BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFF037C09

Length=501
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

emb|CDP02087.1|  unnamed protein product                                152   2e-45   Coffea canephora [robusta coffee]
ref|XP_006338583.1|  PREDICTED: polyribonucleotide nucleotidyltra...    152   2e-45   Solanum tuberosum [potatoes]
ref|XP_009614932.1|  PREDICTED: polyribonucleotide nucleotidyltra...    150   3e-45   Nicotiana tomentosiformis
ref|XP_009768206.1|  PREDICTED: polyribonucleotide nucleotidyltra...    148   9e-45   Nicotiana sylvestris
ref|XP_010316293.1|  PREDICTED: polyribonucleotide nucleotidyltra...    152   1e-44   Solanum lycopersicum
ref|XP_008341437.1|  PREDICTED: LOW QUALITY PROTEIN: polyribonucl...    138   1e-42   
ref|XP_007217697.1|  hypothetical protein PRUPE_ppa000918mg             138   2e-42   Prunus persica
ref|XP_009377194.1|  PREDICTED: polyribonucleotide nucleotidyltra...    138   3e-42   
ref|XP_008230570.1|  PREDICTED: polyribonucleotide nucleotidyltra...    135   2e-41   Prunus mume [ume]
ref|XP_008443548.1|  PREDICTED: polyribonucleotide nucleotidyltra...    136   6e-41   Cucumis melo [Oriental melon]
ref|XP_006470281.1|  PREDICTED: polyribonucleotide nucleotidyltra...    132   4e-40   Citrus sinensis [apfelsine]
gb|KDO55206.1|  hypothetical protein CISIN_1g002054mg                   132   4e-40   Citrus sinensis [apfelsine]
ref|XP_006446552.1|  hypothetical protein CICLE_v10014159mg             132   4e-40   Citrus clementina [clementine]
ref|XP_010248545.1|  PREDICTED: polyribonucleotide nucleotidyltra...    135   5e-40   Nelumbo nucifera [Indian lotus]
ref|XP_010248546.1|  PREDICTED: polyribonucleotide nucleotidyltra...    135   6e-40   Nelumbo nucifera [Indian lotus]
ref|XP_004304642.1|  PREDICTED: polyribonucleotide nucleotidyltra...    130   9e-40   Fragaria vesca subsp. vesca
ref|XP_004164730.1|  PREDICTED: LOW QUALITY PROTEIN: polyribonucl...    130   1e-39   
ref|XP_011047330.1|  PREDICTED: polyribonucleotide nucleotidyltra...    129   2e-39   Populus euphratica
ref|XP_004141096.1|  PREDICTED: polyribonucleotide nucleotidyltra...    129   2e-39   Cucumis sativus [cucumbers]
ref|XP_002300042.2|  hypothetical protein POPTR_0001s35070g             128   3e-39   
ref|XP_010108800.1|  Polyribonucleotide nucleotidyltransferase          135   9e-39   
ref|XP_002524669.1|  polyribonucleotide nucleotidyltransferase, p...    125   1e-38   Ricinus communis
gb|KDP45314.1|  hypothetical protein JCGZ_09563                         127   2e-38   Jatropha curcas
ref|XP_010660886.1|  PREDICTED: polyribonucleotide nucleotidyltra...    127   2e-38   Vitis vinifera
ref|XP_010940149.1|  PREDICTED: polyribonucleotide nucleotidyltra...    126   4e-38   Elaeis guineensis
ref|XP_007151009.1|  hypothetical protein PHAVU_004G011100g             117   5e-36   Phaseolus vulgaris [French bean]
ref|XP_010420100.1|  PREDICTED: polyribonucleotide nucleotidyltra...    121   5e-35   Camelina sativa [gold-of-pleasure]
ref|NP_196962.1|  polyribonucleotide nucleotidyltransferase             120   9e-35   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010550151.1|  PREDICTED: polyribonucleotide nucleotidyltra...    119   9e-35   Tarenaya hassleriana [spider flower]
ref|XP_010453582.1|  PREDICTED: polyribonucleotide nucleotidyltra...    120   1e-34   Camelina sativa [gold-of-pleasure]
ref|XP_010492266.1|  PREDICTED: polyribonucleotide nucleotidyltra...    121   1e-34   Camelina sativa [gold-of-pleasure]
ref|XP_006399970.1|  hypothetical protein EUTSA_v10012572mg             122   1e-34   Eutrema salsugineum [saltwater cress]
ref|XP_007031537.1|  Polyribonucleotide nucleotidyltransferase, p...    111   2e-34   
ref|XP_002873678.1|  hypothetical protein ARALYDRAFT_488299             118   2e-34   
ref|XP_011098446.1|  PREDICTED: polyribonucleotide nucleotidyltra...    116   5e-34   Sesamum indicum [beniseed]
ref|XP_006289585.1|  hypothetical protein CARUB_v10003135mg             115   9e-34   Capsella rubella
gb|KFK25698.1|  hypothetical protein AALP_AA8G147400                    119   9e-34   Arabis alpina [alpine rockcress]
ref|XP_008796014.1|  PREDICTED: LOW QUALITY PROTEIN: polyribonucl...    112   1e-33   
gb|EYU44773.1|  hypothetical protein MIMGU_mgv1a001063mg                110   2e-32   Erythranthe guttata [common monkey flower]
ref|XP_009131416.1|  PREDICTED: polyribonucleotide nucleotidyltra...    117   6e-32   Brassica rapa
emb|CDX78584.1|  BnaA03g04960D                                          117   6e-32   
emb|CDX69573.1|  BnaA10g19220D                                          114   6e-32   
emb|CDX70572.1|  BnaC03g06560D                                          117   9e-32   
gb|KJB33815.1|  hypothetical protein B456_006G032100                    103   2e-31   Gossypium raimondii
gb|KJB33814.1|  hypothetical protein B456_006G032100                    103   2e-31   Gossypium raimondii
gb|KJB33816.1|  hypothetical protein B456_006G032100                    102   2e-31   Gossypium raimondii
ref|XP_009121656.1|  PREDICTED: polyribonucleotide nucleotidyltra...    112   2e-31   Brassica rapa
emb|CDY09870.1|  BnaC09g42910D                                          111   8e-31   Brassica napus [oilseed rape]
ref|XP_010033299.1|  PREDICTED: polyribonucleotide nucleotidyltra...  99.0    7e-29   Eucalyptus grandis [rose gum]
ref|XP_010665719.1|  PREDICTED: polyribonucleotide nucleotidyltra...  98.6    8e-28   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_009375164.1|  PREDICTED: polyribonucleotide nucleotidyltra...  89.4    3e-27   Pyrus x bretschneideri [bai li]
ref|XP_003554809.1|  PREDICTED: polyribonucleotide nucleotidyltra...  91.3    3e-27   Glycine max [soybeans]
emb|CBI34890.3|  unnamed protein product                              86.7    4e-26   Vitis vinifera
ref|XP_004489245.1|  PREDICTED: polyribonucleotide nucleotidyltra...  84.3    6e-24   Cicer arietinum [garbanzo]
ref|XP_009380405.1|  PREDICTED: polyribonucleotide nucleotidyltra...  79.0    1e-23   Musa acuminata subsp. malaccensis [pisang utan]
gb|EMS68952.1|  Polyribonucleotide nucleotidyltransferase             78.6    1e-22   Triticum urartu
ref|XP_008643478.1|  PREDICTED: uncharacterized protein LOC100279...  77.4    2e-21   
ref|XP_006833262.1|  hypothetical protein AMTR_s00113p00140210        63.5    8e-18   
gb|EPS73358.1|  hypothetical protein M569_01398                       64.3    1e-17   Genlisea aurea
gb|AES74396.2|  polyribonucleotide nucleotidyltransferase             65.9    4e-17   Medicago truncatula
sp|Q6KAI0.1|PNP2_ORYSJ  RecName: Full=Polyribonucleotide nucleoti...  79.3    8e-14   Oryza sativa Japonica Group [Japonica rice]
gb|EEC73607.1|  hypothetical protein OsI_08089                        79.3    8e-14   Oryza sativa Indica Group [Indian rice]
ref|XP_010235710.1|  PREDICTED: polyribonucleotide nucleotidyltra...  79.0    1e-13   Brachypodium distachyon [annual false brome]
ref|XP_006648841.1|  PREDICTED: polyribonucleotide nucleotidyltra...  77.4    3e-13   Oryza brachyantha
ref|XP_002454178.1|  hypothetical protein SORBIDRAFT_04g026110        77.4    4e-13   Sorghum bicolor [broomcorn]
ref|XP_001782634.1|  predicted protein                                52.8    6e-12   
ref|WP_041067289.1|  polynucleotide phosphorylase/polyadenylase       50.4    1e-10   Thiolapillus brandeum
gb|AAF83052.1|AE003877_7  polynucleotide phosphorylase                52.0    2e-10   Xylella fastidiosa 9a5c
gb|ETE24598.1|  polynucleotide phosphorylase/polyadenylase            52.0    2e-10   
ref|WP_031337508.1|  polynucleotide phosphorylase/polyadenylase       50.8    4e-10   Xylella fastidiosa
ref|WP_031336189.1|  polynucleotide phosphorylase/polyadenylase       50.8    4e-10   Xylella fastidiosa
ref|WP_006474939.1|  polyribonucleotide nucleotidyltransferase        48.1    6e-10   endosymbiont of Tevnia jerichonana
ref|WP_014238841.1|  polynucleotide phosphorylase                     50.4    1e-09   Azospirillum brasilense
ref|WP_035670107.1|  polynucleotide phosphorylase/polyadenylase       50.1    1e-09   Azospirillum
ref|WP_038530324.1|  polynucleotide phosphorylase/polyadenylase       50.4    1e-09   Azospirillum brasilense
gb|AAO28089.1|  polynucleotide phosphorylase                          49.7    1e-09   Xylella fastidiosa Temecula1
ref|WP_029010755.1|  polynucleotide phosphorylase/polyadenylase       49.7    1e-09   Azospirillum halopraeferens
ref|WP_012337582.1|  polynucleotide phosphorylase/polyadenylase       48.9    2e-09   Xylella fastidiosa
ref|WP_012382430.1|  polynucleotide phosphorylase/polyadenylase       48.9    2e-09   Xylella fastidiosa
ref|WP_020851437.1|  Polyribonucleotide nucleotidyltransferase        48.9    2e-09   Xylella fastidiosa
ref|WP_004086257.1|  polynucleotide phosphorylase/polyadenylase       48.9    2e-09   Xylella fastidiosa
ref|WP_029407474.1|  polynucleotide phosphorylase/polyadenylase       50.8    2e-09   Thiomicrorhabdus sp. Milos-T2
ref|XP_007031538.1|  Polyribonucleotide nucleotidyltransferase, p...  60.8    2e-09   
ref|XP_003618178.1|  Polyribonucleotide nucleotidyltransferase        65.9    2e-09   
gb|ADI16912.1|  polyribonucleotide nucleotidyltransferase (polynu...  50.1    3e-09   uncultured gamma proteobacterium HF0010_16J05
ref|WP_040728507.1|  polynucleotide phosphorylase/polyadenylase       50.1    3e-09   Thiomicrorhabdus sp. Kp2
ref|WP_018026459.1|  polynucleotide phosphorylase/polyadenylase       50.1    3e-09   Oligella urethralis
ref|WP_036560419.1|  polynucleotide phosphorylase/polyadenylase       49.7    3e-09   Oligella
ref|WP_038271091.1|  polynucleotide phosphorylase/polyadenylase       47.8    3e-09   Xylella taiwanensis
ref|WP_018574108.1|  polynucleotide phosphorylase/polyadenylase       51.2    3e-09   Oligella ureolytica
ref|WP_034853538.1|  polynucleotide phosphorylase/polyadenylase       48.9    4e-09   
ref|WP_028466285.1|  polynucleotide phosphorylase/polyadenylase       48.5    4e-09   Nisaea denitrificans
ref|WP_029064149.1|  polynucleotide phosphorylase/polyadenylase       48.9    4e-09   Labrenzia sp. DG1229
ref|WP_040452728.1|  polynucleotide phosphorylase/polyadenylase       48.5    4e-09   Labrenzia alexandrii
gb|EEE46221.1|  3' exoribonuclease family, domain 2                   48.5    5e-09   
dbj|GAK34768.1|  polyribonucleotide nucleotidyltransferase            48.1    5e-09   alpha proteobacterium Q-1
ref|WP_022005994.1|  polyribonucleotide nucleotidyltransferase        49.7    5e-09   
ref|WP_018913972.1|  polynucleotide phosphorylase/polyadenylase       50.1    6e-09   Thiomonas sp. FB-6
ref|WP_031403999.1|  polynucleotide phosphorylase/polyadenylase       50.4    6e-09   Thiomonas sp. FB-Cd
ref|WP_043108091.1|  polynucleotide phosphorylase/polyadenylase       43.5    6e-09   endosymbiont of unidentified scaly snail isolate Monju
ref|WP_026879138.1|  polynucleotide phosphorylase/polyadenylase       44.7    6e-09   Ignatzschineria larvae
ref|WP_014834137.1|  polynucleotide phosphorylase/polyadenylase       48.9    6e-09   Pseudomonas aeruginosa
ref|WP_026479200.1|  polynucleotide phosphorylase/polyadenylase       47.4    6e-09   Ahrensia sp. 13_GOM-1096m
ref|WP_034039209.1|  polynucleotide phosphorylase/polyadenylase       48.9    7e-09   Pseudomonas aeruginosa
ref|WP_033947553.1|  polynucleotide phosphorylase/polyadenylase       48.9    7e-09   Pseudomonas aeruginosa
ref|WP_026317328.1|  polynucleotide phosphorylase/polyadenylase       47.4    7e-09   Ahrensia kielensis
ref|WP_033941628.1|  polynucleotide phosphorylase/polyadenylase       48.9    7e-09   Pseudomonas aeruginosa
ref|WP_042548930.1|  polynucleotide phosphorylase/polyadenylase       49.7    7e-09   Ralstonia solanacearum
ref|WP_014616649.1|  polynucleotide phosphorylase/polyadenylase       49.7    7e-09   Ralstonia solanacearum
ref|WP_003261921.1|  polynucleotide phosphorylase/polyadenylase       49.7    7e-09   Ralstonia solanacearum
ref|WP_024916751.1|  polynucleotide phosphorylase/polyadenylase       48.9    7e-09   Pseudomonas aeruginosa
ref|WP_031640855.1|  polynucleotide phosphorylase/polyadenylase       48.9    7e-09   Pseudomonas aeruginosa
ref|WP_003100524.1|  polynucleotide phosphorylase/polyadenylase       48.9    7e-09   Pseudomonas aeruginosa
ref|WP_003095181.1|  MULTISPECIES: polynucleotide phosphorylase/p...  48.9    7e-09   Pseudomonas
ref|WP_028681348.1|  MULTISPECIES: polynucleotide phosphorylase/p...  48.9    7e-09   Pseudomonas aeruginosa
gb|ERF84557.1|  polyribonucleotide nucleotidyltransferase             46.6    7e-09   Bradyrhizobium sp. DFCI-1
ref|WP_003272823.1|  polynucleotide phosphorylase/polyadenylase       49.7    7e-09   Ralstonia solanacearum
ref|WP_020748132.1|  Polyribonucleotide nucleotidyltransferase        49.7    7e-09   Ralstonia solanacearum
ref|WP_013417766.1|  polynucleotide phosphorylase                     48.1    7e-09   Rhodomicrobium vannielii
ref|WP_044428459.1|  polynucleotide phosphorylase/polyadenylase       47.0    7e-09   Skermanella aerolata
ref|WP_034082159.1|  polynucleotide phosphorylase/polyadenylase       48.9    7e-09   Pseudomonas aeruginosa
ref|WP_003148740.1|  polynucleotide phosphorylase/polyadenylase       48.9    7e-09   Pseudomonas aeruginosa
ref|WP_036108530.1|  polynucleotide phosphorylase/polyadenylase       48.1    7e-09   Lysobacter capsici
emb|CCA84441.1|  polyribonucleotide nucleotidyltransferase            49.7    7e-09   Ralstonia syzygii R24
ref|WP_037233498.1|  polynucleotide phosphorylase/polyadenylase       48.1    7e-09   Rhodomicrobium udaipurense
ref|WP_013212052.1|  polynucleotide phosphorylase/polyadenylase       49.7    8e-09   Ralstonia
ref|WP_006935431.1|  polynucleotide phosphorylase                     48.1    8e-09   Labrenzia aggregata
ref|WP_028486478.1|  polynucleotide phosphorylase/polyadenylase       48.5    8e-09   Thiomicrorhabdus chilensis
gb|ABE60937.1|  Polyribonucleotide nucleotidyltransferase             46.6    8e-09   Nitrobacter hamburgensis X14
ref|WP_024975286.1|  polynucleotide phosphorylase/polyadenylase       49.3    8e-09   Ralstonia
ref|WP_016727045.1|  polynucleotide phosphorylase/polyadenylase       49.7    8e-09   Ralstonia solanacearum
ref|WP_016722935.1|  polynucleotide phosphorylase/polyadenylase       49.7    8e-09   Ralstonia
ref|WP_011001999.1|  polynucleotide phosphorylase/polyadenylase       49.7    8e-09   Ralstonia
ref|WP_026606468.1|  polynucleotide phosphorylase/polyadenylase       48.1    8e-09   Methylocapsa acidiphila
sp|A5CWW8.1|PNP_VESOH  RecName: Full=Polyribonucleotide nucleotid...  50.8    8e-09   Candidatus Vesicomyosocius okutanii HA
ref|WP_041191915.1|  polynucleotide phosphorylase/polyadenylase       50.8    8e-09   Calyptogena okutanii thioautotrophic gill symbiont
ref|WP_011391532.1|  polynucleotide phosphorylase                     47.0    8e-09   Rhodospirillum rubrum
ref|WP_039597857.1|  polynucleotide phosphorylase/polyadenylase       49.3    8e-09   Ralstonia sp. A12
ref|WP_013835409.1|  polynucleotide phosphorylase/polyadenylase       47.0    9e-09   Thiomicrospira cyclica
ref|WP_012915543.1|  polynucleotide phosphorylase/polyadenylase       47.4    9e-09   Xanthomonas albilineans
ref|WP_039006781.1|  polynucleotide phosphorylase/polyadenylase       47.4    9e-09   Xanthomonas translucens
ref|WP_009590756.1|  polyribonucleotide nucleotidyltransferase        47.4    9e-09   Xanthomonas translucens
ref|WP_031256466.1|  polynucleotide phosphorylase/polyadenylase       48.1    9e-09   
ref|WP_009025946.1|  polynucleotide phosphorylase                     46.2    9e-09   Bradyrhizobium sp. ORS 375
ref|WP_042088160.1|  polynucleotide phosphorylase/polyadenylase       47.0    1e-08   alpha proteobacterium Q-1
gb|EEZ79604.1|  Polyribonucleotide nucleotidyltransferase             50.8    1e-08   uncultured SUP05 cluster bacterium
ref|WP_004630820.1|  polyribonucleotide nucleotidyltransferase        48.9    1e-08   Ralstonia pickettii
ref|WP_037027177.1|  polynucleotide phosphorylase/polyadenylase       48.9    1e-08   Ralstonia sp. UNC404CL21Col
ref|WP_012762310.1|  polynucleotide phosphorylase/polyadenylase       48.9    1e-08   Ralstonia pickettii
sp|B2ICY4.1|PNP_BEII9  RecName: Full=Polyribonucleotide nucleotid...  48.1    1e-08   Beijerinckia indica subsp. indica ATCC 9039
ref|WP_041778179.1|  polynucleotide phosphorylase/polyadenylase       48.1    1e-08   Beijerinckia indica
gb|EFP65152.1|  polyribonucleotide nucleotidyltransferase             48.9    1e-08   Ralstonia pickettii
ref|WP_017911268.1|  polynucleotide phosphorylase/polyadenylase       47.4    1e-08   Xanthomonas sp. SHU 166
ref|WP_043092562.1|  polynucleotide phosphorylase/polyadenylase       47.4    1e-08   Xanthomonas sacchari
ref|WP_026345179.1|  polynucleotide phosphorylase/polyadenylase       46.6    1e-08   Novispirillum itersonii
ref|WP_017915146.1|  polynucleotide phosphorylase/polyadenylase       47.4    1e-08   Xanthomonas sp. SHU 308
ref|WP_017907567.1|  polynucleotide phosphorylase/polyadenylase       47.4    1e-08   Xanthomonas sp. SHU 199
ref|WP_010344206.1|  polynucleotide phosphorylase/polyadenylase       47.4    1e-08   Xanthomonas sacchari
ref|WP_011995946.1|  polynucleotide phosphorylase                     48.9    1e-08   Xanthobacter autotrophicus
ref|WP_012436068.1|  MULTISPECIES: polynucleotide phosphorylase/p...  48.9    1e-08   Ralstonia pickettii
ref|WP_009241068.1|  MULTISPECIES: polynucleotide phosphorylase/p...  48.9    1e-08   Ralstonia
ref|WP_028310327.1|  polynucleotide phosphorylase/polyadenylase       49.7    1e-08   Derxia gummosa
ref|WP_024972481.1|  polynucleotide phosphorylase/polyadenylase       48.9    1e-08   Ralstonia pickettii
dbj|BAI73501.1|  polyribonucleotide nucleotidyltransferase            47.0    1e-08   Azospirillum sp. B510
ref|WP_013535495.1|  polynucleotide phosphorylase/polyadenylase       47.4    1e-08   Pseudoxanthomonas suwonensis
ref|WP_024509590.1|  polynucleotide phosphorylase/polyadenylase       46.2    1e-08   Bradyrhizobium sp. ARR65
ref|WP_042443290.1|  polynucleotide phosphorylase/polyadenylase       47.0    1e-08   Azospirillum lipoferum
ref|WP_022186711.1|  polyribonucleotide nucleotidyltransferase        48.5    1e-08   
ref|WP_014249208.1|  polynucleotide phosphorylase                     47.0    1e-08   Azospirillum lipoferum
ref|WP_018699669.1|  polynucleotide phosphorylase                     46.6    1e-08   Amorphus coralli
ref|WP_042700039.1|  polynucleotide phosphorylase/polyadenylase       47.0    1e-08   Azospirillum sp. B506
gb|EKE09557.1|  hypothetical protein ACD_16C00137G0008                49.3    1e-08   uncultured bacterium
ref|WP_004260595.1|  polynucleotide phosphorylase/polyadenylase       49.7    1e-08   Thauera sp. 63
ref|WP_028878228.1|  polynucleotide phosphorylase/polyadenylase       47.0    1e-08   Terasakiella pusilla
ref|WP_037445780.1|  polynucleotide phosphorylase/polyadenylase       46.6    1e-08   Skermanella stibiiresistens
ref|WP_018319413.1|  polynucleotide phosphorylase                     45.8    1e-08   Bradyrhizobium
ref|WP_038970619.1|  polynucleotide phosphorylase/polyadenylase       45.8    1e-08   Bradyrhizobium
ref|WP_028139505.1|  MULTISPECIES: polynucleotide phosphorylase/p...  45.8    1e-08   Bradyrhizobium
ref|WP_028133640.1|  polynucleotide phosphorylase/polyadenylase       45.8    1e-08   Bradyrhizobium japonicum
ref|WP_043239101.1|  polynucleotide phosphorylase/polyadenylase       48.1    1e-08   Bosea
ref|WP_011923331.1|  polynucleotide phosphorylase                     45.8    1e-08   Bradyrhizobium sp. ORS 278
ref|WP_028172517.1|  MULTISPECIES: polynucleotide phosphorylase/p...  45.8    1e-08   Bradyrhizobium
ref|WP_011083601.1|  MULTISPECIES: polynucleotide phosphorylase       45.8    1e-08   Bradyrhizobium diazoefficiens
ref|WP_038944019.1|  polynucleotide phosphorylase/polyadenylase       45.8    1e-08   Bradyrhizobium japonicum
ref|WP_027546823.1|  polynucleotide phosphorylase/polyadenylase       45.8    1e-08   Bradyrhizobium sp. WSM2254
ref|WP_036024490.1|  polynucleotide phosphorylase/polyadenylase       45.8    1e-08   Bradyrhizobium
ref|WP_024575659.1|  MULTISPECIES: polynucleotide phosphorylase/p...  45.8    1e-08   Afipia
ref|WP_036040863.1|  polynucleotide phosphorylase/polyadenylase       45.8    1e-08   Bradyrhizobium yuanmingense
ref|WP_036009004.1|  polynucleotide phosphorylase/polyadenylase       45.8    1e-08   Bradyrhizobium yuanmingense
ref|WP_029011885.1|  polynucleotide phosphorylase/polyadenylase       46.6    1e-08   Niveispirillum irakense
ref|WP_006608910.1|  polynucleotide phosphorylase                     45.8    1e-08   Bradyrhizobium sp. ORS 285
ref|WP_011463790.1|  polynucleotide phosphorylase/polyadenylase       45.8    1e-08   Rhodoferax ferrireducens
ref|WP_031370859.1|  polynucleotide phosphorylase/polyadenylase       47.0    1e-08   Lysobacter antibioticus
ref|WP_035704285.1|  polynucleotide phosphorylase/polyadenylase       45.4    1e-08   Bradyrhizobium sp. CCBAU 43298
ref|WP_027563913.1|  MULTISPECIES: polynucleotide phosphorylase/p...  45.4    1e-08   Bradyrhizobium
ref|WP_028155408.1|  polynucleotide phosphorylase/polyadenylase       45.4    1e-08   Bradyrhizobium japonicum
ref|WP_014490963.1|  polynucleotide phosphorylase                     45.4    1e-08   Bradyrhizobium japonicum
ref|WP_025032911.1|  polynucleotide phosphorylase/polyadenylase       45.8    1e-08   Bradyrhizobium sp. DOA9
ref|WP_041042005.1|  polynucleotide phosphorylase/polyadenylase       46.6    1e-08   Magnetospirillum magnetotacticum
ref|WP_028176494.1|  polynucleotide phosphorylase/polyadenylase       45.4    1e-08   Bradyrhizobium japonicum
ref|WP_024338557.1|  polynucleotide phosphorylase/polyadenylase       45.4    1e-08   Bradyrhizobium japonicum
ref|WP_041957166.1|  polynucleotide phosphorylase/polyadenylase       45.4    1e-08   Bradyrhizobium japonicum
ref|WP_039155106.1|  polynucleotide phosphorylase/polyadenylase       45.4    1e-08   Bradyrhizobium japonicum
ref|WP_035671358.1|  polynucleotide phosphorylase/polyadenylase       45.4    1e-08   Bradyrhizobium liaoningense
ref|WP_027531557.1|  polynucleotide phosphorylase/polyadenylase       45.4    1e-08   Bradyrhizobium sp. WSM3983
ref|WP_008131784.1|  polynucleotide phosphorylase                     45.4    1e-08   Bradyrhizobium sp. YR681
ref|WP_003467386.1|  polynucleotide phosphorylase/polyadenylase       47.0    1e-08   Xanthomonas translucens
gb|AGB69538.1|  polyribonucleotide nucleotidyltransferase             48.9    1e-08   Rhizobium tropici CIAT 899
ref|WP_038359465.1|  polynucleotide phosphorylase/polyadenylase       48.1    1e-08   Bosea sp. UNC402CLCol
ref|WP_018455795.1|  polynucleotide phosphorylase                     45.4    1e-08   Bradyrhizobium
ref|WP_007598347.1|  MULTISPECIES: polynucleotide phosphorylase       45.4    1e-08   Bradyrhizobium
gb|ERP97305.1|  polynucleotide phosphorylase                          47.4    1e-08   Labrenzia sp. C1B10
ref|WP_031268705.1|  MULTISPECIES: polynucleotide phosphorylase/p...  47.4    1e-08   Labrenzia
ref|WP_031799034.1|  polynucleotide phosphorylase/polyadenylase       47.8    1e-08   Pseudomonas aeruginosa
ref|WP_014438696.1|  polynucleotide phosphorylase                     45.4    1e-08   Bradyrhizobium sp. S23321
ref|WP_009150566.1|  polynucleotide phosphorylase/polyadenylase       43.1    1e-08   Thiorhodovibrio sp. 970
ref|WP_007603907.1|  polynucleotide phosphorylase                     45.4    1e-08   Bradyrhizobium
ref|WP_028335503.1|  polynucleotide phosphorylase/polyadenylase       45.4    1e-08   Bradyrhizobium elkanii
ref|WP_011313367.1|  polynucleotide phosphorylase                     45.4    1e-08   Nitrobacter winogradskyi
ref|WP_027278731.1|  polynucleotide phosphorylase/polyadenylase       45.4    2e-08   Rhodopseudomonas palustris
ref|WP_011737843.1|  polynucleotide phosphorylase/polyadenylase       50.1    2e-08   Candidatus Ruthia magnifica
gb|KJC44664.1|  polynucleotide phosphorylase/polyadenylase            45.4    2e-08   Bradyrhizobium sp. LTSP857
ref|WP_002810193.1|  polynucleotide phosphorylase/polyadenylase       46.6    2e-08   Xanthomonas fragariae
ref|WP_008960850.1|  polynucleotide phosphorylase                     45.4    2e-08   Bradyrhizobium sp. STM 3809
ref|WP_014102652.1|  polynucleotide phosphorylase                     49.7    2e-08   Micavibrio aeruginosavorus
ref|WP_015467428.1|  Polyribonucleotide nucleotidyltransferase        49.7    2e-08   Micavibrio aeruginosavorus
ref|WP_011942587.1|  polynucleotide phosphorylase                     45.4    2e-08   Bradyrhizobium sp. BTAi1
gb|EAQ37165.1|  polyribonucleotide nucleotidyltransferase             45.4    2e-08   Nitrobacter sp. Nb-311A
ref|WP_011484169.1|  polynucleotide phosphorylase/polyadenylase       47.4    2e-08   Polaromonas sp. JS666
ref|WP_015663226.1|  polyribonucleotide nucleotidyltransferase        45.4    2e-08   Bradyrhizobium oligotrophicum
ref|WP_019682251.1|  polynucleotide phosphorylase/polyadenylase       48.1    2e-08   Pseudomonas aeruginosa
ref|WP_029082441.1|  polynucleotide phosphorylase/polyadenylase       45.4    2e-08   Bradyrhizobium sp. th.b2
ref|WP_024515116.1|  polynucleotide phosphorylase/polyadenylase       45.4    2e-08   Bradyrhizobium sp. Tv2a-2
ref|WP_004332750.1|  polynucleotide phosphorylase/polyadenylase       49.3    2e-08   Thauera linaloolentis
ref|WP_010463927.1|  polynucleotide phosphorylase/polyadenylase       47.4    2e-08   Acidovorax radicis
ref|WP_034998015.1|  polynucleotide phosphorylase/polyadenylase       47.4    2e-08   Beijerinckia mobilis
ref|WP_008548667.1|  polynucleotide phosphorylase                     47.0    2e-08   Pseudovibrio sp. JE062
ref|WP_019027815.1|  polynucleotide phosphorylase/polyadenylase       47.4    2e-08   Colwellia piezophila
ref|WP_003614793.1|  polynucleotide phosphorylase                     47.0    2e-08   Methylosinus
ref|WP_008906339.1|  polynucleotide phosphorylase/polyadenylase       47.0    2e-08   Acidovorax sp. NO-1
ref|WP_008968206.1|  polynucleotide phosphorylase                     45.1    2e-08   Bradyrhizobium sp. STM 3843
ref|WP_014283428.1|  polynucleotide phosphorylase                     47.0    2e-08   Pseudovibrio
ref|WP_018644187.1|  polynucleotide phosphorylase                     45.1    2e-08   Bradyrhizobium japonicum
ref|WP_027572371.1|  polynucleotide phosphorylase/polyadenylase       45.1    2e-08   Bradyrhizobium sp. WSM1743
ref|WP_029934670.1|  polynucleotide phosphorylase/polyadenylase       47.0    2e-08   Thiomicrospira pelophila
ref|WP_011386466.1|  polynucleotide phosphorylase                     45.8    2e-08   Magnetospirillum magneticum
ref|WP_027054519.1|  polynucleotide phosphorylase/polyadenylase       48.5    2e-08   Mesorhizobium erdmanii
ref|WP_018266721.1|  polynucleotide phosphorylase                     46.6    2e-08   Methylosinus sp. LW4
ref|WP_006458359.1|  polynucleotide phosphorylase/polyadenylase       46.6    2e-08   Stenotrophomonas
ref|WP_041357504.1|  polynucleotide phosphorylase/polyadenylase       45.1    2e-08   Nitrobacter hamburgensis
ref|WP_024878741.1|  MULTISPECIES: polynucleotide phosphorylase/p...  47.0    2e-08   Methylocystaceae
ref|WP_040673744.1|  polynucleotide phosphorylase/polyadenylase       45.1    2e-08   Nitrobacter sp. Nb-311A
ref|WP_022196653.1|  polyribonucleotide nucleotidyltransferase        47.4    2e-08   
ref|WP_027082998.1|  polynucleotide phosphorylase/polyadenylase       47.4    2e-08   Lysobacter sp. URHA0019
ref|WP_032128652.1|  polynucleotide phosphorylase/polyadenylase       46.2    2e-08   Stenotrophomonas maltophilia
ref|WP_032957452.1|  polynucleotide phosphorylase/polyadenylase       46.2    2e-08   Stenotrophomonas maltophilia
ref|WP_019336892.1|  polynucleotide phosphorylase/polyadenylase       46.2    2e-08   Stenotrophomonas maltophilia
ref|WP_010486455.1|  polynucleotide phosphorylase/polyadenylase [     46.2    2e-08   [Pseudomonas] geniculata
ref|WP_036257881.1|  polynucleotide phosphorylase/polyadenylase       47.0    2e-08   Methylocapsa aurea
emb|CBW75684.1|  Polyribonucleotide nucleotidyltransferase (EC 2....  48.1    2e-08   Paraburkholderia rhizoxinica HKI 454
ref|WP_024921192.1|  MULTISPECIES: polynucleotide phosphorylase/p...  45.1    2e-08   Afipia
ref|WP_006023526.1|  polyribonucleotide nucleotidyltransferase        45.1    2e-08   Afipia broomeae
ref|WP_043401944.1|  polynucleotide phosphorylase/polyadenylase       46.2    2e-08   Stenotrophomonas maltophilia
ref|WP_033835143.1|  polynucleotide phosphorylase/polyadenylase       46.2    2e-08   Stenotrophomonas maltophilia
ref|WP_036296398.1|  polynucleotide phosphorylase/polyadenylase       46.6    2e-08   Methylosinus sp. PW1
ref|WP_026861866.1|  polynucleotide phosphorylase/polyadenylase       47.8    2e-08   Idiomarina sediminum
ref|WP_014037942.1|  polynucleotide phosphorylase/polyadenylase       46.2    2e-08   Stenotrophomonas
ref|WP_011156000.1|  polynucleotide phosphorylase                     45.1    2e-08   Rhodopseudomonas palustris
ref|WP_013593730.1|  polynucleotide phosphorylase/polyadenylase       47.0    2e-08   Acidovorax avenae
ref|WP_005417884.1|  polynucleotide phosphorylase/polyadenylase       46.2    2e-08   Stenotrophomonas
ref|WP_026431615.1|  polynucleotide phosphorylase/polyadenylase       47.0    2e-08   Acidovorax oryzae
ref|WP_044586301.1|  polynucleotide phosphorylase/polyadenylase       45.1    2e-08   Bradyrhizobium sp. LTSPM299
ref|WP_044537872.1|  polynucleotide phosphorylase/polyadenylase       45.1    2e-08   Bradyrhizobium sp. LTSP885
gb|KJC42066.1|  polynucleotide phosphorylase/polyadenylase            45.1    2e-08   Bradyrhizobium sp. LTSP849
ref|WP_019703749.1|  polynucleotide phosphorylase/polyadenylase       47.0    2e-08   Acidovorax oryzae
ref|WP_034732575.1|  polynucleotide phosphorylase/polyadenylase       47.8    2e-08   Idiomarina atlantica
ref|WP_004272030.1|  polynucleotide phosphorylase                     45.4    2e-08   Nitrospirillum amazonense
ref|WP_012480876.1|  polynucleotide phosphorylase/polyadenylase       46.2    2e-08   Stenotrophomonas maltophilia
ref|WP_013500033.1|  polynucleotide phosphorylase                     45.1    2e-08   Rhodopseudomonas palustris
ref|WP_012589317.1|  polynucleotide phosphorylase                     47.0    2e-08   
ref|WP_042422512.1|  polynucleotide phosphorylase/polyadenylase       47.0    2e-08   
ref|WP_014647855.1|  polynucleotide phosphorylase/polyadenylase       46.2    2e-08   
ref|WP_036183478.1|  polynucleotide phosphorylase/polyadenylase       49.7    2e-08   
gb|KHD04028.1|  hypothetical protein OT06_56755                       45.4    2e-08   
ref|WP_031798811.1|  polynucleotide phosphorylase/polyadenylase       48.1    2e-08   
ref|WP_005410444.1|  polynucleotide phosphorylase/polyadenylase       46.2    2e-08   
ref|WP_038136585.1|  polynucleotide phosphorylase/polyadenylase       47.4    2e-08   
gb|AEK62888.1|  Polyribonucleotide nucleotidyltransferase             48.1    2e-08   
gb|KEI73163.1|  polynucleotide phosphorylase/polyadenylase            50.1    2e-08   
ref|WP_033402998.1|  polynucleotide phosphorylase/polyadenylase       50.1    2e-08   
ref|WP_028104325.1|  polynucleotide phosphorylase/polyadenylase       48.1    2e-08   
ref|WP_019399702.1|  MULTISPECIES: polynucleotide phosphorylase/p...  46.2    2e-08   
ref|WP_008616456.1|  polynucleotide phosphorylase/polyadenylase       45.8    2e-08   
ref|WP_006459029.1|  polynucleotide phosphorylase/polyadenylase       45.4    2e-08   
ref|WP_004181131.1|  Polyribonucleotide nucleotidyltransferase        43.9    2e-08   
ref|WP_034032426.1|  polynucleotide phosphorylase/polyadenylase       48.1    2e-08   
ref|WP_012494150.1|  polynucleotide phosphorylase                     44.7    2e-08   
ref|WP_007864483.1|  polynucleotide phosphorylase/polyadenylase       46.6    2e-08   
ref|WP_011311205.1|  polynucleotide phosphorylase/polyadenylase       44.3    2e-08   
ref|WP_027467582.1|  polynucleotide phosphorylase/polyadenylase       45.4    3e-08   
gb|EJZ35767.1|  polynucleotide phosphorylase/polyadenylase            45.4    3e-08   
ref|WP_031767157.1|  polynucleotide phosphorylase/polyadenylase       48.1    3e-08   
gb|KFH26016.1|  polynucleotide phosphorylase/polyadenylase            48.1    3e-08   
ref|WP_012031354.1|  polynucleotide phosphorylase/polyadenylase       44.7    3e-08   
ref|WP_014508205.1|  polynucleotide phosphorylase/polyadenylase       45.8    3e-08   
ref|WP_011037640.1|  polynucleotide phosphorylase/polyadenylase       45.8    3e-08   
ref|WP_040435986.1|  polynucleotide phosphorylase/polyadenylase       47.0    3e-08   
ref|WP_042598412.1|  polynucleotide phosphorylase/polyadenylase       45.8    3e-08   
ref|WP_016944314.1|  polynucleotide phosphorylase/polyadenylase       45.8    3e-08   
ref|WP_023412769.1|  hypothetical protein                             42.7    3e-08   
ref|WP_021194995.1|  polynucleotide phosphorylase/polyadenylase       47.4    3e-08   
ref|WP_018269260.1|  polynucleotide phosphorylase                     44.3    3e-08   
emb|CDS54381.1|  Polyribonucleotide nucleotidyltransferase            46.2    3e-08   
ref|WP_028347860.1|  polynucleotide phosphorylase/polyadenylase       44.3    3e-08   
dbj|GAN44023.1|  polynucleotide phosphorylase/polyadenylase           47.0    3e-08   
ref|WP_018402066.1|  polynucleotide phosphorylase/polyadenylase       48.9    3e-08   
ref|WP_027102932.1|  polynucleotide phosphorylase/polyadenylase       47.0    3e-08   
ref|WP_038382605.1|  polynucleotide phosphorylase/polyadenylase       44.3    3e-08   
ref|WP_028343916.1|  polynucleotide phosphorylase/polyadenylase       44.3    3e-08   
ref|WP_005875552.1|  polynucleotide phosphorylase/polyadenylase       46.6    3e-08   
ref|WP_027550038.1|  polynucleotide phosphorylase/polyadenylase       44.3    3e-08   
ref|WP_029351540.1|  polynucleotide phosphorylase/polyadenylase       47.4    3e-08   
ref|WP_009466563.1|  polynucleotide phosphorylase                     46.2    3e-08   
ref|WP_018715226.1|  polynucleotide phosphorylase/polyadenylase       46.6    3e-08   
gb|KHD08943.1|  polynucleotide phosphorylase/polyadenylase            44.3    3e-08   
ref|WP_024584606.1|  MULTISPECIES: polynucleotide phosphorylase/p...  44.3    3e-08   
ref|WP_015397184.1|  polyribonucleotide nucleotidyltransferase        49.3    3e-08   
gb|EKD45241.1|  hypothetical protein ACD_70C00007G0002                43.1    3e-08   
emb|CAP51003.1|  polyribonucleotide nucleotidyltransferase            45.8    3e-08   
ref|WP_019199074.1|  polynucleotide phosphorylase                     44.3    3e-08   
ref|WP_005932636.1|  polynucleotide phosphorylase/polyadenylase       45.4    3e-08   
ref|XP_005965650.1|  PREDICTED: polyribonucleotide nucleotidyltra...  46.6    3e-08   
gb|AET89543.1|  polynucleotide phosphorylase/polyadenylase            47.4    3e-08   
ref|WP_005920229.1|  MULTISPECIES: polynucleotide phosphorylase/p...  45.4    3e-08   
ref|WP_033157375.1|  polynucleotide phosphorylase/polyadenylase       43.5    3e-08   
ref|WP_008503703.1|  polynucleotide phosphorylase                     47.8    3e-08   
ref|WP_024890793.1|  polynucleotide phosphorylase/polyadenylase       46.2    3e-08   
ref|WP_019560378.1|  polynucleotide phosphorylase/polyadenylase       46.6    3e-08   
ref|WP_003485585.1|  polynucleotide phosphorylase/polyadenylase       45.4    3e-08   
ref|WP_027939269.1|  polynucleotide phosphorylase/polyadenylase       43.1    3e-08   
ref|WP_016848689.1|  polynucleotide phosphorylase/polyadenylase       45.4    3e-08   
ref|WP_043421503.1|  hypothetical protein                             49.3    3e-08   
ref|WP_041185973.1|  polynucleotide phosphorylase/polyadenylase       49.3    4e-08   
ref|WP_018410895.1|  polynucleotide phosphorylase/polyadenylase       47.4    4e-08   
ref|WP_039581506.1|  polynucleotide phosphorylase/polyadenylase       45.4    4e-08   
gb|EEX58041.1|  polyribonucleotide nucleotidyltransferase             48.1    4e-08   
ref|WP_044564269.1|  polynucleotide phosphorylase/polyadenylase       46.2    4e-08   
ref|WP_040199909.1|  polynucleotide phosphorylase/polyadenylase       46.2    4e-08   
ref|WP_017404092.1|  polynucleotide phosphorylase/polyadenylase       46.6    4e-08   
ref|WP_034396584.1|  polynucleotide phosphorylase/polyadenylase       46.6    4e-08   
ref|WP_006468160.1|  polynucleotide phosphorylase                     47.8    4e-08   
ref|WP_021587631.1|  MULTISPECIES: polynucleotide phosphorylase       47.8    4e-08   
ref|WP_002714083.1|  polynucleotide phosphorylase                     43.9    4e-08   
gb|AGF49212.1|  polyribonucleotide nucleotidyltransferase             48.9    4e-08   
ref|WP_027580957.1|  polynucleotide phosphorylase/polyadenylase       44.3    4e-08   
ref|WP_043789846.1|  polynucleotide phosphorylase/polyadenylase       46.6    4e-08   
ref|WP_043819231.1|  polynucleotide phosphorylase/polyadenylase       46.6    4e-08   
ref|WP_016447715.1|  polyribonucleotide nucleotidyltransferase        46.6    4e-08   
ref|WP_013801059.1|  polynucleotide phosphorylase/polyadenylase       46.6    4e-08   
ref|WP_009539362.1|  Polyribonucleotide nucleotidyltransferase        45.1    4e-08   
ref|WP_027538115.1|  polynucleotide phosphorylase/polyadenylase       43.9    4e-08   
ref|WP_008596114.1|  polynucleotide phosphorylase                     45.4    4e-08   
ref|WP_012326153.1|  polynucleotide phosphorylase/polyadenylase       43.1    4e-08   
ref|WP_012206983.1|  polynucleotide phosphorylase/polyadenylase       46.6    4e-08   
ref|WP_028150573.1|  polynucleotide phosphorylase/polyadenylase       43.9    4e-08   
ref|WP_011259733.1|  polynucleotide phosphorylase/polyadenylase       45.4    4e-08   
ref|WP_029524380.1|  polynucleotide phosphorylase/polyadenylase       45.8    4e-08   
ref|WP_029584017.1|  polynucleotide phosphorylase/polyadenylase       43.9    4e-08   
ref|WP_024743627.1|  polynucleotide phosphorylase/polyadenylase       45.1    4e-08   
ref|WP_017163064.1|  polynucleotide phosphorylase/polyadenylase       45.1    4e-08   
ref|WP_034878820.1|  polynucleotide phosphorylase/polyadenylase       48.5    4e-08   
ref|WP_039563613.1|  polynucleotide phosphorylase/polyadenylase       45.1    4e-08   
ref|WP_039407470.1|  polynucleotide phosphorylase/polyadenylase       45.1    4e-08   
ref|WP_019302668.1|  polynucleotide phosphorylase/polyadenylase       45.1    4e-08   
ref|WP_037482748.1|  polynucleotide phosphorylase/polyadenylase       46.2    4e-08   
ref|WP_010371227.1|  MULTISPECIES: polynucleotide phosphorylase/p...  45.1    4e-08   
ref|WP_011800821.1|  polynucleotide phosphorylase/polyadenylase       45.4    4e-08   
ref|WP_039567177.1|  polynucleotide phosphorylase/polyadenylase       45.1    4e-08   
ref|WP_029221571.1|  polynucleotide phosphorylase/polyadenylase       45.1    4e-08   
ref|WP_017156102.1|  polynucleotide phosphorylase/polyadenylase       45.1    4e-08   
ref|WP_014503780.1|  polynucleotide phosphorylase/polyadenylase       45.1    4e-08   
gb|KFA03645.1|  polynucleotide phosphorylase/polyadenylase            45.1    4e-08   
ref|WP_019304624.1|  polynucleotide phosphorylase/polyadenylase       45.1    4e-08   
ref|WP_008570980.1|  MULTISPECIES: polynucleotide phosphorylase/p...  45.1    4e-08   
ref|WP_033836644.1|  polynucleotide phosphorylase/polyadenylase       45.1    4e-08   
ref|WP_042822911.1|  polynucleotide phosphorylase/polyadenylase       45.1    4e-08   
ref|WP_007963205.1|  MULTISPECIES: polynucleotide phosphorylase/p...  45.1    4e-08   
ref|WP_036813644.1|  polynucleotide phosphorylase/polyadenylase       45.8    4e-08   
ref|WP_021979374.1|  polyribonucleotide nucleotidyltransferase        46.2    4e-08   
ref|WP_039510894.1|  polynucleotide phosphorylase/polyadenylase       45.1    4e-08   
ref|WP_039526507.1|  polynucleotide phosphorylase/polyadenylase       45.1    4e-08   
ref|WP_018934782.1|  polynucleotide phosphorylase/polyadenylase       45.1    4e-08   
ref|WP_002926546.1|  polynucleotide phosphorylase/polyadenylase       47.8    4e-08   
ref|WP_039522177.1|  polynucleotide phosphorylase/polyadenylase       45.1    4e-08   
ref|WP_034465657.1|  polynucleotide phosphorylase/polyadenylase       43.9    4e-08   
ref|WP_039420590.1|  polynucleotide phosphorylase/polyadenylase       45.1    5e-08   
ref|WP_028928273.1|  polynucleotide phosphorylase/polyadenylase       45.4    5e-08   
ref|WP_024869110.1|  polynucleotide phosphorylase/polyadenylase       45.4    5e-08   
emb|CDH87664.1|  polyribonucleotide nucleotidyltransferase            47.0    5e-08   
ref|WP_016901092.1|  polynucleotide phosphorylase/polyadenylase       45.1    5e-08   
ref|WP_005914260.1|  MULTISPECIES: polynucleotide phosphorylase/p...  45.1    5e-08   
ref|WP_014090520.1|  polynucleotide phosphorylase/polyadenylase       45.1    5e-08   
ref|WP_005991401.1|  polynucleotide phosphorylase/polyadenylase       45.1    5e-08   
ref|WP_020407739.1|  polynucleotide phosphorylase/polyadenylase       47.4    5e-08   
ref|WP_029311466.1|  polynucleotide phosphorylase/polyadenylase       45.4    5e-08   
ref|WP_034957109.1|  polynucleotide phosphorylase/polyadenylase       47.0    5e-08   
ref|WP_019569072.1|  polynucleotide phosphorylase/polyadenylase       44.7    5e-08   
ref|WP_011370551.1|  polynucleotide phosphorylase/polyadenylase       46.2    5e-08   
ref|WP_043330071.1|  polynucleotide phosphorylase/polyadenylase       45.8    5e-08   
ref|WP_004322622.1|  MULTISPECIES: polynucleotide phosphorylase/p...  47.8    5e-08   
ref|WP_004382555.1|  polynucleotide phosphorylase/polyadenylase       47.8    5e-08   
ref|WP_033084355.1|  polynucleotide phosphorylase/polyadenylase       46.2    5e-08   
ref|WP_022720773.1|  polynucleotide phosphorylase                     43.9    5e-08   
ref|WP_028916013.1|  polynucleotide phosphorylase/polyadenylase       45.4    5e-08   
ref|WP_002936676.1|  polynucleotide phosphorylase/polyadenylase       47.8    5e-08   
ref|WP_012334632.1|  MULTISPECIES: polynucleotide phosphorylase       46.6    5e-08   
ref|WP_024830884.1|  MULTISPECIES: polynucleotide phosphorylase/p...  47.4    5e-08   
ref|WP_012317942.1|  polynucleotide phosphorylase                     47.4    5e-08   
ref|WP_028487949.1|  polynucleotide phosphorylase/polyadenylase       43.5    5e-08   
ref|WP_016844723.1|  hypothetical protein                             44.3    5e-08   
ref|WP_020093743.1|  polynucleotide phosphorylase                     47.4    5e-08   
ref|WP_042674598.1|  polynucleotide phosphorylase/polyadenylase       47.8    5e-08   
ref|WP_024300413.1|  polynucleotide phosphorylase/polyadenylase       47.0    5e-08   
ref|WP_027995753.1|  polynucleotide phosphorylase/polyadenylase       45.8    5e-08   
dbj|GAM53793.1|  polyribonucleotide nucleotidyltransferase            47.0    5e-08   
ref|WP_022372624.1|  polyribonucleotide nucleotidyltransferase        48.5    5e-08   
ref|WP_026344328.1|  polynucleotide phosphorylase/polyadenylase       45.1    5e-08   
ref|WP_026199929.1|  polynucleotide phosphorylase/polyadenylase       45.4    5e-08   
ref|WP_036168049.1|  polynucleotide phosphorylase/polyadenylase       44.7    5e-08   
ref|WP_029143708.1|  polynucleotide phosphorylase/polyadenylase       47.0    6e-08   
emb|CCQ75723.1|  Polynucleotide phosphorylase (PNPase)                45.4    6e-08   
ref|WP_008250522.1|  polynucleotide phosphorylase/polyadenylase       49.7    6e-08   
ref|WP_035016121.1|  polynucleotide phosphorylase/polyadenylase       43.5    6e-08   
ref|WP_018946342.1|  polynucleotide phosphorylase/polyadenylase       45.1    6e-08   
ref|WP_015929523.1|  polynucleotide phosphorylase                     46.6    6e-08   
ref|WP_016957966.1|  hypothetical protein                             43.5    6e-08   
gb|EGK73007.1|  Polyribonucleotide nucleotidyltransferase             47.0    6e-08   
ref|WP_041098334.1|  polynucleotide phosphorylase/polyadenylase       43.9    6e-08   
ref|WP_005370379.1|  MULTISPECIES: polynucleotide phosphorylase/p...  45.4    6e-08   
ref|WP_035653773.1|  polynucleotide phosphorylase/polyadenylase       43.5    6e-08   
ref|WP_040097759.1|  polynucleotide phosphorylase/polyadenylase       45.4    6e-08   
ref|WP_006202930.1|  polynucleotide phosphorylase                     47.0    6e-08   
ref|WP_009605736.1|  polynucleotide phosphorylase                     43.9    6e-08   
ref|WP_034773860.1|  polynucleotide phosphorylase/polyadenylase       45.8    6e-08   
ref|WP_031340780.1|  polynucleotide phosphorylase/polyadenylase       46.6    6e-08   
ref|WP_011439506.1|  polynucleotide phosphorylase                     43.5    6e-08   
ref|WP_019936391.1|  polynucleotide phosphorylase/polyadenylase       47.0    6e-08   
ref|WP_019021184.1|  polynucleotide phosphorylase/polyadenylase       44.7    6e-08   
ref|WP_018869941.1|  polynucleotide phosphorylase/polyadenylase       44.7    6e-08   
ref|WP_028770154.1|  polynucleotide phosphorylase/polyadenylase       45.1    6e-08   
ref|WP_019590683.1|  MULTISPECIES: polynucleotide phosphorylase/p...  44.7    6e-08   
ref|WP_011500657.1|  polynucleotide phosphorylase                     43.5    6e-08   
ref|WP_028491364.1|  polynucleotide phosphorylase/polyadenylase       44.7    6e-08   
ref|WP_019589331.1|  MULTISPECIES: polynucleotide phosphorylase/p...  44.7    6e-08   
ref|WP_028168439.1|  polynucleotide phosphorylase/polyadenylase       43.5    6e-08   
ref|WP_018877169.1|  MULTISPECIES: polynucleotide phosphorylase/p...  42.4    6e-08   
ref|WP_019904369.1|  polynucleotide phosphorylase                     46.2    6e-08   
ref|WP_011814531.1|  polynucleotide phosphorylase/polyadenylase       42.0    6e-08   
ref|WP_037429689.1|  polynucleotide phosphorylase/polyadenylase       42.4    6e-08   
ref|WP_014680097.1|  polynucleotide phosphorylase                     46.2    6e-08   
ref|WP_018867807.1|  MULTISPECIES: polynucleotide phosphorylase/p...  42.4    6e-08   
ref|WP_024298422.1|  polynucleotide phosphorylase/polyadenylase       45.4    6e-08   
ref|WP_019998125.1|  polynucleotide phosphorylase                     45.1    7e-08   
ref|WP_019085202.1|  polynucleotide phosphorylase                     45.1    7e-08   
ref|WP_028761446.1|  polynucleotide phosphorylase/polyadenylase       42.0    7e-08   
ref|WP_021028553.1|  polynucleotide phosphorylase/polyadenylase       45.4    7e-08   
sp|A5FVG2.1|PNP_ACICJ  RecName: Full=Polyribonucleotide nucleotid...  45.8    7e-08   
ref|WP_025439776.1|  polynucleotide phosphorylase/polyadenylase       45.1    7e-08   
ref|WP_010370826.1|  MULTISPECIES: polynucleotide phosphorylase/p...  44.7    7e-08   
ref|WP_015435870.1|  polynucleotide phosphorylase/polyadenylase       47.0    7e-08   
ref|WP_005793234.1|  polynucleotide phosphorylase/polyadenylase       45.1    7e-08   
ref|WP_006156842.1|  polynucleotide phosphorylase/polyadenylase       46.6    7e-08   
ref|WP_039492205.1|  polynucleotide phosphorylase/polyadenylase       44.7    7e-08   
gb|ENN84422.1|  Polyribonucleotide nucleotidyltransferase             46.6    7e-08   
ref|WP_011633051.1|  polynucleotide phosphorylase                     43.9    7e-08   
ref|WP_007421553.1|  MULTISPECIES: polynucleotide phosphorylase       45.8    7e-08   
ref|WP_010509166.1|  polynucleotide phosphorylase                     45.1    7e-08   
ref|WP_025287634.1|  polynucleotide phosphorylase/polyadenylase       43.9    7e-08   
ref|WP_008171541.1|  MULTISPECIES: polynucleotide phosphorylase/p...  52.4    7e-08   
ref|WP_006082711.1|  polynucleotide phosphorylase/polyadenylase       42.0    7e-08   
ref|WP_012089919.1|  polynucleotide phosphorylase/polyadenylase       42.0    7e-08   
ref|WP_012587034.1|  polynucleotide phosphorylase/polyadenylase       42.0    7e-08   
ref|WP_005347480.1|  polynucleotide phosphorylase/polyadenylase       42.7    7e-08   
ref|WP_035868717.1|  polynucleotide phosphorylase/polyadenylase       46.2    7e-08   
gb|ADP98827.1|  polynucleotide phosphorylase/polyadenylase            52.4    7e-08   
ref|WP_023745269.1|  polynucleotide phosphorylase                     46.6    7e-08   
ref|WP_023726859.1|  polynucleotide phosphorylase                     46.6    7e-08   
ref|WP_023669561.1|  MULTISPECIES: polynucleotide phosphorylase       46.6    7e-08   
ref|WP_006337961.1|  Polyribonucleotide nucleotidyltransferase (P...  46.6    7e-08   
ref|WP_011759082.1|  polynucleotide phosphorylase/polyadenylase       42.7    7e-08   
ref|WP_027026605.1|  polynucleotide phosphorylase/polyadenylase       46.6    7e-08   
ref|WP_023816176.1|  MULTISPECIES: polynucleotide phosphorylase       46.6    7e-08   
ref|WP_023696731.1|  polynucleotide phosphorylase                     46.6    7e-08   
ref|WP_023676908.1|  polynucleotide phosphorylase                     46.6    7e-08   
ref|WP_008872223.1|  Polyribonucleotide nucleotidyltransferase (P...  46.6    7e-08   
gb|AFT74511.1|  polynucleotide phosphorylase/polyadenylase            45.1    7e-08   
ref|WP_023730929.1|  polynucleotide phosphorylase                     46.6    7e-08   
dbj|BAQ44602.1|  polynucleotide phosphorylase/polyadenylase           45.8    7e-08   
ref|WP_023682005.1|  MULTISPECIES: polynucleotide phosphorylase       46.6    8e-08   
ref|WP_023802123.1|  polynucleotide phosphorylase                     46.6    8e-08   



>emb|CDP02087.1| unnamed protein product [Coffea canephora]
Length=972

 Score =   152 bits (385),  Expect(2) = 2e-45, Method: Compositional matrix adjust.
 Identities = 85/110 (77%), Positives = 95/110 (86%), Gaps = 5/110 (5%)
 Frame = +2

Query  104  MASVTSKANPLISTLPHVLTWQRFGFRTICSGRLGFAtstlssps-----sdsetHMAGT  268
            MASV+SKANPLISTLPH+LTW RF FRT+CSGRLGFA+ + SS S       SET +AGT
Sbjct  1    MASVSSKANPLISTLPHILTWPRFRFRTMCSGRLGFASYSSSSTSASVSPVTSETPVAGT  60

Query  269  KILESFTEEFEIGSRKITLETGKIARFANGSVVLAMDETKVLSTVASAKG  418
            K+LE+F EEFEIGSR ITLETGKIARFANG+VVLAM+ETKVLSTVASAKG
Sbjct  61   KVLETFKEEFEIGSRPITLETGKIARFANGAVVLAMEETKVLSTVASAKG  110


 Score = 56.6 bits (135),  Expect(2) = 2e-45, Method: Composition-based stats.
 Identities = 23/29 (79%), Positives = 28/29 (97%), Gaps = 0/29 (0%)
 Frame = +3

Query  414  RGDAVRDFLPLTVDYQEKQFAQGLIPSTF  500
            +GD VRDFLPLTV+YQEKQFAQG+IP+T+
Sbjct  109  KGDGVRDFLPLTVEYQEKQFAQGVIPNTY  137



>ref|XP_006338583.1| PREDICTED: polyribonucleotide nucleotidyltransferase 2, mitochondrial-like 
[Solanum tuberosum]
Length=977

 Score =   152 bits (383),  Expect(2) = 2e-45, Method: Compositional matrix adjust.
 Identities = 79/105 (75%), Positives = 90/105 (86%), Gaps = 1/105 (1%)
 Frame = +2

Query  104  MASVTSKANPLISTLPHVLTWQRFGFRTICSGRLGFAtstlsspssdsetHMAGTKILES  283
            MASV +K NPL+  LP+VLTW+RFGFRTICSGRLGFA ST  S +      +AGTK+LE+
Sbjct  1    MASVRNKINPLLCNLPYVLTWRRFGFRTICSGRLGFAPSTSPSMADTDTP-VAGTKVLET  59

Query  284  FTEEFEIGSRKITLETGKIARFANGSVVLAMDETKVLSTVASAKG  418
            F EEFEIGSRKITLETGKIARFANGSV+LAM+ETKVLSTVAS+KG
Sbjct  60   FAEEFEIGSRKITLETGKIARFANGSVILAMEETKVLSTVASSKG  104


 Score = 57.0 bits (136),  Expect(2) = 2e-45, Method: Composition-based stats.
 Identities = 23/29 (79%), Positives = 28/29 (97%), Gaps = 0/29 (0%)
 Frame = +3

Query  414  RGDAVRDFLPLTVDYQEKQFAQGLIPSTF  500
            +GDA+RDFLPLTVDYQEKQFAQ +IP+T+
Sbjct  103  KGDAIRDFLPLTVDYQEKQFAQSVIPTTY  131



>ref|XP_009614932.1| PREDICTED: polyribonucleotide nucleotidyltransferase 2, mitochondrial 
[Nicotiana tomentosiformis]
Length=981

 Score =   150 bits (379),  Expect(2) = 3e-45, Method: Compositional matrix adjust.
 Identities = 79/111 (71%), Positives = 91/111 (82%), Gaps = 2/111 (2%)
 Frame = +2

Query  104  MASVTSKANPLISTLPHVLTWQRFGFRTICSGRLGFAtstlsspssdsetHMAGTKILES  283
            MASV +K NPL+  +P+VLTW+RFGFRTICSGR+GFA ST  S +      +AG K+LE+
Sbjct  1    MASVRNKVNPLL--IPYVLTWRRFGFRTICSGRIGFAPSTSPSFADADTPPVAGKKVLET  58

Query  284  FTEEFEIGSRKITLETGKIARFANGSVVLAMDETKVLSTVASAKGRRSSRF  436
            F EEFEIGSRKITLETGKIARFANGSVVLAMDETKVLSTVAS+KG  +  F
Sbjct  59   FAEEFEIGSRKITLETGKIARFANGSVVLAMDETKVLSTVASSKGDAARDF  109


 Score = 58.2 bits (139),  Expect(2) = 3e-45, Method: Composition-based stats.
 Identities = 24/29 (83%), Positives = 28/29 (97%), Gaps = 0/29 (0%)
 Frame = +3

Query  414  RGDAVRDFLPLTVDYQEKQFAQGLIPSTF  500
            +GDA RDFLPLTVDYQEKQFAQG+IP+T+
Sbjct  102  KGDAARDFLPLTVDYQEKQFAQGVIPTTY  130



>ref|XP_009768206.1| PREDICTED: polyribonucleotide nucleotidyltransferase 2, mitochondrial 
[Nicotiana sylvestris]
Length=981

 Score =   148 bits (374),  Expect(2) = 9e-45, Method: Compositional matrix adjust.
 Identities = 79/111 (71%), Positives = 90/111 (81%), Gaps = 2/111 (2%)
 Frame = +2

Query  104  MASVTSKANPLISTLPHVLTWQRFGFRTICSGRLGFAtstlsspssdsetHMAGTKILES  283
            MASV +K NPL+  +P+VLTW+RFGFRTICS R+GFA ST  S +      +AG KILE+
Sbjct  1    MASVRNKVNPLL--IPYVLTWRRFGFRTICSSRIGFAPSTSPSFADADTPPVAGKKILET  58

Query  284  FTEEFEIGSRKITLETGKIARFANGSVVLAMDETKVLSTVASAKGRRSSRF  436
            F EEFEIGSRKITLETGKIARFANGSVVLAMDETKVLSTVAS+KG  +  F
Sbjct  59   FAEEFEIGSRKITLETGKIARFANGSVVLAMDETKVLSTVASSKGDAARDF  109


 Score = 58.5 bits (140),  Expect(2) = 9e-45, Method: Composition-based stats.
 Identities = 24/29 (83%), Positives = 28/29 (97%), Gaps = 0/29 (0%)
 Frame = +3

Query  414  RGDAVRDFLPLTVDYQEKQFAQGLIPSTF  500
            +GDA RDFLPLTVDYQEKQFAQG+IP+T+
Sbjct  102  KGDAARDFLPLTVDYQEKQFAQGVIPTTY  130



>ref|XP_010316293.1| PREDICTED: polyribonucleotide nucleotidyltransferase 2, mitochondrial 
[Solanum lycopersicum]
Length=983

 Score =   152 bits (383),  Expect(2) = 1e-44, Method: Compositional matrix adjust.
 Identities = 81/111 (73%), Positives = 93/111 (84%), Gaps = 1/111 (1%)
 Frame = +2

Query  104  MASVTSKANPLISTLPHVLTWQRFGFRTICSGRLGFAtstlsspssdsetHMAGTKILES  283
            MASV +K NPL+  LP+VLTW+RFGFRTICSGRLGFA ST  S ++     +A TK+LE+
Sbjct  1    MASVRNKINPLLCNLPYVLTWRRFGFRTICSGRLGFAPSTSPSVANTDTP-VARTKVLET  59

Query  284  FTEEFEIGSRKITLETGKIARFANGSVVLAMDETKVLSTVASAKGRRSSRF  436
            FTEEFEIGSRKITLETGKIARFANGSV+LAM+ETKVLSTVAS+KG   S F
Sbjct  60   FTEEFEIGSRKITLETGKIARFANGSVILAMEETKVLSTVASSKGDAISDF  110


 Score = 54.7 bits (130),  Expect(2) = 1e-44, Method: Composition-based stats.
 Identities = 22/29 (76%), Positives = 27/29 (93%), Gaps = 0/29 (0%)
 Frame = +3

Query  414  RGDAVRDFLPLTVDYQEKQFAQGLIPSTF  500
            +GDA+ DFLPLTVDYQEKQFAQ +IP+T+
Sbjct  103  KGDAISDFLPLTVDYQEKQFAQSVIPTTY  131



>ref|XP_008341437.1| PREDICTED: LOW QUALITY PROTEIN: polyribonucleotide nucleotidyltransferase 
2, mitochondrial [Malus domestica]
Length=945

 Score =   138 bits (347),  Expect(2) = 1e-42, Method: Compositional matrix adjust.
 Identities = 68/105 (65%), Positives = 87/105 (83%), Gaps = 2/105 (2%)
 Frame = +2

Query  104  MASVTSKANPLISTLPHVLTWQRFGFRTICSGRLGFAtstlsspssdsetHMAGTKILES  283
            MAS+ ++ANPL++ LPH LTW+  GFRTICSGR+GF++ +   P  ++   +AGTK+LE+
Sbjct  1    MASMANRANPLLNNLPHFLTWRALGFRTICSGRMGFSSQSERQPDPETP--VAGTKVLET  58

Query  284  FTEEFEIGSRKITLETGKIARFANGSVVLAMDETKVLSTVASAKG  418
            F EEFE+G R ITLETGKIARFANG+VVL M+ETKVLSTVA+AKG
Sbjct  59   FREEFEVGDRLITLETGKIARFANGAVVLGMEETKVLSTVAAAKG  103


 Score = 61.2 bits (147),  Expect(2) = 1e-42, Method: Composition-based stats.
 Identities = 26/29 (90%), Positives = 29/29 (100%), Gaps = 0/29 (0%)
 Frame = +3

Query  414  RGDAVRDFLPLTVDYQEKQFAQGLIPSTF  500
            +GDAVRDFLPLTVDYQEKQFAQG+IP+TF
Sbjct  102  KGDAVRDFLPLTVDYQEKQFAQGVIPNTF  130



>ref|XP_007217697.1| hypothetical protein PRUPE_ppa000918mg [Prunus persica]
 gb|EMJ18896.1| hypothetical protein PRUPE_ppa000918mg [Prunus persica]
Length=962

 Score =   138 bits (347),  Expect(2) = 2e-42, Method: Compositional matrix adjust.
 Identities = 68/105 (65%), Positives = 86/105 (82%), Gaps = 2/105 (2%)
 Frame = +2

Query  104  MASVTSKANPLISTLPHVLTWQRFGFRTICSGRLGFAtstlsspssdsetHMAGTKILES  283
            MAS+ ++ANPL++ LPH LTW+  GFRTICSGR+GF++ +      +S   +AGTK+LE+
Sbjct  1    MASMANRANPLLNNLPHFLTWRALGFRTICSGRMGFSSQSQRQLDPESP--VAGTKVLET  58

Query  284  FTEEFEIGSRKITLETGKIARFANGSVVLAMDETKVLSTVASAKG  418
            F EEFEIG R ITLE+GKIARFANG+VVL M+ETKVLSTVA+AKG
Sbjct  59   FKEEFEIGDRLITLESGKIARFANGAVVLGMEETKVLSTVAAAKG  103


 Score = 60.8 bits (146),  Expect(2) = 2e-42, Method: Composition-based stats.
 Identities = 26/29 (90%), Positives = 29/29 (100%), Gaps = 0/29 (0%)
 Frame = +3

Query  414  RGDAVRDFLPLTVDYQEKQFAQGLIPSTF  500
            +GDAVRDFLPLTVDYQEKQFAQG+IP+TF
Sbjct  102  KGDAVRDFLPLTVDYQEKQFAQGVIPNTF  130



>ref|XP_009377194.1| PREDICTED: polyribonucleotide nucleotidyltransferase 2, mitochondrial 
[Pyrus x bretschneideri]
Length=944

 Score =   138 bits (348),  Expect(2) = 3e-42, Method: Compositional matrix adjust.
 Identities = 68/105 (65%), Positives = 86/105 (82%), Gaps = 2/105 (2%)
 Frame = +2

Query  104  MASVTSKANPLISTLPHVLTWQRFGFRTICSGRLGFAtstlsspssdsetHMAGTKILES  283
            MAS+ ++ANPL++ LPH LTW+  GFRTICSGR+GF++ +   P   +   +AGTK+LE+
Sbjct  1    MASMANRANPLLNNLPHFLTWRALGFRTICSGRMGFSSQSERQPDPQTP--VAGTKVLET  58

Query  284  FTEEFEIGSRKITLETGKIARFANGSVVLAMDETKVLSTVASAKG  418
            F EEFE+G R ITLETGKIARFANG+VVL M+ETKVLSTVA+AKG
Sbjct  59   FREEFEVGDRLITLETGKIARFANGAVVLGMEETKVLSTVAAAKG  103


 Score = 60.1 bits (144),  Expect(2) = 3e-42, Method: Composition-based stats.
 Identities = 26/29 (90%), Positives = 28/29 (97%), Gaps = 0/29 (0%)
 Frame = +3

Query  414  RGDAVRDFLPLTVDYQEKQFAQGLIPSTF  500
            +GDAVRDFLPLTVDYQEKQFAQG IP+TF
Sbjct  102  KGDAVRDFLPLTVDYQEKQFAQGAIPNTF  130



>ref|XP_008230570.1| PREDICTED: polyribonucleotide nucleotidyltransferase 2, mitochondrial 
[Prunus mume]
Length=963

 Score =   135 bits (340),  Expect(2) = 2e-41, Method: Compositional matrix adjust.
 Identities = 67/105 (64%), Positives = 85/105 (81%), Gaps = 2/105 (2%)
 Frame = +2

Query  104  MASVTSKANPLISTLPHVLTWQRFGFRTICSGRLGFAtstlsspssdsetHMAGTKILES  283
            MA + ++ANPL++ LPH LTW+  GFRTICSGR+GF++ +      +S   +AGTK+LE+
Sbjct  1    MAFMANRANPLLNNLPHFLTWRALGFRTICSGRMGFSSQSQRQLDPESP--VAGTKVLET  58

Query  284  FTEEFEIGSRKITLETGKIARFANGSVVLAMDETKVLSTVASAKG  418
            F EEFEIG R ITLE+GKIARFANG+VVL M+ETKVLSTVA+AKG
Sbjct  59   FKEEFEIGDRLITLESGKIARFANGAVVLGMEETKVLSTVAAAKG  103


 Score = 60.8 bits (146),  Expect(2) = 2e-41, Method: Composition-based stats.
 Identities = 26/29 (90%), Positives = 29/29 (100%), Gaps = 0/29 (0%)
 Frame = +3

Query  414  RGDAVRDFLPLTVDYQEKQFAQGLIPSTF  500
            +GDAVRDFLPLTVDYQEKQFAQG+IP+TF
Sbjct  102  KGDAVRDFLPLTVDYQEKQFAQGVIPNTF  130



>ref|XP_008443548.1| PREDICTED: polyribonucleotide nucleotidyltransferase 2, mitochondrial 
[Cucumis melo]
Length=1026

 Score =   136 bits (342),  Expect(2) = 6e-41, Method: Compositional matrix adjust.
 Identities = 70/105 (67%), Positives = 84/105 (80%), Gaps = 0/105 (0%)
 Frame = +2

Query  104  MASVTSKANPLISTLPHVLTWQRFGFRTICSGRLGFAtstlsspssdsetHMAGTKILES  283
            MAS+ SKANPL ST+PH LTW+  GFRTIC GR+GFA+ + S    D +T + GTK+LE+
Sbjct  1    MASMASKANPLFSTIPHFLTWRSHGFRTICCGRMGFASQSQSQQQLDPDTTLGGTKVLET  60

Query  284  FTEEFEIGSRKITLETGKIARFANGSVVLAMDETKVLSTVASAKG  418
            F E FEIGSR + LETGKIARFANG+ VL ++ETKVLSTVASAKG
Sbjct  61   FEEVFEIGSRLVKLETGKIARFANGAAVLGIEETKVLSTVASAKG  105


 Score = 58.2 bits (139),  Expect(2) = 6e-41, Method: Composition-based stats.
 Identities = 25/29 (86%), Positives = 27/29 (93%), Gaps = 0/29 (0%)
 Frame = +3

Query  414  RGDAVRDFLPLTVDYQEKQFAQGLIPSTF  500
            +G AVRDFLPLTVDYQEKQFAQG+IP TF
Sbjct  104  KGGAVRDFLPLTVDYQEKQFAQGVIPGTF  132



>ref|XP_006470281.1| PREDICTED: polyribonucleotide nucleotidyltransferase 2, mitochondrial-like 
[Citrus sinensis]
Length=974

 Score =   132 bits (333),  Expect(2) = 4e-40, Method: Compositional matrix adjust.
 Identities = 70/111 (63%), Positives = 84/111 (76%), Gaps = 2/111 (2%)
 Frame = +2

Query  104  MASVTSKANPLISTLPHVLTWQRFGFRTICSGRLGFAtstlsspssdsetHMAGTKILES  283
            M+S+ +K +PL++ LP  LTW+  GFRTICSGRLGFA    + P+      +AGTK+LE+
Sbjct  1    MSSLATKTHPLLNNLPPFLTWRALGFRTICSGRLGFAPCEPAPPTPAPS--VAGTKVLET  58

Query  284  FTEEFEIGSRKITLETGKIARFANGSVVLAMDETKVLSTVASAKGRRSSRF  436
            F EEFEIGSR ITLETGKIARFANG+VVL MDETKVLSTV S+KG     F
Sbjct  59   FKEEFEIGSRLITLETGKIARFANGAVVLGMDETKVLSTVTSSKGDSVRDF  109


 Score = 58.5 bits (140),  Expect(2) = 4e-40, Method: Composition-based stats.
 Identities = 24/29 (83%), Positives = 29/29 (100%), Gaps = 0/29 (0%)
 Frame = +3

Query  414  RGDAVRDFLPLTVDYQEKQFAQGLIPSTF  500
            +GD+VRDFLPLTVDYQEKQFAQG+IP+T+
Sbjct  102  KGDSVRDFLPLTVDYQEKQFAQGVIPNTY  130



>gb|KDO55206.1| hypothetical protein CISIN_1g002054mg [Citrus sinensis]
Length=974

 Score =   132 bits (333),  Expect(2) = 4e-40, Method: Compositional matrix adjust.
 Identities = 70/111 (63%), Positives = 84/111 (76%), Gaps = 2/111 (2%)
 Frame = +2

Query  104  MASVTSKANPLISTLPHVLTWQRFGFRTICSGRLGFAtstlsspssdsetHMAGTKILES  283
            M+S+ +K +PL++ LP  LTW+  GFRTICSGRLGFA    + P+      +AGTK+LE+
Sbjct  1    MSSLATKTHPLLNNLPPFLTWRALGFRTICSGRLGFAPCEPAPPTPAPS--VAGTKVLET  58

Query  284  FTEEFEIGSRKITLETGKIARFANGSVVLAMDETKVLSTVASAKGRRSSRF  436
            F EEFEIGSR ITLETGKIARFANG+VVL MDETKVLSTV S+KG     F
Sbjct  59   FKEEFEIGSRLITLETGKIARFANGAVVLGMDETKVLSTVTSSKGDSVRDF  109


 Score = 58.5 bits (140),  Expect(2) = 4e-40, Method: Composition-based stats.
 Identities = 24/29 (83%), Positives = 29/29 (100%), Gaps = 0/29 (0%)
 Frame = +3

Query  414  RGDAVRDFLPLTVDYQEKQFAQGLIPSTF  500
            +GD+VRDFLPLTVDYQEKQFAQG+IP+T+
Sbjct  102  KGDSVRDFLPLTVDYQEKQFAQGVIPNTY  130



>ref|XP_006446552.1| hypothetical protein CICLE_v10014159mg [Citrus clementina]
 gb|ESR59792.1| hypothetical protein CICLE_v10014159mg [Citrus clementina]
Length=973

 Score =   132 bits (333),  Expect(2) = 4e-40, Method: Compositional matrix adjust.
 Identities = 70/111 (63%), Positives = 84/111 (76%), Gaps = 2/111 (2%)
 Frame = +2

Query  104  MASVTSKANPLISTLPHVLTWQRFGFRTICSGRLGFAtstlsspssdsetHMAGTKILES  283
            M+S+ +K +PL++ LP  LTW+  GFRTICSGRLGFA    + P+      +AGTK+LE+
Sbjct  1    MSSLATKTHPLLNNLPPFLTWRALGFRTICSGRLGFAPCEPAPPTPAPS--VAGTKVLET  58

Query  284  FTEEFEIGSRKITLETGKIARFANGSVVLAMDETKVLSTVASAKGRRSSRF  436
            F EEFEIGSR ITLETGKIARFANG+VVL MDETKVLSTV S+KG     F
Sbjct  59   FKEEFEIGSRLITLETGKIARFANGAVVLGMDETKVLSTVTSSKGDSVRDF  109


 Score = 58.5 bits (140),  Expect(2) = 4e-40, Method: Composition-based stats.
 Identities = 24/29 (83%), Positives = 29/29 (100%), Gaps = 0/29 (0%)
 Frame = +3

Query  414  RGDAVRDFLPLTVDYQEKQFAQGLIPSTF  500
            +GD+VRDFLPLTVDYQEKQFAQG+IP+T+
Sbjct  102  KGDSVRDFLPLTVDYQEKQFAQGVIPNTY  130



>ref|XP_010248545.1| PREDICTED: polyribonucleotide nucleotidyltransferase 2, mitochondrial 
isoform X1 [Nelumbo nucifera]
Length=991

 Score =   135 bits (339),  Expect(2) = 5e-40, Method: Compositional matrix adjust.
 Identities = 69/111 (62%), Positives = 89/111 (80%), Gaps = 4/111 (4%)
 Frame = +2

Query  104  MASVTSKANPLISTLPHVLTWQRFGFRTICSGRLGFAtstlsspssdsetHMAGTKILES  283
            MA++ S++NPL++++P  LTW+RFGFR+ICSGRLGF +S+ +   + S    AGTK+LE+
Sbjct  1    MATLASRSNPLLTSIPAYLTWRRFGFRSICSGRLGFLSSSPTDAETPS----AGTKLLET  56

Query  284  FTEEFEIGSRKITLETGKIARFANGSVVLAMDETKVLSTVASAKGRRSSRF  436
            F EEFEIGS  IT ETGKIARFANG+VV+AMD+TKVLSTVAS+KG     F
Sbjct  57   FKEEFEIGSHLITFETGKIARFANGAVVMAMDKTKVLSTVASSKGDNVKDF  107


 Score = 55.8 bits (133),  Expect(2) = 5e-40, Method: Composition-based stats.
 Identities = 24/29 (83%), Positives = 27/29 (93%), Gaps = 0/29 (0%)
 Frame = +3

Query  414  RGDAVRDFLPLTVDYQEKQFAQGLIPSTF  500
            +GD V+DFLPLTV+YQEKQFAQGLIP TF
Sbjct  100  KGDNVKDFLPLTVEYQEKQFAQGLIPHTF  128



>ref|XP_010248546.1| PREDICTED: polyribonucleotide nucleotidyltransferase 2, mitochondrial 
isoform X2 [Nelumbo nucifera]
Length=971

 Score =   135 bits (339),  Expect(2) = 6e-40, Method: Compositional matrix adjust.
 Identities = 69/111 (62%), Positives = 89/111 (80%), Gaps = 4/111 (4%)
 Frame = +2

Query  104  MASVTSKANPLISTLPHVLTWQRFGFRTICSGRLGFAtstlsspssdsetHMAGTKILES  283
            MA++ S++NPL++++P  LTW+RFGFR+ICSGRLGF +S+ +   + S    AGTK+LE+
Sbjct  1    MATLASRSNPLLTSIPAYLTWRRFGFRSICSGRLGFLSSSPTDAETPS----AGTKLLET  56

Query  284  FTEEFEIGSRKITLETGKIARFANGSVVLAMDETKVLSTVASAKGRRSSRF  436
            F EEFEIGS  IT ETGKIARFANG+VV+AMD+TKVLSTVAS+KG     F
Sbjct  57   FKEEFEIGSHLITFETGKIARFANGAVVMAMDKTKVLSTVASSKGDNVKDF  107


 Score = 55.8 bits (133),  Expect(2) = 6e-40, Method: Composition-based stats.
 Identities = 24/29 (83%), Positives = 27/29 (93%), Gaps = 0/29 (0%)
 Frame = +3

Query  414  RGDAVRDFLPLTVDYQEKQFAQGLIPSTF  500
            +GD V+DFLPLTV+YQEKQFAQGLIP TF
Sbjct  100  KGDNVKDFLPLTVEYQEKQFAQGLIPHTF  128



>ref|XP_004304642.1| PREDICTED: polyribonucleotide nucleotidyltransferase 2, mitochondrial 
[Fragaria vesca subsp. vesca]
Length=969

 Score =   130 bits (328),  Expect(2) = 9e-40, Method: Compositional matrix adjust.
 Identities = 66/99 (67%), Positives = 79/99 (80%), Gaps = 3/99 (3%)
 Frame = +2

Query  122  KANPLISTLPHVLTWQRFGFRTICSGRLGFAtstlsspssdsetHMAGTKILESFTEEFE  301
            +ANPL+  LPH LTW+  GFRT+CSGR+GF++     P S +     GTK+LE+FTE+FE
Sbjct  8    RANPLLGRLPHFLTWRSLGFRTVCSGRMGFSSQPEPEPESHTR---PGTKLLETFTEQFE  64

Query  302  IGSRKITLETGKIARFANGSVVLAMDETKVLSTVASAKG  418
            IGSR ITLETGKIARFANGSVVL MD+T+VLSTV SAKG
Sbjct  65   IGSRLITLETGKIARFANGSVVLGMDDTRVLSTVCSAKG  103


 Score = 59.3 bits (142),  Expect(2) = 9e-40, Method: Composition-based stats.
 Identities = 25/29 (86%), Positives = 29/29 (100%), Gaps = 0/29 (0%)
 Frame = +3

Query  414  RGDAVRDFLPLTVDYQEKQFAQGLIPSTF  500
            +GDAV+DFLPLTVDYQEKQFAQG+IP+TF
Sbjct  102  KGDAVKDFLPLTVDYQEKQFAQGVIPNTF  130



>ref|XP_004164730.1| PREDICTED: LOW QUALITY PROTEIN: polyribonucleotide nucleotidyltransferase 
2, mitochondrial-like [Cucumis sativus]
Length=955

 Score =   130 bits (326),  Expect(2) = 1e-39, Method: Composition-based stats.
 Identities = 65/111 (59%), Positives = 83/111 (75%), Gaps = 2/111 (2%)
 Frame = +2

Query  104  MASVTSKANPLISTLPHVLTWQRFGFRTICSGRLGFAtstlsspssdsetHMAGTKILES  283
            MAS+ +KANPL ST+PH LTW+  GFRTIC GR+GF++ +      ++   +  TK+LE+
Sbjct  1    MASMATKANPLFSTIPHFLTWRSLGFRTICCGRMGFSSQSQQQVDPNTT--LGRTKVLET  58

Query  284  FTEEFEIGSRKITLETGKIARFANGSVVLAMDETKVLSTVASAKGRRSSRF  436
            F E FEIGSR + LETGKIARFANG+ VL ++ETKVLSTVASAKG  +  F
Sbjct  59   FEEVFEIGSRLVKLETGKIARFANGAAVLGIEETKVLSTVASAKGDAARDF  109


 Score = 59.7 bits (143),  Expect(2) = 1e-39, Method: Composition-based stats.
 Identities = 25/29 (86%), Positives = 27/29 (93%), Gaps = 0/29 (0%)
 Frame = +3

Query  414  RGDAVRDFLPLTVDYQEKQFAQGLIPSTF  500
            +GDA RDFLPLTVDYQEKQFAQG+IP TF
Sbjct  102  KGDAARDFLPLTVDYQEKQFAQGVIPGTF  130



>ref|XP_011047330.1| PREDICTED: polyribonucleotide nucleotidyltransferase 2, mitochondrial 
[Populus euphratica]
Length=965

 Score =   129 bits (325),  Expect(2) = 2e-39, Method: Compositional matrix adjust.
 Identities = 71/106 (67%), Positives = 81/106 (76%), Gaps = 5/106 (5%)
 Frame = +2

Query  101  IMASVTSKANPLISTLPHVLTWQRFGFRTICSGRLGFAtstlsspssdsetHMAGTKILE  280
            IMA+  S++NPL+++LP  LTW+  GFRTICSGRLGFA S        S    AGTK LE
Sbjct  4    IMAA--SRSNPLLNSLPRFLTWRSLGFRTICSGRLGFAPSDPDPEPPVST---AGTKFLE  58

Query  281  SFTEEFEIGSRKITLETGKIARFANGSVVLAMDETKVLSTVASAKG  418
            +F EEFEIGSR IT ETGKIARFANGSVVL M+ETKVLSTV S+KG
Sbjct  59   TFREEFEIGSRLITFETGKIARFANGSVVLGMEETKVLSTVTSSKG  104


 Score = 59.7 bits (143),  Expect(2) = 2e-39, Method: Composition-based stats.
 Identities = 25/29 (86%), Positives = 29/29 (100%), Gaps = 0/29 (0%)
 Frame = +3

Query  414  RGDAVRDFLPLTVDYQEKQFAQGLIPSTF  500
            +GD+VRDFLPLTVDYQEKQFAQG+IPST+
Sbjct  103  KGDSVRDFLPLTVDYQEKQFAQGVIPSTY  131



>ref|XP_004141096.1| PREDICTED: polyribonucleotide nucleotidyltransferase 2, mitochondrial-like 
[Cucumis sativus]
 gb|KGN59689.1| hypothetical protein Csa_3G838680 [Cucumis sativus]
Length=1032

 Score =   129 bits (324),  Expect(2) = 2e-39, Method: Composition-based stats.
 Identities = 65/111 (59%), Positives = 83/111 (75%), Gaps = 2/111 (2%)
 Frame = +2

Query  104  MASVTSKANPLISTLPHVLTWQRFGFRTICSGRLGFAtstlsspssdsetHMAGTKILES  283
            MAS+ +KANPL ST+PH LTW+  GFRTIC GR+GF++ +      ++   +  TK+LE+
Sbjct  1    MASMATKANPLFSTIPHFLTWRSLGFRTICCGRMGFSSQSQQQVDPNTT--LGRTKVLET  58

Query  284  FTEEFEIGSRKITLETGKIARFANGSVVLAMDETKVLSTVASAKGRRSSRF  436
            F E FEIGSR + LETGKIARFANG+ VL ++ETKVLSTVASAKG  +  F
Sbjct  59   FEEVFEIGSRLVKLETGKIARFANGAAVLGIEETKVLSTVASAKGDAARDF  109


 Score = 59.7 bits (143),  Expect(2) = 2e-39, Method: Composition-based stats.
 Identities = 25/29 (86%), Positives = 27/29 (93%), Gaps = 0/29 (0%)
 Frame = +3

Query  414  RGDAVRDFLPLTVDYQEKQFAQGLIPSTF  500
            +GDA RDFLPLTVDYQEKQFAQG+IP TF
Sbjct  102  KGDAARDFLPLTVDYQEKQFAQGVIPGTF  130



>ref|XP_002300042.2| hypothetical protein POPTR_0001s35070g [Populus trichocarpa]
 gb|EEE84847.2| hypothetical protein POPTR_0001s35070g [Populus trichocarpa]
Length=961

 Score =   128 bits (322),  Expect(2) = 3e-39, Method: Compositional matrix adjust.
 Identities = 68/100 (68%), Positives = 77/100 (77%), Gaps = 3/100 (3%)
 Frame = +2

Query  119  SKANPLISTLPHVLTWQRFGFRTICSGRLGFAtstlsspssdsetHMAGTKILESFTEEF  298
            S++NPL+++LP  LTW+  GFRTICSGRLGFA S        S    AGTK LE+F EEF
Sbjct  4    SRSNPLLNSLPRFLTWRSLGFRTICSGRLGFAPSDPDPEPPVST---AGTKFLETFREEF  60

Query  299  EIGSRKITLETGKIARFANGSVVLAMDETKVLSTVASAKG  418
            EIGSR IT ETGKIARFANGSVVL M+ETKVLSTV S+KG
Sbjct  61   EIGSRLITFETGKIARFANGSVVLGMEETKVLSTVTSSKG  100


 Score = 59.7 bits (143),  Expect(2) = 3e-39, Method: Composition-based stats.
 Identities = 25/29 (86%), Positives = 29/29 (100%), Gaps = 0/29 (0%)
 Frame = +3

Query  414  RGDAVRDFLPLTVDYQEKQFAQGLIPSTF  500
            +GD+VRDFLPLTVDYQEKQFAQG+IPST+
Sbjct  99   KGDSVRDFLPLTVDYQEKQFAQGVIPSTY  127



>ref|XP_010108800.1| Polyribonucleotide nucleotidyltransferase [Morus notabilis]
 gb|EXC20315.1| Polyribonucleotide nucleotidyltransferase [Morus notabilis]
Length=167

 Score =   135 bits (339),  Expect(2) = 9e-39, Method: Compositional matrix adjust.
 Identities = 71/111 (64%), Positives = 84/111 (76%), Gaps = 1/111 (1%)
 Frame = +2

Query  104  MASVTSKANPLISTLPHVLTWQRFGFRTICSGRLGFAtstlsspssdsetHMAGTKILES  283
            M SV S+ANPL+ T+PH LTW+  GFRTICSGRLGFAT +    +      +AGTK+LE+
Sbjct  1    MVSVASRANPLLRTVPHFLTWRGLGFRTICSGRLGFATLSEPLGTDAEP-SVAGTKVLET  59

Query  284  FTEEFEIGSRKITLETGKIARFANGSVVLAMDETKVLSTVASAKGRRSSRF  436
            F EEFE+G R ITLETGKIARFANG+VVL +DETKVLSTV SAK    + F
Sbjct  60   FREEFEVGLRIITLETGKIARFANGAVVLGIDETKVLSTVTSAKSNAVADF  110


 Score = 52.0 bits (123),  Expect(2) = 9e-39, Method: Compositional matrix adjust.
 Identities = 22/29 (76%), Positives = 27/29 (93%), Gaps = 0/29 (0%)
 Frame = +3

Query  414  RGDAVRDFLPLTVDYQEKQFAQGLIPSTF  500
            + +AV DFLPLTVDYQEKQFAQG+IP+T+
Sbjct  103  KSNAVADFLPLTVDYQEKQFAQGVIPNTY  131



>ref|XP_002524669.1| polyribonucleotide nucleotidyltransferase, putative [Ricinus 
communis]
 gb|EEF37688.1| polyribonucleotide nucleotidyltransferase, putative [Ricinus 
communis]
Length=958

 Score =   125 bits (314),  Expect(2) = 1e-38, Method: Compositional matrix adjust.
 Identities = 66/100 (66%), Positives = 80/100 (80%), Gaps = 7/100 (7%)
 Frame = +2

Query  119  SKANPLISTLPHVLTWQRFGFRTICSGRLGFAtstlsspssdsetHMAGTKILESFTEEF  298
            SKANPL+++LP  LT + F FRTICSGRLGFA S    P       +AGTK+LE+F EEF
Sbjct  7    SKANPLVNSLPRFLTRRSFNFRTICSGRLGFAPSYPDRP-------VAGTKVLETFKEEF  59

Query  299  EIGSRKITLETGKIARFANGSVVLAMDETKVLSTVASAKG  418
            EIGS+ I+LETG+IARFANG+VVL+MD+TKVLSTV S+KG
Sbjct  60   EIGSQVISLETGEIARFANGAVVLSMDQTKVLSTVTSSKG  99


 Score = 60.8 bits (146),  Expect(2) = 1e-38, Method: Composition-based stats.
 Identities = 26/29 (90%), Positives = 29/29 (100%), Gaps = 0/29 (0%)
 Frame = +3

Query  414  RGDAVRDFLPLTVDYQEKQFAQGLIPSTF  500
            +GDAVRDFLPLTVDYQEKQFAQG+IP+TF
Sbjct  98   KGDAVRDFLPLTVDYQEKQFAQGVIPNTF  126



>gb|KDP45314.1| hypothetical protein JCGZ_09563 [Jatropha curcas]
Length=938

 Score =   127 bits (318),  Expect(2) = 2e-38, Method: Composition-based stats.
 Identities = 69/108 (64%), Positives = 82/108 (76%), Gaps = 10/108 (9%)
 Frame = +2

Query  104  MASVTSK---ANPLISTLPHVLTWQRFGFRTICSGRLGFAtstlsspssdsetHMAGTKI  274
            M+S+ S+   AN L S+LP+ LTW+  GFR ICSGRLGFA S    P       +AGTK+
Sbjct  1    MSSIASRGYRANSLRSSLPYFLTWRALGFRNICSGRLGFAPSDPDLP-------VAGTKV  53

Query  275  LESFTEEFEIGSRKITLETGKIARFANGSVVLAMDETKVLSTVASAKG  418
            LE+F EEFE+GSR ITLETGKIARFANG+VVL +DETKVLSTV +AKG
Sbjct  54   LETFKEEFEVGSRLITLETGKIARFANGAVVLGIDETKVLSTVTAAKG  101


 Score = 59.3 bits (142),  Expect(2) = 2e-38, Method: Composition-based stats.
 Identities = 25/29 (86%), Positives = 28/29 (97%), Gaps = 0/29 (0%)
 Frame = +3

Query  414  RGDAVRDFLPLTVDYQEKQFAQGLIPSTF  500
            +GD+VRDFLPLTVDYQEKQFAQG+IP TF
Sbjct  100  KGDSVRDFLPLTVDYQEKQFAQGVIPHTF  128



>ref|XP_010660886.1| PREDICTED: polyribonucleotide nucleotidyltransferase 2, mitochondrial 
[Vitis vinifera]
Length=997

 Score =   127 bits (319),  Expect(2) = 2e-38, Method: Compositional matrix adjust.
 Identities = 66/111 (59%), Positives = 84/111 (76%), Gaps = 3/111 (3%)
 Frame = +2

Query  104  MASVTSKANPLISTLPHVLTWQRFGFRTICSGRLGFAtstlsspssdsetHMAGTKILES  283
            MA++ S+ NPL+++LP  LTW+   +RTICSG LGFA+S+ S         + G K+LE+
Sbjct  1    MAAMASRRNPLLTSLPLYLTWRSLRYRTICSGHLGFASSSPSISEQIP---VPGMKVLET  57

Query  284  FTEEFEIGSRKITLETGKIARFANGSVVLAMDETKVLSTVASAKGRRSSRF  436
            F EEFEIGSR IT ETGKIARFANG+VV++MDETKVLSTVAS+KG  +  F
Sbjct  58   FKEEFEIGSRSITFETGKIARFANGAVVMSMDETKVLSTVASSKGDAARDF  108


 Score = 58.2 bits (139),  Expect(2) = 2e-38, Method: Composition-based stats.
 Identities = 24/29 (83%), Positives = 27/29 (93%), Gaps = 0/29 (0%)
 Frame = +3

Query  414  RGDAVRDFLPLTVDYQEKQFAQGLIPSTF  500
            +GDA RDFLPLTVDYQEK FAQG+IP+TF
Sbjct  101  KGDAARDFLPLTVDYQEKHFAQGVIPTTF  129



>ref|XP_010940149.1| PREDICTED: polyribonucleotide nucleotidyltransferase 2, mitochondrial 
[Elaeis guineensis]
Length=989

 Score =   126 bits (317),  Expect(2) = 4e-38, Method: Compositional matrix adjust.
 Identities = 62/111 (56%), Positives = 84/111 (76%), Gaps = 0/111 (0%)
 Frame = +2

Query  104  MASVTSKANPLISTLPHVLTWQRFGFRTICSGRLGFAtstlsspssdsetHMAGTKILES  283
            +A++  +A PL+S++P  LTW+R GFR+ CSG LGF +    + S+ +   + G+KILE+
Sbjct  3    VAALRGRAYPLMSSVPSFLTWRRLGFRSFCSGHLGFLSQPPEAESTAAAGPVPGSKILET  62

Query  284  FTEEFEIGSRKITLETGKIARFANGSVVLAMDETKVLSTVASAKGRRSSRF  436
            F EEFEIGSR I++ETGK+ARFANGSVV+ MDET VLSTVASA+G  +  F
Sbjct  63   FREEFEIGSRTISIETGKVARFANGSVVITMDETNVLSTVASARGDGARDF  113


 Score = 58.2 bits (139),  Expect(2) = 4e-38, Method: Composition-based stats.
 Identities = 24/29 (83%), Positives = 27/29 (93%), Gaps = 0/29 (0%)
 Frame = +3

Query  414  RGDAVRDFLPLTVDYQEKQFAQGLIPSTF  500
            RGD  RDFLPLTVDYQEKQ+AQG+IP+TF
Sbjct  106  RGDGARDFLPLTVDYQEKQYAQGVIPTTF  134



>ref|XP_007151009.1| hypothetical protein PHAVU_004G011100g [Phaseolus vulgaris]
 gb|ESW23003.1| hypothetical protein PHAVU_004G011100g [Phaseolus vulgaris]
Length=982

 Score =   117 bits (293),  Expect(2) = 5e-36, Method: Compositional matrix adjust.
 Identities = 61/99 (62%), Positives = 72/99 (73%), Gaps = 10/99 (10%)
 Frame = +2

Query  122  KANPLISTLPHVLTWQRFGFRTICSGRLGFAtstlsspssdsetHMAGTKILESFTEEFE  301
            +A PL+ TLPH LTW+ F FR ICSGRLGF  +  ++           TK L++FTE+FE
Sbjct  3    RAKPLLRTLPHFLTWRAFRFRNICSGRLGFDGAGATTT----------TKHLDTFTEQFE  52

Query  302  IGSRKITLETGKIARFANGSVVLAMDETKVLSTVASAKG  418
            IGSR ITLETGKIARFANG+VVL M+ T VLSTV SAKG
Sbjct  53   IGSRVITLETGKIARFANGAVVLTMENTNVLSTVTSAKG  91


 Score = 60.5 bits (145),  Expect(2) = 5e-36, Method: Composition-based stats.
 Identities = 25/29 (86%), Positives = 29/29 (100%), Gaps = 0/29 (0%)
 Frame = +3

Query  414  RGDAVRDFLPLTVDYQEKQFAQGLIPSTF  500
            +GDAVRDFLPLTVDYQEKQFAQG+IP++F
Sbjct  90   KGDAVRDFLPLTVDYQEKQFAQGVIPTSF  118



>ref|XP_010420100.1| PREDICTED: polyribonucleotide nucleotidyltransferase 2, mitochondrial-like 
[Camelina sativa]
Length=996

 Score =   121 bits (303),  Expect(2) = 5e-35, Method: Compositional matrix adjust.
 Identities = 67/104 (64%), Positives = 80/104 (77%), Gaps = 8/104 (8%)
 Frame = +2

Query  104  MASVTSKANPLISTLPHVLTWQRFGFRTICSGRLGFAtstlsspssdsetHMAGTKILES  283
            M+S+ ++A    S+LP++L W+  GFRTICSGRLGFA S   SP+S      AGTKILES
Sbjct  1    MSSIVNRARS--SSLPNLLAWRALGFRTICSGRLGFAPSDPDSPAS------AGTKILES  52

Query  284  FTEEFEIGSRKITLETGKIARFANGSVVLAMDETKVLSTVASAK  415
            F EEFE+GSR ++ ETGKIARFANGSVVL MD+TKVLSTV  AK
Sbjct  53   FKEEFEVGSRVVSFETGKIARFANGSVVLGMDQTKVLSTVTCAK  96


 Score = 53.1 bits (126),  Expect(2) = 5e-35, Method: Composition-based stats.
 Identities = 22/29 (76%), Positives = 27/29 (93%), Gaps = 0/29 (0%)
 Frame = +3

Query  414  RGDAVRDFLPLTVDYQEKQFAQGLIPSTF  500
            + D+ RDFLPLTVDYQEKQ+AQGLIP+T+
Sbjct  96   KTDSPRDFLPLTVDYQEKQYAQGLIPNTY  124



>ref|NP_196962.1| polyribonucleotide nucleotidyltransferase [Arabidopsis thaliana]
 sp|Q9S7G6.1|PNP2_ARATH RecName: Full=Polyribonucleotide nucleotidyltransferase 2, mitochondrial; 
Short=AtmtPNPase; AltName: Full=Polynucleotide 
phosphorylase 2; Short=PNPase 2; Flags: Precursor [Arabidopsis 
thaliana]
 emb|CAB43864.1| polynucleotide phosphorylase [Arabidopsis thaliana]
 emb|CAB43865.1| polynucleotide phosphorylase [Arabidopsis thaliana]
 emb|CAB87625.1| polynucleotide phosphorylase [Arabidopsis thaliana]
 gb|AED92050.1| polyribonucleotide nucleotidyltransferase [Arabidopsis thaliana]
Length=991

 Score =   120 bits (300),  Expect(2) = 9e-35, Method: Compositional matrix adjust.
 Identities = 67/104 (64%), Positives = 79/104 (76%), Gaps = 8/104 (8%)
 Frame = +2

Query  104  MASVTSKANPLISTLPHVLTWQRFGFRTICSGRLGFAtstlsspssdsetHMAGTKILES  283
            M+S+ ++A+   ++LP+ L W+  GFRTICSGRLGFA S   SP S      AGTKILES
Sbjct  1    MSSIVNRASS--ASLPNFLAWRALGFRTICSGRLGFAPSVPDSPVS------AGTKILES  52

Query  284  FTEEFEIGSRKITLETGKIARFANGSVVLAMDETKVLSTVASAK  415
            F EEFE+GSR ++ ETGKIARFANGSVVL MDETKVLSTV  AK
Sbjct  53   FKEEFEVGSRVVSFETGKIARFANGSVVLGMDETKVLSTVTCAK  96


 Score = 53.5 bits (127),  Expect(2) = 9e-35, Method: Composition-based stats.
 Identities = 22/29 (76%), Positives = 27/29 (93%), Gaps = 0/29 (0%)
 Frame = +3

Query  414  RGDAVRDFLPLTVDYQEKQFAQGLIPSTF  500
            + D+ RDFLPLTVDYQEKQ+AQGLIP+T+
Sbjct  96   KTDSPRDFLPLTVDYQEKQYAQGLIPNTY  124



>ref|XP_010550151.1| PREDICTED: polyribonucleotide nucleotidyltransferase 2, mitochondrial 
[Tarenaya hassleriana]
 ref|XP_010550152.1| PREDICTED: polyribonucleotide nucleotidyltransferase 2, mitochondrial 
[Tarenaya hassleriana]
Length=960

 Score =   119 bits (299),  Expect(2) = 9e-35, Method: Compositional matrix adjust.
 Identities = 65/104 (63%), Positives = 78/104 (75%), Gaps = 8/104 (8%)
 Frame = +2

Query  104  MASVTSKANPLISTLPHVLTWQRFGFRTICSGRLGFAtstlsspssdsetHMAGTKILES  283
            M+++ S+A    + LP++L W+  GFRT+CSGRLGFA S    P S      AGTK+L++
Sbjct  1    MSAIASRAT--ATALPNLLAWRALGFRTVCSGRLGFAPSNPEPPVS------AGTKVLDT  52

Query  284  FTEEFEIGSRKITLETGKIARFANGSVVLAMDETKVLSTVASAK  415
            F EEFEIGSR ITLETGKIARFANGSVVL MDETKVLST+  AK
Sbjct  53   FKEEFEIGSRVITLETGKIARFANGSVVLGMDETKVLSTITCAK  96


 Score = 53.9 bits (128),  Expect(2) = 9e-35, Method: Composition-based stats.
 Identities = 22/29 (76%), Positives = 27/29 (93%), Gaps = 0/29 (0%)
 Frame = +3

Query  414  RGDAVRDFLPLTVDYQEKQFAQGLIPSTF  500
            + D+ RDFLPLTVDYQEKQFAQG+IPS++
Sbjct  96   KTDSPRDFLPLTVDYQEKQFAQGVIPSSY  124



>ref|XP_010453582.1| PREDICTED: polyribonucleotide nucleotidyltransferase 2, mitochondrial 
[Camelina sativa]
Length=993

 Score =   120 bits (300),  Expect(2) = 1e-34, Method: Compositional matrix adjust.
 Identities = 67/104 (64%), Positives = 79/104 (76%), Gaps = 8/104 (8%)
 Frame = +2

Query  104  MASVTSKANPLISTLPHVLTWQRFGFRTICSGRLGFAtstlsspssdsetHMAGTKILES  283
            M+S+ ++A    S+LP+ L W+  GFRTICSGRLGFA S   SP+S      AGTKILES
Sbjct  1    MSSIVNRAKS--SSLPNFLAWRALGFRTICSGRLGFAPSDPDSPAS------AGTKILES  52

Query  284  FTEEFEIGSRKITLETGKIARFANGSVVLAMDETKVLSTVASAK  415
            F EEFE+GSR ++ ETGKIARFANGSVVL MD+TKVLSTV  AK
Sbjct  53   FKEEFEVGSRVVSFETGKIARFANGSVVLGMDQTKVLSTVTCAK  96


 Score = 53.1 bits (126),  Expect(2) = 1e-34, Method: Composition-based stats.
 Identities = 22/29 (76%), Positives = 27/29 (93%), Gaps = 0/29 (0%)
 Frame = +3

Query  414  RGDAVRDFLPLTVDYQEKQFAQGLIPSTF  500
            + D+ RDFLPLTVDYQEKQ+AQGLIP+T+
Sbjct  96   KTDSPRDFLPLTVDYQEKQYAQGLIPNTY  124



>ref|XP_010492266.1| PREDICTED: polyribonucleotide nucleotidyltransferase 2, mitochondrial-like 
isoform X1 [Camelina sativa]
 ref|XP_010492267.1| PREDICTED: polyribonucleotide nucleotidyltransferase 2, mitochondrial-like 
isoform X2 [Camelina sativa]
Length=996

 Score =   121 bits (303),  Expect(2) = 1e-34, Method: Compositional matrix adjust.
 Identities = 67/104 (64%), Positives = 80/104 (77%), Gaps = 8/104 (8%)
 Frame = +2

Query  104  MASVTSKANPLISTLPHVLTWQRFGFRTICSGRLGFAtstlsspssdsetHMAGTKILES  283
            M+S+ ++A    S+LP++L W+  GFRTICSGRLGFA S   SP+S      AGTKILES
Sbjct  1    MSSIVNRAKS--SSLPNLLAWRALGFRTICSGRLGFAPSDPDSPAS------AGTKILES  52

Query  284  FTEEFEIGSRKITLETGKIARFANGSVVLAMDETKVLSTVASAK  415
            F EEFE+GSR ++ ETGKIARFANGSVVL MD+TKVLSTV  AK
Sbjct  53   FKEEFEVGSRVVSFETGKIARFANGSVVLGMDQTKVLSTVTCAK  96


 Score = 51.6 bits (122),  Expect(2) = 1e-34, Method: Composition-based stats.
 Identities = 21/29 (72%), Positives = 27/29 (93%), Gaps = 0/29 (0%)
 Frame = +3

Query  414  RGDAVRDFLPLTVDYQEKQFAQGLIPSTF  500
            + D+ +DFLPLTVDYQEKQ+AQGLIP+T+
Sbjct  96   KTDSPKDFLPLTVDYQEKQYAQGLIPNTY  124



>ref|XP_006399970.1| hypothetical protein EUTSA_v10012572mg [Eutrema salsugineum]
 gb|ESQ41423.1| hypothetical protein EUTSA_v10012572mg [Eutrema salsugineum]
Length=984

 Score =   122 bits (306),  Expect(2) = 1e-34, Method: Compositional matrix adjust.
 Identities = 68/111 (61%), Positives = 80/111 (72%), Gaps = 8/111 (7%)
 Frame = +2

Query  104  MASVTSKANPLISTLPHVLTWQRFGFRTICSGRLGFAtstlsspssdsetHMAGTKILES  283
            M+S+ S+A    ++LP+ L W+  GFRTICSGRLGFA S    P++      AGTKILES
Sbjct  1    MSSIVSRARS--TSLPNFLAWRALGFRTICSGRLGFAPSDPGLPAT------AGTKILES  52

Query  284  FTEEFEIGSRKITLETGKIARFANGSVVLAMDETKVLSTVASAKGRRSSRF  436
            F EEFE+GSR +TLETGKIARFANGSVVL MD+TKVLSTV  AK      F
Sbjct  53   FKEEFEVGSRVVTLETGKIARFANGSVVLGMDQTKVLSTVTCAKTNEPRDF  103


 Score = 50.4 bits (119),  Expect(2) = 1e-34, Method: Composition-based stats.
 Identities = 20/24 (83%), Positives = 24/24 (100%), Gaps = 0/24 (0%)
 Frame = +3

Query  429  RDFLPLTVDYQEKQFAQGLIPSTF  500
            RDFLPLTVDYQEKQ+AQGLIP+++
Sbjct  101  RDFLPLTVDYQEKQYAQGLIPNSY  124



>ref|XP_007031537.1| Polyribonucleotide nucleotidyltransferase, putative isoform 1 
[Theobroma cacao]
 gb|EOY02463.1| Polyribonucleotide nucleotidyltransferase, putative isoform 1 
[Theobroma cacao]
Length=980

 Score =   111 bits (278),  Expect(2) = 2e-34, Method: Compositional matrix adjust.
 Identities = 65/100 (65%), Positives = 73/100 (73%), Gaps = 11/100 (11%)
 Frame = +2

Query  119  SKANPLISTLPHVLTWQRFGFRTICSGRLGFAtstlsspssdsetHMAGTKILESFTEEF  298
            +KANPL       LTW+   FRTICSG LGFATS    P       +AGTK LESF EEF
Sbjct  10   AKANPL-------LTWRALRFRTICSGGLGFATSESDPPYPP----VAGTKFLESFKEEF  58

Query  299  EIGSRKITLETGKIARFANGSVVLAMDETKVLSTVASAKG  418
            EIGSR I+LETGKIARFANG+VVL M+ETKVLST+A+ KG
Sbjct  59   EIGSRVISLETGKIARFANGAVVLGMEETKVLSTIAAGKG  98


 Score = 60.8 bits (146),  Expect(2) = 2e-34, Method: Composition-based stats.
 Identities = 26/29 (90%), Positives = 29/29 (100%), Gaps = 0/29 (0%)
 Frame = +3

Query  414  RGDAVRDFLPLTVDYQEKQFAQGLIPSTF  500
            +GDAVRDFLPLTVDYQEKQFAQG+IP+TF
Sbjct  97   KGDAVRDFLPLTVDYQEKQFAQGVIPNTF  125



>ref|XP_002873678.1| hypothetical protein ARALYDRAFT_488299 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH49937.1| hypothetical protein ARALYDRAFT_488299 [Arabidopsis lyrata subsp. 
lyrata]
Length=992

 Score =   118 bits (296),  Expect(2) = 2e-34, Method: Compositional matrix adjust.
 Identities = 66/104 (63%), Positives = 79/104 (76%), Gaps = 8/104 (8%)
 Frame = +2

Query  104  MASVTSKANPLISTLPHVLTWQRFGFRTICSGRLGFAtstlsspssdsetHMAGTKILES  283
            M+S+ ++A    ++LP+ L W+  GFRTICSGRLGFA S   SP+S      AGTKILES
Sbjct  1    MSSIVNRARS--TSLPNFLAWRALGFRTICSGRLGFAPSNPDSPAS------AGTKILES  52

Query  284  FTEEFEIGSRKITLETGKIARFANGSVVLAMDETKVLSTVASAK  415
            F EEFE+GSR ++ ETGKIARFANGSVVL MD+TKVLSTV  AK
Sbjct  53   FKEEFEVGSRVVSFETGKIARFANGSVVLGMDQTKVLSTVTCAK  96


 Score = 53.5 bits (127),  Expect(2) = 2e-34, Method: Composition-based stats.
 Identities = 22/29 (76%), Positives = 27/29 (93%), Gaps = 0/29 (0%)
 Frame = +3

Query  414  RGDAVRDFLPLTVDYQEKQFAQGLIPSTF  500
            + D+ RDFLPLTVDYQEKQ+AQGLIP+T+
Sbjct  96   KTDSPRDFLPLTVDYQEKQYAQGLIPNTY  124



>ref|XP_011098446.1| PREDICTED: polyribonucleotide nucleotidyltransferase 2, mitochondrial 
[Sesamum indicum]
Length=901

 Score =   116 bits (290),  Expect(2) = 5e-34, Method: Compositional matrix adjust.
 Identities = 71/111 (64%), Positives = 84/111 (76%), Gaps = 6/111 (5%)
 Frame = +2

Query  104  MASVTSKANPLISTLPHVLTWQRFGFRTICSGRLGFAtstlsspssdsetHMAGTKILES  283
            MA V SKANPL+S +P    W+R   R I  G  G A +  SS +++SET +AGTK LE+
Sbjct  1    MAPVASKANPLLSKVP----WRRIILRRISGG--GIARAPSSSTATESETVIAGTKFLET  54

Query  284  FTEEFEIGSRKITLETGKIARFANGSVVLAMDETKVLSTVASAKGRRSSRF  436
            F+EEFEIGSRKITLETGKIARFANG+VVLAM+ETKVLSTVASAK   +  F
Sbjct  55   FSEEFEIGSRKITLETGKIARFANGAVVLAMEETKVLSTVASAKSDGTRDF  105


 Score = 54.7 bits (130),  Expect(2) = 5e-34, Method: Composition-based stats.
 Identities = 22/29 (76%), Positives = 26/29 (90%), Gaps = 0/29 (0%)
 Frame = +3

Query  414  RGDAVRDFLPLTVDYQEKQFAQGLIPSTF  500
            + D  RDFLPLTV+YQEKQFAQG+IP+TF
Sbjct  98   KSDGTRDFLPLTVEYQEKQFAQGMIPNTF  126



>ref|XP_006289585.1| hypothetical protein CARUB_v10003135mg [Capsella rubella]
 gb|EOA22483.1| hypothetical protein CARUB_v10003135mg [Capsella rubella]
Length=944

 Score =   115 bits (288),  Expect(2) = 9e-34, Method: Compositional matrix adjust.
 Identities = 65/104 (63%), Positives = 78/104 (75%), Gaps = 8/104 (8%)
 Frame = +2

Query  104  MASVTSKANPLISTLPHVLTWQRFGFRTICSGRLGFAtstlsspssdsetHMAGTKILES  283
            M+S+ ++A    ++LP+ L W+  GFRTICSGRLG A S   SP+S      AGTKILES
Sbjct  1    MSSIANRARS--TSLPNFLAWRALGFRTICSGRLGVAPSDPGSPAS------AGTKILES  52

Query  284  FTEEFEIGSRKITLETGKIARFANGSVVLAMDETKVLSTVASAK  415
            F EEFE+GSR ++ ETGKIARFANGSVVL MD+TKVLSTV  AK
Sbjct  53   FKEEFEVGSRVVSFETGKIARFANGSVVLGMDQTKVLSTVTCAK  96


 Score = 54.7 bits (130),  Expect(2) = 9e-34, Method: Composition-based stats.
 Identities = 23/29 (79%), Positives = 27/29 (93%), Gaps = 0/29 (0%)
 Frame = +3

Query  414  RGDAVRDFLPLTVDYQEKQFAQGLIPSTF  500
            + D+ RDFLPLTVDYQEKQ+AQGLIPST+
Sbjct  96   KTDSPRDFLPLTVDYQEKQYAQGLIPSTY  124



>gb|KFK25698.1| hypothetical protein AALP_AA8G147400 [Arabis alpina]
Length=998

 Score =   119 bits (298),  Expect(2) = 9e-34, Method: Compositional matrix adjust.
 Identities = 67/104 (64%), Positives = 79/104 (76%), Gaps = 8/104 (8%)
 Frame = +2

Query  104  MASVTSKANPLISTLPHVLTWQRFGFRTICSGRLGFAtstlsspssdsetHMAGTKILES  283
            M+S+ S+A    ++LP++L W+  GFRTICSGRLGFA S   SP+S      AGTKILES
Sbjct  1    MSSIVSRARS--TSLPNLLAWRALGFRTICSGRLGFAPSDPHSPAS------AGTKILES  52

Query  284  FTEEFEIGSRKITLETGKIARFANGSVVLAMDETKVLSTVASAK  415
            F EEFEIG R ++ ETGKIARFANGSVVL MD+TKVLSTV  AK
Sbjct  53   FKEEFEIGGRVVSFETGKIARFANGSVVLGMDDTKVLSTVTCAK  96


 Score = 50.8 bits (120),  Expect(2) = 9e-34, Method: Composition-based stats.
 Identities = 21/29 (72%), Positives = 26/29 (90%), Gaps = 0/29 (0%)
 Frame = +3

Query  414  RGDAVRDFLPLTVDYQEKQFAQGLIPSTF  500
            + D  RDFLPLTVDYQEKQ+AQGLIP+++
Sbjct  96   KTDLPRDFLPLTVDYQEKQYAQGLIPNSY  124



>ref|XP_008796014.1| PREDICTED: LOW QUALITY PROTEIN: polyribonucleotide nucleotidyltransferase 
2, mitochondrial [Phoenix dactylifera]
Length=993

 Score =   112 bits (279),  Expect(2) = 1e-33, Method: Compositional matrix adjust.
 Identities = 58/108 (54%), Positives = 73/108 (68%), Gaps = 3/108 (3%)
 Frame = +2

Query  122  KANPLISTLPHVLTWQRFGFRTICSGRLGFAtstlsspssdsetHMAGTKILESFTEEFE  301
            +A PL++++P  LTW+R GFR+ CSGRLGF +      S      + G K+LE+F EEFE
Sbjct  12   RAYPLMASVPSFLTWRRLGFRSFCSGRLGFLSQPPEMESLAPAGPVPGLKVLETFREEFE  71

Query  302  IGSRKITLETGKIARFANGSVVLAMDET---KVLSTVASAKGRRSSRF  436
            IGSR I+LETGKIARFANGSVV+ MDET       TVAS +G  +  F
Sbjct  72   IGSRTISLETGKIARFANGSVVITMDETXXXXXXXTVASXRGDGARDF  119


 Score = 57.8 bits (138),  Expect(2) = 1e-33, Method: Composition-based stats.
 Identities = 24/29 (83%), Positives = 27/29 (93%), Gaps = 0/29 (0%)
 Frame = +3

Query  414  RGDAVRDFLPLTVDYQEKQFAQGLIPSTF  500
            RGD  RDFLPLTVDYQEKQ+AQG+IP+TF
Sbjct  112  RGDGARDFLPLTVDYQEKQYAQGVIPTTF  140



>gb|EYU44773.1| hypothetical protein MIMGU_mgv1a001063mg [Erythranthe guttata]
Length=899

 Score =   110 bits (275),  Expect(2) = 2e-32, Method: Compositional matrix adjust.
 Identities = 63/111 (57%), Positives = 75/111 (68%), Gaps = 5/111 (5%)
 Frame = +2

Query  104  MASVTSKANPLISTLPHVLTWQRFGFRTICSGRLGFAtstlsspssdsetHMAGTKILES  283
            MA V  KANP ++++     W+R   R+I  GRL F +   S         +AG K LE+
Sbjct  1    MAPVVGKANPFLASM----LWRRMKLRSIVGGRL-FHSPAQSPAGDPEAATIAGKKFLET  55

Query  284  FTEEFEIGSRKITLETGKIARFANGSVVLAMDETKVLSTVASAKGRRSSRF  436
            FTEEFEIGSRK++LETGKIARFANGSVVLAM+ETKVLSTV SAK   S  F
Sbjct  56   FTEEFEIGSRKMSLETGKIARFANGSVVLAMEETKVLSTVTSAKSDGSRDF  106


 Score = 55.5 bits (132),  Expect(2) = 2e-32, Method: Composition-based stats.
 Identities = 23/29 (79%), Positives = 26/29 (90%), Gaps = 0/29 (0%)
 Frame = +3

Query  414  RGDAVRDFLPLTVDYQEKQFAQGLIPSTF  500
            + D  RDFLPLTVDYQEKQFAQG+IP+TF
Sbjct  99   KSDGSRDFLPLTVDYQEKQFAQGVIPNTF  127



>ref|XP_009131416.1| PREDICTED: polyribonucleotide nucleotidyltransferase 2, mitochondrial 
[Brassica rapa]
Length=963

 Score =   117 bits (294),  Expect(2) = 6e-32, Method: Compositional matrix adjust.
 Identities = 67/111 (60%), Positives = 79/111 (71%), Gaps = 8/111 (7%)
 Frame = +2

Query  104  MASVTSKANPLISTLPHVLTWQRFGFRTICSGRLGFAtstlsspssdsetHMAGTKILES  283
            M+ + S+A    + LP++L W+  GFRTICSGRLG A S+  +P+       AGTKILES
Sbjct  1    MSLIVSRARS--TPLPNLLAWRALGFRTICSGRLGLAPSSPYTPAP------AGTKILES  52

Query  284  FTEEFEIGSRKITLETGKIARFANGSVVLAMDETKVLSTVASAKGRRSSRF  436
            F EEFE+GS  ITLETGKIARFANGSVVL MDETKVLSTV  AK +    F
Sbjct  53   FKEEFEVGSGVITLETGKIARFANGSVVLGMDETKVLSTVTCAKSKSPGDF  103


 Score = 46.2 bits (108),  Expect(2) = 6e-32, Method: Composition-based stats.
 Identities = 19/23 (83%), Positives = 22/23 (96%), Gaps = 0/23 (0%)
 Frame = +3

Query  432  DFLPLTVDYQEKQFAQGLIPSTF  500
            DFLPLTVDYQEK +AQGLIP+T+
Sbjct  102  DFLPLTVDYQEKLYAQGLIPNTY  124



>emb|CDX78584.1| BnaA03g04960D [Brassica napus]
Length=964

 Score =   117 bits (294),  Expect(2) = 6e-32, Method: Compositional matrix adjust.
 Identities = 67/111 (60%), Positives = 79/111 (71%), Gaps = 8/111 (7%)
 Frame = +2

Query  104  MASVTSKANPLISTLPHVLTWQRFGFRTICSGRLGFAtstlsspssdsetHMAGTKILES  283
            M+ + S+A    + LP++L W+  GFRTICSGRLG A S+  +P+       AGTKILES
Sbjct  1    MSLIVSRARS--TPLPNLLAWRALGFRTICSGRLGLAPSSPYTPAP------AGTKILES  52

Query  284  FTEEFEIGSRKITLETGKIARFANGSVVLAMDETKVLSTVASAKGRRSSRF  436
            F EEFE+GS  ITLETGKIARFANGSVVL MDETKVLSTV  AK +    F
Sbjct  53   FKEEFEVGSGVITLETGKIARFANGSVVLGMDETKVLSTVTCAKSKSPGDF  103


 Score = 46.2 bits (108),  Expect(2) = 6e-32, Method: Composition-based stats.
 Identities = 19/23 (83%), Positives = 22/23 (96%), Gaps = 0/23 (0%)
 Frame = +3

Query  432  DFLPLTVDYQEKQFAQGLIPSTF  500
            DFLPLTVDYQEK +AQGLIP+T+
Sbjct  102  DFLPLTVDYQEKLYAQGLIPNTY  124



>emb|CDX69573.1| BnaA10g19220D [Brassica napus]
Length=975

 Score =   114 bits (286),  Expect(2) = 6e-32, Method: Compositional matrix adjust.
 Identities = 66/111 (59%), Positives = 76/111 (68%), Gaps = 9/111 (8%)
 Frame = +2

Query  104  MASVTSKANPLISTLPHVLTWQRFGFRTICSGRLGFAtstlsspssdsetHMAGTKILES  283
            M+S+ S+A    S+LP+ L W+  GFRTICSG LG A S+            AG KILES
Sbjct  1    MSSIVSRARS--SSLPNFLAWRALGFRTICSGGLGIAPSSSPPA-------SAGIKILES  51

Query  284  FTEEFEIGSRKITLETGKIARFANGSVVLAMDETKVLSTVASAKGRRSSRF  436
            F EEFE+GSR +TLETGKIARFANGSVVL MDETKVLSTV  AK +    F
Sbjct  52   FKEEFEVGSRVVTLETGKIARFANGSVVLGMDETKVLSTVTCAKSKSPGDF  102


 Score = 49.3 bits (116),  Expect(2) = 6e-32, Method: Composition-based stats.
 Identities = 20/23 (87%), Positives = 22/23 (96%), Gaps = 0/23 (0%)
 Frame = +3

Query  432  DFLPLTVDYQEKQFAQGLIPSTF  500
            DFLPLTVDYQEK FAQGLIP+T+
Sbjct  101  DFLPLTVDYQEKMFAQGLIPNTY  123



>emb|CDX70572.1| BnaC03g06560D [Brassica napus]
Length=963

 Score =   117 bits (292),  Expect(2) = 9e-32, Method: Compositional matrix adjust.
 Identities = 68/111 (61%), Positives = 78/111 (70%), Gaps = 8/111 (7%)
 Frame = +2

Query  104  MASVTSKANPLISTLPHVLTWQRFGFRTICSGRLGFAtstlsspssdsetHMAGTKILES  283
            M+ + S+A    + LP++L W+  GFRTICSGRLG A S+  SP+       AGTKILES
Sbjct  1    MSLIVSRARS--TPLPNLLAWRALGFRTICSGRLGLAPSSPHSPAP------AGTKILES  52

Query  284  FTEEFEIGSRKITLETGKIARFANGSVVLAMDETKVLSTVASAKGRRSSRF  436
            F EEFE+GS  ITLETGKIARFANGSVVL MDETKVLSTV  AK      F
Sbjct  53   FKEEFEVGSGVITLETGKIARFANGSVVLGMDETKVLSTVTCAKSNSPGDF  103


 Score = 46.6 bits (109),  Expect(2) = 9e-32, Method: Composition-based stats.
 Identities = 19/23 (83%), Positives = 22/23 (96%), Gaps = 0/23 (0%)
 Frame = +3

Query  432  DFLPLTVDYQEKQFAQGLIPSTF  500
            DFLPLTVDYQEK +AQGLIP+T+
Sbjct  102  DFLPLTVDYQEKLYAQGLIPNTY  124



>gb|KJB33815.1| hypothetical protein B456_006G032100 [Gossypium raimondii]
Length=958

 Score =   103 bits (256),  Expect(2) = 2e-31, Method: Compositional matrix adjust.
 Identities = 62/106 (58%), Positives = 71/106 (67%), Gaps = 11/106 (10%)
 Frame = +2

Query  119  SKANPLISTLPHVLTWQRFGFRTICSGRLGFAtstlsspssdsetHMAGTKILESFTEEF  298
            +KANPL       LT +   FR  C+GR G +TS    P       +AGTK LESF EEF
Sbjct  12   AKANPL-------LTRRALHFRNFCNGRFGLSTSESDPPDRP----VAGTKFLESFKEEF  60

Query  299  EIGSRKITLETGKIARFANGSVVLAMDETKVLSTVASAKGRRSSRF  436
            EIGSR I+LETGKIARFANG+VVL M+ETKVLSTVA+AKG     F
Sbjct  61   EIGSRVISLETGKIARFANGAVVLGMEETKVLSTVAAAKGDADRDF  106


 Score = 58.9 bits (141),  Expect(2) = 2e-31, Method: Composition-based stats.
 Identities = 26/29 (90%), Positives = 28/29 (97%), Gaps = 0/29 (0%)
 Frame = +3

Query  414  RGDAVRDFLPLTVDYQEKQFAQGLIPSTF  500
            +GDA RDFLPLTVDYQEKQFAQGLIP+TF
Sbjct  99   KGDADRDFLPLTVDYQEKQFAQGLIPNTF  127



>gb|KJB33814.1| hypothetical protein B456_006G032100 [Gossypium raimondii]
Length=980

 Score =   103 bits (256),  Expect(2) = 2e-31, Method: Compositional matrix adjust.
 Identities = 62/106 (58%), Positives = 71/106 (67%), Gaps = 11/106 (10%)
 Frame = +2

Query  119  SKANPLISTLPHVLTWQRFGFRTICSGRLGFAtstlsspssdsetHMAGTKILESFTEEF  298
            +KANPL       LT +   FR  C+GR G +TS    P       +AGTK LESF EEF
Sbjct  12   AKANPL-------LTRRALHFRNFCNGRFGLSTSESDPPDRP----VAGTKFLESFKEEF  60

Query  299  EIGSRKITLETGKIARFANGSVVLAMDETKVLSTVASAKGRRSSRF  436
            EIGSR I+LETGKIARFANG+VVL M+ETKVLSTVA+AKG     F
Sbjct  61   EIGSRVISLETGKIARFANGAVVLGMEETKVLSTVAAAKGDADRDF  106


 Score = 58.9 bits (141),  Expect(2) = 2e-31, Method: Composition-based stats.
 Identities = 26/29 (90%), Positives = 28/29 (97%), Gaps = 0/29 (0%)
 Frame = +3

Query  414  RGDAVRDFLPLTVDYQEKQFAQGLIPSTF  500
            +GDA RDFLPLTVDYQEKQFAQGLIP+TF
Sbjct  99   KGDADRDFLPLTVDYQEKQFAQGLIPNTF  127



>gb|KJB33816.1| hypothetical protein B456_006G032100 [Gossypium raimondii]
Length=958

 Score =   102 bits (255),  Expect(2) = 2e-31, Method: Compositional matrix adjust.
 Identities = 62/106 (58%), Positives = 71/106 (67%), Gaps = 11/106 (10%)
 Frame = +2

Query  119  SKANPLISTLPHVLTWQRFGFRTICSGRLGFAtstlsspssdsetHMAGTKILESFTEEF  298
            +KANPL       LT +   FR  C+GR G +TS    P       +AGTK LESF EEF
Sbjct  12   AKANPL-------LTRRALHFRNFCNGRFGLSTSESDPPDRP----VAGTKFLESFKEEF  60

Query  299  EIGSRKITLETGKIARFANGSVVLAMDETKVLSTVASAKGRRSSRF  436
            EIGSR I+LETGKIARFANG+VVL M+ETKVLSTVA+AKG     F
Sbjct  61   EIGSRVISLETGKIARFANGAVVLGMEETKVLSTVAAAKGDADRDF  106


 Score = 58.9 bits (141),  Expect(2) = 2e-31, Method: Composition-based stats.
 Identities = 26/29 (90%), Positives = 28/29 (97%), Gaps = 0/29 (0%)
 Frame = +3

Query  414  RGDAVRDFLPLTVDYQEKQFAQGLIPSTF  500
            +GDA RDFLPLTVDYQEKQFAQGLIP+TF
Sbjct  99   KGDADRDFLPLTVDYQEKQFAQGLIPNTF  127



>ref|XP_009121656.1| PREDICTED: polyribonucleotide nucleotidyltransferase 2, mitochondrial-like 
[Brassica rapa]
Length=975

 Score =   112 bits (281),  Expect(2) = 2e-31, Method: Compositional matrix adjust.
 Identities = 65/111 (59%), Positives = 75/111 (68%), Gaps = 9/111 (8%)
 Frame = +2

Query  104  MASVTSKANPLISTLPHVLTWQRFGFRTICSGRLGFAtstlsspssdsetHMAGTKILES  283
            M+S+  +A    S+LP+ L W+  GFRTICSG LG A S+            AG KILES
Sbjct  1    MSSIVRRARS--SSLPNFLAWRALGFRTICSGGLGIAPSSSPPA-------SAGIKILES  51

Query  284  FTEEFEIGSRKITLETGKIARFANGSVVLAMDETKVLSTVASAKGRRSSRF  436
            F EEFE+GSR +TLETGKIARFANGSVVL MDETKVLSTV  AK +    F
Sbjct  52   FKEEFEVGSRVVTLETGKIARFANGSVVLGMDETKVLSTVTCAKSKSPGDF  102


 Score = 49.3 bits (116),  Expect(2) = 2e-31, Method: Composition-based stats.
 Identities = 20/23 (87%), Positives = 22/23 (96%), Gaps = 0/23 (0%)
 Frame = +3

Query  432  DFLPLTVDYQEKQFAQGLIPSTF  500
            DFLPLTVDYQEK FAQGLIP+T+
Sbjct  101  DFLPLTVDYQEKMFAQGLIPNTY  123



>emb|CDY09870.1| BnaC09g42910D [Brassica napus]
Length=959

 Score =   111 bits (277),  Expect(2) = 8e-31, Method: Compositional matrix adjust.
 Identities = 64/111 (58%), Positives = 74/111 (67%), Gaps = 9/111 (8%)
 Frame = +2

Query  104  MASVTSKANPLISTLPHVLTWQRFGFRTICSGRLGFAtstlsspssdsetHMAGTKILES  283
            M+S+  +A    S+LP+ L W+  GFRTICSG LG A S+            AG KILES
Sbjct  1    MSSIVRRARS--SSLPNFLAWRALGFRTICSGGLGIAPSSSPPA-------SAGIKILES  51

Query  284  FTEEFEIGSRKITLETGKIARFANGSVVLAMDETKVLSTVASAKGRRSSRF  436
            F EEFE+GSR +TLETGKIARF NGSVVL MDETKVLSTV  AK +    F
Sbjct  52   FKEEFEVGSRVVTLETGKIARFTNGSVVLGMDETKVLSTVTCAKSKSPGDF  102


 Score = 49.3 bits (116),  Expect(2) = 8e-31, Method: Composition-based stats.
 Identities = 20/23 (87%), Positives = 22/23 (96%), Gaps = 0/23 (0%)
 Frame = +3

Query  432  DFLPLTVDYQEKQFAQGLIPSTF  500
            DFLPLTVDYQEK FAQGLIP+T+
Sbjct  101  DFLPLTVDYQEKMFAQGLIPNTY  123



>ref|XP_010033299.1| PREDICTED: polyribonucleotide nucleotidyltransferase 2, mitochondrial 
[Eucalyptus grandis]
 gb|KCW52909.1| hypothetical protein EUGRSUZ_J02224 [Eucalyptus grandis]
Length=946

 Score = 99.0 bits (245),  Expect(2) = 7e-29, Method: Compositional matrix adjust.
 Identities = 59/117 (50%), Positives = 75/117 (64%), Gaps = 17/117 (15%)
 Frame = +2

Query  104  MASVTSKANPLISTLPHVLTWQRFGFRTICSGRLGFAtstlsspssds------------  247
            MAS+ ++A       P++L W+   FR    GRLG A+ + SS +               
Sbjct  3    MASIATRARK-----PNLLPWRSLSFRATRGGRLGLASFSSSSSTLSDPELEPPPPPPPS  57

Query  248  etHMAGTKILESFTEEFEIGSRKITLETGKIARFANGSVVLAMDETKVLSTVASAKG  418
             +  AG K+LESFTEEFEIGSR ITLETGKIARFANG+VVL M++TKVLSTV S++G
Sbjct  58   PSPAAGAKVLESFTEEFEIGSRLITLETGKIARFANGAVVLGMEDTKVLSTVTSSRG  114


 Score = 55.1 bits (131),  Expect(2) = 7e-29, Method: Composition-based stats.
 Identities = 24/29 (83%), Positives = 26/29 (90%), Gaps = 0/29 (0%)
 Frame = +3

Query  414  RGDAVRDFLPLTVDYQEKQFAQGLIPSTF  500
            RGDAV  FLPLTVDYQEKQ+AQGLIP T+
Sbjct  113  RGDAVGSFLPLTVDYQEKQYAQGLIPKTY  141



>ref|XP_010665719.1| PREDICTED: polyribonucleotide nucleotidyltransferase 2, mitochondrial 
[Beta vulgaris subsp. vulgaris]
Length=957

 Score = 98.6 bits (244),  Expect(2) = 8e-28, Method: Compositional matrix adjust.
 Identities = 55/94 (59%), Positives = 69/94 (73%), Gaps = 6/94 (6%)
 Frame = +2

Query  134  LISTLPHVLTWQRFGFRTICSGRLGFAtstlsspssdsetHMAGTKILESFTEEFEIGSR  313
            L ++ P  +TW+RF FR+ CS R  F ++   SP +        TK+LESF EEFEIG+R
Sbjct  9    LQNSQPLFVTWRRFKFRSNCSSRRHFVSNPEPSPLTPE------TKLLESFKEEFEIGNR  62

Query  314  KITLETGKIARFANGSVVLAMDETKVLSTVASAK  415
             I+ ETGK+ARFANG+VV+AMDETKVLSTVASAK
Sbjct  63   LISFETGKMARFANGAVVMAMDETKVLSTVASAK  96


 Score = 51.6 bits (122),  Expect(2) = 8e-28, Method: Composition-based stats.
 Identities = 21/24 (88%), Positives = 24/24 (100%), Gaps = 0/24 (0%)
 Frame = +3

Query  429  RDFLPLTVDYQEKQFAQGLIPSTF  500
            RDFLPLTVDYQEKQ+AQG+IP+TF
Sbjct  101  RDFLPLTVDYQEKQYAQGVIPNTF  124



>ref|XP_009375164.1| PREDICTED: polyribonucleotide nucleotidyltransferase 2, mitochondrial-like 
[Pyrus x bretschneideri]
Length=157

 Score = 89.4 bits (220),  Expect(2) = 3e-27, Method: Compositional matrix adjust.
 Identities = 43/54 (80%), Positives = 50/54 (93%), Gaps = 0/54 (0%)
 Frame = +2

Query  257  MAGTKILESFTEEFEIGSRKITLETGKIARFANGSVVLAMDETKVLSTVASAKG  418
            +AGTK+LE+F EEFE+G R ITLETGKIARFANG+VVL M+ETKVLSTVA+AKG
Sbjct  17   VAGTKVLETFREEFEVGDRLITLETGKIARFANGAVVLGMEETKVLSTVAAAKG  70


 Score = 59.3 bits (142),  Expect(2) = 3e-27, Method: Compositional matrix adjust.
 Identities = 26/29 (90%), Positives = 29/29 (100%), Gaps = 0/29 (0%)
 Frame = +3

Query  414  RGDAVRDFLPLTVDYQEKQFAQGLIPSTF  500
            +GDAVRDFLPLTVDYQEKQFAQG+IP+TF
Sbjct  69   KGDAVRDFLPLTVDYQEKQFAQGVIPNTF  97



>ref|XP_003554809.1| PREDICTED: polyribonucleotide nucleotidyltransferase 2, mitochondrial-like 
[Glycine max]
Length=959

 Score = 91.3 bits (225),  Expect(2) = 3e-27, Method: Compositional matrix adjust.
 Identities = 53/108 (49%), Positives = 63/108 (58%), Gaps = 23/108 (21%)
 Frame = +2

Query  122  KANPLISTLPHVLTWQRFGFRTICSGRLGFAtstlsspssdsetHMAGTKILESFTEEFE  301
            + N L+ TLPH LTW+ F FRT                        A TK LE+FTE+FE
Sbjct  3    RTNTLLRTLPHFLTWRAFRFRT-----------------------FATTKHLETFTEQFE  39

Query  302  IGSRKITLETGKIARFANGSVVLAMDETKVLSTVASAKGRRSSRFSTP  445
            IGS  ITLETGKIARFAN +VVLAM+ T VLSTV ++K   + R   P
Sbjct  40   IGSSVITLETGKIARFANAAVVLAMENTNVLSTVTASKANDAVRDFLP  87


 Score = 57.4 bits (137),  Expect(2) = 3e-27, Method: Composition-based stats.
 Identities = 24/27 (89%), Positives = 27/27 (100%), Gaps = 0/27 (0%)
 Frame = +3

Query  420  DAVRDFLPLTVDYQEKQFAQGLIPSTF  500
            DAVRDFLPLTVDYQEKQFAQG+IP++F
Sbjct  80   DAVRDFLPLTVDYQEKQFAQGVIPTSF  106



>emb|CBI34890.3| unnamed protein product [Vitis vinifera]
Length=905

 Score = 86.7 bits (213),  Expect(2) = 4e-26, Method: Compositional matrix adjust.
 Identities = 42/56 (75%), Positives = 49/56 (88%), Gaps = 0/56 (0%)
 Frame = +2

Query  269  KILESFTEEFEIGSRKITLETGKIARFANGSVVLAMDETKVLSTVASAKGRRSSRF  436
            K+LE+F EEFEIGSR IT ETGKIARFANG+VV++MDETKVLSTVAS+KG  +  F
Sbjct  2    KVLETFKEEFEIGSRSITFETGKIARFANGAVVMSMDETKVLSTVASSKGDAARDF  57


 Score = 58.2 bits (139),  Expect(2) = 4e-26, Method: Composition-based stats.
 Identities = 24/29 (83%), Positives = 27/29 (93%), Gaps = 0/29 (0%)
 Frame = +3

Query  414  RGDAVRDFLPLTVDYQEKQFAQGLIPSTF  500
            +GDA RDFLPLTVDYQEK FAQG+IP+TF
Sbjct  50   KGDAARDFLPLTVDYQEKHFAQGVIPTTF  78



>ref|XP_004489245.1| PREDICTED: polyribonucleotide nucleotidyltransferase 2, mitochondrial-like 
[Cicer arietinum]
Length=976

 Score = 84.3 bits (207),  Expect(2) = 6e-24, Method: Compositional matrix adjust.
 Identities = 52/98 (53%), Positives = 62/98 (63%), Gaps = 21/98 (21%)
 Frame = +2

Query  125  ANPLISTLPHVLTWQRFGFRTICSGRLGFAtstlsspssdsetHMAGTKILESFTEEFEI  304
            A PL+ TL H L ++R    TI +   G A                 TK LE+F EEFEI
Sbjct  10   AKPLLRTLRHHLGFRR----TISTTDGGSA-----------------TKFLETFNEEFEI  48

Query  305  GSRKITLETGKIARFANGSVVLAMDETKVLSTVASAKG  418
            G+R ITLETGKIARFANG+VV +M++TKVLSTV SAKG
Sbjct  49   GNRIITLETGKIARFANGAVVFSMEDTKVLSTVTSAKG  86


 Score = 53.1 bits (126),  Expect(2) = 6e-24, Method: Composition-based stats.
 Identities = 23/30 (77%), Positives = 27/30 (90%), Gaps = 1/30 (3%)
 Frame = +3

Query  414  RGDAVR-DFLPLTVDYQEKQFAQGLIPSTF  500
            +GD  + DFLPLTVDYQEKQFAQG+IPST+
Sbjct  85   KGDTAKADFLPLTVDYQEKQFAQGMIPSTY  114



>ref|XP_009380405.1| PREDICTED: polyribonucleotide nucleotidyltransferase 2, mitochondrial 
[Musa acuminata subsp. malaccensis]
Length=1048

 Score = 79.0 bits (193),  Expect(2) = 1e-23, Method: Composition-based stats.
 Identities = 52/122 (43%), Positives = 74/122 (61%), Gaps = 8/122 (7%)
 Frame = +2

Query  92   LKPIMASVTSKANPLISTLPHVLTW------QRFGFRTICSGRLGFAtstlsspssdset  253
            L  + A++  +ANP I  +  +L++      +R G R +CS    F +     P S+   
Sbjct  3    LAAVAATLRRRANPRI-LMASLLSFHCRQRCRRLGVRFLCSDGHAFVSQPPRPPPSERAA  61

Query  254  HMAGT-KILESFTEEFEIGSRKITLETGKIARFANGSVVLAMDETKVLSTVASAKGRRSS  430
                T K+L +F E+FE+GSR I++ETGKIARFANGSVV+ M +T VLSTVASA+G  + 
Sbjct  62   ESFHTRKVLGTFREDFEVGSRIISIETGKIARFANGSVVINMGDTNVLSTVASARGDGAR  121

Query  431  RF  436
             F
Sbjct  122  DF  123


 Score = 57.4 bits (137),  Expect(2) = 1e-23, Method: Compositional matrix adjust.
 Identities = 24/29 (83%), Positives = 27/29 (93%), Gaps = 0/29 (0%)
 Frame = +3

Query  414  RGDAVRDFLPLTVDYQEKQFAQGLIPSTF  500
            RGD  RDFLPLTVDYQEKQ+AQG+IP+TF
Sbjct  116  RGDGARDFLPLTVDYQEKQYAQGVIPTTF  144



>gb|EMS68952.1| Polyribonucleotide nucleotidyltransferase [Triticum urartu]
Length=1374

 Score = 78.6 bits (192),  Expect(2) = 1e-22, Method: Compositional matrix adjust.
 Identities = 38/51 (75%), Positives = 44/51 (86%), Gaps = 0/51 (0%)
 Frame = +2

Query  263  GTKILESFTEEFEIGSRKITLETGKIARFANGSVVLAMDETKVLSTVASAK  415
            G K+LESF EEFEIG R I  ETGK+ARFANGSVV++M+ET VLSTVA+AK
Sbjct  445  GRKVLESFREEFEIGGRLIAFETGKMARFANGSVVISMEETNVLSTVAAAK  495


 Score = 53.9 bits (128),  Expect(2) = 1e-22, Method: Composition-based stats.
 Identities = 22/30 (73%), Positives = 27/30 (90%), Gaps = 0/30 (0%)
 Frame = +3

Query  411  QRGDAVRDFLPLTVDYQEKQFAQGLIPSTF  500
            +  D VRDFLPLTVDYQEKQ+AQG+IP+T+
Sbjct  495  KSSDPVRDFLPLTVDYQEKQYAQGVIPTTY  524



>ref|XP_008643478.1| PREDICTED: uncharacterized protein LOC100279772 isoform X1 [Zea 
mays]
 gb|AFW72337.1| hypothetical protein ZEAMMB73_632002 [Zea mays]
Length=980

 Score = 77.4 bits (189),  Expect(2) = 2e-21, Method: Compositional matrix adjust.
 Identities = 37/51 (73%), Positives = 44/51 (86%), Gaps = 0/51 (0%)
 Frame = +2

Query  263  GTKILESFTEEFEIGSRKITLETGKIARFANGSVVLAMDETKVLSTVASAK  415
            G K+LESF EEFEIG R I  ETGK+ARFANGSVV++M++T VLSTVA+AK
Sbjct  58   GRKVLESFREEFEIGGRSIAFETGKMARFANGSVVISMEDTHVLSTVAAAK  108


 Score = 51.6 bits (122),  Expect(2) = 2e-21, Method: Composition-based stats.
 Identities = 20/30 (67%), Positives = 27/30 (90%), Gaps = 0/30 (0%)
 Frame = +3

Query  411  QRGDAVRDFLPLTVDYQEKQFAQGLIPSTF  500
            +  + +RDFLPLTVDYQEKQ+AQG+IP+T+
Sbjct  108  KSSEPIRDFLPLTVDYQEKQYAQGVIPTTY  137



>ref|XP_006833262.1| hypothetical protein AMTR_s00113p00140210, partial [Amborella 
trichopoda]
 gb|ERM98540.1| hypothetical protein AMTR_s00113p00140210, partial [Amborella 
trichopoda]
Length=958

 Score = 63.5 bits (153),  Expect(2) = 8e-18, Method: Compositional matrix adjust.
 Identities = 31/51 (61%), Positives = 40/51 (78%), Gaps = 0/51 (0%)
 Frame = +2

Query  284  FTEEFEIGSRKITLETGKIARFANGSVVLAMDETKVLSTVASAKGRRSSRF  436
            ++EE E+GSR IT ETGK+ARFA G+VVL + +TKVLSTV SA+G  +  F
Sbjct  59   YSEEVEVGSRLITFETGKLARFAAGAVVLGIKDTKVLSTVVSAEGDGARDF  109


 Score = 53.1 bits (126),  Expect(2) = 8e-18, Method: Composition-based stats.
 Identities = 22/28 (79%), Positives = 25/28 (89%), Gaps = 0/28 (0%)
 Frame = +3

Query  417  GDAVRDFLPLTVDYQEKQFAQGLIPSTF  500
            GD  RDFLPLTVDY+EKQ+AQG IP+TF
Sbjct  103  GDGARDFLPLTVDYREKQYAQGKIPNTF  130



>gb|EPS73358.1| hypothetical protein M569_01398 [Genlisea aurea]
Length=882

 Score = 64.3 bits (155),  Expect(2) = 1e-17, Method: Composition-based stats.
 Identities = 48/105 (46%), Positives = 70/105 (67%), Gaps = 2/105 (2%)
 Frame = +2

Query  128  NPLISTLPHVLTWQRFGFRTICSGRLGFAtstlsspssdset--HMAGTKILESFTEEFE  301
            +P+++ L   + W+R    TI  GR+  A S+L++ + D+ +    AG K  E+F+EEFE
Sbjct  2    SPVVNRLLSAIPWRRKKLHTIRRGRISRALSSLTAETLDANSDFRTAGNKFFETFSEEFE  61

Query  302  IGSRKITLETGKIARFANGSVVLAMDETKVLSTVASAKGRRSSRF  436
            IG  KIT+ETGK+A FANG+V+ A++ETKVLST  SAK   +  F
Sbjct  62   IGESKITMETGKLAPFANGAVLFAVEETKVLSTAVSAKSDGAHDF  106


 Score = 51.2 bits (121),  Expect(2) = 1e-17, Method: Composition-based stats.
 Identities = 21/29 (72%), Positives = 24/29 (83%), Gaps = 0/29 (0%)
 Frame = +3

Query  414  RGDAVRDFLPLTVDYQEKQFAQGLIPSTF  500
            + D   DFLPLTVDY+EKQFAQG+IP TF
Sbjct  99   KSDGAHDFLPLTVDYREKQFAQGVIPGTF  127



>gb|AES74396.2| polyribonucleotide nucleotidyltransferase [Medicago truncatula]
Length=973

 Score = 65.9 bits (159),  Expect(2) = 4e-17, Method: Compositional matrix adjust.
 Identities = 28/50 (56%), Positives = 41/50 (82%), Gaps = 0/50 (0%)
 Frame = +2

Query  266  TKILESFTEEFEIGSRKITLETGKIARFANGSVVLAMDETKVLSTVASAK  415
            TK+LE+FTEEFE+G+R IT + GK  RF+NG+VVL M++ K+LS V +++
Sbjct  38   TKLLETFTEEFEVGNRLITFQNGKYGRFSNGAVVLTMEDNKILSAVNTSR  87


 Score = 48.1 bits (113),  Expect(2) = 4e-17, Method: Composition-based stats.
 Identities = 20/26 (77%), Positives = 23/26 (88%), Gaps = 0/26 (0%)
 Frame = +3

Query  423  AVRDFLPLTVDYQEKQFAQGLIPSTF  500
            A  DFLPLTVDY+EKQF+ GLIPST+
Sbjct  91   ARNDFLPLTVDYEEKQFSHGLIPSTY  116



>sp|Q6KAI0.1|PNP2_ORYSJ RecName: Full=Polyribonucleotide nucleotidyltransferase 2, mitochondrial; 
AltName: Full=Polynucleotide phosphorylase 2; Short=PNPase 
2; Flags: Precursor [Oryza sativa Japonica Group]
 dbj|BAD21450.1| putative polyribonucleotide nucleotidyltransferase [Oryza sativa 
Japonica Group]
Length=982

 Score = 79.3 bits (194),  Expect = 8e-14, Method: Compositional matrix adjust.
 Identities = 40/61 (66%), Positives = 47/61 (77%), Gaps = 0/61 (0%)
 Frame = +2

Query  263  GTKILESFTEEFEIGSRKITLETGKIARFANGSVVLAMDETKVLSTVASAKGRRSSRFST  442
            G K+LESF EEFEIG R I+ ETGK+ARFANGSVV++MD+T VLSTVA+AK     R   
Sbjct  54   GRKVLESFREEFEIGGRVISFETGKMARFANGSVVISMDDTHVLSTVAAAKSSEPVRDFL  113

Query  443  P  445
            P
Sbjct  114  P  114


 Score = 52.4 bits (124),  Expect = 5e-05, Method: Composition-based stats.
 Identities = 21/30 (70%), Positives = 27/30 (90%), Gaps = 0/30 (0%)
 Frame = +3

Query  411  QRGDAVRDFLPLTVDYQEKQFAQGLIPSTF  500
            +  + VRDFLPLTVDYQEKQ+AQG+IP+T+
Sbjct  104  KSSEPVRDFLPLTVDYQEKQYAQGVIPTTY  133



>gb|EEC73607.1| hypothetical protein OsI_08089 [Oryza sativa Indica Group]
Length=1030

 Score = 79.3 bits (194),  Expect = 8e-14, Method: Compositional matrix adjust.
 Identities = 40/61 (66%), Positives = 47/61 (77%), Gaps = 0/61 (0%)
 Frame = +2

Query  263  GTKILESFTEEFEIGSRKITLETGKIARFANGSVVLAMDETKVLSTVASAKGRRSSRFST  442
            G K+LESF EEFEIG R I+ ETGK+ARFANGSVV++MD+T VLSTVA+AK     R   
Sbjct  54   GRKVLESFREEFEIGGRVISFETGKMARFANGSVVISMDDTHVLSTVAAAKSSEPVRDFL  113

Query  443  P  445
            P
Sbjct  114  P  114


 Score = 52.4 bits (124),  Expect = 4e-05, Method: Composition-based stats.
 Identities = 21/30 (70%), Positives = 27/30 (90%), Gaps = 0/30 (0%)
 Frame = +3

Query  411  QRGDAVRDFLPLTVDYQEKQFAQGLIPSTF  500
            +  + VRDFLPLTVDYQEKQ+AQG+IP+T+
Sbjct  104  KSSEPVRDFLPLTVDYQEKQYAQGVIPTTY  133



>ref|XP_010235710.1| PREDICTED: polyribonucleotide nucleotidyltransferase 2, mitochondrial 
[Brachypodium distachyon]
Length=976

 Score = 79.0 bits (193),  Expect = 1e-13, Method: Composition-based stats.
 Identities = 40/61 (66%), Positives = 46/61 (75%), Gaps = 0/61 (0%)
 Frame = +2

Query  263  GTKILESFTEEFEIGSRKITLETGKIARFANGSVVLAMDETKVLSTVASAKGRRSSRFST  442
            G K+LESF EEFEIG R I  ETGKIARFANGSVV++MD+T VLSTVA++K     R   
Sbjct  50   GRKVLESFREEFEIGGRLIAFETGKIARFANGSVVISMDDTHVLSTVAASKSSDPVRDFL  109

Query  443  P  445
            P
Sbjct  110  P  110


 Score = 53.5 bits (127),  Expect = 2e-05, Method: Composition-based stats.
 Identities = 22/30 (73%), Positives = 27/30 (90%), Gaps = 0/30 (0%)
 Frame = +3

Query  411  QRGDAVRDFLPLTVDYQEKQFAQGLIPSTF  500
            +  D VRDFLPLTVDYQEKQ+AQG+IP+T+
Sbjct  100  KSSDPVRDFLPLTVDYQEKQYAQGVIPTTY  129



>ref|XP_006648841.1| PREDICTED: polyribonucleotide nucleotidyltransferase 2, mitochondrial-like, 
partial [Oryza brachyantha]
Length=947

 Score = 77.4 bits (189),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 38/61 (62%), Positives = 47/61 (77%), Gaps = 0/61 (0%)
 Frame = +2

Query  263  GTKILESFTEEFEIGSRKITLETGKIARFANGSVVLAMDETKVLSTVASAKGRRSSRFST  442
            G K+LESF +EFE+G R I+ ETGK+ARFANGSVV++MD+T VLSTVA+AK     R   
Sbjct  23   GRKVLESFRDEFEVGGRVISFETGKMARFANGSVVISMDDTHVLSTVAAAKSSEPVRDFL  82

Query  443  P  445
            P
Sbjct  83   P  83


 Score = 52.0 bits (123),  Expect = 6e-05, Method: Composition-based stats.
 Identities = 21/30 (70%), Positives = 27/30 (90%), Gaps = 0/30 (0%)
 Frame = +3

Query  411  QRGDAVRDFLPLTVDYQEKQFAQGLIPSTF  500
            +  + VRDFLPLTVDYQEKQ+AQG+IP+T+
Sbjct  73   KSSEPVRDFLPLTVDYQEKQYAQGVIPTTY  102



>ref|XP_002454178.1| hypothetical protein SORBIDRAFT_04g026110 [Sorghum bicolor]
 gb|EES07154.1| hypothetical protein SORBIDRAFT_04g026110 [Sorghum bicolor]
Length=983

 Score = 77.4 bits (189),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 39/61 (64%), Positives = 46/61 (75%), Gaps = 0/61 (0%)
 Frame = +2

Query  263  GTKILESFTEEFEIGSRKITLETGKIARFANGSVVLAMDETKVLSTVASAKGRRSSRFST  442
            G K+LESF EEFEIG R I  ETGK+ARFANGSVV++M++T VLSTVA+AK     R   
Sbjct  61   GRKVLESFREEFEIGGRSIAFETGKMARFANGSVVISMEDTHVLSTVAAAKSSEPVRDFL  120

Query  443  P  445
            P
Sbjct  121  P  121


 Score = 52.0 bits (123),  Expect = 6e-05, Method: Composition-based stats.
 Identities = 21/30 (70%), Positives = 27/30 (90%), Gaps = 0/30 (0%)
 Frame = +3

Query  411  QRGDAVRDFLPLTVDYQEKQFAQGLIPSTF  500
            +  + VRDFLPLTVDYQEKQ+AQG+IP+T+
Sbjct  111  KSSEPVRDFLPLTVDYQEKQYAQGVIPTTY  140



>ref|XP_001782634.1| predicted protein [Physcomitrella patens]
 gb|EDQ52537.1| predicted protein [Physcomitrella patens]
Length=817

 Score = 52.8 bits (125),  Expect(2) = 6e-12, Method: Composition-based stats.
 Identities = 24/42 (57%), Positives = 34/42 (81%), Gaps = 0/42 (0%)
 Frame = +2

Query  284  FTEEFEIGSRKITLETGKIARFANGSVVLAMDETKVLSTVAS  409
            F EE E+G+ K++ ETGK+ARFA+G+VV+ + ETKVL TV +
Sbjct  85   FQEEAEVGNMKMSFETGKLARFASGAVVVGVGETKVLVTVVA  126


 Score = 44.3 bits (103),  Expect(2) = 6e-12, Method: Composition-based stats.
 Identities = 18/27 (67%), Positives = 23/27 (85%), Gaps = 0/27 (0%)
 Frame = +3

Query  420  DAVRDFLPLTVDYQEKQFAQGLIPSTF  500
            D  +DFLPL V+Y+EKQ+AQG IP+TF
Sbjct  131  DGGKDFLPLQVEYREKQYAQGKIPATF  157



>ref|WP_041067289.1| polynucleotide phosphorylase/polyadenylase [Thiolapillus brandeum]
 dbj|BAO44454.1| polyribonucleotide nucleotidyltransferase [Thiolapillus brandeum]
Length=697

 Score = 50.4 bits (119),  Expect(2) = 1e-10, Method: Composition-based stats.
 Identities = 23/53 (43%), Positives = 36/53 (68%), Gaps = 0/53 (0%)
 Frame = +2

Query  275  LESFTEEFEIGSRKITLETGKIARFANGSVVLAMDETKVLSTVASAKGRRSSR  433
            + +  +EF+ G  K+TLETG++AR A+G+V++ MD+T VL TV  +K     R
Sbjct  1    MTAIKKEFQFGDHKVTLETGEVARQADGAVIVNMDDTVVLCTVVGSKHAMEGR  53


 Score = 41.6 bits (96),  Expect(2) = 1e-10, Method: Composition-based stats.
 Identities = 17/24 (71%), Positives = 18/24 (75%), Gaps = 0/24 (0%)
 Frame = +3

Query  429  RDFLPLTVDYQEKQFAQGLIPSTF  500
            RDF PLTVDYQEK +A G IP  F
Sbjct  53   RDFFPLTVDYQEKTYAAGKIPGGF  76



>gb|AAF83052.1|AE003877_7 polynucleotide phosphorylase [Xylella fastidiosa 9a5c]
 gb|ETE35903.1| polynucleotide phosphorylase/polyadenylase [Xylella fastidiosa 
32]
Length=719

 Score = 52.0 bits (123),  Expect(2) = 2e-10, Method: Composition-based stats.
 Identities = 24/60 (40%), Positives = 38/60 (63%), Gaps = 0/60 (0%)
 Frame = +2

Query  254  HMAGTKILESFTEEFEIGSRKITLETGKIARFANGSVVLAMDETKVLSTVASAKGRRSSR  433
            H     ++   T+ F+ G   +TLETG++AR ANG+V++ MD+T +L TV +AK  R  +
Sbjct  13   HHPKETLVAKITKTFQYGKHTVTLETGEVARQANGAVIVKMDDTVLLVTVVAAKTAREGQ  72


 Score = 39.3 bits (90),  Expect(2) = 2e-10, Method: Composition-based stats.
 Identities = 16/24 (67%), Positives = 19/24 (79%), Gaps = 0/24 (0%)
 Frame = +3

Query  429  RDFLPLTVDYQEKQFAQGLIPSTF  500
            +DF PLTVDYQEK +A G IP +F
Sbjct  72   QDFFPLTVDYQEKFYAGGRIPGSF  95



>gb|ETE24598.1| polynucleotide phosphorylase/polyadenylase [Xylella fastidiosa 
6c]
Length=719

 Score = 52.0 bits (123),  Expect(2) = 2e-10, Method: Composition-based stats.
 Identities = 24/60 (40%), Positives = 38/60 (63%), Gaps = 0/60 (0%)
 Frame = +2

Query  254  HMAGTKILESFTEEFEIGSRKITLETGKIARFANGSVVLAMDETKVLSTVASAKGRRSSR  433
            H     ++   T+ F+ G   +TLETG++AR ANG+V++ MD+T +L TV +AK  R  +
Sbjct  13   HHPKETLVAKITKTFQYGKHTVTLETGEVARQANGAVIVKMDDTVLLVTVVAAKTAREGQ  72


 Score = 39.3 bits (90),  Expect(2) = 2e-10, Method: Composition-based stats.
 Identities = 16/24 (67%), Positives = 19/24 (79%), Gaps = 0/24 (0%)
 Frame = +3

Query  429  RDFLPLTVDYQEKQFAQGLIPSTF  500
            +DF PLTVDYQEK +A G IP +F
Sbjct  72   QDFFPLTVDYQEKFYAGGRIPGSF  95



>ref|WP_031337508.1| polynucleotide phosphorylase/polyadenylase [Xylella fastidiosa]
 sp|Q9PGQ9.2|PNP_XYLFA RecName: Full=Polyribonucleotide nucleotidyltransferase; AltName: 
Full=Polynucleotide phosphorylase; Short=PNPase [Xylella 
fastidiosa 9a5c]
 gb|KIA59032.1| polynucleotide phosphorylase/polyadenylase [Xylella fastidiosa]
Length=700

 Score = 50.8 bits (120),  Expect(2) = 4e-10, Method: Composition-based stats.
 Identities = 23/53 (43%), Positives = 36/53 (68%), Gaps = 0/53 (0%)
 Frame = +2

Query  275  LESFTEEFEIGSRKITLETGKIARFANGSVVLAMDETKVLSTVASAKGRRSSR  433
            +   T+ F+ G   +TLETG++AR ANG+V++ MD+T +L TV +AK  R  +
Sbjct  1    MAKITKTFQYGKHTVTLETGEVARQANGAVIVKMDDTVLLVTVVAAKTAREGQ  53


 Score = 39.7 bits (91),  Expect(2) = 4e-10, Method: Composition-based stats.
 Identities = 16/24 (67%), Positives = 19/24 (79%), Gaps = 0/24 (0%)
 Frame = +3

Query  429  RDFLPLTVDYQEKQFAQGLIPSTF  500
            +DF PLTVDYQEK +A G IP +F
Sbjct  53   QDFFPLTVDYQEKFYAGGRIPGSF  76



>ref|WP_031336189.1| polynucleotide phosphorylase/polyadenylase [Xylella fastidiosa]
Length=700

 Score = 50.8 bits (120),  Expect(2) = 4e-10, Method: Composition-based stats.
 Identities = 23/53 (43%), Positives = 36/53 (68%), Gaps = 0/53 (0%)
 Frame = +2

Query  275  LESFTEEFEIGSRKITLETGKIARFANGSVVLAMDETKVLSTVASAKGRRSSR  433
            +   T+ F+ G   +TLETG++AR ANG+V++ MD+T +L TV +AK  R  +
Sbjct  1    MAKITKTFQYGKHTVTLETGEVARQANGAVIVKMDDTVLLVTVVAAKTAREGQ  53


 Score = 39.3 bits (90),  Expect(2) = 4e-10, Method: Composition-based stats.
 Identities = 16/24 (67%), Positives = 19/24 (79%), Gaps = 0/24 (0%)
 Frame = +3

Query  429  RDFLPLTVDYQEKQFAQGLIPSTF  500
            +DF PLTVDYQEK +A G IP +F
Sbjct  53   QDFFPLTVDYQEKFYAGGRIPGSF  76



>ref|WP_006474939.1| polyribonucleotide nucleotidyltransferase [endosymbiont of Tevnia 
jerichonana]
 gb|EGW54174.1| polyribonucleotide nucleotidyltransferase [endosymbiont of Tevnia 
jerichonana (vent Tica)]
Length=699

 Score = 48.1 bits (113),  Expect(2) = 6e-10, Method: Compositional matrix adjust.
 Identities = 22/46 (48%), Positives = 35/46 (76%), Gaps = 0/46 (0%)
 Frame = +2

Query  275  LESFTEEFEIGSRKITLETGKIARFANGSVVLAMDETKVLSTVASA  412
            + +  +EF+ G  K++LETG+IAR A+G+V++ MD+T VL+TV  A
Sbjct  1    MTAIKKEFQWGEHKVSLETGEIARQADGAVLVNMDDTVVLATVVGA  46


 Score = 41.6 bits (96),  Expect(2) = 6e-10, Method: Composition-based stats.
 Identities = 17/24 (71%), Positives = 18/24 (75%), Gaps = 0/24 (0%)
 Frame = +3

Query  429  RDFLPLTVDYQEKQFAQGLIPSTF  500
            RDF PLTVDYQEK +A G IP  F
Sbjct  52   RDFFPLTVDYQEKTYAAGKIPGGF  75



>ref|WP_014238841.1| polynucleotide phosphorylase [Azospirillum brasilense]
 emb|CCC96519.1| polynucleotide phosphorylase [Azospirillum brasilense Sp245]
Length=706

 Score = 50.4 bits (119),  Expect(2) = 1e-09, Method: Composition-based stats.
 Identities = 25/48 (52%), Positives = 33/48 (69%), Gaps = 0/48 (0%)
 Frame = +2

Query  272  ILESFTEEFEIGSRKITLETGKIARFANGSVVLAMDETKVLSTVASAK  415
            + + F +E E G RK+T ETGKIAR A+G+V++   ET VL TV  AK
Sbjct  1    MFKVFRKEIEWGGRKLTFETGKIARQADGAVLVTYGETTVLCTVVGAK  48


 Score = 38.9 bits (89),  Expect(2) = 1e-09, Method: Composition-based stats.
 Identities = 16/23 (70%), Positives = 17/23 (74%), Gaps = 0/23 (0%)
 Frame = +3

Query  432  DFLPLTVDYQEKQFAQGLIPSTF  500
            DF PLTV+YQEK FA G IP  F
Sbjct  55   DFFPLTVNYQEKSFAAGKIPGGF  77



>ref|WP_035670107.1| polynucleotide phosphorylase/polyadenylase [Azospirillum brasilense]
Length=706

 Score = 50.1 bits (118),  Expect(2) = 1e-09, Method: Composition-based stats.
 Identities = 25/48 (52%), Positives = 33/48 (69%), Gaps = 0/48 (0%)
 Frame = +2

Query  272  ILESFTEEFEIGSRKITLETGKIARFANGSVVLAMDETKVLSTVASAK  415
            + + F +E E G RK+T ETGKIAR A+G+V++   ET VL TV  AK
Sbjct  1    MFKVFRKEIEWGGRKLTFETGKIARQADGAVLVTYGETTVLCTVVGAK  48


 Score = 38.9 bits (89),  Expect(2) = 1e-09, Method: Composition-based stats.
 Identities = 16/23 (70%), Positives = 17/23 (74%), Gaps = 0/23 (0%)
 Frame = +3

Query  432  DFLPLTVDYQEKQFAQGLIPSTF  500
            DF PLTV+YQEK FA G IP  F
Sbjct  55   DFFPLTVNYQEKSFAAGKIPGGF  77



>ref|WP_038530324.1| polynucleotide phosphorylase/polyadenylase [Azospirillum brasilense]
 gb|EZQ07399.1| polynucleotide phosphorylase/polyadenylase [Azospirillum brasilense]
 gb|AIB13166.1| polynucleotide phosphorylase/polyadenylase [Azospirillum brasilense]
Length=706

 Score = 50.4 bits (119),  Expect(2) = 1e-09, Method: Composition-based stats.
 Identities = 25/48 (52%), Positives = 33/48 (69%), Gaps = 0/48 (0%)
 Frame = +2

Query  272  ILESFTEEFEIGSRKITLETGKIARFANGSVVLAMDETKVLSTVASAK  415
            + + F +E E G RK+T ETGKIAR A+G+V++   ET VL TV  AK
Sbjct  1    MFKVFRKEIEWGGRKLTFETGKIARQADGAVLVTYGETTVLCTVVGAK  48


 Score = 38.9 bits (89),  Expect(2) = 1e-09, Method: Composition-based stats.
 Identities = 16/23 (70%), Positives = 17/23 (74%), Gaps = 0/23 (0%)
 Frame = +3

Query  432  DFLPLTVDYQEKQFAQGLIPSTF  500
            DF PLTV+YQEK FA G IP  F
Sbjct  55   DFFPLTVNYQEKSFAAGKIPGGF  77



>gb|AAO28089.1| polynucleotide phosphorylase [Xylella fastidiosa Temecula1]
 gb|EGO80892.1| Polyribonucleotide nucleotidyltransferase [Xylella fastidiosa 
EB92.1]
Length=719

 Score = 49.7 bits (117),  Expect(2) = 1e-09, Method: Composition-based stats.
 Identities = 23/60 (38%), Positives = 38/60 (63%), Gaps = 0/60 (0%)
 Frame = +2

Query  254  HMAGTKILESFTEEFEIGSRKITLETGKIARFANGSVVLAMDETKVLSTVASAKGRRSSR  433
            H     ++   T+ F+ G   +TLETG++AR A+G+V++ MD+T +L TV +AK  R  +
Sbjct  13   HHPKETLVAKITKTFQYGKHTVTLETGEVARQASGAVIVKMDDTVLLVTVVAAKTAREGQ  72


 Score = 39.3 bits (90),  Expect(2) = 1e-09, Method: Composition-based stats.
 Identities = 16/24 (67%), Positives = 19/24 (79%), Gaps = 0/24 (0%)
 Frame = +3

Query  429  RDFLPLTVDYQEKQFAQGLIPSTF  500
            +DF PLTVDYQEK +A G IP +F
Sbjct  72   QDFFPLTVDYQEKFYAGGRIPGSF  95



>ref|WP_029010755.1| polynucleotide phosphorylase/polyadenylase [Azospirillum halopraeferens]
Length=709

 Score = 49.7 bits (117),  Expect(2) = 1e-09, Method: Compositional matrix adjust.
 Identities = 25/47 (53%), Positives = 34/47 (72%), Gaps = 0/47 (0%)
 Frame = +2

Query  284  FTEEFEIGSRKITLETGKIARFANGSVVLAMDETKVLSTVASAKGRR  424
            F +E + G RK+TLETGKIAR A+G+V++   ET VL TV +AK  +
Sbjct  5    FRKEIDWGGRKLTLETGKIARQADGAVMVTYGETTVLCTVVAAKAAK  51


 Score = 38.9 bits (89),  Expect(2) = 1e-09, Method: Composition-based stats.
 Identities = 16/23 (70%), Positives = 17/23 (74%), Gaps = 0/23 (0%)
 Frame = +3

Query  432  DFLPLTVDYQEKQFAQGLIPSTF  500
            DF PLTV+YQEK FA G IP  F
Sbjct  55   DFFPLTVNYQEKTFAAGKIPGGF  77



>ref|WP_012337582.1| polynucleotide phosphorylase/polyadenylase [Xylella fastidiosa]
 sp|B0U1R2.1|PNP_XYLFM RecName: Full=Polyribonucleotide nucleotidyltransferase; AltName: 
Full=Polynucleotide phosphorylase; Short=PNPase [Xylella 
fastidiosa M12]
 gb|ACA11240.1| Polyribonucleotide nucleotidyltransferase [Xylella fastidiosa 
M12]
 gb|ERI60417.1| polynucleotide phosphorylase/polyadenylase [Xylella fastidiosa 
subsp. multiplex Griffin-1]
 gb|KFA41593.1| polynucleotide phosphorylase/polyadenylase [Xylella fastidiosa]
Length=700

 Score = 48.9 bits (115),  Expect(2) = 2e-09, Method: Composition-based stats.
 Identities = 22/53 (42%), Positives = 36/53 (68%), Gaps = 0/53 (0%)
 Frame = +2

Query  275  LESFTEEFEIGSRKITLETGKIARFANGSVVLAMDETKVLSTVASAKGRRSSR  433
            +   T+ F+ G   +TLETG++AR A+G+V++ MD+T +L TV +AK  R  +
Sbjct  1    MAKITKTFQYGKHTVTLETGEVARQASGAVIVKMDDTVLLVTVVAAKTAREGQ  53


 Score = 39.7 bits (91),  Expect(2) = 2e-09, Method: Composition-based stats.
 Identities = 16/24 (67%), Positives = 19/24 (79%), Gaps = 0/24 (0%)
 Frame = +3

Query  429  RDFLPLTVDYQEKQFAQGLIPSTF  500
            +DF PLTVDYQEK +A G IP +F
Sbjct  53   QDFFPLTVDYQEKFYAGGRIPGSF  76



>ref|WP_012382430.1| polynucleotide phosphorylase/polyadenylase [Xylella fastidiosa]
 sp|Q87EV0.2|PNP_XYLFT RecName: Full=Polyribonucleotide nucleotidyltransferase; AltName: 
Full=Polynucleotide phosphorylase; Short=PNPase [Xylella 
fastidiosa Temecula1]
 sp|B2I730.1|PNP_XYLF2 RecName: Full=Polyribonucleotide nucleotidyltransferase; AltName: 
Full=Polynucleotide phosphorylase; Short=PNPase [Xylella 
fastidiosa M23]
 gb|ACB91640.1| Polyribonucleotide nucleotidyltransferase [Xylella fastidiosa 
M23]
 gb|ADN63187.1| polynucleotide phosphorylase/polyadenylase [Xylella fastidiosa 
subsp. fastidiosa GB514]
 gb|EWG14074.1| polynucleotide phosphorylase [Xylella fastidiosa Mul-MD]
 gb|AIC13204.1| polynucleotide phosphorylase/polyadenylase [Xylella fastidiosa 
MUL0034]
 gb|KGM21481.1| polynucleotide phosphorylase/polyadenylase [Xylella fastidiosa]
Length=700

 Score = 48.9 bits (115),  Expect(2) = 2e-09, Method: Composition-based stats.
 Identities = 22/53 (42%), Positives = 36/53 (68%), Gaps = 0/53 (0%)
 Frame = +2

Query  275  LESFTEEFEIGSRKITLETGKIARFANGSVVLAMDETKVLSTVASAKGRRSSR  433
            +   T+ F+ G   +TLETG++AR A+G+V++ MD+T +L TV +AK  R  +
Sbjct  1    MAKITKTFQYGKHTVTLETGEVARQASGAVIVKMDDTVLLVTVVAAKTAREGQ  53


 Score = 39.3 bits (90),  Expect(2) = 2e-09, Method: Composition-based stats.
 Identities = 16/24 (67%), Positives = 19/24 (79%), Gaps = 0/24 (0%)
 Frame = +3

Query  429  RDFLPLTVDYQEKQFAQGLIPSTF  500
            +DF PLTVDYQEK +A G IP +F
Sbjct  53   QDFFPLTVDYQEKFYAGGRIPGSF  76



>ref|WP_020851437.1| Polyribonucleotide nucleotidyltransferase [Xylella fastidiosa]
 gb|AIC09357.1| polynucleotide phosphorylase/polyadenylase [Xylella fastidiosa 
subsp. sandyi Ann-1]
Length=700

 Score = 48.9 bits (115),  Expect(2) = 2e-09, Method: Composition-based stats.
 Identities = 22/53 (42%), Positives = 36/53 (68%), Gaps = 0/53 (0%)
 Frame = +2

Query  275  LESFTEEFEIGSRKITLETGKIARFANGSVVLAMDETKVLSTVASAKGRRSSR  433
            +   T+ F+ G   +TLETG++AR A+G+V++ MD+T +L TV +AK  R  +
Sbjct  1    MAKITKTFQYGKHTVTLETGEVARQASGAVIVKMDDTVLLVTVVAAKTAREGQ  53


 Score = 39.3 bits (90),  Expect(2) = 2e-09, Method: Composition-based stats.
 Identities = 16/24 (67%), Positives = 19/24 (79%), Gaps = 0/24 (0%)
 Frame = +3

Query  429  RDFLPLTVDYQEKQFAQGLIPSTF  500
            +DF PLTVDYQEK +A G IP +F
Sbjct  53   QDFFPLTVDYQEKFYAGGRIPGSF  76



>ref|WP_004086257.1| polynucleotide phosphorylase/polyadenylase [Xylella fastidiosa]
 gb|EAO12545.1| Polyribonucleotide nucleotidyltransferase [Xylella fastidiosa 
Dixon]
Length=700

 Score = 48.9 bits (115),  Expect(2) = 2e-09, Method: Composition-based stats.
 Identities = 22/53 (42%), Positives = 36/53 (68%), Gaps = 0/53 (0%)
 Frame = +2

Query  275  LESFTEEFEIGSRKITLETGKIARFANGSVVLAMDETKVLSTVASAKGRRSSR  433
            +   T+ F+ G   +TLETG++AR A+G+V++ MD+T +L TV +AK  R  +
Sbjct  1    MAKITKTFQYGKHTVTLETGEVARQASGAVIVKMDDTVLLVTVVAAKTAREGQ  53


 Score = 39.3 bits (90),  Expect(2) = 2e-09, Method: Composition-based stats.
 Identities = 16/24 (67%), Positives = 19/24 (79%), Gaps = 0/24 (0%)
 Frame = +3

Query  429  RDFLPLTVDYQEKQFAQGLIPSTF  500
            +DF PLTVDYQEK +A G IP +F
Sbjct  53   QDFFPLTVDYQEKFYAGGRIPGSF  76



>ref|WP_029407474.1| polynucleotide phosphorylase/polyadenylase [Thiomicrospira sp. 
Milos-T2]
Length=697

 Score = 50.8 bits (120),  Expect(2) = 2e-09, Method: Compositional matrix adjust.
 Identities = 22/53 (42%), Positives = 39/53 (74%), Gaps = 0/53 (0%)
 Frame = +2

Query  275  LESFTEEFEIGSRKITLETGKIARFANGSVVLAMDETKVLSTVASAKGRRSSR  433
            +  FT+ F+ G+ ++TLETG+IAR A+G+V++ M ET++L T  +AK  ++ +
Sbjct  1    MAKFTKTFQYGNHQVTLETGEIARQADGAVMVGMGETRILVTAVAAKSAKAGQ  53


 Score = 37.4 bits (85),  Expect(2) = 2e-09, Method: Composition-based stats.
 Identities = 16/26 (62%), Positives = 19/26 (73%), Gaps = 0/26 (0%)
 Frame = +3

Query  423  AVRDFLPLTVDYQEKQFAQGLIPSTF  500
            A +DF PLTV+YQEK +A G IP  F
Sbjct  51   AGQDFFPLTVNYQEKAYAAGRIPGGF  76



>ref|XP_007031538.1| Polyribonucleotide nucleotidyltransferase, putative isoform 2 
[Theobroma cacao]
 gb|EOY02464.1| Polyribonucleotide nucleotidyltransferase, putative isoform 2 
[Theobroma cacao]
Length=896

 Score = 60.8 bits (146),  Expect(2) = 2e-09, Method: Composition-based stats.
 Identities = 26/29 (90%), Positives = 29/29 (100%), Gaps = 0/29 (0%)
 Frame = +3

Query  414  RGDAVRDFLPLTVDYQEKQFAQGLIPSTF  500
            +GDAVRDFLPLTVDYQEKQFAQG+IP+TF
Sbjct  14   KGDAVRDFLPLTVDYQEKQFAQGVIPNTF  42


 Score = 26.9 bits (58),  Expect(2) = 2e-09, Method: Composition-based stats.
 Identities = 11/15 (73%), Positives = 14/15 (93%), Gaps = 0/15 (0%)
 Frame = +2

Query  374  MDETKVLSTVASAKG  418
            M+ETKVLST+A+ KG
Sbjct  1    MEETKVLSTIAAGKG  15



>ref|XP_003618178.1| Polyribonucleotide nucleotidyltransferase [Medicago truncatula]
Length=1106

 Score = 65.9 bits (159),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 28/50 (56%), Positives = 41/50 (82%), Gaps = 0/50 (0%)
 Frame = +2

Query  266  TKILESFTEEFEIGSRKITLETGKIARFANGSVVLAMDETKVLSTVASAK  415
            TK+LE+FTEEFE+G+R IT + GK  RF+NG+VVL M++ K+LS V +++
Sbjct  38   TKLLETFTEEFEVGNRLITFQNGKYGRFSNGAVVLTMEDNKILSAVNTSR  87



>gb|ADI16912.1| polyribonucleotide nucleotidyltransferase (polynucleotide phosphorylase) 
[uncultured gamma proteobacterium HF0010_16J05]
Length=718

 Score = 50.1 bits (118),  Expect(2) = 3e-09, Method: Composition-based stats.
 Identities = 24/54 (44%), Positives = 37/54 (69%), Gaps = 0/54 (0%)
 Frame = +2

Query  263  GTKILESFTEEFEIGSRKITLETGKIARFANGSVVLAMDETKVLSTVASAKGRR  424
            G   L + T++F+ G +++T+ET KIA+ A GSVV+ + +T VL+TV  AK  R
Sbjct  14   GVYNLNAITKQFQFGDQQVTIETNKIAKQATGSVVVTIGDTVVLTTVVGAKSAR  67


 Score = 37.7 bits (86),  Expect(2) = 3e-09, Method: Composition-based stats.
 Identities = 15/24 (63%), Positives = 18/24 (75%), Gaps = 0/24 (0%)
 Frame = +3

Query  429  RDFLPLTVDYQEKQFAQGLIPSTF  500
            +DF PLTV+YQEK +A G IP  F
Sbjct  70   QDFFPLTVNYQEKTYAAGKIPGGF  93



>ref|WP_040728507.1| polynucleotide phosphorylase/polyadenylase [Thiomicrospira sp. 
Kp2]
Length=696

 Score = 50.1 bits (118),  Expect(2) = 3e-09, Method: Compositional matrix adjust.
 Identities = 22/53 (42%), Positives = 38/53 (72%), Gaps = 0/53 (0%)
 Frame = +2

Query  275  LESFTEEFEIGSRKITLETGKIARFANGSVVLAMDETKVLSTVASAKGRRSSR  433
            +  FT+ F+ G  ++TLETG+IAR A+G+V++ M +T+VL T  +AK  ++ +
Sbjct  1    MAKFTKTFQYGQHQVTLETGEIARQADGAVMIGMGDTRVLVTAVAAKSAKAGQ  53


 Score = 37.4 bits (85),  Expect(2) = 3e-09, Method: Composition-based stats.
 Identities = 16/26 (62%), Positives = 19/26 (73%), Gaps = 0/26 (0%)
 Frame = +3

Query  423  AVRDFLPLTVDYQEKQFAQGLIPSTF  500
            A +DF PLTV+YQEK +A G IP  F
Sbjct  51   AGQDFFPLTVNYQEKAYAAGKIPGGF  76



>ref|WP_018026459.1| polynucleotide phosphorylase/polyadenylase [Oligella urethralis]
Length=715

 Score = 50.1 bits (118),  Expect(2) = 3e-09, Method: Composition-based stats.
 Identities = 23/48 (48%), Positives = 34/48 (71%), Gaps = 0/48 (0%)
 Frame = +2

Query  272  ILESFTEEFEIGSRKITLETGKIARFANGSVVLAMDETKVLSTVASAK  415
            +   FT+ F+ G   +TLETG+IAR A G+V+ +M +T VL+TV +AK
Sbjct  1    MFNKFTQSFQYGEHTVTLETGEIARQATGAVLASMGDTVVLATVVAAK  48


 Score = 37.7 bits (86),  Expect(2) = 3e-09, Method: Composition-based stats.
 Identities = 15/24 (63%), Positives = 18/24 (75%), Gaps = 0/24 (0%)
 Frame = +3

Query  429  RDFLPLTVDYQEKQFAQGLIPSTF  500
            +DF PLTVDY EK +A G+IP  F
Sbjct  54   QDFFPLTVDYIEKAYAAGMIPGGF  77



>ref|WP_036560419.1| polynucleotide phosphorylase/polyadenylase [Oligella urethralis]
 gb|KGF28127.1| polynucleotide phosphorylase/polyadenylase [Oligella urethralis 
DNF00040]
Length=715

 Score = 49.7 bits (117),  Expect(2) = 3e-09, Method: Composition-based stats.
 Identities = 23/48 (48%), Positives = 34/48 (71%), Gaps = 0/48 (0%)
 Frame = +2

Query  272  ILESFTEEFEIGSRKITLETGKIARFANGSVVLAMDETKVLSTVASAK  415
            +   FT+ F+ G   +TLETG+IAR A G+V+ +M +T VL+TV +AK
Sbjct  1    MFNKFTQSFQYGEHTVTLETGEIARQATGAVLASMGDTVVLATVVAAK  48


 Score = 37.7 bits (86),  Expect(2) = 3e-09, Method: Composition-based stats.
 Identities = 15/24 (63%), Positives = 18/24 (75%), Gaps = 0/24 (0%)
 Frame = +3

Query  429  RDFLPLTVDYQEKQFAQGLIPSTF  500
            +DF PLTVDY EK +A G+IP  F
Sbjct  54   QDFFPLTVDYIEKAYAAGMIPGGF  77



>ref|WP_038271091.1| polynucleotide phosphorylase/polyadenylase [Xylella fastidiosa]
 gb|EWS78313.1| polynucleotide phosphorylase/polyadenylase [Xylella fastidiosa 
PLS229]
Length=700

 Score = 47.8 bits (112),  Expect(2) = 3e-09, Method: Composition-based stats.
 Identities = 21/53 (40%), Positives = 35/53 (66%), Gaps = 0/53 (0%)
 Frame = +2

Query  275  LESFTEEFEIGSRKITLETGKIARFANGSVVLAMDETKVLSTVASAKGRRSSR  433
            +   T+ F+ G   +TLETG++AR A+G+V++ MD+T +L T  +AK  R  +
Sbjct  1    MAKITKTFQYGKHTVTLETGEVARQADGAVIVKMDDTVLLVTAVAAKNAREGQ  53


 Score = 39.7 bits (91),  Expect(2) = 3e-09, Method: Composition-based stats.
 Identities = 16/24 (67%), Positives = 19/24 (79%), Gaps = 0/24 (0%)
 Frame = +3

Query  429  RDFLPLTVDYQEKQFAQGLIPSTF  500
            +DF PLTVDYQEK +A G IP +F
Sbjct  53   QDFFPLTVDYQEKFYAGGRIPGSF  76



>ref|WP_018574108.1| polynucleotide phosphorylase/polyadenylase [Oligella ureolytica]
Length=718

 Score = 51.2 bits (121),  Expect(2) = 3e-09, Method: Composition-based stats.
 Identities = 24/48 (50%), Positives = 34/48 (71%), Gaps = 0/48 (0%)
 Frame = +2

Query  272  ILESFTEEFEIGSRKITLETGKIARFANGSVVLAMDETKVLSTVASAK  415
            +   FT+ F+ G   +TLETG+IAR A G+VV +M +T VL+TV +AK
Sbjct  1    MFNKFTQSFQYGDHTVTLETGEIARQATGAVVASMGDTVVLATVVAAK  48


 Score = 36.2 bits (82),  Expect(2) = 3e-09, Method: Composition-based stats.
 Identities = 15/24 (63%), Positives = 17/24 (71%), Gaps = 0/24 (0%)
 Frame = +3

Query  429  RDFLPLTVDYQEKQFAQGLIPSTF  500
            +DF PLTVDY EK +A G IP  F
Sbjct  54   QDFFPLTVDYIEKAYAAGKIPGGF  77



>ref|WP_034853538.1| polynucleotide phosphorylase/polyadenylase [Inquilinus limosus]
Length=716

 Score = 48.9 bits (115),  Expect(2) = 4e-09, Method: Composition-based stats.
 Identities = 24/60 (40%), Positives = 36/60 (60%), Gaps = 0/60 (0%)
 Frame = +2

Query  257  MAGTKILESFTEEFEIGSRKITLETGKIARFANGSVVLAMDETKVLSTVASAKGRRSSRF  436
            M G  +   + +E   G RK+ LETGKIAR A+G+V++   ET VL T   +K + ++ F
Sbjct  1    MEGKAMFNIYRKEINWGGRKLVLETGKIARQADGAVLVTYGETVVLCTAVGSKAKSAADF  60


 Score = 38.1 bits (87),  Expect(2) = 4e-09, Method: Composition-based stats.
 Identities = 16/29 (55%), Positives = 19/29 (66%), Gaps = 0/29 (0%)
 Frame = +3

Query  414  RGDAVRDFLPLTVDYQEKQFAQGLIPSTF  500
            +  +  DF PLTV+YQEK FA G IP  F
Sbjct  53   KAKSAADFFPLTVNYQEKAFAAGKIPGGF  81



>ref|WP_028466285.1| polynucleotide phosphorylase/polyadenylase [Nisaea denitrificans]
Length=703

 Score = 48.5 bits (114),  Expect(2) = 4e-09, Method: Composition-based stats.
 Identities = 23/48 (48%), Positives = 33/48 (69%), Gaps = 0/48 (0%)
 Frame = +2

Query  272  ILESFTEEFEIGSRKITLETGKIARFANGSVVLAMDETKVLSTVASAK  415
            + + + +E + G RK+TLETGKIAR A+G+V+  M ET VL T   A+
Sbjct  1    MFQIYKQEIDWGGRKLTLETGKIARQADGAVMATMGETTVLCTAVYAR  48


 Score = 38.9 bits (89),  Expect(2) = 4e-09, Method: Composition-based stats.
 Identities = 16/23 (70%), Positives = 17/23 (74%), Gaps = 0/23 (0%)
 Frame = +3

Query  432  DFLPLTVDYQEKQFAQGLIPSTF  500
            DF PLTV+YQEK FA G IP  F
Sbjct  55   DFFPLTVNYQEKTFAAGKIPGGF  77



>ref|WP_029064149.1| polynucleotide phosphorylase/polyadenylase [Labrenzia sp. DG1229]
Length=709

 Score = 48.9 bits (115),  Expect(2) = 4e-09, Method: Compositional matrix adjust.
 Identities = 25/47 (53%), Positives = 33/47 (70%), Gaps = 0/47 (0%)
 Frame = +2

Query  293  EFEIGSRKITLETGKIARFANGSVVLAMDETKVLSTVASAKGRRSSR  433
            E E G R + LETGK+AR A+G+V+    ETKVL+TV SAK  R+ +
Sbjct  8    EVEWGGRPLILETGKVARQADGAVMATYGETKVLATVVSAKAPRAGQ  54


 Score = 38.1 bits (87),  Expect(2) = 4e-09, Method: Composition-based stats.
 Identities = 16/26 (62%), Positives = 19/26 (73%), Gaps = 0/26 (0%)
 Frame = +3

Query  423  AVRDFLPLTVDYQEKQFAQGLIPSTF  500
            A +DF PLTV+YQEK FA G IP  +
Sbjct  52   AGQDFFPLTVNYQEKAFAAGKIPGGY  77



>ref|WP_040452728.1| polynucleotide phosphorylase/polyadenylase [Labrenzia alexandrii]
Length=710

 Score = 48.5 bits (114),  Expect(2) = 4e-09, Method: Compositional matrix adjust.
 Identities = 25/47 (53%), Positives = 33/47 (70%), Gaps = 0/47 (0%)
 Frame = +2

Query  293  EFEIGSRKITLETGKIARFANGSVVLAMDETKVLSTVASAKGRRSSR  433
            E + G R + LETGK+AR A+GSV+    ETKVL+TV SAK  R+ +
Sbjct  8    EVDWGGRPLILETGKVARQADGSVMATYGETKVLATVVSAKAPRAGQ  54


 Score = 38.1 bits (87),  Expect(2) = 4e-09, Method: Composition-based stats.
 Identities = 16/26 (62%), Positives = 19/26 (73%), Gaps = 0/26 (0%)
 Frame = +3

Query  423  AVRDFLPLTVDYQEKQFAQGLIPSTF  500
            A +DF PLTV+YQEK FA G IP  +
Sbjct  52   AGQDFFPLTVNYQEKAFAAGKIPGGY  77



>gb|EEE46221.1| 3' exoribonuclease family, domain 2 [Labrenzia alexandrii DFL-11]
Length=711

 Score = 48.5 bits (114),  Expect(2) = 5e-09, Method: Compositional matrix adjust.
 Identities = 25/47 (53%), Positives = 33/47 (70%), Gaps = 0/47 (0%)
 Frame = +2

Query  293  EFEIGSRKITLETGKIARFANGSVVLAMDETKVLSTVASAKGRRSSR  433
            E + G R + LETGK+AR A+GSV+    ETKVL+TV SAK  R+ +
Sbjct  9    EVDWGGRPLILETGKVARQADGSVMATYGETKVLATVVSAKAPRAGQ  55


 Score = 38.1 bits (87),  Expect(2) = 5e-09, Method: Composition-based stats.
 Identities = 16/26 (62%), Positives = 19/26 (73%), Gaps = 0/26 (0%)
 Frame = +3

Query  423  AVRDFLPLTVDYQEKQFAQGLIPSTF  500
            A +DF PLTV+YQEK FA G IP  +
Sbjct  53   AGQDFFPLTVNYQEKAFAAGKIPGGY  78



>dbj|GAK34768.1| polyribonucleotide nucleotidyltransferase [alpha proteobacterium 
Q-1]
Length=719

 Score = 48.1 bits (113),  Expect(2) = 5e-09, Method: Composition-based stats.
 Identities = 24/55 (44%), Positives = 34/55 (62%), Gaps = 0/55 (0%)
 Frame = +2

Query  269  KILESFTEEFEIGSRKITLETGKIARFANGSVVLAMDETKVLSTVASAKGRRSSR  433
            ++ E + +  E G R +TLETG+IAR A+G+VV    ET VL TV +A+     R
Sbjct  13   RMFEIYRKTIEWGGRSLTLETGRIARQADGAVVATYGETSVLCTVVAARKAEPGR  67


 Score = 38.9 bits (89),  Expect(2) = 5e-09, Method: Composition-based stats.
 Identities = 16/30 (53%), Positives = 21/30 (70%), Gaps = 0/30 (0%)
 Frame = +3

Query  411  QRGDAVRDFLPLTVDYQEKQFAQGLIPSTF  500
            ++ +  RDF PLTV+YQEK +A G IP  F
Sbjct  61   RKAEPGRDFFPLTVNYQEKTYAAGKIPGGF  90



>ref|WP_022005994.1| polyribonucleotide nucleotidyltransferase [Proteobacteria bacterium 
CAG:495]
 emb|CCZ30425.1| polyribonucleotide nucleotidyltransferase [Proteobacteria bacterium 
CAG:495]
Length=706

 Score = 49.7 bits (117),  Expect(2) = 5e-09, Method: Compositional matrix adjust.
 Identities = 25/47 (53%), Positives = 34/47 (72%), Gaps = 0/47 (0%)
 Frame = +2

Query  293  EFEIGSRKITLETGKIARFANGSVVLAMDETKVLSTVASAKGRRSSR  433
            E E G RK+ LETGKIAR A G+VV+   ET+VL+TV +AK  ++ +
Sbjct  10   EMEWGGRKLVLETGKIARQATGAVVVKYGETEVLATVCAAKEAKADQ  56


 Score = 37.0 bits (84),  Expect(2) = 5e-09, Method: Composition-based stats.
 Identities = 15/30 (50%), Positives = 20/30 (67%), Gaps = 0/30 (0%)
 Frame = +3

Query  411  QRGDAVRDFLPLTVDYQEKQFAQGLIPSTF  500
            +   A +DF PLTV+YQEK +A G +P  F
Sbjct  50   KEAKADQDFFPLTVNYQEKYYATGKVPGGF  79



>ref|WP_018913972.1| polynucleotide phosphorylase/polyadenylase [Thiomonas sp. FB-6]
Length=705

 Score = 50.1 bits (118),  Expect(2) = 6e-09, Method: Composition-based stats.
 Identities = 24/51 (47%), Positives = 36/51 (71%), Gaps = 0/51 (0%)
 Frame = +2

Query  272  ILESFTEEFEIGSRKITLETGKIARFANGSVVLAMDETKVLSTVASAKGRR  424
            +    T+ F+ GS  +TLETG+IAR A G+V+L MD+T VL++V +AK  +
Sbjct  1    MFNKVTKSFQWGSHTVTLETGEIARQAGGAVLLNMDDTVVLASVVAAKSAK  51


 Score = 36.6 bits (83),  Expect(2) = 6e-09, Method: Composition-based stats.
 Identities = 15/24 (63%), Positives = 17/24 (71%), Gaps = 0/24 (0%)
 Frame = +3

Query  429  RDFLPLTVDYQEKQFAQGLIPSTF  500
            +DF PLTVDY EK +A G IP  F
Sbjct  54   QDFFPLTVDYIEKTYAAGKIPGGF  77



>ref|WP_031403999.1| polynucleotide phosphorylase/polyadenylase [Thiomonas sp. FB-Cd]
Length=710

 Score = 50.4 bits (119),  Expect(2) = 6e-09, Method: Composition-based stats.
 Identities = 24/48 (50%), Positives = 35/48 (73%), Gaps = 0/48 (0%)
 Frame = +2

Query  272  ILESFTEEFEIGSRKITLETGKIARFANGSVVLAMDETKVLSTVASAK  415
            +    T+ F+ G+  +TLETG+IAR A G+V+L MD+T VL+TV +AK
Sbjct  1    MFNKITKTFQWGAHTVTLETGEIARQAGGAVLLNMDDTVVLATVVAAK  48


 Score = 36.2 bits (82),  Expect(2) = 6e-09, Method: Composition-based stats.
 Identities = 15/24 (63%), Positives = 17/24 (71%), Gaps = 0/24 (0%)
 Frame = +3

Query  429  RDFLPLTVDYQEKQFAQGLIPSTF  500
            +DF PLTVDY EK +A G IP  F
Sbjct  54   QDFFPLTVDYIEKTYAAGKIPGGF  77



>ref|WP_043108091.1| polynucleotide phosphorylase/polyadenylase [endosymbiont of unidentified 
scaly snail isolate Monju]
Length=698

 Score = 43.5 bits (101),  Expect(2) = 6e-09, Method: Composition-based stats.
 Identities = 22/48 (46%), Positives = 31/48 (65%), Gaps = 0/48 (0%)
 Frame = +2

Query  290  EEFEIGSRKITLETGKIARFANGSVVLAMDETKVLSTVASAKGRRSSR  433
            +EF+ G  K+ LETG+IAR A+G+V++ M +T VL TV   K     R
Sbjct  6    KEFQYGDHKVVLETGEIARQADGAVMVNMGDTVVLCTVVYEKNASVER  53


 Score = 43.1 bits (100),  Expect(2) = 6e-09, Method: Composition-based stats.
 Identities = 17/24 (71%), Positives = 19/24 (79%), Gaps = 0/24 (0%)
 Frame = +3

Query  429  RDFLPLTVDYQEKQFAQGLIPSTF  500
            RDF PLTVDYQEK +A G+IP  F
Sbjct  53   RDFFPLTVDYQEKTYAAGIIPGGF  76



>ref|WP_026879138.1| polynucleotide phosphorylase/polyadenylase [Ignatzschineria larvae]
Length=696

 Score = 44.7 bits (104),  Expect(2) = 6e-09, Method: Composition-based stats.
 Identities = 22/53 (42%), Positives = 32/53 (60%), Gaps = 0/53 (0%)
 Frame = +2

Query  275  LESFTEEFEIGSRKITLETGKIARFANGSVVLAMDETKVLSTVASAKGRRSSR  433
            LE   +EF  G RK+T+ET +IAR A  +V++ M+ T V  +V +AK     R
Sbjct  3    LEPIVQEFTYGGRKVTIETAEIARQATAAVMVDMEGTTVFVSVVAAKSADPGR  55


 Score = 42.0 bits (97),  Expect(2) = 6e-09, Method: Composition-based stats.
 Identities = 18/30 (60%), Positives = 20/30 (67%), Gaps = 0/30 (0%)
 Frame = +3

Query  411  QRGDAVRDFLPLTVDYQEKQFAQGLIPSTF  500
            +  D  RDF PLTVDYQEK +A G IP  F
Sbjct  49   KSADPGRDFFPLTVDYQEKTYAAGKIPGGF  78



>ref|WP_014834137.1| polynucleotide phosphorylase/polyadenylase [Pseudomonas aeruginosa]
 gb|AFM67297.1| polynucleotide phosphorylase/polyadenylase [Pseudomonas aeruginosa 
DK2]
Length=701

 Score = 48.9 bits (115),  Expect(2) = 6e-09, Method: Composition-based stats.
 Identities = 23/53 (43%), Positives = 33/53 (62%), Gaps = 0/53 (0%)
 Frame = +2

Query  275  LESFTEEFEIGSRKITLETGKIARFANGSVVLAMDETKVLSTVASAKGRRSSR  433
            +   T++F+ G   +TLETG+IAR A G+V++ MD+  VL TV  AK     R
Sbjct  1    MNPVTKQFQFGQSTVTLETGRIARQATGAVLVTMDDVSVLVTVVGAKSPAEGR  53


 Score = 37.4 bits (85),  Expect(2) = 6e-09, Method: Composition-based stats.
 Identities = 15/24 (63%), Positives = 17/24 (71%), Gaps = 0/24 (0%)
 Frame = +3

Query  429  RDFLPLTVDYQEKQFAQGLIPSTF  500
            RDF PL+V YQEK +A G IP  F
Sbjct  53   RDFFPLSVHYQEKTYAAGRIPGGF  76



>ref|WP_026479200.1| polynucleotide phosphorylase/polyadenylase [Ahrensia sp. 13_GOM-1096m]
Length=708

 Score = 47.4 bits (111),  Expect(2) = 6e-09, Method: Composition-based stats.
 Identities = 25/41 (61%), Positives = 30/41 (73%), Gaps = 0/41 (0%)
 Frame = +2

Query  293  EFEIGSRKITLETGKIARFANGSVVLAMDETKVLSTVASAK  415
            E E G R +TLETGKIAR A+G+V+    ET VL+TV SAK
Sbjct  8    EVEWGGRTLTLETGKIARQADGAVLATYGETVVLATVVSAK  48


 Score = 38.9 bits (89),  Expect(2) = 6e-09, Method: Composition-based stats.
 Identities = 16/24 (67%), Positives = 18/24 (75%), Gaps = 0/24 (0%)
 Frame = +3

Query  429  RDFLPLTVDYQEKQFAQGLIPSTF  500
            +DF PLTV+YQEK FA G IP  F
Sbjct  54   QDFFPLTVNYQEKTFAAGKIPGGF  77



>ref|WP_034039209.1| polynucleotide phosphorylase/polyadenylase [Pseudomonas aeruginosa]
Length=701

 Score = 48.9 bits (115),  Expect(2) = 7e-09, Method: Composition-based stats.
 Identities = 23/53 (43%), Positives = 33/53 (62%), Gaps = 0/53 (0%)
 Frame = +2

Query  275  LESFTEEFEIGSRKITLETGKIARFANGSVVLAMDETKVLSTVASAKGRRSSR  433
            +   T++F+ G   +TLETG+IAR A G+V++ MD+  VL TV  AK     R
Sbjct  1    MNPVTKQFQFGQSTVTLETGRIARQATGAVLVTMDDVSVLVTVVGAKSPAEGR  53


 Score = 37.4 bits (85),  Expect(2) = 7e-09, Method: Composition-based stats.
 Identities = 15/24 (63%), Positives = 17/24 (71%), Gaps = 0/24 (0%)
 Frame = +3

Query  429  RDFLPLTVDYQEKQFAQGLIPSTF  500
            RDF PL+V YQEK +A G IP  F
Sbjct  53   RDFFPLSVHYQEKTYAAGRIPGGF  76



>ref|WP_033947553.1| polynucleotide phosphorylase/polyadenylase [Pseudomonas aeruginosa]
Length=701

 Score = 48.9 bits (115),  Expect(2) = 7e-09, Method: Composition-based stats.
 Identities = 23/53 (43%), Positives = 33/53 (62%), Gaps = 0/53 (0%)
 Frame = +2

Query  275  LESFTEEFEIGSRKITLETGKIARFANGSVVLAMDETKVLSTVASAKGRRSSR  433
            +   T++F+ G   +TLETG+IAR A G+V++ MD+  VL TV  AK     R
Sbjct  1    MNPVTKQFQFGQSTVTLETGRIARQATGAVLVTMDDVSVLVTVVGAKSPAEGR  53


 Score = 37.4 bits (85),  Expect(2) = 7e-09, Method: Composition-based stats.
 Identities = 15/24 (63%), Positives = 17/24 (71%), Gaps = 0/24 (0%)
 Frame = +3

Query  429  RDFLPLTVDYQEKQFAQGLIPSTF  500
            RDF PL+V YQEK +A G IP  F
Sbjct  53   RDFFPLSVHYQEKTYAAGRIPGGF  76



>ref|WP_026317328.1| polynucleotide phosphorylase/polyadenylase [Ahrensia kielensis]
Length=708

 Score = 47.4 bits (111),  Expect(2) = 7e-09, Method: Composition-based stats.
 Identities = 25/41 (61%), Positives = 30/41 (73%), Gaps = 0/41 (0%)
 Frame = +2

Query  293  EFEIGSRKITLETGKIARFANGSVVLAMDETKVLSTVASAK  415
            E E G R +TLETGKIAR A+G+V+    ET VL+TV SAK
Sbjct  8    EVEWGGRTLTLETGKIARQADGAVLATYGETVVLATVVSAK  48


 Score = 38.9 bits (89),  Expect(2) = 7e-09, Method: Composition-based stats.
 Identities = 16/24 (67%), Positives = 18/24 (75%), Gaps = 0/24 (0%)
 Frame = +3

Query  429  RDFLPLTVDYQEKQFAQGLIPSTF  500
            +DF PLTV+YQEK FA G IP  F
Sbjct  54   QDFFPLTVNYQEKTFAAGKIPGGF  77



>ref|WP_033941628.1| polynucleotide phosphorylase/polyadenylase [Pseudomonas aeruginosa]
Length=701

 Score = 48.9 bits (115),  Expect(2) = 7e-09, Method: Composition-based stats.
 Identities = 23/53 (43%), Positives = 33/53 (62%), Gaps = 0/53 (0%)
 Frame = +2

Query  275  LESFTEEFEIGSRKITLETGKIARFANGSVVLAMDETKVLSTVASAKGRRSSR  433
            +   T++F+ G   +TLETG+IAR A G+V++ MD+  VL TV  AK     R
Sbjct  1    MNPVTKQFQFGQSTVTLETGRIARQATGAVLVTMDDVSVLVTVVGAKSPAEGR  53


 Score = 37.4 bits (85),  Expect(2) = 7e-09, Method: Composition-based stats.
 Identities = 15/24 (63%), Positives = 17/24 (71%), Gaps = 0/24 (0%)
 Frame = +3

Query  429  RDFLPLTVDYQEKQFAQGLIPSTF  500
            RDF PL+V YQEK +A G IP  F
Sbjct  53   RDFFPLSVHYQEKTYAAGRIPGGF  76



>ref|WP_042548930.1| polynucleotide phosphorylase/polyadenylase [Ralstonia solanacearum]
Length=726

 Score = 49.7 bits (117),  Expect(2) = 7e-09, Method: Composition-based stats.
 Identities = 23/48 (48%), Positives = 35/48 (73%), Gaps = 0/48 (0%)
 Frame = +2

Query  272  ILESFTEEFEIGSRKITLETGKIARFANGSVVLAMDETKVLSTVASAK  415
            +     +EF+ G+ K+ +ETG+IAR A+G+V+L MD+T VL+TV  AK
Sbjct  1    MFNKIVKEFQWGNHKVRMETGEIARQASGAVLLDMDDTVVLATVVGAK  48


 Score = 36.6 bits (83),  Expect(2) = 7e-09, Method: Composition-based stats.
 Identities = 15/24 (63%), Positives = 17/24 (71%), Gaps = 0/24 (0%)
 Frame = +3

Query  429  RDFLPLTVDYQEKQFAQGLIPSTF  500
            +DF PLTVDY EK +A G IP  F
Sbjct  54   QDFFPLTVDYIEKTYAAGKIPGGF  77



>ref|WP_014616649.1| polynucleotide phosphorylase/polyadenylase [Ralstonia solanacearum]
 gb|AEG68667.1| polyribonucleotide nucleotidyltransferase [Ralstonia solanacearum 
Po82]
 gb|EUJ15321.1| polynucleotide phosphorylase/polyadenylase [Ralstonia solanacearum 
P673]
Length=724

 Score = 49.7 bits (117),  Expect(2) = 7e-09, Method: Composition-based stats.
 Identities = 23/48 (48%), Positives = 35/48 (73%), Gaps = 0/48 (0%)
 Frame = +2

Query  272  ILESFTEEFEIGSRKITLETGKIARFANGSVVLAMDETKVLSTVASAK  415
            +     +EF+ G+ K+ +ETG+IAR A+G+V+L MD+T VL+TV  AK
Sbjct  1    MFNKIVKEFQWGNHKVRMETGEIARQASGAVLLDMDDTVVLATVVGAK  48


 Score = 36.6 bits (83),  Expect(2) = 7e-09, Method: Composition-based stats.
 Identities = 15/24 (63%), Positives = 17/24 (71%), Gaps = 0/24 (0%)
 Frame = +3

Query  429  RDFLPLTVDYQEKQFAQGLIPSTF  500
            +DF PLTVDY EK +A G IP  F
Sbjct  54   QDFFPLTVDYIEKTYAAGKIPGGF  77



>ref|WP_003261921.1| polynucleotide phosphorylase/polyadenylase, partial [Ralstonia 
solanacearum]
 gb|EAP74167.1| Polyribonucleotide nucleotidyltransferase [Ralstonia solanacearum 
UW551]
 gb|KEI32285.1| polynucleotide phosphorylase/polyadenylase [Ralstonia solanacearum]
 gb|KFX29171.1| polynucleotide phosphorylase/polyadenylase [Ralstonia solanacearum]
 gb|KFX79511.1| polynucleotide phosphorylase/polyadenylase [Ralstonia solanacearum]
 gb|KFX84831.1| polynucleotide phosphorylase/polyadenylase [Ralstonia solanacearum]
 gb|KFZ95149.1| polynucleotide phosphorylase/polyadenylase [Ralstonia solanacearum]
Length=720

 Score = 49.7 bits (117),  Expect(2) = 7e-09, Method: Composition-based stats.
 Identities = 23/48 (48%), Positives = 35/48 (73%), Gaps = 0/48 (0%)
 Frame = +2

Query  272  ILESFTEEFEIGSRKITLETGKIARFANGSVVLAMDETKVLSTVASAK  415
            +     +EF+ G+ K+ +ETG+IAR A+G+V+L MD+T VL+TV  AK
Sbjct  1    MFNKIVKEFQWGNHKVRMETGEIARQASGAVLLDMDDTVVLATVVGAK  48


 Score = 36.6 bits (83),  Expect(2) = 7e-09, Method: Composition-based stats.
 Identities = 15/24 (63%), Positives = 17/24 (71%), Gaps = 0/24 (0%)
 Frame = +3

Query  429  RDFLPLTVDYQEKQFAQGLIPSTF  500
            +DF PLTVDY EK +A G IP  F
Sbjct  54   QDFFPLTVDYIEKTYAAGKIPGGF  77



>ref|WP_024916751.1| polynucleotide phosphorylase/polyadenylase [Pseudomonas aeruginosa]
Length=701

 Score = 48.9 bits (115),  Expect(2) = 7e-09, Method: Composition-based stats.
 Identities = 23/53 (43%), Positives = 33/53 (62%), Gaps = 0/53 (0%)
 Frame = +2

Query  275  LESFTEEFEIGSRKITLETGKIARFANGSVVLAMDETKVLSTVASAKGRRSSR  433
            +   T++F+ G   +TLETG+IAR A G+V++ MD+  VL TV  AK     R
Sbjct  1    MNPVTKQFQFGQSTVTLETGRIARQATGAVLVTMDDVSVLVTVVGAKSPAEGR  53


 Score = 37.4 bits (85),  Expect(2) = 7e-09, Method: Composition-based stats.
 Identities = 15/24 (63%), Positives = 17/24 (71%), Gaps = 0/24 (0%)
 Frame = +3

Query  429  RDFLPLTVDYQEKQFAQGLIPSTF  500
            RDF PL+V YQEK +A G IP  F
Sbjct  53   RDFFPLSVHYQEKTYAAGRIPGGF  76



>ref|WP_031640855.1| polynucleotide phosphorylase/polyadenylase [Pseudomonas aeruginosa]
 gb|ETV23171.1| polyribonucleotide nucleotidyltransferase [Pseudomonas aeruginosa 
BWHPSA042]
Length=701

 Score = 48.9 bits (115),  Expect(2) = 7e-09, Method: Composition-based stats.
 Identities = 23/53 (43%), Positives = 33/53 (62%), Gaps = 0/53 (0%)
 Frame = +2

Query  275  LESFTEEFEIGSRKITLETGKIARFANGSVVLAMDETKVLSTVASAKGRRSSR  433
            +   T++F+ G   +TLETG+IAR A G+V++ MD+  VL TV  AK     R
Sbjct  1    MNPVTKQFQFGQSTVTLETGRIARQATGAVLVTMDDVSVLVTVVGAKSPAEGR  53


 Score = 37.4 bits (85),  Expect(2) = 7e-09, Method: Composition-based stats.
 Identities = 15/24 (63%), Positives = 17/24 (71%), Gaps = 0/24 (0%)
 Frame = +3

Query  429  RDFLPLTVDYQEKQFAQGLIPSTF  500
            RDF PL+V YQEK +A G IP  F
Sbjct  53   RDFFPLSVHYQEKTYAAGRIPGGF  76



>ref|WP_003100524.1| polynucleotide phosphorylase/polyadenylase [Pseudomonas aeruginosa]
 gb|EME91692.1| polynucleotide phosphorylase/polyadenylase [Pseudomonas aeruginosa 
PA21_ST175]
 gb|ERF06702.1| polynucleotide phosphorylase/polyadenylase [Pseudomonas aeruginosa 
HB13]
Length=701

 Score = 48.9 bits (115),  Expect(2) = 7e-09, Method: Composition-based stats.
 Identities = 23/53 (43%), Positives = 33/53 (62%), Gaps = 0/53 (0%)
 Frame = +2

Query  275  LESFTEEFEIGSRKITLETGKIARFANGSVVLAMDETKVLSTVASAKGRRSSR  433
            +   T++F+ G   +TLETG+IAR A G+V++ MD+  VL TV  AK     R
Sbjct  1    MNPVTKQFQFGQSTVTLETGRIARQATGAVLVTMDDVSVLVTVVGAKSPAEGR  53


 Score = 37.4 bits (85),  Expect(2) = 7e-09, Method: Composition-based stats.
 Identities = 15/24 (63%), Positives = 17/24 (71%), Gaps = 0/24 (0%)
 Frame = +3

Query  429  RDFLPLTVDYQEKQFAQGLIPSTF  500
            RDF PL+V YQEK +A G IP  F
Sbjct  53   RDFFPLSVHYQEKTYAAGRIPGGF  76



>ref|WP_003095181.1| MULTISPECIES: polynucleotide phosphorylase/polyadenylase [Pseudomonas]
 ref|NP_253428.1| polynucleotide phosphorylase [Pseudomonas aeruginosa PAO1]
 ref|YP_008555011.1| polyribonucleotide nucleotidyltransferase [Pseudomonas aeruginosa 
c7447m]
 ref|YP_008560512.1| polyribonucleotide nucleotidyltransferase [Pseudomonas aeruginosa 
PAO581]
 ref|YP_008696652.1| polyribonucleotide nucleotidyltransferase [Pseudomonas aeruginosa 
PAO1-VE2]
 ref|YP_008708933.1| polyribonucleotide nucleotidyltransferase [Pseudomonas aeruginosa 
PAO1-VE13]
 sp|Q9HV59.1|PNP_PSEAE RecName: Full=Polyribonucleotide nucleotidyltransferase; AltName: 
Full=Polynucleotide phosphorylase; Short=PNPase [Pseudomonas 
aeruginosa PAO1]
 sp|Q02FT2.1|PNP_PSEAB RecName: Full=Polyribonucleotide nucleotidyltransferase; AltName: 
Full=Polynucleotide phosphorylase; Short=PNPase [Pseudomonas 
aeruginosa UCBPP-PA14]
 sp|B7V1F2.1|PNP_PSEA8 RecName: Full=Polyribonucleotide nucleotidyltransferase; AltName: 
Full=Polynucleotide phosphorylase; Short=PNPase [Pseudomonas 
aeruginosa LESB58]
 gb|AAG08126.1|AE004888_1 polyribonucleotide nucleotidyltransferase [Pseudomonas aeruginosa 
PAO1]
 gb|ABJ14123.1| polyribonucleotide nucleotidyltransferase [Pseudomonas aeruginosa 
UCBPP-PA14]
 gb|EAZ55965.1| polyribonucleotide nucleotidyltransferase [Pseudomonas aeruginosa 
C3719]
 gb|EAZ61799.1| polyribonucleotide nucleotidyltransferase [Pseudomonas aeruginosa 
2192]
 emb|CAW29879.1| polyribonucleotide nucleotidyltransferase [Pseudomonas aeruginosa 
LESB58]
 gb|EFQ40756.1| polyribonucleotide nucleotidyltransferase [Pseudomonas aeruginosa 
39016]
 dbj|GAA20803.1| polyribonucleotide nucleotidyltransferase [Pseudomonas aeruginosa 
NCMG1179]
 gb|AEO77328.1| polynucleotide phosphorylase/polyadenylase [Pseudomonas aeruginosa 
M18]
 dbj|BAK87682.1| polynucleotide phosphorylase/polyadenylase [Pseudomonas aeruginosa 
NCGM2.S1]
 gb|EHF14215.1| polyribonucleotide nucleotidyltransferase [Pseudomonas sp. 2_1_26]
 gb|EHS36028.1| polynucleotide phosphorylase/polyadenylase [Pseudomonas aeruginosa 
MPAO1/P1]
 gb|EHS40796.1| polynucleotide phosphorylase/polyadenylase [Pseudomonas aeruginosa 
MPAO1/P2]
 gb|EIE48328.1| polynucleotide phosphorylase/polyadenylase [Pseudomonas aeruginosa 
PADK2_CF510]
 gb|EJY59064.1| polynucleotide phosphorylase/polyadenylase [Pseudomonas aeruginosa 
CIG1]
 gb|EJZ71572.1| polynucleotide phosphorylase/polyadenylase [Pseudomonas aeruginosa 
PAO579]
 gb|EKA30073.1| polynucleotide phosphorylase/polyadenylase [Pseudomonas aeruginosa 
ATCC 14886]
 gb|EKA33488.1| polynucleotide phosphorylase/polyadenylase [Pseudomonas aeruginosa 
ATCC 700888]
 gb|EKA39187.1| polynucleotide phosphorylase/polyadenylase [Pseudomonas aeruginosa 
ATCC 25324]
 gb|EKA40096.1| polynucleotide phosphorylase/polyadenylase [Pseudomonas aeruginosa 
CI27]
 gb|EKA50621.1| polynucleotide phosphorylase/polyadenylase [Pseudomonas aeruginosa 
E2]
 emb|CCQ88992.1| Polyribonucleotide nucleotidyltransferase [Pseudomonas aeruginosa 
18A]
 gb|EMZ50294.1| polyribonucleotide nucleotidyltransferase [Pseudomonas aeruginosa 
str. Stone 130]
 gb|EMZ51865.1| polyribonucleotide nucleotidyltransferase [Pseudomonas sp. P179]
 gb|AGI83902.1| polynucleotide phosphorylase/polyadenylase [Pseudomonas aeruginosa 
B136-33]
 gb|ENH90945.1| polynucleotide phosphorylase/polyadenylase [Pseudomonas aeruginosa 
PA45]
 gb|EOQ81770.1| polynucleotide phosphorylase/polyadenylase [Pseudomonas aeruginosa 
VRFPA02]
 gb|EOT07061.1| polyribonucleotide nucleotidyltransferase [Pseudomonas aeruginosa 
PA14]
 gb|EOT09503.1| polyribonucleotide nucleotidyltransferase [Pseudomonas aeruginosa 
MSH-10]
 gb|EOT09713.1| polyribonucleotide nucleotidyltransferase [Pseudomonas aeruginosa 
PAK]
 gb|AGO42227.1| polynucleotide phosphorylase/polyadenylase [Pseudomonas aeruginosa 
RP73]
 gb|EQL42574.1| polynucleotide phosphorylase/polyadenylase [Pseudomonas aeruginosa 
VRFPA03]
 gb|EQM88982.1| polynucleotide phosphorylase/polyadenylase [Pseudomonas aeruginosa 
WC55]
 gb|AGV64180.1| polyribonucleotide nucleotidyltransferase [Pseudomonas aeruginosa 
c7447m]
 gb|AGV58493.1| polyribonucleotide nucleotidyltransferase [Pseudomonas aeruginosa 
PAO581]
 gb|ERU31442.1| polyribonucleotide nucleotidyltransferase [Pseudomonas aeruginosa 
CF614]
 gb|ERU39062.1| polyribonucleotide nucleotidyltransferase [Pseudomonas aeruginosa 
CF77]
 gb|ERU46375.1| polyribonucleotide nucleotidyltransferase [Pseudomonas aeruginosa 
C52]
 gb|ERU54459.1| polyribonucleotide nucleotidyltransferase [Pseudomonas aeruginosa 
C51]
 gb|ERU55398.1| polyribonucleotide nucleotidyltransferase [Pseudomonas aeruginosa 
C48]
 gb|ERU58609.1| polyribonucleotide nucleotidyltransferase [Pseudomonas aeruginosa 
C41]
 gb|ERU64866.1| polyribonucleotide nucleotidyltransferase [Pseudomonas aeruginosa 
C40]
 gb|ERU72070.1| polyribonucleotide nucleotidyltransferase [Pseudomonas aeruginosa 
C23]
 gb|ERU75265.1| polyribonucleotide nucleotidyltransferase [Pseudomonas aeruginosa 
C20]
 gb|ERU87073.1| polyribonucleotide nucleotidyltransferase [Pseudomonas aeruginosa 
M9A.1]
 gb|ERU91363.1| polyribonucleotide nucleotidyltransferase [Pseudomonas aeruginosa 
M8A.2]
 gb|ERU98631.1| polyribonucleotide nucleotidyltransferase [Pseudomonas aeruginosa 
M8A.1]
 gb|ERV06739.1| polyribonucleotide nucleotidyltransferase [Pseudomonas aeruginosa 
BL18]
 gb|ERV08531.1| polyribonucleotide nucleotidyltransferase [Pseudomonas aeruginosa 
BL19]
 gb|ERV09040.1| polyribonucleotide nucleotidyltransferase [Pseudomonas aeruginosa 
BL17]
 gb|ERV27243.1| polyribonucleotide nucleotidyltransferase [Pseudomonas aeruginosa 
BL14]
 gb|ERV28001.1| polyribonucleotide nucleotidyltransferase [Pseudomonas aeruginosa 
BL16]
 gb|ERV31234.1| polyribonucleotide nucleotidyltransferase [Pseudomonas aeruginosa 
BL15]
 gb|ERV38408.1| polyribonucleotide nucleotidyltransferase [Pseudomonas aeruginosa 
BL10]
 gb|ERV39447.1| polyribonucleotide nucleotidyltransferase [Pseudomonas aeruginosa 
BL11]
 gb|ERV53760.1| polyribonucleotide nucleotidyltransferase [Pseudomonas aeruginosa 
BL08]
 gb|ERV58779.1| polyribonucleotide nucleotidyltransferase [Pseudomonas aeruginosa 
BL09]
 gb|ERV66183.1| polyribonucleotide nucleotidyltransferase [Pseudomonas aeruginosa 
BL04]
 gb|ERV66634.1| polyribonucleotide nucleotidyltransferase [Pseudomonas aeruginosa 
BL07]
 gb|ERV80402.1| polyribonucleotide nucleotidyltransferase [Pseudomonas aeruginosa 
BWHPSA027]
 gb|ERV83758.1| polyribonucleotide nucleotidyltransferase [Pseudomonas aeruginosa 
BWHPSA028]
 gb|ERV91036.1| polyribonucleotide nucleotidyltransferase [Pseudomonas aeruginosa 
BWHPSA026]
 gb|ERV98861.1| polyribonucleotide nucleotidyltransferase [Pseudomonas aeruginosa 
BWHPSA025]
 gb|ERW00150.1| polyribonucleotide nucleotidyltransferase [Pseudomonas aeruginosa 
BWHPSA024]
 gb|ERW11621.1| polyribonucleotide nucleotidyltransferase [Pseudomonas aeruginosa 
BWHPSA022]
 gb|ERW14083.1| polyribonucleotide nucleotidyltransferase [Pseudomonas aeruginosa 
BWHPSA021]
 gb|ERW15012.1| polyribonucleotide nucleotidyltransferase [Pseudomonas aeruginosa 
BWHPSA023]
 gb|ERW32986.1| polyribonucleotide nucleotidyltransferase [Pseudomonas aeruginosa 
BWHPSA019]
 gb|ERW41904.1| polyribonucleotide nucleotidyltransferase [Pseudomonas aeruginosa 
BWHPSA020]
 gb|ERW43098.1| polyribonucleotide nucleotidyltransferase [Pseudomonas aeruginosa 
BWHPSA014]
 gb|ERW48800.1| polyribonucleotide nucleotidyltransferase [Pseudomonas aeruginosa 
BWHPSA017]
 gb|ERW49890.1| polyribonucleotide nucleotidyltransferase [Pseudomonas aeruginosa 
BWHPSA018]
 gb|ERW59523.1| polyribonucleotide nucleotidyltransferase [Pseudomonas aeruginosa 
BWHPSA013]
 gb|ERW60595.1| polyribonucleotide nucleotidyltransferase [Pseudomonas aeruginosa 
BWHPSA012]
 gb|ERW71056.1| polyribonucleotide nucleotidyltransferase [Pseudomonas aeruginosa 
BWHPSA011]
 gb|ERW76626.1| polyribonucleotide nucleotidyltransferase [Pseudomonas aeruginosa 
BWHPSA006]
 gb|ERW79449.1| polyribonucleotide nucleotidyltransferase [Pseudomonas aeruginosa 
BWHPSA005]
 gb|ERW91325.1| polyribonucleotide nucleotidyltransferase [Pseudomonas aeruginosa 
BWHPSA004]
 gb|ERW97457.1| polyribonucleotide nucleotidyltransferase [Pseudomonas aeruginosa 
BWHPSA003]
 gb|ERW98972.1| polyribonucleotide nucleotidyltransferase [Pseudomonas aeruginosa 
BWHPSA002]
 gb|ERX03304.1| polyribonucleotide nucleotidyltransferase [Pseudomonas aeruginosa 
BWHPSA001]
 gb|ERX18382.1| polyribonucleotide nucleotidyltransferase [Pseudomonas aeruginosa 
X13273]
 gb|ERX26827.1| polyribonucleotide nucleotidyltransferase [Pseudomonas aeruginosa 
S35004]
 gb|ERX32285.1| polyribonucleotide nucleotidyltransferase [Pseudomonas aeruginosa 
19660]
 gb|ERX32786.1| polyribonucleotide nucleotidyltransferase [Pseudomonas aeruginosa 
U2504]
 gb|ERX33884.1| polyribonucleotide nucleotidyltransferase [Pseudomonas aeruginosa 
6077]
 gb|ERX43635.1| polyribonucleotide nucleotidyltransferase [Pseudomonas aeruginosa 
UDL]
 gb|ERX48789.1| polyribonucleotide nucleotidyltransferase [Pseudomonas aeruginosa 
CF18]
 gb|ERX54514.1| polyribonucleotide nucleotidyltransferase [Pseudomonas aeruginosa 
X24509]
 gb|ERX62521.1| polyribonucleotide nucleotidyltransferase [Pseudomonas aeruginosa 
MSH3]
 gb|ERX73038.1| polyribonucleotide nucleotidyltransferase [Pseudomonas aeruginosa 
E2]
 gb|ERX75977.1| polyribonucleotide nucleotidyltransferase [Pseudomonas aeruginosa 
62]
 gb|ERX82881.1| polyribonucleotide nucleotidyltransferase [Pseudomonas aeruginosa 
M8A.4]
 gb|ERX91064.1| polyribonucleotide nucleotidyltransferase [Pseudomonas aeruginosa 
BL25]
 gb|ERY01615.1| polyribonucleotide nucleotidyltransferase [Pseudomonas aeruginosa 
BL24]
 gb|ERY09807.1| polyribonucleotide nucleotidyltransferase [Pseudomonas aeruginosa 
BL22]
 gb|ERY10402.1| polyribonucleotide nucleotidyltransferase [Pseudomonas aeruginosa 
BL23]
 gb|ERY14196.1| polyribonucleotide nucleotidyltransferase [Pseudomonas aeruginosa 
BL21]
 gb|ERY23142.1| polyribonucleotide nucleotidyltransferase [Pseudomonas aeruginosa 
BL20]
 gb|ERY23736.1| polyribonucleotide nucleotidyltransferase [Pseudomonas aeruginosa 
BL13]
 gb|ERY38132.1| polyribonucleotide nucleotidyltransferase [Pseudomonas aeruginosa 
BL12]
 gb|ERY42412.1| polyribonucleotide nucleotidyltransferase [Pseudomonas aeruginosa 
BL05]
 gb|ERY50895.1| polyribonucleotide nucleotidyltransferase [Pseudomonas aeruginosa 
BL06]
 gb|ERY60140.1| polyribonucleotide nucleotidyltransferase [Pseudomonas aeruginosa 
BL03]
 gb|ERY60656.1| polyribonucleotide nucleotidyltransferase [Pseudomonas aeruginosa 
BL02]
 gb|ERY62991.1| polyribonucleotide nucleotidyltransferase [Pseudomonas aeruginosa 
BL01]
 gb|ERY71858.1| polyribonucleotide nucleotidyltransferase [Pseudomonas aeruginosa 
BWHPSA016]
 gb|ERY77530.1| polyribonucleotide nucleotidyltransferase [Pseudomonas aeruginosa 
BWHPSA015]
 gb|ERY88184.1| polyribonucleotide nucleotidyltransferase [Pseudomonas aeruginosa 
BWHPSA010]
 gb|ERY92053.1| polyribonucleotide nucleotidyltransferase [Pseudomonas aeruginosa 
BWHPSA009]
 gb|ERY94247.1| polyribonucleotide nucleotidyltransferase [Pseudomonas aeruginosa 
BWHPSA008]
 gb|ERZ05655.1| polyribonucleotide nucleotidyltransferase [Pseudomonas aeruginosa 
JJ692]
 gb|ERZ06349.1| polyribonucleotide nucleotidyltransferase [Pseudomonas aeruginosa 
BWHPSA007]
 gb|ERZ13534.1| polyribonucleotide nucleotidyltransferase [Pseudomonas aeruginosa 
S54485]
 gb|ERZ19498.1| polyribonucleotide nucleotidyltransferase [Pseudomonas aeruginosa 
CF5]
 gb|ERZ23304.1| polyribonucleotide nucleotidyltransferase [Pseudomonas aeruginosa 
CF27]
 gb|ERZ36520.1| polyribonucleotide nucleotidyltransferase [Pseudomonas aeruginosa 
MSH10]
 gb|ERZ37838.1| polyribonucleotide nucleotidyltransferase [Pseudomonas aeruginosa 
CF127]
 gb|ERZ45785.1| polyribonucleotide nucleotidyltransferase [Pseudomonas aeruginosa 
M8A.3]
 gb|AGY66880.1| polyribonucleotide nucleotidyltransferase [Pseudomonas aeruginosa 
PAO1-VE2]
 gb|AGY70428.1| polyribonucleotide nucleotidyltransferase [Pseudomonas aeruginosa 
PAO1-VE13]
 gb|ESQ63079.1| polynucleotide phosphorylase/polyadenylase [Pseudomonas aeruginosa 
HB15]
 gb|ESR68394.1| polynucleotide phosphorylase/polyadenylase [Pseudomonas aeruginosa 
VRFPA05]
 gb|ESR94781.1| polynucleotide phosphorylase/polyadenylase [Pseudomonas aeruginosa 
DHS01]
 gb|AHA18587.1| Polyribonucleotide nucleotidyltransferase [Pseudomonas aeruginosa 
PA1]
 gb|AHA24386.1| Polyribonucleotide nucleotidyltransferase [Pseudomonas aeruginosa 
PA1R]
 emb|CDH79806.1| Polyribonucleotide nucleotidyltransferase [Pseudomonas aeruginosa 
MH27]
 gb|ESZ79825.1| polynucleotide phosphorylase/polyadenylase [Pseudomonas aeruginosa 
DHS29]
 gb|AHB58428.1| polynucleotide phosphorylase/polyadenylase [Pseudomonas aeruginosa 
MTB-1]
 gb|ETD52048.1| polynucleotide phosphorylase/polyadenylase [Pseudomonas aeruginosa 
VRFPA07]
 gb|ETD52525.1| polynucleotide phosphorylase/polyadenylase [Pseudomonas aeruginosa 
VRFPA08]
 gb|ETD73753.1| polynucleotide phosphorylase/polyadenylase [Pseudomonas aeruginosa 
VRFPA06]
 gb|AHC67763.1| polynucleotide phosphorylase/polyadenylase [Pseudomonas aeruginosa 
LES431]
 gb|AHC79500.1| Polyribonucleotide nucleotidyltransferase [Pseudomonas aeruginosa 
SCV20265]
 emb|CDH73492.1| Polyribonucleotide nucleotidyltransferase [Pseudomonas aeruginosa 
MH38]
 gb|ETU72025.1| polyribonucleotide nucleotidyltransferase [Pseudomonas aeruginosa 
PS50]
 gb|ETU74364.1| polyribonucleotide nucleotidyltransferase [Pseudomonas aeruginosa 
Z61]
 gb|ETU83638.1| polyribonucleotide nucleotidyltransferase [Pseudomonas aeruginosa 
BWHPSA048]
 gb|ETU88825.1| polyribonucleotide nucleotidyltransferase [Pseudomonas aeruginosa 
PS42]
 gb|ETU93488.1| polyribonucleotide nucleotidyltransferase [Pseudomonas aeruginosa 
BWHPSA047]
 gb|ETV00051.1| polyribonucleotide nucleotidyltransferase [Pseudomonas aeruginosa 
BWHPSA046]
 gb|ETV07357.1| polyribonucleotide nucleotidyltransferase [Pseudomonas aeruginosa 
BWHPSA045]
 gb|ETV13464.1| polyribonucleotide nucleotidyltransferase [Pseudomonas aeruginosa 
BWHPSA044]
 gb|ETV24829.1| polyribonucleotide nucleotidyltransferase [Pseudomonas aeruginosa 
BWHPSA043]
 gb|ETV33103.1| polyribonucleotide nucleotidyltransferase [Pseudomonas aeruginosa 
BWHPSA041]
 gb|ETV33929.1| polyribonucleotide nucleotidyltransferase [Pseudomonas aeruginosa 
BWHPSA040]
 gb|ETV49055.1| polyribonucleotide nucleotidyltransferase [Pseudomonas aeruginosa 
BWHPSA038]
 gb|ETV52173.1| polyribonucleotide nucleotidyltransferase [Pseudomonas aeruginosa 
BWHPSA039]
 gb|ETV59750.1| polyribonucleotide nucleotidyltransferase [Pseudomonas aeruginosa 
BWHPSA037]
 emb|CDI93299.1| polynucleotide phosphorylase/polyadenylase [Pseudomonas aeruginosa 
PA38182]
 gb|AHH48864.1| polynucleotide phosphorylase/polyadenylase [Pseudomonas aeruginosa 
YL84]
 gb|EVT87895.1| polynucleotide phosphorylase/polyadenylase [Pseudomonas aeruginosa 
VRFPA09]
 gb|EWH24220.1| polynucleotide phosphorylase/polyadenylase [Pseudomonas aeruginosa 
SG17M]
 gb|AHK85993.1| polynucleotide phosphorylase/polyadenylase [Pseudomonas aeruginosa 
LESlike5]
 gb|AHK91873.1| polynucleotide phosphorylase/polyadenylase [Pseudomonas aeruginosa 
LESlike7]
 gb|AHK97868.1| polynucleotide phosphorylase/polyadenylase [Pseudomonas aeruginosa 
LES400]
 gb|AHL03834.1| polynucleotide phosphorylase/polyadenylase [Pseudomonas aeruginosa 
LESB65]
 gb|AHL09757.1| polynucleotide phosphorylase/polyadenylase [Pseudomonas aeruginosa 
LESlike1]
 gb|AHL15713.1| polynucleotide phosphorylase/polyadenylase [Pseudomonas aeruginosa 
LESlike4]
 gb|EYU02836.1| Polyribonucleotide nucleotidyltransferase [Pseudomonas aeruginosa 
PA99]
 gb|EYU08485.1| Polyribonucleotide nucleotidyltransferase [Pseudomonas aeruginosa 
PA103]
 gb|AHW73465.1| polynucleotide phosphorylase/polyadenylase [Pseudomonas aeruginosa 
PA96]
 gb|EZN44347.1| polyribonucleotide nucleotidyltransferase [Pseudomonas aeruginosa 
BWH036]
 gb|EZN49649.1| polyribonucleotide nucleotidyltransferase [Pseudomonas aeruginosa 
BWH033]
 gb|EZN55103.1| polyribonucleotide nucleotidyltransferase [Pseudomonas aeruginosa 
BWH035]
 gb|EZN63251.1| polyribonucleotide nucleotidyltransferase [Pseudomonas aeruginosa 
BWH032]
 gb|EZN68828.1| polyribonucleotide nucleotidyltransferase [Pseudomonas aeruginosa 
BWH031]
 gb|EZN78309.1| polyribonucleotide nucleotidyltransferase [Pseudomonas aeruginosa 
BWH030]
 gb|EZN79756.1| polyribonucleotide nucleotidyltransferase [Pseudomonas aeruginosa 
BWH029]
 gb|EZN87490.1| polyribonucleotide nucleotidyltransferase [Pseudomonas aeruginosa 
3580]
 gb|EZN88999.1| polyribonucleotide nucleotidyltransferase [Pseudomonas aeruginosa 
3581]
 gb|EZO04855.1| polyribonucleotide nucleotidyltransferase [Pseudomonas aeruginosa 
3577]
 gb|EZO05085.1| polyribonucleotide nucleotidyltransferase [Pseudomonas aeruginosa 
3579]
 gb|EZO08528.1| polyribonucleotide nucleotidyltransferase [Pseudomonas aeruginosa 
3578]
 gb|EZO17346.1| polyribonucleotide nucleotidyltransferase [Pseudomonas aeruginosa 
3576]
 gb|EZO27910.1| polyribonucleotide nucleotidyltransferase [Pseudomonas aeruginosa 
3575]
 gb|EZO29600.1| polyribonucleotide nucleotidyltransferase [Pseudomonas aeruginosa 
3574]
 gb|EZO35508.1| polyribonucleotide nucleotidyltransferase [Pseudomonas aeruginosa 
PAO1-GFP]
 gb|EZO43719.1| polyribonucleotide nucleotidyltransferase [Pseudomonas aeruginosa 
BWH060]
 gb|EZO44489.1| polyribonucleotide nucleotidyltransferase [Pseudomonas aeruginosa 
PS75]
 gb|EZO56497.1| polyribonucleotide nucleotidyltransferase [Pseudomonas aeruginosa 
3573]
 gb|EZO60691.1| polyribonucleotide nucleotidyltransferase [Pseudomonas aeruginosa 
BWH058]
 gb|EZO65482.1| polyribonucleotide nucleotidyltransferase [Pseudomonas aeruginosa 
BWH059]
 gb|EZO72397.1| polyribonucleotide nucleotidyltransferase [Pseudomonas aeruginosa 
BWH057]
 gb|EZO79660.1| polyribonucleotide nucleotidyltransferase [Pseudomonas aeruginosa 
BWH056]
 gb|EZO80798.1| polyribonucleotide nucleotidyltransferase [Pseudomonas aeruginosa 
BWH055]
 gb|EZO92640.1| polyribonucleotide nucleotidyltransferase [Pseudomonas aeruginosa 
BWH053]
 gb|EZO97093.1| polyribonucleotide nucleotidyltransferase [Pseudomonas aeruginosa 
BWH054]
 gb|EZO98102.1| polyribonucleotide nucleotidyltransferase [Pseudomonas aeruginosa 
BWH052]
 gb|EZP04257.1| polyribonucleotide nucleotidyltransferase [Pseudomonas aeruginosa 
BWH051]
 gb|EZP18103.1| polyribonucleotide nucleotidyltransferase [Pseudomonas aeruginosa 
BWH050]
 gb|EZP21720.1| polyribonucleotide nucleotidyltransferase [Pseudomonas aeruginosa 
BWH049]
 gb|KAJ11316.1| polynucleotide phosphorylase/polyadenylase [Pseudomonas aeruginosa 
ID4365]
 gb|KAJ14816.1| polynucleotide phosphorylase/polyadenylase [Pseudomonas aeruginosa 
IGB83]
 gb|KAJ25029.1| polynucleotide phosphorylase/polyadenylase [Pseudomonas aeruginosa 
148]
 gb|KAJ89738.1| polynucleotide phosphorylase/polyadenylase [Pseudomonas aeruginosa 
PAK]
 gb|KDR46919.1| polynucleotide phosphorylase/polyadenylase [Pseudomonas aeruginosa]
 gb|KEA11653.1| polynucleotide phosphorylase/polyadenylase [Pseudomonas aeruginosa 
C1913C]
 gb|KEA19979.1| polynucleotide phosphorylase/polyadenylase [Pseudomonas aeruginosa 
C2159M]
 gb|KEA27468.1| polynucleotide phosphorylase/polyadenylase [Pseudomonas aeruginosa 
C2773C]
 gb|KEA29512.1| polynucleotide phosphorylase/polyadenylase [Pseudomonas aeruginosa 
C0324C]
 gb|KEF94357.1| polynucleotide phosphorylase/polyadenylase [Pseudomonas aeruginosa]
 gb|KEI27501.1| polynucleotide phosphorylase/polyadenylase [Pseudomonas aeruginosa]
 gb|AID75943.1| polynucleotide phosphorylase/polyadenylase [Pseudomonas aeruginosa 
PAO1H2O]
 gb|AID82649.1| polynucleotide phosphorylase/polyadenylase [Pseudomonas aeruginosa 
VRFPA04]
 gb|KFB20408.1| polynucleotide phosphorylase/polyadenylase [Pseudomonas aeruginosa 
PGPR2]
 dbj|BAP24535.1| polynucleotide phosphorylase/polyadenylase [Pseudomonas aeruginosa]
 gb|KFL12162.1| polyribonucleotide nucleotidyltransferase [Pseudomonas aeruginosa]
 dbj|BAP53309.1| polynucleotide phosphorylase/polyadenylase [Pseudomonas aeruginosa]
 gb|KGB87523.1| polynucleotide phosphorylase/polyadenylase [Pseudomonas aeruginosa]
 gb|KGD90895.1| polynucleotide phosphorylase/polyadenylase [Pseudomonas sp. YS-1p]
 emb|CDM54303.1| polyribonucleotide nucleotidyltransferase [Pseudomonas aeruginosa 
WS394]
 gb|KHE34141.1| polynucleotide phosphorylase/polyadenylase [Pseudomonas aeruginosa]
 gb|KHE64538.1| polynucleotide phosphorylase/polyadenylase [Pseudomonas aeruginosa]
 gb|KHE64642.1| polynucleotide phosphorylase/polyadenylase [Pseudomonas aeruginosa]
 emb|CEI79666.1| Polyribonucleotide nucleotidyltransferase (EC 2.7 .7.8) (Polynucleotide 
phosphorylase) [Pseudomonas aeruginosa]
 emb|CEI11795.1| Polyribonucleotide nucleotidyltransferase [Pseudomonas aeruginosa]
 gb|AJD60430.1| polynucleotide phosphorylase/polyadenylase [Pseudomonas aeruginosa]
 emb|CDM48177.1| polyribonucleotide nucleotidyltransferase [Pseudomonas aeruginosa 
WS136]
 gb|AJF53324.1| polynucleotide phosphorylase/polyadenylase [Pseudomonas aeruginosa]
 dbj|BAQ42516.1| polynucleotide phosphorylase/polyadenylase [Pseudomonas aeruginosa]
 gb|KJC15754.1| polynucleotide phosphorylase/polyadenylase [Pseudomonas aeruginosa]
 gb|KJC21935.1| polynucleotide phosphorylase/polyadenylase [Pseudomonas aeruginosa]
Length=701

 Score = 48.9 bits (115),  Expect(2) = 7e-09, Method: Composition-based stats.
 Identities = 23/53 (43%), Positives = 33/53 (62%), Gaps = 0/53 (0%)
 Frame = +2

Query  275  LESFTEEFEIGSRKITLETGKIARFANGSVVLAMDETKVLSTVASAKGRRSSR  433
            +   T++F+ G   +TLETG+IAR A G+V++ MD+  VL TV  AK     R
Sbjct  1    MNPVTKQFQFGQSTVTLETGRIARQATGAVLVTMDDVSVLVTVVGAKSPAEGR  53


 Score = 37.4 bits (85),  Expect(2) = 7e-09, Method: Composition-based stats.
 Identities = 15/24 (63%), Positives = 17/24 (71%), Gaps = 0/24 (0%)
 Frame = +3

Query  429  RDFLPLTVDYQEKQFAQGLIPSTF  500
            RDF PL+V YQEK +A G IP  F
Sbjct  53   RDFFPLSVHYQEKTYAAGRIPGGF  76



>ref|WP_028681348.1| MULTISPECIES: polynucleotide phosphorylase/polyadenylase [Pseudomonas]
Length=701

 Score = 48.9 bits (115),  Expect(2) = 7e-09, Method: Composition-based stats.
 Identities = 23/53 (43%), Positives = 33/53 (62%), Gaps = 0/53 (0%)
 Frame = +2

Query  275  LESFTEEFEIGSRKITLETGKIARFANGSVVLAMDETKVLSTVASAKGRRSSR  433
            +   T++F+ G   +TLETG+IAR A G+V++ MD+  VL TV  AK     R
Sbjct  1    MNPVTKQFQFGQSTVTLETGRIARQATGAVLVTMDDVSVLVTVVGAKSPAEGR  53


 Score = 37.4 bits (85),  Expect(2) = 7e-09, Method: Composition-based stats.
 Identities = 15/24 (63%), Positives = 17/24 (71%), Gaps = 0/24 (0%)
 Frame = +3

Query  429  RDFLPLTVDYQEKQFAQGLIPSTF  500
            RDF PL+V YQEK +A G IP  F
Sbjct  53   RDFFPLSVHYQEKTYAAGRIPGGF  76



>gb|ERF84557.1| polyribonucleotide nucleotidyltransferase [Bradyrhizobium sp. 
DFCI-1]
Length=750

 Score = 46.6 bits (109),  Expect(2) = 7e-09, Method: Compositional matrix adjust.
 Identities = 26/57 (46%), Positives = 36/57 (63%), Gaps = 0/57 (0%)
 Frame = +2

Query  257  MAGTKILESFTEEFEIGSRKITLETGKIARFANGSVVLAMDETKVLSTVASAKGRRS  427
            M  T++  S + E + G R + LETGKIAR A+G+V+    ET VL+TV +AK  R 
Sbjct  28   MKETEMFNSHSVEIDWGGRPLKLETGKIARQADGAVMATYGETVVLATVVAAKTPRE  84


 Score = 39.7 bits (91),  Expect(2) = 7e-09, Method: Composition-based stats.
 Identities = 16/23 (70%), Positives = 18/23 (78%), Gaps = 0/23 (0%)
 Frame = +3

Query  432  DFLPLTVDYQEKQFAQGLIPSTF  500
            DFLPLTVDYQEK +A G IP  +
Sbjct  87   DFLPLTVDYQEKTYAAGRIPGGY  109



>ref|WP_003272823.1| polynucleotide phosphorylase/polyadenylase [Ralstonia solanacearum]
 emb|CBJ42618.1| Polyribonucleotide nucleotidyltransferase [Ralstonia solanacearum 
CFBP2957]
 emb|CCF99005.1| Polyribonucleotide nucleotidyltransferase [Ralstonia solanacearum 
K60-1]
Length=720

 Score = 49.7 bits (117),  Expect(2) = 7e-09, Method: Composition-based stats.
 Identities = 23/48 (48%), Positives = 35/48 (73%), Gaps = 0/48 (0%)
 Frame = +2

Query  272  ILESFTEEFEIGSRKITLETGKIARFANGSVVLAMDETKVLSTVASAK  415
            +     +EF+ G+ K+ +ETG+IAR A+G+V+L MD+T VL+TV  AK
Sbjct  1    MFNKIVKEFQWGNHKVRMETGEIARQASGAVLLDMDDTVVLATVVGAK  48


 Score = 36.6 bits (83),  Expect(2) = 7e-09, Method: Composition-based stats.
 Identities = 15/24 (63%), Positives = 17/24 (71%), Gaps = 0/24 (0%)
 Frame = +3

Query  429  RDFLPLTVDYQEKQFAQGLIPSTF  500
            +DF PLTVDY EK +A G IP  F
Sbjct  54   QDFFPLTVDYIEKTYAAGKIPGGF  77



>ref|WP_020748132.1| Polyribonucleotide nucleotidyltransferase [Ralstonia solanacearum]
 emb|CBJ37512.1| Polyribonucleotide nucleotidyltransferase [Ralstonia solanacearum 
CMR15]
Length=717

 Score = 49.7 bits (117),  Expect(2) = 7e-09, Method: Composition-based stats.
 Identities = 23/51 (45%), Positives = 36/51 (71%), Gaps = 0/51 (0%)
 Frame = +2

Query  272  ILESFTEEFEIGSRKITLETGKIARFANGSVVLAMDETKVLSTVASAKGRR  424
            +     +EF+ G+ K+ +ETG+IAR A+G+V+L MD+T VL+TV  AK  +
Sbjct  1    MFNKIVKEFQWGNHKVRMETGEIARQASGAVLLDMDDTVVLATVVGAKNAK  51


 Score = 36.6 bits (83),  Expect(2) = 7e-09, Method: Composition-based stats.
 Identities = 15/24 (63%), Positives = 17/24 (71%), Gaps = 0/24 (0%)
 Frame = +3

Query  429  RDFLPLTVDYQEKQFAQGLIPSTF  500
            +DF PLTVDY EK +A G IP  F
Sbjct  54   QDFFPLTVDYIEKTYAAGKIPGGF  77



>ref|WP_013417766.1| polynucleotide phosphorylase [Rhodomicrobium vannielii]
 gb|ADP69359.1| polyribonucleotide nucleotidyltransferase [Rhodomicrobium vannielii 
ATCC 17100]
Length=709

 Score = 48.1 bits (113),  Expect(2) = 7e-09, Method: Compositional matrix adjust.
 Identities = 25/54 (46%), Positives = 35/54 (65%), Gaps = 0/54 (0%)
 Frame = +2

Query  272  ILESFTEEFEIGSRKITLETGKIARFANGSVVLAMDETKVLSTVASAKGRRSSR  433
            + + F EE E G RK+TLETG+IAR A+G+V+    ET VL+TV   +    S+
Sbjct  1    MFDIFREEVEWGGRKLTLETGRIARQADGAVLAHYGETSVLATVVGERDADPSK  54


 Score = 38.1 bits (87),  Expect(2) = 7e-09, Method: Composition-based stats.
 Identities = 15/28 (54%), Positives = 19/28 (68%), Gaps = 0/28 (0%)
 Frame = +3

Query  417  GDAVRDFLPLTVDYQEKQFAQGLIPSTF  500
             D  +DF PLTV+YQEK +A G IP  +
Sbjct  50   ADPSKDFFPLTVNYQEKAYAAGKIPGGY  77



>ref|WP_044428459.1| polynucleotide phosphorylase/polyadenylase [Skermanella aerolata]
Length=704

 Score = 47.0 bits (110),  Expect(2) = 7e-09, Method: Composition-based stats.
 Identities = 23/47 (49%), Positives = 31/47 (66%), Gaps = 0/47 (0%)
 Frame = +2

Query  284  FTEEFEIGSRKITLETGKIARFANGSVVLAMDETKVLSTVASAKGRR  424
            F +E + G RK+ LETGK+AR A+G+V+    ET VL TV  AK  +
Sbjct  5    FRKEIDWGGRKLVLETGKVARQADGAVMATYGETTVLCTVVGAKAAK  51


 Score = 39.3 bits (90),  Expect(2) = 7e-09, Method: Composition-based stats.
 Identities = 16/24 (67%), Positives = 18/24 (75%), Gaps = 0/24 (0%)
 Frame = +3

Query  429  RDFLPLTVDYQEKQFAQGLIPSTF  500
            +DF PLTV+YQEK FA G IP  F
Sbjct  54   QDFFPLTVNYQEKAFAAGKIPGGF  77



>ref|WP_034082159.1| polynucleotide phosphorylase/polyadenylase [Pseudomonas aeruginosa]
Length=701

 Score = 48.9 bits (115),  Expect(2) = 7e-09, Method: Composition-based stats.
 Identities = 23/53 (43%), Positives = 33/53 (62%), Gaps = 0/53 (0%)
 Frame = +2

Query  275  LESFTEEFEIGSRKITLETGKIARFANGSVVLAMDETKVLSTVASAKGRRSSR  433
            +   T++F+ G   +TLETG+IAR A G+V++ MD+  VL TV  AK     R
Sbjct  1    MNPVTKQFQFGQSTVTLETGRIARQATGAVLVTMDDVSVLVTVVGAKSPAEGR  53


 Score = 37.4 bits (85),  Expect(2) = 7e-09, Method: Composition-based stats.
 Identities = 15/24 (63%), Positives = 17/24 (71%), Gaps = 0/24 (0%)
 Frame = +3

Query  429  RDFLPLTVDYQEKQFAQGLIPSTF  500
            RDF PL+V YQEK +A G IP  F
Sbjct  53   RDFFPLSVHYQEKTYAAGRIPGGF  76



>ref|WP_003148740.1| polynucleotide phosphorylase/polyadenylase [Pseudomonas aeruginosa]
 sp|A6VCJ6.1|PNP_PSEA7 RecName: Full=Polyribonucleotide nucleotidyltransferase; AltName: 
Full=Polynucleotide phosphorylase; Short=PNPase [Pseudomonas 
aeruginosa PA7]
 gb|ABR85627.1| polyribonucleotide nucleotidyltransferase [Pseudomonas aeruginosa 
PA7]
 gb|KFF33142.1| polynucleotide phosphorylase/polyadenylase [Pseudomonas aeruginosa 
VRFPA01]
Length=701

 Score = 48.9 bits (115),  Expect(2) = 7e-09, Method: Composition-based stats.
 Identities = 23/53 (43%), Positives = 33/53 (62%), Gaps = 0/53 (0%)
 Frame = +2

Query  275  LESFTEEFEIGSRKITLETGKIARFANGSVVLAMDETKVLSTVASAKGRRSSR  433
            +   T++F+ G   +TLETG+IAR A G+V++ MD+  VL TV  AK     R
Sbjct  1    MNPVTKQFQFGQSTVTLETGRIARQATGAVLVTMDDVSVLVTVVGAKSPAEGR  53


 Score = 37.4 bits (85),  Expect(2) = 7e-09, Method: Composition-based stats.
 Identities = 15/24 (63%), Positives = 17/24 (71%), Gaps = 0/24 (0%)
 Frame = +3

Query  429  RDFLPLTVDYQEKQFAQGLIPSTF  500
            RDF PL+V YQEK +A G IP  F
Sbjct  53   RDFFPLSVHYQEKTYAAGRIPGGF  76



>ref|WP_036108530.1| polynucleotide phosphorylase/polyadenylase [Lysobacter capsici]
 gb|EYR67794.1| polynucleotide phosphorylase/polyadenylase [Lysobacter capsici 
AZ78]
Length=702

 Score = 48.1 bits (113),  Expect(2) = 7e-09, Method: Composition-based stats.
 Identities = 22/53 (42%), Positives = 35/53 (66%), Gaps = 0/53 (0%)
 Frame = +2

Query  275  LESFTEEFEIGSRKITLETGKIARFANGSVVLAMDETKVLSTVASAKGRRSSR  433
            +   T+ F+ G+ ++TLETG+IAR A GSV++ MD+T +L    +AK  R  +
Sbjct  1    MAKITKTFQYGNHQVTLETGEIARQAGGSVIVKMDDTVLLVAAVAAKSAREGQ  53


 Score = 38.1 bits (87),  Expect(2) = 7e-09, Method: Composition-based stats.
 Identities = 16/24 (67%), Positives = 18/24 (75%), Gaps = 0/24 (0%)
 Frame = +3

Query  429  RDFLPLTVDYQEKQFAQGLIPSTF  500
            +DF PLTVDYQEK +A G IP  F
Sbjct  53   QDFFPLTVDYQEKFYAGGRIPGGF  76



>emb|CCA84441.1| polyribonucleotide nucleotidyltransferase [Ralstonia syzygii 
R24]
Length=722

 Score = 49.7 bits (117),  Expect(2) = 7e-09, Method: Composition-based stats.
 Identities = 23/51 (45%), Positives = 36/51 (71%), Gaps = 0/51 (0%)
 Frame = +2

Query  272  ILESFTEEFEIGSRKITLETGKIARFANGSVVLAMDETKVLSTVASAKGRR  424
            +     +EF+ G+ K+ +ETG+IAR A+G+V+L MD+T VL+TV  AK  +
Sbjct  1    MFNKIVKEFQWGNHKVRMETGEIARQASGAVLLDMDDTVVLATVVGAKNAK  51


 Score = 36.6 bits (83),  Expect(2) = 7e-09, Method: Composition-based stats.
 Identities = 15/24 (63%), Positives = 17/24 (71%), Gaps = 0/24 (0%)
 Frame = +3

Query  429  RDFLPLTVDYQEKQFAQGLIPSTF  500
            +DF PLTVDY EK +A G IP  F
Sbjct  54   QDFFPLTVDYIEKTYAAGKIPGGF  77



>ref|WP_037233498.1| polynucleotide phosphorylase/polyadenylase [Rhodomicrobium udaipurense]
 gb|KAI95996.1| polynucleotide phosphorylase/polyadenylase [Rhodomicrobium udaipurense 
JA643]
Length=709

 Score = 48.1 bits (113),  Expect(2) = 7e-09, Method: Compositional matrix adjust.
 Identities = 25/54 (46%), Positives = 35/54 (65%), Gaps = 0/54 (0%)
 Frame = +2

Query  272  ILESFTEEFEIGSRKITLETGKIARFANGSVVLAMDETKVLSTVASAKGRRSSR  433
            + + F EE E G RK+TLETG+IAR A+G+V+    ET VL+TV   +    S+
Sbjct  1    MFDIFREEVEWGGRKLTLETGRIARQADGAVLAHYGETSVLATVVGERDADPSK  54


 Score = 38.1 bits (87),  Expect(2) = 7e-09, Method: Composition-based stats.
 Identities = 15/28 (54%), Positives = 19/28 (68%), Gaps = 0/28 (0%)
 Frame = +3

Query  417  GDAVRDFLPLTVDYQEKQFAQGLIPSTF  500
             D  +DF PLTV+YQEK +A G IP  +
Sbjct  50   ADPSKDFFPLTVNYQEKAYAAGKIPGGY  77



>ref|WP_013212052.1| polynucleotide phosphorylase/polyadenylase [Ralstonia solanacearum]
 ref|YP_003752015.1| Polyribonucleotide nucleotidyltransferase [Ralstonia solanacearum 
PSI07]
 emb|CBJ50723.1| Polyribonucleotide nucleotidyltransferase [Ralstonia solanacearum 
PSI07]
 emb|CCA81989.1| polyribonucleotide nucleotidyltransferase [blood disease bacterium 
R229]
Length=722

 Score = 49.7 bits (117),  Expect(2) = 8e-09, Method: Composition-based stats.
 Identities = 23/51 (45%), Positives = 36/51 (71%), Gaps = 0/51 (0%)
 Frame = +2

Query  272  ILESFTEEFEIGSRKITLETGKIARFANGSVVLAMDETKVLSTVASAKGRR  424
            +     +EF+ G+ K+ +ETG+IAR A+G+V+L MD+T VL+TV  AK  +
Sbjct  1    MFNKIVKEFQWGNHKVRMETGEIARQASGAVLLDMDDTVVLATVVGAKNAK  51


 Score = 36.6 bits (83),  Expect(2) = 8e-09, Method: Composition-based stats.
 Identities = 15/24 (63%), Positives = 17/24 (71%), Gaps = 0/24 (0%)
 Frame = +3

Query  429  RDFLPLTVDYQEKQFAQGLIPSTF  500
            +DF PLTVDY EK +A G IP  F
Sbjct  54   QDFFPLTVDYIEKTYAAGKIPGGF  77



>ref|WP_006935431.1| polynucleotide phosphorylase [Labrenzia aggregata]
 gb|EAV43606.1| polynucleotide phosphorylase/polyadenylase [Stappia aggregata 
IAM 12614]
Length=709

 Score = 48.1 bits (113),  Expect(2) = 8e-09, Method: Composition-based stats.
 Identities = 24/41 (59%), Positives = 31/41 (76%), Gaps = 0/41 (0%)
 Frame = +2

Query  293  EFEIGSRKITLETGKIARFANGSVVLAMDETKVLSTVASAK  415
            E E G R + LETGK+AR A+G+V+ +  ETKVL+TV SAK
Sbjct  8    EVEWGGRPLVLETGKVARQADGAVMASYGETKVLATVVSAK  48


 Score = 37.7 bits (86),  Expect(2) = 8e-09, Method: Composition-based stats.
 Identities = 15/24 (63%), Positives = 18/24 (75%), Gaps = 0/24 (0%)
 Frame = +3

Query  429  RDFLPLTVDYQEKQFAQGLIPSTF  500
            +DF PLTV+YQEK FA G IP  +
Sbjct  54   QDFFPLTVNYQEKAFAAGKIPGGY  77



>ref|WP_028486478.1| polynucleotide phosphorylase/polyadenylase [Thiomicrospira chilensis]
Length=696

 Score = 48.5 bits (114),  Expect(2) = 8e-09, Method: Composition-based stats.
 Identities = 21/53 (40%), Positives = 37/53 (70%), Gaps = 0/53 (0%)
 Frame = +2

Query  275  LESFTEEFEIGSRKITLETGKIARFANGSVVLAMDETKVLSTVASAKGRRSSR  433
            +   ++ F+ G  ++TLETG+IAR A+G+V++ M +T+VL TV +AK  +  +
Sbjct  1    MAKISKSFQYGQHQVTLETGEIARQADGAVMIGMGDTRVLVTVVAAKSAKEGQ  53


 Score = 37.7 bits (86),  Expect(2) = 8e-09, Method: Composition-based stats.
 Identities = 15/24 (63%), Positives = 18/24 (75%), Gaps = 0/24 (0%)
 Frame = +3

Query  429  RDFLPLTVDYQEKQFAQGLIPSTF  500
            +DF PLTV+YQEK +A G IP  F
Sbjct  53   QDFFPLTVNYQEKAYAAGRIPGGF  76



>gb|ABE60937.1| Polyribonucleotide nucleotidyltransferase [Nitrobacter hamburgensis 
X14]
Length=748

 Score = 46.6 bits (109),  Expect(2) = 8e-09, Method: Composition-based stats.
 Identities = 25/52 (48%), Positives = 33/52 (63%), Gaps = 0/52 (0%)
 Frame = +2

Query  269  KILESFTEEFEIGSRKITLETGKIARFANGSVVLAMDETKVLSTVASAKGRR  424
            K+    + E + G R + LETGKIAR A+G+VV    ET VL+TV +AK  R
Sbjct  28   KMFNKHSVEIDWGGRPLKLETGKIARQADGAVVATYGETVVLATVVAAKTPR  79


 Score = 39.7 bits (91),  Expect(2) = 8e-09, Method: Composition-based stats.
 Identities = 16/23 (70%), Positives = 18/23 (78%), Gaps = 0/23 (0%)
 Frame = +3

Query  432  DFLPLTVDYQEKQFAQGLIPSTF  500
            DFLPLTVDYQEK +A G IP  +
Sbjct  83   DFLPLTVDYQEKTYAAGRIPGGY  105



>ref|WP_024975286.1| polynucleotide phosphorylase/polyadenylase [Ralstonia pickettii]
Length=722

 Score = 49.3 bits (116),  Expect(2) = 8e-09, Method: Composition-based stats.
 Identities = 23/48 (48%), Positives = 34/48 (71%), Gaps = 0/48 (0%)
 Frame = +2

Query  272  ILESFTEEFEIGSRKITLETGKIARFANGSVVLAMDETKVLSTVASAK  415
            +     +EF+ G  K+ +ETG+IAR A+G+V+L MD+T VL+TV  AK
Sbjct  1    MFNKIVKEFQWGGHKVRMETGEIARQASGAVLLDMDDTVVLATVVGAK  48


 Score = 36.6 bits (83),  Expect(2) = 8e-09, Method: Composition-based stats.
 Identities = 15/24 (63%), Positives = 17/24 (71%), Gaps = 0/24 (0%)
 Frame = +3

Query  429  RDFLPLTVDYQEKQFAQGLIPSTF  500
            +DF PLTVDY EK +A G IP  F
Sbjct  54   QDFFPLTVDYLEKTYAAGKIPGGF  77



>ref|WP_016727045.1| polynucleotide phosphorylase/polyadenylase [Ralstonia solanacearum]
Length=717

 Score = 49.7 bits (117),  Expect(2) = 8e-09, Method: Composition-based stats.
 Identities = 23/51 (45%), Positives = 36/51 (71%), Gaps = 0/51 (0%)
 Frame = +2

Query  272  ILESFTEEFEIGSRKITLETGKIARFANGSVVLAMDETKVLSTVASAKGRR  424
            +     +EF+ G+ K+ +ETG+IAR A+G+V+L MD+T VL+TV  AK  +
Sbjct  1    MFNKIVKEFQWGNHKVRMETGEIARQASGAVLLDMDDTVVLATVVGAKNAK  51


 Score = 36.6 bits (83),  Expect(2) = 8e-09, Method: Composition-based stats.
 Identities = 15/24 (63%), Positives = 17/24 (71%), Gaps = 0/24 (0%)
 Frame = +3

Query  429  RDFLPLTVDYQEKQFAQGLIPSTF  500
            +DF PLTVDY EK +A G IP  F
Sbjct  54   QDFFPLTVDYIEKTYAAGKIPGGF  77



>ref|WP_016722935.1| polynucleotide phosphorylase/polyadenylase [Ralstonia solanacearum]
 gb|AGH84535.1| Polyribonucleotide nucleotidyltransferase [Ralstonia solanacearum 
FQY_4]
 gb|ESS49358.1| polynucleotide phosphorylase/polyadenylase [Ralstonia solanacearum 
SD54]
Length=717

 Score = 49.7 bits (117),  Expect(2) = 8e-09, Method: Composition-based stats.
 Identities = 23/51 (45%), Positives = 36/51 (71%), Gaps = 0/51 (0%)
 Frame = +2

Query  272  ILESFTEEFEIGSRKITLETGKIARFANGSVVLAMDETKVLSTVASAKGRR  424
            +     +EF+ G+ K+ +ETG+IAR A+G+V+L MD+T VL+TV  AK  +
Sbjct  1    MFNKIVKEFQWGNHKVRMETGEIARQASGAVLLDMDDTVVLATVVGAKNAK  51


 Score = 36.6 bits (83),  Expect(2) = 8e-09, Method: Composition-based stats.
 Identities = 15/24 (63%), Positives = 17/24 (71%), Gaps = 0/24 (0%)
 Frame = +3

Query  429  RDFLPLTVDYQEKQFAQGLIPSTF  500
            +DF PLTVDY EK +A G IP  F
Sbjct  54   QDFFPLTVDYIEKTYAAGKIPGGF  77



>ref|WP_011001999.1| polynucleotide phosphorylase/polyadenylase [Ralstonia solanacearum]
 sp|Q8XXP6.1|PNP_RALSO RecName: Full=Polyribonucleotide nucleotidyltransferase; AltName: 
Full=Polynucleotide phosphorylase; Short=PNPase [Ralstonia 
solanacearum GMI1000]
 emb|CAD15774.1| probable polyribonucleotide nucleotidyltransferase protein [Ralstonia 
solanacearum GMI1000]
Length=717

 Score = 49.7 bits (117),  Expect(2) = 8e-09, Method: Composition-based stats.
 Identities = 23/51 (45%), Positives = 36/51 (71%), Gaps = 0/51 (0%)
 Frame = +2

Query  272  ILESFTEEFEIGSRKITLETGKIARFANGSVVLAMDETKVLSTVASAKGRR  424
            +     +EF+ G+ K+ +ETG+IAR A+G+V+L MD+T VL+TV  AK  +
Sbjct  1    MFNKIVKEFQWGNHKVRMETGEIARQASGAVLLDMDDTVVLATVVGAKNAK  51


 Score = 36.6 bits (83),  Expect(2) = 8e-09, Method: Composition-based stats.
 Identities = 15/24 (63%), Positives = 17/24 (71%), Gaps = 0/24 (0%)
 Frame = +3

Query  429  RDFLPLTVDYQEKQFAQGLIPSTF  500
            +DF PLTVDY EK +A G IP  F
Sbjct  54   QDFFPLTVDYIEKTYAAGKIPGGF  77



>ref|WP_026606468.1| polynucleotide phosphorylase/polyadenylase [Methylocapsa acidiphila]
Length=714

 Score = 48.1 bits (113),  Expect(2) = 8e-09, Method: Compositional matrix adjust.
 Identities = 26/48 (54%), Positives = 32/48 (67%), Gaps = 0/48 (0%)
 Frame = +2

Query  272  ILESFTEEFEIGSRKITLETGKIARFANGSVVLAMDETKVLSTVASAK  415
            + E   EE +   RK+ LETGKIAR A+G+VV    ET VL+TV SAK
Sbjct  1    MFEIHREEIDWAGRKLVLETGKIARQADGAVVATYGETTVLATVVSAK  48


 Score = 37.7 bits (86),  Expect(2) = 8e-09, Method: Composition-based stats.
 Identities = 15/24 (63%), Positives = 18/24 (75%), Gaps = 0/24 (0%)
 Frame = +3

Query  429  RDFLPLTVDYQEKQFAQGLIPSTF  500
            +DF PLTV+YQEK FA G IP  +
Sbjct  54   QDFFPLTVNYQEKAFAAGRIPGGY  77



>sp|A5CWW8.1|PNP_VESOH RecName: Full=Polyribonucleotide nucleotidyltransferase; AltName: 
Full=Polynucleotide phosphorylase; Short=PNPase [Candidatus 
Vesicomyosocius okutanii HA]
 dbj|BAF61545.1| polyribonucleotide nucleotidyltransferase [Candidatus Vesicomyosocius 
okutanii HA]
Length=695

 Score = 50.8 bits (120),  Expect(2) = 8e-09, Method: Composition-based stats.
 Identities = 24/46 (52%), Positives = 35/46 (76%), Gaps = 0/46 (0%)
 Frame = +2

Query  287  TEEFEIGSRKITLETGKIARFANGSVVLAMDETKVLSTVASAKGRR  424
            T+ F +G   +TLETG+IAR A+G+V+ +MD+T+VL TV S+K  R
Sbjct  5    TKSFTMGKHIVTLETGRIARQAHGAVLASMDDTQVLVTVVSSKETR  50


 Score = 35.4 bits (80),  Expect(2) = 8e-09, Method: Composition-based stats.
 Identities = 13/24 (54%), Positives = 18/24 (75%), Gaps = 0/24 (0%)
 Frame = +3

Query  429  RDFLPLTVDYQEKQFAQGLIPSTF  500
            +DF PL+VDY EK ++ G IP +F
Sbjct  53   QDFFPLSVDYIEKTYSTGKIPGSF  76



>ref|WP_041191915.1| polynucleotide phosphorylase/polyadenylase [Calyptogena okutanii 
thioautotrophic gill symbiont]
Length=697

 Score = 50.8 bits (120),  Expect(2) = 8e-09, Method: Composition-based stats.
 Identities = 24/46 (52%), Positives = 35/46 (76%), Gaps = 0/46 (0%)
 Frame = +2

Query  287  TEEFEIGSRKITLETGKIARFANGSVVLAMDETKVLSTVASAKGRR  424
            T+ F +G   +TLETG+IAR A+G+V+ +MD+T+VL TV S+K  R
Sbjct  7    TKSFTMGKHIVTLETGRIARQAHGAVLASMDDTQVLVTVVSSKETR  52


 Score = 35.4 bits (80),  Expect(2) = 8e-09, Method: Composition-based stats.
 Identities = 13/24 (54%), Positives = 18/24 (75%), Gaps = 0/24 (0%)
 Frame = +3

Query  429  RDFLPLTVDYQEKQFAQGLIPSTF  500
            +DF PL+VDY EK ++ G IP +F
Sbjct  55   QDFFPLSVDYIEKTYSTGKIPGSF  78



>ref|WP_011391532.1| polynucleotide phosphorylase [Rhodospirillum rubrum]
 ref|YP_428866.1| polynucleotide phosphorylase/polyadenylase [Rhodospirillum rubrum 
ATCC 11170]
 sp|Q2RMR6.1|PNP_RHORT RecName: Full=Polyribonucleotide nucleotidyltransferase; AltName: 
Full=Polynucleotide phosphorylase; Short=PNPase [Rhodospirillum 
rubrum ATCC 11170]
 gb|ABC24579.1| 3' exoribonuclease [Rhodospirillum rubrum ATCC 11170]
 gb|AEO50332.1| polynucleotide phosphorylase/polyadenylase [Rhodospirillum rubrum 
F11]
Length=708

 Score = 47.0 bits (110),  Expect(2) = 8e-09, Method: Composition-based stats.
 Identities = 23/55 (42%), Positives = 34/55 (62%), Gaps = 0/55 (0%)
 Frame = +2

Query  272  ILESFTEEFEIGSRKITLETGKIARFANGSVVLAMDETKVLSTVASAKGRRSSRF  436
            +   F +E E G RK+ LETG+IAR A+G+V+ ++ +T VL T   AK +    F
Sbjct  3    LFNVFRKEIEWGGRKLVLETGRIARQADGAVMASLGDTTVLCTAVGAKTKSKFDF  57


 Score = 38.9 bits (89),  Expect(2) = 8e-09, Method: Composition-based stats.
 Identities = 16/23 (70%), Positives = 17/23 (74%), Gaps = 0/23 (0%)
 Frame = +3

Query  432  DFLPLTVDYQEKQFAQGLIPSTF  500
            DF PLTV+YQEK FA G IP  F
Sbjct  56   DFFPLTVNYQEKTFAAGKIPGGF  78



>ref|WP_039597857.1| polynucleotide phosphorylase/polyadenylase [Ralstonia sp. A12]
 gb|KHK56360.1| polynucleotide phosphorylase/polyadenylase [Ralstonia sp. A12]
Length=724

 Score = 49.3 bits (116),  Expect(2) = 8e-09, Method: Composition-based stats.
 Identities = 23/48 (48%), Positives = 34/48 (71%), Gaps = 0/48 (0%)
 Frame = +2

Query  272  ILESFTEEFEIGSRKITLETGKIARFANGSVVLAMDETKVLSTVASAK  415
            +     +EF+ G  K+ +ETG+IAR A+G+V+L MD+T VL+TV  AK
Sbjct  3    MFNKIVKEFQWGGHKVRMETGEIARQASGAVLLDMDDTVVLATVVGAK  50


 Score = 36.6 bits (83),  Expect(2) = 8e-09, Method: Composition-based stats.
 Identities = 15/24 (63%), Positives = 17/24 (71%), Gaps = 0/24 (0%)
 Frame = +3

Query  429  RDFLPLTVDYQEKQFAQGLIPSTF  500
            +DF PLTVDY EK +A G IP  F
Sbjct  56   QDFFPLTVDYLEKTYAAGKIPGGF  79



>ref|WP_013835409.1| polynucleotide phosphorylase/polyadenylase [Thioalkalimicrobium 
cyclicum]
 gb|AEG31631.1| Polyribonucleotide nucleotidyltransferase [Thioalkalimicrobium 
cyclicum ALM1]
Length=694

 Score = 47.0 bits (110),  Expect(2) = 9e-09, Method: Composition-based stats.
 Identities = 21/40 (53%), Positives = 31/40 (78%), Gaps = 0/40 (0%)
 Frame = +2

Query  296  FEIGSRKITLETGKIARFANGSVVLAMDETKVLSTVASAK  415
            F+ G  ++TLETG+IAR A+G+V++ M +T+VL TV  AK
Sbjct  8    FQYGQHQVTLETGEIARQADGAVIVGMGDTRVLVTVVGAK  47


 Score = 39.3 bits (90),  Expect(2) = 9e-09, Method: Composition-based stats.
 Identities = 16/24 (67%), Positives = 18/24 (75%), Gaps = 0/24 (0%)
 Frame = +3

Query  429  RDFLPLTVDYQEKQFAQGLIPSTF  500
            +DF PLTV+YQEK FA G IP  F
Sbjct  53   QDFFPLTVNYQEKAFAAGKIPGGF  76



>ref|WP_012915543.1| polynucleotide phosphorylase/polyadenylase [Xanthomonas albilineans]
 ref|YP_003375523.1| polynucleotide phosphorylase [Xanthomonas albilineans GPE PC73]
 emb|CBA15535.1| probable polynucleotide phosphorylase protein [Xanthomonas albilineans 
GPE PC73]
Length=702

 Score = 47.4 bits (111),  Expect(2) = 9e-09, Method: Composition-based stats.
 Identities = 22/53 (42%), Positives = 34/53 (64%), Gaps = 0/53 (0%)
 Frame = +2

Query  275  LESFTEEFEIGSRKITLETGKIARFANGSVVLAMDETKVLSTVASAKGRRSSR  433
            +   T+ F+ G   +TLETG+IAR A G+V++ MD+T +L T  +AK  R  +
Sbjct  1    MAKITKTFQYGKHTVTLETGEIARQAGGAVIVKMDDTVLLVTAVAAKSAREGQ  53


 Score = 38.5 bits (88),  Expect(2) = 9e-09, Method: Composition-based stats.
 Identities = 16/24 (67%), Positives = 18/24 (75%), Gaps = 0/24 (0%)
 Frame = +3

Query  429  RDFLPLTVDYQEKQFAQGLIPSTF  500
            +DF PLTVDYQEK +A G IP  F
Sbjct  53   QDFFPLTVDYQEKFYAGGRIPGGF  76



>ref|WP_039006781.1| polynucleotide phosphorylase/polyadenylase [Xanthomonas translucens]
Length=702

 Score = 47.4 bits (111),  Expect(2) = 9e-09, Method: Composition-based stats.
 Identities = 22/53 (42%), Positives = 34/53 (64%), Gaps = 0/53 (0%)
 Frame = +2

Query  275  LESFTEEFEIGSRKITLETGKIARFANGSVVLAMDETKVLSTVASAKGRRSSR  433
            +   T+ F+ G   +TLETG+IAR A G+V++ MD+T +L T  +AK  R  +
Sbjct  1    MAKITKTFQYGKHTVTLETGEIARQAGGAVIVKMDDTVLLVTAVAAKSAREGQ  53


 Score = 38.5 bits (88),  Expect(2) = 9e-09, Method: Composition-based stats.
 Identities = 16/24 (67%), Positives = 18/24 (75%), Gaps = 0/24 (0%)
 Frame = +3

Query  429  RDFLPLTVDYQEKQFAQGLIPSTF  500
            +DF PLTVDYQEK +A G IP  F
Sbjct  53   QDFFPLTVDYQEKFYAGGRIPGGF  76



>ref|WP_009590756.1| polyribonucleotide nucleotidyltransferase [Xanthomonas translucens]
 gb|EKU25578.1| polyribonucleotide nucleotidyltransferase [Xanthomonas translucens 
pv. graminis ART-Xtg29]
Length=702

 Score = 47.4 bits (111),  Expect(2) = 9e-09, Method: Composition-based stats.
 Identities = 22/53 (42%), Positives = 34/53 (64%), Gaps = 0/53 (0%)
 Frame = +2

Query  275  LESFTEEFEIGSRKITLETGKIARFANGSVVLAMDETKVLSTVASAKGRRSSR  433
            +   T+ F+ G   +TLETG+IAR A G+V++ MD+T +L T  +AK  R  +
Sbjct  1    MAKITKTFQYGKHTVTLETGEIARQAGGAVIVKMDDTVLLVTAVAAKSAREGQ  53


 Score = 38.5 bits (88),  Expect(2) = 9e-09, Method: Composition-based stats.
 Identities = 16/24 (67%), Positives = 18/24 (75%), Gaps = 0/24 (0%)
 Frame = +3

Query  429  RDFLPLTVDYQEKQFAQGLIPSTF  500
            +DF PLTVDYQEK +A G IP  F
Sbjct  53   QDFFPLTVDYQEKFYAGGRIPGGF  76



>ref|WP_031256466.1| polynucleotide phosphorylase/polyadenylase, partial [Curvibacter 
lanceolatus]
Length=699

 Score = 48.1 bits (113),  Expect(2) = 9e-09, Method: Compositional matrix adjust.
 Identities = 23/51 (45%), Positives = 36/51 (71%), Gaps = 0/51 (0%)
 Frame = +2

Query  272  ILESFTEEFEIGSRKITLETGKIARFANGSVVLAMDETKVLSTVASAKGRR  424
            I    T+ F+ G   +TLETG+IAR A G+V++ +D+T VL+TV ++KG +
Sbjct  3    IFNKVTKTFQWGQHTVTLETGEIARQATGAVLVNIDDTVVLATVVASKGAK  53


 Score = 37.7 bits (86),  Expect(2) = 9e-09, Method: Composition-based stats.
 Identities = 15/24 (63%), Positives = 18/24 (75%), Gaps = 0/24 (0%)
 Frame = +3

Query  429  RDFLPLTVDYQEKQFAQGLIPSTF  500
            +DF PLTVDY EK +A G IP +F
Sbjct  56   QDFFPLTVDYIEKAYAAGKIPGSF  79



>ref|WP_009025946.1| polynucleotide phosphorylase [Bradyrhizobium sp. ORS 375]
 emb|CCD90921.1| Polyribonucleotide nucleotidyltransferase (Polynucleotide phosphorylase) 
(PNPase) [Bradyrhizobium sp. ORS 375]
Length=720

 Score = 46.2 bits (108),  Expect(2) = 9e-09, Method: Composition-based stats.
 Identities = 24/44 (55%), Positives = 31/44 (70%), Gaps = 0/44 (0%)
 Frame = +2

Query  293  EFEIGSRKITLETGKIARFANGSVVLAMDETKVLSTVASAKGRR  424
            E + G R + LETGKIAR A+G+VV +  ET VL+TV +AK  R
Sbjct  8    EIDWGGRPLKLETGKIARQADGAVVASYGETVVLATVVAAKAPR  51


 Score = 39.7 bits (91),  Expect(2) = 9e-09, Method: Composition-based stats.
 Identities = 16/23 (70%), Positives = 18/23 (78%), Gaps = 0/23 (0%)
 Frame = +3

Query  432  DFLPLTVDYQEKQFAQGLIPSTF  500
            DFLPLTVDYQEK +A G IP  +
Sbjct  55   DFLPLTVDYQEKAYAAGRIPGGY  77



>ref|WP_042088160.1| polynucleotide phosphorylase/polyadenylase [alpha proteobacterium 
Q-1]
Length=706

 Score = 47.0 bits (110),  Expect(2) = 1e-08, Method: Composition-based stats.
 Identities = 24/54 (44%), Positives = 33/54 (61%), Gaps = 0/54 (0%)
 Frame = +2

Query  272  ILESFTEEFEIGSRKITLETGKIARFANGSVVLAMDETKVLSTVASAKGRRSSR  433
            + E + +  E G R +TLETG+IAR A+G+VV    ET VL TV +A+     R
Sbjct  1    MFEIYRKTIEWGGRSLTLETGRIARQADGAVVATYGETSVLCTVVAARKAEPGR  54


 Score = 38.9 bits (89),  Expect(2) = 1e-08, Method: Compositional matrix adjust.
 Identities = 16/24 (67%), Positives = 18/24 (75%), Gaps = 0/24 (0%)
 Frame = +3

Query  429  RDFLPLTVDYQEKQFAQGLIPSTF  500
            RDF PLTV+YQEK +A G IP  F
Sbjct  54   RDFFPLTVNYQEKTYAAGKIPGGF  77



>gb|EEZ79604.1| Polyribonucleotide nucleotidyltransferase [uncultured SUP05 cluster 
bacterium]
Length=697

 Score = 50.8 bits (120),  Expect(2) = 1e-08, Method: Composition-based stats.
 Identities = 24/46 (52%), Positives = 34/46 (74%), Gaps = 0/46 (0%)
 Frame = +2

Query  287  TEEFEIGSRKITLETGKIARFANGSVVLAMDETKVLSTVASAKGRR  424
            T+ F +G   ITLETG+IAR A+G+V+ +MD+T+VL TV  +K  R
Sbjct  7    TKSFAMGKHTITLETGRIARQAHGAVLASMDDTQVLVTVVGSKEMR  52


 Score = 35.0 bits (79),  Expect(2) = 1e-08, Method: Composition-based stats.
 Identities = 14/24 (58%), Positives = 17/24 (71%), Gaps = 0/24 (0%)
 Frame = +3

Query  429  RDFLPLTVDYQEKQFAQGLIPSTF  500
            +DF PL+VDY EK +A G IP  F
Sbjct  55   QDFFPLSVDYIEKTYAAGKIPGGF  78



>ref|WP_004630820.1| polyribonucleotide nucleotidyltransferase [Ralstonia pickettii]
 gb|ENZ77415.1| polyribonucleotide nucleotidyltransferase [Ralstonia pickettii 
OR214]
Length=724

 Score = 48.9 bits (115),  Expect(2) = 1e-08, Method: Composition-based stats.
 Identities = 23/48 (48%), Positives = 34/48 (71%), Gaps = 0/48 (0%)
 Frame = +2

Query  272  ILESFTEEFEIGSRKITLETGKIARFANGSVVLAMDETKVLSTVASAK  415
            +     +EF+ G  K+ +ETG+IAR A+G+V+L MD+T VL+TV  AK
Sbjct  3    MFNKVVKEFQWGGHKVRMETGEIARQASGAVLLDMDDTVVLATVVGAK  50


 Score = 36.6 bits (83),  Expect(2) = 1e-08, Method: Composition-based stats.
 Identities = 15/24 (63%), Positives = 17/24 (71%), Gaps = 0/24 (0%)
 Frame = +3

Query  429  RDFLPLTVDYQEKQFAQGLIPSTF  500
            +DF PLTVDY EK +A G IP  F
Sbjct  56   QDFFPLTVDYLEKTYAAGKIPGGF  79



>ref|WP_037027177.1| polynucleotide phosphorylase/polyadenylase [Ralstonia sp. UNC404CL21Col]
Length=724

 Score = 48.9 bits (115),  Expect(2) = 1e-08, Method: Composition-based stats.
 Identities = 23/48 (48%), Positives = 34/48 (71%), Gaps = 0/48 (0%)
 Frame = +2

Query  272  ILESFTEEFEIGSRKITLETGKIARFANGSVVLAMDETKVLSTVASAK  415
            +     +EF+ G  K+ +ETG+IAR A+G+V+L MD+T VL+TV  AK
Sbjct  3    MFNKVVKEFQWGGHKVRMETGEIARQASGAVLLDMDDTVVLATVVGAK  50


 Score = 36.6 bits (83),  Expect(2) = 1e-08, Method: Composition-based stats.
 Identities = 15/24 (63%), Positives = 17/24 (71%), Gaps = 0/24 (0%)
 Frame = +3

Query  429  RDFLPLTVDYQEKQFAQGLIPSTF  500
            +DF PLTVDY EK +A G IP  F
Sbjct  56   QDFFPLTVDYLEKTYAAGKIPGGF  79



>ref|WP_012762310.1| polynucleotide phosphorylase/polyadenylase [Ralstonia pickettii]
 gb|ACS63177.1| Polyribonucleotide nucleotidyltransferase [Ralstonia pickettii 
12D]
Length=724

 Score = 48.9 bits (115),  Expect(2) = 1e-08, Method: Composition-based stats.
 Identities = 23/48 (48%), Positives = 34/48 (71%), Gaps = 0/48 (0%)
 Frame = +2

Query  272  ILESFTEEFEIGSRKITLETGKIARFANGSVVLAMDETKVLSTVASAK  415
            +     +EF+ G  K+ +ETG+IAR A+G+V+L MD+T VL+TV  AK
Sbjct  3    MFNKVVKEFQWGGHKVRMETGEIARQASGAVLLDMDDTVVLATVVGAK  50


 Score = 36.6 bits (83),  Expect(2) = 1e-08, Method: Composition-based stats.
 Identities = 15/24 (63%), Positives = 17/24 (71%), Gaps = 0/24 (0%)
 Frame = +3

Query  429  RDFLPLTVDYQEKQFAQGLIPSTF  500
            +DF PLTVDY EK +A G IP  F
Sbjct  56   QDFFPLTVDYLEKTYAAGKIPGGF  79



>sp|B2ICY4.1|PNP_BEII9 RecName: Full=Polyribonucleotide nucleotidyltransferase; AltName: 
Full=Polynucleotide phosphorylase; Short=PNPase [Beijerinckia 
indica subsp. indica ATCC 9039]
 gb|ACB96752.1| Polyribonucleotide nucleotidyltransferase [Beijerinckia indica 
subsp. indica ATCC 9039]
Length=715

 Score = 48.1 bits (113),  Expect(2) = 1e-08, Method: Composition-based stats.
 Identities = 25/48 (52%), Positives = 31/48 (65%), Gaps = 0/48 (0%)
 Frame = +2

Query  272  ILESFTEEFEIGSRKITLETGKIARFANGSVVLAMDETKVLSTVASAK  415
            + E   EE E   RK+ LETGKIAR A+G++     ET VL+TV SAK
Sbjct  3    MFEIHREEIEWAGRKLVLETGKIARQADGAIFATYGETTVLATVVSAK  50


 Score = 37.7 bits (86),  Expect(2) = 1e-08, Method: Composition-based stats.
 Identities = 15/23 (65%), Positives = 17/23 (74%), Gaps = 0/23 (0%)
 Frame = +3

Query  432  DFLPLTVDYQEKQFAQGLIPSTF  500
            DF PLTV+YQEK FA G IP  +
Sbjct  57   DFFPLTVNYQEKAFAAGRIPGGY  79



>ref|WP_041778179.1| polynucleotide phosphorylase/polyadenylase [Beijerinckia indica]
Length=713

 Score = 48.1 bits (113),  Expect(2) = 1e-08, Method: Composition-based stats.
 Identities = 25/48 (52%), Positives = 31/48 (65%), Gaps = 0/48 (0%)
 Frame = +2

Query  272  ILESFTEEFEIGSRKITLETGKIARFANGSVVLAMDETKVLSTVASAK  415
            + E   EE E   RK+ LETGKIAR A+G++     ET VL+TV SAK
Sbjct  1    MFEIHREEIEWAGRKLVLETGKIARQADGAIFATYGETTVLATVVSAK  48


 Score = 37.7 bits (86),  Expect(2) = 1e-08, Method: Composition-based stats.
 Identities = 15/23 (65%), Positives = 17/23 (74%), Gaps = 0/23 (0%)
 Frame = +3

Query  432  DFLPLTVDYQEKQFAQGLIPSTF  500
            DF PLTV+YQEK FA G IP  +
Sbjct  55   DFFPLTVNYQEKAFAAGRIPGGY  77



>gb|EFP65152.1| polyribonucleotide nucleotidyltransferase [Ralstonia sp. 5_7_47FAA]
Length=722

 Score = 48.9 bits (115),  Expect(2) = 1e-08, Method: Composition-based stats.
 Identities = 23/48 (48%), Positives = 34/48 (71%), Gaps = 0/48 (0%)
 Frame = +2

Query  272  ILESFTEEFEIGSRKITLETGKIARFANGSVVLAMDETKVLSTVASAK  415
            +     +EF+ G  K+ +ETG+IAR A+G+V+L MD+T VL+TV  AK
Sbjct  1    MFNKVVKEFQWGGHKVRMETGEIARQASGAVLLDMDDTVVLATVVGAK  48


 Score = 36.6 bits (83),  Expect(2) = 1e-08, Method: Composition-based stats.
 Identities = 15/24 (63%), Positives = 17/24 (71%), Gaps = 0/24 (0%)
 Frame = +3

Query  429  RDFLPLTVDYQEKQFAQGLIPSTF  500
            +DF PLTVDY EK +A G IP  F
Sbjct  54   QDFFPLTVDYLEKTYAAGKIPGGF  77



>ref|WP_017911268.1| polynucleotide phosphorylase/polyadenylase [Xanthomonas sp. SHU166]
Length=702

 Score = 47.4 bits (111),  Expect(2) = 1e-08, Method: Composition-based stats.
 Identities = 22/53 (42%), Positives = 34/53 (64%), Gaps = 0/53 (0%)
 Frame = +2

Query  275  LESFTEEFEIGSRKITLETGKIARFANGSVVLAMDETKVLSTVASAKGRRSSR  433
            +   T+ F+ G   +TLETG+IAR A G+V++ MD+T +L T  +AK  R  +
Sbjct  1    MAKITKTFQYGKHTVTLETGEIARQAGGAVIVKMDDTVLLVTAVAAKSAREGQ  53


 Score = 38.5 bits (88),  Expect(2) = 1e-08, Method: Composition-based stats.
 Identities = 16/24 (67%), Positives = 18/24 (75%), Gaps = 0/24 (0%)
 Frame = +3

Query  429  RDFLPLTVDYQEKQFAQGLIPSTF  500
            +DF PLTVDYQEK +A G IP  F
Sbjct  53   QDFFPLTVDYQEKFYAGGRIPGGF  76



>ref|WP_043092562.1| polynucleotide phosphorylase/polyadenylase [Xanthomonas sacchari]
 gb|AJC45303.1| polynucleotide phosphorylase/polyadenylase [Xanthomonas sacchari]
Length=702

 Score = 47.4 bits (111),  Expect(2) = 1e-08, Method: Composition-based stats.
 Identities = 22/53 (42%), Positives = 34/53 (64%), Gaps = 0/53 (0%)
 Frame = +2

Query  275  LESFTEEFEIGSRKITLETGKIARFANGSVVLAMDETKVLSTVASAKGRRSSR  433
            +   T+ F+ G   +TLETG+IAR A G+V++ MD+T +L T  +AK  R  +
Sbjct  1    MAKITKTFQYGKHTVTLETGEIARQAGGAVIVKMDDTVLLVTAVAAKSAREGQ  53


 Score = 38.5 bits (88),  Expect(2) = 1e-08, Method: Composition-based stats.
 Identities = 16/24 (67%), Positives = 18/24 (75%), Gaps = 0/24 (0%)
 Frame = +3

Query  429  RDFLPLTVDYQEKQFAQGLIPSTF  500
            +DF PLTVDYQEK +A G IP  F
Sbjct  53   QDFFPLTVDYQEKFYAGGRIPGGF  76



>ref|WP_026345179.1| polynucleotide phosphorylase/polyadenylase [Novispirillum itersonii]
Length=708

 Score = 46.6 bits (109),  Expect(2) = 1e-08, Method: Compositional matrix adjust.
 Identities = 23/44 (52%), Positives = 30/44 (68%), Gaps = 0/44 (0%)
 Frame = +2

Query  284  FTEEFEIGSRKITLETGKIARFANGSVVLAMDETKVLSTVASAK  415
            F +E E G RK+ LETGK+AR A+G+V++   ET VL T   AK
Sbjct  7    FRKEIEWGGRKLVLETGKVARQADGAVLVTYGETTVLCTAVGAK  50


 Score = 39.3 bits (90),  Expect(2) = 1e-08, Method: Composition-based stats.
 Identities = 16/24 (67%), Positives = 18/24 (75%), Gaps = 0/24 (0%)
 Frame = +3

Query  429  RDFLPLTVDYQEKQFAQGLIPSTF  500
            +DF PLTV+YQEK FA G IP  F
Sbjct  56   QDFFPLTVNYQEKTFAAGKIPGGF  79



>ref|WP_017915146.1| polynucleotide phosphorylase/polyadenylase [Xanthomonas sp. SHU308]
Length=702

 Score = 47.4 bits (111),  Expect(2) = 1e-08, Method: Composition-based stats.
 Identities = 22/53 (42%), Positives = 34/53 (64%), Gaps = 0/53 (0%)
 Frame = +2

Query  275  LESFTEEFEIGSRKITLETGKIARFANGSVVLAMDETKVLSTVASAKGRRSSR  433
            +   T+ F+ G   +TLETG+IAR A G+V++ MD+T +L T  +AK  R  +
Sbjct  1    MAKITKTFQYGKHTVTLETGEIARQAGGAVIVKMDDTVLLVTAVAAKSAREGQ  53


 Score = 38.5 bits (88),  Expect(2) = 1e-08, Method: Composition-based stats.
 Identities = 16/24 (67%), Positives = 18/24 (75%), Gaps = 0/24 (0%)
 Frame = +3

Query  429  RDFLPLTVDYQEKQFAQGLIPSTF  500
            +DF PLTVDYQEK +A G IP  F
Sbjct  53   QDFFPLTVDYQEKFYAGGRIPGGF  76



>ref|WP_017907567.1| polynucleotide phosphorylase/polyadenylase [Xanthomonas sp. SHU199]
Length=702

 Score = 47.4 bits (111),  Expect(2) = 1e-08, Method: Composition-based stats.
 Identities = 22/53 (42%), Positives = 34/53 (64%), Gaps = 0/53 (0%)
 Frame = +2

Query  275  LESFTEEFEIGSRKITLETGKIARFANGSVVLAMDETKVLSTVASAKGRRSSR  433
            +   T+ F+ G   +TLETG+IAR A G+V++ MD+T +L T  +AK  R  +
Sbjct  1    MAKITKTFQYGKHTVTLETGEIARQAGGAVIVKMDDTVLLVTAVAAKSAREGQ  53


 Score = 38.5 bits (88),  Expect(2) = 1e-08, Method: Composition-based stats.
 Identities = 16/24 (67%), Positives = 18/24 (75%), Gaps = 0/24 (0%)
 Frame = +3

Query  429  RDFLPLTVDYQEKQFAQGLIPSTF  500
            +DF PLTVDYQEK +A G IP  F
Sbjct  53   QDFFPLTVDYQEKFYAGGRIPGGF  76



>ref|WP_010344206.1| polynucleotide phosphorylase/polyadenylase [Xanthomonas sacchari]
Length=702

 Score = 47.4 bits (111),  Expect(2) = 1e-08, Method: Composition-based stats.
 Identities = 22/53 (42%), Positives = 34/53 (64%), Gaps = 0/53 (0%)
 Frame = +2

Query  275  LESFTEEFEIGSRKITLETGKIARFANGSVVLAMDETKVLSTVASAKGRRSSR  433
            +   T+ F+ G   +TLETG+IAR A G+V++ MD+T +L T  +AK  R  +
Sbjct  1    MAKITKTFQYGKHTVTLETGEIARQAGGAVIVKMDDTVLLVTAVAAKSAREGQ  53


 Score = 38.5 bits (88),  Expect(2) = 1e-08, Method: Composition-based stats.
 Identities = 16/24 (67%), Positives = 18/24 (75%), Gaps = 0/24 (0%)
 Frame = +3

Query  429  RDFLPLTVDYQEKQFAQGLIPSTF  500
            +DF PLTVDYQEK +A G IP  F
Sbjct  53   QDFFPLTVDYQEKFYAGGRIPGGF  76



>ref|WP_011995946.1| polynucleotide phosphorylase [Xanthobacter autotrophicus]
 sp|A7IC03.1|PNP_XANP2 RecName: Full=Polyribonucleotide nucleotidyltransferase; AltName: 
Full=Polynucleotide phosphorylase; Short=PNPase [Xanthobacter 
autotrophicus Py2]
 gb|ABS65546.1| Polyribonucleotide nucleotidyltransferase [Xanthobacter autotrophicus 
Py2]
Length=730

 Score = 48.9 bits (115),  Expect(2) = 1e-08, Method: Composition-based stats.
 Identities = 24/42 (57%), Positives = 32/42 (76%), Gaps = 0/42 (0%)
 Frame = +2

Query  290  EEFEIGSRKITLETGKIARFANGSVVLAMDETKVLSTVASAK  415
            EE + G R +TLETGK+AR A+GSV+    +TKVL+TV SA+
Sbjct  7    EELDWGGRTLTLETGKMARQADGSVLATYGDTKVLATVVSAR  48


 Score = 36.6 bits (83),  Expect(2) = 1e-08, Method: Composition-based stats.
 Identities = 14/24 (58%), Positives = 18/24 (75%), Gaps = 0/24 (0%)
 Frame = +3

Query  429  RDFLPLTVDYQEKQFAQGLIPSTF  500
            +DF PLTV+YQEK +A G IP  +
Sbjct  54   QDFFPLTVNYQEKTYAAGRIPGGY  77



>ref|WP_012436068.1| MULTISPECIES: polynucleotide phosphorylase/polyadenylase [Ralstonia]
 sp|B2U7R6.1|PNP_RALPJ RecName: Full=Polyribonucleotide nucleotidyltransferase; AltName: 
Full=Polynucleotide phosphorylase; Short=PNPase [Ralstonia 
pickettii 12J]
 gb|ACD27353.1| Polyribonucleotide nucleotidyltransferase [Ralstonia pickettii 
12J]
Length=724

 Score = 48.9 bits (115),  Expect(2) = 1e-08, Method: Composition-based stats.
 Identities = 23/48 (48%), Positives = 34/48 (71%), Gaps = 0/48 (0%)
 Frame = +2

Query  272  ILESFTEEFEIGSRKITLETGKIARFANGSVVLAMDETKVLSTVASAK  415
            +     +EF+ G  K+ +ETG+IAR A+G+V+L MD+T VL+TV  AK
Sbjct  3    MFNKVVKEFQWGGHKVRMETGEIARQASGAVLLDMDDTVVLATVVGAK  50


 Score = 36.6 bits (83),  Expect(2) = 1e-08, Method: Composition-based stats.
 Identities = 15/24 (63%), Positives = 17/24 (71%), Gaps = 0/24 (0%)
 Frame = +3

Query  429  RDFLPLTVDYQEKQFAQGLIPSTF  500
            +DF PLTVDY EK +A G IP  F
Sbjct  56   QDFFPLTVDYLEKTYAAGKIPGGF  79



>ref|WP_009241068.1| MULTISPECIES: polynucleotide phosphorylase/polyadenylase [Ralstonia]
 gb|EGY63161.1| polyribonucleotide nucleotidyltransferase [Ralstonia sp. 5_2_56FAA]
 gb|KFL20761.1| polyribonucleotide nucleotidyltransferase [Ralstonia pickettii]
Length=724

 Score = 48.9 bits (115),  Expect(2) = 1e-08, Method: Composition-based stats.
 Identities = 23/48 (48%), Positives = 34/48 (71%), Gaps = 0/48 (0%)
 Frame = +2

Query  272  ILESFTEEFEIGSRKITLETGKIARFANGSVVLAMDETKVLSTVASAK  415
            +     +EF+ G  K+ +ETG+IAR A+G+V+L MD+T VL+TV  AK
Sbjct  3    MFNKVVKEFQWGGHKVRMETGEIARQASGAVLLDMDDTVVLATVVGAK  50


 Score = 36.6 bits (83),  Expect(2) = 1e-08, Method: Composition-based stats.
 Identities = 15/24 (63%), Positives = 17/24 (71%), Gaps = 0/24 (0%)
 Frame = +3

Query  429  RDFLPLTVDYQEKQFAQGLIPSTF  500
            +DF PLTVDY EK +A G IP  F
Sbjct  56   QDFFPLTVDYLEKTYAAGKIPGGF  79



>ref|WP_028310327.1| polynucleotide phosphorylase/polyadenylase [Derxia gummosa]
Length=705

 Score = 49.7 bits (117),  Expect(2) = 1e-08, Method: Composition-based stats.
 Identities = 23/48 (48%), Positives = 36/48 (75%), Gaps = 0/48 (0%)
 Frame = +2

Query  272  ILESFTEEFEIGSRKITLETGKIARFANGSVVLAMDETKVLSTVASAK  415
            +    T+EF+ G  K+ LETG+IAR A+G+VV+ +++T VL+TV +AK
Sbjct  1    MFNKVTKEFQYGQHKVVLETGEIARQASGAVVVNIEDTVVLATVVAAK  48


 Score = 36.2 bits (82),  Expect(2) = 1e-08, Method: Composition-based stats.
 Identities = 15/24 (63%), Positives = 17/24 (71%), Gaps = 0/24 (0%)
 Frame = +3

Query  429  RDFLPLTVDYQEKQFAQGLIPSTF  500
            +DF PLTVDY EK +A G IP  F
Sbjct  54   QDFFPLTVDYIEKTYAAGKIPGGF  77



>ref|WP_024972481.1| polynucleotide phosphorylase/polyadenylase [Ralstonia pickettii]
Length=724

 Score = 48.9 bits (115),  Expect(2) = 1e-08, Method: Composition-based stats.
 Identities = 23/48 (48%), Positives = 34/48 (71%), Gaps = 0/48 (0%)
 Frame = +2

Query  272  ILESFTEEFEIGSRKITLETGKIARFANGSVVLAMDETKVLSTVASAK  415
            +     +EF+ G  K+ +ETG+IAR A+G+V+L MD+T VL+TV  AK
Sbjct  3    MFNKVVKEFQWGGHKVRMETGEIARQASGAVLLDMDDTVVLATVVGAK  50


 Score = 36.6 bits (83),  Expect(2) = 1e-08, Method: Composition-based stats.
 Identities = 15/24 (63%), Positives = 17/24 (71%), Gaps = 0/24 (0%)
 Frame = +3

Query  429  RDFLPLTVDYQEKQFAQGLIPSTF  500
            +DF PLTVDY EK +A G IP  F
Sbjct  56   QDFFPLTVDYLEKTYAAGKIPGGF  79



>dbj|BAI73501.1| polyribonucleotide nucleotidyltransferase [Azospirillum sp. B510]
Length=711

 Score = 47.0 bits (110),  Expect(2) = 1e-08, Method: Composition-based stats.
 Identities = 23/43 (53%), Positives = 30/43 (70%), Gaps = 0/43 (0%)
 Frame = +2

Query  290  EEFEIGSRKITLETGKIARFANGSVVLAMDETKVLSTVASAKG  418
            +E E G RK+ LETGKIAR ANG+V++   +T VL T  +AK 
Sbjct  15   KEIEWGGRKLVLETGKIARQANGAVLVTYGDTTVLCTAVAAKA  57


 Score = 38.9 bits (89),  Expect(2) = 1e-08, Method: Composition-based stats.
 Identities = 16/23 (70%), Positives = 17/23 (74%), Gaps = 0/23 (0%)
 Frame = +3

Query  432  DFLPLTVDYQEKQFAQGLIPSTF  500
            DF PLTV+YQEK FA G IP  F
Sbjct  63   DFFPLTVNYQEKAFAAGKIPGGF  85



>ref|WP_013535495.1| polynucleotide phosphorylase/polyadenylase [Pseudoxanthomonas 
suwonensis]
 gb|ADV27667.1| polyribonucleotide nucleotidyltransferase [Pseudoxanthomonas 
suwonensis 11-1]
Length=701

 Score = 47.4 bits (111),  Expect(2) = 1e-08, Method: Compositional matrix adjust.
 Identities = 22/53 (42%), Positives = 35/53 (66%), Gaps = 0/53 (0%)
 Frame = +2

Query  275  LESFTEEFEIGSRKITLETGKIARFANGSVVLAMDETKVLSTVASAKGRRSSR  433
            +   T+ F+ G   +TLETG++AR A+GSV++ MD+T +L T  +AK  R  +
Sbjct  1    MAKITKTFQYGKHTVTLETGEVARQASGSVIVKMDDTVLLVTAVAAKSAREGQ  53


 Score = 38.1 bits (87),  Expect(2) = 1e-08, Method: Composition-based stats.
 Identities = 16/24 (67%), Positives = 18/24 (75%), Gaps = 0/24 (0%)
 Frame = +3

Query  429  RDFLPLTVDYQEKQFAQGLIPSTF  500
            +DF PLTVDYQEK +A G IP  F
Sbjct  53   QDFFPLTVDYQEKFYAGGRIPGGF  76



>ref|WP_024509590.1| polynucleotide phosphorylase/polyadenylase [Bradyrhizobium sp. 
ARR65]
Length=725

 Score = 46.2 bits (108),  Expect(2) = 1e-08, Method: Composition-based stats.
 Identities = 24/44 (55%), Positives = 31/44 (70%), Gaps = 0/44 (0%)
 Frame = +2

Query  293  EFEIGSRKITLETGKIARFANGSVVLAMDETKVLSTVASAKGRR  424
            E + G R + LETGKIAR A+G+VV +  ET VL+TV +AK  R
Sbjct  8    EIDWGGRPLKLETGKIARQADGAVVASYGETVVLATVVAAKAPR  51


 Score = 39.3 bits (90),  Expect(2) = 1e-08, Method: Composition-based stats.
 Identities = 16/23 (70%), Positives = 18/23 (78%), Gaps = 0/23 (0%)
 Frame = +3

Query  432  DFLPLTVDYQEKQFAQGLIPSTF  500
            DFLPLTVDYQEK +A G IP  +
Sbjct  55   DFLPLTVDYQEKAYAAGRIPGGY  77



>ref|WP_042443290.1| polynucleotide phosphorylase/polyadenylase [Azospirillum lipoferum]
Length=703

 Score = 47.0 bits (110),  Expect(2) = 1e-08, Method: Composition-based stats.
 Identities = 23/43 (53%), Positives = 30/43 (70%), Gaps = 0/43 (0%)
 Frame = +2

Query  290  EEFEIGSRKITLETGKIARFANGSVVLAMDETKVLSTVASAKG  418
            +E E G RK+ LETGKIAR ANG+V++   +T VL T  +AK 
Sbjct  7    KEIEWGGRKLVLETGKIARQANGAVLVTYGDTTVLCTAVAAKA  49


 Score = 38.9 bits (89),  Expect(2) = 1e-08, Method: Composition-based stats.
 Identities = 16/23 (70%), Positives = 17/23 (74%), Gaps = 0/23 (0%)
 Frame = +3

Query  432  DFLPLTVDYQEKQFAQGLIPSTF  500
            DF PLTV+YQEK FA G IP  F
Sbjct  55   DFFPLTVNYQEKAFAAGKIPGGF  77



>ref|WP_022186711.1| polyribonucleotide nucleotidyltransferase [Azospirillum sp. CAG:260]
 emb|CDB40264.1| polyribonucleotide nucleotidyltransferase [Azospirillum sp. CAG:260]
Length=706

 Score = 48.5 bits (114),  Expect(2) = 1e-08, Method: Composition-based stats.
 Identities = 23/48 (48%), Positives = 35/48 (73%), Gaps = 0/48 (0%)
 Frame = +2

Query  290  EEFEIGSRKITLETGKIARFANGSVVLAMDETKVLSTVASAKGRRSSR  433
            +E E G RK+ LETGK+AR A G+VV+   ET+V++TV +AK  ++ +
Sbjct  9    KEMEWGGRKLVLETGKLARQAQGAVVVTYGETEVIATVCAAKEAKADQ  56


 Score = 37.4 bits (85),  Expect(2) = 1e-08, Method: Composition-based stats.
 Identities = 15/30 (50%), Positives = 20/30 (67%), Gaps = 0/30 (0%)
 Frame = +3

Query  411  QRGDAVRDFLPLTVDYQEKQFAQGLIPSTF  500
            +   A +DF PLTV+YQEK +A G +P  F
Sbjct  50   KEAKADQDFFPLTVNYQEKYYATGKVPGGF  79



>ref|WP_014249208.1| polynucleotide phosphorylase [Azospirillum lipoferum]
 emb|CBS88234.1| Polynucleotide phosphorylase [Azospirillum lipoferum 4B]
Length=703

 Score = 47.0 bits (110),  Expect(2) = 1e-08, Method: Composition-based stats.
 Identities = 23/43 (53%), Positives = 30/43 (70%), Gaps = 0/43 (0%)
 Frame = +2

Query  290  EEFEIGSRKITLETGKIARFANGSVVLAMDETKVLSTVASAKG  418
            +E E G RK+ LETGKIAR ANG+V++   +T VL T  +AK 
Sbjct  7    KEIEWGGRKLVLETGKIARQANGAVMVTYGDTTVLCTAVAAKA  49


 Score = 38.9 bits (89),  Expect(2) = 1e-08, Method: Composition-based stats.
 Identities = 16/23 (70%), Positives = 17/23 (74%), Gaps = 0/23 (0%)
 Frame = +3

Query  432  DFLPLTVDYQEKQFAQGLIPSTF  500
            DF PLTV+YQEK FA G IP  F
Sbjct  55   DFFPLTVNYQEKAFAAGKIPGGF  77



>ref|WP_018699669.1| polynucleotide phosphorylase [Amorphus coralli]
Length=709

 Score = 46.6 bits (109),  Expect(2) = 1e-08, Method: Compositional matrix adjust.
 Identities = 23/48 (48%), Positives = 33/48 (69%), Gaps = 0/48 (0%)
 Frame = +2

Query  272  ILESFTEEFEIGSRKITLETGKIARFANGSVVLAMDETKVLSTVASAK  415
            + E + E  + G R +TLETG++AR A+G+V+    ET VL+TV SAK
Sbjct  1    MFEIYKETIDWGGRPLTLETGRVARQADGAVLATYGETTVLATVVSAK  48


 Score = 38.9 bits (89),  Expect(2) = 1e-08, Method: Composition-based stats.
 Identities = 16/23 (70%), Positives = 17/23 (74%), Gaps = 0/23 (0%)
 Frame = +3

Query  432  DFLPLTVDYQEKQFAQGLIPSTF  500
            DF PLTV+YQEK FA G IP  F
Sbjct  55   DFFPLTVNYQEKAFAAGRIPGGF  77



>ref|WP_042700039.1| polynucleotide phosphorylase/polyadenylase [Azospirillum sp. 
B506]
Length=703

 Score = 47.0 bits (110),  Expect(2) = 1e-08, Method: Composition-based stats.
 Identities = 23/43 (53%), Positives = 30/43 (70%), Gaps = 0/43 (0%)
 Frame = +2

Query  290  EEFEIGSRKITLETGKIARFANGSVVLAMDETKVLSTVASAKG  418
            +E E G RK+ LETGKIAR ANG+V++   +T VL T  +AK 
Sbjct  7    KEIEWGGRKLVLETGKIARQANGAVMVTYGDTTVLCTAVAAKA  49


 Score = 38.5 bits (88),  Expect(2) = 1e-08, Method: Composition-based stats.
 Identities = 16/23 (70%), Positives = 17/23 (74%), Gaps = 0/23 (0%)
 Frame = +3

Query  432  DFLPLTVDYQEKQFAQGLIPSTF  500
            DF PLTV+YQEK FA G IP  F
Sbjct  55   DFFPLTVNYQEKAFAAGKIPGGF  77



>gb|EKE09557.1| hypothetical protein ACD_16C00137G0008 [uncultured bacterium]
Length=710

 Score = 49.3 bits (116),  Expect(2) = 1e-08, Method: Compositional matrix adjust.
 Identities = 25/48 (52%), Positives = 34/48 (71%), Gaps = 0/48 (0%)
 Frame = +2

Query  272  ILESFTEEFEIGSRKITLETGKIARFANGSVVLAMDETKVLSTVASAK  415
            + E + +E E G +K+TLETGKIAR A+G+VV+   ET VL T  +AK
Sbjct  1    MFEIYRKELEWGGKKLTLETGKIARQADGAVVVTYGETVVLCTAVAAK  48


 Score = 36.2 bits (82),  Expect(2) = 1e-08, Method: Composition-based stats.
 Identities = 16/23 (70%), Positives = 16/23 (70%), Gaps = 0/23 (0%)
 Frame = +3

Query  432  DFLPLTVDYQEKQFAQGLIPSTF  500
            DF PLTV YQEK FA G IP  F
Sbjct  55   DFFPLTVVYQEKAFAAGRIPGGF  77



>ref|WP_004260595.1| polynucleotide phosphorylase/polyadenylase [Thauera sp. 63]
 gb|ENO77114.1| polynucleotide phosphorylase/polyadenylase [Thauera sp. 63]
Length=699

 Score = 49.7 bits (117),  Expect(2) = 1e-08, Method: Compositional matrix adjust.
 Identities = 24/51 (47%), Positives = 36/51 (71%), Gaps = 0/51 (0%)
 Frame = +2

Query  272  ILESFTEEFEIGSRKITLETGKIARFANGSVVLAMDETKVLSTVASAKGRR  424
            +L +  + F  G+  +TLETG++AR A G+V++ MDET VL+TV +AK  R
Sbjct  1    MLNAIKKTFAYGAHTVTLETGEVARQAGGAVIVNMDETVVLATVVAAKEAR  51


 Score = 35.8 bits (81),  Expect(2) = 1e-08, Method: Composition-based stats.
 Identities = 15/24 (63%), Positives = 17/24 (71%), Gaps = 0/24 (0%)
 Frame = +3

Query  429  RDFLPLTVDYQEKQFAQGLIPSTF  500
            +DF PLTVDY EK +A G IP  F
Sbjct  54   QDFFPLTVDYVEKFYAAGRIPGGF  77



>ref|WP_028878228.1| polynucleotide phosphorylase/polyadenylase [Terasakiella pusilla]
Length=736

 Score = 47.0 bits (110),  Expect(2) = 1e-08, Method: Composition-based stats.
 Identities = 23/52 (44%), Positives = 32/52 (62%), Gaps = 0/52 (0%)
 Frame = +2

Query  272  ILESFTEEFEIGSRKITLETGKIARFANGSVVLAMDETKVLSTVASAKGRRS  427
            + + F +E E G R +  ETGKIAR A+G+V++   ETKVL T    K  R+
Sbjct  1    MFKEFRKEIEWGGRPLVFETGKIARQADGAVLVTYGETKVLCTAVGQKQARA  52


 Score = 38.5 bits (88),  Expect(2) = 1e-08, Method: Composition-based stats.
 Identities = 16/23 (70%), Positives = 17/23 (74%), Gaps = 0/23 (0%)
 Frame = +3

Query  432  DFLPLTVDYQEKQFAQGLIPSTF  500
            DF PLTV+YQEK FA G IP  F
Sbjct  55   DFFPLTVNYQEKAFAAGKIPGGF  77



>ref|WP_037445780.1| polynucleotide phosphorylase/polyadenylase [Skermanella stibiiresistens]
 gb|EWY42374.1| polynucleotide phosphorylase [Skermanella stibiiresistens SB22]
Length=703

 Score = 46.6 bits (109),  Expect(2) = 1e-08, Method: Composition-based stats.
 Identities = 23/42 (55%), Positives = 30/42 (71%), Gaps = 0/42 (0%)
 Frame = +2

Query  290  EEFEIGSRKITLETGKIARFANGSVVLAMDETKVLSTVASAK  415
            +E E G RK+ LETGK+AR A+G+V+    ET VL TV +AK
Sbjct  7    KEIEWGGRKLVLETGKVARQADGAVMATYGETTVLCTVVAAK  48


 Score = 38.9 bits (89),  Expect(2) = 1e-08, Method: Composition-based stats.
 Identities = 16/23 (70%), Positives = 17/23 (74%), Gaps = 0/23 (0%)
 Frame = +3

Query  432  DFLPLTVDYQEKQFAQGLIPSTF  500
            DF PLTV+YQEK FA G IP  F
Sbjct  55   DFFPLTVNYQEKAFAAGKIPGGF  77



>ref|WP_018319413.1| polynucleotide phosphorylase [Bradyrhizobium sp. WSM2793]
Length=720

 Score = 45.8 bits (107),  Expect(2) = 1e-08, Method: Composition-based stats.
 Identities = 24/44 (55%), Positives = 30/44 (68%), Gaps = 0/44 (0%)
 Frame = +2

Query  293  EFEIGSRKITLETGKIARFANGSVVLAMDETKVLSTVASAKGRR  424
            E + G R + LETGKIAR A+G+VV    ET VL+TV +AK  R
Sbjct  8    EIDWGGRTLKLETGKIARQADGAVVATYGETVVLATVVAAKAPR  51


 Score = 39.7 bits (91),  Expect(2) = 1e-08, Method: Composition-based stats.
 Identities = 16/23 (70%), Positives = 18/23 (78%), Gaps = 0/23 (0%)
 Frame = +3

Query  432  DFLPLTVDYQEKQFAQGLIPSTF  500
            DFLPLTVDYQEK +A G IP  +
Sbjct  55   DFLPLTVDYQEKTYAAGRIPGGY  77



>ref|WP_038970619.1| polynucleotide phosphorylase/polyadenylase [Bradyrhizobium sp. 
CCBAU 15635]
Length=718

 Score = 45.8 bits (107),  Expect(2) = 1e-08, Method: Composition-based stats.
 Identities = 24/44 (55%), Positives = 30/44 (68%), Gaps = 0/44 (0%)
 Frame = +2

Query  293  EFEIGSRKITLETGKIARFANGSVVLAMDETKVLSTVASAKGRR  424
            E + G R + LETGKIAR A+G+VV    ET VL+TV +AK  R
Sbjct  8    EIDWGGRTLKLETGKIARQADGAVVATYGETVVLATVVAAKAPR  51


 Score = 39.7 bits (91),  Expect(2) = 1e-08, Method: Composition-based stats.
 Identities = 16/23 (70%), Positives = 18/23 (78%), Gaps = 0/23 (0%)
 Frame = +3

Query  432  DFLPLTVDYQEKQFAQGLIPSTF  500
            DFLPLTVDYQEK +A G IP  +
Sbjct  55   DFLPLTVDYQEKTYAAGRIPGGY  77



>ref|WP_028139505.1| MULTISPECIES: polynucleotide phosphorylase/polyadenylase [Bradyrhizobium]
Length=718

 Score = 45.8 bits (107),  Expect(2) = 1e-08, Method: Composition-based stats.
 Identities = 24/44 (55%), Positives = 30/44 (68%), Gaps = 0/44 (0%)
 Frame = +2

Query  293  EFEIGSRKITLETGKIARFANGSVVLAMDETKVLSTVASAKGRR  424
            E + G R + LETGKIAR A+G+VV    ET VL+TV +AK  R
Sbjct  8    EIDWGGRTLKLETGKIARQADGAVVATYGETVVLATVVAAKAPR  51


 Score = 39.7 bits (91),  Expect(2) = 1e-08, Method: Composition-based stats.
 Identities = 16/23 (70%), Positives = 18/23 (78%), Gaps = 0/23 (0%)
 Frame = +3

Query  432  DFLPLTVDYQEKQFAQGLIPSTF  500
            DFLPLTVDYQEK +A G IP  +
Sbjct  55   DFLPLTVDYQEKTYAAGRIPGGY  77



>ref|WP_028133640.1| polynucleotide phosphorylase/polyadenylase [Bradyrhizobium japonicum]
Length=718

 Score = 45.8 bits (107),  Expect(2) = 1e-08, Method: Composition-based stats.
 Identities = 24/44 (55%), Positives = 30/44 (68%), Gaps = 0/44 (0%)
 Frame = +2

Query  293  EFEIGSRKITLETGKIARFANGSVVLAMDETKVLSTVASAKGRR  424
            E + G R + LETGKIAR A+G+VV    ET VL+TV +AK  R
Sbjct  8    EIDWGGRPLKLETGKIARQADGAVVATYGETVVLATVVAAKAPR  51


 Score = 39.7 bits (91),  Expect(2) = 1e-08, Method: Composition-based stats.
 Identities = 16/23 (70%), Positives = 18/23 (78%), Gaps = 0/23 (0%)
 Frame = +3

Query  432  DFLPLTVDYQEKQFAQGLIPSTF  500
            DFLPLTVDYQEK +A G IP  +
Sbjct  55   DFLPLTVDYQEKTYAAGRIPGGY  77



>ref|WP_043239101.1| polynucleotide phosphorylase/polyadenylase [Bosea sp. LC85]
 gb|KFC65477.1| Polyribonucleotide nucleotidyltransferase [Bosea sp. LC85]
Length=724

 Score = 48.1 bits (113),  Expect(2) = 1e-08, Method: Composition-based stats.
 Identities = 25/43 (58%), Positives = 31/43 (72%), Gaps = 0/43 (0%)
 Frame = +2

Query  287  TEEFEIGSRKITLETGKIARFANGSVVLAMDETKVLSTVASAK  415
            TEE   G RK+ LETGK+AR A+G+V+    ET VL+TV SAK
Sbjct  6    TEELIWGGRKLVLETGKVARQADGAVLATYGETVVLATVVSAK  48


 Score = 37.4 bits (85),  Expect(2) = 1e-08, Method: Composition-based stats.
 Identities = 15/23 (65%), Positives = 17/23 (74%), Gaps = 0/23 (0%)
 Frame = +3

Query  432  DFLPLTVDYQEKQFAQGLIPSTF  500
            DF PLTV+YQEK FA G IP  +
Sbjct  55   DFFPLTVNYQEKTFAAGRIPGGY  77



>ref|WP_011923331.1| polynucleotide phosphorylase [Bradyrhizobium sp. ORS 278]
 sp|A4YJF3.1|PNP_BRASO RecName: Full=Polyribonucleotide nucleotidyltransferase; AltName: 
Full=Polynucleotide phosphorylase; Short=PNPase [Bradyrhizobium 
sp. ORS 278]
 emb|CAL74029.1| Polyribonucleotide nucleotidyltransferase (Polynucleotide phosphorylase) 
(PNPase) [Bradyrhizobium sp. ORS 278]
Length=719

 Score = 45.8 bits (107),  Expect(2) = 1e-08, Method: Composition-based stats.
 Identities = 24/44 (55%), Positives = 30/44 (68%), Gaps = 0/44 (0%)
 Frame = +2

Query  293  EFEIGSRKITLETGKIARFANGSVVLAMDETKVLSTVASAKGRR  424
            E + G R + LETGKIAR A+G+VV    ET VL+TV +AK  R
Sbjct  8    EIDWGGRPLKLETGKIARQADGAVVATYGETVVLATVVAAKAPR  51


 Score = 39.7 bits (91),  Expect(2) = 1e-08, Method: Composition-based stats.
 Identities = 16/23 (70%), Positives = 18/23 (78%), Gaps = 0/23 (0%)
 Frame = +3

Query  432  DFLPLTVDYQEKQFAQGLIPSTF  500
            DFLPLTVDYQEK +A G IP  +
Sbjct  55   DFLPLTVDYQEKAYAAGRIPGGY  77



>ref|WP_028172517.1| MULTISPECIES: polynucleotide phosphorylase/polyadenylase [Bradyrhizobium]
 gb|KGJ65218.1| putative Polyribonucleotide nucleotidyltransferase [Bradyrhizobium 
diazoefficiens SEMIA 5080]
Length=720

 Score = 45.8 bits (107),  Expect(2) = 1e-08, Method: Composition-based stats.
 Identities = 24/44 (55%), Positives = 30/44 (68%), Gaps = 0/44 (0%)
 Frame = +2

Query  293  EFEIGSRKITLETGKIARFANGSVVLAMDETKVLSTVASAKGRR  424
            E + G R + LETGKIAR A+G+VV    ET VL+TV +AK  R
Sbjct  8    EIDWGGRPLKLETGKIARQADGAVVATYGETVVLATVVAAKAPR  51


 Score = 39.7 bits (91),  Expect(2) = 1e-08, Method: Composition-based stats.
 Identities = 16/23 (70%), Positives = 18/23 (78%), Gaps = 0/23 (0%)
 Frame = +3

Query  432  DFLPLTVDYQEKQFAQGLIPSTF  500
            DFLPLTVDYQEK +A G IP  +
Sbjct  55   DFLPLTVDYQEKTYAAGRIPGGY  77



>ref|WP_011083601.1| MULTISPECIES: polynucleotide phosphorylase [Bradyrhizobium]
 ref|NP_767419.1| polynucleotide phosphorylase [Bradyrhizobium diazoefficiens USDA 
110]
 sp|Q89WB3.1|PNP_BRADU RecName: Full=Polyribonucleotide nucleotidyltransferase; AltName: 
Full=Polynucleotide phosphorylase; Short=PNPase [Bradyrhizobium 
diazoefficiens USDA 110]
 dbj|BAC46044.1| polyribonucleotide nucleotidyltransferase [Bradyrhizobium diazoefficiens 
USDA 110]
Length=720

 Score = 45.8 bits (107),  Expect(2) = 1e-08, Method: Composition-based stats.
 Identities = 24/44 (55%), Positives = 30/44 (68%), Gaps = 0/44 (0%)
 Frame = +2

Query  293  EFEIGSRKITLETGKIARFANGSVVLAMDETKVLSTVASAKGRR  424
            E + G R + LETGKIAR A+G+VV    ET VL+TV +AK  R
Sbjct  8    EIDWGGRPLKLETGKIARQADGAVVATYGETVVLATVVAAKAPR  51


 Score = 39.7 bits (91),  Expect(2) = 1e-08, Method: Composition-based stats.
 Identities = 16/23 (70%), Positives = 18/23 (78%), Gaps = 0/23 (0%)
 Frame = +3

Query  432  DFLPLTVDYQEKQFAQGLIPSTF  500
            DFLPLTVDYQEK +A G IP  +
Sbjct  55   DFLPLTVDYQEKTYAAGRIPGGY  77



>ref|WP_038944019.1| polynucleotide phosphorylase/polyadenylase [Bradyrhizobium japonicum]
Length=718

 Score = 45.8 bits (107),  Expect(2) = 1e-08, Method: Composition-based stats.
 Identities = 24/44 (55%), Positives = 30/44 (68%), Gaps = 0/44 (0%)
 Frame = +2

Query  293  EFEIGSRKITLETGKIARFANGSVVLAMDETKVLSTVASAKGRR  424
            E + G R + LETGKIAR A+G+VV    ET VL+TV +AK  R
Sbjct  8    EIDWGGRPLKLETGKIARQADGAVVATYGETVVLATVVAAKAPR  51


 Score = 39.7 bits (91),  Expect(2) = 1e-08, Method: Composition-based stats.
 Identities = 16/23 (70%), Positives = 18/23 (78%), Gaps = 0/23 (0%)
 Frame = +3

Query  432  DFLPLTVDYQEKQFAQGLIPSTF  500
            DFLPLTVDYQEK +A G IP  +
Sbjct  55   DFLPLTVDYQEKTYAAGRIPGGY  77



>ref|WP_027546823.1| polynucleotide phosphorylase/polyadenylase [Bradyrhizobium sp. 
WSM2254]
Length=718

 Score = 45.8 bits (107),  Expect(2) = 1e-08, Method: Composition-based stats.
 Identities = 24/44 (55%), Positives = 30/44 (68%), Gaps = 0/44 (0%)
 Frame = +2

Query  293  EFEIGSRKITLETGKIARFANGSVVLAMDETKVLSTVASAKGRR  424
            E + G R + LETGKIAR A+G+VV    ET VL+TV +AK  R
Sbjct  8    EIDWGGRPLKLETGKIARQADGAVVATYGETVVLATVVAAKAPR  51


 Score = 39.7 bits (91),  Expect(2) = 1e-08, Method: Composition-based stats.
 Identities = 16/23 (70%), Positives = 18/23 (78%), Gaps = 0/23 (0%)
 Frame = +3

Query  432  DFLPLTVDYQEKQFAQGLIPSTF  500
            DFLPLTVDYQEK +A G IP  +
Sbjct  55   DFLPLTVDYQEKTYAAGRIPGGY  77



>ref|WP_036024490.1| polynucleotide phosphorylase/polyadenylase [Bradyrhizobium yuanmingense]
Length=720

 Score = 45.8 bits (107),  Expect(2) = 1e-08, Method: Composition-based stats.
 Identities = 24/44 (55%), Positives = 30/44 (68%), Gaps = 0/44 (0%)
 Frame = +2

Query  293  EFEIGSRKITLETGKIARFANGSVVLAMDETKVLSTVASAKGRR  424
            E + G R + LETGKIAR A+G+VV    ET VL+TV +AK  R
Sbjct  8    EIDWGGRPLKLETGKIARQADGAVVATYGETVVLATVVAAKAPR  51


 Score = 39.7 bits (91),  Expect(2) = 1e-08, Method: Composition-based stats.
 Identities = 16/23 (70%), Positives = 18/23 (78%), Gaps = 0/23 (0%)
 Frame = +3

Query  432  DFLPLTVDYQEKQFAQGLIPSTF  500
            DFLPLTVDYQEK +A G IP  +
Sbjct  55   DFLPLTVDYQEKAYAAGRIPGGY  77



>ref|WP_024575659.1| MULTISPECIES: polynucleotide phosphorylase/polyadenylase [Afipia]
Length=714

 Score = 45.8 bits (107),  Expect(2) = 1e-08, Method: Composition-based stats.
 Identities = 24/51 (47%), Positives = 33/51 (65%), Gaps = 0/51 (0%)
 Frame = +2

Query  272  ILESFTEEFEIGSRKITLETGKIARFANGSVVLAMDETKVLSTVASAKGRR  424
            +  + + E + G R + LETGKIAR A+G+VV    ET VL+TV +AK  R
Sbjct  1    MFNAHSVEIDWGGRPLKLETGKIARQADGAVVATYGETIVLATVVAAKAPR  51


 Score = 39.7 bits (91),  Expect(2) = 1e-08, Method: Composition-based stats.
 Identities = 16/23 (70%), Positives = 18/23 (78%), Gaps = 0/23 (0%)
 Frame = +3

Query  432  DFLPLTVDYQEKQFAQGLIPSTF  500
            DFLPLTVDYQEK +A G IP  +
Sbjct  55   DFLPLTVDYQEKTYAAGRIPGGY  77



>ref|WP_036040863.1| polynucleotide phosphorylase/polyadenylase [Bradyrhizobium yuanmingense]
Length=720

 Score = 45.8 bits (107),  Expect(2) = 1e-08, Method: Composition-based stats.
 Identities = 24/44 (55%), Positives = 30/44 (68%), Gaps = 0/44 (0%)
 Frame = +2

Query  293  EFEIGSRKITLETGKIARFANGSVVLAMDETKVLSTVASAKGRR  424
            E + G R + LETGKIAR A+G+VV    ET VL+TV +AK  R
Sbjct  8    EIDWGGRPLKLETGKIARQADGAVVATYGETVVLATVVAAKAPR  51


 Score = 39.7 bits (91),  Expect(2) = 1e-08, Method: Composition-based stats.
 Identities = 16/23 (70%), Positives = 18/23 (78%), Gaps = 0/23 (0%)
 Frame = +3

Query  432  DFLPLTVDYQEKQFAQGLIPSTF  500
            DFLPLTVDYQEK +A G IP  +
Sbjct  55   DFLPLTVDYQEKAYAAGRIPGGY  77



>ref|WP_036009004.1| polynucleotide phosphorylase/polyadenylase [Bradyrhizobium yuanmingense]
Length=720

 Score = 45.8 bits (107),  Expect(2) = 1e-08, Method: Composition-based stats.
 Identities = 24/44 (55%), Positives = 30/44 (68%), Gaps = 0/44 (0%)
 Frame = +2

Query  293  EFEIGSRKITLETGKIARFANGSVVLAMDETKVLSTVASAKGRR  424
            E + G R + LETGKIAR A+G+VV    ET VL+TV +AK  R
Sbjct  8    EIDWGGRPLKLETGKIARQADGAVVATYGETVVLATVVAAKAPR  51


 Score = 39.7 bits (91),  Expect(2) = 1e-08, Method: Composition-based stats.
 Identities = 16/23 (70%), Positives = 18/23 (78%), Gaps = 0/23 (0%)
 Frame = +3

Query  432  DFLPLTVDYQEKQFAQGLIPSTF  500
            DFLPLTVDYQEK +A G IP  +
Sbjct  55   DFLPLTVDYQEKAYAAGRIPGGY  77



>ref|WP_029011885.1| polynucleotide phosphorylase/polyadenylase [Niveispirillum irakense]
Length=707

 Score = 46.6 bits (109),  Expect(2) = 1e-08, Method: Composition-based stats.
 Identities = 22/48 (46%), Positives = 34/48 (71%), Gaps = 0/48 (0%)
 Frame = +2

Query  272  ILESFTEEFEIGSRKITLETGKIARFANGSVVLAMDETKVLSTVASAK  415
            + + F +E E G RK+ +ETGKIAR A+G+V+++  +T VL+T   AK
Sbjct  1    MFKVFRKEMEWGGRKLVIETGKIARQADGAVMVSYGDTVVLATAVGAK  48


 Score = 38.9 bits (89),  Expect(2) = 1e-08, Method: Composition-based stats.
 Identities = 16/23 (70%), Positives = 17/23 (74%), Gaps = 0/23 (0%)
 Frame = +3

Query  432  DFLPLTVDYQEKQFAQGLIPSTF  500
            DF PLTV+YQEK FA G IP  F
Sbjct  55   DFFPLTVNYQEKAFAAGKIPGGF  77



>ref|WP_006608910.1| polynucleotide phosphorylase [Bradyrhizobium sp. ORS 285]
 emb|CCD83574.1| Polyribonucleotide nucleotidyltransferase (Polynucleotide phosphorylase) 
(PNPase) [Bradyrhizobium sp. ORS 285]
Length=718

 Score = 45.8 bits (107),  Expect(2) = 1e-08, Method: Composition-based stats.
 Identities = 24/44 (55%), Positives = 30/44 (68%), Gaps = 0/44 (0%)
 Frame = +2

Query  293  EFEIGSRKITLETGKIARFANGSVVLAMDETKVLSTVASAKGRR  424
            E + G R + LETGKIAR A+G+VV    ET VL+TV +AK  R
Sbjct  8    EIDWGGRPLKLETGKIARQADGAVVATYGETVVLATVVAAKAPR  51


 Score = 39.7 bits (91),  Expect(2) = 1e-08, Method: Composition-based stats.
 Identities = 16/23 (70%), Positives = 18/23 (78%), Gaps = 0/23 (0%)
 Frame = +3

Query  432  DFLPLTVDYQEKQFAQGLIPSTF  500
            DFLPLTVDYQEK +A G IP  +
Sbjct  55   DFLPLTVDYQEKAYAAGRIPGGY  77



>ref|WP_011463790.1| polynucleotide phosphorylase/polyadenylase [Rhodoferax ferrireducens]
 sp|Q21YD1.1|PNP_ALBFT RecName: Full=Polyribonucleotide nucleotidyltransferase; AltName: 
Full=Polynucleotide phosphorylase; Short=PNPase [Rhodoferax 
ferrireducens T118]
 gb|ABD69222.1| 3' exoribonuclease [Rhodoferax ferrireducens T118]
Length=706

 Score = 45.8 bits (107),  Expect(2) = 1e-08, Method: Compositional matrix adjust.
 Identities = 25/56 (45%), Positives = 36/56 (64%), Gaps = 1/56 (2%)
 Frame = +2

Query  272  ILESFTEEFEIGSRKITLETGKIARFANGSVVLAMDETKVLST-VASAKGRRSSRF  436
            I    T+ F+ G   +T+ETG+IAR A+G+V+L MD T VL+T VA  +G+    F
Sbjct  3    IFNKVTKTFQWGQNTVTMETGEIARQASGAVLLDMDGTVVLATVVAKTEGKAGQDF  58


 Score = 39.3 bits (90),  Expect(2) = 1e-08, Method: Composition-based stats.
 Identities = 17/28 (61%), Positives = 20/28 (71%), Gaps = 0/28 (0%)
 Frame = +3

Query  417  GDAVRDFLPLTVDYQEKQFAQGLIPSTF  500
            G A +DF PLTVDY EK +A G IP +F
Sbjct  52   GKAGQDFFPLTVDYLEKTYAAGKIPGSF  79



>ref|WP_031370859.1| polynucleotide phosphorylase/polyadenylase [Lysobacter antibioticus]
Length=702

 Score = 47.0 bits (110),  Expect(2) = 1e-08, Method: Composition-based stats.
 Identities = 21/53 (40%), Positives = 36/53 (68%), Gaps = 0/53 (0%)
 Frame = +2

Query  275  LESFTEEFEIGSRKITLETGKIARFANGSVVLAMDETKVLSTVASAKGRRSSR  433
            +   T+ F+ G+ ++TLETG+IAR A G+V++ M++T +L T  +AK  R  +
Sbjct  1    MAKITKTFQYGNHQVTLETGEIARQAGGAVIVKMEDTVLLVTAVAAKSAREGQ  53


 Score = 38.5 bits (88),  Expect(2) = 1e-08, Method: Composition-based stats.
 Identities = 16/24 (67%), Positives = 18/24 (75%), Gaps = 0/24 (0%)
 Frame = +3

Query  429  RDFLPLTVDYQEKQFAQGLIPSTF  500
            +DF PLTVDYQEK +A G IP  F
Sbjct  53   QDFFPLTVDYQEKFYAGGRIPGGF  76



>ref|WP_035704285.1| polynucleotide phosphorylase/polyadenylase [Bradyrhizobium sp. 
CCBAU 43298]
Length=720

 Score = 45.4 bits (106),  Expect(2) = 1e-08, Method: Composition-based stats.
 Identities = 24/44 (55%), Positives = 30/44 (68%), Gaps = 0/44 (0%)
 Frame = +2

Query  293  EFEIGSRKITLETGKIARFANGSVVLAMDETKVLSTVASAKGRR  424
            E + G R + LETGKIAR A+G+VV    ET VL+TV +AK  R
Sbjct  8    EIDWGGRPLKLETGKIARQADGAVVATYGETVVLATVVAAKAPR  51


 Score = 39.7 bits (91),  Expect(2) = 1e-08, Method: Composition-based stats.
 Identities = 16/23 (70%), Positives = 18/23 (78%), Gaps = 0/23 (0%)
 Frame = +3

Query  432  DFLPLTVDYQEKQFAQGLIPSTF  500
            DFLPLTVDYQEK +A G IP  +
Sbjct  55   DFLPLTVDYQEKTYAAGRIPGGY  77



>ref|WP_027563913.1| MULTISPECIES: polynucleotide phosphorylase/polyadenylase [Bradyrhizobium]
Length=720

 Score = 45.4 bits (106),  Expect(2) = 1e-08, Method: Composition-based stats.
 Identities = 24/44 (55%), Positives = 30/44 (68%), Gaps = 0/44 (0%)
 Frame = +2

Query  293  EFEIGSRKITLETGKIARFANGSVVLAMDETKVLSTVASAKGRR  424
            E + G R + LETGKIAR A+G+VV    ET VL+TV +AK  R
Sbjct  8    EIDWGGRPLKLETGKIARQADGAVVATYGETVVLATVVAAKAPR  51


 Score = 39.7 bits (91),  Expect(2) = 1e-08, Method: Composition-based stats.
 Identities = 16/23 (70%), Positives = 18/23 (78%), Gaps = 0/23 (0%)
 Frame = +3

Query  432  DFLPLTVDYQEKQFAQGLIPSTF  500
            DFLPLTVDYQEK +A G IP  +
Sbjct  55   DFLPLTVDYQEKTYAAGRIPGGY  77



>ref|WP_028155408.1| polynucleotide phosphorylase/polyadenylase [Bradyrhizobium japonicum]
Length=717

 Score = 45.4 bits (106),  Expect(2) = 1e-08, Method: Composition-based stats.
 Identities = 24/44 (55%), Positives = 30/44 (68%), Gaps = 0/44 (0%)
 Frame = +2

Query  293  EFEIGSRKITLETGKIARFANGSVVLAMDETKVLSTVASAKGRR  424
            E + G R + LETGKIAR A+G+VV    ET VL+TV +AK  R
Sbjct  8    EIDWGGRPLKLETGKIARQADGAVVATYGETVVLATVVAAKAPR  51


 Score = 39.7 bits (91),  Expect(2) = 1e-08, Method: Composition-based stats.
 Identities = 16/23 (70%), Positives = 18/23 (78%), Gaps = 0/23 (0%)
 Frame = +3

Query  432  DFLPLTVDYQEKQFAQGLIPSTF  500
            DFLPLTVDYQEK +A G IP  +
Sbjct  55   DFLPLTVDYQEKTYAAGRIPGGY  77



>ref|WP_014490963.1| polynucleotide phosphorylase [Bradyrhizobium japonicum]
 dbj|BAL06076.1| polyribonucleotide nucleotidyltransferase [Bradyrhizobium japonicum 
USDA 6]
 gb|AJA59644.1| polynucleotide phosphorylase/polyadenylase [Bradyrhizobium japonicum]
Length=717

 Score = 45.4 bits (106),  Expect(2) = 1e-08, Method: Composition-based stats.
 Identities = 24/44 (55%), Positives = 30/44 (68%), Gaps = 0/44 (0%)
 Frame = +2

Query  293  EFEIGSRKITLETGKIARFANGSVVLAMDETKVLSTVASAKGRR  424
            E + G R + LETGKIAR A+G+VV    ET VL+TV +AK  R
Sbjct  8    EIDWGGRPLKLETGKIARQADGAVVATYGETVVLATVVAAKAPR  51


 Score = 39.7 bits (91),  Expect(2) = 1e-08, Method: Composition-based stats.
 Identities = 16/23 (70%), Positives = 18/23 (78%), Gaps = 0/23 (0%)
 Frame = +3

Query  432  DFLPLTVDYQEKQFAQGLIPSTF  500
            DFLPLTVDYQEK +A G IP  +
Sbjct  55   DFLPLTVDYQEKTYAAGRIPGGY  77



>ref|WP_025032911.1| polynucleotide phosphorylase/polyadenylase [Bradyrhizobium sp. 
DOA9]
 dbj|GAJ31868.1| polyribonucleotide nucleotidyltransferase [Bradyrhizobium sp. 
DOA9]
Length=720

 Score = 45.8 bits (107),  Expect(2) = 1e-08, Method: Composition-based stats.
 Identities = 24/44 (55%), Positives = 30/44 (68%), Gaps = 0/44 (0%)
 Frame = +2

Query  293  EFEIGSRKITLETGKIARFANGSVVLAMDETKVLSTVASAKGRR  424
            E + G R + LETGKIAR A+G+VV    ET VL+TV +AK  R
Sbjct  8    EIDWGGRPLKLETGKIARQADGAVVATYGETVVLATVVAAKAPR  51


 Score = 39.7 bits (91),  Expect(2) = 1e-08, Method: Composition-based stats.
 Identities = 16/23 (70%), Positives = 18/23 (78%), Gaps = 0/23 (0%)
 Frame = +3

Query  432  DFLPLTVDYQEKQFAQGLIPSTF  500
            DFLPLTVDYQEK +A G IP  +
Sbjct  55   DFLPLTVDYQEKAYAAGRIPGGY  77



>ref|WP_041042005.1| polynucleotide phosphorylase/polyadenylase [Magnetospirillum 
magnetotacticum]
 gb|KIL97541.1| Polyribonucleotide nucleotidyltransferase [Magnetospirillum magnetotacticum 
MS-1]
Length=720

 Score = 46.6 bits (109),  Expect(2) = 1e-08, Method: Composition-based stats.
 Identities = 23/45 (51%), Positives = 31/45 (69%), Gaps = 0/45 (0%)
 Frame = +2

Query  290  EEFEIGSRKITLETGKIARFANGSVVLAMDETKVLSTVASAKGRR  424
            +E   G RK+ LETGKIAR A+G+V++   ET VL TV  AK ++
Sbjct  9    KEITWGGRKLVLETGKIARQADGAVLVTYGETSVLCTVVGAKSQK  53


 Score = 38.9 bits (89),  Expect(2) = 1e-08, Method: Composition-based stats.
 Identities = 16/23 (70%), Positives = 17/23 (74%), Gaps = 0/23 (0%)
 Frame = +3

Query  432  DFLPLTVDYQEKQFAQGLIPSTF  500
            DF PLTV+YQEK FA G IP  F
Sbjct  57   DFFPLTVNYQEKAFAAGKIPGGF  79



>ref|WP_028176494.1| polynucleotide phosphorylase/polyadenylase [Bradyrhizobium japonicum]
Length=720

 Score = 45.4 bits (106),  Expect(2) = 1e-08, Method: Composition-based stats.
 Identities = 24/44 (55%), Positives = 30/44 (68%), Gaps = 0/44 (0%)
 Frame = +2

Query  293  EFEIGSRKITLETGKIARFANGSVVLAMDETKVLSTVASAKGRR  424
            E + G R + LETGKIAR A+G+VV    ET VL+TV +AK  R
Sbjct  8    EIDWGGRPLKLETGKIARQADGAVVATYGETVVLATVVAAKAPR  51


 Score = 39.7 bits (91),  Expect(2) = 1e-08, Method: Composition-based stats.
 Identities = 16/23 (70%), Positives = 18/23 (78%), Gaps = 0/23 (0%)
 Frame = +3

Query  432  DFLPLTVDYQEKQFAQGLIPSTF  500
            DFLPLTVDYQEK +A G IP  +
Sbjct  55   DFLPLTVDYQEKTYAAGRIPGGY  77



>ref|WP_024338557.1| polynucleotide phosphorylase/polyadenylase [Bradyrhizobium japonicum]
Length=720

 Score = 45.4 bits (106),  Expect(2) = 1e-08, Method: Composition-based stats.
 Identities = 24/44 (55%), Positives = 30/44 (68%), Gaps = 0/44 (0%)
 Frame = +2

Query  293  EFEIGSRKITLETGKIARFANGSVVLAMDETKVLSTVASAKGRR  424
            E + G R + LETGKIAR A+G+VV    ET VL+TV +AK  R
Sbjct  8    EIDWGGRPLKLETGKIARQADGAVVATYGETVVLATVVAAKAPR  51


 Score = 39.7 bits (91),  Expect(2) = 1e-08, Method: Composition-based stats.
 Identities = 16/23 (70%), Positives = 18/23 (78%), Gaps = 0/23 (0%)
 Frame = +3

Query  432  DFLPLTVDYQEKQFAQGLIPSTF  500
            DFLPLTVDYQEK +A G IP  +
Sbjct  55   DFLPLTVDYQEKTYAAGRIPGGY  77



>ref|WP_041957166.1| polynucleotide phosphorylase/polyadenylase [Bradyrhizobium japonicum]
 gb|KGT77619.1| polynucleotide phosphorylase/polyadenylase [Bradyrhizobium japonicum]
Length=717

 Score = 45.4 bits (106),  Expect(2) = 1e-08, Method: Composition-based stats.
 Identities = 24/44 (55%), Positives = 30/44 (68%), Gaps = 0/44 (0%)
 Frame = +2

Query  293  EFEIGSRKITLETGKIARFANGSVVLAMDETKVLSTVASAKGRR  424
            E + G R + LETGKIAR A+G+VV    ET VL+TV +AK  R
Sbjct  8    EIDWGGRPLKLETGKIARQADGAVVATYGETVVLATVVAAKAPR  51


 Score = 39.7 bits (91),  Expect(2) = 1e-08, Method: Composition-based stats.
 Identities = 16/23 (70%), Positives = 18/23 (78%), Gaps = 0/23 (0%)
 Frame = +3

Query  432  DFLPLTVDYQEKQFAQGLIPSTF  500
            DFLPLTVDYQEK +A G IP  +
Sbjct  55   DFLPLTVDYQEKTYAAGRIPGGY  77



>ref|WP_039155106.1| polynucleotide phosphorylase/polyadenylase [Bradyrhizobium japonicum]
 gb|AHY55529.1| Polyribonucleotide nucleotidyltransferase [Bradyrhizobium japonicum 
SEMIA 5079]
Length=717

 Score = 45.4 bits (106),  Expect(2) = 1e-08, Method: Composition-based stats.
 Identities = 24/44 (55%), Positives = 30/44 (68%), Gaps = 0/44 (0%)
 Frame = +2

Query  293  EFEIGSRKITLETGKIARFANGSVVLAMDETKVLSTVASAKGRR  424
            E + G R + LETGKIAR A+G+VV    ET VL+TV +AK  R
Sbjct  8    EIDWGGRPLKLETGKIARQADGAVVATYGETVVLATVVAAKAPR  51


 Score = 39.7 bits (91),  Expect(2) = 1e-08, Method: Composition-based stats.
 Identities = 16/23 (70%), Positives = 18/23 (78%), Gaps = 0/23 (0%)
 Frame = +3

Query  432  DFLPLTVDYQEKQFAQGLIPSTF  500
            DFLPLTVDYQEK +A G IP  +
Sbjct  55   DFLPLTVDYQEKTYAAGRIPGGY  77



>ref|WP_035671358.1| polynucleotide phosphorylase/polyadenylase [Bradyrhizobium liaoningense]
Length=720

 Score = 45.4 bits (106),  Expect(2) = 1e-08, Method: Composition-based stats.
 Identities = 24/44 (55%), Positives = 30/44 (68%), Gaps = 0/44 (0%)
 Frame = +2

Query  293  EFEIGSRKITLETGKIARFANGSVVLAMDETKVLSTVASAKGRR  424
            E + G R + LETGKIAR A+G+VV    ET VL+TV +AK  R
Sbjct  8    EIDWGGRPLKLETGKIARQADGAVVATYGETVVLATVVAAKAPR  51


 Score = 39.7 bits (91),  Expect(2) = 1e-08, Method: Composition-based stats.
 Identities = 16/23 (70%), Positives = 18/23 (78%), Gaps = 0/23 (0%)
 Frame = +3

Query  432  DFLPLTVDYQEKQFAQGLIPSTF  500
            DFLPLTVDYQEK +A G IP  +
Sbjct  55   DFLPLTVDYQEKTYAAGRIPGGY  77



>ref|WP_027531557.1| polynucleotide phosphorylase/polyadenylase [Bradyrhizobium sp. 
WSM3983]
Length=718

 Score = 45.4 bits (106),  Expect(2) = 1e-08, Method: Composition-based stats.
 Identities = 24/44 (55%), Positives = 30/44 (68%), Gaps = 0/44 (0%)
 Frame = +2

Query  293  EFEIGSRKITLETGKIARFANGSVVLAMDETKVLSTVASAKGRR  424
            E + G R + LETGKIAR A+G+VV    ET VL+TV +AK  R
Sbjct  8    EIDWGGRPLKLETGKIARQADGAVVATYGETVVLATVVAAKAPR  51


 Score = 39.7 bits (91),  Expect(2) = 1e-08, Method: Composition-based stats.
 Identities = 16/23 (70%), Positives = 18/23 (78%), Gaps = 0/23 (0%)
 Frame = +3

Query  432  DFLPLTVDYQEKQFAQGLIPSTF  500
            DFLPLTVDYQEK +A G IP  +
Sbjct  55   DFLPLTVDYQEKTYAAGRIPGGY  77



>ref|WP_008131784.1| polynucleotide phosphorylase [Bradyrhizobium sp. YR681]
 gb|EJN14978.1| polyribonucleotide nucleotidyltransferase [Bradyrhizobium sp. 
YR681]
Length=718

 Score = 45.4 bits (106),  Expect(2) = 1e-08, Method: Composition-based stats.
 Identities = 24/44 (55%), Positives = 30/44 (68%), Gaps = 0/44 (0%)
 Frame = +2

Query  293  EFEIGSRKITLETGKIARFANGSVVLAMDETKVLSTVASAKGRR  424
            E + G R + LETGKIAR A+G+VV    ET VL+TV +AK  R
Sbjct  8    EIDWGGRPLKLETGKIARQADGAVVATYGETVVLATVVAAKSPR  51


 Score = 39.7 bits (91),  Expect(2) = 1e-08, Method: Composition-based stats.
 Identities = 16/23 (70%), Positives = 18/23 (78%), Gaps = 0/23 (0%)
 Frame = +3

Query  432  DFLPLTVDYQEKQFAQGLIPSTF  500
            DFLPLTVDYQEK +A G IP  +
Sbjct  55   DFLPLTVDYQEKTYAAGRIPGGY  77



>ref|WP_003467386.1| polynucleotide phosphorylase/polyadenylase [Xanthomonas translucens]
 emb|CCP39118.1| polyribonucleotide nucleotidyltransferase [Xanthomonas translucens 
pv. translucens DSM 18974]
 gb|ELQ13751.1| polynucleotide phosphorylase/polyadenylase [Xanthomonas translucens 
DAR61454]
Length=702

 Score = 47.0 bits (110),  Expect(2) = 1e-08, Method: Compositional matrix adjust.
 Identities = 22/53 (42%), Positives = 34/53 (64%), Gaps = 0/53 (0%)
 Frame = +2

Query  275  LESFTEEFEIGSRKITLETGKIARFANGSVVLAMDETKVLSTVASAKGRRSSR  433
            +   T+ F+ G   +TLETG+IAR A G+V++ MD+T +L T  +AK  R  +
Sbjct  1    MAKITKTFQYGKHTVTLETGEIARQAGGAVIVKMDDTVLLVTAVAAKSAREGQ  53


 Score = 38.5 bits (88),  Expect(2) = 1e-08, Method: Composition-based stats.
 Identities = 16/24 (67%), Positives = 18/24 (75%), Gaps = 0/24 (0%)
 Frame = +3

Query  429  RDFLPLTVDYQEKQFAQGLIPSTF  500
            +DF PLTVDYQEK +A G IP  F
Sbjct  53   QDFFPLTVDYQEKFYAGGRIPGGF  76



>gb|AGB69538.1| polyribonucleotide nucleotidyltransferase [Rhizobium tropici 
CIAT 899]
Length=732

 Score = 48.9 bits (115),  Expect(2) = 1e-08, Method: Composition-based stats.
 Identities = 27/54 (50%), Positives = 33/54 (61%), Gaps = 0/54 (0%)
 Frame = +2

Query  257  MAGTKILESFTEEFEIGSRKITLETGKIARFANGSVVLAMDETKVLSTVASAKG  418
            M G  + +  T E E   R + LETGKIAR A+G+VV    ET VL+TV SAK 
Sbjct  16   MQGQDMFDIHTVEIEWAGRPLKLETGKIARQADGAVVATYGETVVLATVVSAKA  69


 Score = 36.2 bits (82),  Expect(2) = 1e-08, Method: Composition-based stats.
 Identities = 14/24 (58%), Positives = 18/24 (75%), Gaps = 0/24 (0%)
 Frame = +3

Query  429  RDFLPLTVDYQEKQFAQGLIPSTF  500
            +DF PLTV+YQEK +A G IP  +
Sbjct  74   QDFFPLTVNYQEKTYAAGKIPGGY  97



>ref|WP_038359465.1| polynucleotide phosphorylase/polyadenylase [Bosea sp. UNC402CLCol]
Length=723

 Score = 48.1 bits (113),  Expect(2) = 1e-08, Method: Composition-based stats.
 Identities = 25/43 (58%), Positives = 31/43 (72%), Gaps = 0/43 (0%)
 Frame = +2

Query  287  TEEFEIGSRKITLETGKIARFANGSVVLAMDETKVLSTVASAK  415
            TEE   G RK+ LETGK+AR A+G+V+    ET VL+TV SAK
Sbjct  6    TEELIWGGRKLVLETGKVARQADGAVMATYGETVVLATVVSAK  48


 Score = 37.4 bits (85),  Expect(2) = 1e-08, Method: Composition-based stats.
 Identities = 15/23 (65%), Positives = 17/23 (74%), Gaps = 0/23 (0%)
 Frame = +3

Query  432  DFLPLTVDYQEKQFAQGLIPSTF  500
            DF PLTV+YQEK FA G IP  +
Sbjct  55   DFFPLTVNYQEKTFAAGRIPGGY  77



>ref|WP_018455795.1| polynucleotide phosphorylase [Bradyrhizobium sp. WSM4349]
Length=717

 Score = 45.4 bits (106),  Expect(2) = 1e-08, Method: Composition-based stats.
 Identities = 24/44 (55%), Positives = 30/44 (68%), Gaps = 0/44 (0%)
 Frame = +2

Query  293  EFEIGSRKITLETGKIARFANGSVVLAMDETKVLSTVASAKGRR  424
            E + G R + LETGKIAR A+G+VV    ET VL+TV +AK  R
Sbjct  8    EIDWGGRPLKLETGKIARQADGAVVATYGETVVLATVVAAKSPR  51


 Score = 39.7 bits (91),  Expect(2) = 1e-08, Method: Composition-based stats.
 Identities = 16/23 (70%), Positives = 18/23 (78%), Gaps = 0/23 (0%)
 Frame = +3

Query  432  DFLPLTVDYQEKQFAQGLIPSTF  500
            DFLPLTVDYQEK +A G IP  +
Sbjct  55   DFLPLTVDYQEKTYAAGRIPGGY  77



>ref|WP_007598347.1| MULTISPECIES: polynucleotide phosphorylase [Bradyrhizobium]
 gb|EIG60109.1| polyribonucleotide nucleotidyltransferase [Bradyrhizobium sp. 
WSM1253]
Length=717

 Score = 45.4 bits (106),  Expect(2) = 1e-08, Method: Composition-based stats.
 Identities = 24/44 (55%), Positives = 30/44 (68%), Gaps = 0/44 (0%)
 Frame = +2

Query  293  EFEIGSRKITLETGKIARFANGSVVLAMDETKVLSTVASAKGRR  424
            E + G R + LETGKIAR A+G+VV    ET VL+TV +AK  R
Sbjct  8    EIDWGGRPLKLETGKIARQADGAVVATYGETVVLATVVAAKSPR  51


 Score = 39.7 bits (91),  Expect(2) = 1e-08, Method: Composition-based stats.
 Identities = 16/23 (70%), Positives = 18/23 (78%), Gaps = 0/23 (0%)
 Frame = +3

Query  432  DFLPLTVDYQEKQFAQGLIPSTF  500
            DFLPLTVDYQEK +A G IP  +
Sbjct  55   DFLPLTVDYQEKTYAAGRIPGGY  77



>gb|ERP97305.1| polynucleotide phosphorylase [Labrenzia sp. C1B10]
 gb|ERS09014.1| polynucleotide phosphorylase [Labrenzia sp. C1B70]
Length=710

 Score = 47.4 bits (111),  Expect(2) = 1e-08, Method: Compositional matrix adjust.
 Identities = 24/41 (59%), Positives = 30/41 (73%), Gaps = 0/41 (0%)
 Frame = +2

Query  293  EFEIGSRKITLETGKIARFANGSVVLAMDETKVLSTVASAK  415
            E E G R + LETGK+AR A+G+V+    ETKVL+TV SAK
Sbjct  9    EVEWGGRPLVLETGKVARQADGAVMATYGETKVLATVVSAK  49


 Score = 37.7 bits (86),  Expect(2) = 1e-08, Method: Composition-based stats.
 Identities = 15/24 (63%), Positives = 18/24 (75%), Gaps = 0/24 (0%)
 Frame = +3

Query  429  RDFLPLTVDYQEKQFAQGLIPSTF  500
            +DF PLTV+YQEK FA G IP  +
Sbjct  55   QDFFPLTVNYQEKAFAAGKIPGGY  78



>ref|WP_031268705.1| MULTISPECIES: polynucleotide phosphorylase/polyadenylase [Labrenzia]
Length=709

 Score = 47.4 bits (111),  Expect(2) = 1e-08, Method: Compositional matrix adjust.
 Identities = 24/41 (59%), Positives = 30/41 (73%), Gaps = 0/41 (0%)
 Frame = +2

Query  293  EFEIGSRKITLETGKIARFANGSVVLAMDETKVLSTVASAK  415
            E E G R + LETGK+AR A+G+V+    ETKVL+TV SAK
Sbjct  8    EVEWGGRPLVLETGKVARQADGAVMATYGETKVLATVVSAK  48


 Score = 37.7 bits (86),  Expect(2) = 1e-08, Method: Composition-based stats.
 Identities = 15/24 (63%), Positives = 18/24 (75%), Gaps = 0/24 (0%)
 Frame = +3

Query  429  RDFLPLTVDYQEKQFAQGLIPSTF  500
            +DF PLTV+YQEK FA G IP  +
Sbjct  54   QDFFPLTVNYQEKAFAAGKIPGGY  77



>ref|WP_031799034.1| polynucleotide phosphorylase/polyadenylase, partial [Pseudomonas 
aeruginosa]
 gb|KAJ27447.1| polynucleotide phosphorylase/polyadenylase, partial [Pseudomonas 
aeruginosa M10]
Length=653

 Score = 47.8 bits (112),  Expect(2) = 1e-08, Method: Compositional matrix adjust.
 Identities = 22/47 (47%), Positives = 32/47 (68%), Gaps = 0/47 (0%)
 Frame = +2

Query  275  LESFTEEFEIGSRKITLETGKIARFANGSVVLAMDETKVLSTVASAK  415
            +   T++F+ G   +TLETG+IAR A G+V++ MD+  VL TV  AK
Sbjct  1    MNPVTKQFQFGQSTVTLETGRIARQATGAVLVTMDDVSVLVTVVGAK  47


 Score = 37.4 bits (85),  Expect(2) = 1e-08, Method: Composition-based stats.
 Identities = 15/24 (63%), Positives = 17/24 (71%), Gaps = 0/24 (0%)
 Frame = +3

Query  429  RDFLPLTVDYQEKQFAQGLIPSTF  500
            RDF PL+V YQEK +A G IP  F
Sbjct  53   RDFFPLSVHYQEKTYAAGRIPGGF  76



>ref|WP_014438696.1| polynucleotide phosphorylase [Bradyrhizobium sp. S23321]
 dbj|BAL73278.1| polyribonucleotide nucleotidyltransferase [Bradyrhizobium sp. 
S23321]
Length=718

 Score = 45.4 bits (106),  Expect(2) = 1e-08, Method: Composition-based stats.
 Identities = 24/44 (55%), Positives = 30/44 (68%), Gaps = 0/44 (0%)
 Frame = +2

Query  293  EFEIGSRKITLETGKIARFANGSVVLAMDETKVLSTVASAKGRR  424
            E + G R + LETGKIAR A+G+VV    ET VL+TV +AK  R
Sbjct  8    EIDWGGRPLKLETGKIARQADGAVVATYGETVVLATVVAAKSPR  51


 Score = 39.7 bits (91),  Expect(2) = 1e-08, Method: Composition-based stats.
 Identities = 16/23 (70%), Positives = 18/23 (78%), Gaps = 0/23 (0%)
 Frame = +3

Query  432  DFLPLTVDYQEKQFAQGLIPSTF  500
            DFLPLTVDYQEK +A G IP  +
Sbjct  55   DFLPLTVDYQEKTYAAGRIPGGY  77



>ref|WP_009150566.1| polynucleotide phosphorylase/polyadenylase [Thiorhodovibrio sp. 
970]
 gb|EIC20163.1| polyribonucleotide nucleotidyltransferase [Thiorhodovibrio sp. 
970]
Length=702

 Score = 43.1 bits (100),  Expect(2) = 1e-08, Method: Composition-based stats.
 Identities = 21/47 (45%), Positives = 33/47 (70%), Gaps = 0/47 (0%)
 Frame = +2

Query  275  LESFTEEFEIGSRKITLETGKIARFANGSVVLAMDETKVLSTVASAK  415
            +   T+ F+ G + +TLETG+IAR A+G+V++ M++T VL TV   K
Sbjct  1    MTHITKTFQYGDQTVTLETGEIARQADGAVMVNMNDTVVLVTVVIDK  47


 Score = 42.0 bits (97),  Expect(2) = 1e-08, Method: Composition-based stats.
 Identities = 18/30 (60%), Positives = 21/30 (70%), Gaps = 0/30 (0%)
 Frame = +3

Query  411  QRGDAVRDFLPLTVDYQEKQFAQGLIPSTF  500
            +R    +DFLPLTVDYQEK +A G IP  F
Sbjct  47   KRATVEKDFLPLTVDYQEKTYAAGRIPGGF  76



>ref|WP_007603907.1| polynucleotide phosphorylase [Bradyrhizobium sp. WSM471]
 gb|EHQ99568.1| polyribonucleotide nucleotidyltransferase [Bradyrhizobium sp. 
WSM471]
Length=717

 Score = 45.4 bits (106),  Expect(2) = 1e-08, Method: Composition-based stats.
 Identities = 24/44 (55%), Positives = 30/44 (68%), Gaps = 0/44 (0%)
 Frame = +2

Query  293  EFEIGSRKITLETGKIARFANGSVVLAMDETKVLSTVASAKGRR  424
            E + G R + LETGKIAR A+G+VV    ET VL+TV +AK  R
Sbjct  8    EIDWGGRPLKLETGKIARQADGAVVATYGETVVLATVVAAKSPR  51


 Score = 39.7 bits (91),  Expect(2) = 1e-08, Method: Composition-based stats.
 Identities = 16/23 (70%), Positives = 18/23 (78%), Gaps = 0/23 (0%)
 Frame = +3

Query  432  DFLPLTVDYQEKQFAQGLIPSTF  500
            DFLPLTVDYQEK +A G IP  +
Sbjct  55   DFLPLTVDYQEKTYAAGRIPGGY  77



>ref|WP_028335503.1| polynucleotide phosphorylase/polyadenylase [Bradyrhizobium elkanii]
Length=720

 Score = 45.4 bits (106),  Expect(2) = 1e-08, Method: Composition-based stats.
 Identities = 24/51 (47%), Positives = 33/51 (65%), Gaps = 0/51 (0%)
 Frame = +2

Query  272  ILESFTEEFEIGSRKITLETGKIARFANGSVVLAMDETKVLSTVASAKGRR  424
            +  S + E + G R + LETGKIAR A+G+V+    ET VL+TV +AK  R
Sbjct  1    MFNSHSVEIDWGGRPLKLETGKIARQADGAVMATYGETVVLATVVAAKAPR  51


 Score = 39.7 bits (91),  Expect(2) = 1e-08, Method: Composition-based stats.
 Identities = 16/23 (70%), Positives = 18/23 (78%), Gaps = 0/23 (0%)
 Frame = +3

Query  432  DFLPLTVDYQEKQFAQGLIPSTF  500
            DFLPLTVDYQEK +A G IP  +
Sbjct  55   DFLPLTVDYQEKTYAAGRIPGGY  77



>ref|WP_011313367.1| polynucleotide phosphorylase [Nitrobacter winogradskyi]
 sp|Q3SWP5.1|PNP_NITWN RecName: Full=Polyribonucleotide nucleotidyltransferase; AltName: 
Full=Polynucleotide phosphorylase; Short=PNPase [Nitrobacter 
winogradskyi Nb-255]
 gb|ABA03296.1| 3'exoribonuclease [Nitrobacter winogradskyi Nb-255]
Length=718

 Score = 45.4 bits (106),  Expect(2) = 1e-08, Method: Composition-based stats.
 Identities = 24/44 (55%), Positives = 30/44 (68%), Gaps = 0/44 (0%)
 Frame = +2

Query  293  EFEIGSRKITLETGKIARFANGSVVLAMDETKVLSTVASAKGRR  424
            E + G R + LETGKIAR A+G+VV    ET VL+TV +AK  R
Sbjct  8    EIDWGGRPLKLETGKIARQADGAVVATYGETVVLATVVAAKSPR  51


 Score = 39.7 bits (91),  Expect(2) = 1e-08, Method: Composition-based stats.
 Identities = 16/23 (70%), Positives = 18/23 (78%), Gaps = 0/23 (0%)
 Frame = +3

Query  432  DFLPLTVDYQEKQFAQGLIPSTF  500
            DFLPLTVDYQEK +A G IP  +
Sbjct  55   DFLPLTVDYQEKTYAAGRIPGGY  77



>ref|WP_027278731.1| polynucleotide phosphorylase/polyadenylase [Rhodopseudomonas 
palustris]
Length=721

 Score = 45.4 bits (106),  Expect(2) = 2e-08, Method: Composition-based stats.
 Identities = 24/44 (55%), Positives = 30/44 (68%), Gaps = 0/44 (0%)
 Frame = +2

Query  293  EFEIGSRKITLETGKIARFANGSVVLAMDETKVLSTVASAKGRR  424
            E + G R + LETGKIAR A+G+VV    ET VL+TV +AK  R
Sbjct  8    EIDWGGRPLKLETGKIARQADGAVVATYGETVVLATVVAAKDAR  51


 Score = 39.7 bits (91),  Expect(2) = 2e-08, Method: Composition-based stats.
 Identities = 16/23 (70%), Positives = 18/23 (78%), Gaps = 0/23 (0%)
 Frame = +3

Query  432  DFLPLTVDYQEKQFAQGLIPSTF  500
            DFLPLTVDYQEK +A G IP  +
Sbjct  55   DFLPLTVDYQEKAYAAGRIPGGY  77



>ref|WP_011737843.1| polynucleotide phosphorylase/polyadenylase [Candidatus Ruthia 
magnifica]
 sp|A1AWB1.1|PNP_RUTMC RecName: Full=Polyribonucleotide nucleotidyltransferase; AltName: 
Full=Polynucleotide phosphorylase; Short=PNPase [Candidatus 
Ruthia magnifica str. Cm (Calyptogena magnifica)]
 gb|ABL02218.1| Polyribonucleotide nucleotidyltransferase [Candidatus Ruthia 
magnifica str. Cm (Calyptogena magnifica)]
Length=695

 Score = 50.1 bits (118),  Expect(2) = 2e-08, Method: Composition-based stats.
 Identities = 23/43 (53%), Positives = 34/43 (79%), Gaps = 0/43 (0%)
 Frame = +2

Query  287  TEEFEIGSRKITLETGKIARFANGSVVLAMDETKVLSTVASAK  415
            T+ F +G   ITLETG+IAR A+G+V+++MD+T+VL TV  +K
Sbjct  5    TKSFVMGKHTITLETGRIARQAHGAVLVSMDDTQVLVTVVGSK  47


 Score = 35.0 bits (79),  Expect(2) = 2e-08, Method: Composition-based stats.
 Identities = 14/24 (58%), Positives = 17/24 (71%), Gaps = 0/24 (0%)
 Frame = +3

Query  429  RDFLPLTVDYQEKQFAQGLIPSTF  500
            +DF PL+VDY EK +A G IP  F
Sbjct  53   QDFFPLSVDYIEKTYAAGKIPGGF  76



>gb|KJC44664.1| polynucleotide phosphorylase/polyadenylase [Bradyrhizobium sp. 
LTSP857]
Length=718

 Score = 45.4 bits (106),  Expect(2) = 2e-08, Method: Composition-based stats.
 Identities = 24/44 (55%), Positives = 30/44 (68%), Gaps = 0/44 (0%)
 Frame = +2

Query  293  EFEIGSRKITLETGKIARFANGSVVLAMDETKVLSTVASAKGRR  424
            E + G R + LETGKIAR A+G+VV    ET VL+TV +AK  R
Sbjct  8    EIDWGGRPLKLETGKIARQADGAVVATYGETVVLATVVAAKSPR  51


 Score = 39.7 bits (91),  Expect(2) = 2e-08, Method: Composition-based stats.
 Identities = 16/23 (70%), Positives = 18/23 (78%), Gaps = 0/23 (0%)
 Frame = +3

Query  432  DFLPLTVDYQEKQFAQGLIPSTF  500
            DFLPLTVDYQEK +A G IP  +
Sbjct  55   DFLPLTVDYQEKTYAAGRIPGGY  77



>ref|WP_002810193.1| polynucleotide phosphorylase/polyadenylase [Xanthomonas fragariae]
 gb|ENZ94893.1| polynucleotide phosphorylase/polyadenylase [Xanthomonas fragariae 
LMG 25863]
Length=704

 Score = 46.6 bits (109),  Expect(2) = 2e-08, Method: Composition-based stats.
 Identities = 21/53 (40%), Positives = 35/53 (66%), Gaps = 0/53 (0%)
 Frame = +2

Query  275  LESFTEEFEIGSRKITLETGKIARFANGSVVLAMDETKVLSTVASAKGRRSSR  433
            +   T+ F+ G   +TLETG++AR A+G+V++ MD+T +L T  +AK  R  +
Sbjct  1    MAKITKTFQYGKHTVTLETGEVARQASGAVIVKMDDTVLLVTAVAAKTAREGQ  53


 Score = 38.5 bits (88),  Expect(2) = 2e-08, Method: Composition-based stats.
 Identities = 16/24 (67%), Positives = 18/24 (75%), Gaps = 0/24 (0%)
 Frame = +3

Query  429  RDFLPLTVDYQEKQFAQGLIPSTF  500
            +DF PLTVDYQEK +A G IP  F
Sbjct  53   QDFFPLTVDYQEKFYAGGRIPGGF  76



>ref|WP_008960850.1| polynucleotide phosphorylase [Bradyrhizobium sp. STM 3809]
 emb|CCD98241.1| Polyribonucleotide nucleotidyltransferase (Polynucleotide phosphorylase) 
(PNPase) [Bradyrhizobium sp. STM 3809]
Length=719

 Score = 45.4 bits (106),  Expect(2) = 2e-08, Method: Composition-based stats.
 Identities = 24/44 (55%), Positives = 30/44 (68%), Gaps = 0/44 (0%)
 Frame = +2

Query  293  EFEIGSRKITLETGKIARFANGSVVLAMDETKVLSTVASAKGRR  424
            E + G R + LETGKIAR A+G+VV    ET VL+TV +AK  R
Sbjct  8    EIDWGGRPLKLETGKIARQADGAVVATYGETVVLATVVAAKSPR  51


 Score = 39.7 bits (91),  Expect(2) = 2e-08, Method: Composition-based stats.
 Identities = 16/23 (70%), Positives = 18/23 (78%), Gaps = 0/23 (0%)
 Frame = +3

Query  432  DFLPLTVDYQEKQFAQGLIPSTF  500
            DFLPLTVDYQEK +A G IP  +
Sbjct  55   DFLPLTVDYQEKAYAAGRIPGGY  77



>ref|WP_014102652.1| polynucleotide phosphorylase [Micavibrio aeruginosavorus]
 gb|AEP09429.1| S1 RNA binding domain protein [Micavibrio aeruginosavorus ARL-13]
Length=715

 Score = 49.7 bits (117),  Expect(2) = 2e-08, Method: Compositional matrix adjust.
 Identities = 24/50 (48%), Positives = 34/50 (68%), Gaps = 0/50 (0%)
 Frame = +2

Query  284  FTEEFEIGSRKITLETGKIARFANGSVVLAMDETKVLSTVASAKGRRSSR  433
            + +EFE+G +K+ LETGKIAR A+G+V+  M  T VL TV  A+  R  +
Sbjct  5    YRKEFELGGKKVVLETGKIARQADGAVMATMGGTTVLCTVVGARSLREGQ  54


 Score = 35.4 bits (80),  Expect(2) = 2e-08, Method: Composition-based stats.
 Identities = 14/24 (58%), Positives = 17/24 (71%), Gaps = 0/24 (0%)
 Frame = +3

Query  429  RDFLPLTVDYQEKQFAQGLIPSTF  500
            +DF PL+V YQEK +A G IP  F
Sbjct  54   QDFFPLSVHYQEKAYAAGKIPGGF  77



>ref|WP_015467428.1| Polyribonucleotide nucleotidyltransferase [Micavibrio aeruginosavorus]
 gb|AGH97885.1| Polyribonucleotide nucleotidyltransferase [Micavibrio aeruginosavorus 
EPB]
Length=715

 Score = 49.7 bits (117),  Expect(2) = 2e-08, Method: Compositional matrix adjust.
 Identities = 24/50 (48%), Positives = 34/50 (68%), Gaps = 0/50 (0%)
 Frame = +2

Query  284  FTEEFEIGSRKITLETGKIARFANGSVVLAMDETKVLSTVASAKGRRSSR  433
            + +EFE+G +K+ LETGKIAR A+G+V+  M  T VL TV  A+  R  +
Sbjct  5    YRKEFELGGKKVVLETGKIARQADGAVMATMGGTTVLCTVVGARSLREGQ  54


 Score = 35.4 bits (80),  Expect(2) = 2e-08, Method: Composition-based stats.
 Identities = 14/24 (58%), Positives = 17/24 (71%), Gaps = 0/24 (0%)
 Frame = +3

Query  429  RDFLPLTVDYQEKQFAQGLIPSTF  500
            +DF PL+V YQEK +A G IP  F
Sbjct  54   QDFFPLSVHYQEKAYAAGKIPGGF  77



>ref|WP_011942587.1| polynucleotide phosphorylase [Bradyrhizobium sp. BTAi1]
 sp|A5E870.1|PNP_BRASB RecName: Full=Polyribonucleotide nucleotidyltransferase; AltName: 
Full=Polynucleotide phosphorylase; Short=PNPase [Bradyrhizobium 
sp. BTAi1]
 gb|ABQ32364.1| Polyribonucleotide nucleotidyltransferase [Bradyrhizobium sp. 
BTAi1]
Length=720

 Score = 45.4 bits (106),  Expect(2) = 2e-08, Method: Composition-based stats.
 Identities = 24/44 (55%), Positives = 30/44 (68%), Gaps = 0/44 (0%)
 Frame = +2

Query  293  EFEIGSRKITLETGKIARFANGSVVLAMDETKVLSTVASAKGRR  424
            E + G R + LETGKIAR A+G+VV    ET VL+TV +AK  R
Sbjct  8    EIDWGGRPLKLETGKIARQADGAVVATYGETVVLATVVAAKSPR  51


 Score = 39.7 bits (91),  Expect(2) = 2e-08, Method: Composition-based stats.
 Identities = 16/23 (70%), Positives = 18/23 (78%), Gaps = 0/23 (0%)
 Frame = +3

Query  432  DFLPLTVDYQEKQFAQGLIPSTF  500
            DFLPLTVDYQEK +A G IP  +
Sbjct  55   DFLPLTVDYQEKAYAAGRIPGGY  77



>gb|EAQ37165.1| polyribonucleotide nucleotidyltransferase [Nitrobacter sp. Nb-311A]
Length=723

 Score = 45.4 bits (106),  Expect(2) = 2e-08, Method: Composition-based stats.
 Identities = 24/56 (43%), Positives = 34/56 (61%), Gaps = 0/56 (0%)
 Frame = +2

Query  257  MAGTKILESFTEEFEIGSRKITLETGKIARFANGSVVLAMDETKVLSTVASAKGRR  424
            M    +    + E + G R + LETGKIAR A+G+V+ +  ET VL+TV +AK  R
Sbjct  1    MKDITMFHKHSVEIDWGGRPLKLETGKIARQADGAVIASYGETVVLATVVAAKTPR  56


 Score = 39.7 bits (91),  Expect(2) = 2e-08, Method: Composition-based stats.
 Identities = 16/23 (70%), Positives = 18/23 (78%), Gaps = 0/23 (0%)
 Frame = +3

Query  432  DFLPLTVDYQEKQFAQGLIPSTF  500
            DFLPLTVDYQEK +A G IP  +
Sbjct  60   DFLPLTVDYQEKTYAAGRIPGGY  82



>ref|WP_011484169.1| polynucleotide phosphorylase/polyadenylase [Polaromonas sp. JS666]
 sp|Q127W8.1|PNP_POLSJ RecName: Full=Polyribonucleotide nucleotidyltransferase; AltName: 
Full=Polynucleotide phosphorylase; Short=PNPase [Polaromonas 
sp. JS666]
 gb|ABE45174.1| Polyribonucleotide nucleotidyltransferase [Polaromonas sp. JS666]
Length=707

 Score = 47.4 bits (111),  Expect(2) = 2e-08, Method: Composition-based stats.
 Identities = 22/46 (48%), Positives = 33/46 (72%), Gaps = 0/46 (0%)
 Frame = +2

Query  272  ILESFTEEFEIGSRKITLETGKIARFANGSVVLAMDETKVLSTVAS  409
            I    T+ F+ G  K+T+ETG++AR A+G+VV+ MD T VL+TV +
Sbjct  3    IFNKVTKSFQWGQHKVTMETGEVARQASGAVVVDMDGTVVLATVVA  48


 Score = 37.7 bits (86),  Expect(2) = 2e-08, Method: Composition-based stats.
 Identities = 15/24 (63%), Positives = 18/24 (75%), Gaps = 0/24 (0%)
 Frame = +3

Query  429  RDFLPLTVDYQEKQFAQGLIPSTF  500
            +DF PLTVDY EK +A G IP +F
Sbjct  56   QDFFPLTVDYLEKTYAAGRIPGSF  79



>ref|WP_015663226.1| polyribonucleotide nucleotidyltransferase [Bradyrhizobium oligotrophicum]
 dbj|BAM86083.1| polyribonucleotide nucleotidyltransferase [Bradyrhizobium oligotrophicum 
S58]
Length=719

 Score = 45.4 bits (106),  Expect(2) = 2e-08, Method: Composition-based stats.
 Identities = 24/44 (55%), Positives = 30/44 (68%), Gaps = 0/44 (0%)
 Frame = +2

Query  293  EFEIGSRKITLETGKIARFANGSVVLAMDETKVLSTVASAKGRR  424
            E + G R + LETGKIAR A+G+VV    ET VL+TV +AK  R
Sbjct  8    EIDWGGRPLKLETGKIARQADGAVVATYGETVVLATVVAAKSPR  51


 Score = 39.7 bits (91),  Expect(2) = 2e-08, Method: Composition-based stats.
 Identities = 16/23 (70%), Positives = 18/23 (78%), Gaps = 0/23 (0%)
 Frame = +3

Query  432  DFLPLTVDYQEKQFAQGLIPSTF  500
            DFLPLTVDYQEK +A G IP  +
Sbjct  55   DFLPLTVDYQEKTYAAGRIPGGY  77



>ref|WP_019682251.1| polynucleotide phosphorylase/polyadenylase, partial [Pseudomonas 
aeruginosa]
Length=554

 Score = 48.1 bits (113),  Expect(2) = 2e-08, Method: Compositional matrix adjust.
 Identities = 23/53 (43%), Positives = 33/53 (62%), Gaps = 0/53 (0%)
 Frame = +2

Query  275  LESFTEEFEIGSRKITLETGKIARFANGSVVLAMDETKVLSTVASAKGRRSSR  433
            +   T++F+ G   +TLETG+IAR A G+V++ MD+  VL TV  AK     R
Sbjct  1    MNPVTKQFQFGQSTVTLETGRIARQATGAVLVTMDDVSVLVTVVGAKSPAEGR  53


 Score = 37.0 bits (84),  Expect(2) = 2e-08, Method: Composition-based stats.
 Identities = 15/24 (63%), Positives = 17/24 (71%), Gaps = 0/24 (0%)
 Frame = +3

Query  429  RDFLPLTVDYQEKQFAQGLIPSTF  500
            RDF PL+V YQEK +A G IP  F
Sbjct  53   RDFFPLSVHYQEKTYAAGRIPGGF  76



>ref|WP_029082441.1| polynucleotide phosphorylase/polyadenylase [Bradyrhizobium sp. 
th.b2]
Length=718

 Score = 45.4 bits (106),  Expect(2) = 2e-08, Method: Composition-based stats.
 Identities = 24/51 (47%), Positives = 33/51 (65%), Gaps = 0/51 (0%)
 Frame = +2

Query  272  ILESFTEEFEIGSRKITLETGKIARFANGSVVLAMDETKVLSTVASAKGRR  424
            +  S + E + G R + LETGKIAR A+G+V+    ET VL+TV +AK  R
Sbjct  1    MFNSHSVEIDWGGRPLKLETGKIARQADGAVLATYGETVVLATVVAAKSPR  51


 Score = 39.7 bits (91),  Expect(2) = 2e-08, Method: Composition-based stats.
 Identities = 16/23 (70%), Positives = 18/23 (78%), Gaps = 0/23 (0%)
 Frame = +3

Query  432  DFLPLTVDYQEKQFAQGLIPSTF  500
            DFLPLTVDYQEK +A G IP  +
Sbjct  55   DFLPLTVDYQEKTYAAGRIPGGY  77



>ref|WP_024515116.1| polynucleotide phosphorylase/polyadenylase [Bradyrhizobium sp. 
Tv2a-2]
Length=724

 Score = 45.4 bits (106),  Expect(2) = 2e-08, Method: Composition-based stats.
 Identities = 23/44 (52%), Positives = 31/44 (70%), Gaps = 0/44 (0%)
 Frame = +2

Query  293  EFEIGSRKITLETGKIARFANGSVVLAMDETKVLSTVASAKGRR  424
            E + G R + LETGK+AR ANG+V+ +  ET VL+TV +AK  R
Sbjct  8    EIDWGGRPLKLETGKVARQANGAVLASYGETVVLATVVAAKTPR  51


 Score = 39.7 bits (91),  Expect(2) = 2e-08, Method: Composition-based stats.
 Identities = 16/23 (70%), Positives = 18/23 (78%), Gaps = 0/23 (0%)
 Frame = +3

Query  432  DFLPLTVDYQEKQFAQGLIPSTF  500
            DFLPLTVDYQEK +A G IP  +
Sbjct  55   DFLPLTVDYQEKAYAAGRIPGGY  77



>ref|WP_004332750.1| polynucleotide phosphorylase/polyadenylase [Thauera linaloolentis]
 gb|ENO90502.1| polynucleotide phosphorylase/polyadenylase [Thauera linaloolentis 
47Lol = DSM 12138]
Length=699

 Score = 49.3 bits (116),  Expect(2) = 2e-08, Method: Compositional matrix adjust.
 Identities = 24/51 (47%), Positives = 35/51 (69%), Gaps = 0/51 (0%)
 Frame = +2

Query  272  ILESFTEEFEIGSRKITLETGKIARFANGSVVLAMDETKVLSTVASAKGRR  424
            +L +  + F  G+  +TLETG++AR A G+V++ MDET VL+TV  AK  R
Sbjct  1    MLNAIKKTFAYGAHTVTLETGEVARQAGGAVIVNMDETVVLATVVGAKEAR  51


 Score = 35.8 bits (81),  Expect(2) = 2e-08, Method: Composition-based stats.
 Identities = 15/24 (63%), Positives = 17/24 (71%), Gaps = 0/24 (0%)
 Frame = +3

Query  429  RDFLPLTVDYQEKQFAQGLIPSTF  500
            +DF PLTVDY EK +A G IP  F
Sbjct  54   QDFFPLTVDYVEKFYAAGRIPGGF  77



>ref|WP_010463927.1| polynucleotide phosphorylase/polyadenylase [Acidovorax radicis]
Length=746

 Score = 47.4 bits (111),  Expect(2) = 2e-08, Method: Composition-based stats.
 Identities = 21/51 (41%), Positives = 37/51 (73%), Gaps = 0/51 (0%)
 Frame = +2

Query  272  ILESFTEEFEIGSRKITLETGKIARFANGSVVLAMDETKVLSTVASAKGRR  424
            I    T+ F+ G + + +ETG+IAR A+G+V++ +D+T VL+TV ++KG +
Sbjct  3    IFNKVTKTFQWGDKTVIMETGEIARQASGAVLVNIDDTVVLATVVASKGAK  53


 Score = 37.7 bits (86),  Expect(2) = 2e-08, Method: Composition-based stats.
 Identities = 15/24 (63%), Positives = 18/24 (75%), Gaps = 0/24 (0%)
 Frame = +3

Query  429  RDFLPLTVDYQEKQFAQGLIPSTF  500
            +DF PLTVDY EK +A G IP +F
Sbjct  56   QDFFPLTVDYIEKTYAAGKIPGSF  79



>ref|WP_034998015.1| polynucleotide phosphorylase/polyadenylase [Beijerinckia mobilis]
Length=713

 Score = 47.4 bits (111),  Expect(2) = 2e-08, Method: Composition-based stats.
 Identities = 24/51 (47%), Positives = 33/51 (65%), Gaps = 0/51 (0%)
 Frame = +2

Query  272  ILESFTEEFEIGSRKITLETGKIARFANGSVVLAMDETKVLSTVASAKGRR  424
            + E   EE +   RK+ LETGKIAR A+G++  +  ET VL+TV SAK  +
Sbjct  1    MFEIHREEIDWAGRKLVLETGKIARQADGAIFASYGETTVLATVVSAKSAK  51


 Score = 37.7 bits (86),  Expect(2) = 2e-08, Method: Composition-based stats.
 Identities = 15/23 (65%), Positives = 17/23 (74%), Gaps = 0/23 (0%)
 Frame = +3

Query  432  DFLPLTVDYQEKQFAQGLIPSTF  500
            DF PLTV+YQEK FA G IP  +
Sbjct  55   DFFPLTVNYQEKAFAAGRIPGGY  77



>ref|WP_008548667.1| polynucleotide phosphorylase [Pseudovibrio sp. JE062]
 gb|EEA95342.1| polyribonucleotide nucleotidyltransferase protein [Pseudovibrio 
sp. JE062]
Length=712

 Score = 47.0 bits (110),  Expect(2) = 2e-08, Method: Composition-based stats.
 Identities = 23/41 (56%), Positives = 30/41 (73%), Gaps = 0/41 (0%)
 Frame = +2

Query  293  EFEIGSRKITLETGKIARFANGSVVLAMDETKVLSTVASAK  415
            E + G R + LETGK+AR A+G+V+    ETKVL+TV SAK
Sbjct  8    EVDWGGRPLILETGKVARQADGAVIATYGETKVLATVVSAK  48


 Score = 38.1 bits (87),  Expect(2) = 2e-08, Method: Composition-based stats.
 Identities = 15/24 (63%), Positives = 18/24 (75%), Gaps = 0/24 (0%)
 Frame = +3

Query  429  RDFLPLTVDYQEKQFAQGLIPSTF  500
            +DF PLTV+YQEK +A G IP  F
Sbjct  54   QDFFPLTVNYQEKAYAAGRIPGGF  77



>ref|WP_019027815.1| polynucleotide phosphorylase/polyadenylase [Colwellia piezophila]
Length=705

 Score = 47.4 bits (111),  Expect(2) = 2e-08, Method: Composition-based stats.
 Identities = 23/54 (43%), Positives = 37/54 (69%), Gaps = 0/54 (0%)
 Frame = +2

Query  272  ILESFTEEFEIGSRKITLETGKIARFANGSVVLAMDETKVLSTVASAKGRRSSR  433
            +L   T++F+ G   +TLETG IAR A+G+V+ +MD+T VL TV + K  ++ +
Sbjct  1    MLNPITKKFQYGKHTVTLETGAIARQASGAVMASMDDTCVLVTVVAKKEAKAGQ  54


 Score = 37.4 bits (85),  Expect(2) = 2e-08, Method: Composition-based stats.
 Identities = 14/30 (47%), Positives = 21/30 (70%), Gaps = 0/30 (0%)
 Frame = +3

Query  411  QRGDAVRDFLPLTVDYQEKQFAQGLIPSTF  500
            +   A +DF PLT++YQE+ +A G IP +F
Sbjct  48   KEAKAGQDFFPLTINYQERAYAAGKIPGSF  77



>ref|WP_003614793.1| polynucleotide phosphorylase [Methylosinus trichosporium]
Length=714

 Score = 47.0 bits (110),  Expect(2) = 2e-08, Method: Composition-based stats.
 Identities = 24/43 (56%), Positives = 30/43 (70%), Gaps = 0/43 (0%)
 Frame = +2

Query  290  EEFEIGSRKITLETGKIARFANGSVVLAMDETKVLSTVASAKG  418
            EE +   RK+ LETGKIAR A+G+V  +  ET VL+TV SAK 
Sbjct  7    EELDWAGRKLVLETGKIARQADGAVFASWGETTVLATVVSAKA  49


 Score = 37.7 bits (86),  Expect(2) = 2e-08, Method: Composition-based stats.
 Identities = 15/24 (63%), Positives = 18/24 (75%), Gaps = 0/24 (0%)
 Frame = +3

Query  429  RDFLPLTVDYQEKQFAQGLIPSTF  500
            +DF PLTV+YQEK FA G IP  +
Sbjct  54   QDFFPLTVNYQEKAFAAGRIPGGY  77



>ref|WP_008906339.1| polynucleotide phosphorylase/polyadenylase [Acidovorax sp. NO-1]
 gb|EHL21317.1| polynucleotide phosphorylase/polyadenylase [Acidovorax sp. NO-1]
Length=751

 Score = 47.0 bits (110),  Expect(2) = 2e-08, Method: Compositional matrix adjust.
 Identities = 21/51 (41%), Positives = 37/51 (73%), Gaps = 0/51 (0%)
 Frame = +2

Query  272  ILESFTEEFEIGSRKITLETGKIARFANGSVVLAMDETKVLSTVASAKGRR  424
            I    T+ F+ G + + +ETG+IAR A+G+V++ +D+T VL+TV ++KG +
Sbjct  3    IFNKVTKSFQWGDKTVIMETGEIARQASGAVLVNIDDTVVLATVVASKGAK  53


 Score = 37.7 bits (86),  Expect(2) = 2e-08, Method: Composition-based stats.
 Identities = 15/24 (63%), Positives = 18/24 (75%), Gaps = 0/24 (0%)
 Frame = +3

Query  429  RDFLPLTVDYQEKQFAQGLIPSTF  500
            +DF PLTVDY EK +A G IP +F
Sbjct  56   QDFFPLTVDYIEKTYAAGKIPGSF  79



>ref|WP_008968206.1| polynucleotide phosphorylase [Bradyrhizobium sp. STM 3843]
 emb|CCE05683.1| Polyribonucleotide nucleotidyltransferase (Polynucleotide phosphorylase) 
(PNPase) [Bradyrhizobium sp. STM 3843]
Length=722

 Score = 45.1 bits (105),  Expect(2) = 2e-08, Method: Composition-based stats.
 Identities = 23/44 (52%), Positives = 30/44 (68%), Gaps = 0/44 (0%)
 Frame = +2

Query  293  EFEIGSRKITLETGKIARFANGSVVLAMDETKVLSTVASAKGRR  424
            E + G R + LETGKIAR A+G+V+    ET VL+TV +AK  R
Sbjct  8    EIDWGGRPLKLETGKIARQADGAVIATYGETVVLATVVAAKAPR  51


 Score = 39.7 bits (91),  Expect(2) = 2e-08, Method: Composition-based stats.
 Identities = 16/23 (70%), Positives = 18/23 (78%), Gaps = 0/23 (0%)
 Frame = +3

Query  432  DFLPLTVDYQEKQFAQGLIPSTF  500
            DFLPLTVDYQEK +A G IP  +
Sbjct  55   DFLPLTVDYQEKAYAAGRIPGGY  77



>ref|WP_014283428.1| polynucleotide phosphorylase [Pseudovibrio sp. FO-BEG1]
 gb|AEV35026.1| polynucleotide phosphorylase/polyadenylase [Pseudovibrio sp. 
FO-BEG1]
Length=716

 Score = 47.0 bits (110),  Expect(2) = 2e-08, Method: Composition-based stats.
 Identities = 23/41 (56%), Positives = 30/41 (73%), Gaps = 0/41 (0%)
 Frame = +2

Query  293  EFEIGSRKITLETGKIARFANGSVVLAMDETKVLSTVASAK  415
            E + G R + LETGK+AR A+G+V+    ETKVL+TV SAK
Sbjct  8    EVDWGGRPLILETGKVARQADGAVIATYGETKVLATVVSAK  48


 Score = 38.1 bits (87),  Expect(2) = 2e-08, Method: Composition-based stats.
 Identities = 15/24 (63%), Positives = 18/24 (75%), Gaps = 0/24 (0%)
 Frame = +3

Query  429  RDFLPLTVDYQEKQFAQGLIPSTF  500
            +DF PLTV+YQEK +A G IP  F
Sbjct  54   QDFFPLTVNYQEKAYAAGRIPGGF  77



>ref|WP_018644187.1| polynucleotide phosphorylase [Bradyrhizobium japonicum]
Length=720

 Score = 45.1 bits (105),  Expect(2) = 2e-08, Method: Composition-based stats.
 Identities = 23/44 (52%), Positives = 30/44 (68%), Gaps = 0/44 (0%)
 Frame = +2

Query  293  EFEIGSRKITLETGKIARFANGSVVLAMDETKVLSTVASAKGRR  424
            E + G R + LETGKIAR A+G+V+    ET VL+TV +AK  R
Sbjct  8    EIDWGGRPLKLETGKIARQADGAVIATYGETVVLATVVAAKAPR  51


 Score = 39.7 bits (91),  Expect(2) = 2e-08, Method: Composition-based stats.
 Identities = 16/23 (70%), Positives = 18/23 (78%), Gaps = 0/23 (0%)
 Frame = +3

Query  432  DFLPLTVDYQEKQFAQGLIPSTF  500
            DFLPLTVDYQEK +A G IP  +
Sbjct  55   DFLPLTVDYQEKTYAAGRIPGGY  77



>ref|WP_027572371.1| polynucleotide phosphorylase/polyadenylase [Bradyrhizobium sp. 
WSM1743]
Length=720

 Score = 45.1 bits (105),  Expect(2) = 2e-08, Method: Composition-based stats.
 Identities = 23/44 (52%), Positives = 30/44 (68%), Gaps = 0/44 (0%)
 Frame = +2

Query  293  EFEIGSRKITLETGKIARFANGSVVLAMDETKVLSTVASAKGRR  424
            E + G R + LETGKIAR A+G+V+    ET VL+TV +AK  R
Sbjct  8    EIDWGGRPLKLETGKIARQADGAVIATYGETVVLATVVAAKAPR  51


 Score = 39.7 bits (91),  Expect(2) = 2e-08, Method: Composition-based stats.
 Identities = 16/23 (70%), Positives = 18/23 (78%), Gaps = 0/23 (0%)
 Frame = +3

Query  432  DFLPLTVDYQEKQFAQGLIPSTF  500
            DFLPLTVDYQEK +A G IP  +
Sbjct  55   DFLPLTVDYQEKTYAAGRIPGGY  77



>ref|WP_029934670.1| polynucleotide phosphorylase/polyadenylase [Thiomicrospira pelophila]
Length=694

 Score = 47.0 bits (110),  Expect(2) = 2e-08, Method: Composition-based stats.
 Identities = 22/42 (52%), Positives = 31/42 (74%), Gaps = 0/42 (0%)
 Frame = +2

Query  290  EEFEIGSRKITLETGKIARFANGSVVLAMDETKVLSTVASAK  415
            + F+ G   ITLETG+IAR A+G+VV+ M +T++L TV  AK
Sbjct  6    KSFQYGHHTITLETGEIARQADGAVVIGMGDTRILVTVVGAK  47


 Score = 37.7 bits (86),  Expect(2) = 2e-08, Method: Composition-based stats.
 Identities = 15/24 (63%), Positives = 18/24 (75%), Gaps = 0/24 (0%)
 Frame = +3

Query  429  RDFLPLTVDYQEKQFAQGLIPSTF  500
            +DF PLTV+YQEK +A G IP  F
Sbjct  53   QDFFPLTVNYQEKAYAAGKIPGGF  76



>ref|WP_011386466.1| polynucleotide phosphorylase [Magnetospirillum magneticum]
 sp|Q2VZQ4.1|PNP_MAGSA RecName: Full=Polyribonucleotide nucleotidyltransferase; AltName: 
Full=Polynucleotide phosphorylase; Short=PNPase [Magnetospirillum 
magneticum AMB-1]
 dbj|BAE52921.1| Polyribonucleotide nucleotidyltransferase [Magnetospirillum magneticum 
AMB-1]
Length=720

 Score = 45.8 bits (107),  Expect(2) = 2e-08, Method: Composition-based stats.
 Identities = 22/45 (49%), Positives = 31/45 (69%), Gaps = 0/45 (0%)
 Frame = +2

Query  290  EEFEIGSRKITLETGKIARFANGSVVLAMDETKVLSTVASAKGRR  424
            +E   G RK+ LETGK+AR A+G+V++   ET VL TV  AK ++
Sbjct  9    KEITWGGRKLVLETGKVARQADGAVMVTYGETSVLCTVVGAKSQK  53


 Score = 38.9 bits (89),  Expect(2) = 2e-08, Method: Composition-based stats.
 Identities = 16/23 (70%), Positives = 17/23 (74%), Gaps = 0/23 (0%)
 Frame = +3

Query  432  DFLPLTVDYQEKQFAQGLIPSTF  500
            DF PLTV+YQEK FA G IP  F
Sbjct  57   DFFPLTVNYQEKAFAAGKIPGGF  79



>ref|WP_027054519.1| polynucleotide phosphorylase/polyadenylase [Mesorhizobium loti]
Length=715

 Score = 48.5 bits (114),  Expect(2) = 2e-08, Method: Composition-based stats.
 Identities = 25/41 (61%), Positives = 30/41 (73%), Gaps = 0/41 (0%)
 Frame = +2

Query  293  EFEIGSRKITLETGKIARFANGSVVLAMDETKVLSTVASAK  415
            E E G R +TLETGKIAR A+G+V+    ETKVL+TV S K
Sbjct  8    EIEWGGRPLTLETGKIARQADGAVLATYGETKVLATVVSMK  48


 Score = 36.2 bits (82),  Expect(2) = 2e-08, Method: Composition-based stats.
 Identities = 14/23 (61%), Positives = 17/23 (74%), Gaps = 0/23 (0%)
 Frame = +3

Query  432  DFLPLTVDYQEKQFAQGLIPSTF  500
            DF PLTV+YQEK +A G IP  +
Sbjct  55   DFFPLTVNYQEKTYAAGKIPGGY  77



>ref|WP_018266721.1| polynucleotide phosphorylase [Methylosinus sp. LW4]
Length=715

 Score = 46.6 bits (109),  Expect(2) = 2e-08, Method: Composition-based stats.
 Identities = 24/43 (56%), Positives = 30/43 (70%), Gaps = 0/43 (0%)
 Frame = +2

Query  290  EEFEIGSRKITLETGKIARFANGSVVLAMDETKVLSTVASAKG  418
            EE +   RK+ LETGKIAR A+G+V  +  ET VL+TV SAK 
Sbjct  7    EELDWAGRKLILETGKIARQADGAVFASWGETTVLATVVSAKA  49


 Score = 38.1 bits (87),  Expect(2) = 2e-08, Method: Composition-based stats.
 Identities = 15/24 (63%), Positives = 18/24 (75%), Gaps = 0/24 (0%)
 Frame = +3

Query  429  RDFLPLTVDYQEKQFAQGLIPSTF  500
            +DF PLTV+YQEK FA G IP  +
Sbjct  54   QDFFPLTVNYQEKAFAAGRIPGGY  77



>ref|WP_006458359.1| polynucleotide phosphorylase/polyadenylase [Stenotrophomonas 
sp. SKA14]
 gb|EED37689.1| 3' exoribonuclease family, domain 2, protein [Stenotrophomonas 
sp. SKA14]
 emb|CCP12541.1| polyribonucleotide nucleotidyltransferase [Stenotrophomonas maltophilia 
SKK35]
Length=702

 Score = 46.6 bits (109),  Expect(2) = 2e-08, Method: Compositional matrix adjust.
 Identities = 21/53 (40%), Positives = 35/53 (66%), Gaps = 0/53 (0%)
 Frame = +2

Query  275  LESFTEEFEIGSRKITLETGKIARFANGSVVLAMDETKVLSTVASAKGRRSSR  433
            +   T+ F+ G   +TLETG++AR A+G+V++ MD+T +L T  +AK  R  +
Sbjct  1    MAKITKTFQYGKHTVTLETGEVARQASGAVIVKMDDTVLLVTAVAAKSAREGQ  53


 Score = 38.1 bits (87),  Expect(2) = 2e-08, Method: Composition-based stats.
 Identities = 16/24 (67%), Positives = 18/24 (75%), Gaps = 0/24 (0%)
 Frame = +3

Query  429  RDFLPLTVDYQEKQFAQGLIPSTF  500
            +DF PLTVDYQEK +A G IP  F
Sbjct  53   QDFFPLTVDYQEKFYAGGRIPGGF  76



>ref|WP_041357504.1| polynucleotide phosphorylase/polyadenylase [Nitrobacter hamburgensis]
 sp|Q1QS60.2|PNP_NITHX RecName: Full=Polyribonucleotide nucleotidyltransferase; AltName: 
Full=Polynucleotide phosphorylase; Short=PNPase [Nitrobacter 
hamburgensis X14]
Length=720

 Score = 45.1 bits (105),  Expect(2) = 2e-08, Method: Composition-based stats.
 Identities = 24/44 (55%), Positives = 30/44 (68%), Gaps = 0/44 (0%)
 Frame = +2

Query  293  EFEIGSRKITLETGKIARFANGSVVLAMDETKVLSTVASAKGRR  424
            E + G R + LETGKIAR A+G+VV    ET VL+TV +AK  R
Sbjct  8    EIDWGGRPLKLETGKIARQADGAVVATYGETVVLATVVAAKTPR  51


 Score = 39.7 bits (91),  Expect(2) = 2e-08, Method: Composition-based stats.
 Identities = 16/23 (70%), Positives = 18/23 (78%), Gaps = 0/23 (0%)
 Frame = +3

Query  432  DFLPLTVDYQEKQFAQGLIPSTF  500
            DFLPLTVDYQEK +A G IP  +
Sbjct  55   DFLPLTVDYQEKTYAAGRIPGGY  77



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 564814758300