCVWVVNCVGALNYKYFLLFL YTFLETTLVT+
Sbjct  127  CRKCSQPKPPRCHHCSVCGRCVLKMDHHCVWVVNCVGALNYKYFLLFLVYTFLETTLVTI  186

Query  361  SLLPNFLAFFGDVDIPGSAGDlattflafvlnlafalsvlGFLIMHISLVSRNTT  525
            SLLP+F  +F D +IPG+ G LATTFL FVLNLAF+LSVLGFL++H+SLV+ NTT
Sbjct  187  SLLPHFKTYFSDGEIPGTPGTLATTFLTFVLNLAFSLSVLGFLVLHVSLVASNTT  241



>ref|XP_006587892.1| PREDICTED: probable protein S-acyltransferase 14-like [Glycine 
max]
Length=307

 Score =   217 bits (553),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 132/175 (75%), Positives = 151/175 (86%), Gaps = 0/175 (0%)
 Frame = +1

Query  1    FYCLLVMLLWSYFSVVFTDPGSVPPNWKPASDEERGDTDPLTASEFGSLPPDTAQSRIRF  180
            F+CLLVMLLW YF+VVF DPG+VPPNWKPA+DEERG+ DPL   E  +L  D A  R R+
Sbjct  67   FHCLLVMLLWCYFAVVFMDPGTVPPNWKPAADEERGEVDPLNGVELSNLQSDPANQRFRY  126

Query  181  CKKCNQLKPPRCHHCSVCGRCVLKMDHHCVWVVNCVGALNYKYfllflfytflettlvtl  360
            C+KC+Q KPPRCHHCSVCGRCVLKMDHHCVWVVNCVGALNYKYFLLFL YTFLETTLVT+
Sbjct  127  CRKCSQPKPPRCHHCSVCGRCVLKMDHHCVWVVNCVGALNYKYFLLFLVYTFLETTLVTI  186

Query  361  SLLPNFLAFFGDVDIPGSAGDlattflafvlnlafalsvlGFLIMHISLVSRNTT  525
            SLLP+F  +F D +IPG+ G LATTFL FVLNLAF+LSVLGFL++H+SLV+ NTT
Sbjct  187  SLLPHFKTYFSDGEIPGTPGTLATTFLTFVLNLAFSLSVLGFLVLHVSLVASNTT  241



>ref|XP_008232660.1| PREDICTED: probable protein S-acyltransferase 14 isoform X1 [Prunus 
mume]
Length=581

 Score =   224 bits (571),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 141/175 (81%), Positives = 157/175 (90%), Gaps = 0/175 (0%)
 Frame = +1

Query  1    FYCLLVMLLWSYFSVVFTDPGSVPPNWKPASDEERGDTDPLTASEFGSLPPDTAQSRIRF  180
            F+CLLVMLLWSYFSVV TDPG VPPNW+PA DEERG+ DPLT S+F  L  D +  RIR+
Sbjct  341  FHCLLVMLLWSYFSVVLTDPGCVPPNWRPAVDEERGEADPLTGSDFSGLQTDPSNQRIRY  400

Query  181  CKKCNQLKPPRCHHCSVCGRCVLKMDHHCVWVVNCVGALNYKYfllflfytflettlvtl  360
            C+KCNQLKPPRCHHCSVCGRCVLKMDHHCVWVVNCVGALNYKYFLLFLFYTFLET++VTL
Sbjct  401  CRKCNQLKPPRCHHCSVCGRCVLKMDHHCVWVVNCVGALNYKYFLLFLFYTFLETSVVTL  460

Query  361  SLLPNFLAFFGDVDIPGSAGDlattflafvlnlafalsvlGFLIMHISLVSRNTT  525
            SLLP+F++FF + +IPG+   LATTFLAFVLNLAFALSVLGFLIMHISLV+ NTT
Sbjct  461  SLLPHFISFFSEGEIPGTPSTLATTFLAFVLNLAFALSVLGFLIMHISLVAANTT  515



>ref|XP_002878349.1| zinc finger family protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH54608.1| zinc finger family protein [Arabidopsis lyrata subsp. lyrata]
Length=306

 Score =   217 bits (552),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 138/176 (78%), Positives = 158/176 (90%), Gaps = 1/176 (1%)
 Frame = +1

Query  1    FYCLLVMLLWSYFSVVFTDPGSVPPNWKPASDEERGDTDPLTASEFGSLPPDTAQS-RIR  177
            F+ LL MLLWSYFSVVFTDPG VPPNW+P++DEERG++DPL + EF  L  D++ + R+R
Sbjct  67   FHFLLAMLLWSYFSVVFTDPGVVPPNWRPSTDEERGESDPLNSLEFVGLQADSSSNPRVR  126

Query  178  FCKKCNQLKPPRCHHCSVCGRCVLKMDHHCVWVVNCVGALNYKYfllflfytflettlvt  357
            FC+KCNQLKP RCHHCSVCGRCVLKMDHHCVWVVNCVGALNYKYFLLFLFYTFLETTLVT
Sbjct  127  FCRKCNQLKPSRCHHCSVCGRCVLKMDHHCVWVVNCVGALNYKYFLLFLFYTFLETTLVT  186

Query  358  lSLLPNFLAFFGDVDIPGSAGDlattflafvlnlafalsvlGFLIMHISLVSRNTT  525
            + L+P+F+AFF D +IPG+ G LATTFLAFVLNLAFALSV+GFLIMHISLV+ NTT
Sbjct  187  MVLMPHFIAFFSDEEIPGTPGTLATTFLAFVLNLAFALSVMGFLIMHISLVAGNTT  242



>ref|XP_010508175.1| PREDICTED: probable protein S-acyltransferase 14 [Camelina sativa]
 ref|XP_010508176.1| PREDICTED: probable protein S-acyltransferase 14 [Camelina sativa]
Length=309

 Score =   217 bits (552),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 140/177 (79%), Positives = 155/177 (88%), Gaps = 2/177 (1%)
 Frame = +1

Query  1    FYCLLVMLLWSYFSVVFTDPGSVPPNWKPASDEER--GDTDPLTASEFGSLPPDTAQSRI  174
            F+ LL MLLWSYFSVVFTDPG VPPNW+ ASDEE+  G++DPL + EFG L PD++  R 
Sbjct  67   FHFLLAMLLWSYFSVVFTDPGVVPPNWRLASDEEQRGGESDPLNSLEFGGLHPDSSNQRT  126

Query  175  RFCKKCNQLKPPRCHHCSVCGRCVLKMDHHCVWVVNCVGALNYKYfllflfytflettlv  354
            RFC+KCNQ KPPRCHHCSVCGRCVLKMDHHCVWVVNCVGALNYKYFLLFL YTFLETTLV
Sbjct  127  RFCRKCNQPKPPRCHHCSVCGRCVLKMDHHCVWVVNCVGALNYKYFLLFLLYTFLETTLV  186

Query  355  tlSLLPNFLAFFGDVDIPGSAGDlattflafvlnlafalsvlGFLIMHISLVSRNTT  525
             L L+P+F+AFF D +IPG+ G LATTFLAFVLNLAFALSV+GFLIMHISLVS NTT
Sbjct  187  ILLLMPHFIAFFSDEEIPGTPGTLATTFLAFVLNLAFALSVMGFLIMHISLVSANTT  243



>ref|NP_191639.2| DHHC-type zinc finger family protein [Arabidopsis thaliana]
 sp|Q8VYP5.1|ZDH14_ARATH RecName: Full=Probable protein S-acyltransferase 14; AltName: 
Full=Probable palmitoyltransferase At3g60800; AltName: Full=Zinc 
finger DHHC domain-containing protein At3g60800 [Arabidopsis 
thaliana]
 gb|AAL49877.1| unknown protein [Arabidopsis thaliana]
 gb|AAM20224.1| unknown protein [Arabidopsis thaliana]
 dbj|BAF01138.1| hypothetical protein [Arabidopsis thaliana]
 gb|AEE80109.1| DHHC-type zinc finger family protein [Arabidopsis thaliana]
Length=307

 Score =   216 bits (549),  Expect = 5e-66, Method: Compositional matrix adjust.
 Identities = 139/177 (79%), Positives = 158/177 (89%), Gaps = 2/177 (1%)
 Frame = +1

Query  1    FYCLLVMLLWSYFSVVFTDPGSVPPNWKPASDEERGDTDPLTASEFGSLPPDTAQS--RI  174
            F+ LL MLLWSYFSVVFTDPG VPPNW+P++DEERG++DPL + +F  L  D++ S  R+
Sbjct  67   FHFLLAMLLWSYFSVVFTDPGVVPPNWRPSTDEERGESDPLNSLDFVGLQSDSSSSNPRV  126

Query  175  RFCKKCNQLKPPRCHHCSVCGRCVLKMDHHCVWVVNCVGALNYKYfllflfytflettlv  354
            RFC+KCNQLKP RCHHCSVCGRCVLKMDHHCVWVVNCVGALNYKYFLLFLFYTFLETTLV
Sbjct  127  RFCRKCNQLKPSRCHHCSVCGRCVLKMDHHCVWVVNCVGALNYKYFLLFLFYTFLETTLV  186

Query  355  tlSLLPNFLAFFGDVDIPGSAGDlattflafvlnlafalsvlGFLIMHISLVSRNTT  525
            TL L+P+F+AFF D +IPG+ G LATTFLAFVLNLAFALSV+GFLIMHISLV+ NTT
Sbjct  187  TLVLMPHFIAFFSDEEIPGTPGTLATTFLAFVLNLAFALSVMGFLIMHISLVAGNTT  243



>ref|XP_004952412.1| PREDICTED: probable S-acyltransferase At3g60800-like isoform 
X1 [Setaria italica]
 ref|XP_004952413.1| PREDICTED: probable S-acyltransferase At3g60800-like isoform 
X2 [Setaria italica]
Length=317

 Score =   216 bits (549),  Expect = 6e-66, Method: Compositional matrix adjust.
 Identities = 138/183 (75%), Positives = 152/183 (83%), Gaps = 8/183 (4%)
 Frame = +1

Query  1    FYCLLVMLLWSYFSVVFTDPGSVPPNWKPASDEERGDTDPLTASEFGSLP--------PD  156
            F+ LL MLLWSYFSVVFTDPG VPPNW+P  DEE G+T PL+ +EF  L          D
Sbjct  69   FHFLLAMLLWSYFSVVFTDPGGVPPNWRPDVDEESGETAPLSTAEFSDLMNSQQSMALSD  128

Query  157  TAQSRIRFCKKCNQLKPPRCHHCSVCGRCVLKMDHHCVWVVNCVGALNYKYfllflfytf  336
            T   RIR+C+KCNQLKPPRCHHCSVCGRCVLKMDHHCVWVVNCVGALNYK+FLLFL YTF
Sbjct  129  TGSPRIRYCRKCNQLKPPRCHHCSVCGRCVLKMDHHCVWVVNCVGALNYKFFLLFLLYTF  188

Query  337  lettlvtlSLLPNFLAFFGDVDIPGSAGDlattflafvlnlafalsvlGFLIMHISLVSR  516
            LET LVTLSLLP+F+AFF DV+IPG+ G LATTFL FVLNLAF LSVLGF+IMH+SLVS 
Sbjct  189  LETALVTLSLLPHFIAFFSDVEIPGTPGALATTFLTFVLNLAFTLSVLGFMIMHVSLVSG  248

Query  517  NTT  525
            NTT
Sbjct  249  NTT  251



>ref|XP_009138811.1| PREDICTED: probable protein S-acyltransferase 14 [Brassica rapa]
Length=300

 Score =   214 bits (546),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 139/175 (79%), Positives = 156/175 (89%), Gaps = 5/175 (3%)
 Frame = +1

Query  1    FYCLLVMLLWSYFSVVFTDPGSVPPNWKPASDEERGDTDPLTASEFGSLPPDTAQSRIRF  180
            F+ LL MLLWSYFSVVFTDPGSVPPNW+P++DEERG++DPL + EF     D +  R+RF
Sbjct  67   FHFLLAMLLWSYFSVVFTDPGSVPPNWRPSTDEERGESDPLNSLEF-----DNSNPRVRF  121

Query  181  CKKCNQLKPPRCHHCSVCGRCVLKMDHHCVWVVNCVGALNYKYfllflfytflettlvtl  360
            C+KCNQ KPPRCHHCSVCGRCVLKMDHHCVWVVNCVGALNYKYFLLFLFYTFLETTLVTL
Sbjct  122  CRKCNQPKPPRCHHCSVCGRCVLKMDHHCVWVVNCVGALNYKYFLLFLFYTFLETTLVTL  181

Query  361  SLLPNFLAFFGDVDIPGSAGDlattflafvlnlafalsvlGFLIMHISLVSRNTT  525
             L+P+F+AFF D +IPG+ G LATTFLAFVLNLAFALSV+GFLIMHISLV+ NTT
Sbjct  182  VLMPHFIAFFSDEEIPGTPGTLATTFLAFVLNLAFALSVMGFLIMHISLVAGNTT  236



>gb|KHG30156.1| hypothetical protein F383_14468 [Gossypium arboreum]
Length=314

 Score =   214 bits (546),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 141/182 (77%), Positives = 153/182 (84%), Gaps = 7/182 (4%)
 Frame = +1

Query  1    FYCLLVMLLWSYFSVVFTDPGSVPPNWKPASDEERGDTDPLTASEFGSLPPDTAQSRIRF  180
            F+C LVMLLWSYFSVV TDPGSVPPNW+PA DEERG+ DPL  SEF    PD    RIR+
Sbjct  67   FHCFLVMLLWSYFSVVLTDPGSVPPNWRPALDEERGEADPLNGSEFNGSQPDPLNQRIRY  126

Query  181  CKKCNQLKPPRCHHCSV-------CGRCVLKMDHHCVWVVNCVGALNYKYfllflfytfl  339
            C+KCNQLKPPRCHHCS         GRCVLKMDHHCVWVVNCVGA NYKYFLLFLFYTFL
Sbjct  127  CRKCNQLKPPRCHHCSFRINIIVSGGRCVLKMDHHCVWVVNCVGAQNYKYFLLFLFYTFL  186

Query  340  ettlvtlSLLPNFLAFFGDVDIPGSAGDlattflafvlnlafalsvlGFLIMHISLVSRN  519
            ET+LVT++LLP+F+AFF D +IPG+ G LATTFLAFVLNLAFALSVLGFLIMHISLVS N
Sbjct  187  ETSLVTMALLPHFIAFFSDGEIPGTPGTLATTFLAFVLNLAFALSVLGFLIMHISLVSAN  246

Query  520  TT  525
            TT
Sbjct  247  TT  248



>ref|XP_003579517.1| PREDICTED: probable protein S-acyltransferase 14 [Brachypodium 
distachyon]
Length=315

 Score =   214 bits (545),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 140/182 (77%), Positives = 154/182 (85%), Gaps = 7/182 (4%)
 Frame = +1

Query  1    FYCLLVMLLWSYFSVVFTDPGSVPPNWKPASDEERGDTDPLTASEFGS-------LPPDT  159
            F+ LL MLLW YFSVVFTDPGSVPPNW    DEERG+T PL++SEF S       +  DT
Sbjct  68   FHFLLGMLLWCYFSVVFTDPGSVPPNWNLDFDEERGETAPLSSSEFSSQMNSQQSMVSDT  127

Query  160  AQSRIRFCKKCNQLKPPRCHHCSVCGRCVLKMDHHCVWVVNCVGALNYKYfllflfytfl  339
               R+R+C+KCNQLKPPRCHHCSVCGRC+LKMDHHCVWVVNCVGALNYKYFLLFLFYTFL
Sbjct  128  GNPRMRYCRKCNQLKPPRCHHCSVCGRCILKMDHHCVWVVNCVGALNYKYFLLFLFYTFL  187

Query  340  ettlvtlSLLPNFLAFFGDVDIPGSAGDlattflafvlnlafalsvlGFLIMHISLVSRN  519
            ETTLVTLSLLP F+AFF D+DIPGS   LATTFL FVLNLAF+LS+LGFLIMH+SLVS N
Sbjct  188  ETTLVTLSLLPQFIAFFSDIDIPGSPAALATTFLTFVLNLAFSLSILGFLIMHVSLVSAN  247

Query  520  TT  525
            TT
Sbjct  248  TT  249



>ref|XP_006397719.1| hypothetical protein EUTSA_v10001560mg [Eutrema salsugineum]
 gb|ESQ39172.1| hypothetical protein EUTSA_v10001560mg [Eutrema salsugineum]
Length=308

 Score =   214 bits (544),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 140/176 (80%), Positives = 155/176 (88%), Gaps = 1/176 (1%)
 Frame = +1

Query  1    FYCLLVMLLWSYFSVVFTDPGSVPPNWKPASDEE-RGDTDPLTASEFGSLPPDTAQSRIR  177
            F+ LL MLLWSYFSVVFTDPG V PNW+ ASDEE RG++DPL + EFG L PD++  R R
Sbjct  67   FHFLLAMLLWSYFSVVFTDPGVVSPNWRSASDEEQRGESDPLNSLEFGGLQPDSSNQRTR  126

Query  178  FCKKCNQLKPPRCHHCSVCGRCVLKMDHHCVWVVNCVGALNYKYfllflfytflettlvt  357
            FC+KCNQ KPPRCHHCSVCGRCVLKMDHHCVWVVNCVGALNYKYFLLFL YTFLETTLVT
Sbjct  127  FCRKCNQPKPPRCHHCSVCGRCVLKMDHHCVWVVNCVGALNYKYFLLFLLYTFLETTLVT  186

Query  358  lSLLPNFLAFFGDVDIPGSAGDlattflafvlnlafalsvlGFLIMHISLVSRNTT  525
            L L+P+F+AFF D +IPG+ G LATTFLAFVLNLAFALSV+GFLIMHISLV+ NTT
Sbjct  187  LLLMPHFIAFFSDEEIPGTPGTLATTFLAFVLNLAFALSVMGFLIMHISLVAANTT  242



>ref|XP_006602748.1| PREDICTED: probable protein S-acyltransferase 14 isoform X2 [Glycine 
max]
Length=307

 Score =   214 bits (544),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 132/175 (75%), Positives = 151/175 (86%), Gaps = 0/175 (0%)
 Frame = +1

Query  1    FYCLLVMLLWSYFSVVFTDPGSVPPNWKPASDEERGDTDPLTASEFGSLPPDTAQSRIRF  180
            F+CLLVMLLW YF+VVFTDPG+VPPNWKPA DEERG+ DPL   E  +L  DT+  R R+
Sbjct  67   FHCLLVMLLWCYFAVVFTDPGTVPPNWKPAVDEERGEVDPLNGVELSNLQSDTSNQRFRY  126

Query  181  CKKCNQLKPPRCHHCSVCGRCVLKMDHHCVWVVNCVGALNYKYfllflfytflettlvtl  360
            C+KC+Q KPPRCHHCSVCGRCVLKMDHHCVWVVNCVGA NYKYFLLFLFYT LETT+VT+
Sbjct  127  CRKCSQPKPPRCHHCSVCGRCVLKMDHHCVWVVNCVGASNYKYFLLFLFYTLLETTIVTI  186

Query  361  SLLPNFLAFFGDVDIPGSAGDlattflafvlnlafalsvlGFLIMHISLVSRNTT  525
            SLLP+F  FF D +IPG+ G LATTFL FVLNLAF+LSVLGFL++H+SLV+ NTT
Sbjct  187  SLLPHFKTFFTDEEIPGTPGTLATTFLTFVLNLAFSLSVLGFLVLHMSLVASNTT  241



>gb|KHN40573.1| Putative S-acyltransferase [Glycine soja]
Length=371

 Score =   215 bits (547),  Expect = 6e-65, Method: Compositional matrix adjust.
 Identities = 132/175 (75%), Positives = 151/175 (86%), Gaps = 0/175 (0%)
 Frame = +1

Query  1    FYCLLVMLLWSYFSVVFTDPGSVPPNWKPASDEERGDTDPLTASEFGSLPPDTAQSRIRF  180
            F+CLLVMLLW YF+VVFTDPG+VPPNWKPA DEERG+ DPL   E  +L  DT+  R R+
Sbjct  131  FHCLLVMLLWCYFAVVFTDPGTVPPNWKPAVDEERGEVDPLNGVELSNLQSDTSNQRFRY  190

Query  181  CKKCNQLKPPRCHHCSVCGRCVLKMDHHCVWVVNCVGALNYKYfllflfytflettlvtl  360
            C+KC+Q KPPRCHHCSVCGRCVLKMDHHCVWVVNCVGA NYKYFLLFLFYT LETT+VT+
Sbjct  191  CRKCSQPKPPRCHHCSVCGRCVLKMDHHCVWVVNCVGASNYKYFLLFLFYTLLETTIVTI  250

Query  361  SLLPNFLAFFGDVDIPGSAGDlattflafvlnlafalsvlGFLIMHISLVSRNTT  525
            SLLP+F  FF D +IPG+ G LATTFL FVLNLAF+LSVLGFL++H+SLV+ NTT
Sbjct  251  SLLPHFKTFFTDEEIPGTPGTLATTFLTFVLNLAFSLSVLGFLVLHMSLVASNTT  305



>ref|XP_009143136.1| PREDICTED: probable protein S-acyltransferase 14 isoform X2 [Brassica 
rapa]
Length=309

 Score =   213 bits (541),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 141/177 (80%), Positives = 154/177 (87%), Gaps = 2/177 (1%)
 Frame = +1

Query  1    FYCLLVMLLWSYFSVVFTDPGSVPPNWKPASDEER--GDTDPLTASEFGSLPPDTAQSRI  174
            F+ LL MLLWSYFSVVFTDPG VPPNW+PASDEE   G+ DPL   EFG L P+ +  R 
Sbjct  67   FHFLLGMLLWSYFSVVFTDPGVVPPNWRPASDEEEQEGECDPLNGLEFGGLQPEASNQRT  126

Query  175  RFCKKCNQLKPPRCHHCSVCGRCVLKMDHHCVWVVNCVGALNYKYfllflfytflettlv  354
            RFC+KCNQ KPPRCHHCSVCGRCVLKMDHHCVWVVNCVGALNYKYFLLFLFYTFLETTLV
Sbjct  127  RFCRKCNQHKPPRCHHCSVCGRCVLKMDHHCVWVVNCVGALNYKYFLLFLFYTFLETTLV  186

Query  355  tlSLLPNFLAFFGDVDIPGSAGDlattflafvlnlafalsvlGFLIMHISLVSRNTT  525
            TL L+P+F+AFF + +IPG+ G LATTFLAFVLNLAFALSV+GFLIMHISLVS NTT
Sbjct  187  TLLLMPHFIAFFSEEEIPGTPGTLATTFLAFVLNLAFALSVMGFLIMHISLVSANTT  243



>emb|CDX89079.1| BnaA04g01070D [Brassica napus]
Length=300

 Score =   212 bits (540),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 137/175 (78%), Positives = 154/175 (88%), Gaps = 5/175 (3%)
 Frame = +1

Query  1    FYCLLVMLLWSYFSVVFTDPGSVPPNWKPASDEERGDTDPLTASEFGSLPPDTAQSRIRF  180
            F+ LL MLLWSYFSVVFTDPGSVPPNW+P++DEERG++DPL + EF     D +  R+RF
Sbjct  67   FHFLLAMLLWSYFSVVFTDPGSVPPNWRPSTDEERGESDPLNSLEF-----DNSNPRVRF  121

Query  181  CKKCNQLKPPRCHHCSVCGRCVLKMDHHCVWVVNCVGALNYKYfllflfytflettlvtl  360
            C+KCNQ KP RCHHCSVCGRCVLKMDHHCVWVVNCVGALNYKYFLLFL YTFLETTLVTL
Sbjct  122  CRKCNQPKPSRCHHCSVCGRCVLKMDHHCVWVVNCVGALNYKYFLLFLLYTFLETTLVTL  181

Query  361  SLLPNFLAFFGDVDIPGSAGDlattflafvlnlafalsvlGFLIMHISLVSRNTT  525
             L+P+F+AFF D +IPG+ G LATTFLAFVLNLAFALSV+GFLIMHISLV+ NTT
Sbjct  182  VLMPHFIAFFSDEEIPGTPGTLATTFLAFVLNLAFALSVMGFLIMHISLVAGNTT  236



>ref|XP_002446206.1| hypothetical protein SORBIDRAFT_06g004040 [Sorghum bicolor]
 gb|EES10534.1| hypothetical protein SORBIDRAFT_06g004040 [Sorghum bicolor]
Length=316

 Score =   212 bits (539),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 141/183 (77%), Positives = 152/183 (83%), Gaps = 8/183 (4%)
 Frame = +1

Query  1    FYCLLVMLLWSYFSVVFTDPGSVPPNWKPASDEERGDTDPLTASEFGS--------LPPD  156
            F+ LL MLLWSYFSVVFTDPGSVPPNW    D ERG+T PL  SEF S           +
Sbjct  68   FHFLLAMLLWSYFSVVFTDPGSVPPNWNLDFDVERGETAPLATSEFSSQMNSQQSVALGN  127

Query  157  TAQSRIRFCKKCNQLKPPRCHHCSVCGRCVLKMDHHCVWVVNCVGALNYKYfllflfytf  336
            TA  R+R+C+KCNQLKPPRCHHCSVCGRCVLKMDHHCVWVVNCVGALNYKYFLLFLFYTF
Sbjct  128  TANPRVRYCRKCNQLKPPRCHHCSVCGRCVLKMDHHCVWVVNCVGALNYKYFLLFLFYTF  187

Query  337  lettlvtlSLLPNFLAFFGDVDIPGSAGDlattflafvlnlafalsvlGFLIMHISLVSR  516
            LETTLVTLSLLP+F+AFF DV+IPGS   LATTFL FVLNLAF+LSV GF+IMHISLVS 
Sbjct  188  LETTLVTLSLLPHFIAFFSDVEIPGSPAALATTFLTFVLNLAFSLSVFGFMIMHISLVSA  247

Query  517  NTT  525
            NTT
Sbjct  248  NTT  250



>gb|EMT07089.1| Putative S-acyltransferase [Aegilops tauschii]
Length=308

 Score =   211 bits (538),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 141/183 (77%), Positives = 155/183 (85%), Gaps = 8/183 (4%)
 Frame = +1

Query  1    FYCLLVMLLWSYFSVVFTDPGSVPPNWKPASDEERGDTDPLTASEFGS--------LPPD  156
            F+ LL MLLWSYFSVVFTDPGSVPPNW    DEERG+T PL++S+F S           D
Sbjct  60   FHFLLAMLLWSYFSVVFTDPGSVPPNWNLDFDEERGETAPLSSSDFNSQMNPQQSMATGD  119

Query  157  TAQSRIRFCKKCNQLKPPRCHHCSVCGRCVLKMDHHCVWVVNCVGALNYKYfllflfytf  336
            T   R+R+C+KCNQLKPPRCHHCSVCGRC+LKMDHHCVWVVNCVGALNYKYFLLFLFYTF
Sbjct  120  TGNPRMRYCRKCNQLKPPRCHHCSVCGRCILKMDHHCVWVVNCVGALNYKYFLLFLFYTF  179

Query  337  lettlvtlSLLPNFLAFFGDVDIPGSAGDlattflafvlnlafalsvlGFLIMHISLVSR  516
            LETTLVTLSLLP+F+AFF DV+IPGS   LATTFL FVLNLAF+LSVLGF+IMHISLVS 
Sbjct  180  LETTLVTLSLLPHFIAFFSDVEIPGSPSALATTFLTFVLNLAFSLSVLGFMIMHISLVSG  239

Query  517  NTT  525
            NTT
Sbjct  240  NTT  242



>gb|KHG01247.1| hypothetical protein F383_23406 [Gossypium arboreum]
Length=235

 Score =   209 bits (531),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 133/169 (79%), Positives = 146/169 (86%), Gaps = 0/169 (0%)
 Frame = +1

Query  19   MLLWSYFSVVFTDPGSVPPNWKPASDEERGDTDPLTASEFGSLPPDTAQSRIRFCKKCNQ  198
            MLLWSY +VV TD G+VPPNWKPA DEERG+ DPL  SEF  L P  +  RIR+C+KCNQ
Sbjct  1    MLLWSYLTVVLTDSGTVPPNWKPAWDEERGEVDPLNESEFDGLQPALSSRRIRYCRKCNQ  60

Query  199  LKPPRCHHCSVCGRCVLKMDHHCVWVVNCVGALNYKYfllflfytflettlvtlSLLPNF  378
             KPPRCHHCSVCGRCVLKMDHHCVWVVNCVGALNYKYFLLFLFYTFLET+LVTL+L  +F
Sbjct  61   FKPPRCHHCSVCGRCVLKMDHHCVWVVNCVGALNYKYFLLFLFYTFLETSLVTLALFSHF  120

Query  379  LAFFGDVDIPGSAGDlattflafvlnlafalsvlGFLIMHISLVSRNTT  525
            LAFF D +IPG+A  LATTFL+FVLNLAFALSV GFLIMH+SLVS NTT
Sbjct  121  LAFFSDEEIPGTAATLATTFLSFVLNLAFALSVFGFLIMHVSLVSANTT  169



>dbj|BAJ93966.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ89372.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=316

 Score =   211 bits (537),  Expect = 4e-64, Method: Compositional matrix adjust.
 Identities = 141/183 (77%), Positives = 157/183 (86%), Gaps = 8/183 (4%)
 Frame = +1

Query  1    FYCLLVMLLWSYFSVVFTDPGSVPPNWKPASDEERGDTDPLTASEFGS-LPP-------D  156
            F+ LL MLLWSYFSVVFTDPGSVPPNW    DEERG+T PL++S+F S + P       D
Sbjct  68   FHFLLAMLLWSYFSVVFTDPGSVPPNWNLDFDEERGETAPLSSSDFNSQMNPQQSMALGD  127

Query  157  TAQSRIRFCKKCNQLKPPRCHHCSVCGRCVLKMDHHCVWVVNCVGALNYKYfllflfytf  336
            T   R+R+C+KCNQLKPPRCHHCSVCGRC+LKMDHHCVWVVNCVGALNYKYFLLFLFYTF
Sbjct  128  TGNPRMRYCRKCNQLKPPRCHHCSVCGRCILKMDHHCVWVVNCVGALNYKYFLLFLFYTF  187

Query  337  lettlvtlSLLPNFLAFFGDVDIPGSAGDlattflafvlnlafalsvlGFLIMHISLVSR  516
            LETTLVTLSLLP+F+AFF DV+IPG+   LATTFL FVLNLAF+LSVLGF+IMHISLVS 
Sbjct  188  LETTLVTLSLLPHFIAFFSDVEIPGTPSALATTFLTFVLNLAFSLSVLGFMIMHISLVSG  247

Query  517  NTT  525
            NTT
Sbjct  248  NTT  250



>ref|XP_010053896.1| PREDICTED: probable protein S-acyltransferase 14 [Eucalyptus 
grandis]
 gb|KCW78271.1| hypothetical protein EUGRSUZ_D02456 [Eucalyptus grandis]
Length=307

 Score =   211 bits (536),  Expect = 5e-64, Method: Compositional matrix adjust.
 Identities = 133/175 (76%), Positives = 154/175 (88%), Gaps = 0/175 (0%)
 Frame = +1

Query  1    FYCLLVMLLWSYFSVVFTDPGSVPPNWKPASDEERGDTDPLTASEFGSLPPDTAQSRIRF  180
            F+ LLVMLLWSYFSVVFTDPGSVPPNW+P+ DEERG++DPLT  +   L  D +  RIR+
Sbjct  67   FHGLLVMLLWSYFSVVFTDPGSVPPNWRPSIDEERGESDPLTLPDSSGLQSDPSNPRIRY  126

Query  181  CKKCNQLKPPRCHHCSVCGRCVLKMDHHCVWVVNCVGALNYKYfllflfytflettlvtl  360
            C+KC+  KPPRCHHCSVCGRCVLKMDHHCVWVVNCVGALNYKYFLLFLFYTFLET++VTL
Sbjct  127  CRKCDHFKPPRCHHCSVCGRCVLKMDHHCVWVVNCVGALNYKYFLLFLFYTFLETSVVTL  186

Query  361  SLLPNFLAFFGDVDIPGSAGDlattflafvlnlafalsvlGFLIMHISLVSRNTT  525
            +LLP+F+AFF D DIP + G LATTFL+FVLNLAF+LSV GFLI+H+SLV+ NTT
Sbjct  187  ALLPHFIAFFTDGDIPDTPGTLATTFLSFVLNLAFSLSVFGFLILHMSLVAANTT  241



>ref|NP_001169109.1| palmitoyltransferase ZDHHC20 [Zea mays]
 gb|ACN31678.1| unknown [Zea mays]
 tpg|DAA38384.1| TPA: palmitoyltransferase ZDHHC20 [Zea mays]
Length=312

 Score =   211 bits (536),  Expect = 6e-64, Method: Compositional matrix adjust.
 Identities = 140/183 (77%), Positives = 152/183 (83%), Gaps = 8/183 (4%)
 Frame = +1

Query  1    FYCLLVMLLWSYFSVVFTDPGSVPPNWKPASDEERGDTDPLTASEFGS--------LPPD  156
            F+ LL MLLWSYFSVV TDPGSVPPNW    D ERG+T PLT+SEF S           +
Sbjct  68   FHFLLAMLLWSYFSVVLTDPGSVPPNWNLDFDAERGETAPLTSSEFSSQMNSQQSVALGN  127

Query  157  TAQSRIRFCKKCNQLKPPRCHHCSVCGRCVLKMDHHCVWVVNCVGALNYKYfllflfytf  336
            TA  R R+C+KCNQLKPPRCHHCSVCGRCVLKMDHHCVWVVNCVGALNYKYFLLFLFYTF
Sbjct  128  TANPRARYCRKCNQLKPPRCHHCSVCGRCVLKMDHHCVWVVNCVGALNYKYFLLFLFYTF  187

Query  337  lettlvtlSLLPNFLAFFGDVDIPGSAGDlattflafvlnlafalsvlGFLIMHISLVSR  516
            LETTLVTLSLLP+F+AFF D++IPGS   LATTFL FVLNLAF+LSV GF+IMHISLVS 
Sbjct  188  LETTLVTLSLLPHFIAFFSDIEIPGSPAALATTFLTFVLNLAFSLSVFGFMIMHISLVSA  247

Query  517  NTT  525
            NTT
Sbjct  248  NTT  250



>ref|XP_010518152.1| PREDICTED: probable protein S-acyltransferase 14 [Camelina sativa]
 ref|XP_010518153.1| PREDICTED: probable protein S-acyltransferase 14 [Camelina sativa]
Length=309

 Score =   210 bits (534),  Expect = 8e-64, Method: Compositional matrix adjust.
 Identities = 139/177 (79%), Positives = 156/177 (88%), Gaps = 2/177 (1%)
 Frame = +1

Query  1    FYCLLVMLLWSYFSVVFTDPGSVPPNWKPASDEER--GDTDPLTASEFGSLPPDTAQSRI  174
            F+ LL MLLWSYFSVVFTDPG VPPNW+ ASDEE+  G++DPL + EFG L PD++  R 
Sbjct  67   FHFLLAMLLWSYFSVVFTDPGVVPPNWRLASDEEQRGGESDPLNSLEFGGLHPDSSNQRT  126

Query  175  RFCKKCNQLKPPRCHHCSVCGRCVLKMDHHCVWVVNCVGALNYKYfllflfytflettlv  354
            RFC+KC+Q KPPRCHHCSVCGRCVLKMDHHCVWVV+CVGALNYKYFLLFL YTFLETTLV
Sbjct  127  RFCRKCSQPKPPRCHHCSVCGRCVLKMDHHCVWVVSCVGALNYKYFLLFLLYTFLETTLV  186

Query  355  tlSLLPNFLAFFGDVDIPGSAGDlattflafvlnlafalsvlGFLIMHISLVSRNTT  525
            TL L+P+F+AFF D +IPG+ G LATTFLAFVLNLAFALSV+GFLIMHISLVS NTT
Sbjct  187  TLLLMPHFIAFFSDEEIPGTPGTLATTFLAFVLNLAFALSVMGFLIMHISLVSSNTT  243



>emb|CDX71345.1| BnaC07g06240D [Brassica napus]
Length=300

 Score =   210 bits (534),  Expect = 8e-64, Method: Compositional matrix adjust.
 Identities = 137/175 (78%), Positives = 153/175 (87%), Gaps = 5/175 (3%)
 Frame = +1

Query  1    FYCLLVMLLWSYFSVVFTDPGSVPPNWKPASDEERGDTDPLTASEFGSLPPDTAQSRIRF  180
            F+ LL MLLWSYFSVV TDPG VPPNW+PASDEERG++DPL + EF     D +  R+RF
Sbjct  67   FHFLLAMLLWSYFSVVLTDPGVVPPNWRPASDEERGESDPLNSLEF-----DNSNLRVRF  121

Query  181  CKKCNQLKPPRCHHCSVCGRCVLKMDHHCVWVVNCVGALNYKYfllflfytflettlvtl  360
            C+KCNQ KP RCHHCSVCGRCVLKMDHHCVWVVNCVGALNYKYFLLFLFYTFLETTLVTL
Sbjct  122  CRKCNQPKPSRCHHCSVCGRCVLKMDHHCVWVVNCVGALNYKYFLLFLFYTFLETTLVTL  181

Query  361  SLLPNFLAFFGDVDIPGSAGDlattflafvlnlafalsvlGFLIMHISLVSRNTT  525
             L+P+F+AFF D +IPG+ G LATTFL+FVLNLAFALSV+GFLIMHISLV+ NTT
Sbjct  182  VLMPHFIAFFSDEEIPGTPGTLATTFLSFVLNLAFALSVMGFLIMHISLVAGNTT  236



>ref|XP_006602749.1| PREDICTED: probable protein S-acyltransferase 14 isoform X3 [Glycine 
max]
Length=287

 Score =   209 bits (533),  Expect = 9e-64, Method: Compositional matrix adjust.
 Identities = 130/177 (73%), Positives = 149/177 (84%), Gaps = 2/177 (1%)
 Frame = +1

Query  1    FYCLLVMLLWSYFSVVFTDPGSVPPNWKPASDEERGDTDPLTASEFGSLPPDTAQSRIRF  180
            F+CLLVMLLW YF+VVFTDPG+VPPNWKPA DEERG+ DPL   E  +L  DT+  R R+
Sbjct  67   FHCLLVMLLWCYFAVVFTDPGTVPPNWKPAVDEERGEVDPLNGVELSNLQSDTSNQRFRY  126

Query  181  CKKCNQLKPPRCHHCSVCGRCVLKMDHHCVWVVNCVGALNYKYfllflfytflettlvtl  360
            C+KC+Q KPPRCHHCSVCGRCVLKMDHHCVWVVNCVGA NYKYFLLFLFYT LETT+VT+
Sbjct  127  CRKCSQPKPPRCHHCSVCGRCVLKMDHHCVWVVNCVGASNYKYFLLFLFYTLLETTIVTI  186

Query  361  SLLPNFLAFFGDVDIPGSAGDlatt--flafvlnlafalsvlGFLIMHISLVSRNTT  525
            SLLP+F  FF D +IPG+ G LATT    A VLNLAF+LSVLGFL++H+SLV+ NTT
Sbjct  187  SLLPHFKTFFTDEEIPGTPGTLATTFLTFAAVLNLAFSLSVLGFLVLHMSLVASNTT  243



>ref|XP_003552340.1| PREDICTED: probable protein S-acyltransferase 14 isoform X1 [Glycine 
max]
Length=309

 Score =   209 bits (533),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 130/177 (73%), Positives = 149/177 (84%), Gaps = 2/177 (1%)
 Frame = +1

Query  1    FYCLLVMLLWSYFSVVFTDPGSVPPNWKPASDEERGDTDPLTASEFGSLPPDTAQSRIRF  180
            F+CLLVMLLW YF+VVFTDPG+VPPNWKPA DEERG+ DPL   E  +L  DT+  R R+
Sbjct  67   FHCLLVMLLWCYFAVVFTDPGTVPPNWKPAVDEERGEVDPLNGVELSNLQSDTSNQRFRY  126

Query  181  CKKCNQLKPPRCHHCSVCGRCVLKMDHHCVWVVNCVGALNYKYfllflfytflettlvtl  360
            C+KC+Q KPPRCHHCSVCGRCVLKMDHHCVWVVNCVGA NYKYFLLFLFYT LETT+VT+
Sbjct  127  CRKCSQPKPPRCHHCSVCGRCVLKMDHHCVWVVNCVGASNYKYFLLFLFYTLLETTIVTI  186

Query  361  SLLPNFLAFFGDVDIPGSAGDlatt--flafvlnlafalsvlGFLIMHISLVSRNTT  525
            SLLP+F  FF D +IPG+ G LATT    A VLNLAF+LSVLGFL++H+SLV+ NTT
Sbjct  187  SLLPHFKTFFTDEEIPGTPGTLATTFLTFAAVLNLAFSLSVLGFLVLHMSLVASNTT  243



>ref|XP_009116762.1| PREDICTED: probable protein S-acyltransferase 14 [Brassica rapa]
Length=305

 Score =   209 bits (532),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 133/166 (80%), Positives = 151/166 (91%), Gaps = 0/166 (0%)
 Frame = +1

Query  28   WSYFSVVFTDPGSVPPNWKPASDEERGDTDPLTASEFGSLPPDTAQSRIRFCKKCNQLKP  207
            WSYFSVVFTDPG+VP NW+PA+DEERG++DPLT+ EF  L  D++  R+RFC+KCNQ KP
Sbjct  76   WSYFSVVFTDPGAVPANWRPAADEERGESDPLTSLEFVGLQTDSSNPRVRFCRKCNQPKP  135

Query  208  PRCHHCSVCGRCVLKMDHHCVWVVNCVGALNYKYfllflfytflettlvtlSLLPNFLAF  387
            PRCHHCSVCGRCVLKMDHHCVWVVNCVGALNYKYFLLFLFYTFLETTLVTL L+P+F+AF
Sbjct  136  PRCHHCSVCGRCVLKMDHHCVWVVNCVGALNYKYFLLFLFYTFLETTLVTLVLMPHFIAF  195

Query  388  FGDVDIPGSAGDlattflafvlnlafalsvlGFLIMHISLVSRNTT  525
            F D +IPG+ G LATTFLAFVLNLAFALSV+GFLIMH+SLV+ NTT
Sbjct  196  FSDEEIPGTPGTLATTFLAFVLNLAFALSVMGFLIMHMSLVAGNTT  241



>emb|CDX74736.1| BnaA05g04820D [Brassica napus]
Length=309

 Score =   209 bits (532),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 139/177 (79%), Positives = 153/177 (86%), Gaps = 2/177 (1%)
 Frame = +1

Query  1    FYCLLVMLLWSYFSVVFTDPGSVPPNWKPASDEER--GDTDPLTASEFGSLPPDTAQSRI  174
            F+ LL MLLWSYFSVVFTDPG VPPNW+PASDEE   G+ DPL   EFG L P+ +  R 
Sbjct  67   FHFLLGMLLWSYFSVVFTDPGVVPPNWRPASDEEEQEGECDPLNGLEFGGLQPEASNQRT  126

Query  175  RFCKKCNQLKPPRCHHCSVCGRCVLKMDHHCVWVVNCVGALNYKYfllflfytflettlv  354
            RFC+KCNQ KPPRCHHCSVCGRCVLKMDHHCVWVVNCVGALNYKYFLLFLFYTFLETTLV
Sbjct  127  RFCRKCNQHKPPRCHHCSVCGRCVLKMDHHCVWVVNCVGALNYKYFLLFLFYTFLETTLV  186

Query  355  tlSLLPNFLAFFGDVDIPGSAGDlattflafvlnlafalsvlGFLIMHISLVSRNTT  525
            TL L+P+F+AFF + +IPG+   LATTFLAFVLNLAFALSV+GFLIMHISLV+ NTT
Sbjct  187  TLLLMPHFIAFFSEEEIPGTPSTLATTFLAFVLNLAFALSVMGFLIMHISLVAANTT  243



>ref|XP_004492612.1| PREDICTED: probable S-acyltransferase At3g60800-like [Cicer arietinum]
Length=307

 Score =   208 bits (530),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 131/175 (75%), Positives = 149/175 (85%), Gaps = 0/175 (0%)
 Frame = +1

Query  1    FYCLLVMLLWSYFSVVFTDPGSVPPNWKPASDEERGDTDPLTASEFGSLPPDTAQSRIRF  180
            F+CLLVM+LWSYF+VVFTDPG VPPNWKP+ DEERG+ DPL   E  +L  D +   +R+
Sbjct  67   FHCLLVMVLWSYFAVVFTDPGIVPPNWKPSVDEERGEADPLNGLELSNLQSDASNKNVRY  126

Query  181  CKKCNQLKPPRCHHCSVCGRCVLKMDHHCVWVVNCVGALNYKYfllflfytflettlvtl  360
            C+KC+Q KP RCHHCSVCGRCVLKMDHHCVWVVNC+GALNYKYFLLFLFYTF ETTLVTL
Sbjct  127  CRKCSQPKPARCHHCSVCGRCVLKMDHHCVWVVNCIGALNYKYFLLFLFYTFFETTLVTL  186

Query  361  SLLPNFLAFFGDVDIPGSAGDlattflafvlnlafalsvlGFLIMHISLVSRNTT  525
            SLLPNF  FF D +IPG+ G LATTFLAFVLN+AF LSVL FLI+H+SLV+ NTT
Sbjct  187  SLLPNFKTFFDDGEIPGTPGTLATTFLAFVLNVAFVLSVLRFLIIHVSLVAANTT  241



>ref|XP_006402542.1| hypothetical protein EUTSA_v10006120mg [Eutrema salsugineum]
 gb|ESQ43995.1| hypothetical protein EUTSA_v10006120mg [Eutrema salsugineum]
Length=305

 Score =   208 bits (530),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 135/166 (81%), Positives = 148/166 (89%), Gaps = 0/166 (0%)
 Frame = +1

Query  28   WSYFSVVFTDPGSVPPNWKPASDEERGDTDPLTASEFGSLPPDTAQSRIRFCKKCNQLKP  207
            WSYFSVVFTDPG VPPNW+PA DEERG++DPL + EF  L PD +  RIRFC+KCNQ KP
Sbjct  76   WSYFSVVFTDPGVVPPNWRPAIDEERGESDPLNSLEFVGLQPDLSNPRIRFCRKCNQPKP  135

Query  208  PRCHHCSVCGRCVLKMDHHCVWVVNCVGALNYKYfllflfytflettlvtlSLLPNFLAF  387
             RCHHCSVCGRCVLKMDHHCVWVVNCVGALNYKYFLLFLFYTFLETTLVTL L+P+F+AF
Sbjct  136  SRCHHCSVCGRCVLKMDHHCVWVVNCVGALNYKYFLLFLFYTFLETTLVTLVLMPHFIAF  195

Query  388  FGDVDIPGSAGDlattflafvlnlafalsvlGFLIMHISLVSRNTT  525
            F D +IPG+ G LATTFLAFVLNLAFALSV+GFLIMHISLV+ NTT
Sbjct  196  FSDEEIPGTPGTLATTFLAFVLNLAFALSVMGFLIMHISLVAGNTT  241



>ref|XP_009143135.1| PREDICTED: probable protein S-acyltransferase 14 isoform X1 [Brassica 
rapa]
Length=337

 Score =   209 bits (532),  Expect = 4e-63, Method: Compositional matrix adjust.
 Identities = 139/173 (80%), Positives = 151/173 (87%), Gaps = 2/173 (1%)
 Frame = +1

Query  13   LVMLLWSYFSVVFTDPGSVPPNWKPASDEER--GDTDPLTASEFGSLPPDTAQSRIRFCK  186
            L MLLWSYFSVVFTDPG VPPNW+PASDEE   G+ DPL   EFG L P+ +  R RFC+
Sbjct  99   LGMLLWSYFSVVFTDPGVVPPNWRPASDEEEQEGECDPLNGLEFGGLQPEASNQRTRFCR  158

Query  187  KCNQLKPPRCHHCSVCGRCVLKMDHHCVWVVNCVGALNYKYfllflfytflettlvtlSL  366
            KCNQ KPPRCHHCSVCGRCVLKMDHHCVWVVNCVGALNYKYFLLFLFYTFLETTLVTL L
Sbjct  159  KCNQHKPPRCHHCSVCGRCVLKMDHHCVWVVNCVGALNYKYFLLFLFYTFLETTLVTLLL  218

Query  367  LPNFLAFFGDVDIPGSAGDlattflafvlnlafalsvlGFLIMHISLVSRNTT  525
            +P+F+AFF + +IPG+ G LATTFLAFVLNLAFALSV+GFLIMHISLVS NTT
Sbjct  219  MPHFIAFFSEEEIPGTPGTLATTFLAFVLNLAFALSVMGFLIMHISLVSANTT  271



>emb|CDY51805.1| BnaC04g53110D [Brassica napus]
Length=309

 Score =   208 bits (529),  Expect = 5e-63, Method: Compositional matrix adjust.
 Identities = 139/177 (79%), Positives = 153/177 (86%), Gaps = 2/177 (1%)
 Frame = +1

Query  1    FYCLLVMLLWSYFSVVFTDPGSVPPNWKPASDEER--GDTDPLTASEFGSLPPDTAQSRI  174
            F+ LL MLLWSYFSVVFTDPG VPPNW+PASDEE   G+ DPL + EFG L PD +  R 
Sbjct  67   FHFLLGMLLWSYFSVVFTDPGVVPPNWRPASDEEEQEGECDPLNSLEFGGLQPDASNQRT  126

Query  175  RFCKKCNQLKPPRCHHCSVCGRCVLKMDHHCVWVVNCVGALNYKYfllflfytflettlv  354
            RFC+KCNQ KPPRCHHCSVCGRCVLKMDHHCVWVVNCVGA NYKYFLLFLFYTFLETTLV
Sbjct  127  RFCRKCNQHKPPRCHHCSVCGRCVLKMDHHCVWVVNCVGARNYKYFLLFLFYTFLETTLV  186

Query  355  tlSLLPNFLAFFGDVDIPGSAGDlattflafvlnlafalsvlGFLIMHISLVSRNTT  525
            TL L+P+F+AFF + +IPG+   LATTFLAFVLNLAFALSV+GFLIMHISLV+ NTT
Sbjct  187  TLLLMPHFIAFFSEEEIPGTPSTLATTFLAFVLNLAFALSVMGFLIMHISLVAANTT  243



>ref|XP_004975099.1| PREDICTED: probable S-acyltransferase At3g60800-like [Setaria 
italica]
Length=316

 Score =   207 bits (528),  Expect = 9e-63, Method: Compositional matrix adjust.
 Identities = 141/184 (77%), Positives = 154/184 (84%), Gaps = 10/184 (5%)
 Frame = +1

Query  1    FYCLLVMLLWSYFSVVFTDPGSVPPNWKPASDEERGDTDPLTASEFGSLPPDTAQS----  168
            F+ LL MLLWSYFSVVFTDPGSVPPNW    D E G+T PL +SEF S   ++ QS    
Sbjct  68   FHFLLAMLLWSYFSVVFTDPGSVPPNWNLDFDAEMGETAPLASSEFSS-QMNSQQSVALG  126

Query  169  -----RIRFCKKCNQLKPPRCHHCSVCGRCVLKMDHHCVWVVNCVGALNYKYfllflfyt  333
                 R+R+C+KCNQLKPPRCHHCSVCGRCVLKMDHHCVWVVNCVGALNYKYFLLFLFYT
Sbjct  127  SMGNPRVRYCRKCNQLKPPRCHHCSVCGRCVLKMDHHCVWVVNCVGALNYKYFLLFLFYT  186

Query  334  flettlvtlSLLPNFLAFFGDVDIPGSAGDlattflafvlnlafalsvlGFLIMHISLVS  513
            FLETTLVTLSLLP+F+AFF D+DIPGS   LATTFL FVLNLAF+LSVLGF+IMHISLVS
Sbjct  187  FLETTLVTLSLLPHFIAFFSDIDIPGSPAALATTFLTFVLNLAFSLSVLGFMIMHISLVS  246

Query  514  RNTT  525
             NTT
Sbjct  247  ANTT  250



>ref|XP_010506482.1| PREDICTED: probable protein S-acyltransferase 14 [Camelina sativa]
Length=309

 Score =   207 bits (527),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 138/177 (78%), Positives = 155/177 (88%), Gaps = 2/177 (1%)
 Frame = +1

Query  1    FYCLLVMLLWSYFSVVFTDPGSVPPNWKPASDEER--GDTDPLTASEFGSLPPDTAQSRI  174
            F+ LL MLLWSYFSVVFTDPG VPPNW+ ASDEE+  G++D L + EFG L PD++  R 
Sbjct  67   FHFLLAMLLWSYFSVVFTDPGVVPPNWRLASDEEQRGGESDLLNSLEFGGLHPDSSNQRT  126

Query  175  RFCKKCNQLKPPRCHHCSVCGRCVLKMDHHCVWVVNCVGALNYKYfllflfytflettlv  354
            RFC+KC+Q KPPRCHHCSVCGRCVLKMDHHCVWV+NCVGALNYKYFLLFL YTFLETTLV
Sbjct  127  RFCRKCSQPKPPRCHHCSVCGRCVLKMDHHCVWVLNCVGALNYKYFLLFLLYTFLETTLV  186

Query  355  tlSLLPNFLAFFGDVDIPGSAGDlattflafvlnlafalsvlGFLIMHISLVSRNTT  525
            TL L+P+F+AFF D +IPG+ G LATTFLAFVLNLAFALSV+GFLIMHISLVS NTT
Sbjct  187  TLLLMPHFVAFFSDEEIPGTPGTLATTFLAFVLNLAFALSVMGFLIMHISLVSGNTT  243



>gb|KFK35280.1| hypothetical protein AALP_AA5G264300 [Arabis alpina]
Length=305

 Score =   207 bits (526),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 132/166 (80%), Positives = 148/166 (89%), Gaps = 0/166 (0%)
 Frame = +1

Query  28   WSYFSVVFTDPGSVPPNWKPASDEERGDTDPLTASEFGSLPPDTAQSRIRFCKKCNQLKP  207
            WSYFSVVFTDPG VP NW+P+SDEERG++DPLT+ EF  L  D++  R+RFC+KCNQ KP
Sbjct  76   WSYFSVVFTDPGVVPTNWRPSSDEERGESDPLTSLEFVGLQTDSSNPRVRFCRKCNQPKP  135

Query  208  PRCHHCSVCGRCVLKMDHHCVWVVNCVGALNYKYfllflfytflettlvtlSLLPNFLAF  387
             RCHHCSVCGRCVLKMDHHCVWVVNCVGALNYKYFLLFLFYTFL TTLVTL L+P+F+AF
Sbjct  136  SRCHHCSVCGRCVLKMDHHCVWVVNCVGALNYKYFLLFLFYTFLATTLVTLVLMPHFIAF  195

Query  388  FGDVDIPGSAGDlattflafvlnlafalsvlGFLIMHISLVSRNTT  525
            F D +IPG+ G LATTFLAFVLNLAFALSV+GFLIMHISLV+ NTT
Sbjct  196  FSDEEIPGTPGTLATTFLAFVLNLAFALSVMGFLIMHISLVAGNTT  241



>ref|XP_002882009.1| hypothetical protein ARALYDRAFT_903981 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH58268.1| hypothetical protein ARALYDRAFT_903981 [Arabidopsis lyrata subsp. 
lyrata]
Length=308

 Score =   207 bits (526),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 138/176 (78%), Positives = 154/176 (88%), Gaps = 1/176 (1%)
 Frame = +1

Query  1    FYCLLVMLLWSYFSVVFTDPGSVPPNWKPASDEE-RGDTDPLTASEFGSLPPDTAQSRIR  177
            F+ LL MLLWSYFSVVFTDPG VPPNW+ ASDEE RG++D L + EF  L PD++  R R
Sbjct  67   FHFLLAMLLWSYFSVVFTDPGVVPPNWRLASDEEQRGESDALNSLEFCVLQPDSSNQRTR  126

Query  178  FCKKCNQLKPPRCHHCSVCGRCVLKMDHHCVWVVNCVGALNYKYfllflfytflettlvt  357
            FC+KCNQ KPPRCHHCSVCGRCVLKMDHHCVWVV+CVGALNYKYFLLFL YTFLETTLVT
Sbjct  127  FCRKCNQPKPPRCHHCSVCGRCVLKMDHHCVWVVSCVGALNYKYFLLFLLYTFLETTLVT  186

Query  358  lSLLPNFLAFFGDVDIPGSAGDlattflafvlnlafalsvlGFLIMHISLVSRNTT  525
            L L+P+F+AFF D +IPG+ G LATTFLAFVLNLAFALSV+GFLIMHISLV+ NTT
Sbjct  187  LLLMPHFIAFFSDEEIPGTPGTLATTFLAFVLNLAFALSVMGFLIMHISLVAANTT  242



>gb|ABK24332.1| unknown [Picea sitchensis]
Length=316

 Score =   207 bits (526),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 136/184 (74%), Positives = 155/184 (84%), Gaps = 9/184 (5%)
 Frame = +1

Query  1    FYCLLVMLLWSYFSVVFTDPGSVPPNWKPASDEERGDTDPLTASEFGS----LPP-----  153
            F+ LL MLLWSYF+VV TDPG VPPNW+  +DEERG+T PLT+SEFG     L P     
Sbjct  67   FHALLGMLLWSYFAVVLTDPGGVPPNWRANTDEERGETLPLTSSEFGGPGLGLQPQMNLK  126

Query  154  DTAQSRIRFCKKCNQLKPPRCHHCSVCGRCVLKMDHHCVWVVNCVGALNYKYfllflfyt  333
            D + SRIR+C+KCNQ+KPPRCHHCSVCGRC+LKMDHHCVWVVNCVGA NYK+FLLFLFYT
Sbjct  127  DPSYSRIRYCRKCNQMKPPRCHHCSVCGRCILKMDHHCVWVVNCVGARNYKFFLLFLFYT  186

Query  334  flettlvtlSLLPNFLAFFGDVDIPGSAGDlattflafvlnlafalsvlGFLIMHISLVS  513
            F ETTLVTL+LLP+F+AFF + +I G+ G LATTFL FVLNLAFALSVLGFLIMHISLV+
Sbjct  187  FFETTLVTLALLPHFIAFFSEEEISGTPGSLATTFLGFVLNLAFALSVLGFLIMHISLVA  246

Query  514  RNTT  525
             NTT
Sbjct  247  GNTT  250



>ref|XP_008437153.1| PREDICTED: probable protein S-acyltransferase 14 [Cucumis melo]
Length=310

 Score =   206 bits (525),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 129/179 (72%), Positives = 147/179 (82%), Gaps = 9/179 (5%)
 Frame = +1

Query  16   VMLLWSYFSVVFTDPGSVPPNWKPASDEERGDTDPLTASEF---------GSLPPDTAQS  168
            VMLLWSYFSVV T+PG VPP W+P SDEE+GD DPL ASE+         G++P D++  
Sbjct  65   VMLLWSYFSVVLTNPGFVPPYWRPESDEEKGDADPLMASEYNGPGAGPEQGTMPSDSSNQ  124

Query  169  RIRFCKKCNQLKPPRCHHCSVCGRCVLKMDHHCVWVVNCVGALNYKYfllflfytflett  348
            ++RFC+KCNQ KPPRCHHCSVCGRCVLKMDHHCVWVVNCVGA NYKYFLLFLFYTFLETT
Sbjct  125  KVRFCRKCNQFKPPRCHHCSVCGRCVLKMDHHCVWVVNCVGAKNYKYFLLFLFYTFLETT  184

Query  349  lvtlSLLPNFLAFFGDVDIPGSAGDlattflafvlnlafalsvlGFLIMHISLVSRNTT  525
            LVT+SLLP FLAFF D DI G+ G LA  F+ F+LNL FALSV+GFLI+H+SLV  NTT
Sbjct  185  LVTVSLLPYFLAFFSDGDITGTPGSLAAIFITFILNLTFALSVMGFLILHVSLVVANTT  243



>gb|KDO85816.1| hypothetical protein CISIN_1g021813mg [Citrus sinensis]
Length=245

 Score =   204 bits (519),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 109/140 (78%), Positives = 122/140 (87%), Gaps = 0/140 (0%)
 Frame = +1

Query  1    FYCLLVMLLWSYFSVVFTDPGSVPPNWKPASDEERGDTDPLTASEFGSLPPDTAQSRIRF  180
            F+CLLVMLLWSYFSVV TD GSVPPNW+PA DEERG+ DPL ASEF     D    RIR+
Sbjct  67   FHCLLVMLLWSYFSVVLTDAGSVPPNWRPALDEERGEADPLNASEFSGAQSDPLNPRIRY  126

Query  181  CKKCNQLKPPRCHHCSVCGRCVLKMDHHCVWVVNCVGALNYKYfllflfytflettlvtl  360
            C+KCNQLKPPRCHHCSVCGRC+LKMDHHCVWVVNCVGALNYKYFLLFL YTFLET+LVTL
Sbjct  127  CRKCNQLKPPRCHHCSVCGRCILKMDHHCVWVVNCVGALNYKYFLLFLLYTFLETSLVTL  186

Query  361  SLLPNFLAFFGDVDIPGSAG  420
            SLLP+F++FF + +IPG+ G
Sbjct  187  SLLPHFISFFSEGEIPGTPG  206



>gb|KJB49337.1| hypothetical protein B456_008G114100 [Gossypium raimondii]
Length=285

 Score =   205 bits (521),  Expect = 5e-62, Method: Compositional matrix adjust.
 Identities = 132/166 (80%), Positives = 144/166 (87%), Gaps = 0/166 (0%)
 Frame = +1

Query  28   WSYFSVVFTDPGSVPPNWKPASDEERGDTDPLTASEFGSLPPDTAQSRIRFCKKCNQLKP  207
            WSYF+VV TD G+VPPNWKPASDEERG+ DPL  SEF  L PD +  RIR+C KCNQ KP
Sbjct  76   WSYFTVVLTDSGTVPPNWKPASDEERGEVDPLNESEFDGLQPDLSSQRIRYCWKCNQFKP  135

Query  208  PRCHHCSVCGRCVLKMDHHCVWVVNCVGALNYKYfllflfytflettlvtlSLLPNFLAF  387
            PRCHHCSVCGRCVLKMDHHCVWVVNCVGALNYKYFLLFLFYTFLET+LVTL+L  +FLAF
Sbjct  136  PRCHHCSVCGRCVLKMDHHCVWVVNCVGALNYKYFLLFLFYTFLETSLVTLALFSHFLAF  195

Query  388  FGDVDIPGSAGDlattflafvlnlafalsvlGFLIMHISLVSRNTT  525
            F D +IPG+   LATTFL+FVLNLAFALSV GFLIMH+SLVS NTT
Sbjct  196  FSDEEIPGTTATLATTFLSFVLNLAFALSVFGFLIMHVSLVSANTT  241



>ref|XP_004147573.1| PREDICTED: probable S-acyltransferase At3g60800-like [Cucumis 
sativus]
 ref|XP_004165772.1| PREDICTED: probable S-acyltransferase At3g60800-like [Cucumis 
sativus]
Length=310

 Score =   206 bits (523),  Expect = 5e-62, Method: Compositional matrix adjust.
 Identities = 129/178 (72%), Positives = 147/178 (83%), Gaps = 9/178 (5%)
 Frame = +1

Query  19   MLLWSYFSVVFTDPGSVPPNWKPASDEERGDTDPLTASEF---------GSLPPDTAQSR  171
            MLLWSYFSVV T+PG VPP W+P SDEE+GD DPL ASE+         G++P D++  +
Sbjct  66   MLLWSYFSVVLTNPGFVPPFWRPESDEEKGDADPLMASEYNGPGAGPEQGTMPSDSSNQK  125

Query  172  IRFCKKCNQLKPPRCHHCSVCGRCVLKMDHHCVWVVNCVGALNYKYfllflfytflettl  351
            +RFC+KCNQ KPPRCHHCSVCGRCVLKMDHHCVWVVNCVGA NYKYFLLFLFYTFLETTL
Sbjct  126  VRFCRKCNQFKPPRCHHCSVCGRCVLKMDHHCVWVVNCVGAKNYKYFLLFLFYTFLETTL  185

Query  352  vtlSLLPNFLAFFGDVDIPGSAGDlattflafvlnlafalsvlGFLIMHISLVSRNTT  525
            VTLSLLP FLAFF D DI G+ G LA  F+ F+LNL FALSV+GFLI+H+SLV+ NTT
Sbjct  186  VTLSLLPYFLAFFSDGDITGTPGSLAAIFITFILNLTFALSVMGFLILHVSLVAANTT  243



>gb|KCW78273.1| hypothetical protein EUGRSUZ_D02456 [Eucalyptus grandis]
Length=235

 Score =   203 bits (516),  Expect = 7e-62, Method: Compositional matrix adjust.
 Identities = 129/169 (76%), Positives = 149/169 (88%), Gaps = 0/169 (0%)
 Frame = +1

Query  19   MLLWSYFSVVFTDPGSVPPNWKPASDEERGDTDPLTASEFGSLPPDTAQSRIRFCKKCNQ  198
            MLLWSYFSVVFTDPGSVPPNW+P+ DEERG++DPLT  +   L  D +  RIR+C+KC+ 
Sbjct  1    MLLWSYFSVVFTDPGSVPPNWRPSIDEERGESDPLTLPDSSGLQSDPSNPRIRYCRKCDH  60

Query  199  LKPPRCHHCSVCGRCVLKMDHHCVWVVNCVGALNYKYfllflfytflettlvtlSLLPNF  378
             KPPRCHHCSVCGRCVLKMDHHCVWVVNCVGALNYKYFLLFLFYTFLET++VTL+LLP+F
Sbjct  61   FKPPRCHHCSVCGRCVLKMDHHCVWVVNCVGALNYKYFLLFLFYTFLETSVVTLALLPHF  120

Query  379  LAFFGDVDIPGSAGDlattflafvlnlafalsvlGFLIMHISLVSRNTT  525
            +AFF D DIP + G LATTFL+FVLNLAF+LSV GFLI+H+SLV+ NTT
Sbjct  121  IAFFTDGDIPDTPGTLATTFLSFVLNLAFSLSVFGFLILHMSLVAANTT  169



>ref|XP_010108133.1| putative S-acyltransferase [Morus notabilis]
 gb|EXC17865.1| putative S-acyltransferase [Morus notabilis]
Length=307

 Score =   205 bits (521),  Expect = 8e-62, Method: Compositional matrix adjust.
 Identities = 129/181 (71%), Positives = 147/181 (81%), Gaps = 6/181 (3%)
 Frame = +1

Query  1    FYCLLVMLLWSYFSVVFTDPGSVPPNWKPASDEERGDTDPLTASEFG------SLPPDTA  162
            F+ LLVMLLWSYFSVV TDPG VPPNW+P +DEERG+ D L  SE+       +   D  
Sbjct  60   FHSLLVMLLWSYFSVVLTDPGGVPPNWRPVTDEERGEADSLVESEYNGSDLASNRLDDLD  119

Query  163  QSRIRFCKKCNQLKPPRCHHCSVCGRCVLKMDHHCVWVVNCVGALNYKYfllflfytfle  342
              R+RFC+KCNQ KPPRCHHCSVCGRC+LKMDHHCVWVVNCVGA NYKYFLLFLFYTFLE
Sbjct  120  HQRVRFCQKCNQFKPPRCHHCSVCGRCILKMDHHCVWVVNCVGAFNYKYFLLFLFYTFLE  179

Query  343  ttlvtlSLLPNFLAFFGDVDIPGSAGDlattflafvlnlafalsvlGFLIMHISLVSRNT  522
            TT+VTLSLLP F+AFF + +IPG+ G LA TF+ F+LN AFALSV+GFLIMH+SLV  NT
Sbjct  180  TTVVTLSLLPYFIAFFTEGEIPGTPGTLAATFITFILNFAFALSVMGFLIMHLSLVGANT  239

Query  523  T  525
            T
Sbjct  240  T  240



>gb|KJB49335.1| hypothetical protein B456_008G114100 [Gossypium raimondii]
Length=307

 Score =   204 bits (520),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 132/166 (80%), Positives = 144/166 (87%), Gaps = 0/166 (0%)
 Frame = +1

Query  28   WSYFSVVFTDPGSVPPNWKPASDEERGDTDPLTASEFGSLPPDTAQSRIRFCKKCNQLKP  207
            WSYF+VV TD G+VPPNWKPASDEERG+ DPL  SEF  L PD +  RIR+C KCNQ KP
Sbjct  76   WSYFTVVLTDSGTVPPNWKPASDEERGEVDPLNESEFDGLQPDLSSQRIRYCWKCNQFKP  135

Query  208  PRCHHCSVCGRCVLKMDHHCVWVVNCVGALNYKYfllflfytflettlvtlSLLPNFLAF  387
            PRCHHCSVCGRCVLKMDHHCVWVVNCVGALNYKYFLLFLFYTFLET+LVTL+L  +FLAF
Sbjct  136  PRCHHCSVCGRCVLKMDHHCVWVVNCVGALNYKYFLLFLFYTFLETSLVTLALFSHFLAF  195

Query  388  FGDVDIPGSAGDlattflafvlnlafalsvlGFLIMHISLVSRNTT  525
            F D +IPG+   LATTFL+FVLNLAFALSV GFLIMH+SLVS NTT
Sbjct  196  FSDEEIPGTTATLATTFLSFVLNLAFALSVFGFLIMHVSLVSANTT  241



>ref|XP_009362134.1| PREDICTED: probable protein S-acyltransferase 14 isoform X1 [Pyrus 
x bretschneideri]
Length=301

 Score =   204 bits (520),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 126/175 (72%), Positives = 145/175 (83%), Gaps = 0/175 (0%)
 Frame = +1

Query  1    FYCLLVMLLWSYFSVVFTDPGSVPPNWKPASDEERGDTDPLTASEFGSLPPDTAQSRIRF  180
            F+ LLVMLLWSYF+VV TDPG VPPNW+PA DEE GD  PL  S+  ++  D A  +IRF
Sbjct  60   FHFLLVMLLWSYFNVVLTDPGRVPPNWRPAIDEETGDEAPLVGSDQSTMVSDPANQKIRF  119

Query  181  CKKCNQLKPPRCHHCSVCGRCVLKMDHHCVWVVNCVGALNYKYfllflfytflettlvtl  360
            C+KCN  KPPRCHHCSVCGRC+LKMDHHCVWVVNCVGALNYKYFLLFLFYTFLETTLVTL
Sbjct  120  CRKCNHYKPPRCHHCSVCGRCILKMDHHCVWVVNCVGALNYKYFLLFLFYTFLETTLVTL  179

Query  361  SLLPNFLAFFGDVDIPGSAGDlattflafvlnlafalsvlGFLIMHISLVSRNTT  525
            SL   F+AFF + +IPG+ G +A +F+ FVLN AFALSV GF+IMH+SLV+ NTT
Sbjct  180  SLFKYFMAFFTEEEIPGTLGTVAASFITFVLNFAFALSVFGFMIMHLSLVASNTT  234



>ref|XP_008345376.1| PREDICTED: probable protein S-acyltransferase 14 [Malus domestica]
Length=334

 Score =   204 bits (520),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 126/175 (72%), Positives = 145/175 (83%), Gaps = 0/175 (0%)
 Frame = +1

Query  1    FYCLLVMLLWSYFSVVFTDPGSVPPNWKPASDEERGDTDPLTASEFGSLPPDTAQSRIRF  180
            F+ LLVMLLWSYF+VV TDPG VPPNW+PA DEE GD  PL  S+  ++  D A  +IRF
Sbjct  93   FHFLLVMLLWSYFNVVLTDPGRVPPNWRPAIDEETGDEAPLVGSDQSTMVSDPANQKIRF  152

Query  181  CKKCNQLKPPRCHHCSVCGRCVLKMDHHCVWVVNCVGALNYKYfllflfytflettlvtl  360
            C+KCN  KPPRCHHCSVCGRC+LKMDHHCVWVVNCVGALNYKYFLLFLFYTFLETTLVTL
Sbjct  153  CRKCNHYKPPRCHHCSVCGRCILKMDHHCVWVVNCVGALNYKYFLLFLFYTFLETTLVTL  212

Query  361  SLLPNFLAFFGDVDIPGSAGDlattflafvlnlafalsvlGFLIMHISLVSRNTT  525
            SL   F+AFF + +IPG+ G +A +F+ FVLN AFALSV GF+IMH+SLV+ NTT
Sbjct  213  SLFKYFMAFFTEEEIPGTLGTVAASFITFVLNFAFALSVFGFMIMHLSLVASNTT  267



>ref|XP_006652138.1| PREDICTED: probable protein S-acyltransferase 14-like [Oryza 
brachyantha]
Length=316

 Score =   203 bits (517),  Expect = 5e-61, Method: Compositional matrix adjust.
 Identities = 136/174 (78%), Positives = 147/174 (84%), Gaps = 8/174 (5%)
 Frame = +1

Query  28   WSYFSVVFTDPGSVPPNWKPASDEERGDTDPLTASEFGS--------LPPDTAQSRIRFC  183
            WSYFSVVFTDPGSVPPNW    DEERG+T PL+ S+F S           DT  SR R+C
Sbjct  77   WSYFSVVFTDPGSVPPNWNLDFDEERGETVPLSGSDFTSQMNSQQSMAHNDTGHSRARYC  136

Query  184  KKCNQLKPPRCHHCSVCGRCVLKMDHHCVWVVNCVGALNYKYfllflfytflettlvtlS  363
            +KCNQLKPPRCHHCSVCGRCVLKMDHHCVWVVNCVGALNYKYFLLFLFYTFLETTLVTLS
Sbjct  137  RKCNQLKPPRCHHCSVCGRCVLKMDHHCVWVVNCVGALNYKYFLLFLFYTFLETTLVTLS  196

Query  364  LLPNFLAFFGDVDIPGSAGDlattflafvlnlafalsvlGFLIMHISLVSRNTT  525
            LLP+F+AFF D+DIPGS   LATTFL FVLNLAF+LSVLGF+IMH+SLVS NTT
Sbjct  197  LLPHFIAFFSDIDIPGSPAALATTFLTFVLNLAFSLSVLGFMIMHVSLVSANTT  250



>ref|XP_009761491.1| PREDICTED: probable protein S-acyltransferase 14 [Nicotiana sylvestris]
Length=182

 Score =   198 bits (503),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 88/103 (85%), Positives = 94/103 (91%), Gaps = 0/103 (0%)
 Frame = +1

Query  1    FYCLLVMLLWSYFSVVFTDPGSVPPNWKPASDEERGDTDPLTASEFGSLPPDTAQSRIRF  180
            F+CLLVMLLW YFSVVFTDPGSVPPNW+P  DEERG+ DPLTASEFG+ P D+   RIRF
Sbjct  69   FHCLLVMLLWCYFSVVFTDPGSVPPNWRPELDEERGEADPLTASEFGASPADSGNPRIRF  128

Query  181  CKKCNQLKPPRCHHCSVCGRCVLKMDHHCVWVVNCVGALNYKY  309
            C+KCNQLKPPRCHHCSVCGRCVLKMDHHCVWVVNCVGALNYKY
Sbjct  129  CRKCNQLKPPRCHHCSVCGRCVLKMDHHCVWVVNCVGALNYKY  171



>ref|XP_008798535.1| PREDICTED: probable protein S-acyltransferase 14 [Phoenix dactylifera]
Length=317

 Score =   202 bits (514),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 132/175 (75%), Positives = 145/175 (83%), Gaps = 9/175 (5%)
 Frame = +1

Query  28   WSYFSVVFTDPGSVPPNWKPASDEERGDTDPLTASEFGSLP---------PDTAQSRIRF  180
            WSYFSVV TDPGS+PPNWKP  DEERG+  PL +SEFG+            D+   R+R+
Sbjct  77   WSYFSVVLTDPGSIPPNWKPTVDEERGEEAPLNSSEFGNQILTYQQSANLADSGSPRVRY  136

Query  181  CKKCNQLKPPRCHHCSVCGRCVLKMDHHCVWVVNCVGALNYKYfllflfytflettlvtl  360
            C+KC+QLKPPRCHHCSVCGRCVLKMDHHCVWVVNCVGALNYK+FLLFL YTFLETTLVTL
Sbjct  137  CRKCSQLKPPRCHHCSVCGRCVLKMDHHCVWVVNCVGALNYKFFLLFLLYTFLETTLVTL  196

Query  361  SLLPNFLAFFGDVDIPGSAGDlattflafvlnlafalsvlGFLIMHISLVSRNTT  525
            SLLPNF+AFF D +I G+ G LATTFL FVLNLAFALSVLGFLIMHISLV  NTT
Sbjct  197  SLLPNFIAFFSDAEIAGTPGTLATTFLTFVLNLAFALSVLGFLIMHISLVGGNTT  251



>ref|NP_001148846.1| palmitoyltransferase ZDHHC20 [Zea mays]
 gb|ACF83769.1| unknown [Zea mays]
 gb|ACG33116.1| palmitoyltransferase ZDHHC20 [Zea mays]
Length=316

 Score =   202 bits (513),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 139/184 (76%), Positives = 152/184 (83%), Gaps = 10/184 (5%)
 Frame = +1

Query  1    FYCLLVMLLWSYFSVVFTDPGSVPPNWKPASDEERGDTDPLTASEFGSLPPDTAQS----  168
            F+ LL MLLWSYFSVVFTDPGSVPPNW    D E G+T PL +SE  S   ++ QS    
Sbjct  68   FHFLLAMLLWSYFSVVFTDPGSVPPNWNLDFDVEMGETAPLASSELCS-QMNSQQSVALG  126

Query  169  -----RIRFCKKCNQLKPPRCHHCSVCGRCVLKMDHHCVWVVNCVGALNYKYfllflfyt  333
                 R+R+C+KCNQLKPPRCHHCSVCGRCVLKMDHHCVWVVNCVGALNYKYFLLFLFYT
Sbjct  127  NMTNPRVRYCRKCNQLKPPRCHHCSVCGRCVLKMDHHCVWVVNCVGALNYKYFLLFLFYT  186

Query  334  flettlvtlSLLPNFLAFFGDVDIPGSAGDlattflafvlnlafalsvlGFLIMHISLVS  513
            FLETTLVTLSLLP+F+AFF D +IPGS   LATTFL FVLNLAF+LSVLGF+IMHISLVS
Sbjct  187  FLETTLVTLSLLPHFIAFFSDAEIPGSPAALATTFLTFVLNLAFSLSVLGFMIMHISLVS  246

Query  514  RNTT  525
             NTT
Sbjct  247  ANTT  250



>gb|ABF99421.1| DHHC zinc finger domain containing protein, expressed [Oryza 
sativa Japonica Group]
Length=256

 Score =   199 bits (507),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 133/174 (76%), Positives = 145/174 (83%), Gaps = 8/174 (5%)
 Frame = +1

Query  28   WSYFSVVFTDPGSVPPNWKPASDEERGDTDPLTASEFGS--------LPPDTAQSRIRFC  183
            WSYFSVVFTDPGSVPPNW    DEERG+T PL+  +F S           DT   R R+C
Sbjct  77   WSYFSVVFTDPGSVPPNWNLDFDEERGETAPLSGLDFNSQVNSQQSIAHNDTGHPRARYC  136

Query  184  KKCNQLKPPRCHHCSVCGRCVLKMDHHCVWVVNCVGALNYKYfllflfytflettlvtlS  363
            +KCNQ+KPPRCHHCSVCGRCVLKMDHHCVWVVNCVGALNYKYFLLFLFYTFLETTLVTLS
Sbjct  137  RKCNQMKPPRCHHCSVCGRCVLKMDHHCVWVVNCVGALNYKYFLLFLFYTFLETTLVTLS  196

Query  364  LLPNFLAFFGDVDIPGSAGDlattflafvlnlafalsvlGFLIMHISLVSRNTT  525
            LLP+F+AFF D+DIPGS   LATTFL FVLNLAF+LSVLGF+IMH+SLVS NTT
Sbjct  197  LLPHFIAFFSDIDIPGSPAALATTFLTFVLNLAFSLSVLGFMIMHVSLVSANTT  250



>ref|XP_002267258.3| PREDICTED: probable protein S-acyltransferase 14 [Vitis vinifera]
Length=294

 Score =   200 bits (509),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 134/184 (73%), Positives = 148/184 (80%), Gaps = 9/184 (5%)
 Frame = +1

Query  1    FYCLLVMLLWSYFSVVFTDPGSVPPNWKPASDEERGDTDPLTASEFG---------SLPP  153
            F+ LLVMLLWSYFSVV TDPG VP NWKP  DEE+GD DPL  SE           ++  
Sbjct  60   FHSLLVMLLWSYFSVVSTDPGGVPLNWKPMVDEEKGDVDPLLGSEHTGVGLGVDQENMVA  119

Query  154  DTAQSRIRFCKKCNQLKPPRCHHCSVCGRCVLKMDHHCVWVVNCVGALNYKYfllflfyt  333
            + A   +RFC+KCN  KPPRCHHCSVCGRC+LKMDHHCVWVVNCVGA NYKYFLLFLFYT
Sbjct  120  NPASEAVRFCRKCNLFKPPRCHHCSVCGRCILKMDHHCVWVVNCVGAKNYKYFLLFLFYT  179

Query  334  flettlvtlSLLPNFLAFFGDVDIPGSAGDlattflafvlnlafalsvlGFLIMHISLVS  513
            FLETTLVTLSLLP+F+AFF D +IPG+ G +A TFL FVLNLAFALSVLGFLIMHISLV+
Sbjct  180  FLETTLVTLSLLPHFIAFFSDGEIPGTPGTIAATFLTFVLNLAFALSVLGFLIMHISLVA  239

Query  514  RNTT  525
             NTT
Sbjct  240  ANTT  243



>ref|XP_003635680.2| PREDICTED: probable protein S-acyltransferase 14 [Vitis vinifera]
Length=324

 Score =   201 bits (510),  Expect = 6e-60, Method: Compositional matrix adjust.
 Identities = 134/184 (73%), Positives = 148/184 (80%), Gaps = 9/184 (5%)
 Frame = +1

Query  1    FYCLLVMLLWSYFSVVFTDPGSVPPNWKPASDEERGDTDPLTASEFG---------SLPP  153
            F+ LLVMLLWSYFSVV TDPG VP NWKP  DEE+GD DPL  SE           ++  
Sbjct  60   FHSLLVMLLWSYFSVVSTDPGGVPLNWKPMVDEEKGDVDPLLGSEHTGVGLGVDQENMVA  119

Query  154  DTAQSRIRFCKKCNQLKPPRCHHCSVCGRCVLKMDHHCVWVVNCVGALNYKYfllflfyt  333
            + A   +RFC+KCN  KPPRCHHCSVCGRC+LKMDHHCVWVVNCVGA NYKYFLLFLFYT
Sbjct  120  NPASEAVRFCRKCNLFKPPRCHHCSVCGRCILKMDHHCVWVVNCVGAKNYKYFLLFLFYT  179

Query  334  flettlvtlSLLPNFLAFFGDVDIPGSAGDlattflafvlnlafalsvlGFLIMHISLVS  513
            FLETTLVTLSLLP+F+AFF D +IPG+ G +A TFL FVLNLAFALSVLGFLIMHISLV+
Sbjct  180  FLETTLVTLSLLPHFIAFFSDGEIPGTPGTIAATFLTFVLNLAFALSVLGFLIMHISLVA  239

Query  514  RNTT  525
             NTT
Sbjct  240  ANTT  243



>gb|KGN50197.1| hypothetical protein Csa_5G158530 [Cucumis sativus]
Length=316

 Score =   200 bits (508),  Expect = 8e-60, Method: Compositional matrix adjust.
 Identities = 123/184 (67%), Positives = 142/184 (77%), Gaps = 15/184 (8%)
 Frame = +1

Query  19   MLLWSYFSVVFTDPGSVPPNWKPASDEERGDTDPLTASEF---------GSLPPDTAQSR  171
            MLLWSYFSVV T+PG VPP W+P SDEE+GD DPL ASE+         G++P D++  +
Sbjct  66   MLLWSYFSVVLTNPGFVPPFWRPESDEEKGDADPLMASEYNGPGAGPEQGTMPSDSSNQK  125

Query  172  IRFCKKCNQLKPPRCHHCSVCGRCVLKMDHHCVWVVNCVGALNYKYf------llflfyt  333
            +RFC+KCNQ KPPRCHHCSVCGRCVLKMDHHCVWVVNCVGA NY +       L   FYT
Sbjct  126  VRFCRKCNQFKPPRCHHCSVCGRCVLKMDHHCVWVVNCVGAKNYNFTNHLILFLFMQFYT  185

Query  334  flettlvtlSLLPNFLAFFGDVDIPGSAGDlattflafvlnlafalsvlGFLIMHISLVS  513
            FLETTLVTLSLLP FLAFF D DI G+ G LA  F+ F+LNL FALSV+GFLI+H+SLV+
Sbjct  186  FLETTLVTLSLLPYFLAFFSDGDITGTPGSLAAIFITFILNLTFALSVMGFLILHVSLVA  245

Query  514  RNTT  525
             NTT
Sbjct  246  ANTT  249



>ref|XP_010662159.1| PREDICTED: probable protein S-acyltransferase 14 [Vitis vinifera]
Length=310

 Score =   200 bits (508),  Expect = 9e-60, Method: Compositional matrix adjust.
 Identities = 134/184 (73%), Positives = 148/184 (80%), Gaps = 9/184 (5%)
 Frame = +1

Query  1    FYCLLVMLLWSYFSVVFTDPGSVPPNWKPASDEERGDTDPLTASEFG---------SLPP  153
            F+ LLVMLLWSYFSVV TDPG VP NWKP  DEE+GD DPL  SE           ++  
Sbjct  60   FHSLLVMLLWSYFSVVSTDPGGVPLNWKPMVDEEKGDVDPLLGSEHTGVGLGVDQENMVA  119

Query  154  DTAQSRIRFCKKCNQLKPPRCHHCSVCGRCVLKMDHHCVWVVNCVGALNYKYfllflfyt  333
            + A   +RFC+KCN  KPPRCHHCSVCGRC+LKMDHHCVWVVNCVGA NYKYFLLFLFYT
Sbjct  120  NPASEAVRFCRKCNLFKPPRCHHCSVCGRCILKMDHHCVWVVNCVGAKNYKYFLLFLFYT  179

Query  334  flettlvtlSLLPNFLAFFGDVDIPGSAGDlattflafvlnlafalsvlGFLIMHISLVS  513
            FLETTLVTLSLLP+F+AFF D +IPG+ G +A TFL FVLNLAFALSVLGFLIMHISLV+
Sbjct  180  FLETTLVTLSLLPHFIAFFSDGEIPGTPGTIAATFLTFVLNLAFALSVLGFLIMHISLVA  239

Query  514  RNTT  525
             NTT
Sbjct  240  ANTT  243



>ref|XP_007209402.1| hypothetical protein PRUPE_ppa009226mg [Prunus persica]
 gb|EMJ10601.1| hypothetical protein PRUPE_ppa009226mg [Prunus persica]
Length=301

 Score =   199 bits (505),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 123/175 (70%), Positives = 144/175 (82%), Gaps = 0/175 (0%)
 Frame = +1

Query  1    FYCLLVMLLWSYFSVVFTDPGSVPPNWKPASDEERGDTDPLTASEFGSLPPDTAQSRIRF  180
            F+ LLVMLLWSYF+VV  DPG VPPNW+PA+DEE GD  PL  S+  +L  D A  ++RF
Sbjct  60   FHFLLVMLLWSYFNVVLNDPGVVPPNWRPANDEEGGDGAPLVGSDQSTLVSDPANQKVRF  119

Query  181  CKKCNQLKPPRCHHCSVCGRCVLKMDHHCVWVVNCVGALNYKYfllflfytflettlvtl  360
            C+KCN  KPPRCHHCSVCGRC+LKMDHHCVWVVNCVGALNYKYFLLFLFYTFLETTLVTL
Sbjct  120  CRKCNHFKPPRCHHCSVCGRCILKMDHHCVWVVNCVGALNYKYFLLFLFYTFLETTLVTL  179

Query  361  SLLPNFLAFFGDVDIPGSAGDlattflafvlnlafalsvlGFLIMHISLVSRNTT  525
            SL   F+AFF + ++ G+ G +A +F+ FVLN AFALSV GF+IMH+SLV+ NTT
Sbjct  180  SLFKYFMAFFTEEEVIGTLGTVAASFITFVLNFAFALSVFGFMIMHLSLVASNTT  234



>ref|XP_008238650.1| PREDICTED: probable protein S-acyltransferase 14 [Prunus mume]
Length=301

 Score =   199 bits (505),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 123/175 (70%), Positives = 144/175 (82%), Gaps = 0/175 (0%)
 Frame = +1

Query  1    FYCLLVMLLWSYFSVVFTDPGSVPPNWKPASDEERGDTDPLTASEFGSLPPDTAQSRIRF  180
            F+ LLVMLLWSYF+VV  DPG VPPNW+PA+DEE GD  PL  S+  +L  D A  ++RF
Sbjct  60   FHFLLVMLLWSYFNVVLNDPGVVPPNWRPANDEEGGDGAPLVGSDQSTLVSDPANQKVRF  119

Query  181  CKKCNQLKPPRCHHCSVCGRCVLKMDHHCVWVVNCVGALNYKYfllflfytflettlvtl  360
            C+KCN  KPPRCHHCSVCGRC+LKMDHHCVWVVNCVGALNYKYFLLFLFYTFLETTLVTL
Sbjct  120  CRKCNHFKPPRCHHCSVCGRCILKMDHHCVWVVNCVGALNYKYFLLFLFYTFLETTLVTL  179

Query  361  SLLPNFLAFFGDVDIPGSAGDlattflafvlnlafalsvlGFLIMHISLVSRNTT  525
            SL   F+AFF + ++ G+ G +A +F+ FVLN AFALSV GF+IMH+SLV+ NTT
Sbjct  180  SLFKYFMAFFTEEEVIGTLGTVAASFITFVLNFAFALSVFGFMIMHLSLVASNTT  234



>ref|XP_009399491.1| PREDICTED: probable protein S-acyltransferase 14 [Musa acuminata 
subsp. malaccensis]
Length=315

 Score =   199 bits (506),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 140/185 (76%), Positives = 155/185 (84%), Gaps = 11/185 (6%)
 Frame = +1

Query  1    FYCLLVMLLWSYFSVVFTDPGSVPPNWKPASDEERGDTDPLTASEF----------GSLP  150
            F+ LL +LLWSYFSVVF DPG VP NWKP +DEE G+T PLT+ EF          G L 
Sbjct  69   FHVLLGLLLWSYFSVVFRDPGRVPSNWKPPADEEIGETAPLTSLEFSNHILNLQQLGRLE  128

Query  151  PDTAQSRIRFCKKCNQLKPPRCHHCSVCGRCVLKMDHHCVWVVNCVGALNYKYfllflfy  330
             DT    IR+C+KCNQLKPPRCHHCSVCGRCVLKMDHHC+WVVNCVGALNYK+FLLFLFY
Sbjct  129  -DTGSQMIRYCRKCNQLKPPRCHHCSVCGRCVLKMDHHCIWVVNCVGALNYKFFLLFLFY  187

Query  331  tflettlvtlSLLPNFLAFFGDVDIPGSAGDlattflafvlnlafalsvlGFLIMHISLV  510
            TFLETTLVTLSL P+F+AFF DV+IPG+ G LATTFLAFVLNLAFALSVLGFLIMHI+LV
Sbjct  188  TFLETTLVTLSLFPHFIAFFKDVEIPGTPGKLATTFLAFVLNLAFALSVLGFLIMHITLV  247

Query  511  SRNTT  525
            +RNTT
Sbjct  248  ARNTT  252



>gb|EEE60128.1| hypothetical protein OsJ_13009 [Oryza sativa Japonica Group]
Length=180

 Score =   194 bits (494),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 132/173 (76%), Positives = 144/173 (83%), Gaps = 8/173 (5%)
 Frame = +1

Query  31   SYFSVVFTDPGSVPPNWKPASDEERGDTDPLTASEFGS--------LPPDTAQSRIRFCK  186
            SYFSVVFTDPGSVPPNW    DEERG+T PL+  +F S           DT   R R+C+
Sbjct  2    SYFSVVFTDPGSVPPNWNLDFDEERGETAPLSGLDFNSQVNSQQSIAHNDTGHPRARYCR  61

Query  187  KCNQLKPPRCHHCSVCGRCVLKMDHHCVWVVNCVGALNYKYfllflfytflettlvtlSL  366
            KCNQ+KPPRCHHCSVCGRCVLKMDHHCVWVVNCVGALNYKYFLLFLFYTFLETTLVTLSL
Sbjct  62   KCNQMKPPRCHHCSVCGRCVLKMDHHCVWVVNCVGALNYKYFLLFLFYTFLETTLVTLSL  121

Query  367  LPNFLAFFGDVDIPGSAGDlattflafvlnlafalsvlGFLIMHISLVSRNTT  525
            LP+F+AFF D+DIPGS   LATTFL FVLNLAF+LSVLGF+IMH+SLVS NTT
Sbjct  122  LPHFIAFFSDIDIPGSPAALATTFLTFVLNLAFSLSVLGFMIMHVSLVSANTT  174



>ref|XP_010918308.1| PREDICTED: probable protein S-acyltransferase 14 [Elaeis guineensis]
Length=317

 Score =   199 bits (505),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 132/175 (75%), Positives = 143/175 (82%), Gaps = 9/175 (5%)
 Frame = +1

Query  28   WSYFSVVFTDPGSVPPNWKPASDEERGDTDPLTASEFGSLP---------PDTAQSRIRF  180
            WSYFSVV TDPGSVPPNWKP  DEERG+  PL + +FG+            D+   RIR+
Sbjct  77   WSYFSVVLTDPGSVPPNWKPTVDEERGEEAPLNSPDFGNQILSYQQSANLADSGSPRIRY  136

Query  181  CKKCNQLKPPRCHHCSVCGRCVLKMDHHCVWVVNCVGALNYKYfllflfytflettlvtl  360
            C+KCNQLKPPRCHHCSVCGRCVLKMDHHCVWVVNCVGALNYK+FLLFL YTFLETTLVTL
Sbjct  137  CRKCNQLKPPRCHHCSVCGRCVLKMDHHCVWVVNCVGALNYKFFLLFLLYTFLETTLVTL  196

Query  361  SLLPNFLAFFGDVDIPGSAGDlattflafvlnlafalsvlGFLIMHISLVSRNTT  525
            SLLPN +A F D +IPG+ G LATTFL FVLNLAFALSVLGFLIMHISLV  NTT
Sbjct  197  SLLPNSIALFSDAEIPGTPGTLATTFLTFVLNLAFALSVLGFLIMHISLVGGNTT  251



>ref|NP_001051618.1| Os03g0804300 [Oryza sativa Japonica Group]
 gb|AAS07218.1| putative zinc finger protein [Oryza sativa Japonica Group]
 gb|ABF99420.1| DHHC zinc finger domain containing protein, expressed [Oryza 
sativa Japonica Group]
 dbj|BAF13532.1| Os03g0804300 [Oryza sativa Japonica Group]
Length=316

 Score =   199 bits (505),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 133/174 (76%), Positives = 145/174 (83%), Gaps = 8/174 (5%)
 Frame = +1

Query  28   WSYFSVVFTDPGSVPPNWKPASDEERGDTDPLTASEFGS--------LPPDTAQSRIRFC  183
            WSYFSVVFTDPGSVPPNW    DEERG+T PL+  +F S           DT   R R+C
Sbjct  77   WSYFSVVFTDPGSVPPNWNLDFDEERGETAPLSGLDFNSQVNSQQSIAHNDTGHPRARYC  136

Query  184  KKCNQLKPPRCHHCSVCGRCVLKMDHHCVWVVNCVGALNYKYfllflfytflettlvtlS  363
            +KCNQ+KPPRCHHCSVCGRCVLKMDHHCVWVVNCVGALNYKYFLLFLFYTFLETTLVTLS
Sbjct  137  RKCNQMKPPRCHHCSVCGRCVLKMDHHCVWVVNCVGALNYKYFLLFLFYTFLETTLVTLS  196

Query  364  LLPNFLAFFGDVDIPGSAGDlattflafvlnlafalsvlGFLIMHISLVSRNTT  525
            LLP+F+AFF D+DIPGS   LATTFL FVLNLAF+LSVLGF+IMH+SLVS NTT
Sbjct  197  LLPHFIAFFSDIDIPGSPAALATTFLTFVLNLAFSLSVLGFMIMHVSLVSANTT  250



>gb|EEC76365.1| hypothetical protein OsI_13959 [Oryza sativa Indica Group]
Length=308

 Score =   198 bits (504),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 133/174 (76%), Positives = 145/174 (83%), Gaps = 8/174 (5%)
 Frame = +1

Query  28   WSYFSVVFTDPGSVPPNWKPASDEERGDTDPLTASEFGS--------LPPDTAQSRIRFC  183
            WSYFSVVFTDPGSVPPNW    DEERG+T PL+  +F S           DT   R R+C
Sbjct  69   WSYFSVVFTDPGSVPPNWNLDFDEERGETAPLSGLDFNSQVNSQQSIAHNDTGHPRARYC  128

Query  184  KKCNQLKPPRCHHCSVCGRCVLKMDHHCVWVVNCVGALNYKYfllflfytflettlvtlS  363
            +KCNQ+KPPRCHHCSVCGRCVLKMDHHCVWVVNCVGALNYKYFLLFLFYTFLETTLVTLS
Sbjct  129  RKCNQMKPPRCHHCSVCGRCVLKMDHHCVWVVNCVGALNYKYFLLFLFYTFLETTLVTLS  188

Query  364  LLPNFLAFFGDVDIPGSAGDlattflafvlnlafalsvlGFLIMHISLVSRNTT  525
            LLP+F+AFF D+DIPGS   LATTFL FVLNLAF+LSVLGF+IMH+SLVS NTT
Sbjct  189  LLPHFIAFFSDIDIPGSPAALATTFLTFVLNLAFSLSVLGFMIMHVSLVSANTT  242



>gb|KCW78272.1| hypothetical protein EUGRSUZ_D02456 [Eucalyptus grandis]
Length=283

 Score =   197 bits (501),  Expect = 5e-59, Method: Compositional matrix adjust.
 Identities = 132/202 (65%), Positives = 153/202 (76%), Gaps = 27/202 (13%)
 Frame = +1

Query  1    FYCLLVMLLWSYFSVVFTDPGSVPPNWKPASDEERGDTDPLTASEFGSLPPDTAQSRIRF  180
            F+ LLVMLLWSYFSVVFTDPGSVPPNW+P+ DEERG++DPLT  +   L  D +  RIR+
Sbjct  67   FHGLLVMLLWSYFSVVFTDPGSVPPNWRPSIDEERGESDPLTLPDSSGLQSDPSNPRIRY  126

Query  181  CKKCNQLKPPRCHHCSVCGRCVLKMDHHCVWVVNCVGALNYKYfllflfytflettlvtl  360
            C+KC+  KPPRCHHCSVCGRCVLKMDHHCVWVVNCVGALNYKYFLLFLFYTFLET++VTL
Sbjct  127  CRKCDHFKPPRCHHCSVCGRCVLKMDHHCVWVVNCVGALNYKYFLLFLFYTFLETSVVTL  186

Query  361  SLLPNFLAFFGDVDIPGSAGDlattfl---------------------------afvlnl  459
            +LLP+F+AFF D DIP + G LATTFL                           + VLNL
Sbjct  187  ALLPHFIAFFTDGDIPDTPGTLATTFLSFGKVNTTVCDLHLHLVFLELIMFFCWSLVLNL  246

Query  460  afalsvlGFLIMHISLVSRNTT  525
            AF+LSV GFLI+H+SLV+ NTT
Sbjct  247  AFSLSVFGFLILHMSLVAANTT  268



>gb|AFW57919.1| palmitoyltransferase ZDHHC20, mRNA [Zea mays]
Length=243

 Score =   195 bits (495),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 136/178 (76%), Positives = 148/178 (83%), Gaps = 10/178 (6%)
 Frame = +1

Query  19   MLLWSYFSVVFTDPGSVPPNWKPASDEERGDTDPLTASEFGSLPPDTAQS---------R  171
            MLLWSYFSVVFTDPGSVPPNW    D E G+T PL +SE  S   ++ QS         R
Sbjct  1    MLLWSYFSVVFTDPGSVPPNWNLDFDVEMGETAPLASSELCS-QMNSQQSVALGNMTNPR  59

Query  172  IRFCKKCNQLKPPRCHHCSVCGRCVLKMDHHCVWVVNCVGALNYKYfllflfytflettl  351
            +R+C+KCNQLKPPRCHHCSVCGRCVLKMDHHCVWVVNCVGALNYKYFLLFLFYTFLETTL
Sbjct  60   VRYCRKCNQLKPPRCHHCSVCGRCVLKMDHHCVWVVNCVGALNYKYFLLFLFYTFLETTL  119

Query  352  vtlSLLPNFLAFFGDVDIPGSAGDlattflafvlnlafalsvlGFLIMHISLVSRNTT  525
            VTLSLLP+F+AFF D +IPGS   LATTFL FVLNLAF+LSVLGF+IMHISLVS NTT
Sbjct  120  VTLSLLPHFIAFFSDAEIPGSPAALATTFLTFVLNLAFSLSVLGFMIMHISLVSANTT  177



>gb|EPS68199.1| hypothetical protein M569_06570, partial [Genlisea aurea]
Length=315

 Score =   196 bits (498),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 129/166 (78%), Positives = 143/166 (86%), Gaps = 4/166 (2%)
 Frame = +1

Query  28   WSYFSVVFTDPGSVPPNWKPASDEERGDTDPLTASEFGSLPPDTAQSRIRFCKKCNQLKP  207
            WSYFSVVFTDPGSVPPNW P  D E GDT+ L A E     P+  ++R RFC+KCNQLKP
Sbjct  93   WSYFSVVFTDPGSVPPNWGPEVDVESGDTEALAAVEL----PENVENRPRFCRKCNQLKP  148

Query  208  PRCHHCSVCGRCVLKMDHHCVWVVNCVGALNYKYfllflfytflettlvtlSLLPNFLAF  387
            PRCHHCSVCGRCVLKMDHHCVWVVNCVGA NYKYFLLFLFYTFLETT+V LSLLP+F+AF
Sbjct  149  PRCHHCSVCGRCVLKMDHHCVWVVNCVGARNYKYFLLFLFYTFLETTVVALSLLPHFIAF  208

Query  388  FGDVDIPGSAGDlattflafvlnlafalsvlGFLIMHISLVSRNTT  525
            F D +IPG+ G LATTFLAFVLNLAFALSV+GFLIMH++LV+ NTT
Sbjct  209  FSDGEIPGTPGTLATTFLAFVLNLAFALSVMGFLIMHMTLVAANTT  254



>ref|XP_009389071.1| PREDICTED: probable protein S-acyltransferase 14 [Musa acuminata 
subsp. malaccensis]
Length=315

 Score =   192 bits (487),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 136/184 (74%), Positives = 152/184 (83%), Gaps = 9/184 (5%)
 Frame = +1

Query  1    FYCLLVMLLWSYFSVVFTDPGSVPPNWKPASDEERGDTDPLTASEFGSL---------PP  153
            F+ LL +LLW+YFSVV TDPGSVPP+WKP  DEE G+T PL  SEF S            
Sbjct  68   FHLLLGLLLWAYFSVVITDPGSVPPHWKPVIDEEEGETAPLANSEFTSHILNLQQPGPVA  127

Query  154  DTAQSRIRFCKKCNQLKPPRCHHCSVCGRCVLKMDHHCVWVVNCVGALNYKYfllflfyt  333
            DT   RIR+C+KCNQLKPPRCHHCSVCGRCVLKMDHHCVWVVNCVGALNYK+FLLFLFYT
Sbjct  128  DTGSPRIRYCRKCNQLKPPRCHHCSVCGRCVLKMDHHCVWVVNCVGALNYKFFLLFLFYT  187

Query  334  flettlvtlSLLPNFLAFFGDVDIPGSAGDlattflafvlnlafalsvlGFLIMHISLVS  513
            FLETTLVT+SL P+F+AFF DV+IPG+ G LA TF+ FVLNLAFALSVLGFL+MHISLV 
Sbjct  188  FLETTLVTVSLFPHFIAFFKDVEIPGTPGTLAATFITFVLNLAFALSVLGFLVMHISLVM  247

Query  514  RNTT  525
            +NTT
Sbjct  248  KNTT  251



>gb|KDP42560.1| hypothetical protein JCGZ_24334 [Jatropha curcas]
Length=316

 Score =   191 bits (485),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 120/172 (70%), Positives = 136/172 (79%), Gaps = 6/172 (3%)
 Frame = +1

Query  28   WSYFSVVFTDPGSVPPNWKPASDEERGDTDPLT------ASEFGSLPPDTAQSRIRFCKK  189
            WSYF+ V TDPG VPPNW+P+ DEERG+TD L        S+  S+  + A  R RFC+K
Sbjct  78   WSYFTTVLTDPGGVPPNWRPSIDEERGETDALMEHGANLGSDRSSVLGEPANQRTRFCRK  137

Query  190  CNQLKPPRCHHCSVCGRCVLKMDHHCVWVVNCVGALNYKYfllflfytflettlvtlSLL  369
            CNQ KPPRCHHCSVCGRC+LKMDHHCVWVVNCVGALNYKYF LFL YTFLETTLVTLSLL
Sbjct  138  CNQFKPPRCHHCSVCGRCILKMDHHCVWVVNCVGALNYKYFFLFLVYTFLETTLVTLSLL  197

Query  370  PNFLAFFGDVDIPGSAGDlattflafvlnlafalsvlGFLIMHISLVSRNTT  525
              F+AFF D +I G+ G L  TF+ FVLNL+FALSV+GFLIMHISL+  NTT
Sbjct  198  RLFIAFFADGEISGTPGSLVATFITFVLNLSFALSVMGFLIMHISLILANTT  249



>ref|XP_007039984.1| DHHC-type zinc finger family protein [Theobroma cacao]
 gb|EOY24485.1| DHHC-type zinc finger family protein [Theobroma cacao]
Length=312

 Score =   190 bits (483),  Expect = 4e-56, Method: Compositional matrix adjust.
 Identities = 122/184 (66%), Positives = 142/184 (77%), Gaps = 9/184 (5%)
 Frame = +1

Query  1    FYCLLVMLLWSYFSVVFTDPGSVPPNWKPASDEERGDTDPLTASEFGS---------LPP  153
            F+ LLVM++WSYF+VV TDPG VPPNWKP  DEE+G+ DPL +  +GS         +P 
Sbjct  62   FHFLLVMVIWSYFAVVLTDPGGVPPNWKPPRDEEKGEVDPLVSFSYGSPELGSNQSAVPG  121

Query  154  DTAQSRIRFCKKCNQLKPPRCHHCSVCGRCVLKMDHHCVWVVNCVGALNYKYfllflfyt  333
            D+    IRFC+KCNQ KPPR HHCSVC RC+LKMDHHCVWVVNCVGALNYKYFLLFLFYT
Sbjct  122  DSPNQDIRFCRKCNQFKPPRTHHCSVCKRCILKMDHHCVWVVNCVGALNYKYFLLFLFYT  181

Query  334  flettlvtlSLLPNFLAFFGDVDIPGSAGDlattflafvlnlafalsvlGFLIMHISLVS  513
            FL  TL +LSLL  F+ FF D +I  + G LA TF+ FVLN+AFALS+LGFLIMHI+LV 
Sbjct  182  FLGATLSSLSLLRVFIEFFNDGEIAETPGTLAATFITFVLNIAFALSILGFLIMHITLVG  241

Query  514  RNTT  525
             NTT
Sbjct  242  ANTT  245



>ref|XP_011463771.1| PREDICTED: probable protein S-acyltransferase 14 [Fragaria vesca 
subsp. vesca]
Length=310

 Score =   190 bits (483),  Expect = 4e-56, Method: Compositional matrix adjust.
 Identities = 125/184 (68%), Positives = 143/184 (78%), Gaps = 9/184 (5%)
 Frame = +1

Query  1    FYCLLVMLLWSYFSVVFTDPGSVPPNWKPASDEERGDTDPLTASEFGS---------LPP  153
            F+ LLVMLLWSYF V+ TDPG VP NW+P  DEE G   PL  SE+           +  
Sbjct  60   FHFLLVMLLWSYFYVLVTDPGGVPLNWRPEIDEEAGQGAPLVESEYSGAGLVSNQSVMAF  119

Query  154  DTAQSRIRFCKKCNQLKPPRCHHCSVCGRCVLKMDHHCVWVVNCVGALNYKYfllflfyt  333
            D A  ++RFC+KCN  KPPRCHHCSVCGRC+LKMDHHCVWVVNCVGALNYKYFLLFLFYT
Sbjct  120  DPANQKVRFCRKCNHFKPPRCHHCSVCGRCILKMDHHCVWVVNCVGALNYKYFLLFLFYT  179

Query  334  flettlvtlSLLPNFLAFFGDVDIPGSAGDlattflafvlnlafalsvlGFLIMHISLVS  513
            FLETTLVTLSLL  F+AFF D +I G+ G +A +F+ FVLNLAF+LSVLGF+IMHISLV+
Sbjct  180  FLETTLVTLSLLRYFMAFFTDQEISGTLGTVAASFITFVLNLAFSLSVLGFMIMHISLVA  239

Query  514  RNTT  525
             NTT
Sbjct  240  ANTT  243



>gb|KJB49338.1| hypothetical protein B456_008G114100 [Gossypium raimondii]
Length=232

 Score =   187 bits (474),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 102/128 (80%), Positives = 111/128 (87%), Gaps = 0/128 (0%)
 Frame = +1

Query  28   WSYFSVVFTDPGSVPPNWKPASDEERGDTDPLTASEFGSLPPDTAQSRIRFCKKCNQLKP  207
            WSYF+VV TD G+VPPNWKPASDEERG+ DPL  SEF  L PD +  RIR+C KCNQ KP
Sbjct  76   WSYFTVVLTDSGTVPPNWKPASDEERGEVDPLNESEFDGLQPDLSSQRIRYCWKCNQFKP  135

Query  208  PRCHHCSVCGRCVLKMDHHCVWVVNCVGALNYKYfllflfytflettlvtlSLLPNFLAF  387
            PRCHHCSVCGRCVLKMDHHCVWVVNCVGALNYKYFLLFLFYTFLET+LVTL+L  +FLAF
Sbjct  136  PRCHHCSVCGRCVLKMDHHCVWVVNCVGALNYKYFLLFLFYTFLETSLVTLALFSHFLAF  195

Query  388  FGDVDIPG  411
            F D +IPG
Sbjct  196  FSDEEIPG  203



>ref|XP_009362135.1| PREDICTED: probable protein S-acyltransferase 14 isoform X2 [Pyrus 
x bretschneideri]
Length=220

 Score =   186 bits (472),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 103/140 (74%), Positives = 116/140 (83%), Gaps = 0/140 (0%)
 Frame = +1

Query  1    FYCLLVMLLWSYFSVVFTDPGSVPPNWKPASDEERGDTDPLTASEFGSLPPDTAQSRIRF  180
            F+ LLVMLLWSYF+VV TDPG VPPNW+PA DEE GD  PL  S+  ++  D A  +IRF
Sbjct  60   FHFLLVMLLWSYFNVVLTDPGRVPPNWRPAIDEETGDEAPLVGSDQSTMVSDPANQKIRF  119

Query  181  CKKCNQLKPPRCHHCSVCGRCVLKMDHHCVWVVNCVGALNYKYfllflfytflettlvtl  360
            C+KCN  KPPRCHHCSVCGRC+LKMDHHCVWVVNCVGALNYKYFLLFLFYTFLETTLVTL
Sbjct  120  CRKCNHYKPPRCHHCSVCGRCILKMDHHCVWVVNCVGALNYKYFLLFLFYTFLETTLVTL  179

Query  361  SLLPNFLAFFGDVDIPGSAG  420
            SL   F+AFF + +IPG+ G
Sbjct  180  SLFKYFMAFFTEEEIPGTLG  199



>ref|XP_009398464.1| PREDICTED: probable protein S-acyltransferase 14 [Musa acuminata 
subsp. malaccensis]
Length=314

 Score =   189 bits (480),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 139/184 (76%), Positives = 154/184 (84%), Gaps = 10/184 (5%)
 Frame = +1

Query  1    FYCLLVMLLWSYFSVVFTDPGSVPPNWKPASDEERGDTDPLTASEF---------GSLPP  153
            F+ LL +LLWSYFSVVFTDPGSVPPNWKP  DEE G+  PLT  +F         G L  
Sbjct  68   FHVLLGLLLWSYFSVVFTDPGSVPPNWKPTIDEEIGENAPLTNLDFSNHILNLQQGHLA-  126

Query  154  DTAQSRIRFCKKCNQLKPPRCHHCSVCGRCVLKMDHHCVWVVNCVGALNYKYfllflfyt  333
            +T    IR+C+KCNQLKPPRCHHCSVCGRCVLKMDHHCVWVVNCVGALNYK+FLLFLFYT
Sbjct  127  ETGNPTIRYCRKCNQLKPPRCHHCSVCGRCVLKMDHHCVWVVNCVGALNYKFFLLFLFYT  186

Query  334  flettlvtlSLLPNFLAFFGDVDIPGSAGDlattflafvlnlafalsvlGFLIMHISLVS  513
            FLETTLVTLSL P+F+AFF DV+IPG+ G LATTFL FVLNLAFALSVLGFLIMH+SLV+
Sbjct  187  FLETTLVTLSLFPHFIAFFKDVEIPGTPGTLATTFLTFVLNLAFALSVLGFLIMHVSLVA  246

Query  514  RNTT  525
            +NTT
Sbjct  247  KNTT  250



>ref|XP_006477282.1| PREDICTED: probable protein S-acyltransferase 14-like isoform 
X1 [Citrus sinensis]
 ref|XP_006477283.1| PREDICTED: probable protein S-acyltransferase 14-like isoform 
X2 [Citrus sinensis]
Length=316

 Score =   187 bits (476),  Expect = 5e-55, Method: Compositional matrix adjust.
 Identities = 128/184 (70%), Positives = 142/184 (77%), Gaps = 9/184 (5%)
 Frame = +1

Query  1    FYCLLVMLLWSYFSVVFTDPGSVPPNWKPASDEERGDTDPLTASEFGSLPPDTAQSR---  171
            F+ LLVML+WSYFSVV TDPG VPPNW P  DEE GD      S+ G +     QS    
Sbjct  69   FHSLLVMLVWSYFSVVITDPGGVPPNWIPNLDEESGDAGQWAGSDNGGVDLGANQSAMLI  128

Query  172  ------IRFCKKCNQLKPPRCHHCSVCGRCVLKMDHHCVWVVNCVGALNYKYfllflfyt  333
                  IRFC+KCNQ KPPRCHHCSVC RC+LKMDHHCVWVVNCVGA NYKYFLLFLFYT
Sbjct  129  EPKHQGIRFCQKCNQFKPPRCHHCSVCRRCILKMDHHCVWVVNCVGAFNYKYFLLFLFYT  188

Query  334  flettlvtlSLLPNFLAFFGDVDIPGSAGDlattflafvlnlafalsvlGFLIMHISLVS  513
            FLETTLVT+SLLP F+A F D +IP S G+LA +F+ FVLNLAFALS+LGFLIMHISLV+
Sbjct  189  FLETTLVTVSLLPIFIALFTDDEIPESPGNLAASFITFVLNLAFALSILGFLIMHISLVA  248

Query  514  RNTT  525
             NTT
Sbjct  249  GNTT  252



>ref|XP_002535239.1| zinc finger protein, putative [Ricinus communis]
 gb|EEF27145.1| zinc finger protein, putative [Ricinus communis]
Length=261

 Score =   184 bits (466),  Expect = 4e-54, Method: Compositional matrix adjust.
 Identities = 126/182 (69%), Positives = 140/182 (77%), Gaps = 11/182 (6%)
 Frame = +1

Query  13   LVMLLWSYFSVVFTDPGSVPPNWKPASDEERGDTDPLTASEFGSLPPDTAQ---------  165
            LVMLLWSYF+ V TDPG VPPNW+P+ DEERG+ DPL   E G       Q         
Sbjct  13   LVMLLWSYFATVLTDPGGVPPNWRPSIDEERGEADPLMRIEHGDANSGLNQFTILGKPDD  72

Query  166  SRIRFCKKCNQLKPPRCHHCSVCGRCVLKMDHHCVWVVNCVGALNYKYfllflfytflet  345
             R+RFC+KCNQ KPPRCHHCSVCGRC+LKMDHHCVWVVNCVGALNYKYFLLFLFYTFLET
Sbjct  73   QRMRFCRKCNQFKPPRCHHCSVCGRCILKMDHHCVWVVNCVGALNYKYFLLFLFYTFLET  132

Query  346  tlvtlSLLPNFLAFFGDVD--IPGSAGDlattflafvlnlafalsvlGFLIMHISLVSRN  519
            TLVTLSLL  F+AFF D D  +  + G L  TF+ FVLNL+FALSV+GFLIMHISLV  N
Sbjct  133  TLVTLSLLRLFVAFFTDSDAEVTETPGILVATFITFVLNLSFALSVVGFLIMHISLVLAN  192

Query  520  TT  525
            T+
Sbjct  193  TS  194



>ref|XP_008354779.1| PREDICTED: uncharacterized protein LOC103418427 [Malus domestica]
Length=822

 Score =   193 bits (490),  Expect = 6e-54, Method: Compositional matrix adjust.
 Identities = 84/103 (82%), Positives = 91/103 (88%), Gaps = 0/103 (0%)
 Frame = +1

Query  1    FYCLLVMLLWSYFSVVFTDPGSVPPNWKPASDEERGDTDPLTASEFGSLPPDTAQSRIRF  180
            F+CLLVMLLWSYFSVV TDPG VPPNW+PA DEERG  DPLT S+F  L PD +  RIR+
Sbjct  67   FHCLLVMLLWSYFSVVLTDPGGVPPNWRPAVDEERGQADPLTWSDFNGLQPDPSNLRIRY  126

Query  181  CKKCNQLKPPRCHHCSVCGRCVLKMDHHCVWVVNCVGALNYKY  309
            C+KCNQLKPPRCHHCSVCGRCVLKMDHHCVWVV+CVGALNYKY
Sbjct  127  CRKCNQLKPPRCHHCSVCGRCVLKMDHHCVWVVHCVGALNYKY  169



>ref|XP_008776787.1| PREDICTED: probable protein S-acyltransferase 14 [Phoenix dactylifera]
Length=317

 Score =   185 bits (469),  Expect = 7e-54, Method: Compositional matrix adjust.
 Identities = 131/175 (75%), Positives = 143/175 (82%), Gaps = 9/175 (5%)
 Frame = +1

Query  28   WSYFSVVFTDPGSVPPNWKPASDEERGDTDPLTASEFGSLP---------PDTAQSRIRF  180
            WSYFSVV TDPGS+PPNWKP  DEERG+  PL   EFG+            D+   RIR+
Sbjct  77   WSYFSVVLTDPGSIPPNWKPTVDEERGEEAPLNGLEFGNQSLSFQQSVNLADSGSPRIRY  136

Query  181  CKKCNQLKPPRCHHCSVCGRCVLKMDHHCVWVVNCVGALNYKYfllflfytflettlvtl  360
            C+KCNQLKPPRCHHCSVCGRC+LKMDHHCVWVVNCVGALNYK+FLLFLFYTFLETTLVTL
Sbjct  137  CRKCNQLKPPRCHHCSVCGRCILKMDHHCVWVVNCVGALNYKFFLLFLFYTFLETTLVTL  196

Query  361  SLLPNFLAFFGDVDIPGSAGDlattflafvlnlafalsvlGFLIMHISLVSRNTT  525
             LL NF+ FF D +IPG+ G LATTFL FVLNLAFALSVLGFLIMHISLV+ NTT
Sbjct  197  LLLQNFITFFSDAEIPGTPGTLATTFLTFVLNLAFALSVLGFLIMHISLVAGNTT  251



>gb|ACU18884.1| unknown [Glycine max]
Length=179

 Score =   180 bits (457),  Expect = 9e-54, Method: Compositional matrix adjust.
 Identities = 79/103 (77%), Positives = 88/103 (85%), Gaps = 0/103 (0%)
 Frame = +1

Query  1    FYCLLVMLLWSYFSVVFTDPGSVPPNWKPASDEERGDTDPLTASEFGSLPPDTAQSRIRF  180
            F+CLLVMLLW YF+VVFTDPG+VPPNWKPA DEERG+ DPL   E  +L  DT+  R R+
Sbjct  67   FHCLLVMLLWCYFAVVFTDPGTVPPNWKPAVDEERGEVDPLNGVELSNLQSDTSNQRFRY  126

Query  181  CKKCNQLKPPRCHHCSVCGRCVLKMDHHCVWVVNCVGALNYKY  309
            C+KC+Q KPPRCHHCSVCGRCVLKMDHHCVWVVNCVGA NYKY
Sbjct  127  CRKCSQPKPPRCHHCSVCGRCVLKMDHHCVWVVNCVGASNYKY  169



>gb|AHA84213.1| palmitoyltransferase [Phaseolus vulgaris]
Length=304

 Score =   184 bits (467),  Expect = 9e-54, Method: Compositional matrix adjust.
 Identities = 124/176 (70%), Positives = 139/176 (79%), Gaps = 3/176 (2%)
 Frame = +1

Query  1    FYCLLVMLLWSYFSVVFTDPGSVPPNWKPASDEERGDTDPLTASEFGSLPPDTAQSRIRF  180
            F+ LLVMLLWSYFSVVFTDPGSVPPNW+P  DEER + DPL  +EF ++  D  Q RIR+
Sbjct  67   FHSLLVMLLWSYFSVVFTDPGSVPPNWRPTIDEERREADPLVGTEFNNVQTDPNQ-RIRY  125

Query  181  CKKCNQLKPPRCHHCSVCGRCVLKMDH-HCVWVVNCVGALNYKYfllflfytflettlvt  357
            C+KCNQLKPPRCHHCSVCGRCVLKMDH  CV    C G+   + F   L   FL TTLVT
Sbjct  126  CRKCNQLKPPRCHHCSVCGRCVLKMDHPLCVGSQLCWGS-KLQVFPSLLSTLFLSTTLVT  184

Query  358  lSLLPNFLAFFGDVDIPGSAGDlattflafvlnlafalsvlGFLIMHISLVSRNTT  525
             SLLP+F+AFF D +IPG+ G LATTFLAFVLNLAFALSVLGFLIMHISLV+ NTT
Sbjct  185  ASLLPHFIAFFSDGEIPGTPGSLATTFLAFVLNLAFALSVLGFLIMHISLVAANTT  240



>gb|KJB37585.1| hypothetical protein B456_006G211800 [Gossypium raimondii]
Length=270

 Score =   182 bits (463),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 121/182 (66%), Positives = 139/182 (76%), Gaps = 7/182 (4%)
 Frame = +1

Query  1    FYCLLVMLLWSYFSVVFTDPGSVPPNWKPASDEERGDTDPLTASEFGSLPPDTAQS----  168
            F+ LLVM++W Y SVV TDPG VPPNW+P +DEE+GD DPL  S +GS   D  QS    
Sbjct  60   FHSLLVMVMWCYSSVVVTDPGGVPPNWRPLTDEEKGDADPLVGSGYGSAQLDPKQSATVA  119

Query  169  ---RIRFCKKCNQLKPPRCHHCSVCGRCVLKMDHHCVWVVNCVGALNYKYfllflfytfl  339
                IRFC KC Q KPPR HHCSVC RC+LKMDHHCVWVVNCVGALNYKYFLLFLFYTFL
Sbjct  120  VSQEIRFCHKCKQFKPPRAHHCSVCRRCILKMDHHCVWVVNCVGALNYKYFLLFLFYTFL  179

Query  340  ettlvtlSLLPNFLAFFGDVDIPGSAGDlattflafvlnlafalsvlGFLIMHISLVSRN  519
            ETTLV+L LL  F+ FF + +I  + G LA TF+ FVLN+AF LS+LGFLIMHI+LV  N
Sbjct  180  ETTLVSLLLLRVFMEFFNEGEIDETPGSLAATFITFVLNIAFTLSILGFLIMHITLVGAN  239

Query  520  TT  525
            T+
Sbjct  240  TS  241



>gb|KJB09891.1| hypothetical protein B456_001G174100 [Gossypium raimondii]
Length=230

 Score =   181 bits (459),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 82/103 (80%), Positives = 89/103 (86%), Gaps = 3/103 (3%)
 Frame = +1

Query  1    FYCLLVMLLWSYFSVVFTDPGSVPPNWKPASDEERGDTDPLTASEFGSLPPDTAQSRIRF  180
            F+CLLVMLLWSYFSVV TDPGS+P NW+PA DEERG+ DPL  SEF   P   +  RIR+
Sbjct  67   FHCLLVMLLWSYFSVVLTDPGSIPANWRPALDEERGEADPLNGSEFNVNP---SNQRIRY  123

Query  181  CKKCNQLKPPRCHHCSVCGRCVLKMDHHCVWVVNCVGALNYKY  309
            C+KCNQLKPPRCHHCSVCGRCVLKMDHHCVWVVNCVGALNYKY
Sbjct  124  CRKCNQLKPPRCHHCSVCGRCVLKMDHHCVWVVNCVGALNYKY  166



>gb|KDO63755.1| hypothetical protein CISIN_1g021223mg [Citrus sinensis]
Length=289

 Score =   182 bits (463),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 125/184 (68%), Positives = 140/184 (76%), Gaps = 9/184 (5%)
 Frame = +1

Query  1    FYCLLVMLLWSYFSVVFTDPGSVPPNWKPASDEERGDTDPLTASEFGSLPPDTAQSR---  171
            F+ LLVML+WSYFSVV TDPG VPPNW P  DEE G       S+   +     QS    
Sbjct  69   FHSLLVMLVWSYFSVVITDPGGVPPNWIPNLDEESGGAGQWAGSDNDGVDLGANQSAMLI  128

Query  172  ------IRFCKKCNQLKPPRCHHCSVCGRCVLKMDHHCVWVVNCVGALNYKYfllflfyt  333
                  +RFC+KCNQ KPPRCHHCSVC RC+LKMDHHCVWVVNCVGA NYKYFLLFLFYT
Sbjct  129  EPKHQGVRFCQKCNQFKPPRCHHCSVCRRCILKMDHHCVWVVNCVGAFNYKYFLLFLFYT  188

Query  334  flettlvtlSLLPNFLAFFGDVDIPGSAGDlattflafvlnlafalsvlGFLIMHISLVS  513
            FLETTLVT+SLLP F+A F D +IP S G+LA +F+ FVLNLAFALS+LGFLIMHISLV+
Sbjct  189  FLETTLVTVSLLPIFIALFTDDEIPESPGNLAASFITFVLNLAFALSILGFLIMHISLVA  248

Query  514  RNTT  525
             NTT
Sbjct  249  GNTT  252



>ref|XP_001781101.1| predicted protein [Physcomitrella patens]
 gb|EDQ54049.1| predicted protein, partial [Physcomitrella patens]
Length=306

 Score =   182 bits (463),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 121/180 (67%), Positives = 140/180 (78%), Gaps = 5/180 (3%)
 Frame = +1

Query  1    FYCLLVMLLWSYFSVVFTDPGSVPPNWKPASDEERGDTDPLTASEFGS-----LPPDTAQ  165
            F+ LL MLLW YFSVVFTDPG VPP+W+P+S EE  +   L  ++  S     +P  +  
Sbjct  61   FHALLAMLLWCYFSVVFTDPGGVPPSWRPSSSEEDLEVPSLPLTQNSSHDSAKIPTMSQS  120

Query  166  SRIRFCKKCNQLKPPRCHHCSVCGRCVLKMDHHCVWVVNCVGALNYKYfllflfytflet  345
             R R+C+KC+Q KPPRCHHCSVCGRC+LKMDHHCVWVVNCVGA NYKYFLLFLFYT LET
Sbjct  121  GRARYCRKCSQYKPPRCHHCSVCGRCILKMDHHCVWVVNCVGACNYKYFLLFLFYTLLET  180

Query  346  tlvtlSLLPNFLAFFGDVDIPGSAGDlattflafvlnlafalsvlGFLIMHISLVSRNTT  525
            ++VT+SLLP F+AFFGDV+     G L  TFL FVLN+AFALSVLGFLIMHISLV  NTT
Sbjct  181  SVVTVSLLPAFIAFFGDVEETAIPGSLVATFLGFVLNMAFALSVLGFLIMHISLVGGNTT  240



>gb|KJB37584.1| hypothetical protein B456_006G211800 [Gossypium raimondii]
 gb|KJB37586.1| hypothetical protein B456_006G211800 [Gossypium raimondii]
Length=308

 Score =   181 bits (460),  Expect = 9e-53, Method: Compositional matrix adjust.
 Identities = 121/182 (66%), Positives = 139/182 (76%), Gaps = 7/182 (4%)
 Frame = +1

Query  1    FYCLLVMLLWSYFSVVFTDPGSVPPNWKPASDEERGDTDPLTASEFGSLPPDTAQS----  168
            F+ LLVM++W Y SVV TDPG VPPNW+P +DEE+GD DPL  S +GS   D  QS    
Sbjct  60   FHSLLVMVMWCYSSVVVTDPGGVPPNWRPLTDEEKGDADPLVGSGYGSAQLDPKQSATVA  119

Query  169  ---RIRFCKKCNQLKPPRCHHCSVCGRCVLKMDHHCVWVVNCVGALNYKYfllflfytfl  339
                IRFC KC Q KPPR HHCSVC RC+LKMDHHCVWVVNCVGALNYKYFLLFLFYTFL
Sbjct  120  VSQEIRFCHKCKQFKPPRAHHCSVCRRCILKMDHHCVWVVNCVGALNYKYFLLFLFYTFL  179

Query  340  ettlvtlSLLPNFLAFFGDVDIPGSAGDlattflafvlnlafalsvlGFLIMHISLVSRN  519
            ETTLV+L LL  F+ FF + +I  + G LA TF+ FVLN+AF LS+LGFLIMHI+LV  N
Sbjct  180  ETTLVSLLLLRVFMEFFNEGEIDETPGSLAATFITFVLNIAFTLSILGFLIMHITLVGAN  239

Query  520  TT  525
            T+
Sbjct  240  TS  241



>gb|KDO63753.1| hypothetical protein CISIN_1g021223mg [Citrus sinensis]
 gb|KDO63754.1| hypothetical protein CISIN_1g021223mg [Citrus sinensis]
Length=316

 Score =   181 bits (460),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 125/184 (68%), Positives = 140/184 (76%), Gaps = 9/184 (5%)
 Frame = +1

Query  1    FYCLLVMLLWSYFSVVFTDPGSVPPNWKPASDEERGDTDPLTASEFGSLPPDTAQSR---  171
            F+ LLVML+WSYFSVV TDPG VPPNW P  DEE G       S+   +     QS    
Sbjct  69   FHSLLVMLVWSYFSVVITDPGGVPPNWIPNLDEESGGAGQWAGSDNDGVDLGANQSAMLI  128

Query  172  ------IRFCKKCNQLKPPRCHHCSVCGRCVLKMDHHCVWVVNCVGALNYKYfllflfyt  333
                  +RFC+KCNQ KPPRCHHCSVC RC+LKMDHHCVWVVNCVGA NYKYFLLFLFYT
Sbjct  129  EPKHQGVRFCQKCNQFKPPRCHHCSVCRRCILKMDHHCVWVVNCVGAFNYKYFLLFLFYT  188

Query  334  flettlvtlSLLPNFLAFFGDVDIPGSAGDlattflafvlnlafalsvlGFLIMHISLVS  513
            FLETTLVT+SLLP F+A F D +IP S G+LA +F+ FVLNLAFALS+LGFLIMHISLV+
Sbjct  189  FLETTLVTVSLLPIFIALFTDDEIPESPGNLAASFITFVLNLAFALSILGFLIMHISLVA  248

Query  514  RNTT  525
             NTT
Sbjct  249  GNTT  252



>ref|XP_006440415.1| hypothetical protein CICLE_v10021242mg [Citrus clementina]
 ref|XP_006440416.1| hypothetical protein CICLE_v10021242mg [Citrus clementina]
 gb|ESR53655.1| hypothetical protein CICLE_v10021242mg [Citrus clementina]
 gb|ESR53656.1| hypothetical protein CICLE_v10021242mg [Citrus clementina]
Length=315

 Score =   181 bits (460),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 125/184 (68%), Positives = 140/184 (76%), Gaps = 9/184 (5%)
 Frame = +1

Query  1    FYCLLVMLLWSYFSVVFTDPGSVPPNWKPASDEERGDTDPLTASEFGSLPPDTAQSR---  171
            F+ LLVML+WSYFSVV TDPG VPPNW P  DEE G       S+   +     QS    
Sbjct  68   FHSLLVMLVWSYFSVVITDPGGVPPNWIPNLDEESGGAGQWAGSDNDGVDLGANQSAMLI  127

Query  172  ------IRFCKKCNQLKPPRCHHCSVCGRCVLKMDHHCVWVVNCVGALNYKYfllflfyt  333
                  +RFC+KCNQ KPPRCHHCSVC RC+LKMDHHCVWVVNCVGA NYKYFLLFLFYT
Sbjct  128  EPKHQGVRFCQKCNQFKPPRCHHCSVCRRCILKMDHHCVWVVNCVGAFNYKYFLLFLFYT  187

Query  334  flettlvtlSLLPNFLAFFGDVDIPGSAGDlattflafvlnlafalsvlGFLIMHISLVS  513
            FLETTLVT+SLLP F+A F D +IP S G+LA +F+ FVLNLAFALS+LGFLIMHISLV+
Sbjct  188  FLETTLVTVSLLPIFIALFTDDEIPESPGNLAASFITFVLNLAFALSILGFLIMHISLVA  247

Query  514  RNTT  525
             NTT
Sbjct  248  GNTT  251



>gb|KHG16541.1| hypothetical protein F383_02611 [Gossypium arboreum]
Length=308

 Score =   181 bits (459),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 120/182 (66%), Positives = 139/182 (76%), Gaps = 7/182 (4%)
 Frame = +1

Query  1    FYCLLVMLLWSYFSVVFTDPGSVPPNWKPASDEERGDTDPLTASEFGSLPPDTAQS----  168
            F+ LLVM++W Y SVV TDPG VPPNW+P +DEE+GD DPL  S +GS   D  QS    
Sbjct  60   FHSLLVMVMWCYSSVVVTDPGGVPPNWRPLTDEEKGDADPLVGSSYGSAQLDPKQSAMVA  119

Query  169  ---RIRFCKKCNQLKPPRCHHCSVCGRCVLKMDHHCVWVVNCVGALNYKYfllflfytfl  339
                IRFC KC Q KPPR HHCSVC RC+LKMDHHCVWVVNCVGALNYKYFLLFLFYTFL
Sbjct  120  ASQEIRFCHKCKQFKPPRAHHCSVCRRCILKMDHHCVWVVNCVGALNYKYFLLFLFYTFL  179

Query  340  ettlvtlSLLPNFLAFFGDVDIPGSAGDlattflafvlnlafalsvlGFLIMHISLVSRN  519
            ETTLV+L LL  F+ FF + ++  + G LA TF+ FVLN+AF LS+LGFLIMHI+LV  N
Sbjct  180  ETTLVSLLLLRVFMEFFMEGEVDETPGSLAATFITFVLNIAFMLSILGFLIMHITLVGAN  239

Query  520  TT  525
            T+
Sbjct  240  TS  241



>ref|XP_002304438.2| hypothetical protein POPTR_0003s11520g [Populus trichocarpa]
 gb|EEE79417.2| hypothetical protein POPTR_0003s11520g [Populus trichocarpa]
Length=318

 Score =   181 bits (459),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 126/184 (68%), Positives = 143/184 (78%), Gaps = 9/184 (5%)
 Frame = +1

Query  1    FYCLLVMLLWSYFSVVFTDPGSVPPNWKPASDEERGDTDPLTA-----SEFGSLPPDT--  159
            F+ LLVMLLWSYF+ V TDPG VPPNW+P+ DEE GD DPL       ++ G   P T  
Sbjct  68   FHSLLVMLLWSYFTTVLTDPGGVPPNWRPSIDEESGDADPLVGLGYEGTDLGLNQPATFG  127

Query  160  --AQSRIRFCKKCNQLKPPRCHHCSVCGRCVLKMDHHCVWVVNCVGALNYKYfllflfyt  333
              A  ++R C+KCNQ KPPRCHHCSVCGRC+LKMDHHCVWVVNCVGALNYKYFLLFLFYT
Sbjct  128  EPANPQLRVCRKCNQCKPPRCHHCSVCGRCILKMDHHCVWVVNCVGALNYKYFLLFLFYT  187

Query  334  flettlvtlSLLPNFLAFFGDVDIPGSAGDlattflafvlnlafalsvlGFLIMHISLVS  513
            FL TTLVTLSLL  F+AFF D  I G+ G L  TF+ FVLNL+FALS++GFL+MHISLV 
Sbjct  188  FLLTTLVTLSLLRLFIAFFTDGVINGTPGTLVATFVTFVLNLSFALSIMGFLVMHISLVL  247

Query  514  RNTT  525
             NTT
Sbjct  248  GNTT  251



>emb|CDX94118.1| BnaC07g37520D [Brassica napus]
Length=305

 Score =   180 bits (457),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 122/178 (69%), Positives = 139/178 (78%), Gaps = 3/178 (2%)
 Frame = +1

Query  1    FYCLLVMLLWSYFSVVFTDPGSVPPNWKPASDEERGDTDPLTASEFGSLP-PDTAQSRIR  177
            F+ LLVMLLWSYFSVV TDPG VPP W+P  D E+GD +    +E   L   D++   +R
Sbjct  60   FHFLLVMLLWSYFSVVVTDPGGVPPGWRPELDIEKGDGNEAAIAEASPLSVGDSSSHIVR  119

Query  178  FCKKCNQLKPPRCHHCSVCGRCVLKMDHHCVWVVNCVGALNYKYfllflfytflettlvt  357
             C+KCNQ KPPR HHCSVCGRC+LKMDHHCVWVVNCVGA NYK FLLFLFYTFLETT+V 
Sbjct  120  HCRKCNQYKPPRSHHCSVCGRCILKMDHHCVWVVNCVGARNYKSFLLFLFYTFLETTVVA  179

Query  358  lSLLPNFLAFF--GDVDIPGSAGDlattflafvlnlafalsvlGFLIMHISLVSRNTT  525
            +SL P FL FF  GD +I  S G LA TF+AF+LN+AFALSVLGFLIMHI LV+RNTT
Sbjct  180  VSLFPAFLVFFTDGDDEITVSLGSLAATFIAFILNIAFALSVLGFLIMHIMLVARNTT  237



>ref|XP_009137276.1| PREDICTED: probable protein S-acyltransferase 13 [Brassica rapa]
Length=305

 Score =   179 bits (454),  Expect = 8e-52, Method: Compositional matrix adjust.
 Identities = 121/178 (68%), Positives = 139/178 (78%), Gaps = 3/178 (2%)
 Frame = +1

Query  1    FYCLLVMLLWSYFSVVFTDPGSVPPNWKPASDEERGDTDPLTASEFGSLP-PDTAQSRIR  177
            F+ LLVM+LWSYFSVV TDPG VPP W+P  D E+GD +    +E   L   D++   +R
Sbjct  60   FHFLLVMVLWSYFSVVVTDPGGVPPGWRPELDIEKGDGNEAAIAEASPLSVGDSSSHIVR  119

Query  178  FCKKCNQLKPPRCHHCSVCGRCVLKMDHHCVWVVNCVGALNYKYfllflfytflettlvt  357
             C+KCNQ KPPR HHCSVCGRC+LKMDHHCVWVVNCVGA NYK FLLFLFYTFLETT+V 
Sbjct  120  HCRKCNQYKPPRSHHCSVCGRCILKMDHHCVWVVNCVGARNYKSFLLFLFYTFLETTVVA  179

Query  358  lSLLPNFLAFF--GDVDIPGSAGDlattflafvlnlafalsvlGFLIMHISLVSRNTT  525
            +SL P FL FF  GD +I  S G LA TF+AF+LN+AFALSVLGFLIMHI LV+RNTT
Sbjct  180  VSLFPAFLVFFTDGDDEITVSLGSLAATFIAFILNIAFALSVLGFLIMHIMLVARNTT  237



>emb|CDX98764.1| BnaA03g45490D [Brassica napus]
Length=305

 Score =   179 bits (454),  Expect = 8e-52, Method: Compositional matrix adjust.
 Identities = 121/178 (68%), Positives = 139/178 (78%), Gaps = 3/178 (2%)
 Frame = +1

Query  1    FYCLLVMLLWSYFSVVFTDPGSVPPNWKPASDEERGDTDPLTASEFGSLP-PDTAQSRIR  177
            F+ LLVM+LWSYFSVV TDPG VPP W+P  D E+GD +    +E   L   D++   +R
Sbjct  60   FHFLLVMVLWSYFSVVVTDPGGVPPGWRPELDIEKGDGNEAAIAEASPLSVGDSSSHIVR  119

Query  178  FCKKCNQLKPPRCHHCSVCGRCVLKMDHHCVWVVNCVGALNYKYfllflfytflettlvt  357
             C+KCNQ KPPR HHCSVCGRC+LKMDHHCVWVVNCVGA NYK FLLFLFYTFLETT+V 
Sbjct  120  HCRKCNQYKPPRSHHCSVCGRCILKMDHHCVWVVNCVGARNYKSFLLFLFYTFLETTVVA  179

Query  358  lSLLPNFLAFF--GDVDIPGSAGDlattflafvlnlafalsvlGFLIMHISLVSRNTT  525
            +SL P FL FF  GD +I  S G LA TF+AF+LN+AFALSVLGFLIMHI LV+RNTT
Sbjct  180  VSLFPAFLVFFTDGDDEITVSLGSLAATFIAFILNIAFALSVLGFLIMHIMLVARNTT  237



>ref|XP_006440414.1| hypothetical protein CICLE_v10021242mg [Citrus clementina]
 gb|ESR53654.1| hypothetical protein CICLE_v10021242mg [Citrus clementina]
 gb|KDO63756.1| hypothetical protein CISIN_1g021223mg [Citrus sinensis]
Length=253

 Score =   177 bits (449),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 124/184 (67%), Positives = 138/184 (75%), Gaps = 9/184 (5%)
 Frame = +1

Query  1    FYCLLVMLLWSYFSVVFTDPGSVPPNWKPASDEERGDTDPLTASEFGSLPPDTAQSR---  171
            F   LVML+WSYFSVV TDPG VPPNW P  DEE G       S+   +     QS    
Sbjct  6    FVMQLVMLVWSYFSVVITDPGGVPPNWIPNLDEESGGAGQWAGSDNDGVDLGANQSAMLI  65

Query  172  ------IRFCKKCNQLKPPRCHHCSVCGRCVLKMDHHCVWVVNCVGALNYKYfllflfyt  333
                  +RFC+KCNQ KPPRCHHCSVC RC+LKMDHHCVWVVNCVGA NYKYFLLFLFYT
Sbjct  66   EPKHQGVRFCQKCNQFKPPRCHHCSVCRRCILKMDHHCVWVVNCVGAFNYKYFLLFLFYT  125

Query  334  flettlvtlSLLPNFLAFFGDVDIPGSAGDlattflafvlnlafalsvlGFLIMHISLVS  513
            FLETTLVT+SLLP F+A F D +IP S G+LA +F+ FVLNLAFALS+LGFLIMHISLV+
Sbjct  126  FLETTLVTVSLLPIFIALFTDDEIPESPGNLAASFITFVLNLAFALSILGFLIMHISLVA  185

Query  514  RNTT  525
             NTT
Sbjct  186  GNTT  189



>ref|XP_011033891.1| PREDICTED: probable protein S-acyltransferase 14 [Populus euphratica]
Length=318

 Score =   179 bits (453),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 122/184 (66%), Positives = 140/184 (76%), Gaps = 9/184 (5%)
 Frame = +1

Query  1    FYCLLVMLLWSYFSVVFTDPGSVPPNWKPASDEERGDTDPLTASEFGSLP---------P  153
            F+ LLVMLLWSYF+ V TDPG VPPNW+P+ DEE GD DPL    +  +           
Sbjct  68   FHSLLVMLLWSYFTTVLTDPGGVPPNWRPSIDEESGDADPLVGLGYEGMDLGLNQLATFG  127

Query  154  DTAQSRIRFCKKCNQLKPPRCHHCSVCGRCVLKMDHHCVWVVNCVGALNYKYfllflfyt  333
            + A  ++R C+KCNQ KPPRCHHCSVCGRC+LKMDHHCVWVVNCVGALNYKYFLLFLFYT
Sbjct  128  EPANPQLRVCRKCNQFKPPRCHHCSVCGRCILKMDHHCVWVVNCVGALNYKYFLLFLFYT  187

Query  334  flettlvtlSLLPNFLAFFGDVDIPGSAGDlattflafvlnlafalsvlGFLIMHISLVS  513
            FL TTLVTLSLL  F+AFF D  I G+ G L  TF+ FVLNL+FALS++GF +MHISLV 
Sbjct  188  FLLTTLVTLSLLRLFIAFFTDGVINGTPGTLVATFVTFVLNLSFALSIMGFRVMHISLVL  247

Query  514  RNTT  525
             NTT
Sbjct  248  GNTT  251



>gb|KFK28858.1| hypothetical protein AALP_AA7G057700 [Arabis alpina]
Length=304

 Score =   177 bits (449),  Expect = 4e-51, Method: Compositional matrix adjust.
 Identities = 122/178 (69%), Positives = 139/178 (78%), Gaps = 3/178 (2%)
 Frame = +1

Query  1    FYCLLVMLLWSYFSVVFTDPGSVPPNWKPASDEERGDTDPLTASEFGSLP-PDTAQSRIR  177
            F+ LLVML+WSYFSVV TDPG VPP W+P  D E+ + +     E   +   D++   +R
Sbjct  60   FHFLLVMLVWSYFSVVVTDPGGVPPGWRPELDIEKSEGNQQAIVEANPISVGDSSSHIVR  119

Query  178  FCKKCNQLKPPRCHHCSVCGRCVLKMDHHCVWVVNCVGALNYKYfllflfytflettlvt  357
            +C+KCNQ KPPR HHCSVCGRC+LKMDHHCVWVVNCVGA+NYK FLLFLFYTFLETTLV 
Sbjct  120  YCRKCNQYKPPRSHHCSVCGRCILKMDHHCVWVVNCVGAMNYKSFLLFLFYTFLETTLVA  179

Query  358  lSLLPNFLAFF--GDVDIPGSAGDlattflafvlnlafalsvlGFLIMHISLVSRNTT  525
            +SLLP FL FF  GD DI  S G LA TF+AFVLN+AFALSVLGFLIMHI LV RNTT
Sbjct  180  VSLLPVFLVFFSDGDDDITVSPGSLAATFVAFVLNIAFALSVLGFLIMHIMLVRRNTT  237



>ref|XP_011029092.1| PREDICTED: probable protein S-acyltransferase 14 isoform X1 [Populus 
euphratica]
Length=310

 Score =   177 bits (449),  Expect = 4e-51, Method: Compositional matrix adjust.
 Identities = 120/184 (65%), Positives = 134/184 (73%), Gaps = 9/184 (5%)
 Frame = +1

Query  1    FYCLLVMLLWSYFSVVFTDPGSVPPNWKPASDEERGDTDPLTASEFGSLPPDTAQS----  168
            F+ LLVMLLWSYF+   TDPG VPP+W+P+ DEE GD DPL          D  QS    
Sbjct  60   FHSLLVMLLWSYFTTCLTDPGGVPPSWRPSIDEESGDADPLVGLAHEGTGLDLNQSAMLG  119

Query  169  -----RIRFCKKCNQLKPPRCHHCSVCGRCVLKMDHHCVWVVNCVGALNYKYfllflfyt  333
                 R R C+KCN  KPPRCHHCSVCGRC+LKMDHHCVWVVNCVGALNYKYFLLFLFYT
Sbjct  120  EPANPRTRVCRKCNWFKPPRCHHCSVCGRCILKMDHHCVWVVNCVGALNYKYFLLFLFYT  179

Query  334  flettlvtlSLLPNFLAFFGDVDIPGSAGDlattflafvlnlafalsvlGFLIMHISLVS  513
            FL TTLVT SLLP F+AF    +  G+   L  TF+ FVLNL+FALS++GFLIMHISLV 
Sbjct  180  FLVTTLVTSSLLPKFIAFLTVGEKNGTPETLVATFVTFVLNLSFALSIMGFLIMHISLVL  239

Query  514  RNTT  525
             NTT
Sbjct  240  GNTT  243



>ref|XP_009136109.1| PREDICTED: probable protein S-acyltransferase 13 [Brassica rapa]
Length=301

 Score =   177 bits (448),  Expect = 5e-51, Method: Compositional matrix adjust.
 Identities = 121/178 (68%), Positives = 138/178 (78%), Gaps = 7/178 (4%)
 Frame = +1

Query  1    FYCLLVMLLWSYFSVVFTDPGSVPPNWKPASDEERGDTDPLTASEFGSLP-PDTAQSRIR  177
            F+ LL+MLLWSYFSVV TDPG VPP W+P  D E+ D +     E+ SL   D++   +R
Sbjct  60   FHFLLIMLLWSYFSVVVTDPGGVPPGWRPELDIEKSDGN----QEYSSLTVGDSSSHIVR  115

Query  178  FCKKCNQLKPPRCHHCSVCGRCVLKMDHHCVWVVNCVGALNYKYfllflfytflettlvt  357
            +C+KCNQ KPPR HHCSVCGRC+LKMDHHCVWVVNCVGA NYK FLLFLFYTFLETT+V 
Sbjct  116  YCRKCNQYKPPRSHHCSVCGRCILKMDHHCVWVVNCVGAKNYKSFLLFLFYTFLETTVVA  175

Query  358  lSLLPNFLAFF--GDVDIPGSAGDlattflafvlnlafalsvlGFLIMHISLVSRNTT  525
            +SL P FL FF  GD D+  S G LA TF+AFVLN+ FALSVLGFLIMHI LV RNTT
Sbjct  176  ISLFPVFLVFFTDGDSDVTVSPGSLAATFVAFVLNITFALSVLGFLIMHIMLVIRNTT  233



>ref|XP_009136132.1| PREDICTED: probable protein S-acyltransferase 13 [Brassica rapa]
Length=302

 Score =   177 bits (448),  Expect = 6e-51, Method: Compositional matrix adjust.
 Identities = 121/178 (68%), Positives = 138/178 (78%), Gaps = 7/178 (4%)
 Frame = +1

Query  1    FYCLLVMLLWSYFSVVFTDPGSVPPNWKPASDEERGDTDPLTASEFGSLP-PDTAQSRIR  177
            F+ LL+MLLWSYFSVV TDPG VPP W+P  D E+ D +     E+ SL   D++   +R
Sbjct  60   FHFLLIMLLWSYFSVVVTDPGGVPPGWRPELDIEKSDGN----QEYSSLTVGDSSSHIVR  115

Query  178  FCKKCNQLKPPRCHHCSVCGRCVLKMDHHCVWVVNCVGALNYKYfllflfytflettlvt  357
            +C+KCNQ KPPR HHCSVCGRC+LKMDHHCVWVVNCVGA NYK FLLFLFYTFLETT+V 
Sbjct  116  YCRKCNQYKPPRSHHCSVCGRCILKMDHHCVWVVNCVGAKNYKSFLLFLFYTFLETTVVA  175

Query  358  lSLLPNFLAFF--GDVDIPGSAGDlattflafvlnlafalsvlGFLIMHISLVSRNTT  525
            +SL P FL FF  GD D+  S G LA TF+AFVLN+ FALSVLGFLIMHI LV RNTT
Sbjct  176  ISLFPVFLVFFTDGDSDVTVSPGSLAATFVAFVLNITFALSVLGFLIMHIMLVIRNTT  233



>ref|XP_010448848.1| PREDICTED: probable protein S-acyltransferase 13 [Camelina sativa]
Length=304

 Score =   176 bits (447),  Expect = 8e-51, Method: Compositional matrix adjust.
 Identities = 125/179 (70%), Positives = 140/179 (78%), Gaps = 4/179 (2%)
 Frame = +1

Query  1    FYCLLVMLLWSYFSVVFTDPGSVPPNWKPASDEERGDTDPLTASEFG-SLP-PDTAQSRI  174
            F+ LLVMLLWSYFSVV TDPG VP  W+P  D E+ D +     E   SL   D++   +
Sbjct  60   FHFLLVMLLWSYFSVVVTDPGGVPTGWRPELDIEKSDGNQTLIGEANPSLSVGDSSTHGV  119

Query  175  RFCKKCNQLKPPRCHHCSVCGRCVLKMDHHCVWVVNCVGALNYKYfllflfytflettlv  354
            R+C+KCNQ KPPR HHCSVCGRC+LKMDHHCVWVVNCVGA+NYK FLLFLFYTFLETTLV
Sbjct  120  RYCRKCNQYKPPRSHHCSVCGRCILKMDHHCVWVVNCVGAMNYKSFLLFLFYTFLETTLV  179

Query  355  tlSLLPNFLAFF--GDVDIPGSAGDlattflafvlnlafalsvlGFLIMHISLVSRNTT  525
             +SLLP FL FF  GD DI  S G LA TF+AFVLN+AFALSVLGFLIMHI LV+RNTT
Sbjct  180  AISLLPVFLVFFSDGDGDITVSPGSLAATFVAFVLNIAFALSVLGFLIMHIMLVARNTT  238



>ref|XP_002994078.1| hypothetical protein SELMODRAFT_449300 [Selaginella moellendorffii]
 gb|EFJ04865.1| hypothetical protein SELMODRAFT_449300 [Selaginella moellendorffii]
Length=313

 Score =   175 bits (444),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 129/188 (69%), Positives = 143/188 (76%), Gaps = 13/188 (7%)
 Frame = +1

Query  1    FYCLLVMLLWSYFSVVFTDPGSVPPNWKPASDEERGDTD-----PLTASEFGSLPPDTAQ  165
            F+ LL M+LW YF+VVFTDPGSVP +WKPAS  E  +        L A+    L   T Q
Sbjct  60   FHLLLAMVLWCYFAVVFTDPGSVPSDWKPASANEDMEAQNTLLSSLPANSAAVLTAPTTQ  119

Query  166  -------SRIRFCKKCNQLKPPRCHHCSVCGRCVLKMDHHCVWVVNCVGALNYKYfllfl  324
                   SR+RFC+KC Q KPPRCHHCSVCGRCVLKMDHHCVWVVNCVGA NYK FLLFL
Sbjct  120  MSTSLDSSRMRFCRKCCQFKPPRCHHCSVCGRCVLKMDHHCVWVVNCVGARNYKAFLLFL  179

Query  325  fytflettlvtlSLLPNFLAFFGDV-DIPGSAGDlattflafvlnlafalsvlGFLIMHI  501
            FYTFLET+LV+LSLLP+F+AFF D  D P   G LATTFLAFVL+LAFALSVLGFLIMHI
Sbjct  180  FYTFLETSLVSLSLLPHFIAFFTDADDEPALPGTLATTFLAFVLDLAFALSVLGFLIMHI  239

Query  502  SLVSRNTT  525
            SLV+ NTT
Sbjct  240  SLVAGNTT  247



>ref|XP_010433998.1| PREDICTED: probable protein S-acyltransferase 13 [Camelina sativa]
Length=305

 Score =   175 bits (443),  Expect = 4e-50, Method: Compositional matrix adjust.
 Identities = 122/180 (68%), Positives = 140/180 (78%), Gaps = 5/180 (3%)
 Frame = +1

Query  1    FYCLLVMLLWSYFSVVFTDPGSVPPNWKPASDEER---GDTDPLTASEFGSLPPDTAQSR  171
            F+ LLVMLLWSYFSVV TDPG VP  W+P  D E+   G+ + +  +       D++   
Sbjct  60   FHFLLVMLLWSYFSVVVTDPGGVPTGWRPELDIEKSGDGNQNLIGEANPSLSVGDSSNHG  119

Query  172  IRFCKKCNQLKPPRCHHCSVCGRCVLKMDHHCVWVVNCVGALNYKYfllflfytflettl  351
            +R+C+KCNQ KPPR HHCSVCGRC+LKMDHHCVWVVNCVGA+NYK FLLFLFYTFLETTL
Sbjct  120  VRYCRKCNQYKPPRSHHCSVCGRCILKMDHHCVWVVNCVGAMNYKSFLLFLFYTFLETTL  179

Query  352  vtlSLLPNFLAFF--GDVDIPGSAGDlattflafvlnlafalsvlGFLIMHISLVSRNTT  525
            V +SLLP FL FF  GD DI  S G LA TF+AFVLN+AFALSVLGFLIMHI LV+RNTT
Sbjct  180  VAISLLPVFLVFFSDGDGDITVSPGSLAATFVAFVLNIAFALSVLGFLIMHIMLVARNTT  239



>ref|NP_567668.1| DHHC-type zinc finger family protein [Arabidopsis thaliana]
 sp|Q94C49.1|ZDH18_ARATH RecName: Full=Probable protein S-acyltransferase 13; AltName: 
Full=Probable palmitoyltransferase At4g22750; AltName: Full=Zinc 
finger DHHC domain-containing protein At4g22750 [Arabidopsis 
thaliana]
 gb|AAK59683.1| unknown protein [Arabidopsis thaliana]
 gb|AAL33803.1| unknown protein [Arabidopsis thaliana]
 gb|AEE84651.1| DHHC-type zinc finger family protein [Arabidopsis thaliana]
Length=302

 Score =   174 bits (442),  Expect = 5e-50, Method: Compositional matrix adjust.
 Identities = 119/177 (67%), Positives = 138/177 (78%), Gaps = 4/177 (2%)
 Frame = +1

Query  1    FYCLLVMLLWSYFSVVFTDPGSVPPNWKPASDEERGDTDPLTASEFGSLPPDTAQSRIRF  180
            F+ LL+MLLWSYFSVV TDPG VP  W+P  D E+ + +     E  +   D++   +R+
Sbjct  60   FHFLLIMLLWSYFSVVVTDPGGVPTGWRPELDIEKSEGNQALIGE--ASVGDSSSHGVRY  117

Query  181  CKKCNQLKPPRCHHCSVCGRCVLKMDHHCVWVVNCVGALNYKYfllflfytflettlvtl  360
            C+KCNQ KPPR HHCSVCGRC+LKMDHHCVWVVNCVGA NYK FLLFLFYTFLETT+V +
Sbjct  118  CRKCNQYKPPRSHHCSVCGRCILKMDHHCVWVVNCVGANNYKSFLLFLFYTFLETTVVAV  177

Query  361  SLLPNFLAFF--GDVDIPGSAGDlattflafvlnlafalsvlGFLIMHISLVSRNTT  525
            SLLP FL FF  GD DI  S G LA +F+AFVLN+AFALSVLGFLIMHI LV+RNTT
Sbjct  178  SLLPIFLVFFSDGDGDITVSPGSLAASFVAFVLNIAFALSVLGFLIMHIMLVARNTT  234



>ref|XP_010540019.1| PREDICTED: probable protein S-acyltransferase 13 [Tarenaya hassleriana]
Length=307

 Score =   174 bits (441),  Expect = 6e-50, Method: Compositional matrix adjust.
 Identities = 122/181 (67%), Positives = 139/181 (77%), Gaps = 6/181 (3%)
 Frame = +1

Query  1    FYCLLVMLLWSYFSVVFTDPGSVPPNWKPASDEERGD-TDPLTASEFGSLP-PDTAQSRI  174
            F+ LL MLLWSYFSVV TDPG VPP W+P  D E+ D + P  +    SL   D     +
Sbjct  60   FHFLLAMLLWSYFSVVVTDPGGVPPGWRPELDIEKSDPSQPGNSEASQSLAVADPLSHGV  119

Query  175  RFCKKCNQLKPPRCHHCSVCGRCVLKMDHHCVWVVNCVGALNYKYfllflfytflettlv  354
            R+C+KCNQ KPPRCHHCSVCGRC+LKMDHHCVWVVNCVGA+NYKYFLLFLF+TFLETTLV
Sbjct  120  RYCRKCNQYKPPRCHHCSVCGRCILKMDHHCVWVVNCVGAMNYKYFLLFLFFTFLETTLV  179

Query  355  tlSLLPNFLAFFGD----VDIPGSAGDlattflafvlnlafalsvlGFLIMHISLVSRNT  522
             +SLL  FL FF D    +D   S G LA TF+AFVLNLAFALS+LGFLIMH+ LV+RNT
Sbjct  180  AVSLLHVFLVFFTDGDTEIDTTISPGTLAVTFVAFVLNLAFALSILGFLIMHLMLVARNT  239

Query  523  T  525
            T
Sbjct  240  T  240



>gb|AAM65313.1| unknown [Arabidopsis thaliana]
Length=302

 Score =   174 bits (440),  Expect = 7e-50, Method: Compositional matrix adjust.
 Identities = 119/177 (67%), Positives = 138/177 (78%), Gaps = 4/177 (2%)
 Frame = +1

Query  1    FYCLLVMLLWSYFSVVFTDPGSVPPNWKPASDEERGDTDPLTASEFGSLPPDTAQSRIRF  180
            F+ LL+MLLWSYFSVV TDPG VP  W+P  D E+ + +     E  +   D++   +R+
Sbjct  60   FHFLLIMLLWSYFSVVVTDPGGVPTGWRPELDIEKSEGNQALIGE--ASVGDSSSHGVRY  117

Query  181  CKKCNQLKPPRCHHCSVCGRCVLKMDHHCVWVVNCVGALNYKYfllflfytflettlvtl  360
            C+KCNQ KPPR HHCSVCGRC+LKMDHHCVWVVNCVGA NYK FLLFLFYTFLETT+V +
Sbjct  118  CRKCNQYKPPRSHHCSVCGRCILKMDHHCVWVVNCVGANNYKSFLLFLFYTFLETTVVAV  177

Query  361  SLLPNFLAFF--GDVDIPGSAGDlattflafvlnlafalsvlGFLIMHISLVSRNTT  525
            SLLP FL FF  GD DI  S G LA +F+AFVLN+AFALSVLGFLIMHI LV+RNTT
Sbjct  178  SLLPIFLVFFSDGDGDITVSPGSLAASFVAFVLNIAFALSVLGFLIMHIMLVARNTT  234



>ref|XP_010439292.1| PREDICTED: probable protein S-acyltransferase 13 [Camelina sativa]
Length=305

 Score =   174 bits (440),  Expect = 8e-50, Method: Compositional matrix adjust.
 Identities = 122/180 (68%), Positives = 140/180 (78%), Gaps = 5/180 (3%)
 Frame = +1

Query  1    FYCLLVMLLWSYFSVVFTDPGSVPPNWKPASDEER---GDTDPLTASEFGSLPPDTAQSR  171
            F+ LLVMLLWSYFSVV TDPG VP  W+P  D E+   G+ + +  +       D++   
Sbjct  60   FHFLLVMLLWSYFSVVVTDPGGVPTGWRPELDIEKSGDGNQNLIGEANPSLSVGDSSNHG  119

Query  172  IRFCKKCNQLKPPRCHHCSVCGRCVLKMDHHCVWVVNCVGALNYKYfllflfytflettl  351
            +R+C+KCNQ KPPR HHCSVCGRC+LKMDHHCVWVVNCVGA+NYK FLLFLFYTFLETTL
Sbjct  120  VRYCRKCNQYKPPRSHHCSVCGRCILKMDHHCVWVVNCVGAMNYKSFLLFLFYTFLETTL  179

Query  352  vtlSLLPNFLAFF--GDVDIPGSAGDlattflafvlnlafalsvlGFLIMHISLVSRNTT  525
            V +SLLP FL FF  GD DI  S G LA TF+AFVLN+AFALSVLGFLIMHI LV+RNTT
Sbjct  180  VAISLLPVFLVFFGDGDGDITVSPGSLAATFVAFVLNIAFALSVLGFLIMHIMLVARNTT  239



>dbj|BAJ34112.1| unnamed protein product [Thellungiella halophila]
Length=304

 Score =   173 bits (439),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 119/178 (67%), Positives = 138/178 (78%), Gaps = 4/178 (2%)
 Frame = +1

Query  1    FYCLLVMLLWSYFSVVFTDPGSVPPNWKPASDEERGD-TDPLTASEFGSLPPDTAQSRIR  177
            F+ LL+MLLWSYFSVV TDPG VPP W+P  D E+ +   P  A +  S+   ++   +R
Sbjct  60   FHFLLIMLLWSYFSVVVTDPGGVPPGWRPELDIEKNEGNQPAIADQSLSVGGSSSHG-VR  118

Query  178  FCKKCNQLKPPRCHHCSVCGRCVLKMDHHCVWVVNCVGALNYKYfllflfytflettlvt  357
            +C+KCNQ KPPR HHCSVCGRC+LKMDHHCVWVVNCVGA+NYK FLLFLFYTFLETT+V 
Sbjct  119  YCRKCNQYKPPRSHHCSVCGRCILKMDHHCVWVVNCVGAMNYKSFLLFLFYTFLETTVVA  178

Query  358  lSLLPNFLAFFGD--VDIPGSAGDlattflafvlnlafalsvlGFLIMHISLVSRNTT  525
             SL P FL FF D   DI  S G LA TF+AFVLN+AFALSVLGFLIMHI LV+RN+T
Sbjct  179  TSLFPVFLVFFTDEEADITVSPGSLAATFVAFVLNIAFALSVLGFLIMHILLVARNST  236



>ref|XP_004515766.1| PREDICTED: probable S-acyltransferase At3g60800-like [Cicer arietinum]
Length=299

 Score =   173 bits (438),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 114/175 (65%), Positives = 128/175 (73%), Gaps = 12/175 (7%)
 Frame = +1

Query  1    FYCLLVMLLWSYFSVVFTDPGSVPPNWKPASDEERGDTDPLTASEFGSLPPDTAQSRIRF  180
            F+ LLVMLLWSYFSVVFTDPG VP NW+P   +  GD D                 RIR+
Sbjct  70   FHALLVMLLWSYFSVVFTDPGRVPLNWRPKICKNIGDDDSYD------------DQRIRY  117

Query  181  CKKCNQLKPPRCHHCSVCGRCVLKMDHHCVWVVNCVGALNYKYfllflfytflettlvtl  360
            C+KCNQ KPPRCHHCS CGRC+LKMDHHC+WVVNCVGALNYKYFLLFLFYT LET LVT+
Sbjct  118  CRKCNQFKPPRCHHCSSCGRCILKMDHHCIWVVNCVGALNYKYFLLFLFYTLLETALVTV  177

Query  361  SLLPNFLAFFGDVDIPGSAGDlattflafvlnlafalsvlGFLIMHISLVSRNTT  525
            SL P   AFF D D+  S   LA +F+AF  NL F LS+LGFLIMH+SLV+ NTT
Sbjct  178  SLFPYVKAFFSDEDVFVSLTTLAVSFIAFAFNLVFVLSILGFLIMHVSLVATNTT  232



>ref|XP_006283414.1| hypothetical protein CARUB_v10004463mg [Capsella rubella]
 gb|EOA16312.1| hypothetical protein CARUB_v10004463mg [Capsella rubella]
Length=574

 Score =   179 bits (453),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 122/179 (68%), Positives = 139/179 (78%), Gaps = 4/179 (2%)
 Frame = +1

Query  1    FYCLLVMLLWSYFSVVFTDPGSVPPNWKPASDEERGDTDPLTASEFGSLPP--DTAQSRI  174
            F+ LLVMLLWSYFSVV TDPG VP  W+P  D E+ D +  +       P   D++   +
Sbjct  330  FHFLLVMLLWSYFSVVVTDPGGVPTGWRPELDIEKSDGNQHSTGVANQAPSVGDSSSHGV  389

Query  175  RFCKKCNQLKPPRCHHCSVCGRCVLKMDHHCVWVVNCVGALNYKYfllflfytflettlv  354
            R+C+KCNQ KPPR HHCSVCGRC+LKMDHHCVWVVNCVGA+NYK FLLFLFYTFLETT+V
Sbjct  390  RYCRKCNQYKPPRSHHCSVCGRCILKMDHHCVWVVNCVGAMNYKAFLLFLFYTFLETTVV  449

Query  355  tlSLLPNFLAFF--GDVDIPGSAGDlattflafvlnlafalsvlGFLIMHISLVSRNTT  525
             +SLLP FL FF  GD DI  S G LA TF+AFVLN+AFALSVLGFLIMHI LV+RNTT
Sbjct  450  AISLLPVFLVFFSDGDGDITVSPGSLAATFVAFVLNIAFALSVLGFLIMHIMLVARNTT  508



>ref|XP_002989117.1| hypothetical protein SELMODRAFT_184354 [Selaginella moellendorffii]
 gb|EFJ09911.1| hypothetical protein SELMODRAFT_184354 [Selaginella moellendorffii]
Length=314

 Score =   172 bits (436),  Expect = 4e-49, Method: Compositional matrix adjust.
 Identities = 130/189 (69%), Positives = 144/189 (76%), Gaps = 14/189 (7%)
 Frame = +1

Query  1    FYCLLVMLLWSYFSVVFTDPGSVPPNWKPAS----DEERGDT--DPLTASEFGSLPPDTA  162
            F+ LL M+LW YF+VVFTDPGSVP +WKPAS    D E  +T    L A+    L   T 
Sbjct  60   FHLLLAMVLWCYFAVVFTDPGSVPSDWKPASANEEDMEAQNTLLSSLPANSAAVLTAPTT  119

Query  163  QS-------RIRFCKKCNQLKPPRCHHCSVCGRCVLKMDHHCVWVVNCVGALNYKYfllf  321
            Q        R+RFC+KC Q KPPRCHHCSVCGRCVLKMDHHCVWVVNCVGA NYK FLLF
Sbjct  120  QMSTSLDSPRMRFCRKCCQFKPPRCHHCSVCGRCVLKMDHHCVWVVNCVGARNYKAFLLF  179

Query  322  lfytflettlvtlSLLPNFLAFFGDV-DIPGSAGDlattflafvlnlafalsvlGFLIMH  498
            LFYTFLET+LV+LSLLP+F+AFF D  D P   G LATTFLAFVL+LAFALSVLGFLIMH
Sbjct  180  LFYTFLETSLVSLSLLPHFIAFFTDADDEPALPGTLATTFLAFVLDLAFALSVLGFLIMH  239

Query  499  ISLVSRNTT  525
            ISLV+ NTT
Sbjct  240  ISLVAGNTT  248



>gb|KJB37583.1| hypothetical protein B456_006G211800 [Gossypium raimondii]
Length=523

 Score =   177 bits (448),  Expect = 5e-49, Method: Compositional matrix adjust.
 Identities = 119/178 (67%), Positives = 136/178 (76%), Gaps = 7/178 (4%)
 Frame = +1

Query  13   LVMLLWSYFSVVFTDPGSVPPNWKPASDEERGDTDPLTASEFGSLPPDTAQS-------R  171
            LVM++W Y SVV TDPG VPPNW+P +DEE+GD DPL  S +GS   D  QS        
Sbjct  279  LVMVMWCYSSVVVTDPGGVPPNWRPLTDEEKGDADPLVGSGYGSAQLDPKQSATVAVSQE  338

Query  172  IRFCKKCNQLKPPRCHHCSVCGRCVLKMDHHCVWVVNCVGALNYKYfllflfytflettl  351
            IRFC KC Q KPPR HHCSVC RC+LKMDHHCVWVVNCVGALNYKYFLLFLFYTFLETTL
Sbjct  339  IRFCHKCKQFKPPRAHHCSVCRRCILKMDHHCVWVVNCVGALNYKYFLLFLFYTFLETTL  398

Query  352  vtlSLLPNFLAFFGDVDIPGSAGDlattflafvlnlafalsvlGFLIMHISLVSRNTT  525
            V+L LL  F+ FF + +I  + G LA TF+ FVLN+AF LS+LGFLIMHI+LV  NT+
Sbjct  399  VSLLLLRVFMEFFNEGEIDETPGSLAATFITFVLNIAFTLSILGFLIMHITLVGANTS  456



>emb|CDX82967.1| BnaC01g14170D [Brassica napus]
Length=583

 Score =   177 bits (449),  Expect = 8e-49, Method: Compositional matrix adjust.
 Identities = 121/178 (68%), Positives = 138/178 (78%), Gaps = 7/178 (4%)
 Frame = +1

Query  1    FYCLLVMLLWSYFSVVFTDPGSVPPNWKPASDEERGDTDPLTASEFGSLP-PDTAQSRIR  177
            F+ LL+MLLWSYFSVV TDPG VPP W+P  D E+ D +     E+ SL   D++   +R
Sbjct  361  FHFLLIMLLWSYFSVVVTDPGGVPPGWRPELDIEKSDGN----QEYSSLTVGDSSSHIVR  416

Query  178  FCKKCNQLKPPRCHHCSVCGRCVLKMDHHCVWVVNCVGALNYKYfllflfytflettlvt  357
            +C+KCNQ KPPR HHCSVCGRC+LKMDHHCVWVVNCVGA NYK FLLFLFYTFLETT+V 
Sbjct  417  YCRKCNQYKPPRSHHCSVCGRCILKMDHHCVWVVNCVGAKNYKSFLLFLFYTFLETTVVA  476

Query  358  lSLLPNFLAFF--GDVDIPGSAGDlattflafvlnlafalsvlGFLIMHISLVSRNTT  525
            +SL P FL FF  GD D+  S G LA TF+AFVLN+ FALSVLGFLIMHI LV RNTT
Sbjct  477  ISLFPVFLVFFTDGDSDVTVSPGSLAATFVAFVLNITFALSVLGFLIMHIMLVIRNTT  534



>ref|NP_001154264.1| DHHC-type zinc finger family protein [Arabidopsis thaliana]
 gb|AEE84652.1| DHHC-type zinc finger family protein [Arabidopsis thaliana]
Length=324

 Score =   172 bits (435),  Expect = 9e-49, Method: Compositional matrix adjust.
 Identities = 117/174 (67%), Positives = 136/174 (78%), Gaps = 4/174 (2%)
 Frame = +1

Query  10   LLVMLLWSYFSVVFTDPGSVPPNWKPASDEERGDTDPLTASEFGSLPPDTAQSRIRFCKK  189
            +L+MLLWSYFSVV TDPG VP  W+P  D E+ + +     E  +   D++   +R+C+K
Sbjct  85   ILIMLLWSYFSVVVTDPGGVPTGWRPELDIEKSEGNQALIGE--ASVGDSSSHGVRYCRK  142

Query  190  CNQLKPPRCHHCSVCGRCVLKMDHHCVWVVNCVGALNYKYfllflfytflettlvtlSLL  369
            CNQ KPPR HHCSVCGRC+LKMDHHCVWVVNCVGA NYK FLLFLFYTFLETT+V +SLL
Sbjct  143  CNQYKPPRSHHCSVCGRCILKMDHHCVWVVNCVGANNYKSFLLFLFYTFLETTVVAVSLL  202

Query  370  PNFLAFF--GDVDIPGSAGDlattflafvlnlafalsvlGFLIMHISLVSRNTT  525
            P FL FF  GD DI  S G LA +F+AFVLN+AFALSVLGFLIMHI LV+RNTT
Sbjct  203  PIFLVFFSDGDGDITVSPGSLAASFVAFVLNIAFALSVLGFLIMHIMLVARNTT  256



>ref|XP_006368710.1| hypothetical protein POPTR_0001s08000g [Populus trichocarpa]
 gb|ERP65279.1| hypothetical protein POPTR_0001s08000g [Populus trichocarpa]
Length=304

 Score =   171 bits (433),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 118/175 (67%), Positives = 129/175 (74%), Gaps = 9/175 (5%)
 Frame = +1

Query  28   WSYFSVVFTDPGSVPPNWKPASDEERGDTDPLTASEFGSLPPDTAQS---------RIRF  180
            WSYF+ V TDPG VPPNW+P+ DEE GD DPL          D  QS         R R 
Sbjct  63   WSYFTTVLTDPGGVPPNWRPSIDEESGDADPLVGLAHEGTGLDLNQSAMLGEPANPRTRA  122

Query  181  CKKCNQLKPPRCHHCSVCGRCVLKMDHHCVWVVNCVGALNYKYfllflfytflettlvtl  360
            C+KCN  KPPRCHHCSVCGRC+LKMDHHCVWVVNCVGALNYKYFLLFLFYTFL TTLVTL
Sbjct  123  CRKCNWFKPPRCHHCSVCGRCILKMDHHCVWVVNCVGALNYKYFLLFLFYTFLVTTLVTL  182

Query  361  SLLPNFLAFFGDVDIPGSAGDlattflafvlnlafalsvlGFLIMHISLVSRNTT  525
            SLLP FLAFF   +  G+   L  TF+ FVLNL+FALS++GFLIMHISLV  NTT
Sbjct  183  SLLPQFLAFFTVGEKNGTPETLVATFVTFVLNLSFALSIMGFLIMHISLVLGNTT  237



>ref|XP_010910146.1| PREDICTED: probable protein S-acyltransferase 14 [Elaeis guineensis]
Length=317

 Score =   171 bits (433),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 126/175 (72%), Positives = 138/175 (79%), Gaps = 9/175 (5%)
 Frame = +1

Query  28   WSYFSVVFTDPGSVPPNWKPASDEERGDTDPLTASEFGSLP---------PDTAQSRIRF  180
            W YFSVV TDPGSVPPNWKP  DEERG+  PL   EF +            D+   R R+
Sbjct  77   WCYFSVVLTDPGSVPPNWKPTVDEERGEETPLNNLEFTNQILSFQQSANLADSGSPRTRY  136

Query  181  CKKCNQLKPPRCHHCSVCGRCVLKMDHHCVWVVNCVGALNYKYfllflfytflettlvtl  360
            C+KCN LKPPRCHHCSVCGRC+LKMDHHCVWVVNCVGALNYK+FLLFLFYTFLETTLVTL
Sbjct  137  CRKCNHLKPPRCHHCSVCGRCILKMDHHCVWVVNCVGALNYKFFLLFLFYTFLETTLVTL  196

Query  361  SLLPNFLAFFGDVDIPGSAGDlattflafvlnlafalsvlGFLIMHISLVSRNTT  525
             LL NF+  F D ++PG+ G LATTFL FVLNLAFALSVLGFLIMHISLV+ NTT
Sbjct  197  LLLSNFITLFSDEEVPGTPGTLATTFLTFVLNLAFALSVLGFLIMHISLVAGNTT  251



>ref|NP_001190801.1| sterol 4-alpha methyl oxidase 1-3 [Arabidopsis thaliana]
 gb|AEE84650.1| sterol 4-alpha methyl oxidase 1-3 [Arabidopsis thaliana]
Length=581

 Score =   174 bits (440),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 119/177 (67%), Positives = 138/177 (78%), Gaps = 4/177 (2%)
 Frame = +1

Query  1    FYCLLVMLLWSYFSVVFTDPGSVPPNWKPASDEERGDTDPLTASEFGSLPPDTAQSRIRF  180
            F+ LL+MLLWSYFSVV TDPG VP  W+P  D E+ + +     E  +   D++   +R+
Sbjct  339  FHFLLIMLLWSYFSVVVTDPGGVPTGWRPELDIEKSEGNQALIGE--ASVGDSSSHGVRY  396

Query  181  CKKCNQLKPPRCHHCSVCGRCVLKMDHHCVWVVNCVGALNYKYfllflfytflettlvtl  360
            C+KCNQ KPPR HHCSVCGRC+LKMDHHCVWVVNCVGA NYK FLLFLFYTFLETT+V +
Sbjct  397  CRKCNQYKPPRSHHCSVCGRCILKMDHHCVWVVNCVGANNYKSFLLFLFYTFLETTVVAV  456

Query  361  SLLPNFLAFF--GDVDIPGSAGDlattflafvlnlafalsvlGFLIMHISLVSRNTT  525
            SLLP FL FF  GD DI  S G LA +F+AFVLN+AFALSVLGFLIMHI LV+RNTT
Sbjct  457  SLLPIFLVFFSDGDGDITVSPGSLAASFVAFVLNIAFALSVLGFLIMHIMLVARNTT  513



>ref|XP_006413626.1| hypothetical protein EUTSA_v10024722mg [Eutrema salsugineum]
 gb|ESQ55079.1| hypothetical protein EUTSA_v10024722mg [Eutrema salsugineum]
Length=599

 Score =   173 bits (438),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 119/178 (67%), Positives = 138/178 (78%), Gaps = 4/178 (2%)
 Frame = +1

Query  1    FYCLLVMLLWSYFSVVFTDPGSVPPNWKPASDEERGD-TDPLTASEFGSLPPDTAQSRIR  177
            F+ LL+MLLWSYFSVV TDPG VPP W+P  D E+ +   P  A +  S+   ++   +R
Sbjct  355  FHFLLIMLLWSYFSVVVTDPGGVPPGWRPELDIEKNEGNQPAIADQSLSVGGSSSHG-VR  413

Query  178  FCKKCNQLKPPRCHHCSVCGRCVLKMDHHCVWVVNCVGALNYKYfllflfytflettlvt  357
            +C+KCNQ KPPR HHCSVCGRC+LKMDHHCVWVVNCVGA+NYK FLLFLFYTFLETT+V 
Sbjct  414  YCRKCNQYKPPRSHHCSVCGRCILKMDHHCVWVVNCVGAMNYKSFLLFLFYTFLETTVVA  473

Query  358  lSLLPNFLAFFGD--VDIPGSAGDlattflafvlnlafalsvlGFLIMHISLVSRNTT  525
             SL P FL FF D   DI  S G LA TF+AFVLN+AFALSVLGFLIMHI LV+RN+T
Sbjct  474  TSLFPVFLVFFTDEEADITVSPGSLAATFVAFVLNIAFALSVLGFLIMHILLVARNST  531



>emb|CDY71422.1| BnaAnng37380D, partial [Brassica napus]
Length=186

 Score =   156 bits (394),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 93/143 (65%), Positives = 108/143 (76%), Gaps = 7/143 (5%)
 Frame = +1

Query  1    FYCLLVMLLWSYFSVVFTDPGSVPPNWKPASDEERGDTDPLTASEFGSLP-PDTAQSRIR  177
            F+ LL+MLLWSYFSVV TDPG VPP W+P  D E+ D +     E+ SL   D++   +R
Sbjct  42   FHFLLIMLLWSYFSVVVTDPGGVPPGWRPELDIEKSDGN----QEYSSLTVGDSSSHIVR  97

Query  178  FCKKCNQLKPPRCHHCSVCGRCVLKMDHHCVWVVNCVGALNYKYfllflfytflettlvt  357
            +C+KCNQ KPPR HHCSVCGRC+LKMDHHCVWVVNCVGA NYK FLLFLFYTFLETT+V 
Sbjct  98   YCRKCNQYKPPRSHHCSVCGRCILKMDHHCVWVVNCVGAKNYKSFLLFLFYTFLETTVVA  157

Query  358  lSLLPNFLAFF--GDVDIPGSAG  420
            +SL P FL FF  GD D+  S G
Sbjct  158  ISLFPVFLVFFTDGDSDVTVSPG  180



>ref|XP_004306624.1| PREDICTED: probable protein S-acyltransferase 12 [Fragaria vesca 
subsp. vesca]
 ref|XP_011468902.1| PREDICTED: probable protein S-acyltransferase 12 [Fragaria vesca 
subsp. vesca]
 ref|XP_011468903.1| PREDICTED: probable protein S-acyltransferase 12 [Fragaria vesca 
subsp. vesca]
Length=308

 Score =   159 bits (402),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 114/186 (61%), Positives = 134/186 (72%), Gaps = 11/186 (6%)
 Frame = +1

Query  1    FYCLLVMLLWSYFSVVFTDPGSVPPNWKPASDEERGDT-DPLTASE------FGSLPPDT  159
            F+ LLVMLLW YF VVFTDPGSVP NWKP + EE  +    LT+SE      F S+    
Sbjct  60   FHFLLVMLLWCYFMVVFTDPGSVPENWKPLTQEEILEAGSSLTSSEITAPEAFTSMHSTD  119

Query  160  AQSR---IRFCKKCNQLKPPRCHHCSVCGRCVLKMDHHCVWVVNCVGALNYKYfllflfy  330
             Q R   + +C +C   KPPRCHHCSVC RCVLKMDHHCVWVVNCVGA NYK FLLFL Y
Sbjct  120  GQERRPEVAYCSRCQNAKPPRCHHCSVCQRCVLKMDHHCVWVVNCVGATNYKSFLLFLLY  179

Query  331  tflettlvtlSLLPNFLAFFGDVDIPGSA-GDlattflafvlnlafalsvlGFLIMHISL  507
            TFLETT+ TL LLPNF+ FF +     ++ G+LA  F+ FVLNLAF+LS+L F++MHISL
Sbjct  180  TFLETTMNTLVLLPNFINFFSEAKSHSTSPGNLAVVFVTFVLNLAFSLSLLCFVVMHISL  239

Query  508  VSRNTT  525
            +S NTT
Sbjct  240  LSSNTT  245



>gb|KJB25654.1| hypothetical protein B456_004G202600 [Gossypium raimondii]
Length=292

 Score =   158 bits (399),  Expect = 8e-44, Method: Compositional matrix adjust.
 Identities = 108/179 (60%), Positives = 128/179 (72%), Gaps = 9/179 (5%)
 Frame = +1

Query  16   VMLLWSYFSVVFTDPGSVPPNWKPASDEERGDTDPLTASEFG---------SLPPDTAQS  168
            VM+LW+Y +VV TDPG VP NW+P  +EE+GD DPL    +G         ++P D    
Sbjct  47   VMVLWTYATVVLTDPGGVPLNWRPLREEEKGDADPLVGLGYGIAKIGTNQSAVPGDFKNL  106

Query  169  RIRFCKKCNQLKPPRCHHCSVCGRCVLKMDHHCVWVVNCVGALNYKYfllflfytflett  348
             I FC KCN+LKPPR HHCS+C RC+LKMDHHC WV NCVGALNYK FLLFLFYTFL   
Sbjct  107  DIGFCLKCNRLKPPRAHHCSICNRCILKMDHHCGWVANCVGALNYKSFLLFLFYTFLAEI  166

Query  349  lvtlSLLPNFLAFFGDVDIPGSAGDlattflafvlnlafalsvlGFLIMHISLVSRNTT  525
            LV L+LL  F+  F D ++  + G LA TF+AFVLNLAFA+SVLGFLIMHI+LV  N T
Sbjct  167  LVCLALLRVFMEIFNDDEVDLTPGKLAATFIAFVLNLAFAVSVLGFLIMHITLVGANRT  225



>ref|XP_010267425.1| PREDICTED: probable protein S-acyltransferase 12 isoform X1 [Nelumbo 
nucifera]
 ref|XP_010267426.1| PREDICTED: probable protein S-acyltransferase 12 isoform X1 [Nelumbo 
nucifera]
 ref|XP_010267427.1| PREDICTED: probable protein S-acyltransferase 12 isoform X1 [Nelumbo 
nucifera]
 ref|XP_010267428.1| PREDICTED: probable protein S-acyltransferase 12 isoform X1 [Nelumbo 
nucifera]
 ref|XP_010267429.1| PREDICTED: probable protein S-acyltransferase 12 isoform X1 [Nelumbo 
nucifera]
 ref|XP_010267430.1| PREDICTED: probable protein S-acyltransferase 12 isoform X1 [Nelumbo 
nucifera]
Length=306

 Score =   155 bits (392),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 109/184 (59%), Positives = 132/184 (72%), Gaps = 9/184 (5%)
 Frame = +1

Query  1    FYCLLVMLLWSYFSVVFTDPGSVPPNWKPASDEERGDTDPLTASEF--------GSLPPD  156
            F+ LL++L WSY  VVF DPGSVP NW+P   EE  +T  +  S +         + P +
Sbjct  60   FHLLLILLTWSYLMVVFQDPGSVPENWRPVMQEENMETSSMALSGYVDPESRNSTASPSE  119

Query  157  TAQSRIRFCKKCNQLKPPRCHHCSVCGRCVLKMDHHCVWVVNCVGALNYKYfllflfytf  336
              +  + +C +C   KPPRCHHCSVC RCVLKMDHHCVWVVNCVGA NYK+FLLFL YTF
Sbjct  120  GGRQAVGYCSRCQNSKPPRCHHCSVCQRCVLKMDHHCVWVVNCVGAQNYKFFLLFLLYTF  179

Query  337  lettlvtlSLLPNFLAFFGDVDIPGSA-GDlattflafvlnlafalsvlGFLIMHISLVS  513
            LETTL TL LLP+F+ FFGD     ++ G+LA TFLAFV+NLAFALS++ FLIMH SL+S
Sbjct  180  LETTLDTLVLLPHFIKFFGDAKSRSTSPGNLALTFLAFVINLAFALSLICFLIMHASLLS  239

Query  514  RNTT  525
             NTT
Sbjct  240  SNTT  243



>ref|XP_006657677.1| PREDICTED: probable protein S-acyltransferase 12-like isoform 
X1 [Oryza brachyantha]
Length=248

 Score =   153 bits (387),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 105/172 (61%), Positives = 124/172 (72%), Gaps = 3/172 (2%)
 Frame = +1

Query  19   MLLWSYFSVVFTDPGSVPPNWKPASDEERGDTDPLTASEF--GSLPPDTAQSRIRFCKKC  192
            M++W Y  VVFTDPG+VP NW+  S+E+  D +    S+    + P    QS  R+C +C
Sbjct  1    MIIWCYLMVVFTDPGAVPENWRHTSEEDDIDVNSRIISDNWDATYPASDGQSAQRYCSRC  60

Query  193  NQLKPPRCHHCSVCGRCVLKMDHHCVWVVNCVGALNYKYfllflfytflettlvtlSLLP  372
               KPPRCHHCSVC RCVLKMDHHCVWVVNCVGA NYKYFLLFL YTF+ET L  L LLP
Sbjct  61   QNGKPPRCHHCSVCNRCVLKMDHHCVWVVNCVGARNYKYFLLFLVYTFIETVLDILVLLP  120

Query  373  NFLAFFGDVDIPGSA-GDlattflafvlnlafalsvlGFLIMHISLVSRNTT  525
            NF+ FF D     S+ GD+A  FLAFVLNLAFALS++ F+ MH SLV+RNTT
Sbjct  121  NFIEFFRDESKRSSSPGDIAILFLAFVLNLAFALSLVCFIGMHTSLVTRNTT  172



>ref|XP_006657678.1| PREDICTED: probable protein S-acyltransferase 12-like isoform 
X2 [Oryza brachyantha]
Length=235

 Score =   152 bits (385),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 105/172 (61%), Positives = 124/172 (72%), Gaps = 3/172 (2%)
 Frame = +1

Query  19   MLLWSYFSVVFTDPGSVPPNWKPASDEERGDTDPLTASEF--GSLPPDTAQSRIRFCKKC  192
            M++W Y  VVFTDPG+VP NW+  S+E+  D +    S+    + P    QS  R+C +C
Sbjct  1    MIIWCYLMVVFTDPGAVPENWRHTSEEDDIDVNSRIISDNWDATYPASDGQSAQRYCSRC  60

Query  193  NQLKPPRCHHCSVCGRCVLKMDHHCVWVVNCVGALNYKYfllflfytflettlvtlSLLP  372
               KPPRCHHCSVC RCVLKMDHHCVWVVNCVGA NYKYFLLFL YTF+ET L  L LLP
Sbjct  61   QNGKPPRCHHCSVCNRCVLKMDHHCVWVVNCVGARNYKYFLLFLVYTFIETVLDILVLLP  120

Query  373  NFLAFFGDVDIPGSA-GDlattflafvlnlafalsvlGFLIMHISLVSRNTT  525
            NF+ FF D     S+ GD+A  FLAFVLNLAFALS++ F+ MH SLV+RNTT
Sbjct  121  NFIEFFRDESKRSSSPGDIAILFLAFVLNLAFALSLVCFIGMHTSLVTRNTT  172



>gb|KHG08036.1| hypothetical protein F383_35334 [Gossypium arboreum]
Length=303

 Score =   154 bits (389),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 94/179 (53%), Positives = 113/179 (63%), Gaps = 16/179 (9%)
 Frame = +1

Query  16   VMLLWSYFSVVFTDPGSVPPNWKPASDEERGDTDPLTASEFG---------SLPPDTAQS  168
            VM+LW+Y +VV TDPG VP NW+P  +EE+GD DPL    +G         ++P D    
Sbjct  65   VMVLWTYATVVLTDPGGVPLNWRPLREEEKGDADPLVGLGYGIAKIGTNQSAVPGDFKNL  124

Query  169  RIRFCKKCNQLKPPRCHHCSVCGRCVLKMDHHCVWVVNCVGALNYKYfllflfytflett  348
             I FC KCN+LKPPR HHCS+C RC+LKMDHHC WV NCVGALNYK FLLFLFYT L   
Sbjct  125  DIGFCLKCNRLKPPRAHHCSICNRCILKMDHHCGWVANCVGALNYKSFLLFLFYTSLAAI  184

Query  349  lvtlSLLPNFLAFFGDVDIPGSAGDlattflafvlnlafalsvlGFLIMHISLVSRNTT  525
            LV L+LL  F+  F D ++  + G                +SVLGFLIMHI+LV  N T
Sbjct  185  LVCLALLRVFMEIFNDDEVDLTPGK-------LAATFIAFVSVLGFLIMHITLVGANRT  236



>gb|KJB25653.1| hypothetical protein B456_004G202600 [Gossypium raimondii]
Length=285

 Score =   152 bits (385),  Expect = 7e-42, Method: Compositional matrix adjust.
 Identities = 95/179 (53%), Positives = 114/179 (64%), Gaps = 16/179 (9%)
 Frame = +1

Query  16   VMLLWSYFSVVFTDPGSVPPNWKPASDEERGDTDPLTASEFG---------SLPPDTAQS  168
            VM+LW+Y +VV TDPG VP NW+P  +EE+GD DPL    +G         ++P D    
Sbjct  47   VMVLWTYATVVLTDPGGVPLNWRPLREEEKGDADPLVGLGYGIAKIGTNQSAVPGDFKNL  106

Query  169  RIRFCKKCNQLKPPRCHHCSVCGRCVLKMDHHCVWVVNCVGALNYKYfllflfytflett  348
             I FC KCN+LKPPR HHCS+C RC+LKMDHHC WV NCVGALNYK FLLFLFYTFL   
Sbjct  107  DIGFCLKCNRLKPPRAHHCSICNRCILKMDHHCGWVANCVGALNYKSFLLFLFYTFLAEI  166

Query  349  lvtlSLLPNFLAFFGDVDIPGSAGDlattflafvlnlafalsvlGFLIMHISLVSRNTT  525
            LV L+LL  F+  F D ++  + G                +SVLGFLIMHI+LV  N T
Sbjct  167  LVCLALLRVFMEIFNDDEVDLTPGK-------LAATFIAFVSVLGFLIMHITLVGANRT  218



>gb|KJB25655.1| hypothetical protein B456_004G202600 [Gossypium raimondii]
Length=238

 Score =   150 bits (379),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 94/178 (53%), Positives = 113/178 (63%), Gaps = 16/178 (9%)
 Frame = +1

Query  19   MLLWSYFSVVFTDPGSVPPNWKPASDEERGDTDPLTASEFG---------SLPPDTAQSR  171
            M+LW+Y +VV TDPG VP NW+P  +EE+GD DPL    +G         ++P D     
Sbjct  1    MVLWTYATVVLTDPGGVPLNWRPLREEEKGDADPLVGLGYGIAKIGTNQSAVPGDFKNLD  60

Query  172  IRFCKKCNQLKPPRCHHCSVCGRCVLKMDHHCVWVVNCVGALNYKYfllflfytflettl  351
            I FC KCN+LKPPR HHCS+C RC+LKMDHHC WV NCVGALNYK FLLFLFYTFL   L
Sbjct  61   IGFCLKCNRLKPPRAHHCSICNRCILKMDHHCGWVANCVGALNYKSFLLFLFYTFLAEIL  120

Query  352  vtlSLLPNFLAFFGDVDIPGSAGDlattflafvlnlafalsvlGFLIMHISLVSRNTT  525
            V L+LL  F+  F D ++  + G                +SVLGFLIMHI+LV  N T
Sbjct  121  VCLALLRVFMEIFNDDEVDLTPGK-------LAATFIAFVSVLGFLIMHITLVGANRT  171



>ref|XP_008233069.1| PREDICTED: probable protein S-acyltransferase 12 [Prunus mume]
 ref|XP_008233070.1| PREDICTED: probable protein S-acyltransferase 12 [Prunus mume]
 ref|XP_008233071.1| PREDICTED: probable protein S-acyltransferase 12 [Prunus mume]
Length=308

 Score =   152 bits (383),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 112/188 (60%), Positives = 135/188 (72%), Gaps = 15/188 (8%)
 Frame = +1

Query  1    FYCLLVMLLWSYFSVVFTDPGSVPPNWKPASDEERGDT-DPLTASEFGSLPPDTAQS---  168
            F+ LL+MLLWSYF VVF DPGSVP NWKP ++EE  +    LT SE  S+ P+   S   
Sbjct  60   FHFLLIMLLWSYFMVVFKDPGSVPDNWKPLTEEEVLEAGSSLTLSE--SIEPEAFTSTHS  117

Query  169  --------RIRFCKKCNQLKPPRCHHCSVCGRCVLKMDHHCVWVVNCVGALNYKYfllfl  324
                    ++ +C +C   KPPRCHHCSVC RCVLKMDHHCVWVVNCVGA NYK+FLLFL
Sbjct  118  ADGRERRPQVGYCSRCQNGKPPRCHHCSVCQRCVLKMDHHCVWVVNCVGARNYKFFLLFL  177

Query  325  fytflettlvtlSLLPNFLAFFGDV-DIPGSAGDlattflafvlnlafalsvlGFLIMHI  501
             YTFLETT+ T  LLP+F+ FF +  +   S G+LA  FL FVLNLAFALS+L F++MH+
Sbjct  178  LYTFLETTMDTFILLPSFIDFFSEAKNHSTSPGNLAVIFLTFVLNLAFALSLLCFVVMHV  237

Query  502  SLVSRNTT  525
            SL+S NTT
Sbjct  238  SLLSSNTT  245



>ref|XP_008376192.1| PREDICTED: probable protein S-acyltransferase 12 [Malus domestica]
Length=308

 Score =   152 bits (383),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 116/188 (62%), Positives = 134/188 (71%), Gaps = 15/188 (8%)
 Frame = +1

Query  1    FYCLLVMLLWSYFSVVFTDPGSVPPNWKPASDEERGDT-DPLTASEFGSLPPDTAQS---  168
            F+ LLVMLLW YF VVF DPGSVP NWKP  DEE  +    LT SE  ++ P+   S   
Sbjct  60   FHILLVMLLWGYFMVVFKDPGSVPENWKPLIDEENLEAGSSLTLSE--NIEPEAFTSTQS  117

Query  169  --------RIRFCKKCNQLKPPRCHHCSVCGRCVLKMDHHCVWVVNCVGALNYKYfllfl  324
                    ++++C  C   KPPRCHHCSVC RCVLKMDHHCVWVVNCVGA NYK+FLLFL
Sbjct  118  SGGGERRPQVQYCSPCQNGKPPRCHHCSVCQRCVLKMDHHCVWVVNCVGARNYKFFLLFL  177

Query  325  fytflettlvtlSLLPNFLAFFGD-VDIPGSAGDlattflafvlnlafalsvlGFLIMHI  501
             YTFLETT+ TL LLPNF+ FF + +D   S G LA  FLAFVLNLAFALS+L F++MH 
Sbjct  178  LYTFLETTMDTLVLLPNFIDFFSEAMDHSESPGHLAVVFLAFVLNLAFALSLLCFVVMHA  237

Query  502  SLVSRNTT  525
            SL+S NTT
Sbjct  238  SLLSSNTT  245



>ref|XP_006830293.1| hypothetical protein AMTR_s00121p00069490, partial [Amborella 
trichopoda]
 gb|ERM97709.1| hypothetical protein AMTR_s00121p00069490, partial [Amborella 
trichopoda]
Length=367

 Score =   153 bits (386),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 115/187 (61%), Positives = 135/187 (72%), Gaps = 12/187 (6%)
 Frame = +1

Query  1    FYCLLVMLLWSYFSVVFTDPGSVPPNWKPASDEERGDT-DPLTASEF-------GSLPPD  156
            F+ LL ML+WSY  VVFTDPGSVP NW+   DEE  +T     +S+F        +  P 
Sbjct  120  FHFLLAMLIWSYCMVVFTDPGSVPENWRRLLDEENPETVASANSSDFVAPIVRSSAWSPS  179

Query  157  TAQSRIR---FCKKCNQLKPPRCHHCSVCGRCVLKMDHHCVWVVNCVGALNYKYfllflf  327
            T+ +R     +C +C   KPPRCHHCSVC RCVLKMDHHCVWVVNCVGA NYK+FLLFL 
Sbjct  180  TSMARTSEGGYCGRCQNNKPPRCHHCSVCQRCVLKMDHHCVWVVNCVGAGNYKFFLLFLM  239

Query  328  ytflettlvtlSLLPNFLAFFGDV-DIPGSAGDlattflafvlnlafalsvlGFLIMHIS  504
            YTFLETTL TL LLP+F+ FFG+  +  GS G+LA +FL FVLNLAFALS+LGFLIMH S
Sbjct  240  YTFLETTLDTLVLLPHFIEFFGEAKNRSGSPGNLAISFLTFVLNLAFALSLLGFLIMHAS  299

Query  505  LVSRNTT  525
            L+  NTT
Sbjct  300  LLLSNTT  306



>ref|XP_010267431.1| PREDICTED: probable protein S-acyltransferase 12 isoform X2 [Nelumbo 
nucifera]
Length=296

 Score =   150 bits (379),  Expect = 7e-41, Method: Compositional matrix adjust.
 Identities = 101/183 (55%), Positives = 123/183 (67%), Gaps = 17/183 (9%)
 Frame = +1

Query  1    FYCLLVMLLWSYFSVVFTDPGSVPPNWKPASDEERGDTDPLTASEF--------GSLPPD  156
            F+ LL++L WSY  VVF DPGSVP NW+P   EE  +T  +  S +         + P +
Sbjct  60   FHLLLILLTWSYLMVVFQDPGSVPENWRPVMQEENMETSSMALSGYVDPESRNSTASPSE  119

Query  157  TAQSRIRFCKKCNQLKPPRCHHCSVCGRCVLKMDHHCVWVVNCVGALNYKYfllflfytf  336
              +  + +C +C   KPPRCHHCSVC RCVLKMDHHCVWVVNCVGA NYK+FLLFL YTF
Sbjct  120  GGRQAVGYCSRCQNSKPPRCHHCSVCQRCVLKMDHHCVWVVNCVGAQNYKFFLLFLLYTF  179

Query  337  lettlvtlSLLPNFLAFFGDVDIPGSAGDlattflafvlnlafalsvlGFLIMHISLVSR  516
            LETTL TL LLP+F+ FFGD     ++          V+NLAFALS++ FLIMH SL+S 
Sbjct  180  LETTLDTLVLLPHFIKFFGDAKSRSTS---------PVINLAFALSLICFLIMHASLLSS  230

Query  517  NTT  525
            NTT
Sbjct  231  NTT  233



>ref|XP_009401747.1| PREDICTED: probable protein S-acyltransferase 12 [Musa acuminata 
subsp. malaccensis]
Length=313

 Score =   150 bits (379),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 114/187 (61%), Positives = 132/187 (71%), Gaps = 12/187 (6%)
 Frame = +1

Query  1    FYCLLVMLLWSYFSVVFTDPGSVPPNWKPASDEERGD-TDPLTASEF--------GSLPP  153
            F+ LL +L+WSYF VVF DPG+VP NW+P  DEE  + T   T S++         S PP
Sbjct  64   FHLLLALLIWSYFMVVFHDPGAVPANWRPLLDEESLERTASATLSDYIAPETRASTSSPP  123

Query  154  DTAQSR--IRFCKKCNQLKPPRCHHCSVCGRCVLKMDHHCVWVVNCVGALNYKYfllflf  327
            +  + R    +C +C   KPPRCHHCSVC RCVLKMDHHCVWVVNCVGA NYK+FLLFL 
Sbjct  124  EGIERRPNTGYCARCQNGKPPRCHHCSVCQRCVLKMDHHCVWVVNCVGARNYKFFLLFLI  183

Query  328  ytflettlvtlSLLPNFLAFFGDVDIPGSA-GDlattflafvlnlafalsvlGFLIMHIS  504
            YTFLET L T  LLPNF+ FFGD     S+ G+LA TFLAFVLNLAFALS+L F+ MH S
Sbjct  184  YTFLETILDTFVLLPNFVKFFGDARKHSSSPGNLAVTFLAFVLNLAFALSLLCFVGMHTS  243

Query  505  LVSRNTT  525
            LV  NTT
Sbjct  244  LVLSNTT  250



>gb|ADE76560.1| unknown [Picea sitchensis]
Length=309

 Score =   150 bits (379),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 113/189 (60%), Positives = 131/189 (69%), Gaps = 16/189 (8%)
 Frame = +1

Query  1    FYCLLVMLLWSYFSVVFTDPGSVPPNWKPASDEERGDTDPLTASEFGSLPPDTAQS----  168
            F+ LLVML+W YF VV TDPGSVP NW+P  DEE  +   +  S   SLP  +  +    
Sbjct  60   FHILLVMLIWCYFMVVMTDPGSVPRNWRPIVDEEAAEAQTMPIS--ASLPSVSNTACPQP  117

Query  169  ---------RIRFCKKCNQLKPPRCHHCSVCGRCVLKMDHHCVWVVNCVGALNYKYfllf  321
                      +R+C KC  +KPPR HHC VC RC+LKMDHHCVWVVNCVGA NYK+FLLF
Sbjct  118  LVGGMAQIPGLRYCVKCENIKPPRSHHCRVCQRCILKMDHHCVWVVNCVGARNYKFFLLF  177

Query  322  lfytflettlvtlSLLPNFLAFF-GDVDIPGSAGDlattflafvlnlafalsvlGFLIMH  498
            L YTFL TTL T  LLP F+ FF G  +  GS+  LATTFLAF+LN+AFALS+LGFLIMH
Sbjct  178  LLYTFLATTLDTFVLLPCFINFFKGFQNRTGSSSGLATTFLAFILNVAFALSLLGFLIMH  237

Query  499  ISLVSRNTT  525
             SLVS NTT
Sbjct  238  ASLVSSNTT  246



>ref|XP_007051453.1| DHHC-type zinc finger family protein [Theobroma cacao]
 gb|EOX95610.1| DHHC-type zinc finger family protein [Theobroma cacao]
Length=294

 Score =   149 bits (376),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 109/176 (62%), Positives = 127/176 (72%), Gaps = 5/176 (3%)
 Frame = +1

Query  1    FYCLLVMLLWSYFSVVFTDPGSVPPNWKPASDEERGDTDPLTASEFGSLPPDTAQSRIRF  180
            F+ LL++LLWSYF VVF DPGSVP NW+P S EE  +      S F +      +SR  +
Sbjct  60   FHVLLILLLWSYFRVVFKDPGSVPGNWRPVSPEENLEV----GSSFAAADDGLERSRGGY  115

Query  181  CKKCNQLKPPRCHHCSVCGRCVLKMDHHCVWVVNCVGALNYKYfllflfytflettlvtl  360
            C  C   KPPRCHHCSVC RCVLKMDHHCVWVVNCVGA NYK+FLLFL YTFLETT+ T+
Sbjct  116  CSHCQNGKPPRCHHCSVCQRCVLKMDHHCVWVVNCVGARNYKFFLLFLLYTFLETTMDTI  175

Query  361  SLLPNFLAFFGDVDIPGSA-GDlattflafvlnlafalsvlGFLIMHISLVSRNTT  525
             LLP+F+ FF +     S   +LA  FLAFVLNLAFALS+L FL+MH SL+S NTT
Sbjct  176  VLLPSFINFFDEAKNHSSTPANLAIIFLAFVLNLAFALSLLCFLVMHASLLSSNTT  231



>ref|XP_002263621.1| PREDICTED: probable protein S-acyltransferase 12 [Vitis vinifera]
 emb|CBI38696.3| unnamed protein product [Vitis vinifera]
Length=308

 Score =   149 bits (377),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 109/188 (58%), Positives = 137/188 (73%), Gaps = 15/188 (8%)
 Frame = +1

Query  1    FYCLLVMLLWSYFSVVFTDPGSVPPNWKPASDEERGDTDPLTASEFGSLPPDTAQSR---  171
            F+ LL++L W YF VVF DPGSVP NW+P S+E   +  P+T+S+   + P+T  S    
Sbjct  60   FHILLILLTWCYFMVVFRDPGSVPENWRPVSEEYNLEEGPMTSSD--CVVPETLNSTWSS  117

Query  172  ---------IRFCKKCNQLKPPRCHHCSVCGRCVLKMDHHCVWVVNCVGALNYKYfllfl  324
                     + +C +C   KPPRCHHCSVC RCVLKMDHHCVWVVNCVGA NYK+FLLFL
Sbjct  118  SDGQERRPAVGYCIQCQNGKPPRCHHCSVCQRCVLKMDHHCVWVVNCVGACNYKFFLLFL  177

Query  325  fytflettlvtlSLLPNFLAFFGDV-DIPGSAGDlattflafvlnlafalsvlGFLIMHI  501
             YTFLETTL TL+LLP+F+ FFG+  +   S G+L+  FLAFV+NLAFALS+L F++MH+
Sbjct  178  LYTFLETTLDTLALLPSFINFFGEAKNHSVSPGNLSIIFLAFVINLAFALSLLCFIVMHV  237

Query  502  SLVSRNTT  525
            SL+S NTT
Sbjct  238  SLLSSNTT  245



>ref|XP_011039097.1| PREDICTED: probable protein S-acyltransferase 12 isoform X2 [Populus 
euphratica]
Length=298

 Score =   149 bits (376),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 109/176 (62%), Positives = 122/176 (69%), Gaps = 1/176 (1%)
 Frame = +1

Query  1    FYCLLVMLLWSYFSVVFTDPGSVPPNWKPASDEERGDTDPLTASEFGSLPPDTAQSRIRF  180
            F+ LL+MLLWSYF VV  DPGSVP NW+    EE  +T          +       R  F
Sbjct  60   FHFLLIMLLWSYFMVVSKDPGSVPENWRAVLPEEALETGSSLNDRSECVVATDGLDRRAF  119

Query  181  CKKCNQLKPPRCHHCSVCGRCVLKMDHHCVWVVNCVGALNYKYfllflfytflettlvtl  360
            C  C   KPPRCHHCSVC RCVLKMDHHCVWVVNCVGA NYK+FLLFL YTF+ TT+ TL
Sbjct  120  CNHCQNGKPPRCHHCSVCQRCVLKMDHHCVWVVNCVGARNYKFFLLFLLYTFMVTTMDTL  179

Query  361  SLLPNFLAFFGDVDIPGSA-GDlattflafvlnlafalsvlGFLIMHISLVSRNTT  525
            +LLP F+ FFG      S+ GDLA  FLAFVLNLAFALS+L FL+MH SLVS NTT
Sbjct  180  ALLPGFINFFGKAKNHSSSPGDLAVIFLAFVLNLAFALSLLCFLVMHASLVSSNTT  235



>emb|CAB82684.1| putative protein [Arabidopsis thaliana]
Length=273

 Score =   148 bits (374),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 115/175 (66%), Positives = 132/175 (75%), Gaps = 25/175 (14%)
 Frame = +1

Query  1    FYCLLVMLLWSYFSVVFTDPGSVPPNWKPASDEERGDTDPLTASEFGSLPPDTAQSRIRF  180
            F+ LL MLLWSYFSVVFTDPG VPPNW+P++DEERG++DPL + +F  L  D++ S  R 
Sbjct  60   FHFLLAMLLWSYFSVVFTDPGVVPPNWRPSTDEERGESDPLNSLDFVGLQSDSSSSNPR-  118

Query  181  CKKCNQLKPPRCHHCSVCGRCVLKMDHHCVWVVNCVGALNYKYfllflfytflettlvtl  360
                                    MDHHCVWVVNCVGALNYKYFLLFLFYTFLETTLVTL
Sbjct  119  ------------------------MDHHCVWVVNCVGALNYKYFLLFLFYTFLETTLVTL  154

Query  361  SLLPNFLAFFGDVDIPGSAGDlattflafvlnlafalsvlGFLIMHISLVSRNTT  525
             L+P+F+AFF D +IPG+ G LATTFLAFVLNLAFALSV+GFLIMHISLV+ NTT
Sbjct  155  VLMPHFIAFFSDEEIPGTPGTLATTFLAFVLNLAFALSVMGFLIMHISLVAGNTT  209



>gb|EEC81995.1| hypothetical protein OsI_25930 [Oryza sativa Indica Group]
Length=304

 Score =   149 bits (375),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 106/178 (60%), Positives = 126/178 (71%), Gaps = 3/178 (2%)
 Frame = +1

Query  1    FYCLLVMLLWSYFSVVFTDPGSVPPNWKPASDEERGDTDPLTASEF--GSLPPDTAQSRI  174
            F+ LL M++W Y  VVFTDPG+VP NW+ AS+E+    +  T S     + P    QS  
Sbjct  64   FHLLLAMIIWCYLMVVFTDPGAVPENWRHASEEDGIGVNSRTISYNWDATYPNPEGQSAQ  123

Query  175  RFCKKCNQLKPPRCHHCSVCGRCVLKMDHHCVWVVNCVGALNYKYfllflfytflettlv  354
            ++C +C   KPPRCHHCSVC RCVLKMDHHCVWVVNCVGA NYKYFLLFL YTF+ET L 
Sbjct  124  KYCSRCQNGKPPRCHHCSVCNRCVLKMDHHCVWVVNCVGARNYKYFLLFLVYTFVETVLD  183

Query  355  tlSLLPNFLAFFGDVDIPGSA-GDlattflafvlnlafalsvlGFLIMHISLVSRNTT  525
            TL LLP F+ FF D     S+ GD+A  F+ FVLNLAFALS+L F+ MH SLV+ NTT
Sbjct  184  TLVLLPYFIEFFRDESRRSSSPGDIAILFITFVLNLAFALSLLCFIGMHASLVTSNTT  241



>gb|EEE67131.1| hypothetical protein OsJ_24176 [Oryza sativa Japonica Group]
Length=303

 Score =   149 bits (375),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 106/178 (60%), Positives = 126/178 (71%), Gaps = 3/178 (2%)
 Frame = +1

Query  1    FYCLLVMLLWSYFSVVFTDPGSVPPNWKPASDEERGDTDPLTASEF--GSLPPDTAQSRI  174
            F+ LL M++W Y  VVFTDPG+VP NW+ AS+E+    +  T S     + P    QS  
Sbjct  63   FHLLLAMIIWCYLMVVFTDPGAVPENWRHASEEDGIGVNSRTISYNWDATYPNPEGQSAQ  122

Query  175  RFCKKCNQLKPPRCHHCSVCGRCVLKMDHHCVWVVNCVGALNYKYfllflfytflettlv  354
            ++C +C   KPPRCHHCSVC RCVLKMDHHCVWVVNCVGA NYKYFLLFL YTF+ET L 
Sbjct  123  KYCSRCQNGKPPRCHHCSVCNRCVLKMDHHCVWVVNCVGARNYKYFLLFLVYTFVETVLD  182

Query  355  tlSLLPNFLAFFGDVDIPGSA-GDlattflafvlnlafalsvlGFLIMHISLVSRNTT  525
            TL LLP F+ FF D     S+ GD+A  F+ FVLNLAFALS+L F+ MH SLV+ NTT
Sbjct  183  TLVLLPYFIEFFRDESRRSSSPGDIAILFVTFVLNLAFALSLLCFIGMHASLVTSNTT  240



>ref|XP_009351330.1| PREDICTED: probable protein S-acyltransferase 14, partial [Pyrus 
x bretschneideri]
Length=148

 Score =   144 bits (362),  Expect = 7e-40, Method: Compositional matrix adjust.
 Identities = 63/82 (77%), Positives = 70/82 (85%), Gaps = 0/82 (0%)
 Frame = +1

Query  1    FYCLLVMLLWSYFSVVFTDPGSVPPNWKPASDEERGDTDPLTASEFGSLPPDTAQSRIRF  180
            F+CLLVMLLWSYFSVV TDPG VPPNW+PA DEERG+ DPLT  +F  L PD +  RIR+
Sbjct  67   FHCLLVMLLWSYFSVVLTDPGGVPPNWRPAVDEERGEADPLTWLDFNGLQPDPSNQRIRY  126

Query  181  CKKCNQLKPPRCHHCSVCGRCV  246
            C+KCNQLKPPRCHHCSVCGRCV
Sbjct  127  CRKCNQLKPPRCHHCSVCGRCV  148



>tpg|DAA40775.1| TPA: hypothetical protein ZEAMMB73_782285 [Zea mays]
Length=236

 Score =   145 bits (367),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 107/176 (61%), Positives = 124/176 (70%), Gaps = 10/176 (6%)
 Frame = +1

Query  1    FYCLLVMLLWSYFSVVFTDPGSVPPNWKPASDEERGDTDPLTASEFGSLPPDTAQSRIRF  180
            F+ LL M+LW Y   VFTDPG+VP NW+   D E       ++S       D  +S  R+
Sbjct  64   FHILLAMILWCYLMAVFTDPGAVPENWR--HDAEDSGNPSFSSS-------DEQESAPRY  114

Query  181  CKKCNQLKPPRCHHCSVCGRCVLKMDHHCVWVVNCVGALNYKYfllflfytflettlvtl  360
            C +C   KPPRCHHCSVC RCVLKMDHHC+WVVNCVGA NYKYFLLFL YTF+ET L TL
Sbjct  115  CSRCQNGKPPRCHHCSVCNRCVLKMDHHCIWVVNCVGARNYKYFLLFLVYTFIETVLDTL  174

Query  361  SLLPNFLAFFGDVDIPGSA-GDlattflafvlnlafalsvlGFLIMHISLVSRNTT  525
             LLPNF+ FF D     S+ GD+A  FLAFVLNLAFALS+L F+ MH SLV+RNTT
Sbjct  175  VLLPNFIEFFQDEHRRSSSPGDIAILFLAFVLNLAFALSLLCFIGMHASLVTRNTT  230



>gb|KJB09587.1| hypothetical protein B456_001G151300 [Gossypium raimondii]
 gb|KJB09589.1| hypothetical protein B456_001G151300 [Gossypium raimondii]
Length=295

 Score =   146 bits (369),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 108/179 (60%), Positives = 126/179 (70%), Gaps = 10/179 (6%)
 Frame = +1

Query  1    FYCLLVMLLWSYFSVVFTDPGSVPPNWKPASDEERGDT-DPLTASEFGSLPPDTAQSRIR  177
            F+ LLV+LLWSY  VV  DPGSVP NW+  S EE  +    L A+E      D  + R R
Sbjct  60   FHVLLVLLLWSYIRVVLKDPGSVPENWRAVSGEESLEVGTSLAAAE------DGFERRSR  113

Query  178  ---FCKKCNQLKPPRCHHCSVCGRCVLKMDHHCVWVVNCVGALNYKYfllflfytflett  348
               +C  C   KPPRCHHCS+C RCVLKMDHHCVWVVNCVGA NYK+FLLFL YTFLETT
Sbjct  114  GGGYCIHCQNGKPPRCHHCSICQRCVLKMDHHCVWVVNCVGACNYKFFLLFLLYTFLETT  173

Query  349  lvtlSLLPNFLAFFGDVDIPGSAGDlattflafvlnlafalsvlGFLIMHISLVSRNTT  525
            +VT+ LLP+F+ FFG+     SA   A  FLAFVLN AFALS+L F++MH SL+S NTT
Sbjct  174  MVTIVLLPSFINFFGEAKNHSSAAKSAIIFLAFVLNFAFALSLLCFVVMHASLLSSNTT  232



>ref|XP_008779828.1| PREDICTED: probable protein S-acyltransferase 12 isoform X2 [Phoenix 
dactylifera]
Length=315

 Score =   146 bits (369),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 112/189 (59%), Positives = 132/189 (70%), Gaps = 16/189 (8%)
 Frame = +1

Query  1    FYCLLVMLLWSYFSVVFTDPGSVPPNWKPASDEERGDT-DPLTASEFGSLPPDTAQS---  168
            F+ LL +L+WSYF VVF DPGSVP NW+P  +EE  +    +T S++  + P+T  S   
Sbjct  66   FHLLLALLIWSYFMVVFVDPGSVPLNWRPTLEEENLEIGSSVTLSDY--VAPETRASAWP  123

Query  169  ---------RIRFCKKCNQLKPPRCHHCSVCGRCVLKMDHHCVWVVNCVGALNYKYfllf  321
                      I +C +C+  KPPRCHHCSVC RCVLKMDHHCVWVVNCVGA NYK FLLF
Sbjct  124  SSEGLERRPTIGYCSRCHNSKPPRCHHCSVCQRCVLKMDHHCVWVVNCVGARNYKCFLLF  183

Query  322  lfytflettlvtlSLLPNFLAFFGDVDIPGSA-GDlattflafvlnlafalsvlGFLIMH  498
            L YTFLET L  ++LLP F+ FFGD     S+ G LA TFLAFVLNLAFALS+L F+IMH
Sbjct  184  LLYTFLETVLDAVALLPRFVKFFGDARNHNSSPGKLAVTFLAFVLNLAFALSLLCFVIMH  243

Query  499  ISLVSRNTT  525
             SLV  NTT
Sbjct  244  TSLVLSNTT  252



>ref|XP_002462839.1| hypothetical protein SORBIDRAFT_02g032840 [Sorghum bicolor]
 gb|EER99360.1| hypothetical protein SORBIDRAFT_02g032840 [Sorghum bicolor]
Length=293

 Score =   145 bits (367),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 107/176 (61%), Positives = 127/176 (72%), Gaps = 10/176 (6%)
 Frame = +1

Query  1    FYCLLVMLLWSYFSVVFTDPGSVPPNWKPASDEERGDTDPLTASEFGSLPPDTAQSRIRF  180
            F+ LL M+LW Y  VVFTDPG+VP NW+  + E+ G+    ++ E GS P        ++
Sbjct  64   FHILLAMILWCYLMVVFTDPGAVPENWRHDA-EDSGNPLFSSSEEQGSAP--------KY  114

Query  181  CKKCNQLKPPRCHHCSVCGRCVLKMDHHCVWVVNCVGALNYKYfllflfytflettlvtl  360
            C +C   KPPRCHHCSVC RCVLKMDHHC+WVVNCVGA NYKYFLLFL YTF+ET L TL
Sbjct  115  CSRCQNGKPPRCHHCSVCNRCVLKMDHHCIWVVNCVGARNYKYFLLFLVYTFIETVLDTL  174

Query  361  SLLPNFLAFFGDVDIPGSA-GDlattflafvlnlafalsvlGFLIMHISLVSRNTT  525
             LLPNF+ FF D     S+ GD+A  FLAFVLNLAFALS+L F+ MH SLV+ NTT
Sbjct  175  VLLPNFIEFFQDESRRSSSPGDIAILFLAFVLNLAFALSLLCFIGMHTSLVTHNTT  230



>ref|XP_003560239.2| PREDICTED: probable protein S-acyltransferase 12 isoform X2 [Brachypodium 
distachyon]
Length=312

 Score =   146 bits (368),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 108/185 (58%), Positives = 131/185 (71%), Gaps = 10/185 (5%)
 Frame = +1

Query  1    FYCLLVMLLWSYFSVVFTDPGSVPPNWKPASDEERGDTDPL------TASEFGSLPPDTA  162
            F+ LL+M+LW Y  VVFTDPG+VP NW+ A++E+  D           A++  + P  T+
Sbjct  65   FHLLLIMMLWCYLMVVFTDPGAVPENWRHAAEEDDMDESNTRTISNDVATDIVNPPLFTS  124

Query  163  QSR---IRFCKKCNQLKPPRCHHCSVCGRCVLKMDHHCVWVVNCVGALNYKYfllflfyt  333
            + +    R+C +C   KPPRCHHCS+C RCVLKMDHHCVWVVNCVGA NYKYFLLFL YT
Sbjct  125  EGQGNASRYCSRCQNGKPPRCHHCSICDRCVLKMDHHCVWVVNCVGARNYKYFLLFLVYT  184

Query  334  flettlvtlSLLPNFLAFFGDVD-IPGSAGDlattflafvlnlafalsvlGFLIMHISLV  510
            FLET L TL LLP+F+ FF D      SA D+A  FLAFVLNLAFALS+L F+ MH SLV
Sbjct  185  FLETVLDTLVLLPSFITFFRDESRRSSSASDVAILFLAFVLNLAFALSLLIFIGMHTSLV  244

Query  511  SRNTT  525
            + NTT
Sbjct  245  ASNTT  249



>gb|ACF85839.1| unknown [Zea mays]
 gb|ACG46105.1| transposon protein [Zea mays]
 tpg|DAA40776.1| TPA: Transposon protein [Zea mays]
Length=293

 Score =   145 bits (367),  Expect = 5e-39, Method: Compositional matrix adjust.
 Identities = 107/176 (61%), Positives = 124/176 (70%), Gaps = 10/176 (6%)
 Frame = +1

Query  1    FYCLLVMLLWSYFSVVFTDPGSVPPNWKPASDEERGDTDPLTASEFGSLPPDTAQSRIRF  180
            F+ LL M+LW Y   VFTDPG+VP NW+   D E       ++S       D  +S  R+
Sbjct  64   FHILLAMILWCYLMAVFTDPGAVPENWR--HDAEDSGNPSFSSS-------DEQESAPRY  114

Query  181  CKKCNQLKPPRCHHCSVCGRCVLKMDHHCVWVVNCVGALNYKYfllflfytflettlvtl  360
            C +C   KPPRCHHCSVC RCVLKMDHHC+WVVNCVGA NYKYFLLFL YTF+ET L TL
Sbjct  115  CSRCQNGKPPRCHHCSVCNRCVLKMDHHCIWVVNCVGARNYKYFLLFLVYTFIETVLDTL  174

Query  361  SLLPNFLAFFGDVDIPGSA-GDlattflafvlnlafalsvlGFLIMHISLVSRNTT  525
             LLPNF+ FF D     S+ GD+A  FLAFVLNLAFALS+L F+ MH SLV+RNTT
Sbjct  175  VLLPNFIEFFQDEHRRSSSPGDIAILFLAFVLNLAFALSLLCFIGMHASLVTRNTT  230



>ref|NP_567193.2| putative S-acyltransferase [Arabidopsis thaliana]
 sp|Q5M757.1|ZDH15_ARATH RecName: Full=Probable protein S-acyltransferase 12; AltName: 
Full=Probable palmitoyltransferase At4g00840; AltName: Full=Zinc 
finger DHHC domain-containing protein At4g00840 [Arabidopsis 
thaliana]
 gb|AAV91337.1| At4g00840 [Arabidopsis thaliana]
 gb|AAW39012.1| At4g00840 [Arabidopsis thaliana]
 dbj|BAF01156.1| hypothetical protein [Arabidopsis thaliana]
 gb|AEE81944.1| putative S-acyltransferase [Arabidopsis thaliana]
Length=291

 Score =   145 bits (366),  Expect = 6e-39, Method: Compositional matrix adjust.
 Identities = 105/176 (60%), Positives = 126/176 (72%), Gaps = 8/176 (5%)
 Frame = +1

Query  1    FYCLLVMLLWSYFSVVFTDPGSVPPNWKPASDEERGDTDPLTASEFGSLPPDTAQSRIRF  180
            F+ LL+MLLWSYF+ VFTDPGSVP +++     E G  D L A   G+     A   + +
Sbjct  60   FHFLLIMLLWSYFTTVFTDPGSVPEHFR----REMGGGDSLEA---GTSTDQGAFGSLGY  112

Query  181  CKKCNQLKPPRCHHCSVCGRCVLKMDHHCVWVVNCVGALNYKYfllflfytflettlvtl  360
            C KC  +KPPRCHHCSVC RCVLKMDHHCVW+VNCVGA NYK+FLLFLFYTFLET L  +
Sbjct  113  CTKCRNVKPPRCHHCSVCQRCVLKMDHHCVWIVNCVGARNYKFFLLFLFYTFLETMLDVI  172

Query  361  SLLPNFLAFFGD-VDIPGSAGDlattflafvlnlafalsvlGFLIMHISLVSRNTT  525
             LLP+F+ FF   +    S G LA+  LAFVLN AF LS+L F++MHISL+S NTT
Sbjct  173  VLLPSFIEFFSQAIKHSSSPGKLASLVLAFVLNFAFVLSLLCFVVMHISLLSSNTT  228



>ref|XP_006360644.1| PREDICTED: probable protein S-acyltransferase 12-like [Solanum 
tuberosum]
Length=309

 Score =   145 bits (367),  Expect = 7e-39, Method: Compositional matrix adjust.
 Identities = 104/187 (56%), Positives = 128/187 (68%), Gaps = 12/187 (6%)
 Frame = +1

Query  1    FYCLLVMLLWSYFSVVFTDPGSVPPNWKPASDEERGDTDPLTASEFGSLPPDT-------  159
            F+ LLVML+WSY  VV  DPGSVP NWK  S++     + +  S++ S+   T       
Sbjct  60   FHILLVMLMWSYIKVVIQDPGSVPENWKLVSEQNIEGGNSVALSDYASIENPTPTLSTEQ  119

Query  160  ---AQSRIR-FCKKCNQLKPPRCHHCSVCGRCVLKMDHHCVWVVNCVGALNYKYfllflf  327
                QS+ R +C KC   KPPRCHHCSVC RCVLKMDHHC+WVVNCVGA NYK+FLLF+ 
Sbjct  120  IERRQSQSRGYCSKCQNGKPPRCHHCSVCQRCVLKMDHHCIWVVNCVGARNYKFFLLFVV  179

Query  328  ytflettlvtlSLLPNFLAFFGDVDIPGSA-GDlattflafvlnlafalsvlGFLIMHIS  504
            YTFL +TL TL LLP+F+ FF   +      G++A  FL FVLNLAF+LS+L F+IMH S
Sbjct  180  YTFLISTLDTLVLLPSFIKFFRQAENQSLLPGNIAVIFLVFVLNLAFSLSLLCFVIMHAS  239

Query  505  LVSRNTT  525
            L+S NTT
Sbjct  240  LLSSNTT  246



>ref|XP_002867753.1| hypothetical protein ARALYDRAFT_329352 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH44012.1| hypothetical protein ARALYDRAFT_329352 [Arabidopsis lyrata subsp. 
lyrata]
Length=777

 Score =   150 bits (379),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 92/177 (52%), Positives = 109/177 (62%), Gaps = 26/177 (15%)
 Frame = +1

Query  1    FYCLLVMLLWSYFSVVFTDPGSVPPNWKPASDEERGDTDPLTASEFGSLPPDTAQSR--I  174
            F+ LL+MLLWSYFSVV TDPG VP  W+P  D E+ D +     E  S       S   +
Sbjct  541  FHFLLIMLLWSYFSVVVTDPGGVPTGWRPELDVEKSDGNQALIGEANSSLSVGDSSSHGV  600

Query  175  RFCKKCNQLKPPRCHHCSVCGRCVLKMDHHCVWVVNCVGALNYKYfllflfytflettlv  354
            R+C+KCNQ KPPR HHCSVCGRC+LKMDHHCVWVVNCVGA+NYK                
Sbjct  601  RYCRKCNQYKPPRSHHCSVCGRCILKMDHHCVWVVNCVGAMNYK----------------  644

Query  355  tlSLLPNFLAFFGDVDIPGSAGDlattflafvlnlafalsvlGFLIMHISLVSRNTT  525
                  +FL F   + +P  +    +     VLN+AFALSVLGFLIMHI LV+RNTT
Sbjct  645  ------SFLLFLNTLRLPSDSKS--SFSCFPVLNIAFALSVLGFLIMHIMLVARNTT  693



>ref|XP_006288366.1| hypothetical protein CARUB_v10001614mg [Capsella rubella]
 gb|EOA21264.1| hypothetical protein CARUB_v10001614mg [Capsella rubella]
Length=291

 Score =   144 bits (364),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 106/176 (60%), Positives = 127/176 (72%), Gaps = 8/176 (5%)
 Frame = +1

Query  1    FYCLLVMLLWSYFSVVFTDPGSVPPNWKPASDEERGDTDPLTASEFGSLPPDTAQSRIRF  180
            F+ LL+MLLWSYFS VFTDPGSVP +++     E G  D L A   G+     A   + +
Sbjct  60   FHFLLIMLLWSYFSTVFTDPGSVPEHFR----REMGGGDNLEA---GTSTDQGAFGSLGY  112

Query  181  CKKCNQLKPPRCHHCSVCGRCVLKMDHHCVWVVNCVGALNYKYfllflfytflettlvtl  360
            C KC  +KPPRCHHCSVC RCVLKMDHHCVW+VNCVGA NYK+FLLFLFYTFLET L  +
Sbjct  113  CTKCRNVKPPRCHHCSVCQRCVLKMDHHCVWIVNCVGARNYKFFLLFLFYTFLETMLDVI  172

Query  361  SLLPNFLAFFGD-VDIPGSAGDlattflafvlnlafalsvlGFLIMHISLVSRNTT  525
             LLP+F+ FF   +    S G LA+  LAFVLNLAF LS+L F++MH+SL+S NTT
Sbjct  173  VLLPSFIEFFSQAIKHSSSPGKLASLVLAFVLNLAFVLSLLCFVVMHLSLLSSNTT  228



>ref|XP_010456165.1| PREDICTED: probable protein S-acyltransferase 12 [Camelina sativa]
Length=291

 Score =   144 bits (363),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 104/176 (59%), Positives = 125/176 (71%), Gaps = 8/176 (5%)
 Frame = +1

Query  1    FYCLLVMLLWSYFSVVFTDPGSVPPNWKPASDEERGDTDPLTASEFGSLPPDTAQSRIRF  180
            F+ LL+MLLWSYF+ VFTDPGSVP +++     E G  D L A   G+     A   + +
Sbjct  60   FHFLLIMLLWSYFATVFTDPGSVPEHFR----REMGGGDSLEA---GTSTDQGAFGSLGY  112

Query  181  CKKCNQLKPPRCHHCSVCGRCVLKMDHHCVWVVNCVGALNYKYfllflfytflettlvtl  360
            C KC  +KPPRCHHCSVC RCVLKMDHHCVW+VNCVGA NYK+FLLFLFYTF ET L  +
Sbjct  113  CTKCRNVKPPRCHHCSVCQRCVLKMDHHCVWIVNCVGARNYKFFLLFLFYTFFETLLDVI  172

Query  361  SLLPNFLAFFGD-VDIPGSAGDlattflafvlnlafalsvlGFLIMHISLVSRNTT  525
             LLP+F+ FF   V    S G LA+  LAFVLN AF LS+L F++MH+SL+S NTT
Sbjct  173  VLLPSFIEFFSQAVKHSSSPGKLASLVLAFVLNFAFVLSLLCFVVMHLSLLSSNTT  228



>ref|XP_010422733.1| PREDICTED: probable protein S-acyltransferase 12 [Camelina sativa]
Length=291

 Score =   144 bits (362),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 104/176 (59%), Positives = 124/176 (70%), Gaps = 8/176 (5%)
 Frame = +1

Query  1    FYCLLVMLLWSYFSVVFTDPGSVPPNWKPASDEERGDTDPLTASEFGSLPPDTAQSRIRF  180
            F+ LL+MLLWSYF+ VFTDPGSVP  ++     E G  D L A   G+     A   + +
Sbjct  60   FHFLLIMLLWSYFATVFTDPGSVPERFR----REMGGGDSLEA---GTSTDQGAFGSLGY  112

Query  181  CKKCNQLKPPRCHHCSVCGRCVLKMDHHCVWVVNCVGALNYKYfllflfytflettlvtl  360
            C KC  +KPPRCHHCSVC RCVLKMDHHCVW+VNCVGA NYK+FLLFLFYTF ET L  +
Sbjct  113  CTKCRNVKPPRCHHCSVCQRCVLKMDHHCVWIVNCVGARNYKFFLLFLFYTFFETLLDVI  172

Query  361  SLLPNFLAFFGD-VDIPGSAGDlattflafvlnlafalsvlGFLIMHISLVSRNTT  525
             LLP+F+ FF   V    S G LA+  LAFVLN AF LS+L F++MH+SL+S NTT
Sbjct  173  VLLPSFIEFFSQAVKHSSSPGKLASLVLAFVLNFAFVLSLLCFVVMHLSLLSSNTT  228



>tpg|DAA40774.1| TPA: hypothetical protein ZEAMMB73_782285 [Zea mays]
Length=258

 Score =   143 bits (360),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 106/176 (60%), Positives = 122/176 (69%), Gaps = 10/176 (6%)
 Frame = +1

Query  1    FYCLLVMLLWSYFSVVFTDPGSVPPNWKPASDEERGDTDPLTASEFGSLPPDTAQSRIRF  180
            F   L M+LW Y   VFTDPG+VP NW+   D E       ++S       D  +S  R+
Sbjct  29   FLLQLAMILWCYLMAVFTDPGAVPENWR--HDAEDSGNPSFSSS-------DEQESAPRY  79

Query  181  CKKCNQLKPPRCHHCSVCGRCVLKMDHHCVWVVNCVGALNYKYfllflfytflettlvtl  360
            C +C   KPPRCHHCSVC RCVLKMDHHC+WVVNCVGA NYKYFLLFL YTF+ET L TL
Sbjct  80   CSRCQNGKPPRCHHCSVCNRCVLKMDHHCIWVVNCVGARNYKYFLLFLVYTFIETVLDTL  139

Query  361  SLLPNFLAFFGDVDIPGSA-GDlattflafvlnlafalsvlGFLIMHISLVSRNTT  525
             LLPNF+ FF D     S+ GD+A  FLAFVLNLAFALS+L F+ MH SLV+RNTT
Sbjct  140  VLLPNFIEFFQDEHRRSSSPGDIAILFLAFVLNLAFALSLLCFIGMHASLVTRNTT  195



>ref|XP_009366621.1| PREDICTED: LOW QUALITY PROTEIN: probable protein S-acyltransferase 
12 [Pyrus x bretschneideri]
Length=303

 Score =   144 bits (363),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 107/182 (59%), Positives = 128/182 (70%), Gaps = 10/182 (5%)
 Frame = +1

Query  1    FYCLLVMLLWSYFSVVFTDPGSVPPNWKPASD-------EERGDTDPLTASEFGSLPPDT  159
            F+ LLVMLLWSYF +VF DP SVP NWKP  +        E  + +  T+++        
Sbjct  60   FHILLVMLLWSYFMIVFKDPASVPENWKPLMEAGSSLTLSENIEPEAFTSTQSSGGGERL  119

Query  160  AQSRIRFCKKCNQLKPPRCHHCSVCGRCVLKMDHHCVWVVNCVGALNYKYfllflfytfl  339
            AQ  +R+C +C   KPP CHHCSVC RCVLKMDHHCVWVVNCVGA NYK+FLLFL YTFL
Sbjct  120  AQ--VRYCSRCQNGKPPXCHHCSVCQRCVLKMDHHCVWVVNCVGARNYKFFLLFLLYTFL  177

Query  340  ettlvtlSLLPNFLAFFGD-VDIPGSAGDlattflafvlnlafalsvlGFLIMHISLVSR  516
            ETT+ TL LLPNF+ FF + +D   S G LA  FLAFV+NLAFA S+L F++MH SL+S 
Sbjct  178  ETTMDTLVLLPNFIDFFSEAMDHSESPGHLAVVFLAFVVNLAFAPSLLCFVVMHASLLSS  237

Query  517  NT  522
            NT
Sbjct  238  NT  239



>ref|XP_004240115.1| PREDICTED: probable protein S-acyltransferase 12 [Solanum lycopersicum]
Length=309

 Score =   144 bits (363),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 105/187 (56%), Positives = 128/187 (68%), Gaps = 12/187 (6%)
 Frame = +1

Query  1    FYCLLVMLLWSYFSVVFTDPGSVPPNWKPASDEERGDTDPLTASEFGSLPPDT-------  159
            F+ LLVML+WSY  VV  DPGSVP NWK  S++   + + +  S++ S+   T       
Sbjct  60   FHILLVMLMWSYIRVVVQDPGSVPENWKLVSEQNIEEGNSVALSDYASIENPTPTLSTEQ  119

Query  160  ---AQSRIR-FCKKCNQLKPPRCHHCSVCGRCVLKMDHHCVWVVNCVGALNYKYfllflf  327
                QS+ R +C KC   KPPRCHHCSVC RCVLKMDHHC+WVVNCVGA NYK+FLLF+ 
Sbjct  120  IERRQSQSRGYCSKCQNGKPPRCHHCSVCQRCVLKMDHHCIWVVNCVGACNYKFFLLFVV  179

Query  328  ytflettlvtlSLLPNFLAFFGDVDIPGSA-GDlattflafvlnlafalsvlGFLIMHIS  504
            YTFL TTL TL LLP+F+ FF          G++A  FL FVLNLAF+LS+L F+IMH S
Sbjct  180  YTFLITTLDTLVLLPSFIKFFRQSKNQSLLPGNIAVIFLVFVLNLAFSLSLLCFVIMHAS  239

Query  505  LVSRNTT  525
            L+S NTT
Sbjct  240  LLSSNTT  246



>ref|XP_011039088.1| PREDICTED: probable protein S-acyltransferase 12 isoform X1 [Populus 
euphratica]
Length=307

 Score =   144 bits (363),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 107/185 (58%), Positives = 120/185 (65%), Gaps = 10/185 (5%)
 Frame = +1

Query  1    FYCLLVMLLWSYFSVVFTDPGSVPPNWKPASDEERGDTDPLTASEFGSLPPDTAQSRIRF  180
            F+ LL+MLLWSYF VV  DPGSVP NW+    EE  +T          +       R  F
Sbjct  60   FHFLLIMLLWSYFMVVSKDPGSVPENWRAVLPEEALETGSSLNDRSECVVATDGLDRRAF  119

Query  181  CKKCNQLKPPRCHHCSVCGRCVLKMDHHCVWVVNCVGALNYKYfllflfytf--------  336
            C  C   KPPRCHHCSVC RCVLKMDHHCVWVVNCVGA NYK+FLLFL  T         
Sbjct  120  CNHCQNGKPPRCHHCSVCQRCVLKMDHHCVWVVNCVGARNYKFFLLFLLSTSFFSLKLYT  179

Query  337  -lettlvtlSLLPNFLAFFGDVDIPGSA-GDlattflafvlnlafalsvlGFLIMHISLV  510
             + TT+ TL+LLP F+ FFG      S+ GDLA  FLAFVLNLAFALS+L FL+MH SLV
Sbjct  180  FMVTTMDTLALLPGFINFFGKAKNHSSSPGDLAVIFLAFVLNLAFALSLLCFLVMHASLV  239

Query  511  SRNTT  525
            S NTT
Sbjct  240  SSNTT  244



>dbj|BAK01014.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=330

 Score =   144 bits (364),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 106/179 (59%), Positives = 127/179 (71%), Gaps = 9/179 (5%)
 Frame = +1

Query  16   VMLLWSYFSVVFTDPGSVPPNWKPASDEE------RGDTDPLTASEFGSLPPDTAQS--R  171
            +M+LW YF VVFT+PG+VP NW+ A++E+              A++  + PP + +    
Sbjct  89   IMMLWCYFMVVFTNPGAVPGNWRHAAEEDGMYPNNSSTISDNVATDCANRPPTSEEQGHA  148

Query  172  IRFCKKCNQLKPPRCHHCSVCGRCVLKMDHHCVWVVNCVGALNYKYfllflfytflettl  351
             R+C +C   KPPRCHHCSVC RCVLKMDHHCVWVVNCVGA NYKYFLLFL YTFLET L
Sbjct  149  PRYCSRCQSGKPPRCHHCSVCDRCVLKMDHHCVWVVNCVGARNYKYFLLFLVYTFLETVL  208

Query  352  vtlSLLPNFLAFFGD-VDIPGSAGDlattflafvlnlafalsvlGFLIMHISLVSRNTT  525
              L LLP+F+ FF D    P SAGD+A  FLAFVLNLAFALS+L F+ MH SLV+ NTT
Sbjct  209  DALVLLPSFIIFFRDGSGRPSSAGDIAILFLAFVLNLAFALSLLCFICMHTSLVASNTT  267



>ref|XP_004957652.1| PREDICTED: probable S-acyltransferase At4g00840-like [Setaria 
italica]
Length=292

 Score =   143 bits (361),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 106/176 (60%), Positives = 121/176 (69%), Gaps = 11/176 (6%)
 Frame = +1

Query  1    FYCLLVMLLWSYFSVVFTDPGSVPPNWKPASDEERGDTDPLTASEFGSLPPDTAQSRIRF  180
            F+ LL M+LW Y  VVFTDPG+VP NW+   D E       ++ E GS P         +
Sbjct  64   FHVLLAMILWCYLMVVFTDPGAVPENWR--HDAEYSGDPGSSSEEQGSAPS--------Y  113

Query  181  CKKCNQLKPPRCHHCSVCGRCVLKMDHHCVWVVNCVGALNYKYfllflfytflettlvtl  360
            C +C   KPPRCHHCSVC RCVLKMDHHC+WVVNCVGA NYKYFLLFL YTF ET L TL
Sbjct  114  CSRCQNGKPPRCHHCSVCNRCVLKMDHHCIWVVNCVGARNYKYFLLFLVYTFAETVLDTL  173

Query  361  SLLPNFLAFFGDVDIPGSA-GDlattflafvlnlafalsvlGFLIMHISLVSRNTT  525
             LLPNF+ FF D     S+ GD+A  FLAFVLNLAF LS+L F+ MH SLV+ NTT
Sbjct  174  VLLPNFIEFFQDESRRSSSPGDIAILFLAFVLNLAFVLSLLCFIGMHTSLVTSNTT  229



>ref|XP_002872926.1| zinc ion binding protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH49185.1| zinc ion binding protein [Arabidopsis lyrata subsp. lyrata]
Length=291

 Score =   143 bits (361),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 105/176 (60%), Positives = 126/176 (72%), Gaps = 8/176 (5%)
 Frame = +1

Query  1    FYCLLVMLLWSYFSVVFTDPGSVPPNWKPASDEERGDTDPLTASEFGSLPPDTAQSRIRF  180
            F+ LL+MLLWSYF+ VFTDPGSVP  ++     E G  D L A   G+     A   + +
Sbjct  60   FHFLLIMLLWSYFTTVFTDPGSVPEYFR----REMGGGDNLEA---GTSTDQGAFGSLGY  112

Query  181  CKKCNQLKPPRCHHCSVCGRCVLKMDHHCVWVVNCVGALNYKYfllflfytflettlvtl  360
            C KC  +KPPRCHHCSVC RCVLKMDHHCVW+VNCVGA NYK+FLLFLFYTFLET L  +
Sbjct  113  CTKCRNVKPPRCHHCSVCQRCVLKMDHHCVWIVNCVGARNYKFFLLFLFYTFLETMLDVI  172

Query  361  SLLPNFLAFFGD-VDIPGSAGDlattflafvlnlafalsvlGFLIMHISLVSRNTT  525
             LLP+F+ FF   +    S G LA+  LAFVLNLAF LS+L F++MH+SL+S NTT
Sbjct  173  VLLPSFIEFFSQAIKHSSSPGKLASLVLAFVLNLAFVLSLLCFVVMHLSLLSSNTT  228



>gb|KJB09590.1| hypothetical protein B456_001G151300 [Gossypium raimondii]
Length=234

 Score =   141 bits (356),  Expect = 5e-38, Method: Compositional matrix adjust.
 Identities = 106/175 (61%), Positives = 123/175 (70%), Gaps = 10/175 (6%)
 Frame = +1

Query  13   LVMLLWSYFSVVFTDPGSVPPNWKPASDEERGDT-DPLTASEFGSLPPDTAQSRIR---F  180
            LV+LLWSY  VV  DPGSVP NW+  S EE  +    L A+E      D  + R R   +
Sbjct  3    LVLLLWSYIRVVLKDPGSVPENWRAVSGEESLEVGTSLAAAE------DGFERRSRGGGY  56

Query  181  CKKCNQLKPPRCHHCSVCGRCVLKMDHHCVWVVNCVGALNYKYfllflfytflettlvtl  360
            C  C   KPPRCHHCS+C RCVLKMDHHCVWVVNCVGA NYK+FLLFL YTFLETT+VT+
Sbjct  57   CIHCQNGKPPRCHHCSICQRCVLKMDHHCVWVVNCVGACNYKFFLLFLLYTFLETTMVTI  116

Query  361  SLLPNFLAFFGDVDIPGSAGDlattflafvlnlafalsvlGFLIMHISLVSRNTT  525
             LLP+F+ FFG+     SA   A  FLAFVLN AFALS+L F++MH SL+S NTT
Sbjct  117  VLLPSFINFFGEAKNHSSAAKSAIIFLAFVLNFAFALSLLCFVVMHASLLSSNTT  171



>emb|CDX74374.1| BnaA03g26730D [Brassica napus]
Length=291

 Score =   142 bits (359),  Expect = 6e-38, Method: Compositional matrix adjust.
 Identities = 105/176 (60%), Positives = 127/176 (72%), Gaps = 8/176 (5%)
 Frame = +1

Query  1    FYCLLVMLLWSYFSVVFTDPGSVPPNWKPASDEERGDTDPLTASEFGSLPPDTAQSRIRF  180
            F+ LLVMLLWSYF+VVFTDPGSVP +++     E G  + L A   G+     A   + +
Sbjct  60   FHFLLVMLLWSYFTVVFTDPGSVPEHFR----RELGGGESLEA---GTSTDQGAFGSLCY  112

Query  181  CKKCNQLKPPRCHHCSVCGRCVLKMDHHCVWVVNCVGALNYKYfllflfytflettlvtl  360
            C KC  +KPPRCHHCSVC RCVLKMDHHCVW+VNCVGA NYK+FLLFL YTFLET L  +
Sbjct  113  CPKCRNVKPPRCHHCSVCQRCVLKMDHHCVWIVNCVGARNYKFFLLFLLYTFLETMLDVV  172

Query  361  SLLPNFLAFFGD-VDIPGSAGDlattflafvlnlafalsvlGFLIMHISLVSRNTT  525
             LLP+F+ FF   +    S G LA+  LAFVLNLAF LS+L F++MH+SL+S NTT
Sbjct  173  VLLPSFIKFFSQAIKHSSSPGKLASLVLAFVLNLAFVLSLLCFVVMHLSLLSTNTT  228



>ref|XP_010428132.1| PREDICTED: probable protein S-acyltransferase 12 [Camelina sativa]
Length=292

 Score =   142 bits (358),  Expect = 8e-38, Method: Compositional matrix adjust.
 Identities = 103/176 (59%), Positives = 123/176 (70%), Gaps = 7/176 (4%)
 Frame = +1

Query  1    FYCLLVMLLWSYFSVVFTDPGSVPPNWKPASDEERGDTDPLTASEFGSLPPDTAQSRIRF  180
            F+ LL+MLLWSYF+ VFTDPGSVP  ++     E G  D L A   G+     A   + +
Sbjct  60   FHFLLIMLLWSYFATVFTDPGSVPERFR----REMGGGDSLEAG--GTSTDQGAFGSLGY  113

Query  181  CKKCNQLKPPRCHHCSVCGRCVLKMDHHCVWVVNCVGALNYKYfllflfytflettlvtl  360
            C KC  +KPPRCHHCSVC RCVLKMDHHCVW+VNCVGA NYK+FLLFLFYTF ET L  +
Sbjct  114  CTKCRNVKPPRCHHCSVCQRCVLKMDHHCVWIVNCVGARNYKFFLLFLFYTFFETLLDVI  173

Query  361  SLLPNFLAFFGD-VDIPGSAGDlattflafvlnlafalsvlGFLIMHISLVSRNTT  525
             LLP+F+ FF   V    S G LA+  LAFVLN AF LS+L F++MH+SL+S N T
Sbjct  174  VLLPSFIEFFSQAVKHSSSPGKLASLVLAFVLNFAFVLSLLCFVVMHLSLLSSNIT  229



>emb|CBI25933.3| unnamed protein product [Vitis vinifera]
Length=178

 Score =   139 bits (349),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 100/127 (79%), Positives = 111/127 (87%), Gaps = 0/127 (0%)
 Frame = +1

Query  145  LPPDTAQSRIRFCKKCNQLKPPRCHHCSVCGRCVLKMDHHCVWVVNCVGALNYKYfllfl  324
            +  + A   +RFC+KCN  KPPRCHHCSVCGRC+LKMDHHCVWVVNCVGA NYKYFLLFL
Sbjct  1    MVANPASEAVRFCRKCNLFKPPRCHHCSVCGRCILKMDHHCVWVVNCVGAKNYKYFLLFL  60

Query  325  fytflettlvtlSLLPNFLAFFGDVDIPGSAGDlattflafvlnlafalsvlGFLIMHIS  504
            FYTFLETTLVTLSLLP+F+AFF D +IPG+ G +A TFL FVLNLAFALSVLGFLIMHIS
Sbjct  61   FYTFLETTLVTLSLLPHFIAFFSDGEIPGTPGTIAATFLTFVLNLAFALSVLGFLIMHIS  120

Query  505  LVSRNTT  525
            LV+ NTT
Sbjct  121  LVAANTT  127



>ref|XP_010691320.1| PREDICTED: probable protein S-acyltransferase 12 [Beta vulgaris 
subsp. vulgaris]
Length=310

 Score =   142 bits (358),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 103/178 (58%), Positives = 122/178 (69%), Gaps = 3/178 (2%)
 Frame = +1

Query  1    FYCLLVMLLWSYFSVVFTDPGSVPPNWKPASDE--ERGDTDPLTASEFGSLPPDTAQSRI  174
            F+ LL++L WSY  VVF DPGSVP NW P  D   E G +    AS + +      +S  
Sbjct  65   FHVLLILLTWSYLMVVFQDPGSVPQNWSPVLDGNLEEGTSSSSLASPWPASNGSERRSTA  124

Query  175  RFCKKCNQLKPPRCHHCSVCGRCVLKMDHHCVWVVNCVGALNYKYfllflfytflettlv  354
             +C +C   +PPRCHHCSVC RCVLKMDHHCVWVVNCVGA NYK+FLLFL YTFLET L 
Sbjct  125  GYCSRCQSARPPRCHHCSVCQRCVLKMDHHCVWVVNCVGARNYKFFLLFLIYTFLETVLD  184

Query  355  tlSLLPNFLAFFGDVDI-PGSAGDlattflafvlnlafalsvlGFLIMHISLVSRNTT  525
            T +LLP  +  FG+      S G+L+ T LAFVLNLAFALS+L F+IMH +LV  NTT
Sbjct  185  TFALLPRIITLFGEAKKHSASPGNLSVTVLAFVLNLAFALSLLCFVIMHATLVWSNTT  242



>ref|XP_006396329.1| hypothetical protein EUTSA_v10028856mg [Eutrema salsugineum]
 gb|ESQ37782.1| hypothetical protein EUTSA_v10028856mg [Eutrema salsugineum]
Length=290

 Score =   142 bits (357),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 106/176 (60%), Positives = 128/176 (73%), Gaps = 9/176 (5%)
 Frame = +1

Query  1    FYCLLVMLLWSYFSVVFTDPGSVPPNWKPASDEERGDTDPLTASEFGSLPPDTAQSRIRF  180
            F+ LL+MLLWSYF+VVFTDPGSVP +++    E  GD       E G+     A S + +
Sbjct  60   FHFLLMMLLWSYFTVVFTDPGSVPEHFR---RELEGDN-----LEAGTSTDRGAFSSLGY  111

Query  181  CKKCNQLKPPRCHHCSVCGRCVLKMDHHCVWVVNCVGALNYKYfllflfytflettlvtl  360
            C KC  +KPPRCHHCSVC RCVLKMDHHCVW+VNCVGA NYK+FLLFLFYTFLET L  +
Sbjct  112  CPKCRNVKPPRCHHCSVCQRCVLKMDHHCVWIVNCVGARNYKFFLLFLFYTFLETMLDVV  171

Query  361  SLLPNFLAFFGD-VDIPGSAGDlattflafvlnlafalsvlGFLIMHISLVSRNTT  525
             LLP+F+ FF   +    S G LA+  LAFVLNLAF LS+L F++MH+SL+S NTT
Sbjct  172  VLLPSFIKFFSQAMKHSSSPGKLASLVLAFVLNLAFVLSLLCFVVMHLSLLSTNTT  227



>ref|XP_007218830.1| hypothetical protein PRUPE_ppa010169mg [Prunus persica]
 gb|EMJ20029.1| hypothetical protein PRUPE_ppa010169mg [Prunus persica]
Length=261

 Score =   140 bits (354),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 87/146 (60%), Positives = 102/146 (70%), Gaps = 14/146 (10%)
 Frame = +1

Query  1    FYCLLVMLLWSYFSVVFTDPGSVPPNWKPASDEERGDT-DPLTASEFGSLPPDTAQS---  168
            F+ LL+MLLWSYF VVF DPGSVP NWKP ++EE  +    LT SE  S+ P+   S   
Sbjct  105  FHFLLIMLLWSYFMVVFKDPGSVPNNWKPLTEEEVLEAGSSLTLSE--SIEPEAFTSTHS  162

Query  169  --------RIRFCKKCNQLKPPRCHHCSVCGRCVLKMDHHCVWVVNCVGALNYKYfllfl  324
                    ++ +C +C   KPPRCHHCSVC RCVLKMDHHCVWVVNCVGA NYK+FLLFL
Sbjct  163  ADGRERRPQVGYCSRCQNGKPPRCHHCSVCQRCVLKMDHHCVWVVNCVGARNYKFFLLFL  222

Query  325  fytflettlvtlSLLPNFLAFFGDVD  402
             YTFLETT+ T  LLPNF+ FF +  
Sbjct  223  LYTFLETTMDTFILLPNFIDFFSEAK  248



>ref|XP_009134494.1| PREDICTED: probable protein S-acyltransferase 12 [Brassica rapa]
Length=291

 Score =   141 bits (355),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 105/176 (60%), Positives = 127/176 (72%), Gaps = 8/176 (5%)
 Frame = +1

Query  1    FYCLLVMLLWSYFSVVFTDPGSVPPNWKPASDEERGDTDPLTASEFGSLPPDTAQSRIRF  180
            F+ LLVMLLWS F+VVFTDPGSVP +++     E G  + L A   G+     A   I +
Sbjct  60   FHFLLVMLLWSCFTVVFTDPGSVPEHFR----RELGGGESLEA---GTSTDQGAFGSIGY  112

Query  181  CKKCNQLKPPRCHHCSVCGRCVLKMDHHCVWVVNCVGALNYKYfllflfytflettlvtl  360
            C KC  +KPPRCHHCSVC RCVLKMDHHCVW+VNCVGA NYK+FLLFL YTFLET L  +
Sbjct  113  CPKCRNVKPPRCHHCSVCQRCVLKMDHHCVWIVNCVGARNYKFFLLFLLYTFLETMLDVV  172

Query  361  SLLPNFLAFFGD-VDIPGSAGDlattflafvlnlafalsvlGFLIMHISLVSRNTT  525
             LLP+F+ FF + +    S G LA+  LAFVLNLAF LS+L F++MH+SL+S NTT
Sbjct  173  VLLPSFIKFFSEAIKHSSSPGKLASLVLAFVLNLAFVLSLLCFVVMHLSLLSTNTT  228



>ref|XP_010054971.1| PREDICTED: probable protein S-acyltransferase 12 [Eucalyptus 
grandis]
 gb|KCW71455.1| hypothetical protein EUGRSUZ_E00018 [Eucalyptus grandis]
Length=306

 Score =   140 bits (354),  Expect = 5e-37, Method: Compositional matrix adjust.
 Identities = 109/175 (62%), Positives = 122/175 (70%), Gaps = 9/175 (5%)
 Frame = +1

Query  28   WSYFSVVFTDPGSVPPNWKPASDEERGDTD----PLTASEFGSLPPDTAQSRIR----FC  183
            WSYF VV  DPGSVP NW+P  DEE  + D    P  AS  GS  P +  S  R    FC
Sbjct  69   WSYFMVVLRDPGSVPENWRPVRDEENFEGDASYLPHEASGSGSTWPSSNGSEGRPPSGFC  128

Query  184  KKCNQLKPPRCHHCSVCGRCVLKMDHHCVWVVNCVGALNYKYfllflfytflettlvtlS  363
             +C   KPPRCHHCS+C RCVLKMDHHCVWVVNCVGA NYK+FLLFL YTFLET + TL 
Sbjct  129  VRCQNGKPPRCHHCSICQRCVLKMDHHCVWVVNCVGACNYKFFLLFLLYTFLETMMDTLV  188

Query  364  LLPNFLAFFGDV-DIPGSAGDlattflafvlnlafalsvlGFLIMHISLVSRNTT  525
            LLP+F+ FF +  D   S G LA  F+AFVLNLAFALS+L FL+MH SLV  NTT
Sbjct  189  LLPSFINFFSEAKDHSNSPGKLAVIFVAFVLNLAFALSLLCFLVMHGSLVFSNTT  243



>gb|KFK30666.1| hypothetical protein AALP_AA6G012100 [Arabis alpina]
Length=289

 Score =   139 bits (350),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 103/176 (59%), Positives = 124/176 (70%), Gaps = 10/176 (6%)
 Frame = +1

Query  1    FYCLLVMLLWSYFSVVFTDPGSVPPNWKPASDEERGDTDPLTASEFGSLPPDTAQSRIRF  180
            F+ LL+MLLWSY   VFTDPGSVP +++    +     +      FGSL          +
Sbjct  60   FHFLLIMLLWSYLITVFTDPGSVPEHFRRELGDNLEAGNSNDQGGFGSLG---------Y  110

Query  181  CKKCNQLKPPRCHHCSVCGRCVLKMDHHCVWVVNCVGALNYKYfllflfytflettlvtl  360
            C KC  +KPPRCHHCSVC RCVLKMDHHCVW+VNCVGA NYK+FLLFLFYTFLET L  +
Sbjct  111  CPKCRNVKPPRCHHCSVCQRCVLKMDHHCVWIVNCVGARNYKFFLLFLFYTFLETMLDIV  170

Query  361  SLLPNFLAFFGD-VDIPGSAGDlattflafvlnlafalsvlGFLIMHISLVSRNTT  525
             LLP+F+ FFG  +    S G+LA+  LAFVLNLAF LS+L F++MHISL+S NTT
Sbjct  171  VLLPSFIKFFGQAIKHSSSPGNLASLVLAFVLNLAFVLSLLCFVVMHISLLSSNTT  226



>ref|XP_011082342.1| PREDICTED: probable protein S-acyltransferase 12 isoform X1 [Sesamum 
indicum]
Length=306

 Score =   139 bits (351),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 103/186 (55%), Positives = 130/186 (70%), Gaps = 13/186 (7%)
 Frame = +1

Query  1    FYCLLVMLLWSYFSVVFTDPGSVPPNWKPASDEERGDTDPLTASEFGSLPPDTA------  162
            F+ LLV+L WSYF VVF DPGSVP NWK + ++   D + ++ +   S P ++A      
Sbjct  60   FHVLLVLLTWSYFMVVFRDPGSVPANWKTSPEQNVADENFVSCTY--SAPDNSAGPSSSE  117

Query  163  ----QSRIRFCKKCNQLKPPRCHHCSVCGRCVLKMDHHCVWVVNCVGALNYKYfllflfy  330
                +  + +C  C   KPPRCHHCSVC RCVLKMDHHC+WVVNCVGA NYK+FLLF+ Y
Sbjct  118  GIEKRPALNYCSYCKNGKPPRCHHCSVCQRCVLKMDHHCIWVVNCVGARNYKFFLLFVLY  177

Query  331  tflettlvtlSLLPNFLAFFGDVDIPGSA-GDlattflafvlnlafalsvlGFLIMHISL  507
            T+LET + TL LLP F+ FF       S+ G+LA TFLAFVLNLAF+LS+L F++MHISL
Sbjct  178  TYLETMMDTLVLLPGFINFFQQAKRHSSSPGNLAITFLAFVLNLAFSLSLLCFVVMHISL  237

Query  508  VSRNTT  525
            +  NTT
Sbjct  238  LLSNTT  243



>ref|XP_010238650.1| PREDICTED: probable protein S-acyltransferase 12 isoform X1 [Brachypodium 
distachyon]
Length=298

 Score =   139 bits (349),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 90/184 (49%), Positives = 111/184 (60%), Gaps = 22/184 (12%)
 Frame = +1

Query  1    FYCLLVMLLWSYFSVVFTDPGSVPPNWKPASDEERGDTDPL------TASEFGSLPPDTA  162
            F+ LL+M+LW Y  VVFTDPG+VP NW+ A++E+  D           A++  + P  T+
Sbjct  65   FHLLLIMMLWCYLMVVFTDPGAVPENWRHAAEEDDMDESNTRTISNDVATDIVNPPLFTS  124

Query  163  QSR---IRFCKKCNQLKPPRCHHCSVCGRCVLKMDHHCVWVVNCVGALNYKYfllflfyt  333
            + +    R+C +C   KPPRCHHCS+C RCVLKMDHHCVWVVNCVGA NYKYFLLFL YT
Sbjct  125  EGQGNASRYCSRCQNGKPPRCHHCSICDRCVLKMDHHCVWVVNCVGARNYKYFLLFLVYT  184

Query  334  flettlvtlSLLPNFLAFFGDVDIPGSAGDlattflafvlnlafalsvlGFLIMHISLVS  513
            FLET L TL LLP+F+ FF D     S+                         MH SLV+
Sbjct  185  FLETVLDTLVLLPSFITFFRDESRRSSSASDVAILFLAFG-------------MHTSLVA  231

Query  514  RNTT  525
             NTT
Sbjct  232  SNTT  235



>ref|XP_001419536.1| predicted protein [Ostreococcus lucimarinus CCE9901]
 gb|ABO97829.1| predicted protein [Ostreococcus lucimarinus CCE9901]
Length=331

 Score =   139 bits (350),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 93/175 (53%), Positives = 113/175 (65%), Gaps = 9/175 (5%)
 Frame = +1

Query  1    FYCLLVMLLWSYFSVVFTDPGSVPPNWKPASDEERGDTDPLTASEFGSLPPDTAQSRIRF  180
            ++    MLLWSYF+ V T PG VP  W PA +      DP  A+         ++ R RF
Sbjct  82   YHVFAFMLLWSYFACVLTAPGDVPRGWTPAPE------DPEEAAS--EAKKSNSEKRRRF  133

Query  181  CKKCNQLKPPRCHHCSVCGRCVLKMDHHCVWVVNCVGALNYKYfllflfytflettlvtl  360
            CKKC   KP R HHCSVC RCVLKMDHHCVWV NCVGA NYK+FL FL YTFL T L  +
Sbjct  134  CKKCAAWKPTRTHHCSVCKRCVLKMDHHCVWVANCVGAYNYKFFLQFLAYTFLATVLDAI  193

Query  361  SLLPNFLAFFGDVDIPGSAGDlattflafvlnlafalsvlGFLIMHISLVSRNTT  525
             LL NF+ FF DVD P    +LA  F+ F++N+AF+ S+LGFL+MH +L+  N T
Sbjct  194  LLLSNFIDFFKDVD-PAEGTELAVVFVTFIVNVAFSASLLGFLVMHGNLILSNMT  247



>emb|CAA16560.1| predicted protein [Arabidopsis thaliana]
 emb|CAB79230.1| predicted protein [Arabidopsis thaliana]
Length=820

 Score =   143 bits (361),  Expect = 5e-36, Method: Compositional matrix adjust.
 Identities = 84/175 (48%), Positives = 103/175 (59%), Gaps = 26/175 (15%)
 Frame = +1

Query  1    FYCLLVMLLWSYFSVVFTDPGSVPPNWKPASDEERGDTDPLTASEFGSLPPDTAQSRIRF  180
            F+ LL+MLLWSYFSVV TDPG VP  W+P  D E+ + +     E  +   D++   +R+
Sbjct  584  FHFLLIMLLWSYFSVVVTDPGGVPTGWRPELDIEKSEGNQALIGE--ASVGDSSSHGVRY  641

Query  181  CKKCNQLKPPRCHHCSVCGRCVLKMDHHCVWVVNCVGALNYKYfllflfytflettlvtl  360
            C+KCNQ KPPR HHCSVCGRC+LKMDHHCVWVVNCVGA NYK       +     TL   
Sbjct  642  CRKCNQYKPPRSHHCSVCGRCILKMDHHCVWVVNCVGANNYK------SFLLFLNTLTLP  695

Query  361  SLLPNFLAFFGDVDIPGSAGDlattflafvlnlafalsvlGFLIMHISLVSRNTT  525
            S     L+ F  ++I  +                    VLGFLIMHI LV+RNTT
Sbjct  696  SDSKTSLSCFPVLNIAFALS------------------VLGFLIMHIMLVARNTT  732



>gb|KJB09588.1| hypothetical protein B456_001G151300 [Gossypium raimondii]
Length=210

 Score =   135 bits (339),  Expect = 8e-36, Method: Compositional matrix adjust.
 Identities = 85/145 (59%), Positives = 99/145 (68%), Gaps = 10/145 (7%)
 Frame = +1

Query  1    FYCLLVMLLWSYFSVVFTDPGSVPPNWKPASDEERGDT-DPLTASEFGSLPPDTAQSRIR  177
            F+ LLV+LLWSY  VV  DPGSVP NW+  S EE  +    L A+E      D  + R R
Sbjct  60   FHVLLVLLLWSYIRVVLKDPGSVPENWRAVSGEESLEVGTSLAAAE------DGFERRSR  113

Query  178  ---FCKKCNQLKPPRCHHCSVCGRCVLKMDHHCVWVVNCVGALNYKYfllflfytflett  348
               +C  C   KPPRCHHCS+C RCVLKMDHHCVWVVNCVGA NYK+FLLFL YTFLETT
Sbjct  114  GGGYCIHCQNGKPPRCHHCSICQRCVLKMDHHCVWVVNCVGACNYKFFLLFLLYTFLETT  173

Query  349  lvtlSLLPNFLAFFGDVDIPGSAGD  423
            +VT+ LLP+F+ FFG+     SA  
Sbjct  174  MVTIVLLPSFINFFGEAKNHSSAAK  198



>emb|CDY07150.1| BnaCnng01650D [Brassica napus]
Length=289

 Score =   137 bits (344),  Expect = 8e-36, Method: Compositional matrix adjust.
 Identities = 102/176 (58%), Positives = 123/176 (70%), Gaps = 10/176 (6%)
 Frame = +1

Query  1    FYCLLVMLLWSYFSVVFTDPGSVPPNWKPASDEERGDTDPLTASEFGSLPPDTAQSRIRF  180
            F+ LL+MLLWSYF+ VFTDPGSVP +++    E     D L A         T Q  + +
Sbjct  60   FHFLLIMLLWSYFTAVFTDPGSVPEHFR---RELVVVGDSLEAG------ASTGQGALGY  110

Query  181  CKKCNQLKPPRCHHCSVCGRCVLKMDHHCVWVVNCVGALNYKYfllflfytflettlvtl  360
            C KC  +KPPRCHHCSVC RCVLKMDHHCVW+VNCVGA NYK+FLLFL YTFLET L  +
Sbjct  111  CPKCRIVKPPRCHHCSVCQRCVLKMDHHCVWIVNCVGARNYKFFLLFLLYTFLETLLDVV  170

Query  361  SLLPNFLAFFGD-VDIPGSAGDlattflafvlnlafalsvlGFLIMHISLVSRNTT  525
             LLP+F+ FF   +    S   LA+  LAFVLNLAF LS+L F++MH+SL+S NTT
Sbjct  171  VLLPSFIEFFSQAIKHSSSPSQLASLVLAFVLNLAFVLSLLCFIVMHLSLLSTNTT  226



>ref|XP_010919145.1| PREDICTED: probable protein S-acyltransferase 12 [Elaeis guineensis]
Length=315

 Score =   137 bits (344),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 111/189 (59%), Positives = 133/189 (70%), Gaps = 16/189 (8%)
 Frame = +1

Query  1    FYCLLVMLLWSYFSVVFTDPGSVPPNWKPASDEERGDT-DPLTASEFGSLPPDTAQS---  168
            F+ LL +L+WSYF VVF DPGSVP NW+P  +EE  +    +T S++  + P+T+ S   
Sbjct  66   FHLLLALLIWSYFMVVFVDPGSVPLNWRPTIEEENLEIGSSVTLSDY--VAPETSASAWS  123

Query  169  ---------RIRFCKKCNQLKPPRCHHCSVCGRCVLKMDHHCVWVVNCVGALNYKYfllf  321
                      I +C +C+  KPPRCHHCSVC RCVLKMDHHCVWVVNCVG  NYK FLLF
Sbjct  124  SSEGLERRPTIGYCSRCHNSKPPRCHHCSVCQRCVLKMDHHCVWVVNCVGVRNYKCFLLF  183

Query  322  lfytflettlvtlSLLPNFLAFFGDVDIPGSA-GDlattflafvlnlafalsvlGFLIMH  498
            L YTFLET L TL+LLP F+ FFGD     S+ G LA TFLAFVLNLAFALS+L F+++H
Sbjct  184  LLYTFLETVLDTLALLPRFIKFFGDARNHNSSPGKLAVTFLAFVLNLAFALSLLCFVVLH  243

Query  499  ISLVSRNTT  525
             SLV  NTT
Sbjct  244  TSLVLSNTT  252



>emb|CDP08628.1| unnamed protein product [Coffea canephora]
Length=223

 Score =   134 bits (338),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 80/140 (57%), Positives = 101/140 (72%), Gaps = 12/140 (9%)
 Frame = +1

Query  1    FYCLLVMLLWSYFSVVFTDPGSVPPNWKPASDEERGDTDPLTASEFGSLPPDTAQSR---  171
            F+ LL++L WSY  VVF DPGSVP NW+  S+E+  + +P + S   +L P T+ S    
Sbjct  62   FHYLLILLTWSYMMVVFRDPGSVPDNWQLVSEEDLEEGNPTSISH--NLGPQTSASALSD  119

Query  172  -------IRFCKKCNQLKPPRCHHCSVCGRCVLKMDHHCVWVVNCVGALNYKYfllflfy  330
                   IR+C +C   KPPRCHHCS+C RCVLKMDHHC+WVVNCVGA N+K+FLLF+FY
Sbjct  120  GTEIRPAIRYCSQCQNGKPPRCHHCSICQRCVLKMDHHCIWVVNCVGARNHKFFLLFVFY  179

Query  331  tflettlvtlSLLPNFLAFF  390
            TFLETTL T+ LLP+F+ FF
Sbjct  180  TFLETTLNTVVLLPSFVNFF  199



>gb|KDO86584.1| hypothetical protein CISIN_1g021385mg [Citrus sinensis]
Length=286

 Score =   135 bits (341),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 108/183 (59%), Positives = 128/183 (70%), Gaps = 8/183 (4%)
 Frame = +1

Query  1    FYCLLVMLLWSYFSVVFTDPGSVPPNWKPASDEERG----DTDPLTASE-FGSLPPDTA-  162
            F+ LLVML+WSY  VVF DPGSVP NW+  S         + +  T+S+   ++ PD   
Sbjct  60   FHILLVMLVWSYVMVVFWDPGSVPENWRSVSVSSSSSSGVNLEAGTSSQSLDNVGPDARG  119

Query  163  -QSRIRFCKKCNQLKPPRCHHCSVCGRCVLKMDHHCVWVVNCVGALNYKYfllflfytfl  339
                + FC +C   KPPRCHHCSVC RCVLKMDHHCVWVVNCVGA NYK FLLFL YTFL
Sbjct  120  PSRSVGFCDRCQNGKPPRCHHCSVCQRCVLKMDHHCVWVVNCVGARNYKSFLLFLLYTFL  179

Query  340  ettlvtlSLLPNFLAFFGDVDIPGSA-GDlattflafvlnlafalsvlGFLIMHISLVSR  516
            ETT+ TL LLP+F+ FFG      S+  +LA  FLAFV+NLAFALS+L F++MH SLVS 
Sbjct  180  ETTMDTLVLLPSFIKFFGKAKNHSSSPANLAIVFLAFVINLAFALSLLCFIVMHSSLVSS  239

Query  517  NTT  525
            NTT
Sbjct  240  NTT  242



>gb|KDO86583.1| hypothetical protein CISIN_1g021385mg [Citrus sinensis]
Length=313

 Score =   136 bits (342),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 108/183 (59%), Positives = 128/183 (70%), Gaps = 8/183 (4%)
 Frame = +1

Query  1    FYCLLVMLLWSYFSVVFTDPGSVPPNWKPASDEERG----DTDPLTASE-FGSLPPDTA-  162
            F+ LLVML+WSY  VVF DPGSVP NW+  S         + +  T+S+   ++ PD   
Sbjct  60   FHILLVMLVWSYVMVVFWDPGSVPENWRSVSVSSSSSSGVNLEAGTSSQSLDNVGPDARG  119

Query  163  -QSRIRFCKKCNQLKPPRCHHCSVCGRCVLKMDHHCVWVVNCVGALNYKYfllflfytfl  339
                + FC +C   KPPRCHHCSVC RCVLKMDHHCVWVVNCVGA NYK FLLFL YTFL
Sbjct  120  PSRSVGFCDRCQNGKPPRCHHCSVCQRCVLKMDHHCVWVVNCVGARNYKSFLLFLLYTFL  179

Query  340  ettlvtlSLLPNFLAFFGDVDIPGSA-GDlattflafvlnlafalsvlGFLIMHISLVSR  516
            ETT+ TL LLP+F+ FFG      S+  +LA  FLAFV+NLAFALS+L F++MH SLVS 
Sbjct  180  ETTMDTLVLLPSFIKFFGKAKNHSSSPANLAIVFLAFVINLAFALSLLCFIVMHSSLVSS  239

Query  517  NTT  525
            NTT
Sbjct  240  NTT  242



>ref|XP_006288365.1| hypothetical protein CARUB_v10001614mg [Capsella rubella]
 gb|EOA21263.1| hypothetical protein CARUB_v10001614mg [Capsella rubella]
Length=210

 Score =   133 bits (335),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 81/132 (61%), Positives = 95/132 (72%), Gaps = 7/132 (5%)
 Frame = +1

Query  1    FYCLLVMLLWSYFSVVFTDPGSVPPNWKPASDEERGDTDPLTASEFGSLPPDTAQSRIRF  180
            F+ LL+MLLWSYFS VFTDPGSVP +++     E G  D L A   G+     A   + +
Sbjct  60   FHFLLIMLLWSYFSTVFTDPGSVPEHFR----REMGGGDNLEA---GTSTDQGAFGSLGY  112

Query  181  CKKCNQLKPPRCHHCSVCGRCVLKMDHHCVWVVNCVGALNYKYfllflfytflettlvtl  360
            C KC  +KPPRCHHCSVC RCVLKMDHHCVW+VNCVGA NYK+FLLFLFYTFLET L  +
Sbjct  113  CTKCRNVKPPRCHHCSVCQRCVLKMDHHCVWIVNCVGARNYKFFLLFLFYTFLETMLDVI  172

Query  361  SLLPNFLAFFGD  396
             LLP+F+ FF  
Sbjct  173  VLLPSFIEFFSQ  184



>emb|CDY51717.1| BnaA09g52040D [Brassica napus]
Length=289

 Score =   135 bits (339),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 102/176 (58%), Positives = 122/176 (69%), Gaps = 10/176 (6%)
 Frame = +1

Query  1    FYCLLVMLLWSYFSVVFTDPGSVPPNWKPASDEERGDTDPLTASEFGSLPPDTAQSRIRF  180
            F+ LL+MLLWSYF+ V TDPGSVP +++    E     D L A         T Q  + +
Sbjct  60   FHFLLIMLLWSYFTAVCTDPGSVPEHFR---RELVVVGDSLEAG------TSTEQGALGY  110

Query  181  CKKCNQLKPPRCHHCSVCGRCVLKMDHHCVWVVNCVGALNYKYfllflfytflettlvtl  360
            C KC  +KPPRCHHCSVC RCVLKMDHHCVW+VNCVGA NYK+FLLFL YTFLET L  +
Sbjct  111  CPKCRNVKPPRCHHCSVCQRCVLKMDHHCVWIVNCVGARNYKFFLLFLLYTFLETLLDVV  170

Query  361  SLLPNFLAFFGD-VDIPGSAGDlattflafvlnlafalsvlGFLIMHISLVSRNTT  525
             LLP+F+ FF   +    S   LA+  LAFVLNLAF LS+L F++MH+SLVS NTT
Sbjct  171  VLLPSFIEFFSQAIKRSSSPSQLASLVLAFVLNLAFVLSLLCFIVMHLSLVSTNTT  226



>ref|XP_009111388.1| PREDICTED: LOW QUALITY PROTEIN: probable protein S-acyltransferase 
12 [Brassica rapa]
Length=292

 Score =   135 bits (339),  Expect = 5e-35, Method: Compositional matrix adjust.
 Identities = 100/176 (57%), Positives = 123/176 (70%), Gaps = 7/176 (4%)
 Frame = +1

Query  1    FYCLLVMLLWSYFSVVFTDPGSVPPNWKPASDEERGDTDPLTASEFGSLPPDTAQSRIRF  180
            F+ LL+MLLWSYF+ V TDPGSVP +++          +  T++E G+L          +
Sbjct  60   FHFLLIMLLWSYFTAVCTDPGSVPEHFRRELVVVGDSLEAGTSTEQGAL------GSXGY  113

Query  181  CKKCNQLKPPRCHHCSVCGRCVLKMDHHCVWVVNCVGALNYKYfllflfytflettlvtl  360
            C KC  +KPPRCHHCSVC RCVLKMDHHCVW+VNCVGA NYK+FLLFL YTFLET L  +
Sbjct  114  CPKCRNVKPPRCHHCSVCQRCVLKMDHHCVWIVNCVGARNYKFFLLFLLYTFLETLLDVV  173

Query  361  SLLPNFLAFFGD-VDIPGSAGDlattflafvlnlafalsvlGFLIMHISLVSRNTT  525
             LLP+F+ FF   +    S   LA+  LAFVLNLAF LS+L F++MH+SLVS NTT
Sbjct  174  VLLPSFIEFFSQAIKRSSSPSQLASLVLAFVLNLAFVLSLLCFIVMHLSLVSTNTT  229



>gb|KDO86582.1| hypothetical protein CISIN_1g021385mg [Citrus sinensis]
Length=300

 Score =   135 bits (339),  Expect = 6e-35, Method: Compositional matrix adjust.
 Identities = 108/183 (59%), Positives = 128/183 (70%), Gaps = 8/183 (4%)
 Frame = +1

Query  1    FYCLLVMLLWSYFSVVFTDPGSVPPNWKPASDEERG----DTDPLTASE-FGSLPPDTA-  162
            F+ LLVML+WSY  VVF DPGSVP NW+  S         + +  T+S+   ++ PD   
Sbjct  60   FHILLVMLVWSYVMVVFWDPGSVPENWRSVSVSSSSSSGVNLEAGTSSQSLDNVGPDARG  119

Query  163  -QSRIRFCKKCNQLKPPRCHHCSVCGRCVLKMDHHCVWVVNCVGALNYKYfllflfytfl  339
                + FC +C   KPPRCHHCSVC RCVLKMDHHCVWVVNCVGA NYK FLLFL YTFL
Sbjct  120  PSRSVGFCDRCQNGKPPRCHHCSVCQRCVLKMDHHCVWVVNCVGARNYKSFLLFLLYTFL  179

Query  340  ettlvtlSLLPNFLAFFGDV-DIPGSAGDlattflafvlnlafalsvlGFLIMHISLVSR  516
            ETT+ TL LLP+F+ FFG   +   S  +LA  FLAFV+NLAFALS+L F++MH SLVS 
Sbjct  180  ETTMDTLVLLPSFIKFFGKAKNHSSSPANLAIVFLAFVINLAFALSLLCFIVMHSSLVSS  239

Query  517  NTT  525
            NTT
Sbjct  240  NTT  242



>ref|XP_006491350.1| PREDICTED: LOW QUALITY PROTEIN: probable protein S-acyltransferase 
12-like [Citrus sinensis]
Length=303

 Score =   135 bits (339),  Expect = 6e-35, Method: Compositional matrix adjust.
 Identities = 108/183 (59%), Positives = 128/183 (70%), Gaps = 8/183 (4%)
 Frame = +1

Query  1    FYCLLVMLLWSYFSVVFTDPGSVPPNWKPASDEERG----DTDPLTASE-FGSLPPDTA-  162
            F+ LLVML+WSY  VVF DPGSVP NW+  S         + +  T+S+   ++ PD   
Sbjct  60   FHILLVMLVWSYVMVVFWDPGSVPENWRSVSVSSSSSSGVNLEAGTSSQSLDNVGPDARG  119

Query  163  -QSRIRFCKKCNQLKPPRCHHCSVCGRCVLKMDHHCVWVVNCVGALNYKYfllflfytfl  339
                + FC +C   KPPRCHHCSVC RCVLKMDHHCVWVVNCVGA NYK FLLFL YTFL
Sbjct  120  PSRSVGFCDRCQNGKPPRCHHCSVCQRCVLKMDHHCVWVVNCVGARNYKSFLLFLLYTFL  179

Query  340  ettlvtlSLLPNFLAFFGDVDIPGSA-GDlattflafvlnlafalsvlGFLIMHISLVSR  516
            ETT+ TL LLP+F+ FFG      S+  +LA  FLAFV+NLAFALS+L F++MH SLVS 
Sbjct  180  ETTMDTLVLLPSFIKFFGKAKNHSSSPANLAIVFLAFVINLAFALSLLCFIVMHSSLVSS  239

Query  517  NTT  525
            NTT
Sbjct  240  NTT  242



>gb|KCW73003.1| hypothetical protein EUGRSUZ_E01439 [Eucalyptus grandis]
Length=164

 Score =   130 bits (327),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 57/91 (63%), Positives = 71/91 (78%), Gaps = 1/91 (1%)
 Frame = +1

Query  1    FYCLLVMLLWSYFSVVFTDPGSVPPNWKPASDEERGDTDPLTASEFGSLPPDTAQSRIRF  180
            F+CLLVMLLWSYFSVV TDPG +PPNW+P+ DEERG++DPL   +F  L  D +  RIRF
Sbjct  67   FHCLLVMLLWSYFSVVLTDPGGIPPNWRPSVDEERGESDPLNGLDFSVLQSDPSHRRIRF  126

Query  181  CKKCNQLKPPRCHHCSVCGRCVLKMDHHCVW  273
            C+KCNQ KPPRCHHCSVC +C   + + C++
Sbjct  127  CRKCNQPKPPRCHHCSVC-QCFYIIQYFCLF  156



>ref|XP_002320223.1| hypothetical protein POPTR_0014s09980g [Populus trichocarpa]
 gb|EEE98538.1| hypothetical protein POPTR_0014s09980g [Populus trichocarpa]
Length=331

 Score =   134 bits (337),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 78/131 (60%), Positives = 89/131 (68%), Gaps = 0/131 (0%)
 Frame = +1

Query  1    FYCLLVMLLWSYFSVVFTDPGSVPPNWKPASDEERGDTDPLTASEFGSLPPDTAQSRIRF  180
            F+ LL+MLLWSYF+V+  DPGSVP NW+    EE  +T          +       R  F
Sbjct  60   FHFLLIMLLWSYFTVLSKDPGSVPENWRAVLPEEALETGSSLNDRSDCVVATDGLDRRAF  119

Query  181  CKKCNQLKPPRCHHCSVCGRCVLKMDHHCVWVVNCVGALNYKYfllflfytflettlvtl  360
            C  C   KPPRCHHCSVC RCVLKMDHHCVWVVNCVGA NYK+FLLFL YTF+ TT+ TL
Sbjct  120  CNHCENGKPPRCHHCSVCQRCVLKMDHHCVWVVNCVGARNYKFFLLFLLYTFMVTTMDTL  179

Query  361  SLLPNFLAFFG  393
             LLP F+ FFG
Sbjct  180  VLLPGFINFFG  190



>ref|XP_011082343.1| PREDICTED: probable protein S-acyltransferase 12 isoform X2 [Sesamum 
indicum]
Length=292

 Score =   132 bits (333),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 85/185 (46%), Positives = 108/185 (58%), Gaps = 25/185 (14%)
 Frame = +1

Query  1    FYCLLVMLLWSYFSVVFTDPGSVPPNWKPASDEERGDTDPLTASEFGSLPPDTA------  162
            F+ LLV+L WSYF VVF DPGSVP NWK + ++   D + ++ +   S P ++A      
Sbjct  60   FHVLLVLLTWSYFMVVFRDPGSVPANWKTSPEQNVADENFVSCTY--SAPDNSAGPSSSE  117

Query  163  ----QSRIRFCKKCNQLKPPRCHHCSVCGRCVLKMDHHCVWVVNCVGALNYKYfllflfy  330
                +  + +C  C   KPPRCHHCSVC RCVLKMDHHC+WVVNCVGA NYK+FLLF+ Y
Sbjct  118  GIEKRPALNYCSYCKNGKPPRCHHCSVCQRCVLKMDHHCIWVVNCVGARNYKFFLLFVLY  177

Query  331  tflettlvtlSLLPNFLAFFGDVDIPGSAGDlattflafvlnlafalsvlGFLIMHISLV  510
            T+LET + TL LLP F+ FF       S+                        +MHISL+
Sbjct  178  TYLETMMDTLVLLPGFINFFQQAKRHSSSPGNLAITFLA-------------FVMHISLL  224

Query  511  SRNTT  525
              NTT
Sbjct  225  LSNTT  229



>gb|KDP28430.1| hypothetical protein JCGZ_14201 [Jatropha curcas]
Length=309

 Score =   132 bits (332),  Expect = 7e-34, Method: Compositional matrix adjust.
 Identities = 105/179 (59%), Positives = 123/179 (69%), Gaps = 14/179 (8%)
 Frame = +1

Query  28   WSYFSVVFTDPGSVPPNWKPASDEERGDT-DPLTASEFGSLPPDTAQSR-----------  171
            WSYF VVF DPGSVP NW P   EE  +    ++ S +G+ P   + +R           
Sbjct  69   WSYFMVVFKDPGSVPVNWSPVVLEENLEGGSSISESNYGA-PGALSSTRSASEALDGRPV  127

Query  172  IRFCKKCNQLKPPRCHHCSVCGRCVLKMDHHCVWVVNCVGALNYKYfllflfytflettl  351
            + FC  C   KPPRCHHCSVC RCVLKMDHHCVWVVNCVGA NYK+FLLFL YTFLETT+
Sbjct  128  VGFCNHCQNSKPPRCHHCSVCQRCVLKMDHHCVWVVNCVGARNYKFFLLFLLYTFLETTM  187

Query  352  vtlSLLPNFLAFFGDV-DIPGSAGDlattflafvlnlafalsvlGFLIMHISLVSRNTT  525
             TL LLP+F+ FF +  +   S G LA  FLAFVLNLAFALS+L F++MH SL+S NTT
Sbjct  188  DTLVLLPSFMKFFDEAKNHSNSPGKLAVLFLAFVLNLAFALSLLCFIVMHASLLSSNTT  246



>gb|KCW71456.1| hypothetical protein EUGRSUZ_E00018 [Eucalyptus grandis]
Length=222

 Score =   130 bits (327),  Expect = 7e-34, Method: Compositional matrix adjust.
 Identities = 81/133 (61%), Positives = 91/133 (68%), Gaps = 8/133 (6%)
 Frame = +1

Query  28   WSYFSVVFTDPGSVPPNWKPASDEERGDTD----PLTASEFGSLPPDTAQSRIR----FC  183
            WSYF VV  DPGSVP NW+P  DEE  + D    P  AS  GS  P +  S  R    FC
Sbjct  69   WSYFMVVLRDPGSVPENWRPVRDEENFEGDASYLPHEASGSGSTWPSSNGSEGRPPSGFC  128

Query  184  KKCNQLKPPRCHHCSVCGRCVLKMDHHCVWVVNCVGALNYKYfllflfytflettlvtlS  363
             +C   KPPRCHHCS+C RCVLKMDHHCVWVVNCVGA NYK+FLLFL YTFLET + TL 
Sbjct  129  VRCQNGKPPRCHHCSICQRCVLKMDHHCVWVVNCVGACNYKFFLLFLLYTFLETMMDTLV  188

Query  364  LLPNFLAFFGDVD  402
            LLP+F+ FF +  
Sbjct  189  LLPSFINFFSEAK  201



>ref|XP_008779824.1| PREDICTED: probable protein S-acyltransferase 12 isoform X1 [Phoenix 
dactylifera]
Length=339

 Score =   133 bits (334),  Expect = 7e-34, Method: Compositional matrix adjust.
 Identities = 112/213 (53%), Positives = 132/213 (62%), Gaps = 40/213 (19%)
 Frame = +1

Query  1    FYCLLVMLLWSYFSVVFTDPGSVPPNWKPASDEERGDT-DPLTASEFGSLPPDTAQS---  168
            F+ LL +L+WSYF VVF DPGSVP NW+P  +EE  +    +T S++  + P+T  S   
Sbjct  66   FHLLLALLIWSYFMVVFVDPGSVPLNWRPTLEEENLEIGSSVTLSDY--VAPETRASAWP  123

Query  169  ---------RIRFCKKCNQLKPPRCHHCSVCGRCVLKMDHHCVWVVNCVGALNYKYfllf  321
                      I +C +C+  KPPRCHHCSVC RCVLKMDHHCVWVVNCVGA NYK FLLF
Sbjct  124  SSEGLERRPTIGYCSRCHNSKPPRCHHCSVCQRCVLKMDHHCVWVVNCVGARNYKCFLLF  183

Query  322  l------------------------fytflettlvtlSLLPNFLAFFGDVDIPGSA-GDl  426
            L                         YTFLET L  ++LLP F+ FFGD     S+ G L
Sbjct  184  LEFCRFKCRALEDTWTLWHPWPTVCLYTFLETVLDAVALLPRFVKFFGDARNHNSSPGKL  243

Query  427  attflafvlnlafalsvlGFLIMHISLVSRNTT  525
            A TFLAFVLNLAFALS+L F+IMH SLV  NTT
Sbjct  244  AVTFLAFVLNLAFALSLLCFVIMHTSLVLSNTT  276



>ref|XP_011082344.1| PREDICTED: probable protein S-acyltransferase 12 isoform X3 [Sesamum 
indicum]
Length=221

 Score =   130 bits (326),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 76/140 (54%), Positives = 96/140 (69%), Gaps = 12/140 (9%)
 Frame = +1

Query  1    FYCLLVMLLWSYFSVVFTDPGSVPPNWKPASDEERGDTDPLTASEFGSLPPDTA------  162
            F+ LLV+L WSYF VVF DPGSVP NWK + ++   D + ++ +   S P ++A      
Sbjct  60   FHVLLVLLTWSYFMVVFRDPGSVPANWKTSPEQNVADENFVSCTY--SAPDNSAGPSSSE  117

Query  163  ----QSRIRFCKKCNQLKPPRCHHCSVCGRCVLKMDHHCVWVVNCVGALNYKYfllflfy  330
                +  + +C  C   KPPRCHHCSVC RCVLKMDHHC+WVVNCVGA NYK+FLLF+ Y
Sbjct  118  GIEKRPALNYCSYCKNGKPPRCHHCSVCQRCVLKMDHHCIWVVNCVGARNYKFFLLFVLY  177

Query  331  tflettlvtlSLLPNFLAFF  390
            T+LET + TL LLP F+ FF
Sbjct  178  TYLETMMDTLVLLPGFINFF  197



>emb|CDX91862.1| BnaC03g31640D [Brassica napus]
Length=291

 Score =   131 bits (330),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 98/167 (59%), Positives = 119/167 (71%), Gaps = 8/167 (5%)
 Frame = +1

Query  28   WSYFSVVFTDPGSVPPNWKPASDEERGDTDPLTASEFGSLPPDTAQSRIRFCKKCNQLKP  207
            WSYF+VVFTDPGSVP +++     E G  + L A   G+     A   + +C KC  +KP
Sbjct  69   WSYFTVVFTDPGSVPEHFR----RELGGGESLEA---GTSTDQRAFGSLGYCPKCRNVKP  121

Query  208  PRCHHCSVCGRCVLKMDHHCVWVVNCVGALNYKYfllflfytflettlvtlSLLPNFLAF  387
            PRCHHCSVC RCVLKMDHHCVW+VNCVGA NYK+FLLFL YTFLET L  + LLP+F+ F
Sbjct  122  PRCHHCSVCQRCVLKMDHHCVWIVNCVGARNYKFFLLFLLYTFLETMLDVVVLLPSFIKF  181

Query  388  FGD-VDIPGSAGDlattflafvlnlafalsvlGFLIMHISLVSRNTT  525
            F   +    S G LA+  LAFVLNLAF LS+L F++MH+SL+S NTT
Sbjct  182  FSQALKHSSSPGKLASLVLAFVLNLAFVLSLLCFVVMHLSLLSTNTT  228



>ref|XP_009607103.1| PREDICTED: probable protein S-acyltransferase 12, partial [Nicotiana 
tomentosiformis]
Length=277

 Score =   130 bits (328),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 100/183 (55%), Positives = 127/183 (69%), Gaps = 12/183 (7%)
 Frame = +1

Query  13   LVMLLWSYFSVVFTDPGSVPPNWKPASDEERGDTDPLTASEFGSLPPDT----------A  162
            LV+L+WSY  VV  DPGSVP NWK  S++   + + +  +++ S+   T           
Sbjct  32   LVLLMWSYIKVVIQDPGSVPENWKLVSEQNIEEGNSVALTDYASIENPTPTVSTDQIERR  91

Query  163  QSRIR-FCKKCNQLKPPRCHHCSVCGRCVLKMDHHCVWVVNCVGALNYKYfllflfytfl  339
            QS+ R +C +C   KPPRCHHCSVC RCVLKMDHHC+WVVNCVG+ NYK+FLLF+ YTFL
Sbjct  92   QSQFRGYCSQCQNGKPPRCHHCSVCQRCVLKMDHHCIWVVNCVGSRNYKFFLLFVMYTFL  151

Query  340  ettlvtlSLLPNFLAFFGDV-DIPGSAGDlattflafvlnlafalsvlGFLIMHISLVSR  516
             TTL TL LLP+F+ FF    +   S  ++A  FLAFVLNLAF+LS+L F+IMH SL+S 
Sbjct  152  TTTLDTLVLLPSFIKFFRQAKNHSFSPDNIAVVFLAFVLNLAFSLSLLCFVIMHASLLSS  211

Query  517  NTT  525
            NTT
Sbjct  212  NTT  214



>ref|XP_004167123.1| PREDICTED: probable S-acyltransferase At4g00840-like [Cucumis 
sativus]
Length=306

 Score =   130 bits (328),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 100/174 (57%), Positives = 117/174 (67%), Gaps = 8/174 (5%)
 Frame = +1

Query  28   WSYFSVVFTDPGSVPPNWKPASDEERGDTDPLTASEFGSLPPDTAQS-------RIRFCK  186
            WSYF VV  DPGSVP NW  AS+ E  +    +  E G     T  S          +C+
Sbjct  70   WSYFMVVLEDPGSVPANWVLASEAENMEAGSSSLPEHGPTGDATYSSLDGAGRRSTAYCR  129

Query  187  KCNQLKPPRCHHCSVCGRCVLKMDHHCVWVVNCVGALNYKYfllflfytflettlvtlSL  366
            +C   KPPRCHHCSVC RCVLKMDHHC+WVVNCVGA NYK+FLLFL YTFLETT+ TL L
Sbjct  130  QCQNGKPPRCHHCSVCQRCVLKMDHHCIWVVNCVGARNYKFFLLFLLYTFLETTMDTLVL  189

Query  367  LPNFLAFFGDVDI-PGSAGDlattflafvlnlafalsvlGFLIMHISLVSRNTT  525
            LP+F+ FF +     GS  +L   FLAFVLNLAFALS+L F++MH SL+  NTT
Sbjct  190  LPSFIKFFNEAKSHSGSPANLVILFLAFVLNLAFALSLLCFVVMHASLLMSNTT  243



>ref|XP_009775888.1| PREDICTED: probable protein S-acyltransferase 12 isoform X1 [Nicotiana 
sylvestris]
Length=177

 Score =   127 bits (319),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 58/114 (51%), Positives = 77/114 (68%), Gaps = 11/114 (10%)
 Frame = +1

Query  1    FYCLLVMLLWSYFSVVFTDPGSVPPNWKPASDEERGDTDPLTASEFGSLPPDT-------  159
            F+ LLV+L+WSY  VV  DPGSVP NWK  S++   + + +  +++ S+  +T       
Sbjct  56   FHILLVLLMWSYIKVVIQDPGSVPENWKLVSEQNIEEGNSVALTDYASIENNTPTVSTDQ  115

Query  160  ---AQSRIR-FCKKCNQLKPPRCHHCSVCGRCVLKMDHHCVWVVNCVGALNYKY  309
                QS+ R +C +C   KPPRCHHCSVC RCVLKMDHHC+WVVNCVG+ NYK+
Sbjct  116  IERRQSQSRGYCSQCQNGKPPRCHHCSVCHRCVLKMDHHCIWVVNCVGSRNYKF  169



>ref|XP_002529972.1| zinc finger protein, putative [Ricinus communis]
 gb|EEF32415.1| zinc finger protein, putative [Ricinus communis]
Length=223

 Score =   128 bits (322),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 82/142 (58%), Positives = 95/142 (67%), Gaps = 10/142 (7%)
 Frame = +1

Query  1    FYCLLVMLLWSYFSVVFTDPGSVPPNWKPASDEERG----DTD---PLTASEFGSLPPDT  159
            F+ LLVMLLWSYF VVF DPGSVP NW+  + E  G    ++D   P  +          
Sbjct  60   FHILLVMLLWSYFRVVFKDPGSVPENWRQENLEGGGSCINESDCGAPEASGSASVWAASE  119

Query  160  AQSRIR---FCKKCNQLKPPRCHHCSVCGRCVLKMDHHCVWVVNCVGALNYKYfllflfy  330
               R+    +C  C   KPPRCHHCSVC RCVLKMDHHCVWVVNCVGA NYK+FLLFL Y
Sbjct  120  GSDRLAASGYCTHCKNGKPPRCHHCSVCQRCVLKMDHHCVWVVNCVGARNYKFFLLFLLY  179

Query  331  tflettlvtlSLLPNFLAFFGD  396
            TFLETT+ TL LLP+F+ FF +
Sbjct  180  TFLETTMDTLVLLPSFIKFFDE  201



>ref|XP_004133790.1| PREDICTED: probable S-acyltransferase At4g00840-like [Cucumis 
sativus]
 gb|KGN56387.1| hypothetical protein Csa_3G118230 [Cucumis sativus]
Length=306

 Score =   130 bits (327),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 100/174 (57%), Positives = 117/174 (67%), Gaps = 8/174 (5%)
 Frame = +1

Query  28   WSYFSVVFTDPGSVPPNWKPASDEERGDTDPLTASEFGSLPPDTAQS-------RIRFCK  186
            WSYF VV  DPGSVP NW  AS+ E  +    +  E G     T  S          +C+
Sbjct  70   WSYFMVVLEDPGSVPANWVLASEAENMEAGSSSLPEHGPTGDATYSSLDGAGRRSTAYCR  129

Query  187  KCNQLKPPRCHHCSVCGRCVLKMDHHCVWVVNCVGALNYKYfllflfytflettlvtlSL  366
            +C   KPPRCHHCSVC RCVLKMDHHC+WVVNCVGA NYK+FLLFL YTFLETT+ TL L
Sbjct  130  QCQNGKPPRCHHCSVCQRCVLKMDHHCIWVVNCVGARNYKFFLLFLLYTFLETTMDTLVL  189

Query  367  LPNFLAFFGDVDI-PGSAGDlattflafvlnlafalsvlGFLIMHISLVSRNTT  525
            LP+F+ FF +     GS  +L   FLAFVLNLAFALS+L F++MH SL+  NTT
Sbjct  190  LPSFIKFFDEAKSHSGSPANLVILFLAFVLNLAFALSLLCFVVMHASLLMSNTT  243



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 561572122600