BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFF037D05

Length=482
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

emb|CDP11509.1|  unnamed protein product                              64.7    5e-09   Coffea canephora [robusta coffee]
gb|AAS92623.1|  NADPH:cytochrome P450-reductase                       64.7    5e-09   Centaurium erythraea
ref|XP_007136327.1|  hypothetical protein PHAVU_009G036200g           63.2    2e-08   Phaseolus vulgaris [French bean]
gb|ACF17649.1|  putative cytochrome reductase                         62.4    3e-08   Capsicum annuum
ref|XP_006338052.1|  PREDICTED: NADPH--cytochrome P450 reductase-...  61.6    4e-08   Solanum tuberosum [potatoes]
ref|XP_004238001.1|  PREDICTED: NADPH--cytochrome P450 reductase      61.6    4e-08   Solanum lycopersicum
ref|XP_002514049.1|  cytochrome P450, putative                        61.2    6e-08   Ricinus communis
ref|XP_004501653.1|  PREDICTED: NADPH--cytochrome P450 reductase-...  60.8    8e-08   
gb|ADI49691.1|  cytochrome P450 reductase                             60.5    1e-07   Withania somnifera [ashwagandha]
ref|XP_004501654.1|  PREDICTED: NADPH--cytochrome P450 reductase-...  60.5    1e-07   Cicer arietinum [garbanzo]
gb|KDP41487.1|  hypothetical protein JCGZ_15894                       60.1    1e-07   Jatropha curcas
ref|XP_009630023.1|  PREDICTED: NADPH--cytochrome P450 reductase      59.7    2e-07   Nicotiana tomentosiformis
ref|XP_003522768.1|  PREDICTED: NADPH--cytochrome P450 reductase      59.7    2e-07   Glycine max [soybeans]
dbj|BAC41516.1|  NADPH-cytochrome P-450 reductase                     59.7    2e-07   Ophiorrhiza pumila
ref|XP_009786522.1|  PREDICTED: NADPH--cytochrome P450 reductase      59.7    2e-07   Nicotiana sylvestris
ref|XP_003602898.1|  NADPH cytochrome P450 reductase                  59.3    2e-07   Medicago truncatula
sp|P37116.1|NCPR_VIGRR  RecName: Full=NADPH--cytochrome P450 redu...  58.9    3e-07   Vigna radiata var. radiata [golden gram]
pir||A47298  NADPH-ferrihemoprotein reductase (EC 1.6.2.4) - mung...  58.9    4e-07
emb|CAA81211.1|  NADPH-ferrihemoprotein reductase                     58.5    4e-07   Vicia sativa [spring vetch]
ref|XP_008219251.1|  PREDICTED: NADPH--cytochrome P450 reductase ...  57.8    7e-07   
ref|XP_008338958.1|  PREDICTED: NADPH--cytochrome P450 reductase      57.0    2e-06   Malus domestica [apple tree]
ref|XP_009791726.1|  PREDICTED: NADPH--cytochrome P450 reductase-...  56.6    2e-06   Nicotiana sylvestris
ref|XP_003526551.1|  PREDICTED: NADPH--cytochrome P450 reductase-...  56.6    2e-06   Glycine max [soybeans]
ref|XP_002265859.2|  PREDICTED: NADPH--cytochrome P450 reductase      56.6    2e-06   Vitis vinifera
ref|XP_009376208.1|  PREDICTED: NADPH--cytochrome P450 reductase      55.5    5e-06   Pyrus x bretschneideri [bai li]
ref|XP_004299743.1|  PREDICTED: NADPH--cytochrome P450 reductase      55.1    6e-06   Fragaria vesca subsp. vesca
ref|XP_011016946.1|  PREDICTED: LOW QUALITY PROTEIN: NADPH--cytoc...  54.7    8e-06   Populus euphratica
ref|XP_010530279.1|  PREDICTED: NADPH--cytochrome P450 reductase ...  54.3    1e-05   Tarenaya hassleriana [spider flower]
ref|XP_010086660.1|  NADPH--cytochrome P450 reductase                 54.3    1e-05   Morus notabilis
gb|AAZ39648.1|  cytochrome P450 NADPH-reductase                       53.9    2e-05   Petunia x hybrida [garden petunia]
gb|KHN39959.1|  NADPH--cytochrome P450 reductase                      53.1    2e-05   Glycine soja [wild soybean]
ref|NP_001236742.1|  NADPH:P450 reductase                             53.1    2e-05   
ref|XP_007226979.1|  hypothetical protein PRUPE_ppa002280mg           52.0    6e-05   Prunus persica
ref|XP_008219252.1|  PREDICTED: NADPH--cytochrome P450 reductase ...  52.0    6e-05   Prunus mume [ume]
gb|ACF35281.1|  cytochrome P450 reductase-like protein                51.2    1e-04   Nothapodytes nimmoniana
gb|EYU36460.1|  hypothetical protein MIMGU_mgv1a002296mg              51.2    1e-04   Erythranthe guttata [common monkey flower]
gb|KDO81198.1|  hypothetical protein CISIN_1g005496mg                 50.8    1e-04   Citrus sinensis [apfelsine]
gb|KDO81196.1|  hypothetical protein CISIN_1g005496mg                 50.8    1e-04   Citrus sinensis [apfelsine]
gb|KDO81193.1|  hypothetical protein CISIN_1g005496mg                 50.8    1e-04   Citrus sinensis [apfelsine]
gb|KDO81197.1|  hypothetical protein CISIN_1g005496mg                 50.8    1e-04   Citrus sinensis [apfelsine]
ref|XP_006472452.1|  PREDICTED: NADPH--cytochrome P450 reductase-...  50.8    1e-04   Citrus sinensis [apfelsine]
ref|XP_010520739.1|  PREDICTED: NADPH--cytochrome P450 reductase ...  50.8    1e-04   Tarenaya hassleriana [spider flower]
ref|XP_007018236.1|  NADPH--cytochrome P450 reductase isoform 3       50.1    2e-04   
ref|XP_007018237.1|  NADPH--cytochrome P450 reductase isoform 4       50.1    2e-04   
ref|XP_006433816.1|  hypothetical protein CICLE_v10000469mg           50.1    2e-04   Citrus clementina [clementine]
ref|XP_007018234.1|  P450 reductase 1 isoform 1                       50.1    2e-04   
gb|AIG15451.1|  NADPH-cytochrome P450 reductase 1                     48.5    7e-04   Azadirachta indica [Indian-lilac]



>emb|CDP11509.1| unnamed protein product [Coffea canephora]
Length=691

 Score = 64.7 bits (156),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 47/71 (66%), Positives = 55/71 (77%), Gaps = 3/71 (4%)
 Frame = +2

Query  278  LVRSLESALGVSLGNDtvvv--llttslavivGLLVFIWKRSGDRSKEVKPVVVPKAMTA  451
            L+RS+ESALGVSLG D   V  +LTTSLA IVGLLVF+WKRS DRSKE KP+V+ K  T+
Sbjct  7    LIRSIESALGVSLGEDGNQVLLVLTTSLAAIVGLLVFLWKRSSDRSKETKPLVITKLNTS  66

Query  452  DPEEDA-VVDP  481
             PEE+   VDP
Sbjct  67   VPEEEEDDVDP  77



>gb|AAS92623.1| NADPH:cytochrome P450-reductase [Centaurium erythraea]
Length=692

 Score = 64.7 bits (156),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 48/70 (69%), Positives = 55/70 (79%), Gaps = 3/70 (4%)
 Frame = +2

Query  278  LVRSLESALGVSLGNDtvvvl---lttslavivGLLVFIWKRSGDRSKEVKPVVVPKAMT  448
            LVRS+ESALGVSLG D   V+   LTTSLAVIVGL+VF+WKRS DRS+E K VVVPK +T
Sbjct  7    LVRSIESALGVSLGEDGDKVVILVLTTSLAVIVGLVVFLWKRSSDRSRETKSVVVPKLVT  66

Query  449  ADPEEDAVVD  478
            A  EE+  VD
Sbjct  67   ALQEEEEEVD  76



>ref|XP_007136327.1| hypothetical protein PHAVU_009G036200g [Phaseolus vulgaris]
 gb|ESW08321.1| hypothetical protein PHAVU_009G036200g [Phaseolus vulgaris]
Length=692

 Score = 63.2 bits (152),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 39/68 (57%), Positives = 56/68 (82%), Gaps = 3/68 (4%)
 Frame = +2

Query  278  LVRSLESALGVSLGN---DtvvvllttslavivGLLVFIWKRSGDRSKEVKPVVVPKAMT  448
            LVR++ES LGVSLG+   D+++++ TTS AV++GL+VF+WK+S DRSKEVKPV+VPK + 
Sbjct  7    LVRTVESLLGVSLGDSVSDSLLLIATTSAAVVIGLIVFLWKKSSDRSKEVKPVIVPKDLL  66

Query  449  ADPEEDAV  472
             + E+D V
Sbjct  67   MEEEDDEV  74



>gb|ACF17649.1| putative cytochrome reductase [Capsicum annuum]
 gb|AFV95075.1| cytochrome P450 reductase [Capsicum annuum]
Length=686

 Score = 62.4 bits (150),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 42/57 (74%), Positives = 50/57 (88%), Gaps = 0/57 (0%)
 Frame = +2

Query  278  LVRSLESALGVSLGNDtvvvllttslavivGLLVFIWKRSGDRSKEVKPVVVPKAMT  448
            LVRS+ESA+GVSLG+D V++LLTTS AVIVGL+VF  KRS DRSKEVKPVV PK++ 
Sbjct  7    LVRSIESAIGVSLGSDAVLMLLTTSFAVIVGLVVFFLKRSSDRSKEVKPVVFPKSLN  63



>ref|XP_006338052.1| PREDICTED: NADPH--cytochrome P450 reductase-like [Solanum tuberosum]
Length=686

 Score = 61.6 bits (148),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 44/56 (79%), Positives = 51/56 (91%), Gaps = 0/56 (0%)
 Frame = +2

Query  278  LVRSLESALGVSLGNDtvvvllttslavivGLLVFIWKRSGDRSKEVKPVVVPKAM  445
            L+RS+ESALGVSLG+DTV+VLLTTS AVIVGL+VF  KRS DRSKEVKPVV PK++
Sbjct  7    LLRSIESALGVSLGSDTVLVLLTTSFAVIVGLVVFFLKRSSDRSKEVKPVVFPKSL  62



>ref|XP_004238001.1| PREDICTED: NADPH--cytochrome P450 reductase [Solanum lycopersicum]
Length=686

 Score = 61.6 bits (148),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 44/56 (79%), Positives = 51/56 (91%), Gaps = 0/56 (0%)
 Frame = +2

Query  278  LVRSLESALGVSLGNDtvvvllttslavivGLLVFIWKRSGDRSKEVKPVVVPKAM  445
            L+RS+ESALGVSLG+DTV+VLLTTS AVIVGL+VF  KRS DRSKEVKPVV PK++
Sbjct  7    LLRSIESALGVSLGSDTVLVLLTTSFAVIVGLVVFFLKRSSDRSKEVKPVVFPKSL  62



>ref|XP_002514049.1| cytochrome P450, putative [Ricinus communis]
 gb|EEF48632.1| cytochrome P450, putative [Ricinus communis]
Length=692

 Score = 61.2 bits (147),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 43/67 (64%), Positives = 54/67 (81%), Gaps = 4/67 (6%)
 Frame = +2

Query  278  LVRSLESALGVSLG----NDtvvvllttslavivGLLVFIWKRSGDRSKEVKPVVVPKAM  445
            LVR +ES LGV LG    +D+VVV++TTS AVI+GLLVF+WKRS DRSKEV P+VVPK++
Sbjct  8    LVRYIESVLGVELGGSPMSDSVVVIITTSFAVIIGLLVFLWKRSSDRSKEVTPLVVPKSL  67

Query  446  TADPEED  466
            +   EED
Sbjct  68   SVKDEED  74



>ref|XP_004501653.1| PREDICTED: NADPH--cytochrome P450 reductase-like isoform X1 [Cicer 
arietinum]
Length=700

 Score = 60.8 bits (146),  Expect = 8e-08, Method: Compositional matrix adjust.
 Identities = 36/66 (55%), Positives = 56/66 (85%), Gaps = 3/66 (5%)
 Frame = +2

Query  278  LVRSLESALGVSLGN---DtvvvllttslavivGLLVFIWKRSGDRSKEVKPVVVPKAMT  448
            LVR++ES LGVSLG+   D++++++TTS AV++GLLVF+WK+S DRS E+KPV+VPK++ 
Sbjct  8    LVRTIESVLGVSLGDSVSDSLILIVTTSAAVVIGLLVFLWKKSSDRSNELKPVIVPKSLV  67

Query  449  ADPEED  466
             + ++D
Sbjct  68   KEEDDD  73



>gb|ADI49691.1| cytochrome P450 reductase [Withania somnifera]
Length=686

 Score = 60.5 bits (145),  Expect = 1e-07, Method: Composition-based stats.
 Identities = 39/56 (70%), Positives = 50/56 (89%), Gaps = 0/56 (0%)
 Frame = +2

Query  278  LVRSLESALGVSLGNDtvvvllttslavivGLLVFIWKRSGDRSKEVKPVVVPKAM  445
            LVRS+ES++GVSLG+D V++LLTTS AVIVGL+VF  KRS D+ KEVKPVV+PK++
Sbjct  7    LVRSIESSIGVSLGSDMVLMLLTTSFAVIVGLVVFFLKRSSDQRKEVKPVVLPKSL  62



>ref|XP_004501654.1| PREDICTED: NADPH--cytochrome P450 reductase-like isoform X2 [Cicer 
arietinum]
Length=692

 Score = 60.5 bits (145),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 36/66 (55%), Positives = 56/66 (85%), Gaps = 3/66 (5%)
 Frame = +2

Query  278  LVRSLESALGVSLGN---DtvvvllttslavivGLLVFIWKRSGDRSKEVKPVVVPKAMT  448
            LVR++ES LGVSLG+   D++++++TTS AV++GLLVF+WK+S DRS E+KPV+VPK++ 
Sbjct  8    LVRTIESVLGVSLGDSVSDSLILIVTTSAAVVIGLLVFLWKKSSDRSNELKPVIVPKSLV  67

Query  449  ADPEED  466
             + ++D
Sbjct  68   KEEDDD  73



>gb|KDP41487.1| hypothetical protein JCGZ_15894 [Jatropha curcas]
Length=689

 Score = 60.1 bits (144),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 42/66 (64%), Positives = 54/66 (82%), Gaps = 3/66 (5%)
 Frame = +2

Query  278  LVRSLESALGVSLG---NDtvvvllttslavivGLLVFIWKRSGDRSKEVKPVVVPKAMT  448
            LVR +ES LGVSLG    D++++++TTS+AVIVGL VF+ K+S DRSKEVKPVVVPK++T
Sbjct  5    LVRYVESVLGVSLGGSVTDSLLLIVTTSVAVIVGLFVFLLKKSSDRSKEVKPVVVPKSLT  64

Query  449  ADPEED  466
               EED
Sbjct  65   VKKEED  70



>ref|XP_009630023.1| PREDICTED: NADPH--cytochrome P450 reductase [Nicotiana tomentosiformis]
Length=686

 Score = 59.7 bits (143),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 43/56 (77%), Positives = 50/56 (89%), Gaps = 0/56 (0%)
 Frame = +2

Query  278  LVRSLESALGVSLGNDtvvvllttslavivGLLVFIWKRSGDRSKEVKPVVVPKAM  445
            LVRS+ESALGVSLG+DTV+VLLTTS AVIVGL+V   KRS DRSKEVKP+V PK++
Sbjct  7    LVRSIESALGVSLGSDTVLVLLTTSFAVIVGLVVLFLKRSSDRSKEVKPIVFPKSL  62



>ref|XP_003522768.1| PREDICTED: NADPH--cytochrome P450 reductase [Glycine max]
 gb|KHN08276.1| NADPH--cytochrome P450 reductase [Glycine soja]
Length=691

 Score = 59.7 bits (143),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 38/66 (58%), Positives = 54/66 (82%), Gaps = 3/66 (5%)
 Frame = +2

Query  278  LVRSLESALGVSLGN---DtvvvllttslavivGLLVFIWKRSGDRSKEVKPVVVPKAMT  448
            LVR++ES LGVSL +   D+++++ TTS AVI+GLLVF+WK+S DRSKEVKPV+VPK + 
Sbjct  7    LVRAVESLLGVSLADSVSDSLLLIATTSAAVIIGLLVFLWKKSSDRSKEVKPVIVPKGLP  66

Query  449  ADPEED  466
             D +++
Sbjct  67   KDEDDE  72



>dbj|BAC41516.1| NADPH-cytochrome P-450 reductase [Ophiorrhiza pumila]
Length=690

 Score = 59.7 bits (143),  Expect = 2e-07, Method: Composition-based stats.
 Identities = 38/52 (73%), Positives = 48/52 (92%), Gaps = 2/52 (4%)
 Frame = +2

Query  278  LVRSLESALGVSLGNDt--vvvllttslavivGLLVFIWKRSGDRSKEVKPV  427
            L+RS+ESALGVSLG+D   ++++LTTSLAVIVGLL+F+WKRSGDR KE+KPV
Sbjct  7    LIRSIESALGVSLGDDVNQILLVLTTSLAVIVGLLMFLWKRSGDRGKEIKPV  58



>ref|XP_009786522.1| PREDICTED: NADPH--cytochrome P450 reductase [Nicotiana sylvestris]
Length=686

 Score = 59.7 bits (143),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 43/56 (77%), Positives = 50/56 (89%), Gaps = 0/56 (0%)
 Frame = +2

Query  278  LVRSLESALGVSLGNDtvvvllttslavivGLLVFIWKRSGDRSKEVKPVVVPKAM  445
            LVRS+ESALGVSLG+DTV+VLLTTS AVIVGL+V   KRS DRSKEVKP+V PK++
Sbjct  7    LVRSIESALGVSLGSDTVLVLLTTSFAVIVGLVVLFLKRSSDRSKEVKPIVFPKSL  62



>ref|XP_003602898.1| NADPH cytochrome P450 reductase [Medicago truncatula]
 gb|AES73149.1| NADPH-cytochrome P450 family 2 reductase [Medicago truncatula]
Length=692

 Score = 59.3 bits (142),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 39/59 (66%), Positives = 53/59 (90%), Gaps = 3/59 (5%)
 Frame = +2

Query  278  LVRSLESALGVSLGN---DtvvvllttslavivGLLVFIWKRSGDRSKEVKPVVVPKAM  445
            LVR++ES LGVSLG+   D+VV+++TTS AVI+GLLVF+WK+S DRSKE+KPV+VPK++
Sbjct  8    LVRTIESVLGVSLGDSVSDSVVLIVTTSAAVIIGLLVFLWKKSSDRSKELKPVIVPKSL  66



>sp|P37116.1|NCPR_VIGRR RecName: Full=NADPH--cytochrome P450 reductase; Short=CPR; Short=P450R 
[Vigna radiata var. radiata]
 gb|AAA34240.1| NADPH cytochrome P450 [Vigna radiata]
Length=690

 Score = 58.9 bits (141),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 38/57 (67%), Positives = 50/57 (88%), Gaps = 3/57 (5%)
 Frame = +2

Query  278  LVRSLESALGVSLGN---DtvvvllttslavivGLLVFIWKRSGDRSKEVKPVVVPK  439
            LVR++ES LGVSLG+   D+++++ TTS AV+VGLLVF+WK+S DRSKEVKPVVVP+
Sbjct  7    LVRAVESFLGVSLGDSVSDSLLLIATTSAAVVVGLLVFLWKKSSDRSKEVKPVVVPR  63



>pir||A47298 NADPH-ferrihemoprotein reductase (EC 1.6.2.4) - mung bean
Length=690

 Score = 58.9 bits (141),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 38/57 (67%), Positives = 50/57 (88%), Gaps = 3/57 (5%)
 Frame = +2

Query  278  LVRSLESALGVSLGN---DtvvvllttslavivGLLVFIWKRSGDRSKEVKPVVVPK  439
            LVR++ES LGVSLG+   D+++++ TTS AV+VGLLVF+WK+S DRSKEVKPVVVP+
Sbjct  7    LVRAVESFLGVSLGDSVSDSLLLIATTSAAVVVGLLVFLWKKSSDRSKEVKPVVVPR  63



>emb|CAA81211.1| NADPH-ferrihemoprotein reductase [Vicia sativa]
Length=692

 Score = 58.5 bits (140),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 40/68 (59%), Positives = 56/68 (82%), Gaps = 4/68 (6%)
 Frame = +2

Query  278  LVRSLESALGVSLGN---DtvvvllttslavivGLLVFIWKRSGDRSKEVKPVVVPKAMT  448
            LVR++ESALG+SLG+   D+VV++ TTS AVI+GLLVF+W++S DRS+E++PV+VPK  T
Sbjct  8    LVRTIESALGISLGDSVSDSVVIIATTSAAVIIGLLVFLWRKSPDRSRELRPVIVPK-FT  66

Query  449  ADPEEDAV  472
               E+D V
Sbjct  67   VKHEDDEV  74



>ref|XP_008219251.1| PREDICTED: NADPH--cytochrome P450 reductase isoform X1 [Prunus 
mume]
Length=728

 Score = 57.8 bits (138),  Expect = 7e-07, Method: Composition-based stats.
 Identities = 38/66 (58%), Positives = 49/66 (74%), Gaps = 3/66 (5%)
 Frame = +2

Query  278  LVRSLESALGVSLG---NDtvvvllttslavivGLLVFIWKRSGDRSKEVKPVVVPKAMT  448
            LV  LESALGVS G    D+VVV+ TTS+A+I+G+LV +W+RS DRS+EVK + VPK + 
Sbjct  7    LVSMLESALGVSFGGSVTDSVVVIATTSVALILGVLVLVWRRSSDRSREVKQLAVPKPLV  66

Query  449  ADPEED  466
               EED
Sbjct  67   VKDEED  72



>ref|XP_008338958.1| PREDICTED: NADPH--cytochrome P450 reductase [Malus domestica]
Length=692

 Score = 57.0 bits (136),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 40/66 (61%), Positives = 53/66 (80%), Gaps = 3/66 (5%)
 Frame = +2

Query  278  LVRSLESALGVSLG---NDtvvvllttslavivGLLVFIWKRSGDRSKEVKPVVVPKAMT  448
            LVR+LESALGVS G    DTVVV+ TTS+A+I+G+LV +W+RS DRS+EVK +VVPK + 
Sbjct  7    LVRALESALGVSFGGSVTDTVVVIATTSIALIIGVLVLVWRRSSDRSREVKQLVVPKPLA  66

Query  449  ADPEED  466
             + E+D
Sbjct  67   VEEEKD  72



>ref|XP_009791726.1| PREDICTED: NADPH--cytochrome P450 reductase-like [Nicotiana sylvestris]
Length=686

 Score = 56.6 bits (135),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 40/56 (71%), Positives = 48/56 (86%), Gaps = 0/56 (0%)
 Frame = +2

Query  278  LVRSLESALGVSLGNDtvvvllttslavivGLLVFIWKRSGDRSKEVKPVVVPKAM  445
            LVRS+ES LGVSLG+DTV+VLLT S AVIVGL+V   KRS DRSKEVKP++ PK++
Sbjct  7    LVRSIESELGVSLGSDTVLVLLTMSFAVIVGLVVLFLKRSSDRSKEVKPIMFPKSL  62



>ref|XP_003526551.1| PREDICTED: NADPH--cytochrome P450 reductase-like [Glycine max]
 gb|KHN08988.1| NADPH--cytochrome P450 reductase [Glycine soja]
Length=691

 Score = 56.6 bits (135),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 35/59 (59%), Positives = 50/59 (85%), Gaps = 3/59 (5%)
 Frame = +2

Query  278  LVRSLESALGVSLGN---DtvvvllttslavivGLLVFIWKRSGDRSKEVKPVVVPKAM  445
            LVR++ES LGVSL +   D+++++ TTS A+I+GLLVF+WK+S DRSKE+KPV+VPK +
Sbjct  7    LVRAVESLLGVSLADSVSDSLLLIATTSAALIIGLLVFLWKKSSDRSKELKPVIVPKGL  65



>ref|XP_002265859.2| PREDICTED: NADPH--cytochrome P450 reductase [Vitis vinifera]
 emb|CBI19275.3| unnamed protein product [Vitis vinifera]
Length=688

 Score = 56.6 bits (135),  Expect = 2e-06, Method: Composition-based stats.
 Identities = 32/56 (57%), Positives = 50/56 (89%), Gaps = 0/56 (0%)
 Frame = +2

Query  278  LVRSLESALGVSLGNDtvvvllttslavivGLLVFIWKRSGDRSKEVKPVVVPKAM  445
            L+ ++E+ LGVSLG+++ VV+LTT++AVI+GLL+F+W+ S DR ++VKP+VVPKA+
Sbjct  7    LINTVEAFLGVSLGSESAVVILTTTVAVILGLLIFVWRISSDRGRDVKPLVVPKAV  62



>ref|XP_009376208.1| PREDICTED: NADPH--cytochrome P450 reductase [Pyrus x bretschneideri]
Length=692

 Score = 55.5 bits (132),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 40/66 (61%), Positives = 51/66 (77%), Gaps = 3/66 (5%)
 Frame = +2

Query  278  LVRSLESALGVSLG---NDtvvvllttslavivGLLVFIWKRSGDRSKEVKPVVVPKAMT  448
            LVR+LES LGVS G    DTVVV+ TTS+A+I+G+LV +W+RS DRS+EVK +VVPK + 
Sbjct  7    LVRALESVLGVSFGGSVTDTVVVIATTSIALIIGVLVLVWRRSSDRSREVKQLVVPKPLE  66

Query  449  ADPEED  466
               EED
Sbjct  67   VKEEED  72



>ref|XP_004299743.1| PREDICTED: NADPH--cytochrome P450 reductase [Fragaria vesca subsp. 
vesca]
Length=689

 Score = 55.1 bits (131),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 38/66 (58%), Positives = 49/66 (74%), Gaps = 3/66 (5%)
 Frame = +2

Query  278  LVRSLESALGVSLG---NDtvvvllttslavivGLLVFIWKRSGDRSKEVKPVVVPKAMT  448
            LVR LESALGVS G    DT V++ TTS+A+I+G+LV +W+RS DRS+E K + VPKA+ 
Sbjct  7    LVRKLESALGVSFGESVTDTAVLIATTSIALIIGVLVVLWRRSSDRSREFKQLAVPKAVV  66

Query  449  ADPEED  466
               EED
Sbjct  67   VKEEED  72



>ref|XP_011016946.1| PREDICTED: LOW QUALITY PROTEIN: NADPH--cytochrome P450 reductase-like 
[Populus euphratica]
Length=692

 Score = 54.7 bits (130),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 41/66 (62%), Positives = 52/66 (79%), Gaps = 3/66 (5%)
 Frame = +2

Query  278  LVRSLESALGVSLGN---DtvvvllttslavivGLLVFIWKRSGDRSKEVKPVVVPKAMT  448
            LVR +ES LGVS G+   D+VVV++TTS AV+ GL+VFI KRS DRSK VKP+VVPK+++
Sbjct  8    LVRFVESVLGVSFGDSVSDSVVVIITTSFAVVFGLVVFISKRSSDRSKVVKPLVVPKSLS  67

Query  449  ADPEED  466
               EED
Sbjct  68   VKDEED  73



>ref|XP_010530279.1| PREDICTED: NADPH--cytochrome P450 reductase 1-like [Tarenaya 
hassleriana]
Length=694

 Score = 54.3 bits (129),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 40/68 (59%), Positives = 52/68 (76%), Gaps = 5/68 (7%)
 Frame = +2

Query  278  LVRSLESALGVSLGN----DtvvvllttslavivGLLVFIWKRSG-DRSKEVKPVVVPKA  442
            LVR LESALG+SLG+    D  +V+ TTSLAVIVG  V +W+++  DRS+EVKPVVVPK+
Sbjct  10   LVRYLESALGISLGDSVSDDVALVIATTSLAVIVGFAVLLWRKTATDRSREVKPVVVPKS  69

Query  443  MTADPEED  466
            + A  E+D
Sbjct  70   LMAKDEDD  77



>ref|XP_010086660.1| NADPH--cytochrome P450 reductase [Morus notabilis]
 gb|EXB22547.1| NADPH--cytochrome P450 reductase [Morus notabilis]
Length=687

 Score = 54.3 bits (129),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 37/65 (57%), Positives = 52/65 (80%), Gaps = 1/65 (2%)
 Frame = +2

Query  278  LVRSLESALGVSLGNDtvvvllttslavivGLLVFIWKRSGDRSKEVKPVVVPKAMTADP  457
            LVR+LES LGV +  D+V+V+ TT++A+I+GLLV +W+RS DRS+EVKPVVVPK +    
Sbjct  7    LVRTLESLLGVPV-TDSVIVIATTAVALILGLLVLVWRRSSDRSREVKPVVVPKPLLVKD  65

Query  458  EEDAV  472
            E++ V
Sbjct  66   EDNEV  70



>gb|AAZ39648.1| cytochrome P450 NADPH-reductase [Petunia x hybrida]
Length=687

 Score = 53.9 bits (128),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 38/57 (67%), Positives = 47/57 (82%), Gaps = 0/57 (0%)
 Frame = +2

Query  278  LVRSLESALGVSLGNDtvvvllttslavivGLLVFIWKRSGDRSKEVKPVVVPKAMT  448
            L +S+ESA GVSL  DT++VLLTTS A+IVGL+VF+ KRS DRSKEVKPVV  K++ 
Sbjct  8    LFKSIESAFGVSLSTDTLIVLLTTSFALIVGLIVFLLKRSSDRSKEVKPVVFTKSLN  64



>gb|KHN39959.1| NADPH--cytochrome P450 reductase [Glycine soja]
Length=689

 Score = 53.1 bits (126),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 36/66 (55%), Positives = 53/66 (80%), Gaps = 2/66 (3%)
 Frame = +2

Query  278  LVRSL-ESALGVSLGNDtvvvllttslavivGLLVFIWKRSGDRSKEVKPVVVPKAMTAD  454
            LVR++ ES LGVS+ +D+V+V+  TS+A+++GLLVF+W++S DRSKE KP+ VPK +  +
Sbjct  7    LVRTVVESVLGVSV-SDSVMVIAATSVALVIGLLVFVWRKSSDRSKEQKPLAVPKLLVKE  65

Query  455  PEEDAV  472
             EED V
Sbjct  66   DEEDEV  71



>ref|NP_001236742.1| NADPH:P450 reductase [Glycine max]
 gb|AAN85869.1| NADPH:P450 reductase [Glycine max]
Length=689

 Score = 53.1 bits (126),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 36/66 (55%), Positives = 53/66 (80%), Gaps = 2/66 (3%)
 Frame = +2

Query  278  LVRSL-ESALGVSLGNDtvvvllttslavivGLLVFIWKRSGDRSKEVKPVVVPKAMTAD  454
            LVR++ ES LGVS+ +D+V+V+  TS+A+++GLLVF+W++S DRSKE KP+ VPK +  +
Sbjct  7    LVRTVVESVLGVSV-SDSVMVIAATSVALVIGLLVFVWRKSSDRSKEQKPLAVPKLLVKE  65

Query  455  PEEDAV  472
             EED V
Sbjct  66   DEEDEV  71



>ref|XP_007226979.1| hypothetical protein PRUPE_ppa002280mg [Prunus persica]
 gb|EMJ28178.1| hypothetical protein PRUPE_ppa002280mg [Prunus persica]
Length=692

 Score = 52.0 bits (123),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 38/66 (58%), Positives = 49/66 (74%), Gaps = 3/66 (5%)
 Frame = +2

Query  278  LVRSLESALGVSLG---NDtvvvllttslavivGLLVFIWKRSGDRSKEVKPVVVPKAMT  448
            LV  LESALGVS G    D+VVV+ TTS+A+I+G+LV +W+RS DRS+EVK + VPK + 
Sbjct  7    LVSMLESALGVSFGGSVTDSVVVIATTSVALILGVLVLVWRRSSDRSREVKQLAVPKPLV  66

Query  449  ADPEED  466
               EED
Sbjct  67   VKDEED  72



>ref|XP_008219252.1| PREDICTED: NADPH--cytochrome P450 reductase isoform X2 [Prunus 
mume]
Length=692

 Score = 52.0 bits (123),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 38/66 (58%), Positives = 49/66 (74%), Gaps = 3/66 (5%)
 Frame = +2

Query  278  LVRSLESALGVSLG---NDtvvvllttslavivGLLVFIWKRSGDRSKEVKPVVVPKAMT  448
            LV  LESALGVS G    D+VVV+ TTS+A+I+G+LV +W+RS DRS+EVK + VPK + 
Sbjct  7    LVSMLESALGVSFGGSVTDSVVVIATTSVALILGVLVLVWRRSSDRSREVKQLAVPKPLV  66

Query  449  ADPEED  466
               EED
Sbjct  67   VKDEED  72



>gb|ACF35281.1| cytochrome P450 reductase-like protein [Nothapodytes nimmoniana]
Length=692

 Score = 51.2 bits (121),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 39/63 (62%), Positives = 49/63 (78%), Gaps = 4/63 (6%)
 Frame = +2

Query  278  LVRSLESALGVSLG---NDtvvvllttslavivGLLVFIWKRSGDRSKEV-KPVVVPKAM  445
            L+R +ES  GVS G   +DTVV++ TTS+AVI GLLVF+WKRS ++S EV KPVVVPKA+
Sbjct  7    LIRWIESMFGVSFGESVSDTVVLIATTSVAVITGLLVFLWKRSSNQSTEVKKPVVVPKAL  66

Query  446  TAD  454
              D
Sbjct  67   QLD  69



>gb|EYU36460.1| hypothetical protein MIMGU_mgv1a002296mg [Erythranthe guttata]
Length=690

 Score = 51.2 bits (121),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 39/59 (66%), Positives = 48/59 (81%), Gaps = 2/59 (3%)
 Frame = +2

Query  278  LVRS-LESALGVSLGNDtvvvllttslavivGLLVFIWKR-SGDRSKEVKPVVVPKAMT  448
            LVRS +E  LGV LG++T V++LTTS A+I+GLL+FIWKR SGD SK  KPVVVPK +T
Sbjct  7    LVRSSVEQVLGVKLGDETAVLVLTTSAALILGLLIFIWKRSSGDLSKAAKPVVVPKLVT  65



>gb|KDO81198.1| hypothetical protein CISIN_1g005496mg [Citrus sinensis]
Length=599

 Score = 50.8 bits (120),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 40/67 (60%), Positives = 53/67 (79%), Gaps = 4/67 (6%)
 Frame = +2

Query  278  LVRSLESALGVSLGN---DtvvvllttslavivGLLVFIWKRSG-DRSKEVKPVVVPKAM  445
            LV+ +ESALGVSLG+   DTV+++ TTS AV++GLLV +WK+S  DRSKEVKPVV  K +
Sbjct  9    LVKFVESALGVSLGDSVTDTVILIATTSFAVVIGLLVLVWKKSSSDRSKEVKPVVPLKPL  68

Query  446  TADPEED  466
            +A  E+D
Sbjct  69   SAKDEDD  75



>gb|KDO81196.1| hypothetical protein CISIN_1g005496mg [Citrus sinensis]
Length=669

 Score = 50.8 bits (120),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 40/67 (60%), Positives = 53/67 (79%), Gaps = 4/67 (6%)
 Frame = +2

Query  278  LVRSLESALGVSLGN---DtvvvllttslavivGLLVFIWKRSG-DRSKEVKPVVVPKAM  445
            LV+ +ESALGVSLG+   DTV+++ TTS AV++GLLV +WK+S  DRSKEVKPVV  K +
Sbjct  9    LVKFVESALGVSLGDSVTDTVILIATTSFAVVIGLLVLVWKKSSSDRSKEVKPVVPLKPL  68

Query  446  TADPEED  466
            +A  E+D
Sbjct  69   SAKDEDD  75



>gb|KDO81193.1| hypothetical protein CISIN_1g005496mg [Citrus sinensis]
Length=694

 Score = 50.8 bits (120),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 40/67 (60%), Positives = 53/67 (79%), Gaps = 4/67 (6%)
 Frame = +2

Query  278  LVRSLESALGVSLGN---DtvvvllttslavivGLLVFIWKRSG-DRSKEVKPVVVPKAM  445
            LV+ +ESALGVSLG+   DTV+++ TTS AV++GLLV +WK+S  DRSKEVKPVV  K +
Sbjct  9    LVKFVESALGVSLGDSVTDTVILIATTSFAVVIGLLVLVWKKSSSDRSKEVKPVVPLKPL  68

Query  446  TADPEED  466
            +A  E+D
Sbjct  69   SAKDEDD  75



>gb|KDO81197.1| hypothetical protein CISIN_1g005496mg [Citrus sinensis]
Length=635

 Score = 50.8 bits (120),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 40/67 (60%), Positives = 53/67 (79%), Gaps = 4/67 (6%)
 Frame = +2

Query  278  LVRSLESALGVSLGN---DtvvvllttslavivGLLVFIWKRSG-DRSKEVKPVVVPKAM  445
            LV+ +ESALGVSLG+   DTV+++ TTS AV++GLLV +WK+S  DRSKEVKPVV  K +
Sbjct  9    LVKFVESALGVSLGDSVTDTVILIATTSFAVVIGLLVLVWKKSSSDRSKEVKPVVPLKPL  68

Query  446  TADPEED  466
            +A  E+D
Sbjct  69   SAKDEDD  75



>ref|XP_006472452.1| PREDICTED: NADPH--cytochrome P450 reductase-like [Citrus sinensis]
Length=694

 Score = 50.8 bits (120),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 40/67 (60%), Positives = 53/67 (79%), Gaps = 4/67 (6%)
 Frame = +2

Query  278  LVRSLESALGVSLGN---DtvvvllttslavivGLLVFIWKRSG-DRSKEVKPVVVPKAM  445
            LV+ +ESALGVSLG+   DTV+++ TTS AV++GLLV +WK+S  DRSKEVKPVV  K +
Sbjct  9    LVKFVESALGVSLGDSVTDTVILIATTSFAVVIGLLVLVWKKSSSDRSKEVKPVVPLKPL  68

Query  446  TADPEED  466
            +A  E+D
Sbjct  69   SAKDEDD  75



>ref|XP_010520739.1| PREDICTED: NADPH--cytochrome P450 reductase 1-like [Tarenaya 
hassleriana]
Length=694

 Score = 50.8 bits (120),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 37/68 (54%), Positives = 51/68 (75%), Gaps = 5/68 (7%)
 Frame = +2

Query  278  LVRSLESALGVSLGN----DtvvvllttslavivGLLVFIWKRSG-DRSKEVKPVVVPKA  442
            LVR LESALG+SLG+    D  +V+ TTSLAVIVG  V +W+++  DRS+E+KPV VP++
Sbjct  10   LVRYLESALGISLGDSVSDDAALVIATTSLAVIVGFAVLLWRKTAADRSREMKPVTVPQS  69

Query  443  MTADPEED  466
            + A  E+D
Sbjct  70   LMAKDEDD  77



>ref|XP_007018236.1| NADPH--cytochrome P450 reductase isoform 3 [Theobroma cacao]
 gb|EOY15461.1| NADPH--cytochrome P450 reductase isoform 3 [Theobroma cacao]
Length=736

 Score = 50.1 bits (118),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 39/72 (54%), Positives = 56/72 (78%), Gaps = 6/72 (8%)
 Frame = +2

Query  278  LVRSLESALGVSLG---NDtvvvllttslavivGLLVFIWKRSG-DRSKEVKPVVVPK--  439
            LVR +ES LGVSLG    D+++V+ TTSLAVI+GLLVF+WK+S  +RS ++KP+V PK  
Sbjct  7    LVRFVESVLGVSLGGSVTDSMIVIATTSLAVILGLLVFLWKKSASERSHDIKPLVTPKPI  66

Query  440  AMTADPEEDAVV  475
            ++  D ++DAV+
Sbjct  67   SLKDDEDDDAVI  78



>ref|XP_007018237.1| NADPH--cytochrome P450 reductase isoform 4 [Theobroma cacao]
 gb|EOY15462.1| NADPH--cytochrome P450 reductase isoform 4 [Theobroma cacao]
Length=517

 Score = 50.1 bits (118),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 39/72 (54%), Positives = 56/72 (78%), Gaps = 6/72 (8%)
 Frame = +2

Query  278  LVRSLESALGVSLG---NDtvvvllttslavivGLLVFIWKRSG-DRSKEVKPVVVPK--  439
            LVR +ES LGVSLG    D+++V+ TTSLAVI+GLLVF+WK+S  +RS ++KP+V PK  
Sbjct  7    LVRFVESVLGVSLGGSVTDSMIVIATTSLAVILGLLVFLWKKSASERSHDIKPLVTPKPI  66

Query  440  AMTADPEEDAVV  475
            ++  D ++DAV+
Sbjct  67   SLKDDEDDDAVI  78



>ref|XP_006433816.1| hypothetical protein CICLE_v10000469mg [Citrus clementina]
 gb|ESR47056.1| hypothetical protein CICLE_v10000469mg [Citrus clementina]
Length=694

 Score = 50.1 bits (118),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 39/67 (58%), Positives = 52/67 (78%), Gaps = 4/67 (6%)
 Frame = +2

Query  278  LVRSLESALGVSLGN---DtvvvllttslavivGLLVFIWKRSG-DRSKEVKPVVVPKAM  445
            LV+ +ESALG+SLG+   DTV+++ TTS AV +GLLV +WK+S  DRSKEVKPVV  K +
Sbjct  9    LVKFVESALGLSLGDSVTDTVILIATTSFAVAIGLLVLVWKKSSSDRSKEVKPVVPLKPL  68

Query  446  TADPEED  466
            +A  E+D
Sbjct  69   SAKDEDD  75



>ref|XP_007018234.1| P450 reductase 1 isoform 1 [Theobroma cacao]
 gb|EOY15459.1| P450 reductase 1 isoform 1 [Theobroma cacao]
Length=693

 Score = 50.1 bits (118),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 39/72 (54%), Positives = 56/72 (78%), Gaps = 6/72 (8%)
 Frame = +2

Query  278  LVRSLESALGVSLG---NDtvvvllttslavivGLLVFIWKRSG-DRSKEVKPVVVPK--  439
            LVR +ES LGVSLG    D+++V+ TTSLAVI+GLLVF+WK+S  +RS ++KP+V PK  
Sbjct  7    LVRFVESVLGVSLGGSVTDSMIVIATTSLAVILGLLVFLWKKSASERSHDIKPLVTPKPI  66

Query  440  AMTADPEEDAVV  475
            ++  D ++DAV+
Sbjct  67   SLKDDEDDDAVI  78



>gb|AIG15451.1| NADPH-cytochrome P450 reductase 1 [Azadirachta indica]
Length=695

 Score = 48.5 bits (114),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 36/54 (67%), Positives = 44/54 (81%), Gaps = 3/54 (6%)
 Frame = +2

Query  278  LVRSLESALGVSLGN---DtvvvllttslavivGLLVFIWKRSGDRSKEVKPVV  430
            LV+ +ESALGVSLG+   DTV+V+ TT  AV++GLLV  WK+S DRSKEVKPVV
Sbjct  10   LVKFVESALGVSLGSSVTDTVIVIATTLFAVVIGLLVLAWKKSSDRSKEVKPVV  63



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 564765596140