BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFF037B24

Length=578
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009630733.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       229   8e-69   Nicotiana tomentosiformis
ref|XP_009768477.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       228   2e-68   Nicotiana sylvestris
gb|KDO54650.1|  hypothetical protein CISIN_1g0100251mg                  216   2e-65   Citrus sinensis [apfelsine]
ref|XP_009590301.1|  PREDICTED: protein TRANSPARENT TESTA 12-like...    219   3e-65   Nicotiana tomentosiformis
ref|XP_006351961.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       219   5e-65   Solanum tuberosum [potatoes]
ref|XP_009590300.1|  PREDICTED: protein TRANSPARENT TESTA 12-like...    219   6e-65   Nicotiana tomentosiformis
ref|XP_004251515.1|  PREDICTED: protein TRANSPARENT TESTA 12            218   3e-64   Solanum lycopersicum
ref|XP_006447549.1|  hypothetical protein CICLE_v10014926mg             216   1e-63   Citrus clementina [clementine]
emb|CDP11780.1|  unnamed protein product                                214   7e-63   Coffea canephora [robusta coffee]
emb|CDP11782.1|  unnamed protein product                                214   1e-62   Coffea canephora [robusta coffee]
ref|XP_004243470.1|  PREDICTED: protein TRANSPARENT TESTA 12            213   1e-62   Solanum lycopersicum
ref|XP_010278703.1|  PREDICTED: protein TRANSPARENT TESTA 12-like...    211   6e-62   Nelumbo nucifera [Indian lotus]
emb|CDY19294.1|  BnaC01g31860D                                          211   8e-62   Brassica napus [oilseed rape]
ref|XP_003605914.1|  Transparent testa 12 protein                       211   8e-62   Medicago truncatula
emb|CDY39494.1|  BnaA01g24940D                                          211   1e-61   Brassica napus [oilseed rape]
ref|XP_010278702.1|  PREDICTED: protein TRANSPARENT TESTA 12-like...    211   1e-61   Nelumbo nucifera [Indian lotus]
ref|XP_009353271.1|  PREDICTED: protein TRANSPARENT TESTA 12-like...    210   2e-61   Pyrus x bretschneideri [bai li]
ref|XP_009353270.1|  PREDICTED: protein TRANSPARENT TESTA 12-like...    210   2e-61   Pyrus x bretschneideri [bai li]
emb|CDY19295.1|  BnaC01g31850D                                          204   4e-61   Brassica napus [oilseed rape]
ref|XP_008342001.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       204   7e-61   
ref|XP_006375529.1|  hypothetical protein POPTR_0014s15140g             204   8e-61   
gb|KFK39487.1|  hypothetical protein AALP_AA3G250500                    208   1e-60   Arabis alpina [alpine rockcress]
ref|XP_009145463.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       207   2e-60   Brassica rapa
ref|XP_010466422.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       207   3e-60   Camelina sativa [gold-of-pleasure]
emb|CDY38631.1|  BnaA05g19560D                                          207   3e-60   Brassica napus [oilseed rape]
ref|XP_009109391.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       207   3e-60   Brassica rapa
ref|XP_010510483.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       206   5e-60   
ref|XP_003540303.1|  PREDICTED: protein TRANSPARENT TESTA 12            206   9e-60   Glycine max [soybeans]
ref|XP_008379931.1|  PREDICTED: protein TRANSPARENT TESTA 12            204   1e-59   
ref|XP_004515071.1|  PREDICTED: protein TRANSPARENT TESTA 12-like...    205   2e-59   Cicer arietinum [garbanzo]
emb|CDY69153.1|  BnaAnng29470D                                          200   2e-59   Brassica napus [oilseed rape]
ref|XP_010551032.1|  PREDICTED: protein TRANSPARENT TESTA 12            204   3e-59   Tarenaya hassleriana [spider flower]
gb|KFK39486.1|  hypothetical protein AALP_AA3G250400                    204   5e-59   Arabis alpina [alpine rockcress]
ref|XP_006406243.1|  hypothetical protein EUTSA_v10020526mg             202   5e-59   
ref|XP_008362257.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       203   7e-59   
ref|XP_004144495.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       203   8e-59   Cucumis sativus [cucumbers]
ref|XP_002279330.1|  PREDICTED: protein TRANSPARENT TESTA 12            202   2e-58   Vitis vinifera
ref|XP_006406242.1|  hypothetical protein EUTSA_v10020526mg             202   2e-58   Eutrema salsugineum [saltwater cress]
ref|XP_002883313.1|  mate efflux family protein                         202   3e-58   
emb|CBI28937.3|  unnamed protein product                                202   5e-58   Vitis vinifera
gb|KHN21236.1|  Protein TRANSPARENT TESTA 12                            201   7e-58   Glycine soja [wild soybean]
emb|CBI28939.3|  unnamed protein product                                197   7e-58   Vitis vinifera
ref|XP_008455435.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       201   8e-58   Cucumis melo [Oriental melon]
emb|CAN69305.1|  hypothetical protein VITISV_021605                     195   1e-57   Vitis vinifera
emb|CDY33129.1|  BnaCnng07000D                                          199   2e-57   Brassica napus [oilseed rape]
ref|XP_009145464.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       199   2e-57   Brassica rapa
ref|XP_004487410.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       199   3e-57   Cicer arietinum [garbanzo]
ref|XP_007045634.1|  MATE efflux family protein isoform 2               197   3e-57   
ref|XP_010930078.1|  PREDICTED: protein TRANSPARENT TESTA 12-like...    199   3e-57   Elaeis guineensis
emb|CDP17486.1|  unnamed protein product                                199   4e-57   Coffea canephora [robusta coffee]
ref|XP_010276072.1|  PREDICTED: protein TRANSPARENT TESTA 12            199   4e-57   Nelumbo nucifera [Indian lotus]
gb|KEH39009.1|  MATE efflux family protein                              197   6e-57   Medicago truncatula
emb|CDY24250.1|  BnaC03g42230D                                          193   7e-57   Brassica napus [oilseed rape]
ref|XP_010930069.1|  PREDICTED: protein TRANSPARENT TESTA 12-like...    198   7e-57   Elaeis guineensis
ref|XP_010051023.1|  PREDICTED: protein TRANSPARENT TESTA 12            198   8e-57   
ref|XP_008230071.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       198   9e-57   Prunus mume [ume]
ref|XP_010923890.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       198   1e-56   Elaeis guineensis
gb|KHN41220.1|  Protein TRANSPARENT TESTA 12                            197   1e-56   Glycine soja [wild soybean]
ref|XP_010510494.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       197   1e-56   Camelina sativa [gold-of-pleasure]
ref|XP_010930135.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       197   1e-56   Elaeis guineensis
dbj|BAJ34540.1|  unnamed protein product                                197   2e-56   Eutrema halophilum
ref|XP_009388870.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       197   2e-56   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_003596992.1|  Transparent testa 12 protein                       196   2e-56   Medicago truncatula
ref|XP_007215031.1|  hypothetical protein PRUPE_ppa004291mg             197   2e-56   
ref|XP_010466426.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       196   3e-56   Camelina sativa [gold-of-pleasure]
ref|XP_003526327.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       197   3e-56   Glycine max [soybeans]
ref|XP_007045633.1|  MATE efflux family protein isoform 1               196   3e-56   
ref|XP_008812639.1|  PREDICTED: protein TRANSPARENT TESTA 12            196   4e-56   Phoenix dactylifera
ref|XP_010930104.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       196   5e-56   Elaeis guineensis
ref|XP_003633309.1|  PREDICTED: LOW QUALITY PROTEIN: protein TRAN...    195   7e-56   Vitis vinifera
ref|XP_002279487.1|  PREDICTED: protein TRANSPARENT TESTA 12            195   1e-55   Vitis vinifera
ref|XP_004487408.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       195   1e-55   Cicer arietinum [garbanzo]
ref|XP_009402851.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       194   2e-55   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_002279276.2|  PREDICTED: protein TRANSPARENT TESTA 12            194   2e-55   
ref|XP_010930090.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       194   2e-55   Elaeis guineensis
ref|XP_009109403.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       193   3e-55   Brassica rapa
emb|CDX92916.1|  BnaA03g36380D                                          193   3e-55   
ref|XP_006383933.1|  hypothetical protein POPTR_0004s01620g             193   4e-55   
emb|CDY65669.1|  BnaCnng48120D                                          193   4e-55   Brassica napus [oilseed rape]
gb|KGN43526.1|  hypothetical protein Csa_7G043680                       193   6e-55   Cucumis sativus [cucumbers]
ref|XP_009135765.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       192   7e-55   Brassica rapa
ref|XP_004159226.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       192   8e-55   
gb|KDO75455.1|  hypothetical protein CISIN_1g010798mg                   191   8e-55   Citrus sinensis [apfelsine]
gb|KFK39485.1|  hypothetical protein AALP_AA3G250300                    192   1e-54   Arabis alpina [alpine rockcress]
gb|KDO75454.1|  hypothetical protein CISIN_1g010798mg                   191   1e-54   Citrus sinensis [apfelsine]
ref|XP_006297470.1|  hypothetical protein CARUB_v10013491mg             192   1e-54   Capsella rubella
gb|KGN43522.1|  Mate efflux family protein                              192   1e-54   Cucumis sativus [cucumbers]
ref|XP_004144588.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       192   1e-54   
ref|NP_188806.1|  MATE efflux family protein                            191   2e-54   Arabidopsis thaliana [mouse-ear cress]
gb|AAM20595.1|  integral membrane protein, putative                     191   2e-54   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008455433.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       191   2e-54   Cucumis melo [Oriental melon]
gb|KDO75453.1|  hypothetical protein CISIN_1g010798mg                   190   5e-54   Citrus sinensis [apfelsine]
emb|CDY39493.1|  BnaA01g24950D                                          190   6e-54   Brassica napus [oilseed rape]
ref|XP_006389632.1|  hypothetical protein POPTR_0021s00810g             190   6e-54   Populus trichocarpa [western balsam poplar]
ref|XP_011047996.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       190   8e-54   Populus euphratica
ref|XP_006389631.1|  hypothetical protein POPTR_0021s00800g             190   8e-54   Populus trichocarpa [western balsam poplar]
ref|XP_006449030.1|  hypothetical protein CICLE_v10014983mg             189   9e-54   Citrus clementina [clementine]
ref|XP_010930122.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       189   1e-53   
gb|AGT17221.1|  transparent testa 12 protein                            189   1e-53   Saccharum hybrid cultivar R570
tpg|DAA50098.1|  TPA: putative MATE efflux family protein               187   2e-53   
gb|KHG27903.1|  Protein TRANSPARENT TESTA 12 -like protein              189   2e-53   Gossypium arboreum [tree cotton]
ref|XP_008230142.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       189   2e-53   Prunus mume [ume]
gb|KGN43524.1|  hypothetical protein Csa_7G043660                       188   2e-53   Cucumis sativus [cucumbers]
gb|ACF85423.1|  unknown                                                 189   2e-53   Zea mays [maize]
ref|XP_011037771.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       188   3e-53   Populus euphratica
ref|XP_004515070.1|  PREDICTED: protein TRANSPARENT TESTA 12-like...    188   4e-53   Cicer arietinum [garbanzo]
gb|ACZ55931.1|  MATE transporter 2                                      188   4e-53   Zea mays [maize]
gb|KJB30571.1|  hypothetical protein B456_005G149900                    188   5e-53   Gossypium raimondii
ref|XP_007132552.1|  hypothetical protein PHAVU_011G104200g             188   6e-53   Phaseolus vulgaris [French bean]
ref|NP_001149176.1|  transparent testa 12 protein                       187   7e-53   Zea mays [maize]
ref|XP_004982537.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       187   7e-53   Setaria italica
ref|XP_009398220.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       187   7e-53   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_011047997.1|  PREDICTED: protein TRANSPARENT TESTA 12-like...    187   9e-53   Populus euphratica
ref|XP_006468029.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       187   1e-52   Citrus sinensis [apfelsine]
gb|ACZ55932.1|  MATE transporter 2                                      187   1e-52   Zea mays [maize]
ref|XP_008441737.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       186   1e-52   Cucumis melo [Oriental melon]
ref|XP_002273739.2|  PREDICTED: protein TRANSPARENT TESTA 12            186   2e-52   Vitis vinifera
ref|NP_001050524.1|  Os03g0572900                                       186   2e-52   
tpg|DAA50097.1|  TPA: putative MATE efflux family protein               177   2e-52   
gb|EEC75610.1|  hypothetical protein OsI_12322                          186   2e-52   Oryza sativa Indica Group [Indian rice]
gb|ABF97220.1|  MATE efflux family protein, expressed                   186   2e-52   Oryza sativa Japonica Group [Japonica rice]
ref|NP_001148084.1|  transparent testa 12 protein                       186   2e-52   Zea mays [maize]
tpg|DAA50100.1|  TPA: putative MATE efflux family protein               186   3e-52   
emb|CDM85992.1|  unnamed protein product                                186   4e-52   Triticum aestivum [Canadian hard winter wheat]
ref|XP_006650264.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       185   4e-52   
ref|XP_008676828.1|  PREDICTED: transparent testa 12 protein isof...    186   4e-52   Zea mays [maize]
ref|XP_004173828.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       181   4e-52   
ref|XP_010100632.1|  Protein TRANSPARENT TESTA 12                       185   4e-52   
gb|KDP20755.1|  hypothetical protein JCGZ_21226                         182   5e-52   Jatropha curcas
gb|KJB57729.1|  hypothetical protein B456_009G178100                    182   5e-52   Gossypium raimondii
ref|XP_006389633.1|  hypothetical protein POPTR_0021s00820g             184   1e-51   
ref|XP_008455432.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       184   2e-51   Cucumis melo [Oriental melon]
ref|XP_004295265.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       184   2e-51   Fragaria vesca subsp. vesca
ref|XP_004144494.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       184   2e-51   Cucumis sativus [cucumbers]
ref|XP_003562349.1|  PREDICTED: protein TRANSPARENT TESTA 12-like...    183   2e-51   Brachypodium distachyon [annual false brome]
ref|XP_011096076.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       183   3e-51   Sesamum indicum [beniseed]
ref|XP_004982535.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       183   3e-51   Setaria italica
gb|AAS01962.1|  putative MATE efflux family protein                     183   3e-51   Oryza sativa Japonica Group [Japonica rice]
gb|ABF97209.1|  MATE efflux family protein, expressed                   183   4e-51   Oryza sativa Japonica Group [Japonica rice]
ref|XP_006389634.1|  hypothetical protein POPTR_0021s00830g             182   4e-51   
gb|KJB69294.1|  hypothetical protein B456_011G014800                    182   4e-51   Gossypium raimondii
gb|KJB57730.1|  hypothetical protein B456_009G178100                    182   4e-51   Gossypium raimondii
ref|XP_006449716.1|  hypothetical protein CICLE_v10014968mg             182   4e-51   Citrus clementina [clementine]
gb|EEC75606.1|  hypothetical protein OsI_12318                          183   5e-51   Oryza sativa Indica Group [Indian rice]
gb|KJB57728.1|  hypothetical protein B456_009G178100                    182   5e-51   Gossypium raimondii
ref|XP_011048000.1|  PREDICTED: protein TRANSPARENT TESTA 12-like...    182   7e-51   Populus euphratica
ref|XP_003562350.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       182   7e-51   Brachypodium distachyon [annual false brome]
gb|KJB69293.1|  hypothetical protein B456_011G014800                    182   1e-50   Gossypium raimondii
ref|XP_011047999.1|  PREDICTED: protein TRANSPARENT TESTA 12-like...    182   1e-50   Populus euphratica
ref|XP_006467446.1|  PREDICTED: protein TRANSPARENT TESTA 12-like...    181   1e-50   Citrus sinensis [apfelsine]
gb|KHG25345.1|  Protein TRANSPARENT TESTA 12 -like protein              182   1e-50   Gossypium arboreum [tree cotton]
ref|XP_004982536.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       181   2e-50   
gb|KDO78208.1|  hypothetical protein CISIN_1g010561mg                   180   3e-50   Citrus sinensis [apfelsine]
ref|XP_006467445.1|  PREDICTED: protein TRANSPARENT TESTA 12-like...    180   3e-50   Citrus sinensis [apfelsine]
ref|XP_008347106.1|  PREDICTED: LOW QUALITY PROTEIN: protein TRAN...    180   3e-50   
gb|KGN64598.1|  hypothetical protein Csa_1G071120                       180   4e-50   Cucumis sativus [cucumbers]
ref|XP_004293282.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       180   5e-50   Fragaria vesca subsp. vesca
gb|KCW76957.1|  hypothetical protein EUGRSUZ_D01316                     178   1e-49   Eucalyptus grandis [rose gum]
ref|XP_007149972.1|  hypothetical protein PHAVU_005G115000g             179   1e-49   Phaseolus vulgaris [French bean]
ref|XP_010278701.1|  PREDICTED: protein TRANSPARENT TESTA 12            179   1e-49   Nelumbo nucifera [Indian lotus]
gb|EMT13253.1|  Protein TRANSPARENT TESTA 12                            179   1e-49   
ref|XP_007026054.1|  MATE efflux family protein isoform 1               178   2e-49   
gb|KDP20756.1|  hypothetical protein JCGZ_21227                         182   2e-49   Jatropha curcas
ref|XP_010052837.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       178   2e-49   Eucalyptus grandis [rose gum]
ref|XP_007026055.1|  MATE efflux family protein, expressed isoform 2    178   2e-49   
ref|XP_007212447.1|  hypothetical protein PRUPE_ppa017237mg             177   2e-49   
gb|EMS63519.1|  Protein TRANSPARENT TESTA 12                            178   3e-49   Triticum urartu
emb|CDM86677.1|  unnamed protein product                                177   3e-49   Triticum aestivum [Canadian hard winter wheat]
ref|XP_009345545.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       177   3e-49   
ref|XP_007211777.1|  hypothetical protein PRUPE_ppa004182mg             177   4e-49   Prunus persica
ref|XP_009361725.1|  PREDICTED: protein TRANSPARENT TESTA 12-like...    177   4e-49   Pyrus x bretschneideri [bai li]
ref|XP_008664995.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       177   4e-49   Zea mays [maize]
ref|XP_009361804.1|  PREDICTED: protein TRANSPARENT TESTA 12-like...    177   4e-49   Pyrus x bretschneideri [bai li]
ref|XP_002273901.2|  PREDICTED: protein TRANSPARENT TESTA 12-like       177   4e-49   Vitis vinifera
gb|KDO78210.1|  hypothetical protein CISIN_1g043801mg                   169   8e-49   Citrus sinensis [apfelsine]
ref|XP_009345550.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       176   1e-48   Pyrus x bretschneideri [bai li]
ref|XP_008371179.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       172   1e-48   
ref|XP_010093281.1|  Protein TRANSPARENT TESTA 12                       176   1e-48   Morus notabilis
ref|XP_011048008.1|  PREDICTED: protein TRANSPARENT TESTA 12-like...    175   2e-48   Populus euphratica
ref|XP_010052836.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       176   2e-48   Eucalyptus grandis [rose gum]
ref|XP_008371177.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       171   2e-48   
ref|XP_007026057.1|  MATE efflux family protein                         176   2e-48   
ref|XP_002464321.1|  hypothetical protein SORBIDRAFT_01g016100          175   2e-48   Sorghum bicolor [broomcorn]
ref|XP_008371097.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       171   2e-48   
ref|XP_008664994.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       175   2e-48   Zea mays [maize]
ref|XP_011048006.1|  PREDICTED: protein TRANSPARENT TESTA 12-like...    175   3e-48   Populus euphratica
gb|EYU29855.1|  hypothetical protein MIMGU_mgv1a004845mg                175   3e-48   Erythranthe guttata [common monkey flower]
ref|XP_011048007.1|  PREDICTED: protein TRANSPARENT TESTA 12-like...    175   3e-48   Populus euphratica
ref|XP_007212986.1|  hypothetical protein PRUPE_ppa022523mg             175   3e-48   
ref|XP_011096071.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       175   4e-48   Sesamum indicum [beniseed]
ref|XP_008224820.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       174   5e-48   Prunus mume [ume]
ref|XP_008224822.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       174   5e-48   Prunus mume [ume]
emb|CDM86696.1|  unnamed protein product                                174   6e-48   Triticum aestivum [Canadian hard winter wheat]
ref|XP_010546899.1|  PREDICTED: protein TRANSPARENT TESTA 12-like...    174   6e-48   Tarenaya hassleriana [spider flower]
dbj|BAF47751.1|  multi antimicrobial extrusion family protein           174   7e-48   Nicotiana tabacum [American tobacco]
ref|XP_009790570.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       174   7e-48   Nicotiana sylvestris
gb|EYU29854.1|  hypothetical protein MIMGU_mgv1a005159mg                174   9e-48   Erythranthe guttata [common monkey flower]
ref|XP_006389638.1|  MATE efflux family protein                         174   9e-48   
ref|XP_007026056.1|  MATE efflux family protein                         174   1e-47   
emb|CDM86692.1|  unnamed protein product                                173   1e-47   Triticum aestivum [Canadian hard winter wheat]
ref|XP_008224821.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       173   1e-47   Prunus mume [ume]
ref|XP_009618512.1|  PREDICTED: protein TRANSPARENT TESTA 12-like...    171   1e-47   Nicotiana tomentosiformis
gb|EPS61219.1|  hypothetical protein M569_13580                         164   1e-47   Genlisea aurea
ref|XP_009798076.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       173   2e-47   Nicotiana sylvestris
gb|EYU27797.1|  hypothetical protein MIMGU_mgv1a004389mg                173   2e-47   Erythranthe guttata [common monkey flower]
ref|XP_006363107.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       172   2e-47   Solanum tuberosum [potatoes]
ref|XP_006348109.1|  PREDICTED: protein TRANSPARENT TESTA 12-like...    171   2e-47   Solanum tuberosum [potatoes]
ref|XP_009618511.1|  PREDICTED: protein TRANSPARENT TESTA 12-like...    171   2e-47   Nicotiana tomentosiformis
ref|XP_008364095.1|  PREDICTED: protein TRANSPARENT TESTA 12-like...    172   3e-47   
gb|KDP20757.1|  hypothetical protein JCGZ_21228                         168   3e-47   Jatropha curcas
ref|XP_009362007.1|  PREDICTED: protein TRANSPARENT TESTA 12-like...    171   3e-47   
ref|XP_004231608.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       172   3e-47   Solanum lycopersicum
gb|EYU29852.1|  hypothetical protein MIMGU_mgv1a004818mg                172   3e-47   Erythranthe guttata [common monkey flower]
ref|XP_002518493.1|  multidrug resistance pump, putative                172   3e-47   Ricinus communis
ref|XP_009608373.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       172   3e-47   Nicotiana tomentosiformis
ref|XP_008364096.1|  PREDICTED: protein TRANSPARENT TESTA 12-like...    171   3e-47   
ref|XP_002518495.1|  multidrug resistance pump, putative                172   4e-47   Ricinus communis
ref|XP_009361291.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       172   4e-47   
ref|XP_008364094.1|  PREDICTED: protein TRANSPARENT TESTA 12-like...    172   4e-47   
ref|XP_008364093.1|  PREDICTED: protein TRANSPARENT TESTA 12-like...    172   4e-47   
ref|XP_006597580.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       172   4e-47   Glycine max [soybeans]
ref|XP_008364091.1|  PREDICTED: protein TRANSPARENT TESTA 12-like...    172   4e-47   
ref|XP_008364092.1|  PREDICTED: protein TRANSPARENT TESTA 12-like...    172   4e-47   
gb|KHN33034.1|  Protein TRANSPARENT TESTA 12                            172   5e-47   Glycine soja [wild soybean]
gb|EPS67796.1|  hypothetical protein M569_06975                         171   5e-47   Genlisea aurea
ref|XP_011048004.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       172   5e-47   Populus euphratica
ref|XP_009760618.1|  PREDICTED: LOW QUALITY PROTEIN: protein TRAN...    171   6e-47   Nicotiana sylvestris
gb|ABK24492.1|  unknown                                                 171   6e-47   Picea sitchensis
emb|CDM86687.1|  unnamed protein product                                171   9e-47   Triticum aestivum [Canadian hard winter wheat]
ref|XP_009345548.1|  PREDICTED: protein TRANSPARENT TESTA 12-like...    169   1e-46   Pyrus x bretschneideri [bai li]
ref|XP_004232716.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       170   2e-46   Solanum lycopersicum
ref|XP_009361903.1|  PREDICTED: protein TRANSPARENT TESTA 12-like...    171   2e-46   Pyrus x bretschneideri [bai li]
ref|XP_006348110.1|  PREDICTED: protein TRANSPARENT TESTA 12-like...    170   2e-46   Solanum tuberosum [potatoes]
ref|XP_006348108.1|  PREDICTED: protein TRANSPARENT TESTA 12-like...    170   2e-46   Solanum tuberosum [potatoes]
ref|XP_009345546.1|  PREDICTED: protein TRANSPARENT TESTA 12-like...    170   2e-46   Pyrus x bretschneideri [bai li]
ref|XP_006389636.1|  hypothetical protein POPTR_0021s00860g             170   2e-46   Populus trichocarpa [western balsam poplar]
gb|EMT19998.1|  hypothetical protein F775_52364                         173   4e-46   
ref|XP_010533820.1|  PREDICTED: protein TRANSPARENT TESTA 12-like...    165   5e-46   Tarenaya hassleriana [spider flower]
ref|XP_010468355.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       168   5e-46   
ref|XP_010533821.1|  PREDICTED: protein TRANSPARENT TESTA 12-like...    165   5e-46   Tarenaya hassleriana [spider flower]
ref|XP_009417226.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       169   6e-46   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010533819.1|  PREDICTED: protein TRANSPARENT TESTA 12-like...    165   7e-46   Tarenaya hassleriana [spider flower]
ref|XP_010533818.1|  PREDICTED: protein TRANSPARENT TESTA 12-like...    165   7e-46   Tarenaya hassleriana [spider flower]
ref|XP_009614256.1|  PREDICTED: LOW QUALITY PROTEIN: protein TRAN...    168   9e-46   Nicotiana tomentosiformis
ref|XP_009614258.1|  PREDICTED: protein TRANSPARENT TESTA 12-like...    167   1e-45   
ref|XP_004232715.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       167   2e-45   Solanum lycopersicum
ref|XP_010533817.1|  PREDICTED: protein TRANSPARENT TESTA 12-like...    164   2e-45   
emb|CDY33130.1|  BnaCnng07010D                                          163   2e-45   Brassica napus [oilseed rape]
ref|XP_006348111.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       167   3e-45   Solanum tuberosum [potatoes]
ref|XP_006651561.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       166   4e-45   Oryza brachyantha
ref|XP_011037658.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       166   5e-45   Populus euphratica
ref|XP_009614257.1|  PREDICTED: protein TRANSPARENT TESTA 12-like...    166   7e-45   Nicotiana tomentosiformis
gb|ADE77677.1|  unknown                                                 166   7e-45   Picea sitchensis
ref|XP_008384070.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       166   8e-45   Malus domestica [apple tree]
ref|XP_011037659.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       166   9e-45   Populus euphratica
gb|AHI48506.1|  multidrug and toxic extrusion transporter               166   1e-44   Vaccinium corymbosum [American blueberry]
gb|KDP20759.1|  hypothetical protein JCGZ_21230                         161   1e-44   Jatropha curcas
gb|EYU29853.1|  hypothetical protein MIMGU_mgv1a004772mg                165   2e-44   Erythranthe guttata [common monkey flower]
ref|XP_006651562.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       165   2e-44   
ref|XP_009760619.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       164   3e-44   Nicotiana sylvestris
gb|KEH36840.1|  MATE efflux family protein                              164   4e-44   Medicago truncatula
ref|XP_009357445.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       164   4e-44   Pyrus x bretschneideri [bai li]
ref|NP_001147791.1|  transparent testa 12 protein                       164   5e-44   Zea mays [maize]
ref|XP_011048003.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       163   7e-44   Populus euphratica
gb|KDP20758.1|  hypothetical protein JCGZ_21229                         163   9e-44   Jatropha curcas
tpg|DAA62913.1|  TPA: putative MATE efflux family protein               164   1e-43   
ref|XP_002518492.1|  multidrug resistance pump, putative                162   2e-43   Ricinus communis
gb|AAS01961.1|  putative MatE domain containing protein, 3'-partial     155   4e-43   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010665570.1|  PREDICTED: protein TRANSPARENT TESTA 12            161   4e-43   Beta vulgaris subsp. vulgaris [field beet]
gb|EEC75604.1|  hypothetical protein OsI_12313                          161   4e-43   Oryza sativa Indica Group [Indian rice]
ref|XP_006389635.1|  hypothetical protein POPTR_0021s00850g             160   9e-43   Populus trichocarpa [western balsam poplar]
ref|XP_002464323.1|  hypothetical protein SORBIDRAFT_01g016140          160   9e-43   Sorghum bicolor [broomcorn]
gb|AGT17223.1|  MATE efflux family protein                              160   1e-42   Saccharum hybrid cultivar R570
ref|NP_001050520.1|  Os03g0570800                                       159   2e-42   
emb|CDP04391.1|  unnamed protein product                                159   4e-42   Coffea canephora [robusta coffee]
ref|XP_010538707.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       157   1e-41   Tarenaya hassleriana [spider flower]
ref|XP_002274027.2|  PREDICTED: protein TRANSPARENT TESTA 12            156   2e-41   Vitis vinifera
ref|XP_009798075.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       156   3e-41   Nicotiana sylvestris
gb|EAY90719.1|  hypothetical protein OsI_12317                          153   6e-41   Oryza sativa Indica Group [Indian rice]
ref|XP_006417328.1|  hypothetical protein EUTSA_v10007409mg             155   8e-41   
gb|KFK33086.1|  hypothetical protein AALP_AA6G328900                    155   1e-40   
ref|NP_001142368.1|  uncharacterized protein LOC100274540               153   1e-40   
ref|XP_008670448.1|  PREDICTED: LOW QUALITY PROTEIN: protein TRAN...    154   2e-40   
tpg|DAA40987.1|  TPA: putative MATE efflux family protein               154   2e-40   
ref|XP_006307297.1|  hypothetical protein CARUB_v10008916mg             153   3e-40   
ref|XP_010476100.1|  PREDICTED: protein TRANSPARENT TESTA 12-like...    153   3e-40   
emb|CBI23252.3|  unnamed protein product                                149   3e-40   
ref|XP_002892653.1|  mate efflux family protein                         153   4e-40   
gb|AAM98160.1|  unknown protein                                         153   4e-40   
ref|NP_172632.1|  MATE efflux family protein                            153   4e-40   
emb|CDY64820.1|  BnaA08g31640D                                          153   5e-40   
emb|CDY64933.1|  BnaCnng45550D                                          152   5e-40   
ref|XP_009110708.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       152   6e-40   
gb|EMT03955.1|  Protein TRANSPARENT TESTA 12                            153   6e-40   
gb|AAK82541.1|  At1g61890/F8K4_9                                        152   1e-39   
ref|XP_010418166.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       152   1e-39   
ref|XP_002886501.1|  mate efflux family protein                         151   1e-39   
ref|NP_564787.1|  MATE efflux family protein                            151   1e-39   
ref|XP_010458574.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       151   1e-39   
ref|XP_010473410.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       151   2e-39   
ref|XP_008224855.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       151   2e-39   
ref|XP_009118179.1|  PREDICTED: protein TRANSPARENT TESTA 12            151   2e-39   
ref|XP_011100216.1|  PREDICTED: protein TRANSPARENT TESTA 12-like...    150   3e-39   
emb|CDY34637.1|  BnaC08g41960D                                          150   3e-39   
ref|XP_010493132.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       150   4e-39   
emb|CDY47166.1|  BnaA01g22920D                                          150   5e-39   
ref|XP_009105791.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       150   5e-39   
emb|CDY25329.1|  BnaC01g29980D                                          150   5e-39   
ref|XP_011100217.1|  PREDICTED: protein TRANSPARENT TESTA 12-like...    149   7e-39   
ref|XP_010430214.1|  PREDICTED: protein TRANSPARENT TESTA 12-like...    149   9e-39   
dbj|BAJ90668.1|  predicted protein                                      149   1e-38   
tpg|DAA40993.1|  TPA: putative MATE efflux family protein               148   1e-38   
ref|XP_007212709.1|  hypothetical protein PRUPE_ppa018676mg             149   1e-38   
ref|XP_006302163.1|  hypothetical protein CARUB_v10020177mg             148   2e-38   
emb|CDY34833.1|  BnaA09g47590D                                          148   2e-38   
ref|XP_009353369.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       139   4e-38   
ref|NP_001140602.1|  putative MATE efflux family protein isoform 1      147   4e-38   
tpg|DAA40990.1|  TPA: putative MATE efflux family protein               147   4e-38   
gb|KFK37989.1|  hypothetical protein AALP_AA3G055600                    147   4e-38   
ref|XP_008667480.1|  PREDICTED: putative MATE efflux family prote...    147   6e-38   
ref|XP_006391951.1|  hypothetical protein EUTSA_v10023417mg             146   7e-38   
emb|CDY12916.1|  BnaA09g13580D                                          147   7e-38   
emb|CDY19507.1|  BnaC09g13960D                                          147   7e-38   
ref|XP_009113112.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       146   8e-38   
ref|XP_006391952.1|  hypothetical protein EUTSA_v10023417mg             146   1e-37   
gb|EMS53434.1|  Protein TRANSPARENT TESTA 12                            145   1e-37   
emb|CDX94061.1|  BnaC07g36950D                                          145   2e-37   
emb|CDP11781.1|  unnamed protein product                                143   6e-37   
ref|XP_002466898.1|  hypothetical protein SORBIDRAFT_01g016120          144   7e-37   
ref|XP_002460773.1|  hypothetical protein SORBIDRAFT_02g034720          143   1e-36   
emb|CAN60226.1|  hypothetical protein VITISV_039920                     142   2e-36   
emb|CDX94063.1|  BnaC07g36970D                                          143   2e-36   
ref|XP_006282889.1|  hypothetical protein CARUB_v10007133mg             142   2e-36   
ref|XP_009137220.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       142   2e-36   
emb|CDY07256.1|  BnaC04g19150D                                          134   3e-36   
emb|CDX98711.1|  BnaA03g44960D                                          142   3e-36   
ref|XP_009137221.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       142   3e-36   
emb|CDX98712.1|  BnaA03g44970D                                          142   5e-36   
ref|XP_009108539.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       141   5e-36   
ref|XP_010439401.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       140   9e-36   
ref|XP_010434104.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       140   1e-35   
emb|CDX76391.1|  BnaA08g10090D                                          140   1e-35   
gb|AGT17222.1|  MATE efflux family protein                              140   1e-35   
ref|XP_010448968.1|  PREDICTED: protein TRANSPARENT TESTA 12-like...    140   2e-35   
emb|CDY27434.1|  BnaC03g64740D                                          139   3e-35   
ref|XP_009108536.1|  PREDICTED: protein TRANSPARENT TESTA 12-like...    139   4e-35   
emb|CDX98713.1|  BnaA03g44980D                                          138   7e-35   
emb|CAA17158.1|  putative protein                                       137   2e-34   
emb|CBI28938.3|  unnamed protein product                                137   2e-34   
ref|XP_002867813.1|  mate efflux family protein                         137   2e-34   
dbj|BAH19969.1|  AT4G21910                                              137   2e-34   
ref|NP_974587.1|  MATE efflux family protein                            137   2e-34   
emb|CDX79109.1|  BnaA01g11760D                                          137   2e-34   
ref|NP_001190793.1|  MATE efflux family protein                         137   3e-34   
ref|XP_002867814.1|  mate efflux family protein                         136   3e-34   
emb|CDY27431.1|  BnaC03g64710D                                          135   5e-34   
ref|XP_006282967.1|  hypothetical protein CARUB_v10007727mg             135   6e-34   
ref|XP_009135444.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       135   8e-34   
emb|CDX76392.1|  BnaA08g10080D                                          134   1e-33   
ref|XP_006413712.1|  hypothetical protein EUTSA_v10024978mg             134   2e-33   
ref|XP_008646561.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       133   4e-33   
ref|NP_567640.1|  MATE efflux family protein                            133   6e-33   
ref|XP_006413715.1|  hypothetical protein EUTSA_v10024969mg             132   7e-33   
gb|AAM62936.1|  unknown                                                 132   9e-33   
ref|XP_004957863.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       132   1e-32   
gb|EMS67482.1|  Protein TRANSPARENT TESTA 12                            129   6e-32   
ref|XP_010237714.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       130   6e-32   
emb|CBI23254.3|  unnamed protein product                                129   1e-31   
gb|EMT20038.1|  Protein TRANSPARENT TESTA 12                            128   3e-31   
ref|XP_006413716.1|  hypothetical protein EUTSA_v10027142mg             128   3e-31   
dbj|BAC56017.1|  putative ripening regulated protein DDTFR18            127   6e-31   
ref|XP_006651560.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       127   6e-31   
ref|NP_001059785.1|  Os07g0516600                                       127   7e-31   
gb|EEC82143.1|  hypothetical protein OsI_26198                          127   7e-31   
emb|CBI23251.3|  unnamed protein product                                123   1e-29   
emb|CDP04390.1|  unnamed protein product                                122   2e-29   
ref|XP_004299689.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       122   3e-29   
ref|XP_010026078.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       120   3e-28   
gb|EMS63521.1|  Protein TRANSPARENT TESTA 12                            113   3e-28   
gb|KJB64207.1|  hypothetical protein B456_010G037100                    119   4e-28   
gb|EMS54427.1|  Protein TRANSPARENT TESTA 12                            121   4e-28   
ref|XP_009373462.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       119   6e-28   
gb|KDO60642.1|  hypothetical protein CISIN_1g011371mg                   117   7e-28   
ref|XP_006426305.1|  hypothetical protein CICLE_v10025480mg             117   8e-28   
emb|CDP20703.1|  unnamed protein product                                118   8e-28   
ref|XP_008804797.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       118   9e-28   
gb|AAL06936.1|  AT5g38030/F16F17_30                                     116   1e-27   
ref|XP_006292391.1|  hypothetical protein CARUB_v10018603mg             117   1e-27   
ref|NP_001119025.1|  mate efflux domain-containing protein              117   1e-27   
ref|XP_006836338.1|  hypothetical protein AMTR_s00092p00085880          117   1e-27   
ref|NP_001190792.1|  mate efflux domain-containing protein              117   2e-27   
emb|CDP11775.1|  unnamed protein product                                116   2e-27   
ref|XP_010106306.1|  Protein TRANSPARENT TESTA 12                       117   2e-27   
ref|NP_191462.1|  protein TRANSPARENT TESTA 12                          117   2e-27   
ref|XP_006402730.1|  hypothetical protein EUTSA_v10005907mg             117   2e-27   
ref|XP_004250128.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       117   2e-27   
gb|KDO60638.1|  hypothetical protein CISIN_1g011371mg                   117   2e-27   
gb|KFK35144.1|  hypothetical protein AALP_AA5G243900                    117   2e-27   
gb|KDO60639.1|  hypothetical protein CISIN_1g011371mg                   117   3e-27   
ref|XP_010512133.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       117   3e-27   
ref|XP_006426307.1|  hypothetical protein CICLE_v10025480mg             117   3e-27   
ref|XP_010916697.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       117   3e-27   
gb|KDO60641.1|  hypothetical protein CISIN_1g011371mg                   116   3e-27   
ref|XP_006426304.1|  hypothetical protein CICLE_v10025480mg             116   3e-27   
ref|XP_010275892.1|  PREDICTED: protein TRANSPARENT TESTA 12            117   3e-27   
ref|XP_009409170.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       116   4e-27   
gb|KDO60640.1|  hypothetical protein CISIN_1g011371mg                   116   4e-27   
gb|KHG03893.1|  Protein TRANSPARENT TESTA 12 -like protein              115   4e-27   
emb|CDX67772.1|  BnaA07g18120D                                          116   6e-27   
ref|XP_002876486.1|  hypothetical protein ARALYDRAFT_907401             116   6e-27   
ref|XP_006394040.1|  hypothetical protein EUTSA_v100040871mg            112   6e-27   
ref|XP_006466280.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       115   7e-27   
gb|ACU15197.1|  unknown                                                 111   8e-27   
ref|NP_198619.1|  MATE efflux family protein                            115   8e-27   
ref|XP_004501679.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       115   9e-27   
ref|XP_002868811.1|  mate efflux family protein                         115   9e-27   
ref|XP_010060062.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       115   9e-27   
ref|XP_010250482.1|  PREDICTED: protein TRANSPARENT TESTA 12-like...    115   1e-26   
ref|XP_010250481.1|  PREDICTED: protein TRANSPARENT TESTA 12-like...    115   1e-26   
ref|XP_009759747.1|  PREDICTED: protein TRANSPARENT TESTA 12-like...    113   1e-26   
ref|XP_010502591.1|  PREDICTED: protein TRANSPARENT TESTA 12-like...    114   1e-26   
ref|XP_010681039.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       115   1e-26   
ref|XP_006290950.1|  hypothetical protein CARUB_v10017066mg             115   1e-26   
ref|XP_009117173.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       111   1e-26   
ref|XP_009759746.1|  PREDICTED: protein TRANSPARENT TESTA 12-like...    113   1e-26   
ref|XP_010504878.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       115   1e-26   
ref|XP_010026089.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       115   1e-26   
ref|XP_010425356.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       115   2e-26   
ref|XP_009759744.1|  PREDICTED: protein TRANSPARENT TESTA 12-like...    114   2e-26   
ref|XP_010504879.1|  PREDICTED: protein TRANSPARENT TESTA 12            114   2e-26   
ref|XP_006353193.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       114   2e-26   
gb|ACJ36215.1|  transparent testa 12                                    114   2e-26   
gb|ACJ36211.1|  transparent testa 12 isoform 2                          114   2e-26   
ref|XP_009104180.1|  PREDICTED: protein TRANSPARENT TESTA 12            114   2e-26   
ref|XP_010514303.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       114   2e-26   
ref|XP_002285728.2|  PREDICTED: protein TRANSPARENT TESTA 12-like       114   2e-26   
ref|XP_006852302.1|  hypothetical protein AMTR_s00049p00190590          112   3e-26   
emb|CBI19217.3|  unnamed protein product                                114   3e-26   
ref|XP_007224466.1|  hypothetical protein PRUPE_ppa022569mg             114   3e-26   
gb|ABK24651.1|  unknown                                                 114   3e-26   
ref|XP_010681038.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       114   3e-26   
ref|XP_010502590.1|  PREDICTED: protein TRANSPARENT TESTA 12-like...    114   3e-26   
ref|XP_009398326.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       114   4e-26   
ref|XP_004299688.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       113   4e-26   
emb|CDP01534.1|  unnamed protein product                                114   4e-26   
ref|XP_006858200.1|  hypothetical protein AMTR_s00062p00173640          107   4e-26   
ref|XP_008219413.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       113   4e-26   
ref|XP_006466279.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       113   5e-26   
gb|KFK33585.1|  hypothetical protein AALP_AA5G032800                    113   6e-26   
gb|KDO60635.1|  hypothetical protein CISIN_1g011035mg                   112   6e-26   
gb|EMT26283.1|  Protein TRANSPARENT TESTA 12                            106   6e-26   
dbj|BAE98722.1|  hypothetical protein                                   109   6e-26   
gb|KDO60636.1|  hypothetical protein CISIN_1g011035mg                   112   6e-26   
ref|XP_009599386.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       113   7e-26   
dbj|BAE99795.1|  hypothetical protein                                   113   8e-26   
ref|NP_172755.1|  root hair specific 2                                  113   9e-26   
ref|XP_006478600.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       112   9e-26   
ref|XP_007018128.1|  MATE efflux family protein isoform 2               112   9e-26   
gb|KDP35980.1|  hypothetical protein JCGZ_08375                         112   1e-25   
ref|XP_010045479.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       112   1e-25   
gb|KDO60634.1|  hypothetical protein CISIN_1g011035mg                   112   1e-25   
ref|XP_009393552.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       112   1e-25   
ref|XP_010528103.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       112   1e-25   
ref|XP_009601126.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       111   1e-25   
gb|KDP29740.1|  hypothetical protein JCGZ_18675                         112   1e-25   
ref|XP_007018127.1|  MATE efflux family protein isoform 1               112   1e-25   
gb|KFK32791.1|  hypothetical protein AALP_AA6G288700                    112   2e-25   
ref|XP_009150628.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       112   2e-25   
ref|XP_010476276.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       112   2e-25   
ref|XP_009789598.1|  PREDICTED: protein TRANSPARENT TESTA 12-like...    111   2e-25   
ref|XP_003613099.1|  Protein TRANSPARENT TESTA                          112   2e-25   
gb|KDO60633.1|  hypothetical protein CISIN_1g011035mg                   111   2e-25   
ref|XP_006306102.1|  hypothetical protein CARUB_v10011529mg             112   2e-25   
emb|CDY26602.1|  BnaA09g46750D                                          112   2e-25   
ref|XP_006417171.1|  hypothetical protein EUTSA_v10007376mg             112   2e-25   
ref|XP_006433900.1|  hypothetical protein CICLE_v10000950mg             111   2e-25   
gb|KDO81079.1|  hypothetical protein CISIN_1g011186mg                   111   2e-25   
gb|KDO60632.1|  hypothetical protein CISIN_1g011035mg                   111   2e-25   
ref|XP_006472534.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       111   2e-25   
gb|ACJ36209.1|  transparent testa 12 isoform 1                          111   3e-25   
ref|XP_009629826.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       111   3e-25   
ref|XP_006426302.1|  hypothetical protein CICLE_v10025455mg             111   3e-25   
emb|CDY08796.1|  BnaA06g24280D                                          112   3e-25   
emb|CDY61495.1|  BnaC03g74630D                                          112   3e-25   
ref|XP_009591643.1|  PREDICTED: protein TRANSPARENT TESTA 12            111   3e-25   
gb|AIW42903.1|  transparent testa 12                                    111   3e-25   
ref|XP_003561965.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       111   3e-25   
ref|XP_009791264.1|  PREDICTED: protein TRANSPARENT TESTA 12            111   3e-25   
gb|EEC74654.1|  hypothetical protein OsI_10313                          111   3e-25   
gb|KFK43564.1|  hypothetical protein AALP_AA1G142600                    111   3e-25   
ref|XP_011016879.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       111   4e-25   
gb|EEE58464.1|  hypothetical protein OsJ_09708                          110   4e-25   
ref|XP_002302325.2|  hypothetical protein POPTR_0002s10240g             110   4e-25   
gb|KDO45799.1|  hypothetical protein CISIN_1g0118571mg                  109   5e-25   
ref|XP_006827533.1|  hypothetical protein AMTR_s00009p00209360          110   5e-25   
ref|XP_007219057.1|  hypothetical protein PRUPE_ppa004822mg             110   5e-25   
emb|CDY16041.1|  BnaC08g40820D                                          111   5e-25   
ref|XP_010556333.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       110   5e-25   
ref|XP_010494806.1|  PREDICTED: protein TRANSPARENT TESTA 12-like       111   5e-25   
gb|ABR18290.1|  unknown                                                 104   5e-25   



>ref|XP_009630733.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Nicotiana tomentosiformis]
Length=513

 Score =   229 bits (585),  Expect = 8e-69, Method: Compositional matrix adjust.
 Identities = 123/170 (72%), Positives = 146/170 (86%), Gaps = 4/170 (2%)
 Frame = +3

Query  81   MDSSNGAAYDPLPESDGVVS-SPPHEES---EASNELESILMDTGIPRWQRLKLATWIEL  248
            MDSS    Y P  E++G  + SP   E+   E+SNELE++L+DT IP W +L+LATWIE+
Sbjct  1    MDSSKNNTYQPFLENNGTSNLSPQLSETHNFESSNELETVLLDTEIPFWSKLRLATWIEM  60

Query  249  KLLCYLAAPAVVVYMINYLMSMSTQIFSGHLGNLELAAASLGNTGIQIFAYGLMLGMGSA  428
            KLL YLAAPAV+VYMINY+MSMSTQIFSGHLGNLELAAASLGNTGIQ+FAYGLMLGMGSA
Sbjct  61   KLLFYLAAPAVMVYMINYIMSMSTQIFSGHLGNLELAAASLGNTGIQVFAYGLMLGMGSA  120

Query  429  VETLCGQAFGAGKYELLGIYLQRStvlltltgvllalIYVFSEPILIFLG  578
            VETLCGQAFGA K+++LG+YLQRST+LLTLTG+LL  +Y+F +PILIFLG
Sbjct  121  VETLCGQAFGAKKFDMLGVYLQRSTILLTLTGILLTFVYIFCKPILIFLG  170



>ref|XP_009768477.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Nicotiana sylvestris]
Length=513

 Score =   228 bits (582),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 124/170 (73%), Positives = 147/170 (86%), Gaps = 4/170 (2%)
 Frame = +3

Query  81   MDSSNGAAYDPLPESDGVVS-SPPHEES---EASNELESILMDTGIPRWQRLKLATWIEL  248
            MDSS    Y P  +++G  S SP   E+   E+SNELE++L+DT IP W +L+LATWIE+
Sbjct  1    MDSSKNNIYQPFLDNNGNSSLSPQFSETHNFESSNELETVLLDTEIPLWNKLRLATWIEM  60

Query  249  KLLCYLAAPAVVVYMINYLMSMSTQIFSGHLGNLELAAASLGNTGIQIFAYGLMLGMGSA  428
            KLL +LAAPAV+VYMINY+MSMSTQIFSGHLGNLELAAASLGNTGIQ+FAYGLMLGMGSA
Sbjct  61   KLLFHLAAPAVMVYMINYIMSMSTQIFSGHLGNLELAAASLGNTGIQVFAYGLMLGMGSA  120

Query  429  VETLCGQAFGAGKYELLGIYLQRStvlltltgvllalIYVFSEPILIFLG  578
            VETLCGQAFGA KY++LG+YLQRST+LLTLTG+LLA +Y+F +PILIFLG
Sbjct  121  VETLCGQAFGAKKYDMLGVYLQRSTILLTLTGILLAFVYIFCKPILIFLG  170



>gb|KDO54650.1| hypothetical protein CISIN_1g0100251mg, partial [Citrus sinensis]
Length=351

 Score =   216 bits (551),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 122/174 (70%), Positives = 141/174 (81%), Gaps = 8/174 (5%)
 Frame = +3

Query  60   HHLTNSVMDSSNGAAYDPLPESDGVVSSPPHEESEASN-ELESILMDTGIPRWQRLKLAT  236
            HH+   ++ S     + P P +  V+S  P E    SN ELE++L DT +  WQRL+ AT
Sbjct  12   HHIHQPLLQS-----HPPAPPA--VLSPRPSEHKHGSNGELEAVLSDTELSLWQRLRRAT  64

Query  237  WIELKLLCYLAAPAVVVYMINYLMSMSTQIFSGHLGNLELAAASLGNTGIQIFAYGLMLG  416
            WIE KLL +LAAPAV+VYMINYLMSMSTQIFSGHLGNLELAAASLGNTGIQ+FAYGLMLG
Sbjct  65   WIESKLLFHLAAPAVIVYMINYLMSMSTQIFSGHLGNLELAAASLGNTGIQVFAYGLMLG  124

Query  417  MGSAVETLCGQAFGAGKYELLGIYLQRStvlltltgvllalIYVFSEPILIFLG  578
            MGSAVETLCGQA+GA KYE+LGIYLQRS VLLTLTG+L+ ++YVFS PILIFLG
Sbjct  125  MGSAVETLCGQAYGANKYEMLGIYLQRSAVLLTLTGILMTVLYVFSRPILIFLG  178



>ref|XP_009590301.1| PREDICTED: protein TRANSPARENT TESTA 12-like isoform X2 [Nicotiana 
tomentosiformis]
Length=488

 Score =   219 bits (559),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 120/170 (71%), Positives = 143/170 (84%), Gaps = 4/170 (2%)
 Frame = +3

Query  81   MDSSNGAAYDPLPESDGVVSSPPH----EESEASNELESILMDTGIPRWQRLKLATWIEL  248
            M SS      P  E++GV +  P     +  E+++ELE++L+DT +P W RL+LATWIE 
Sbjct  1    MTSSKNEVNQPFLENNGVSALSPQLSTEQNLESNSELETVLLDTSLPLWSRLRLATWIET  60

Query  249  KLLCYLAAPAVVVYMINYLMSMSTQIFSGHLGNLELAAASLGNTGIQIFAYGLMLGMGSA  428
            KLL +LAAPAV+VYMINYLMSMSTQIFSGHLGNLELAAASLGNTGIQIFAYGL+LGMGSA
Sbjct  61   KLLFFLAAPAVMVYMINYLMSMSTQIFSGHLGNLELAAASLGNTGIQIFAYGLLLGMGSA  120

Query  429  VETLCGQAFGAGKYELLGIYLQRStvlltltgvllalIYVFSEPILIFLG  578
            VETLCGQA+GA KY++LG+YLQRST+LLTLTGVLL L+Y+F +PILIFLG
Sbjct  121  VETLCGQAYGARKYDMLGVYLQRSTILLTLTGVLLTLVYIFCKPILIFLG  170



>ref|XP_006351961.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Solanum tuberosum]
Length=512

 Score =   219 bits (559),  Expect = 5e-65, Method: Compositional matrix adjust.
 Identities = 119/169 (70%), Positives = 142/169 (84%), Gaps = 3/169 (2%)
 Frame = +3

Query  81   MDSSNGAAYDPLPESDGVVSSPPHEES---EASNELESILMDTGIPRWQRLKLATWIELK  251
            M S     Y P  +++    SP   E+   E+SNELE++L+DT IP W +L+LATWIE+K
Sbjct  1    MASPENDIYRPFLQNNVTSLSPQLSETHNFESSNELETVLLDTEIPLWSKLRLATWIEMK  60

Query  252  LLCYLAAPAVVVYMINYLMSMSTQIFSGHLGNLELAAASLGNTGIQIFAYGLMLGMGSAV  431
             L +LAAPAV+VYMINY+MSMSTQIFSGHLGNLELAAASLGNTGIQ+FAYGLMLGMGSAV
Sbjct  61   FLFFLAAPAVMVYMINYIMSMSTQIFSGHLGNLELAAASLGNTGIQVFAYGLMLGMGSAV  120

Query  432  ETLCGQAFGAGKYELLGIYLQRStvlltltgvllalIYVFSEPILIFLG  578
            ETLCGQAFGA KY++LG+YLQRSTVLLTLTG+LL ++Y+F +PILIFLG
Sbjct  121  ETLCGQAFGAKKYDMLGVYLQRSTVLLTLTGILLTIMYIFCKPILIFLG  169



>ref|XP_009590300.1| PREDICTED: protein TRANSPARENT TESTA 12-like isoform X1 [Nicotiana 
tomentosiformis]
Length=513

 Score =   219 bits (559),  Expect = 6e-65, Method: Compositional matrix adjust.
 Identities = 120/170 (71%), Positives = 143/170 (84%), Gaps = 4/170 (2%)
 Frame = +3

Query  81   MDSSNGAAYDPLPESDGVVSSPPH----EESEASNELESILMDTGIPRWQRLKLATWIEL  248
            M SS      P  E++GV +  P     +  E+++ELE++L+DT +P W RL+LATWIE 
Sbjct  1    MTSSKNEVNQPFLENNGVSALSPQLSTEQNLESNSELETVLLDTSLPLWSRLRLATWIET  60

Query  249  KLLCYLAAPAVVVYMINYLMSMSTQIFSGHLGNLELAAASLGNTGIQIFAYGLMLGMGSA  428
            KLL +LAAPAV+VYMINYLMSMSTQIFSGHLGNLELAAASLGNTGIQIFAYGL+LGMGSA
Sbjct  61   KLLFFLAAPAVMVYMINYLMSMSTQIFSGHLGNLELAAASLGNTGIQIFAYGLLLGMGSA  120

Query  429  VETLCGQAFGAGKYELLGIYLQRStvlltltgvllalIYVFSEPILIFLG  578
            VETLCGQA+GA KY++LG+YLQRST+LLTLTGVLL L+Y+F +PILIFLG
Sbjct  121  VETLCGQAYGARKYDMLGVYLQRSTILLTLTGVLLTLVYIFCKPILIFLG  170



>ref|XP_004251515.1| PREDICTED: protein TRANSPARENT TESTA 12 [Solanum lycopersicum]
Length=512

 Score =   218 bits (554),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 118/169 (70%), Positives = 142/169 (84%), Gaps = 3/169 (2%)
 Frame = +3

Query  81   MDSSNGAAYDPLPESDGVVSSPPHEES---EASNELESILMDTGIPRWQRLKLATWIELK  251
            M S     Y P  +++    SP   E+   E+SNELE++L+DT I  W +L+LATWIE+K
Sbjct  1    MASPENDIYRPFLQNNVTSLSPQLSETHNFESSNELETVLLDTEITLWSKLRLATWIEMK  60

Query  252  LLCYLAAPAVVVYMINYLMSMSTQIFSGHLGNLELAAASLGNTGIQIFAYGLMLGMGSAV  431
            LL +LAAPAV+VYMINY+MSMSTQIFSGHLGNLELAAASLGNTGIQ+FAYGLMLGMGSAV
Sbjct  61   LLFFLAAPAVMVYMINYIMSMSTQIFSGHLGNLELAAASLGNTGIQVFAYGLMLGMGSAV  120

Query  432  ETLCGQAFGAGKYELLGIYLQRStvlltltgvllalIYVFSEPILIFLG  578
            ETLCGQAFGA KY++LG+YLQRSTVLLTLTG+LL ++Y+F +PILIF+G
Sbjct  121  ETLCGQAFGAKKYDMLGVYLQRSTVLLTLTGILLTIVYIFCKPILIFVG  169



>ref|XP_006447549.1| hypothetical protein CICLE_v10014926mg [Citrus clementina]
 ref|XP_006469688.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Citrus sinensis]
 gb|ESR60789.1| hypothetical protein CICLE_v10014926mg [Citrus clementina]
Length=520

 Score =   216 bits (551),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 122/174 (70%), Positives = 141/174 (81%), Gaps = 8/174 (5%)
 Frame = +3

Query  60   HHLTNSVMDSSNGAAYDPLPESDGVVSSPPHEESEASN-ELESILMDTGIPRWQRLKLAT  236
            HH+   ++ S     + P P +  V+S  P E    SN ELE++L DT +  WQRL+ AT
Sbjct  12   HHIHQPLLQS-----HPPAPPA--VLSPRPSEHKHGSNGELEAVLSDTELSLWQRLRRAT  64

Query  237  WIELKLLCYLAAPAVVVYMINYLMSMSTQIFSGHLGNLELAAASLGNTGIQIFAYGLMLG  416
            WIE KLL +LAAPAV+VYMINYLMSMSTQIFSGHLGNLELAAASLGNTGIQ+FAYGLMLG
Sbjct  65   WIESKLLFHLAAPAVIVYMINYLMSMSTQIFSGHLGNLELAAASLGNTGIQVFAYGLMLG  124

Query  417  MGSAVETLCGQAFGAGKYELLGIYLQRStvlltltgvllalIYVFSEPILIFLG  578
            MGSAVETLCGQA+GA KYE+LGIYLQRS VLLTLTG+L+ ++YVFS PILIFLG
Sbjct  125  MGSAVETLCGQAYGANKYEMLGIYLQRSAVLLTLTGILMTVLYVFSRPILIFLG  178



>emb|CDP11780.1| unnamed protein product [Coffea canephora]
Length=501

 Score =   214 bits (544),  Expect = 7e-63, Method: Compositional matrix adjust.
 Identities = 123/166 (74%), Positives = 136/166 (82%), Gaps = 9/166 (5%)
 Frame = +3

Query  81   MDSSNGAAYDPLPESDGVVSSPPHEESEASNELESILMDTGIPRWQRLKLATWIELKLLC  260
            MDSS+  A  PL          P   ++ S ELE IL D   P  QR + ATWIE+KLL 
Sbjct  1    MDSSSVDASQPLL---------PRTNTQISKELEEILCDNEQPLLQRYRAATWIEMKLLF  51

Query  261  YLAAPAVVVYMINYLMSMSTQIFSGHLGNLELAAASLGNTGIQIFAYGLMLGMGSAVETL  440
            +LAAPAV+VYMINYLMSMSTQIFSGHLGNLELAAASLGNTGIQIFAYGLMLGMGSAVETL
Sbjct  52   HLAAPAVIVYMINYLMSMSTQIFSGHLGNLELAAASLGNTGIQIFAYGLMLGMGSAVETL  111

Query  441  CGQAFGAGKYELLGIYLQRStvlltltgvllalIYVFSEPILIFLG  578
            CGQAFGA KYE+LG+YLQRST+LL+LTGVLLA+IYVFS+PILIFLG
Sbjct  112  CGQAFGAKKYEMLGVYLQRSTILLSLTGVLLAIIYVFSKPILIFLG  157



>emb|CDP11782.1| unnamed protein product [Coffea canephora]
Length=524

 Score =   214 bits (544),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 122/166 (73%), Positives = 135/166 (81%), Gaps = 9/166 (5%)
 Frame = +3

Query  81   MDSSNGAAYDPLPESDGVVSSPPHEESEASNELESILMDTGIPRWQRLKLATWIELKLLC  260
            MDSS+  A  PL          P   ++ S ELE IL D   P  QR + ATWIE+KLL 
Sbjct  1    MDSSSNDAGQPLL---------PRTNTQISKELEEILCDNEQPLLQRYRAATWIEMKLLF  51

Query  261  YLAAPAVVVYMINYLMSMSTQIFSGHLGNLELAAASLGNTGIQIFAYGLMLGMGSAVETL  440
            +LAAPAV+VYMINYLMSMSTQIFSGHLGNLELAAASLGNTGIQIFAYGLMLGMGSAVETL
Sbjct  52   HLAAPAVIVYMINYLMSMSTQIFSGHLGNLELAAASLGNTGIQIFAYGLMLGMGSAVETL  111

Query  441  CGQAFGAGKYELLGIYLQRStvlltltgvllalIYVFSEPILIFLG  578
            CGQAFGA K+E+LGIYLQRST+LL+LTGVLL +IYVFS+PILIFLG
Sbjct  112  CGQAFGAKKFEMLGIYLQRSTILLSLTGVLLTIIYVFSKPILIFLG  157



>ref|XP_004243470.1| PREDICTED: protein TRANSPARENT TESTA 12 [Solanum lycopersicum]
Length=503

 Score =   213 bits (542),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 116/160 (73%), Positives = 136/160 (85%), Gaps = 5/160 (3%)
 Frame = +3

Query  114  LPESDGVVSSPPHEESEASN-----ELESILMDTGIPRWQRLKLATWIELKLLCYLAAPA  278
            +  S+  V+ P  E+S AS+     ELES+L+D  +PRW RL+ ATWIE+KLL  LAAPA
Sbjct  1    MASSENDVNQPFIEKSRASDSESSIELESVLLDHSLPRWNRLRQATWIEMKLLFSLAAPA  60

Query  279  VVVYMINYLMSMSTQIFSGHLGNLELAAASLGNTGIQIFAYGLMLGMGSAVETLCGQAFG  458
            V+VYMINYLMSMSTQIFSGH+GNLELAAASLGNTGIQIF YGLMLGMGSAVETLCGQA+G
Sbjct  61   VMVYMINYLMSMSTQIFSGHIGNLELAAASLGNTGIQIFVYGLMLGMGSAVETLCGQAYG  120

Query  459  AGKYELLGIYLQRStvlltltgvllalIYVFSEPILIFLG  578
            A KY++LG+YLQRST+LL LTGVLL  +YVFS+PIL+FLG
Sbjct  121  ARKYDMLGVYLQRSTILLVLTGVLLTFVYVFSKPILLFLG  160



>ref|XP_010278703.1| PREDICTED: protein TRANSPARENT TESTA 12-like isoform X2 [Nelumbo 
nucifera]
Length=484

 Score =   211 bits (536),  Expect = 6e-62, Method: Compositional matrix adjust.
 Identities = 116/170 (68%), Positives = 138/170 (81%), Gaps = 4/170 (2%)
 Frame = +3

Query  81   MDSSNGAAYDPLPESDGVVSSPPHEESEA----SNELESILMDTGIPRWQRLKLATWIEL  248
            M++S      P+  S    +S   ++S A    S ELE IL D  +P ++R ++ATWIEL
Sbjct  1    METSGEELNQPILHSKSPAASISRQQSAAEQEWSKELEQILSDMQMPAFKRYRVATWIEL  60

Query  249  KLLCYLAAPAVVVYMINYLMSMSTQIFSGHLGNLELAAASLGNTGIQIFAYGLMLGMGSA  428
            KLL YLAAPAV+VYMINY+MSMSTQIFSGHLGNLELAAASLGNTGIQIFAYGLMLGMGSA
Sbjct  61   KLLFYLAAPAVIVYMINYVMSMSTQIFSGHLGNLELAAASLGNTGIQIFAYGLMLGMGSA  120

Query  429  VETLCGQAFGAGKYELLGIYLQRStvlltltgvllalIYVFSEPILIFLG  578
            VETLCGQ++GAGKYE+LGIYLQRST+LL  TG+ LA+IY+ S+P+LIFLG
Sbjct  121  VETLCGQSYGAGKYEMLGIYLQRSTILLMATGIPLAVIYILSKPLLIFLG  170



>emb|CDY19294.1| BnaC01g31860D [Brassica napus]
Length=514

 Score =   211 bits (537),  Expect = 8e-62, Method: Compositional matrix adjust.
 Identities = 126/166 (76%), Positives = 136/166 (82%), Gaps = 3/166 (2%)
 Frame = +3

Query  87   SSNGAAYDPL--PESDGVVSSPPHEESEASNELESILMDTGIPRWQRLKLATWIELKLLC  260
            S N   Y PL  P+SDG V   P  ES ++ ELE +L D   P + RL+ AT IE KLL 
Sbjct  4    SQNDGVYQPLLHPQSDGTVPLSPSTES-SNGELERVLSDVETPLFHRLRKATMIESKLLF  62

Query  261  YLAAPAVVVYMINYLMSMSTQIFSGHLGNLELAAASLGNTGIQIFAYGLMLGMGSAVETL  440
             LAAPAV+VYMINYLMSMSTQIFSGHLGNLELAAASLGNTGIQIFAYGLMLGMGSAVETL
Sbjct  63   KLAAPAVIVYMINYLMSMSTQIFSGHLGNLELAAASLGNTGIQIFAYGLMLGMGSAVETL  122

Query  441  CGQAFGAGKYELLGIYLQRStvlltltgvllalIYVFSEPILIFLG  578
            CGQAFG  KYE+LGIYLQRSTVLLTLTGVLL LIYVFS+PIL+FLG
Sbjct  123  CGQAFGGRKYEMLGIYLQRSTVLLTLTGVLLTLIYVFSKPILLFLG  168



>ref|XP_003605914.1| Transparent testa 12 protein [Medicago truncatula]
 gb|AES88111.1| MATE efflux family protein [Medicago truncatula]
 gb|AFK38335.1| unknown [Medicago truncatula]
Length=519

 Score =   211 bits (538),  Expect = 8e-62, Method: Compositional matrix adjust.
 Identities = 111/142 (78%), Positives = 127/142 (89%), Gaps = 0/142 (0%)
 Frame = +3

Query  153  EESEASNELESILMDTGIPRWQRLKLATWIELKLLCYLAAPAVVVYMINYLMSMSTQIFS  332
             + E+  ELE IL DT +P  +R+KLATW+E KLL YLAAP+V+VY+INY+MSMSTQIFS
Sbjct  35   SKHESDGELERILSDTSVPFVKRIKLATWVEFKLLFYLAAPSVIVYLINYVMSMSTQIFS  94

Query  333  GHLGNLELAAASLGNTGIQIFAYGLMLGMGSAVETLCGQAFGAGKYELLGIYLQRStvll  512
            GHLGNLELAAASLGN GIQIFAYGLMLGMGSAVETLCGQAFGA KYE+LGIYLQRSTVLL
Sbjct  95   GHLGNLELAAASLGNNGIQIFAYGLMLGMGSAVETLCGQAFGAKKYEMLGIYLQRSTVLL  154

Query  513  tltgvllalIYVFSEPILIFLG  578
            T+ G++L +IY+FSEPILIFLG
Sbjct  155  TIAGLILTIIYIFSEPILIFLG  176



>emb|CDY39494.1| BnaA01g24940D [Brassica napus]
Length=514

 Score =   211 bits (536),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 126/166 (76%), Positives = 136/166 (82%), Gaps = 3/166 (2%)
 Frame = +3

Query  87   SSNGAAYDPL--PESDGVVSSPPHEESEASNELESILMDTGIPRWQRLKLATWIELKLLC  260
            S N   Y PL  P+SDG V   P  ES ++ ELE +L D   P + RL+ AT IE KLL 
Sbjct  4    SQNDGVYQPLLHPQSDGTVPLSPSTES-SNGELERVLSDVETPLFHRLRKATMIESKLLF  62

Query  261  YLAAPAVVVYMINYLMSMSTQIFSGHLGNLELAAASLGNTGIQIFAYGLMLGMGSAVETL  440
             LAAPAV+VYMINYLMSMSTQIFSGHLGNLELAAASLGNTGIQIFAYGLMLGMGSAVETL
Sbjct  63   KLAAPAVIVYMINYLMSMSTQIFSGHLGNLELAAASLGNTGIQIFAYGLMLGMGSAVETL  122

Query  441  CGQAFGAGKYELLGIYLQRStvlltltgvllalIYVFSEPILIFLG  578
            CGQAFG  KYE+LGIYLQRSTVLLTLTGVLL LIYVFS+PIL+FLG
Sbjct  123  CGQAFGGRKYEMLGIYLQRSTVLLTLTGVLLTLIYVFSKPILLFLG  168



>ref|XP_010278702.1| PREDICTED: protein TRANSPARENT TESTA 12-like isoform X1 [Nelumbo 
nucifera]
Length=513

 Score =   211 bits (536),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 116/170 (68%), Positives = 138/170 (81%), Gaps = 4/170 (2%)
 Frame = +3

Query  81   MDSSNGAAYDPLPESDGVVSSPPHEESEA----SNELESILMDTGIPRWQRLKLATWIEL  248
            M++S      P+  S    +S   ++S A    S ELE IL D  +P ++R ++ATWIEL
Sbjct  1    METSGEELNQPILHSKSPAASISRQQSAAEQEWSKELEQILSDMQMPAFKRYRVATWIEL  60

Query  249  KLLCYLAAPAVVVYMINYLMSMSTQIFSGHLGNLELAAASLGNTGIQIFAYGLMLGMGSA  428
            KLL YLAAPAV+VYMINY+MSMSTQIFSGHLGNLELAAASLGNTGIQIFAYGLMLGMGSA
Sbjct  61   KLLFYLAAPAVIVYMINYVMSMSTQIFSGHLGNLELAAASLGNTGIQIFAYGLMLGMGSA  120

Query  429  VETLCGQAFGAGKYELLGIYLQRStvlltltgvllalIYVFSEPILIFLG  578
            VETLCGQ++GAGKYE+LGIYLQRST+LL  TG+ LA+IY+ S+P+LIFLG
Sbjct  121  VETLCGQSYGAGKYEMLGIYLQRSTILLMATGIPLAVIYILSKPLLIFLG  170



>ref|XP_009353271.1| PREDICTED: protein TRANSPARENT TESTA 12-like isoform X2 [Pyrus 
x bretschneideri]
Length=512

 Score =   210 bits (535),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 119/175 (68%), Positives = 135/175 (77%), Gaps = 6/175 (3%)
 Frame = +3

Query  54   PPHHLTNSVMDSSNGAAYDPLPESDGVVSSPPHEESEASNELESILMDTGIPRWQRLKLA  233
            P + L + +++S     Y PLP +    S   HEE  AS ELE +L DTG P  QRLK A
Sbjct  4    PKNELQHPLLES-----YPPLPSTKSFTSKHAHEE-HASGELEQVLCDTGKPFSQRLKPA  57

Query  234  TWIELKLLCYLAAPAVVVYMINYLMSMSTQIFSGHLGNLELAAASLGNTGIQIFAYGLML  413
             WIE KLL  LAAPA++VYMINY+MSMSTQIF GHLGNLELAA+SLGN GIQIFAYGL+L
Sbjct  58   LWIESKLLVVLAAPAIIVYMINYVMSMSTQIFCGHLGNLELAASSLGNNGIQIFAYGLLL  117

Query  414  GMGSAVETLCGQAFGAGKYELLGIYLQRStvlltltgvllalIYVFSEPILIFLG  578
            GMGSAVETLCGQA+GA KYE+LGIYLQRS VLL   GVLL +IYVFSEPIL+ LG
Sbjct  118  GMGSAVETLCGQAYGAQKYEMLGIYLQRSAVLLFFPGVLLTIIYVFSEPILLLLG  172



>ref|XP_009353270.1| PREDICTED: protein TRANSPARENT TESTA 12-like isoform X1 [Pyrus 
x bretschneideri]
Length=512

 Score =   210 bits (535),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 119/175 (68%), Positives = 135/175 (77%), Gaps = 6/175 (3%)
 Frame = +3

Query  54   PPHHLTNSVMDSSNGAAYDPLPESDGVVSSPPHEESEASNELESILMDTGIPRWQRLKLA  233
            P + L + +++S     Y PLP +    S   HEE  AS ELE +L DTG P  QRLK A
Sbjct  4    PKNELQHPLLES-----YPPLPSTKSFTSKHAHEE-HASGELEQVLCDTGKPFSQRLKPA  57

Query  234  TWIELKLLCYLAAPAVVVYMINYLMSMSTQIFSGHLGNLELAAASLGNTGIQIFAYGLML  413
             WIE KLL  LAAPA++VYMINY+MSMSTQIF GHLGNLELAA+SLGN GIQIFAYGL+L
Sbjct  58   LWIESKLLVVLAAPAIIVYMINYVMSMSTQIFCGHLGNLELAASSLGNNGIQIFAYGLLL  117

Query  414  GMGSAVETLCGQAFGAGKYELLGIYLQRStvlltltgvllalIYVFSEPILIFLG  578
            GMGSAVETLCGQA+GA KYE+LGIYLQRS VLL   GVLL +IYVFSEPIL+ LG
Sbjct  118  GMGSAVETLCGQAYGAQKYEMLGIYLQRSAVLLFFPGVLLTIIYVFSEPILLLLG  172



>emb|CDY19295.1| BnaC01g31850D [Brassica napus]
Length=304

 Score =   204 bits (518),  Expect = 4e-61, Method: Compositional matrix adjust.
 Identities = 122/169 (72%), Positives = 135/169 (80%), Gaps = 4/169 (2%)
 Frame = +3

Query  81   MDSS-NGAAYDPL--PESDGVVSSPPHEESEASNELESILMDTGIPRWQRLKLATWIELK  251
            MDSS N   Y+ L  P+SDG V   P  ES  + ELE +L D   P + RL+ AT IE K
Sbjct  1    MDSSQNDGLYEQLLHPQSDGTVPLSPSTESR-NGELERVLSDVETPLFHRLRKATMIESK  59

Query  252  LLCYLAAPAVVVYMINYLMSMSTQIFSGHLGNLELAAASLGNTGIQIFAYGLMLGMGSAV  431
            LL  LAAPAV+VYMINY+MSMSTQIF GHLGNLELAAASLGNTGI+ FAYGLMLGMGSAV
Sbjct  60   LLFKLAAPAVIVYMINYMMSMSTQIFPGHLGNLELAAASLGNTGIKTFAYGLMLGMGSAV  119

Query  432  ETLCGQAFGAGKYELLGIYLQRStvlltltgvllalIYVFSEPILIFLG  578
            ETLCGQAFG  KYE+LGIYL+RSTVLLTL GVLL LIYVFS+PIL+FLG
Sbjct  120  ETLCGQAFGGRKYEMLGIYLRRSTVLLTLAGVLLTLIYVFSKPILLFLG  168



>ref|XP_008342001.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Malus domestica]
Length=325

 Score =   204 bits (518),  Expect = 7e-61, Method: Compositional matrix adjust.
 Identities = 113/159 (71%), Positives = 130/159 (82%), Gaps = 1/159 (1%)
 Frame = +3

Query  102  AYDPLPESDGVVSSPPHEESEASNELESILMDTGIPRWQRLKLATWIELKLLCYLAAPAV  281
            +Y PLP +    S   H+E +AS ELE +L DT  P  QRLK A WIE KLL  LAAPA+
Sbjct  13   SYHPLPPTSTQSSKHSHDE-DASRELEQVLSDTDKPFSQRLKPALWIESKLLVILAAPAI  71

Query  282  VVYMINYLMSMSTQIFSGHLGNLELAAASLGNTGIQIFAYGLMLGMGSAVETLCGQAFGA  461
            +VY+INY+MSMSTQIFSGHLGNLELAA+SLGN GIQ+FAYGL+LGMGSAVETLCGQA+GA
Sbjct  72   IVYVINYVMSMSTQIFSGHLGNLELAASSLGNNGIQMFAYGLLLGMGSAVETLCGQAYGA  131

Query  462  GKYELLGIYLQRStvlltltgvllalIYVFSEPILIFLG  578
             KYE+LGIYLQRSTVLL   GVLL +IY+FSEPIL+ LG
Sbjct  132  QKYEMLGIYLQRSTVLLFFPGVLLTIIYIFSEPILLLLG  170



>ref|XP_006375529.1| hypothetical protein POPTR_0014s15140g, partial [Populus trichocarpa]
 gb|ERP53326.1| hypothetical protein POPTR_0014s15140g, partial [Populus trichocarpa]
Length=326

 Score =   204 bits (518),  Expect = 8e-61, Method: Compositional matrix adjust.
 Identities = 113/156 (72%), Positives = 132/156 (85%), Gaps = 3/156 (2%)
 Frame = +3

Query  111  PLPESDGVVSSPPHEESEASNELESILMDTGIPRWQRLKLATWIELKLLCYLAAPAVVVY  290
            P P S  +    P + + +S ELES+L DT +P ++RL+ ATWIE KLLC LAAPAVVVY
Sbjct  19   PSPFSSTI---KPKQSNHSSIELESVLSDTEMPYFKRLRRATWIESKLLCRLAAPAVVVY  75

Query  291  MINYLMSMSTQIFSGHLGNLELAAASLGNTGIQIFAYGLMLGMGSAVETLCGQAFGAGKY  470
            MINYLMSMSTQIFSG LGNLELAAASLGNTGIQ+FAYGLMLGMGSAVETLCGQAFGA KY
Sbjct  76   MINYLMSMSTQIFSGQLGNLELAAASLGNTGIQLFAYGLMLGMGSAVETLCGQAFGAHKY  135

Query  471  ELLGIYLQRStvlltltgvllalIYVFSEPILIFLG  578
             +LG+YLQRST+LL+LTG+LL +IY+F +PIL+ LG
Sbjct  136  GMLGLYLQRSTLLLSLTGILLTIIYIFCKPILVLLG  171



>gb|KFK39487.1| hypothetical protein AALP_AA3G250500 [Arabis alpina]
Length=513

 Score =   208 bits (530),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 125/170 (74%), Positives = 137/170 (81%), Gaps = 4/170 (2%)
 Frame = +3

Query  81   MDSS-NGAAYDPLPESDGVVSSPPH--EESEASN-ELESILMDTGIPRWQRLKLATWIEL  248
            MDSS N   Y PL    G  + PPH    +E++N ELE +L D   P + RL+ AT IE 
Sbjct  1    MDSSQNDGVYQPLLHPHGDATLPPHLPPSTESTNGELERVLSDVETPLFLRLRKATMIES  60

Query  249  KLLCYLAAPAVVVYMINYLMSMSTQIFSGHLGNLELAAASLGNTGIQIFAYGLMLGMGSA  428
            KLL  LAAPAV+VYMINYLMSMSTQIFSGHLGNLELAAASLGNTGIQIFAYGLMLGMGSA
Sbjct  61   KLLFKLAAPAVIVYMINYLMSMSTQIFSGHLGNLELAAASLGNTGIQIFAYGLMLGMGSA  120

Query  429  VETLCGQAFGAGKYELLGIYLQRStvlltltgvllalIYVFSEPILIFLG  578
            VETLCGQA+G  KYE+LGIYLQRSTVLLTLTGV L LIYVFS+PIL+FLG
Sbjct  121  VETLCGQAYGGRKYEMLGIYLQRSTVLLTLTGVFLTLIYVFSKPILLFLG  170



>ref|XP_009145463.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Brassica rapa]
Length=511

 Score =   207 bits (528),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 125/169 (74%), Positives = 137/169 (81%), Gaps = 4/169 (2%)
 Frame = +3

Query  81   MDSSN-GAAYDPL--PESDGVVSSPPHEESEASNELESILMDTGIPRWQRLKLATWIELK  251
            MDSS     Y PL  P +DG V   P  ES ++ ELE +L D   P + RL+ AT IE K
Sbjct  1    MDSSQYDGVYQPLLYPPADGTVPLSPSTES-SNGELERVLSDVETPLFHRLRKATMIESK  59

Query  252  LLCYLAAPAVVVYMINYLMSMSTQIFSGHLGNLELAAASLGNTGIQIFAYGLMLGMGSAV  431
            LL  LAAPAV+VYMINYLMSMSTQIFSGHLGNLELAAASLGNTGIQIFAYGLMLGMGSAV
Sbjct  60   LLFKLAAPAVIVYMINYLMSMSTQIFSGHLGNLELAAASLGNTGIQIFAYGLMLGMGSAV  119

Query  432  ETLCGQAFGAGKYELLGIYLQRStvlltltgvllalIYVFSEPILIFLG  578
            ETLCGQAFG  KYE+LGIYLQRSTVLLTLTG+LL LIY+FS+PIL+FLG
Sbjct  120  ETLCGQAFGGRKYEMLGIYLQRSTVLLTLTGLLLTLIYIFSKPILLFLG  168



>ref|XP_010466422.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Camelina sativa]
Length=506

 Score =   207 bits (526),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 123/167 (74%), Positives = 140/167 (84%), Gaps = 5/167 (3%)
 Frame = +3

Query  81   MDSS-NGAAYDPLPESDGVVSSPPHEESEASNELESILMDTGIPRWQRLKLATWIELKLL  257
            MDSS N  AY PL +S    SSP   ES ++ ELE++L D   P +QRL+ AT IE KLL
Sbjct  1    MDSSQNDGAYQPLLQSQ---SSPSTTES-SNGELETVLSDVETPLFQRLRKATMIESKLL  56

Query  258  CYLAAPAVVVYMINYLMSMSTQIFSGHLGNLELAAASLGNTGIQIFAYGLMLGMGSAVET  437
              LAAPAV+VYMINYLMSMSTQIFSGHLGNLELAAASLGNTGIQ+FAYGL+LGMGSAVET
Sbjct  57   FNLAAPAVIVYMINYLMSMSTQIFSGHLGNLELAAASLGNTGIQVFAYGLLLGMGSAVET  116

Query  438  LCGQAFGAGKYELLGIYLQRStvlltltgvllalIYVFSEPILIFLG  578
            LCGQA+G  KYE+LG+YLQRSTVLLTLTG++L L+YVFSEPIL+FLG
Sbjct  117  LCGQAYGGKKYEMLGVYLQRSTVLLTLTGLVLTLLYVFSEPILLFLG  163



>emb|CDY38631.1| BnaA05g19560D [Brassica napus]
Length=512

 Score =   207 bits (526),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 125/169 (74%), Positives = 137/169 (81%), Gaps = 4/169 (2%)
 Frame = +3

Query  81   MDSSN-GAAYDPL--PESDGVVSSPPHEESEASNELESILMDTGIPRWQRLKLATWIELK  251
            MDSS     Y PL  P +DG V   P  ES ++ ELE +L D   P + RL+ AT IE K
Sbjct  1    MDSSQYDGVYQPLLYPPADGTVPLSPSTES-SNGELERVLSDVETPLFHRLRKATMIESK  59

Query  252  LLCYLAAPAVVVYMINYLMSMSTQIFSGHLGNLELAAASLGNTGIQIFAYGLMLGMGSAV  431
            LL  LAAPAV+VYMINYLMSMSTQIFSGHLGNLELAAASLGNTGIQIFAYGLMLGMGSAV
Sbjct  60   LLFKLAAPAVIVYMINYLMSMSTQIFSGHLGNLELAAASLGNTGIQIFAYGLMLGMGSAV  119

Query  432  ETLCGQAFGAGKYELLGIYLQRStvlltltgvllalIYVFSEPILIFLG  578
            ETLCGQAFG  KYE+LGIYLQRSTVLLTLTG+LL LIY+FS+PIL+FLG
Sbjct  120  ETLCGQAFGGRKYEMLGIYLQRSTVLLTLTGLLLTLIYIFSKPILLFLG  168



>ref|XP_009109391.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Brassica rapa]
Length=511

 Score =   207 bits (526),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 124/166 (75%), Positives = 135/166 (81%), Gaps = 3/166 (2%)
 Frame = +3

Query  87   SSNGAAYDPL--PESDGVVSSPPHEESEASNELESILMDTGIPRWQRLKLATWIELKLLC  260
            S N   Y PL  P+SDG V   P  ES ++ ELE +L +   P + RL+ AT IE KLL 
Sbjct  4    SQNDGVYQPLLHPQSDGTVPLSPSTES-SNGELERVLSNVETPLFHRLRKATMIESKLLF  62

Query  261  YLAAPAVVVYMINYLMSMSTQIFSGHLGNLELAAASLGNTGIQIFAYGLMLGMGSAVETL  440
             LAAPAV+VYMINYLMSMSTQIFSGHLG LELAAASLGNTGIQIFAYGLMLGMGSAVETL
Sbjct  63   KLAAPAVIVYMINYLMSMSTQIFSGHLGTLELAAASLGNTGIQIFAYGLMLGMGSAVETL  122

Query  441  CGQAFGAGKYELLGIYLQRStvlltltgvllalIYVFSEPILIFLG  578
            CGQAFG  KYE+LGIYLQRSTVLLTLTGVLL LIYVFS+PIL+FLG
Sbjct  123  CGQAFGGRKYEMLGIYLQRSTVLLTLTGVLLTLIYVFSKPILLFLG  168



>ref|XP_010510483.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Camelina sativa]
Length=517

 Score =   206 bits (525),  Expect = 5e-60, Method: Compositional matrix adjust.
 Identities = 124/169 (73%), Positives = 140/169 (83%), Gaps = 5/169 (3%)
 Frame = +3

Query  75   SVMDSS-NGAAYDPLPESDGVVSSPPHEESEASNELESILMDTGIPRWQRLKLATWIELK  251
            S MDSS N  AY PL +     SSP   ES ++ ELE++L D   P +QRL+ AT IE K
Sbjct  10   SAMDSSRNDGAYQPLLQPQ---SSPSTTES-SNGELETVLSDVETPLFQRLRKATMIESK  65

Query  252  LLCYLAAPAVVVYMINYLMSMSTQIFSGHLGNLELAAASLGNTGIQIFAYGLMLGMGSAV  431
            LL  LAAPAV+VYMINYLMSMSTQIFSGHLGNLELAAASLGNTGIQ+FAYGL+LGMGSAV
Sbjct  66   LLFNLAAPAVIVYMINYLMSMSTQIFSGHLGNLELAAASLGNTGIQVFAYGLLLGMGSAV  125

Query  432  ETLCGQAFGAGKYELLGIYLQRStvlltltgvllalIYVFSEPILIFLG  578
            ETLCGQA+G  KYE+LGIYLQRSTVLLTLTG++L L+YVFSEPIL+FLG
Sbjct  126  ETLCGQAYGGRKYEMLGIYLQRSTVLLTLTGLVLTLLYVFSEPILLFLG  174



>ref|XP_003540303.1| PREDICTED: protein TRANSPARENT TESTA 12 [Glycine max]
Length=504

 Score =   206 bits (523),  Expect = 9e-60, Method: Compositional matrix adjust.
 Identities = 114/160 (71%), Positives = 134/160 (84%), Gaps = 1/160 (1%)
 Frame = +3

Query  99   AAYDPLPESDGVVSSPPHEESEASNELESILMDTGIPRWQRLKLATWIELKLLCYLAAPA  278
            A  +PL  ++G  S+  HE S +  +LE IL D  +P   R+  ATWIELKLL +LAAPA
Sbjct  4    AEKEPLLTAEGTRSNSKHESS-SHGQLERILSDDTLPFLNRVGPATWIELKLLFFLAAPA  62

Query  279  VVVYMINYLMSMSTQIFSGHLGNLELAAASLGNTGIQIFAYGLMLGMGSAVETLCGQAFG  458
            V+VY+INYLMSMSTQIFSGHLGNLELAAASLGNTGIQ+FAYGLMLGMGSAVETLCGQAFG
Sbjct  63   VIVYLINYLMSMSTQIFSGHLGNLELAAASLGNTGIQMFAYGLMLGMGSAVETLCGQAFG  122

Query  459  AGKYELLGIYLQRStvlltltgvllalIYVFSEPILIFLG  578
            A KY +LG+Y+QRST+LL+L GV+L +IYVFSEP+LIFLG
Sbjct  123  AQKYGMLGVYMQRSTILLSLAGVVLTVIYVFSEPMLIFLG  162



>ref|XP_008379931.1| PREDICTED: protein TRANSPARENT TESTA 12 [Malus domestica]
Length=446

 Score =   204 bits (519),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 114/159 (72%), Positives = 127/159 (80%), Gaps = 1/159 (1%)
 Frame = +3

Query  102  AYDPLPESDGVVSSPPHEESEASNELESILMDTGIPRWQRLKLATWIELKLLCYLAAPAV  281
            +Y PLP +    S   HEE  AS ELE +L DT  P  QRLK A WIE KLL  LAAPA+
Sbjct  15   SYRPLPSTKSFTSKHAHEE-HASGELEQVLCDTYKPFSQRLKPALWIESKLLVVLAAPAI  73

Query  282  VVYMINYLMSMSTQIFSGHLGNLELAAASLGNTGIQIFAYGLMLGMGSAVETLCGQAFGA  461
            +VYMINY+MSMSTQ+F GHLGNLELAA+SLGN GIQIFAYGL+LGMGSAVETLCGQA GA
Sbjct  74   IVYMINYVMSMSTQMFCGHLGNLELAASSLGNNGIQIFAYGLLLGMGSAVETLCGQAHGA  133

Query  462  GKYELLGIYLQRStvlltltgvllalIYVFSEPILIFLG  578
             KY++LGIYLQRSTVLL   GVLL +IYVFSEPIL+ LG
Sbjct  134  QKYKMLGIYLQRSTVLLFFPGVLLTIIYVFSEPILLLLG  172



>ref|XP_004515071.1| PREDICTED: protein TRANSPARENT TESTA 12-like isoform X2 [Cicer 
arietinum]
Length=510

 Score =   205 bits (521),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 113/167 (68%), Positives = 134/167 (80%), Gaps = 1/167 (1%)
 Frame = +3

Query  81   MDSSNGAAYDPLPES-DGVVSSPPHEESEASNELESILMDTGIPRWQRLKLATWIELKLL  257
            MD    A  D  P+    + +     + E+  ELE IL DT +P  +R+ LATW+ELKLL
Sbjct  1    MDEPFLALNDSTPQQPSSIFTHSFGSKHESDGELERILSDTNVPFVKRIPLATWVELKLL  60

Query  258  CYLAAPAVVVYMINYLMSMSTQIFSGHLGNLELAAASLGNTGIQIFAYGLMLGMGSAVET  437
             YLAAPAV+VY+INY+MSMSTQIFSGHLG LELA ASLGNTGIQIFAYGLMLGMGSAVET
Sbjct  61   FYLAAPAVIVYLINYVMSMSTQIFSGHLGTLELAGASLGNTGIQIFAYGLMLGMGSAVET  120

Query  438  LCGQAFGAGKYELLGIYLQRStvlltltgvllalIYVFSEPILIFLG  578
            LCGQAFGA KY++LGIYLQ+S+VLLTL G++L LIY+FS+PILIF+G
Sbjct  121  LCGQAFGAKKYDMLGIYLQKSSVLLTLAGLILTLIYIFSKPILIFIG  167



>emb|CDY69153.1| BnaAnng29470D [Brassica napus]
Length=317

 Score =   200 bits (508),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 119/167 (71%), Positives = 132/167 (79%), Gaps = 6/167 (4%)
 Frame = +3

Query  81   MDSS-NGAAYDPLPESDGVVSSPPHEESEASNELESILMDTGIPRWQRLKLATWIELKLL  257
            MDSS N  AY PL +      SP  E +  ++ELE +L D   P + RL+ AT IE KLL
Sbjct  1    MDSSQNDGAYQPLLQPQ---LSPATESN--NSELERVLSDVETPLFARLRKATMIESKLL  55

Query  258  CYLAAPAVVVYMINYLMSMSTQIFSGHLGNLELAAASLGNTGIQIFAYGLMLGMGSAVET  437
              LAAPAV+VYMINYLMSMSTQIFSGHLGNLELAAASLGNTGIQ+FAYGLMLGMGSAVET
Sbjct  56   FKLAAPAVIVYMINYLMSMSTQIFSGHLGNLELAAASLGNTGIQVFAYGLMLGMGSAVET  115

Query  438  LCGQAFGAGKYELLGIYLQRStvlltltgvllalIYVFSEPILIFLG  578
            LCGQAFG  KY++LGIYLQRS VLLTLTGV L  IYVFS+P L+FLG
Sbjct  116  LCGQAFGGRKYDMLGIYLQRSAVLLTLTGVFLTFIYVFSKPFLLFLG  162



>ref|XP_010551032.1| PREDICTED: protein TRANSPARENT TESTA 12 [Tarenaya hassleriana]
Length=506

 Score =   204 bits (519),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 117/166 (70%), Positives = 133/166 (80%), Gaps = 8/166 (5%)
 Frame = +3

Query  84   DSSNGAAYDPLPESDGVVSSPPHEESE-ASNELESILMDTGIPRWQRLKLATWIELKLLC  260
             S N A Y PL +       P    +E    ELE +L D   P  +R+  ATWIE KLL 
Sbjct  3    SSRNDAVYQPLLQ-------PVAAAAEYGGGELERVLTDAETPAMRRVGRATWIESKLLF  55

Query  261  YLAAPAVVVYMINYLMSMSTQIFSGHLGNLELAAASLGNTGIQIFAYGLMLGMGSAVETL  440
            +LAAPAV+VYMINYLMSMSTQIFSGHLGNLELAAASLGNTGIQ+FAYGLMLGMGSAVETL
Sbjct  56   HLAAPAVIVYMINYLMSMSTQIFSGHLGNLELAAASLGNTGIQVFAYGLMLGMGSAVETL  115

Query  441  CGQAFGAGKYELLGIYLQRStvlltltgvllalIYVFSEPILIFLG  578
            CGQA+GAGK+E+LG+YLQRSTVLLTLTGV+L +IYVFS+PIL+FLG
Sbjct  116  CGQAYGAGKFEMLGVYLQRSTVLLTLTGVILTVIYVFSKPILLFLG  161



>gb|KFK39486.1| hypothetical protein AALP_AA3G250400 [Arabis alpina]
Length=508

 Score =   204 bits (518),  Expect = 5e-59, Method: Compositional matrix adjust.
 Identities = 123/167 (74%), Positives = 133/167 (80%), Gaps = 3/167 (2%)
 Frame = +3

Query  81   MDSS-NGAAYDPLPESDGVVSSPPHEESEASNELESILMDTGIPRWQRLKLATWIELKLL  257
            MDSS N   Y P  +  G  + P  E S    ELE +L D   P + RL+ AT IE KLL
Sbjct  1    MDSSQNDDFYQPFLQPLGDETVPSTESS--IGELERVLSDVETPLFLRLRKATMIESKLL  58

Query  258  CYLAAPAVVVYMINYLMSMSTQIFSGHLGNLELAAASLGNTGIQIFAYGLMLGMGSAVET  437
              LAAPAVVVYMINY MSMSTQIFSGHLGNLELAAASLGNTGIQ+FAYGLMLGMGSAVET
Sbjct  59   FNLAAPAVVVYMINYFMSMSTQIFSGHLGNLELAAASLGNTGIQVFAYGLMLGMGSAVET  118

Query  438  LCGQAFGAGKYELLGIYLQRStvlltltgvllalIYVFSEPILIFLG  578
            LCGQAFG GKYE+LGIYLQRSTVLL+LTGVLL +IYVFSEPIL+FLG
Sbjct  119  LCGQAFGGGKYEMLGIYLQRSTVLLSLTGVLLTVIYVFSEPILLFLG  165



>ref|XP_006406243.1| hypothetical protein EUTSA_v10020526mg [Eutrema salsugineum]
 gb|ESQ47696.1| hypothetical protein EUTSA_v10020526mg [Eutrema salsugineum]
Length=468

 Score =   202 bits (515),  Expect = 5e-59, Method: Compositional matrix adjust.
 Identities = 126/172 (73%), Positives = 138/172 (80%), Gaps = 6/172 (3%)
 Frame = +3

Query  81   MDSS--NGAAYDPLPESDGVVSSPPHE---ESEASN-ELESILMDTGIPRWQRLKLATWI  242
            MDSS   G    PL +     ++PP +    +E+SN ELE +L D   P + RL+ AT I
Sbjct  1    MDSSQTTGLYQQPLLQPHADETAPPPQLSPSTESSNGELERVLSDVETPLFLRLRKATMI  60

Query  243  ELKLLCYLAAPAVVVYMINYLMSMSTQIFSGHLGNLELAAASLGNTGIQIFAYGLMLGMG  422
            E KLL  LAAPAVVVYMINYLMSMSTQIFSGHLGNLELAAASLGNTGIQIFAYGLMLGMG
Sbjct  61   ESKLLFKLAAPAVVVYMINYLMSMSTQIFSGHLGNLELAAASLGNTGIQIFAYGLMLGMG  120

Query  423  SAVETLCGQAFGAGKYELLGIYLQRStvlltltgvllalIYVFSEPILIFLG  578
            SAVETLCGQAFG  KYE+LG+YLQRSTVLLTLTGVLL LIYVFSEPIL+FLG
Sbjct  121  SAVETLCGQAFGGRKYEMLGVYLQRSTVLLTLTGVLLTLIYVFSEPILLFLG  172



>ref|XP_008362257.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Malus domestica]
Length=506

 Score =   203 bits (517),  Expect = 7e-59, Method: Compositional matrix adjust.
 Identities = 113/159 (71%), Positives = 130/159 (82%), Gaps = 1/159 (1%)
 Frame = +3

Query  102  AYDPLPESDGVVSSPPHEESEASNELESILMDTGIPRWQRLKLATWIELKLLCYLAAPAV  281
            +Y PLP +    S   H+E +AS ELE +L DT  P  QRLK A WIE KLL  LAAPA+
Sbjct  13   SYHPLPPTSTQSSKHSHDE-DASRELEQVLSDTDKPFSQRLKPALWIESKLLVILAAPAI  71

Query  282  VVYMINYLMSMSTQIFSGHLGNLELAAASLGNTGIQIFAYGLMLGMGSAVETLCGQAFGA  461
            +VY+INY+MSMSTQIFSGHLGNLELAA+SLGN GIQ+FAYGL+LGMGSAVETLCGQA+GA
Sbjct  72   IVYVINYVMSMSTQIFSGHLGNLELAASSLGNNGIQMFAYGLLLGMGSAVETLCGQAYGA  131

Query  462  GKYELLGIYLQRStvlltltgvllalIYVFSEPILIFLG  578
             KYE+LGIYLQRSTVLL   GVLL +IY+FSEPIL+ LG
Sbjct  132  QKYEMLGIYLQRSTVLLFFPGVLLTIIYIFSEPILLLLG  170



>ref|XP_004144495.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Cucumis sativus]
 ref|XP_004159201.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Cucumis sativus]
 gb|KGN43525.1| hypothetical protein Csa_7G043670 [Cucumis sativus]
Length=510

 Score =   203 bits (516),  Expect = 8e-59, Method: Compositional matrix adjust.
 Identities = 113/149 (76%), Positives = 128/149 (86%), Gaps = 2/149 (1%)
 Frame = +3

Query  138  SSPP--HEESEASNELESILMDTGIPRWQRLKLATWIELKLLCYLAAPAVVVYMINYLMS  311
            + PP    + E S+ELESIL DT +P  QR   ATWIE+KLL YLAAPAV VY+INYLMS
Sbjct  19   TQPPVLSNKHEYSDELESILSDTHLPLLQRYTKATWIEMKLLFYLAAPAVFVYVINYLMS  78

Query  312  MSTQIFSGHLGNLELAAASLGNTGIQIFAYGLMLGMGSAVETLCGQAFGAGKYELLGIYL  491
            MSTQIFSGHLGNLELAA+SLGN GIQIFAYGLMLGMGSAVETLCGQA+GA KY++LGIYL
Sbjct  79   MSTQIFSGHLGNLELAASSLGNNGIQIFAYGLMLGMGSAVETLCGQAYGAEKYDMLGIYL  138

Query  492  QRStvlltltgvllalIYVFSEPILIFLG  578
            QRS++LLTLTG +L LIY+F +PILIFLG
Sbjct  139  QRSSILLTLTGFVLTLIYIFCKPILIFLG  167



>ref|XP_002279330.1| PREDICTED: protein TRANSPARENT TESTA 12 [Vitis vinifera]
Length=507

 Score =   202 bits (514),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 116/166 (70%), Positives = 132/166 (80%), Gaps = 2/166 (1%)
 Frame = +3

Query  81   MDSSNGAAYDPLPESDGVVSSPPHEESEASNELESILMDTGIPRWQRLKLATWIELKLLC  260
            M+SS      P+ +S+  +SS      E S +LESIL DT +P  QRL  ATW ELKLL 
Sbjct  1    MESSRDGVDKPMLQSNPPLSS--ERRPETSGQLESILSDTRLPFCQRLLAATWTELKLLF  58

Query  261  YLAAPAVVVYMINYLMSMSTQIFSGHLGNLELAAASLGNTGIQIFAYGLMLGMGSAVETL  440
             LA PAV VYMINYLMSMSTQIF+GHLGNLELAAASLGNTG+Q+FAYGLMLGMGSAVETL
Sbjct  59   RLAGPAVAVYMINYLMSMSTQIFAGHLGNLELAAASLGNTGVQMFAYGLMLGMGSAVETL  118

Query  441  CGQAFGAGKYELLGIYLQRStvlltltgvllalIYVFSEPILIFLG  578
            CGQAFGA K+E+LGIYLQ+STVLLT+TG LL  IY+F +PILI LG
Sbjct  119  CGQAFGAQKFEMLGIYLQKSTVLLTITGFLLTFIYIFCKPILILLG  164



>ref|XP_006406242.1| hypothetical protein EUTSA_v10020526mg [Eutrema salsugineum]
 gb|ESQ47695.1| hypothetical protein EUTSA_v10020526mg [Eutrema salsugineum]
Length=515

 Score =   202 bits (514),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 126/172 (73%), Positives = 138/172 (80%), Gaps = 6/172 (3%)
 Frame = +3

Query  81   MDSS--NGAAYDPLPESDGVVSSPPHE---ESEASN-ELESILMDTGIPRWQRLKLATWI  242
            MDSS   G    PL +     ++PP +    +E+SN ELE +L D   P + RL+ AT I
Sbjct  1    MDSSQTTGLYQQPLLQPHADETAPPPQLSPSTESSNGELERVLSDVETPLFLRLRKATMI  60

Query  243  ELKLLCYLAAPAVVVYMINYLMSMSTQIFSGHLGNLELAAASLGNTGIQIFAYGLMLGMG  422
            E KLL  LAAPAVVVYMINYLMSMSTQIFSGHLGNLELAAASLGNTGIQIFAYGLMLGMG
Sbjct  61   ESKLLFKLAAPAVVVYMINYLMSMSTQIFSGHLGNLELAAASLGNTGIQIFAYGLMLGMG  120

Query  423  SAVETLCGQAFGAGKYELLGIYLQRStvlltltgvllalIYVFSEPILIFLG  578
            SAVETLCGQAFG  KYE+LG+YLQRSTVLLTLTGVLL LIYVFSEPIL+FLG
Sbjct  121  SAVETLCGQAFGGRKYEMLGVYLQRSTVLLTLTGVLLTLIYVFSEPILLFLG  172



>ref|XP_002883313.1| mate efflux family protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH59572.1| mate efflux family protein [Arabidopsis lyrata subsp. lyrata]
Length=506

 Score =   202 bits (513),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 122/167 (73%), Positives = 136/167 (81%), Gaps = 5/167 (3%)
 Frame = +3

Query  81   MDSS-NGAAYDPLPESDGVVSSPPHEESEASNELESILMDTGIPRWQRLKLATWIELKLL  257
            MDSS N   Y PL        SPP  ES ++ ELE++L D   P + RL+ AT IE KLL
Sbjct  1    MDSSQNDGVYQPLLHPQ---PSPPTTES-SNGELETVLSDVETPLFLRLRKATTIESKLL  56

Query  258  CYLAAPAVVVYMINYLMSMSTQIFSGHLGNLELAAASLGNTGIQIFAYGLMLGMGSAVET  437
              LAAPAV+VYMINYLMSMSTQIFSGHLGNLELAAASLGNTGIQ+FAYGLMLGMGSAVET
Sbjct  57   FNLAAPAVIVYMINYLMSMSTQIFSGHLGNLELAAASLGNTGIQVFAYGLMLGMGSAVET  116

Query  438  LCGQAFGAGKYELLGIYLQRStvlltltgvllalIYVFSEPILIFLG  578
            LCGQA+G  KY++LG+YLQRSTVLLTLTG+LL LIYVFSEPIL+FLG
Sbjct  117  LCGQAYGGRKYDMLGVYLQRSTVLLTLTGLLLTLIYVFSEPILLFLG  163



>emb|CBI28937.3| unnamed protein product [Vitis vinifera]
Length=543

 Score =   202 bits (513),  Expect = 5e-58, Method: Compositional matrix adjust.
 Identities = 116/166 (70%), Positives = 132/166 (80%), Gaps = 2/166 (1%)
 Frame = +3

Query  81   MDSSNGAAYDPLPESDGVVSSPPHEESEASNELESILMDTGIPRWQRLKLATWIELKLLC  260
            M+SS      P+ +S+  +SS      E S +LESIL DT +P  QRL  ATW ELKLL 
Sbjct  37   MESSRDGVDKPMLQSNPPLSS--ERRPETSGQLESILSDTRLPFCQRLLAATWTELKLLF  94

Query  261  YLAAPAVVVYMINYLMSMSTQIFSGHLGNLELAAASLGNTGIQIFAYGLMLGMGSAVETL  440
             LA PAV VYMINYLMSMSTQIF+GHLGNLELAAASLGNTG+Q+FAYGLMLGMGSAVETL
Sbjct  95   RLAGPAVAVYMINYLMSMSTQIFAGHLGNLELAAASLGNTGVQMFAYGLMLGMGSAVETL  154

Query  441  CGQAFGAGKYELLGIYLQRStvlltltgvllalIYVFSEPILIFLG  578
            CGQAFGA K+E+LGIYLQ+STVLLT+TG LL  IY+F +PILI LG
Sbjct  155  CGQAFGAQKFEMLGIYLQKSTVLLTITGFLLTFIYIFCKPILILLG  200



>gb|KHN21236.1| Protein TRANSPARENT TESTA 12 [Glycine soja]
Length=517

 Score =   201 bits (511),  Expect = 7e-58, Method: Compositional matrix adjust.
 Identities = 111/157 (71%), Positives = 131/157 (83%), Gaps = 1/157 (1%)
 Frame = +3

Query  108  DPLPESDGVVSSPPHEESEASNELESILMDTGIPRWQRLKLATWIELKLLCYLAAPAVVV  287
            +P PE      S   +   +  ELE IL +T +P  +RL  ATW+ELKLL +LAAPAV+V
Sbjct  19   EPSPEPPSCTQSFSSKHG-SDGELERILSNTSVPFAKRLGPATWVELKLLFHLAAPAVIV  77

Query  288  YMINYLMSMSTQIFSGHLGNLELAAASLGNTGIQIFAYGLMLGMGSAVETLCGQAFGAGK  467
            Y+INY+MSMSTQIFSGHLGNLELAAASLGNTGIQ+FAYGLMLGMGSAVETLCGQA+GA K
Sbjct  78   YLINYVMSMSTQIFSGHLGNLELAAASLGNTGIQVFAYGLMLGMGSAVETLCGQAYGAKK  137

Query  468  YELLGIYLQRStvlltltgvllalIYVFSEPILIFLG  578
            +++LGIYLQRSTVLLTL G++L +IY+FSEPILIFLG
Sbjct  138  FDMLGIYLQRSTVLLTLAGIILTIIYIFSEPILIFLG  174



>emb|CBI28939.3| unnamed protein product [Vitis vinifera]
Length=353

 Score =   197 bits (500),  Expect = 7e-58, Method: Compositional matrix adjust.
 Identities = 115/172 (67%), Positives = 133/172 (77%), Gaps = 2/172 (1%)
 Frame = +3

Query  60   HHLTNSVMDSSNGAAYDPLPESDGVVSSPPHEESEASNELESILMDTGIPRWQRLKLATW  239
            H    + M+SS     +P+ +S+  +SS     SE S +LESIL DT +P  QRL  AT 
Sbjct  4    HKYLFNPMESSRDGVNEPMLQSNPPLSS--ERRSETSRQLESILSDTRLPFCQRLLAATS  61

Query  240  IELKLLCYLAAPAVVVYMINYLMSMSTQIFSGHLGNLELAAASLGNTGIQIFAYGLMLGM  419
             E KLL  LA PAV VYMINYLMSMSTQIF+GHLGNLELAAASLGNTG+Q+FAYGLMLGM
Sbjct  62   TESKLLFRLAGPAVAVYMINYLMSMSTQIFAGHLGNLELAAASLGNTGVQMFAYGLMLGM  121

Query  420  GSAVETLCGQAFGAGKYELLGIYLQRStvlltltgvllalIYVFSEPILIFL  575
            GSAVETLCGQAFGA K+E+LGIYLQ+STVLLT+TG LL  IY+F +PILI L
Sbjct  122  GSAVETLCGQAFGAQKFEMLGIYLQKSTVLLTITGFLLTFIYIFCKPILILL  173



>ref|XP_008455435.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Cucumis melo]
Length=510

 Score =   201 bits (510),  Expect = 8e-58, Method: Compositional matrix adjust.
 Identities = 109/149 (73%), Positives = 130/149 (87%), Gaps = 2/149 (1%)
 Frame = +3

Query  138  SSPP--HEESEASNELESILMDTGIPRWQRLKLATWIELKLLCYLAAPAVVVYMINYLMS  311
            + PP    + E+S+ELE+IL DT +P  QR   ATWIE+KL+ YLAAPA+ VYM+NYLMS
Sbjct  19   TEPPLLSNKHESSDELEAILSDTHLPLLQRYTKATWIEMKLMFYLAAPAIFVYMVNYLMS  78

Query  312  MSTQIFSGHLGNLELAAASLGNTGIQIFAYGLMLGMGSAVETLCGQAFGAGKYELLGIYL  491
            MSTQIFSGHLGNLELAA+SLGN GIQIFAYGLMLGMGSAVETLCGQA+GA KY++LGIYL
Sbjct  79   MSTQIFSGHLGNLELAASSLGNNGIQIFAYGLMLGMGSAVETLCGQAYGAEKYDMLGIYL  138

Query  492  QRStvlltltgvllalIYVFSEPILIFLG  578
            QRS++LLTLTG++L L+Y+F +PILIFLG
Sbjct  139  QRSSILLTLTGLVLTLVYIFCKPILIFLG  167



>emb|CAN69305.1| hypothetical protein VITISV_021605 [Vitis vinifera]
Length=320

 Score =   195 bits (496),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 115/166 (69%), Positives = 132/166 (80%), Gaps = 2/166 (1%)
 Frame = +3

Query  81   MDSSNGAAYDPLPESDGVVSSPPHEESEASNELESILMDTGIPRWQRLKLATWIELKLLC  260
            M+SS     +P+ +S+  +SS     SE S +LESIL DT +P  QRL  AT  E KLL 
Sbjct  1    MESSRDGVNEPMLQSNPPLSS--EGRSETSGQLESILSDTRLPFCQRLLEATSTESKLLF  58

Query  261  YLAAPAVVVYMINYLMSMSTQIFSGHLGNLELAAASLGNTGIQIFAYGLMLGMGSAVETL  440
             LA PAV VYMINYLMSMSTQIF+GHLGNLELAAASLGNTG+Q+FAYGLMLGMGSAVETL
Sbjct  59   RLAGPAVAVYMINYLMSMSTQIFAGHLGNLELAAASLGNTGVQMFAYGLMLGMGSAVETL  118

Query  441  CGQAFGAGKYELLGIYLQRStvlltltgvllalIYVFSEPILIFLG  578
            CGQAFGA K+E+LGIYLQ+STVLLT+TG LL  IY+F +PILI LG
Sbjct  119  CGQAFGAQKFEMLGIYLQKSTVLLTITGFLLTFIYIFCKPILILLG  164



>emb|CDY33129.1| BnaCnng07000D [Brassica napus]
Length=505

 Score =   199 bits (507),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 119/167 (71%), Positives = 132/167 (79%), Gaps = 6/167 (4%)
 Frame = +3

Query  81   MDSS-NGAAYDPLPESDGVVSSPPHEESEASNELESILMDTGIPRWQRLKLATWIELKLL  257
            MDSS N  AY PL +      SP  E +  ++ELE +L D   P + RL+ AT IE KLL
Sbjct  1    MDSSQNDGAYQPLLQPQ---LSPATESN--NSELERVLSDVETPLFARLRKATMIESKLL  55

Query  258  CYLAAPAVVVYMINYLMSMSTQIFSGHLGNLELAAASLGNTGIQIFAYGLMLGMGSAVET  437
              LAAPAV+VYMINYLMSMSTQIFSGHLGNLELAAASLGNTGIQ+FAYGLMLGMGSAVET
Sbjct  56   FKLAAPAVIVYMINYLMSMSTQIFSGHLGNLELAAASLGNTGIQVFAYGLMLGMGSAVET  115

Query  438  LCGQAFGAGKYELLGIYLQRStvlltltgvllalIYVFSEPILIFLG  578
            LCGQAFG  KY++LGIYLQRS VLLTLTGV L  IYVFS+P L+FLG
Sbjct  116  LCGQAFGGRKYDMLGIYLQRSAVLLTLTGVFLTFIYVFSKPFLLFLG  162



>ref|XP_009145464.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Brassica rapa]
Length=505

 Score =   199 bits (507),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 119/167 (71%), Positives = 132/167 (79%), Gaps = 6/167 (4%)
 Frame = +3

Query  81   MDSS-NGAAYDPLPESDGVVSSPPHEESEASNELESILMDTGIPRWQRLKLATWIELKLL  257
            MDSS N  AY PL +      SP  E +  ++ELE +L D   P + RL+ AT IE KLL
Sbjct  1    MDSSQNDGAYQPLLQPQ---LSPATESN--NSELERVLSDVETPLFARLRKATMIESKLL  55

Query  258  CYLAAPAVVVYMINYLMSMSTQIFSGHLGNLELAAASLGNTGIQIFAYGLMLGMGSAVET  437
              LAAPAV+VYMINYLMSMSTQIFSGHLGNLELAAASLGNTGIQ+FAYGLMLGMGSAVET
Sbjct  56   FKLAAPAVIVYMINYLMSMSTQIFSGHLGNLELAAASLGNTGIQVFAYGLMLGMGSAVET  115

Query  438  LCGQAFGAGKYELLGIYLQRStvlltltgvllalIYVFSEPILIFLG  578
            LCGQAFG  KY++LGIYLQRS VLLTLTGV L  IYVFS+P L+FLG
Sbjct  116  LCGQAFGGRKYDMLGIYLQRSAVLLTLTGVFLTFIYVFSKPFLLFLG  162



>ref|XP_004487410.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Cicer arietinum]
Length=503

 Score =   199 bits (506),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 107/145 (74%), Positives = 123/145 (85%), Gaps = 0/145 (0%)
 Frame = +3

Query  144  PPHEESEASNELESILMDTGIPRWQRLKLATWIELKLLCYLAAPAVVVYMINYLMSMSTQ  323
            P     E+  ELE +L DT +P + R+  ATWIEL+LL +LAAPAV VY+INY+MSMSTQ
Sbjct  16   PGKGAHESDGELERLLSDTTVPYFTRVCSATWIELRLLFFLAAPAVFVYLINYVMSMSTQ  75

Query  324  IFSGHLGNLELAAASLGNTGIQIFAYGLMLGMGSAVETLCGQAFGAGKYELLGIYLQRSt  503
            IFSGHLGNLELAAASLGNTGIQIFAYGLMLGMGSAVETLCGQAFGA K+E+LG YLQRST
Sbjct  76   IFSGHLGNLELAAASLGNTGIQIFAYGLMLGMGSAVETLCGQAFGAEKFEMLGTYLQRST  135

Query  504  vlltltgvllalIYVFSEPILIFLG  578
            +LLT+ G+ L +IYV SEPILIF+G
Sbjct  136  ILLTIAGLFLTVIYVLSEPILIFIG  160



>ref|XP_007045634.1| MATE efflux family protein isoform 2 [Theobroma cacao]
 gb|EOY01466.1| MATE efflux family protein isoform 2 [Theobroma cacao]
Length=424

 Score =   197 bits (501),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 112/167 (67%), Positives = 133/167 (80%), Gaps = 5/167 (3%)
 Frame = +3

Query  78   VMDSSNGAAYDPLPESDGVVSSPPHEESEASNELESILMDTGIPRWQRLKLATWIELKLL  257
            +M SS  +   PL +S        + +SE S+ELE  L D  +  ++R +  TWIE KLL
Sbjct  1    MMGSSQESIQQPLLQSQ-----TSNTKSETSSELEDTLSDARLSLFERFRKGTWIESKLL  55

Query  258  CYLAAPAVVVYMINYLMSMSTQIFSGHLGNLELAAASLGNTGIQIFAYGLMLGMGSAVET  437
             +LAAPAV+VYMINYLMSMSTQIFSGHLGNLELAAASLGNTGIQ+FAYGLMLGMGSAVET
Sbjct  56   FHLAAPAVIVYMINYLMSMSTQIFSGHLGNLELAAASLGNTGIQVFAYGLMLGMGSAVET  115

Query  438  LCGQAFGAGKYELLGIYLQRStvlltltgvllalIYVFSEPILIFLG  578
            LCGQAFGA KY++LGIYLQRS +LLTLTG+LL +IY+ S+PIL+ LG
Sbjct  116  LCGQAFGAHKYDMLGIYLQRSAILLTLTGILLTIIYILSKPILLLLG  162



>ref|XP_010930078.1| PREDICTED: protein TRANSPARENT TESTA 12-like isoform X2 [Elaeis 
guineensis]
Length=494

 Score =   199 bits (505),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 114/176 (65%), Positives = 137/176 (78%), Gaps = 7/176 (4%)
 Frame = +3

Query  57   PHHLTNSVMDSSNGAAYDPLPESDGVVSS--PPHEESEASNELESILMDTGIPRWQRLKL  230
            P  L+  ++  ++     PLP S  + +    PH    +   LESIL +T +P  +RL+L
Sbjct  8    PQKLSTPLLAPADDE--HPLPPSSPITADVDDPHG---SGGRLESILTETSVPWARRLRL  62

Query  231  ATWIELKLLCYLAAPAVVVYMINYLMSMSTQIFSGHLGNLELAAASLGNTGIQIFAYGLM  410
            AT IE+KLL +LAAPAV+VYM+NYLMSMSTQIFSGHLGNLELAAASLGNTGIQ+FAYGLM
Sbjct  63   ATVIEMKLLIHLAAPAVIVYMVNYLMSMSTQIFSGHLGNLELAAASLGNTGIQVFAYGLM  122

Query  411  LGMGSAVETLCGQAFGAGKYELLGIYLQRStvlltltgvllalIYVFSEPILIFLG  578
            LGMGSAVETLCGQA+GA KYE+LG+YLQRST+LL  TGV LA+IY FS PIL+ LG
Sbjct  123  LGMGSAVETLCGQAYGAHKYEMLGVYLQRSTILLMATGVPLAVIYGFSRPILVLLG  178



>emb|CDP17486.1| unnamed protein product [Coffea canephora]
Length=514

 Score =   199 bits (505),  Expect = 4e-57, Method: Compositional matrix adjust.
 Identities = 111/169 (66%), Positives = 134/169 (79%), Gaps = 3/169 (2%)
 Frame = +3

Query  81   MDSSNGAAYDPLPESDG---VVSSPPHEESEASNELESILMDTGIPRWQRLKLATWIELK  251
            M SS  ++Y  LP+++    +  +      EAS+ELE IL +T +P  +R+  ATWIE+K
Sbjct  1    MGSSGDSSYKTLPQNEKKPVLTHTQSQVRKEASDELERILSNTEVPFIKRVVPATWIEIK  60

Query  252  LLCYLAAPAVVVYMINYLMSMSTQIFSGHLGNLELAAASLGNTGIQIFAYGLMLGMGSAV  431
            LL +LAAPAVVVYMINYLMSM TQIFSGHLGNLE AAASLGN G+Q FAYGLMLGMGSAV
Sbjct  61   LLVHLAAPAVVVYMINYLMSMLTQIFSGHLGNLEYAAASLGNNGVQTFAYGLMLGMGSAV  120

Query  432  ETLCGQAFGAGKYELLGIYLQRStvlltltgvllalIYVFSEPILIFLG  578
            ETLCGQA+GA +Y +LGIYLQRS +LLTLTGV L +IY+FS+PIL+ LG
Sbjct  121  ETLCGQAYGAHRYGMLGIYLQRSAILLTLTGVSLTIIYIFSKPILLLLG  169



>ref|XP_010276072.1| PREDICTED: protein TRANSPARENT TESTA 12 [Nelumbo nucifera]
Length=512

 Score =   199 bits (505),  Expect = 4e-57, Method: Compositional matrix adjust.
 Identities = 111/153 (73%), Positives = 125/153 (82%), Gaps = 0/153 (0%)
 Frame = +3

Query  120  ESDGVVSSPPHEESEASNELESILMDTGIPRWQRLKLATWIELKLLCYLAAPAVVVYMIN  299
            +S  V       E   S++LE IL D  IP  +R ++ATWIELK L  LAAPAVVVYMIN
Sbjct  17   KSPSVSRQSSAGEYRWSDQLEKILTDPHIPTLKRYRMATWIELKRLFLLAAPAVVVYMIN  76

Query  300  YLMSMSTQIFSGHLGNLELAAASLGNTGIQIFAYGLMLGMGSAVETLCGQAFGAGKYELL  479
            Y MSMSTQIFSGHLGNLELAAASLGNTGIQ+FAYGLMLGMGSAVETLCGQA+GAGKY +L
Sbjct  77   YSMSMSTQIFSGHLGNLELAAASLGNTGIQVFAYGLMLGMGSAVETLCGQAYGAGKYGML  136

Query  480  GIYLQRStvlltltgvllalIYVFSEPILIFLG  578
            GIYLQRSTV+L  TG+LL +IY+FS+PILI LG
Sbjct  137  GIYLQRSTVILMATGILLMVIYIFSKPILIALG  169



>gb|KEH39009.1| MATE efflux family protein [Medicago truncatula]
Length=461

 Score =   197 bits (501),  Expect = 6e-57, Method: Compositional matrix adjust.
 Identities = 109/147 (74%), Positives = 124/147 (84%), Gaps = 2/147 (1%)
 Frame = +3

Query  138  SSPPHEESEASNELESILMDTGIPRWQRLKLATWIELKLLCYLAAPAVVVYMINYLMSMS  317
            +S  H ES+   ELE IL DT +P + R+  ATWIEL+LL  LAAPAV VY+INY+MSMS
Sbjct  20   TSQKHHESD--GELERILSDTTVPFFSRIGSATWIELRLLFLLAAPAVFVYLINYVMSMS  77

Query  318  TQIFSGHLGNLELAAASLGNTGIQIFAYGLMLGMGSAVETLCGQAFGAGKYELLGIYLQR  497
            TQIFSGHLGNLELAAASLGNTGIQIFAYGLMLGMGSAVETLCGQA+GA KY +LG YLQR
Sbjct  78   TQIFSGHLGNLELAAASLGNTGIQIFAYGLMLGMGSAVETLCGQAYGAEKYGMLGTYLQR  137

Query  498  StvlltltgvllalIYVFSEPILIFLG  578
            ST+LLT+TG  L +IYV SEPIL+F+G
Sbjct  138  STILLTITGFFLTIIYVLSEPILVFIG  164



>emb|CDY24250.1| BnaC03g42230D [Brassica napus]
Length=317

 Score =   193 bits (490),  Expect = 7e-57, Method: Compositional matrix adjust.
 Identities = 120/167 (72%), Positives = 132/167 (79%), Gaps = 6/167 (4%)
 Frame = +3

Query  81   MDSS-NGAAYDPLPESDGVVSSPPHEESEASNELESILMDTGIPRWQRLKLATWIELKLL  257
            MDSS N   Y  L +      SP  E S  + ELE +L D   P + RL+ AT IE KLL
Sbjct  1    MDSSQNDGVYQQLLQPQ---LSPLPESS--NGELERVLSDLETPLFPRLRKATMIESKLL  55

Query  258  CYLAAPAVVVYMINYLMSMSTQIFSGHLGNLELAAASLGNTGIQIFAYGLMLGMGSAVET  437
              LAAPAVVVYMINYLMSMSTQIFSGHLGNLELAAASLGNTGIQ+FAYGLMLGMGSAVET
Sbjct  56   FKLAAPAVVVYMINYLMSMSTQIFSGHLGNLELAAASLGNTGIQVFAYGLMLGMGSAVET  115

Query  438  LCGQAFGAGKYELLGIYLQRStvlltltgvllalIYVFSEPILIFLG  578
            LCGQAFG  KY++LG+YLQRS VLLTLTGVLL +IYVFS+PIL+FLG
Sbjct  116  LCGQAFGGRKYDMLGVYLQRSAVLLTLTGVLLTIIYVFSKPILLFLG  162



>ref|XP_010930069.1| PREDICTED: protein TRANSPARENT TESTA 12-like isoform X1 [Elaeis 
guineensis]
Length=523

 Score =   198 bits (504),  Expect = 7e-57, Method: Compositional matrix adjust.
 Identities = 114/176 (65%), Positives = 137/176 (78%), Gaps = 7/176 (4%)
 Frame = +3

Query  57   PHHLTNSVMDSSNGAAYDPLPESDGVVSS--PPHEESEASNELESILMDTGIPRWQRLKL  230
            P  L+  ++  ++     PLP S  + +    PH    +   LESIL +T +P  +RL+L
Sbjct  8    PQKLSTPLLAPADDE--HPLPPSSPITADVDDPHG---SGGRLESILTETSVPWARRLRL  62

Query  231  ATWIELKLLCYLAAPAVVVYMINYLMSMSTQIFSGHLGNLELAAASLGNTGIQIFAYGLM  410
            AT IE+KLL +LAAPAV+VYM+NYLMSMSTQIFSGHLGNLELAAASLGNTGIQ+FAYGLM
Sbjct  63   ATVIEMKLLIHLAAPAVIVYMVNYLMSMSTQIFSGHLGNLELAAASLGNTGIQVFAYGLM  122

Query  411  LGMGSAVETLCGQAFGAGKYELLGIYLQRStvlltltgvllalIYVFSEPILIFLG  578
            LGMGSAVETLCGQA+GA KYE+LG+YLQRST+LL  TGV LA+IY FS PIL+ LG
Sbjct  123  LGMGSAVETLCGQAYGAHKYEMLGVYLQRSTILLMATGVPLAVIYGFSRPILVLLG  178



>ref|XP_010051023.1| PREDICTED: protein TRANSPARENT TESTA 12 [Eucalyptus grandis]
 gb|KCW89409.1| hypothetical protein EUGRSUZ_A01710 [Eucalyptus grandis]
Length=520

 Score =   198 bits (504),  Expect = 8e-57, Method: Compositional matrix adjust.
 Identities = 118/177 (67%), Positives = 134/177 (76%), Gaps = 11/177 (6%)
 Frame = +3

Query  81   MDSSNGAA----YDPLPESDGVVSSPPHEES-------EASNELESILMDTGIPRWQRLK  227
            M SS  A     YDPLPES  V   P            E S  LES+L D  +    R++
Sbjct  1    MGSSQAAGGDRKYDPLPESTQVPPPPSPRPHRPRPDHHETSGHLESVLSDPSLTLGARVR  60

Query  228  LATWIELKLLCYLAAPAVVVYMINYLMSMSTQIFSGHLGNLELAAASLGNTGIQIFAYGL  407
             A+ IELKLL +LAAPAVVVYMINY+MSMSTQIFSGHLGNLELAAASLGNTGIQ+FAYGL
Sbjct  61   AASRIELKLLFHLAAPAVVVYMINYIMSMSTQIFSGHLGNLELAAASLGNTGIQVFAYGL  120

Query  408  MLGMGSAVETLCGQAFGAGKYELLGIYLQRStvlltltgvllalIYVFSEPILIFLG  578
            MLGMGSAVETLCGQA+GA KYE+LG+YLQR+ VLLT TG LL L+YVFS+P+L+FLG
Sbjct  121  MLGMGSAVETLCGQAYGAHKYEMLGVYLQRAAVLLTATGFLLTLVYVFSKPLLLFLG  177



>ref|XP_008230071.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Prunus mume]
Length=518

 Score =   198 bits (503),  Expect = 9e-57, Method: Compositional matrix adjust.
 Identities = 112/163 (69%), Positives = 133/163 (82%), Gaps = 4/163 (2%)
 Frame = +3

Query  102  AYDPLP----ESDGVVSSPPHEESEASNELESILMDTGIPRWQRLKLATWIELKLLCYLA  269
            +Y P P    + D +     H +  +SNELE +L +T  P  +RLKLA WIE KLL YLA
Sbjct  15   SYPPPPTLTTKHDDLPDLHLHHDLHSSNELERVLSETDRPFLERLKLALWIESKLLFYLA  74

Query  270  APAVVVYMINYLMSMSTQIFSGHLGNLELAAASLGNTGIQIFAYGLMLGMGSAVETLCGQ  449
            +PAV+VYMINY+M+MSTQIF+GHLGNLELAAASLGN GIQ+FAYG+MLGMGSAVETLCGQ
Sbjct  75   SPAVIVYMINYVMAMSTQIFAGHLGNLELAAASLGNNGIQVFAYGVMLGMGSAVETLCGQ  134

Query  450  AFGAGKYELLGIYLQRStvlltltgvllalIYVFSEPILIFLG  578
            A+GA KYE+LGIYLQRSTVLLTLTGVLL ++Y+FS P+LI LG
Sbjct  135  AYGAHKYEMLGIYLQRSTVLLTLTGVLLTIVYIFSRPVLILLG  177



>ref|XP_010923890.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Elaeis guineensis]
Length=523

 Score =   198 bits (503),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 115/178 (65%), Positives = 135/178 (76%), Gaps = 2/178 (1%)
 Frame = +3

Query  45   PRFPPHHLTNSVMDSSNGAAYDPLPESDGVVSSPPHEESEASNELESILMDTGIPRWQRL  224
            P   P  L+  ++  S+     PLP S   ++    +   +S  LE IL DT IP  +RL
Sbjct  3    PVASPEKLSTPLLVPSDDD--QPLPTSTPSMAGDVDDPHGSSGRLERILTDTSIPWARRL  60

Query  225  KLATWIELKLLCYLAAPAVVVYMINYLMSMSTQIFSGHLGNLELAAASLGNTGIQIFAYG  404
             LAT IE+KLL +LAAPAV+VYM+NY+MSMSTQIFSGHLGNLELAA+SLGN GIQ+FAYG
Sbjct  61   PLATAIEMKLLIHLAAPAVIVYMLNYVMSMSTQIFSGHLGNLELAASSLGNNGIQVFAYG  120

Query  405  LMLGMGSAVETLCGQAFGAGKYELLGIYLQRStvlltltgvllalIYVFSEPILIFLG  578
            LMLGMGSAVETLCGQAFGA K+E+LGIYLQRSTVLL  TGV LA+IY FS PIL+ LG
Sbjct  121  LMLGMGSAVETLCGQAFGANKHEMLGIYLQRSTVLLMATGVPLAVIYGFSRPILVLLG  178



>gb|KHN41220.1| Protein TRANSPARENT TESTA 12 [Glycine soja]
Length=517

 Score =   197 bits (502),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 112/164 (68%), Positives = 132/164 (80%), Gaps = 7/164 (4%)
 Frame = +3

Query  108  DPLPESDGVVSSPPHEESEA-------SNELESILMDTGIPRWQRLKLATWIELKLLCYL  266
            +PL  SD   S  P   +++         ELE IL +T +P  +R+  ATW+ELK L +L
Sbjct  12   EPLLVSDEPSSPQPPSFTQSFSSRHGSDGELERILSNTSVPFAKRIGPATWVELKFLFHL  71

Query  267  AAPAVVVYMINYLMSMSTQIFSGHLGNLELAAASLGNTGIQIFAYGLMLGMGSAVETLCG  446
            AAPAV+VY+INY+MSMSTQIFSGHLGNLELAAASLGNTGIQ+FAYGLMLGMGSAVETLCG
Sbjct  72   AAPAVIVYLINYVMSMSTQIFSGHLGNLELAAASLGNTGIQVFAYGLMLGMGSAVETLCG  131

Query  447  QAFGAGKYELLGIYLQRStvlltltgvllalIYVFSEPILIFLG  578
            QA+GA K+ +LGIYLQRSTVLLTL G+LL +IY+FSEPILIFLG
Sbjct  132  QAYGAKKFNMLGIYLQRSTVLLTLAGILLTIIYIFSEPILIFLG  175



>ref|XP_010510494.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Camelina sativa]
Length=506

 Score =   197 bits (501),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 117/166 (70%), Positives = 134/166 (81%), Gaps = 3/166 (2%)
 Frame = +3

Query  81   MDSSNGAAYDPLPESDGVVSSPPHEESEASNELESILMDTGIPRWQRLKLATWIELKLLC  260
            MDSS     D       +  SP   ES ++ ELE++L D   P +QRL+ AT IE KLL 
Sbjct  1    MDSSRNDGVDQALLQRQL--SPKTTES-SNGELETVLSDVETPLFQRLRKATMIESKLLF  57

Query  261  YLAAPAVVVYMINYLMSMSTQIFSGHLGNLELAAASLGNTGIQIFAYGLMLGMGSAVETL  440
             LAAPAV+VYMINYLMSMSTQIFSGHLGNLELAAASLGNTGIQ+FAYGL+LGMGSAVETL
Sbjct  58   NLAAPAVIVYMINYLMSMSTQIFSGHLGNLELAAASLGNTGIQVFAYGLLLGMGSAVETL  117

Query  441  CGQAFGAGKYELLGIYLQRStvlltltgvllalIYVFSEPILIFLG  578
            CGQA+GA KYE+LG+YLQRSTVLLT+T +LL L+YVFSEPIL+FLG
Sbjct  118  CGQAYGARKYEMLGVYLQRSTVLLTITSLLLTLLYVFSEPILLFLG  163



>ref|XP_010930135.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Elaeis guineensis]
Length=523

 Score =   197 bits (502),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 109/156 (70%), Positives = 126/156 (81%), Gaps = 0/156 (0%)
 Frame = +3

Query  111  PLPESDGVVSSPPHEESEASNELESILMDTGIPRWQRLKLATWIELKLLCYLAAPAVVVY  290
            PLP S   +     +   +   LESIL D   PR +RL+LAT +E+KLL +LAAP V+VY
Sbjct  23   PLPPSSPSMDGDIDDPHGSRGRLESILTDPSFPRARRLQLATIVEMKLLVHLAAPTVIVY  82

Query  291  MINYLMSMSTQIFSGHLGNLELAAASLGNTGIQIFAYGLMLGMGSAVETLCGQAFGAGKY  470
            M+NY+MSMSTQIFSGHLGNLELAAASLGNTGIQ+FAYGLMLGMGSAVETLCGQA+GA KY
Sbjct  83   MLNYVMSMSTQIFSGHLGNLELAAASLGNTGIQVFAYGLMLGMGSAVETLCGQAYGAHKY  142

Query  471  ELLGIYLQRStvlltltgvllalIYVFSEPILIFLG  578
             +LGIYLQRST+LL  TGV LA+IYVFS PIL+ LG
Sbjct  143  GMLGIYLQRSTILLMATGVPLAVIYVFSRPILLLLG  178



>dbj|BAJ34540.1| unnamed protein product [Thellungiella halophila]
Length=505

 Score =   197 bits (500),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 122/170 (72%), Positives = 134/170 (79%), Gaps = 12/170 (7%)
 Frame = +3

Query  81   MDSS-NGAAYDPLPESDGVVSSPPHEE--SEASN-ELESILMDTGIPRWQRLKLATWIEL  248
            MDSS N     PL +        PH +  +E+SN ELE +L D   P   RL+ AT IE 
Sbjct  1    MDSSQNDGVNQPLLQ--------PHADHGTESSNGELERVLSDVETPLSSRLRKATMIES  52

Query  249  KLLCYLAAPAVVVYMINYLMSMSTQIFSGHLGNLELAAASLGNTGIQIFAYGLMLGMGSA  428
            KLL  LAAPAV+VYMINY MSMSTQIFSGHLGNLELAAASLGNTGIQ+FAYGLMLGMGSA
Sbjct  53   KLLFKLAAPAVIVYMINYFMSMSTQIFSGHLGNLELAAASLGNTGIQVFAYGLMLGMGSA  112

Query  429  VETLCGQAFGAGKYELLGIYLQRStvlltltgvllalIYVFSEPILIFLG  578
            VETLCGQAFG  KYE+LG+YLQRSTVLLTLTGVLL +IYVFSEPIL+FLG
Sbjct  113  VETLCGQAFGGRKYEMLGVYLQRSTVLLTLTGVLLTIIYVFSEPILLFLG  162



>ref|XP_009388870.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Musa acuminata 
subsp. malaccensis]
Length=521

 Score =   197 bits (500),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 113/164 (69%), Positives = 129/164 (79%), Gaps = 0/164 (0%)
 Frame = +3

Query  87   SSNGAAYDPLPESDGVVSSPPHEESEASNELESILMDTGIPRWQRLKLATWIELKLLCYL  266
            + N     PLP S     +   E   AS +LE +L D  IP  +R+ LA+ IE+KLL +L
Sbjct  15   TGNDDVDQPLPPSTPPAMADEGEAHGASGQLEIVLNDASIPWARRMWLASLIEMKLLVFL  74

Query  267  AAPAVVVYMINYLMSMSTQIFSGHLGNLELAAASLGNTGIQIFAYGLMLGMGSAVETLCG  446
            AAPAV+VYMINY+MSMSTQIFSGHLGNLELAAASLGNTGIQIFAYGLMLGMGSAVETLCG
Sbjct  75   AAPAVMVYMINYVMSMSTQIFSGHLGNLELAAASLGNTGIQIFAYGLMLGMGSAVETLCG  134

Query  447  QAFGAGKYELLGIYLQRStvlltltgvllalIYVFSEPILIFLG  578
            QA+GA KYE+LGIY+QRSTVLL  TGV LA+IY FS PIL+ LG
Sbjct  135  QAYGAHKYEMLGIYMQRSTVLLMATGVPLAVIYAFSRPILVLLG  178



>ref|XP_003596992.1| Transparent testa 12 protein [Medicago truncatula]
 gb|AES67243.1| MATE efflux family protein [Medicago truncatula]
Length=507

 Score =   196 bits (499),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 109/147 (74%), Positives = 124/147 (84%), Gaps = 2/147 (1%)
 Frame = +3

Query  138  SSPPHEESEASNELESILMDTGIPRWQRLKLATWIELKLLCYLAAPAVVVYMINYLMSMS  317
            +S  H ES+   ELE IL DT +P + R+  ATWIEL+LL  LAAPAV VY+INY+MSMS
Sbjct  20   TSQKHHESD--GELERILSDTTVPFFSRIGSATWIELRLLFLLAAPAVFVYLINYVMSMS  77

Query  318  TQIFSGHLGNLELAAASLGNTGIQIFAYGLMLGMGSAVETLCGQAFGAGKYELLGIYLQR  497
            TQIFSGHLGNLELAAASLGNTGIQIFAYGLMLGMGSAVETLCGQA+GA KY +LG YLQR
Sbjct  78   TQIFSGHLGNLELAAASLGNTGIQIFAYGLMLGMGSAVETLCGQAYGAEKYGMLGTYLQR  137

Query  498  StvlltltgvllalIYVFSEPILIFLG  578
            ST+LLT+TG  L +IYV SEPIL+F+G
Sbjct  138  STILLTITGFFLTIIYVLSEPILVFIG  164



>ref|XP_007215031.1| hypothetical protein PRUPE_ppa004291mg [Prunus persica]
 gb|EMJ16230.1| hypothetical protein PRUPE_ppa004291mg [Prunus persica]
Length=518

 Score =   197 bits (500),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 112/163 (69%), Positives = 130/163 (80%), Gaps = 4/163 (2%)
 Frame = +3

Query  102  AYDPLP----ESDGVVSSPPHEESEASNELESILMDTGIPRWQRLKLATWIELKLLCYLA  269
            +Y P P    + D +     H +  +SNELE +L DT  P  +RLK A WIE KLL YLA
Sbjct  15   SYPPPPTLTTKHDDLPDLHLHHDLHSSNELERVLSDTNRPFLERLKPALWIESKLLFYLA  74

Query  270  APAVVVYMINYLMSMSTQIFSGHLGNLELAAASLGNTGIQIFAYGLMLGMGSAVETLCGQ  449
            APAV+VYMINY+MSMSTQIF+GHLGNLELAAASLGN GI IF+YGL+LGMGSAVETLCGQ
Sbjct  75   APAVIVYMINYVMSMSTQIFAGHLGNLELAAASLGNNGILIFSYGLLLGMGSAVETLCGQ  134

Query  450  AFGAGKYELLGIYLQRStvlltltgvllalIYVFSEPILIFLG  578
            A+GA KYE+LGIYLQRST+LLTL GVLL ++Y+FS PILI LG
Sbjct  135  AYGAHKYEMLGIYLQRSTILLTLGGVLLTIVYIFSRPILILLG  177



>ref|XP_010466426.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Camelina sativa]
Length=506

 Score =   196 bits (499),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 116/161 (72%), Positives = 135/161 (84%), Gaps = 8/161 (5%)
 Frame = +3

Query  117  PESDGV-------VSSPPHEESEASNELESILMDTGIPRWQRLKLATWIELKLLCYLAAP  275
            P++DGV        SSP   ES ++ ELE++L D   P  QRL+ AT IE KLL  LAAP
Sbjct  4    PQNDGVDQPLLQPQSSPSTTES-SNGELETVLSDVETPLVQRLRKATMIESKLLFNLAAP  62

Query  276  AVVVYMINYLMSMSTQIFSGHLGNLELAAASLGNTGIQIFAYGLMLGMGSAVETLCGQAF  455
            AV+VYMINYLMSMST+IFSGHLGNLELAAASLGNTGIQ+F+YGL+LGMGSAVETLCGQA+
Sbjct  63   AVIVYMINYLMSMSTRIFSGHLGNLELAAASLGNTGIQVFSYGLLLGMGSAVETLCGQAY  122

Query  456  GAGKYELLGIYLQRStvlltltgvllalIYVFSEPILIFLG  578
            GA KYE+LG+YLQRSTVLLTLTG++L L+YVFSEPIL+FLG
Sbjct  123  GARKYEMLGVYLQRSTVLLTLTGLVLTLLYVFSEPILLFLG  163



>ref|XP_003526327.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Glycine max]
Length=517

 Score =   197 bits (500),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 106/135 (79%), Positives = 122/135 (90%), Gaps = 0/135 (0%)
 Frame = +3

Query  174  ELESILMDTGIPRWQRLKLATWIELKLLCYLAAPAVVVYMINYLMSMSTQIFSGHLGNLE  353
            ELE IL +T +P  +R+  ATW+ELK L +LAAPAV+VY+INY+MSMSTQIFSGHLGNLE
Sbjct  41   ELERILSNTSVPFAKRIGPATWVELKFLFHLAAPAVIVYLINYVMSMSTQIFSGHLGNLE  100

Query  354  LAAASLGNTGIQIFAYGLMLGMGSAVETLCGQAFGAGKYELLGIYLQRStvlltltgvll  533
            LAAASLGNTGIQ+FAYGLMLGMGSAVETLCGQA+GA K+ +LGIYLQRSTVLLTL G+LL
Sbjct  101  LAAASLGNTGIQVFAYGLMLGMGSAVETLCGQAYGAKKFNMLGIYLQRSTVLLTLAGILL  160

Query  534  alIYVFSEPILIFLG  578
             +IY+FSEPILIFLG
Sbjct  161  TIIYIFSEPILIFLG  175



>ref|XP_007045633.1| MATE efflux family protein isoform 1 [Theobroma cacao]
 gb|EOY01465.1| MATE efflux family protein isoform 1 [Theobroma cacao]
Length=504

 Score =   196 bits (498),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 112/167 (67%), Positives = 133/167 (80%), Gaps = 5/167 (3%)
 Frame = +3

Query  78   VMDSSNGAAYDPLPESDGVVSSPPHEESEASNELESILMDTGIPRWQRLKLATWIELKLL  257
            +M SS  +   PL +S        + +SE S+ELE  L D  +  ++R +  TWIE KLL
Sbjct  1    MMGSSQESIQQPLLQSQ-----TSNTKSETSSELEDTLSDARLSLFERFRKGTWIESKLL  55

Query  258  CYLAAPAVVVYMINYLMSMSTQIFSGHLGNLELAAASLGNTGIQIFAYGLMLGMGSAVET  437
             +LAAPAV+VYMINYLMSMSTQIFSGHLGNLELAAASLGNTGIQ+FAYGLMLGMGSAVET
Sbjct  56   FHLAAPAVIVYMINYLMSMSTQIFSGHLGNLELAAASLGNTGIQVFAYGLMLGMGSAVET  115

Query  438  LCGQAFGAGKYELLGIYLQRStvlltltgvllalIYVFSEPILIFLG  578
            LCGQAFGA KY++LGIYLQRS +LLTLTG+LL +IY+ S+PIL+ LG
Sbjct  116  LCGQAFGAHKYDMLGIYLQRSAILLTLTGILLTIIYILSKPILLLLG  162



>ref|XP_008812639.1| PREDICTED: protein TRANSPARENT TESTA 12 [Phoenix dactylifera]
Length=522

 Score =   196 bits (499),  Expect = 4e-56, Method: Compositional matrix adjust.
 Identities = 116/180 (64%), Positives = 137/180 (76%), Gaps = 7/180 (4%)
 Frame = +3

Query  45   PRFPPHHLTNSVMDSSNGAAYDPLPESDGVVSS--PPHEESEASNELESILMDTGIPRWQ  218
            P   P  L   ++  S+     PLP S  + +    PH    +S  LESIL DT +   +
Sbjct  3    PAASPEKLRTPLLGPSDDD--QPLPSSSPMAADMDDPHG---SSGRLESILTDTSLSWAR  57

Query  219  RLKLATWIELKLLCYLAAPAVVVYMINYLMSMSTQIFSGHLGNLELAAASLGNTGIQIFA  398
            RL+LAT IE+KLL +LAAPAV+VYM+NY+MSMSTQIFSGHLGNLELAAASLGNTGIQ+FA
Sbjct  58   RLQLATIIEMKLLIHLAAPAVIVYMLNYVMSMSTQIFSGHLGNLELAAASLGNTGIQVFA  117

Query  399  YGLMLGMGSAVETLCGQAFGAGKYELLGIYLQRStvlltltgvllalIYVFSEPILIFLG  578
            YGLMLGMGSAVETLCGQA+GA KYE+LGIYLQRST+LL  TGV LA+IY FS P+L+ LG
Sbjct  118  YGLMLGMGSAVETLCGQAYGAHKYEMLGIYLQRSTILLMATGVPLAVIYAFSRPLLVLLG  177



>ref|XP_010930104.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Elaeis guineensis]
Length=522

 Score =   196 bits (498),  Expect = 5e-56, Method: Compositional matrix adjust.
 Identities = 114/159 (72%), Positives = 128/159 (81%), Gaps = 7/159 (4%)
 Frame = +3

Query  111  PLPESD---GVVSSPPHEESEASNELESILMDTGIPRWQRLKLATWIELKLLCYLAAPAV  281
            PLP S    G V  P      +S  LESIL DT +P  +RL+LAT +E+KLL +LA PAV
Sbjct  23   PLPPSSPTTGTVDDP----HGSSGRLESILTDTTVPWSRRLRLATIVEMKLLLHLAGPAV  78

Query  282  VVYMINYLMSMSTQIFSGHLGNLELAAASLGNTGIQIFAYGLMLGMGSAVETLCGQAFGA  461
             VYM+NY+MSMSTQIFSGHLGNLELAAASLGN GIQIFAYGLMLGMGSAVETLCGQA+GA
Sbjct  79   TVYMLNYVMSMSTQIFSGHLGNLELAAASLGNNGIQIFAYGLMLGMGSAVETLCGQAYGA  138

Query  462  GKYELLGIYLQRStvlltltgvllalIYVFSEPILIFLG  578
             KYE+LGIYLQRST+LL  TGVLLA+IY FS PIL+ LG
Sbjct  139  HKYEMLGIYLQRSTILLMATGVLLAVIYAFSRPILLLLG  177



>ref|XP_003633309.1| PREDICTED: LOW QUALITY PROTEIN: protein TRANSPARENT TESTA 12 
[Vitis vinifera]
Length=507

 Score =   195 bits (496),  Expect = 7e-56, Method: Compositional matrix adjust.
 Identities = 114/165 (69%), Positives = 131/165 (79%), Gaps = 2/165 (1%)
 Frame = +3

Query  81   MDSSNGAAYDPLPESDGVVSSPPHEESEASNELESILMDTGIPRWQRLKLATWIELKLLC  260
            M+SS     +P+ +S+  +SS     SE S +LESIL DT +P  QRL  AT  E KLL 
Sbjct  1    MESSRDGVNEPMLQSNPPLSS--ERRSETSRQLESILSDTRLPFCQRLLAATSTESKLLF  58

Query  261  YLAAPAVVVYMINYLMSMSTQIFSGHLGNLELAAASLGNTGIQIFAYGLMLGMGSAVETL  440
             LA PAV VYMINYLMSMSTQIF+GHLGNLELAAASLGNTG+Q+FAYGLMLGMGSAVETL
Sbjct  59   RLAGPAVAVYMINYLMSMSTQIFAGHLGNLELAAASLGNTGVQMFAYGLMLGMGSAVETL  118

Query  441  CGQAFGAGKYELLGIYLQRStvlltltgvllalIYVFSEPILIFL  575
            CGQAFGA K+E+LGIYLQ+STVLLT+TG LL  IY+F +PILI L
Sbjct  119  CGQAFGAQKFEMLGIYLQKSTVLLTITGFLLTFIYIFCKPILILL  163



>ref|XP_002279487.1| PREDICTED: protein TRANSPARENT TESTA 12 [Vitis vinifera]
Length=507

 Score =   195 bits (495),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 115/166 (69%), Positives = 132/166 (80%), Gaps = 2/166 (1%)
 Frame = +3

Query  81   MDSSNGAAYDPLPESDGVVSSPPHEESEASNELESILMDTGIPRWQRLKLATWIELKLLC  260
            M+SS     +P+ +S+  +SS     SE S +LESIL DT +P  QRL  AT  E KLL 
Sbjct  1    MESSRDGVNEPMLQSNPPLSS--EGRSETSGQLESILSDTRLPFCQRLLEATSTESKLLF  58

Query  261  YLAAPAVVVYMINYLMSMSTQIFSGHLGNLELAAASLGNTGIQIFAYGLMLGMGSAVETL  440
             LA PAV VYMINYLMSMSTQIF+GHLGNLELAAASLGNTG+Q+FAYGLMLGMGSAVETL
Sbjct  59   RLAGPAVAVYMINYLMSMSTQIFAGHLGNLELAAASLGNTGVQMFAYGLMLGMGSAVETL  118

Query  441  CGQAFGAGKYELLGIYLQRStvlltltgvllalIYVFSEPILIFLG  578
            CGQAFGA K+E+LGIYLQ+STVLLT+TG LL  IY+F +PILI LG
Sbjct  119  CGQAFGAQKFEMLGIYLQKSTVLLTITGFLLTFIYIFCKPILILLG  164



>ref|XP_004487408.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Cicer arietinum]
Length=507

 Score =   195 bits (495),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 108/157 (69%), Positives = 128/157 (82%), Gaps = 3/157 (2%)
 Frame = +3

Query  108  DPLPESDGVVSSPPHEESEASNELESILMDTGIPRWQRLKLATWIELKLLCYLAAPAVVV  287
            +PL  S+ +     HE   +  ELE +L DT +P  +R+  ATWIEL+LL +LAAPAV V
Sbjct  11   EPLLLSNNIGKPNLHE---SDGELERLLSDTTVPFLRRVGSATWIELRLLFFLAAPAVFV  67

Query  288  YMINYLMSMSTQIFSGHLGNLELAAASLGNTGIQIFAYGLMLGMGSAVETLCGQAFGAGK  467
            Y+INY+MSMSTQIFSGHLGNLELAAASLGNTGIQ+ AYGLMLGMGSAVETLCGQAFGA K
Sbjct  68   YLINYVMSMSTQIFSGHLGNLELAAASLGNTGIQMLAYGLMLGMGSAVETLCGQAFGAEK  127

Query  468  YELLGIYLQRStvlltltgvllalIYVFSEPILIFLG  578
            +E+LG YLQRST+LLT+ G+ L +IYV SEPILIF+G
Sbjct  128  FEMLGTYLQRSTILLTIAGLFLTVIYVLSEPILIFIG  164



>ref|XP_009402851.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Musa acuminata 
subsp. malaccensis]
Length=486

 Score =   194 bits (493),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 108/141 (77%), Positives = 122/141 (87%), Gaps = 0/141 (0%)
 Frame = +3

Query  156  ESEASNELESILMDTGIPRWQRLKLATWIELKLLCYLAAPAVVVYMINYLMSMSTQIFSG  335
            ES AS +LESIL D  IP  +R+ +A+ +E+KLL YLAAPAV+VYM+NY+MSMSTQIFSG
Sbjct  4    ESGASQKLESILSDNSIPWARRIWMASLVEMKLLVYLAAPAVMVYMLNYVMSMSTQIFSG  63

Query  336  HLGNLELAAASLGNTGIQIFAYGLMLGMGSAVETLCGQAFGAGKYELLGIYLQRStvllt  515
            HLGNLELAAASLGNTGIQIFAYGLMLGMGSAVETLCGQA+GA KYE+LG+YLQRSTVLL 
Sbjct  64   HLGNLELAAASLGNTGIQIFAYGLMLGMGSAVETLCGQAYGAHKYEMLGVYLQRSTVLLM  123

Query  516  ltgvllalIYVFSEPILIFLG  578
             TGV LA IY  S PIL+ LG
Sbjct  124  ATGVPLAAIYALSRPILVLLG  144



>ref|XP_002279276.2| PREDICTED: protein TRANSPARENT TESTA 12 [Vitis vinifera]
 emb|CBI28936.3| unnamed protein product [Vitis vinifera]
Length=515

 Score =   194 bits (494),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 114/174 (66%), Positives = 134/174 (77%), Gaps = 10/174 (6%)
 Frame = +3

Query  81   MDSSNGAAYDPLPESDGVVSSPP--------HEESEASNELESILMDTGIPRWQRLKLAT  236
            M SS      P+ +SD   S PP           SE S +LESIL +T +   +RL+LAT
Sbjct  1    MKSSPEVVQKPILQSDD--SDPPLSSSLQSDDTRSETSAQLESILSNTQLRLSERLRLAT  58

Query  237  WIELKLLCYLAAPAVVVYMINYLMSMSTQIFSGHLGNLELAAASLGNTGIQIFAYGLMLG  416
            W ELKLL YLA PAV+VYMI Y+MSM+TQIF GHLGNLELAAASLGN GIQIFAYGL+LG
Sbjct  59   WTELKLLFYLAGPAVLVYMIGYVMSMATQIFVGHLGNLELAAASLGNNGIQIFAYGLLLG  118

Query  417  MGSAVETLCGQAFGAGKYELLGIYLQRStvlltltgvllalIYVFSEPILIFLG  578
            MGSAVETLCGQA+GA K+++LGIYLQ+STVLLT+TGVLL  +Y+FS+PILI LG
Sbjct  119  MGSAVETLCGQAYGAKKFDMLGIYLQKSTVLLTITGVLLTFVYIFSKPILILLG  172



>ref|XP_010930090.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Elaeis guineensis]
Length=520

 Score =   194 bits (494),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 111/158 (70%), Positives = 125/158 (79%), Gaps = 5/158 (3%)
 Frame = +3

Query  111  PLPESDGVVSS--PPHEESEASNELESILMDTGIPRWQRLKLATWIELKLLCYLAAPAVV  284
            PLP S  V      PH    +S  LESIL DT IP  +RL+LAT IE+KLL +LA P+V 
Sbjct  23   PLPPSSPVTGDIDDPHG---SSGRLESILTDTSIPWARRLRLATIIEMKLLLHLAVPSVT  79

Query  285  VYMINYLMSMSTQIFSGHLGNLELAAASLGNTGIQIFAYGLMLGMGSAVETLCGQAFGAG  464
            VYM+NY+MSMST I SGHLGNLELAAASLGN GIQ+FAYGLMLGMGSAVETLCGQA+GA 
Sbjct  80   VYMLNYVMSMSTTIISGHLGNLELAAASLGNAGIQVFAYGLMLGMGSAVETLCGQAYGAH  139

Query  465  KYELLGIYLQRStvlltltgvllalIYVFSEPILIFLG  578
            KYE+LGIYLQRST+LL  T V LA+IY FS PIL+FLG
Sbjct  140  KYEMLGIYLQRSTILLMATAVPLAVIYAFSRPILLFLG  177



>ref|XP_009109403.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Brassica rapa]
Length=506

 Score =   193 bits (491),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 118/167 (71%), Positives = 130/167 (78%), Gaps = 5/167 (3%)
 Frame = +3

Query  81   MDSS-NGAAYDPLPESDGVVSSPPHEESEASNELESILMDTGIPRWQRLKLATWIELKLL  257
            MDS+     Y PL + D +  SP  E +    ELE +L D   P + RL+ AT IE KLL
Sbjct  1    MDSAQTDGVYQPLLQPDQL--SPLPESNNC--ELERVLADVETPLFLRLRKATMIETKLL  56

Query  258  CYLAAPAVVVYMINYLMSMSTQIFSGHLGNLELAAASLGNTGIQIFAYGLMLGMGSAVET  437
              LAAPAV+VYMINYLMSMSTQIFSGHLGNLELAAASLGN GIQ+FAYGLMLGMGSAVET
Sbjct  57   FKLAAPAVIVYMINYLMSMSTQIFSGHLGNLELAAASLGNRGIQVFAYGLMLGMGSAVET  116

Query  438  LCGQAFGAGKYELLGIYLQRStvlltltgvllalIYVFSEPILIFLG  578
            LCGQAFG  KYE+LG+YLQRS VLLTLTGVLL  IYVFSE IL+FLG
Sbjct  117  LCGQAFGGRKYEMLGVYLQRSIVLLTLTGVLLTSIYVFSENILLFLG  163



>emb|CDX92916.1| BnaA03g36380D [Brassica napus]
Length=505

 Score =   193 bits (491),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 119/167 (71%), Positives = 132/167 (79%), Gaps = 6/167 (4%)
 Frame = +3

Query  81   MDSSN-GAAYDPLPESDGVVSSPPHEESEASNELESILMDTGIPRWQRLKLATWIELKLL  257
            MDSS     Y PL +      SP  E S  + ELE +L D   P + RL+ AT IE KLL
Sbjct  1    MDSSQYDVVYQPLLQPQ---LSPLPESS--NGELERVLSDLETPLFLRLRKATMIESKLL  55

Query  258  CYLAAPAVVVYMINYLMSMSTQIFSGHLGNLELAAASLGNTGIQIFAYGLMLGMGSAVET  437
              LAAPAV+VYMINYLMSMSTQIFSGHLGNLELAAASLGNTGIQ+FAYGLMLGMGSAVET
Sbjct  56   FKLAAPAVIVYMINYLMSMSTQIFSGHLGNLELAAASLGNTGIQVFAYGLMLGMGSAVET  115

Query  438  LCGQAFGAGKYELLGIYLQRStvlltltgvllalIYVFSEPILIFLG  578
            LCGQAFG  KY++LG+YLQRS VLLTLTGVLL +IYVFS+PIL+FLG
Sbjct  116  LCGQAFGGRKYDMLGVYLQRSAVLLTLTGVLLTIIYVFSKPILLFLG  162



>ref|XP_006383933.1| hypothetical protein POPTR_0004s01620g [Populus trichocarpa]
 gb|ERP61730.1| hypothetical protein POPTR_0004s01620g [Populus trichocarpa]
Length=499

 Score =   193 bits (491),  Expect = 4e-55, Method: Compositional matrix adjust.
 Identities = 101/153 (66%), Positives = 125/153 (82%), Gaps = 0/153 (0%)
 Frame = +3

Query  120  ESDGVVSSPPHEESEASNELESILMDTGIPRWQRLKLATWIELKLLCYLAAPAVVVYMIN  299
            ++  + S   H +   SNELE IL +   P  +RL+LA+W+ELKLL  LAAPAV+VY++N
Sbjct  4    DTSRLSSKVSHHDETVSNELEEILTNNQSPYSKRLRLASWVELKLLFQLAAPAVIVYLLN  63

Query  300  YLMSMSTQIFSGHLGNLELAAASLGNTGIQIFAYGLMLGMGSAVETLCGQAFGAGKYELL  479
             ++SMSTQIF GHLGNLELAA SLGNTGIQ+FAYGL+LGMGSAVETLCGQA+GA +YE+L
Sbjct  64   NVISMSTQIFCGHLGNLELAAVSLGNTGIQVFAYGLLLGMGSAVETLCGQAYGANRYEIL  123

Query  480  GIYLQRStvlltltgvllalIYVFSEPILIFLG  578
            GIYLQRST+LL LT + L +IY+FS+PILI LG
Sbjct  124  GIYLQRSTILLMLTALPLMVIYIFSKPILILLG  156



>emb|CDY65669.1| BnaCnng48120D [Brassica napus]
Length=495

 Score =   193 bits (490),  Expect = 4e-55, Method: Compositional matrix adjust.
 Identities = 114/165 (69%), Positives = 126/165 (76%), Gaps = 4/165 (2%)
 Frame = +3

Query  84   DSSNGAAYDPLPESDGVVSSPPHEESEASNELESILMDTGIPRWQRLKLATWIELKLLCY  263
             +     Y PL + D + + P  +  E    LE +L D   P + RL+ AT IE KLL  
Sbjct  3    SAQTDGVYQPLLQPDQLSALPESKNCE----LERVLADVETPLFLRLRKATMIETKLLFK  58

Query  264  LAAPAVVVYMINYLMSMSTQIFSGHLGNLELAAASLGNTGIQIFAYGLMLGMGSAVETLC  443
            LAAPAVVVYMINYLMSMSTQIFSGHLGNLELAAASLGN GIQ+FAYGLMLGMGSAVETLC
Sbjct  59   LAAPAVVVYMINYLMSMSTQIFSGHLGNLELAAASLGNRGIQVFAYGLMLGMGSAVETLC  118

Query  444  GQAFGAGKYELLGIYLQRStvlltltgvllalIYVFSEPILIFLG  578
            GQAFG  KYE+LG+YLQRS VLLTLTGVLL  IYVFSE IL+FLG
Sbjct  119  GQAFGGRKYEMLGVYLQRSIVLLTLTGVLLTSIYVFSENILLFLG  163



>gb|KGN43526.1| hypothetical protein Csa_7G043680 [Cucumis sativus]
Length=517

 Score =   193 bits (490),  Expect = 6e-55, Method: Compositional matrix adjust.
 Identities = 102/142 (72%), Positives = 119/142 (84%), Gaps = 0/142 (0%)
 Frame = +3

Query  153  EESEASNELESILMDTGIPRWQRLKLATWIELKLLCYLAAPAVVVYMINYLMSMSTQIFS  332
               + S+ELE +L DT +   +R  LA+WIE+KL+ YLAAPAV VY+INYLMSMSTQIFS
Sbjct  29   NHHKTSDELEKVLSDTQLSVLRRYSLASWIEMKLMFYLAAPAVFVYVINYLMSMSTQIFS  88

Query  333  GHLGNLELAAASLGNTGIQIFAYGLMLGMGSAVETLCGQAFGAGKYELLGIYLQRStvll  512
            GHLGNLELAA+SLGN GIQ+FAYGLMLGMGSAVETLCGQA+GA KY +LGIYLQRS +LL
Sbjct  89   GHLGNLELAASSLGNNGIQLFAYGLMLGMGSAVETLCGQAYGAQKYHMLGIYLQRSIILL  148

Query  513  tltgvllalIYVFSEPILIFLG  578
            TLTG  +  IY+F +PILIFLG
Sbjct  149  TLTGFAITTIYIFCKPILIFLG  170



>ref|XP_009135765.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Brassica rapa]
Length=505

 Score =   192 bits (489),  Expect = 7e-55, Method: Compositional matrix adjust.
 Identities = 118/167 (71%), Positives = 131/167 (78%), Gaps = 6/167 (4%)
 Frame = +3

Query  81   MDSSN-GAAYDPLPESDGVVSSPPHEESEASNELESILMDTGIPRWQRLKLATWIELKLL  257
            MDSS     Y PL +        P  ES  + ELE +L D   P + RL+ AT IE KLL
Sbjct  1    MDSSQYDVVYQPLLQPQ----LSPLPESN-NGELERVLSDLETPLFPRLRKATMIESKLL  55

Query  258  CYLAAPAVVVYMINYLMSMSTQIFSGHLGNLELAAASLGNTGIQIFAYGLMLGMGSAVET  437
              LAAPAV+VYMINYLMSMSTQIFSGHLGNLELAAASLGNTGIQ+FAYGLMLGMGSAVET
Sbjct  56   FKLAAPAVIVYMINYLMSMSTQIFSGHLGNLELAAASLGNTGIQVFAYGLMLGMGSAVET  115

Query  438  LCGQAFGAGKYELLGIYLQRStvlltltgvllalIYVFSEPILIFLG  578
            LCGQAFG  KY++LG+YLQRS VLLTLTGVLL +IYVFS+PIL+FLG
Sbjct  116  LCGQAFGGRKYDMLGVYLQRSAVLLTLTGVLLTIIYVFSKPILLFLG  162



>ref|XP_004159226.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Cucumis sativus]
Length=507

 Score =   192 bits (489),  Expect = 8e-55, Method: Compositional matrix adjust.
 Identities = 108/157 (69%), Positives = 127/157 (81%), Gaps = 6/157 (4%)
 Frame = +3

Query  108  DPLPESDGVVSSPPHEESEASNELESILMDTGIPRWQRLKLATWIELKLLCYLAAPAVVV  287
            +PL E     S+P H+    S ELE+IL DT +    R++ A WIELKLL  LAAPAV V
Sbjct  8    EPLVEQ----SAPKHDA--VSGELENILSDTQLRYVVRIRRAAWIELKLLSKLAAPAVFV  61

Query  288  YMINYLMSMSTQIFSGHLGNLELAAASLGNTGIQIFAYGLMLGMGSAVETLCGQAFGAGK  467
            Y+IN LMSMST+IFSG LGNL+LAAASLGN G+QIFAYGLMLGMGSAVETLCGQA+GAGK
Sbjct  62   YLINNLMSMSTRIFSGQLGNLQLAAASLGNNGVQIFAYGLMLGMGSAVETLCGQAYGAGK  121

Query  468  YELLGIYLQRStvlltltgvllalIYVFSEPILIFLG  578
            YE+LGIYLQRST+LLT+   LL L+Y+FS+PIL+FLG
Sbjct  122  YEMLGIYLQRSTILLTMVAFLLTLLYIFSKPILLFLG  158



>gb|KDO75455.1| hypothetical protein CISIN_1g010798mg [Citrus sinensis]
Length=444

 Score =   191 bits (485),  Expect = 8e-55, Method: Compositional matrix adjust.
 Identities = 98/161 (61%), Positives = 129/161 (80%), Gaps = 9/161 (6%)
 Frame = +3

Query  96   GAAYDPLPESDGVVSSPPHEESEASNELESILMDTGIPRWQRLKLATWIELKLLCYLAAP  275
             A Y P+ ES         E ++AS  LE++L DT +  ++RL++A+W+ELKLL  LAAP
Sbjct  7    AAQYQPIIES---------EATDASRRLENVLSDTNLSCFKRLQIASWLELKLLVRLAAP  57

Query  276  AVVVYMINYLMSMSTQIFSGHLGNLELAAASLGNTGIQIFAYGLMLGMGSAVETLCGQAF  455
            AV VY+IN LMS+ST++F GHLGNLELAAASLGN+GIQ+FAYGLMLGMGSAVETLCGQA+
Sbjct  58   AVFVYLINNLMSLSTRVFCGHLGNLELAAASLGNSGIQLFAYGLMLGMGSAVETLCGQAY  117

Query  456  GAGKYELLGIYLQRStvlltltgvllalIYVFSEPILIFLG  578
            GAG+YE+LG+Y+QR+T +L  TGV + ++Y+F +P+LI LG
Sbjct  118  GAGRYEMLGVYMQRATFVLLATGVPVMMVYIFCKPMLILLG  158



>gb|KFK39485.1| hypothetical protein AALP_AA3G250300 [Arabis alpina]
Length=510

 Score =   192 bits (488),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 120/169 (71%), Positives = 131/169 (78%), Gaps = 5/169 (3%)
 Frame = +3

Query  81   MDSS-NGAAYDPL--PESDGVVSSPPHEESEASNELESILMDTGIPRWQRLKLATWIELK  251
            MDSS N   Y PL  P  DG + SP  E    + ELE +L D   P +  L+ AT IE K
Sbjct  1    MDSSQNEGVYQPLIQPHGDGTLPSPLSESR--NGELERVLSDFEAPLFLCLRKATIIESK  58

Query  252  LLCYLAAPAVVVYMINYLMSMSTQIFSGHLGNLELAAASLGNTGIQIFAYGLMLGMGSAV  431
            LL  LAAPAV+VYMIN  MSMSTQIFSGHLGNLELAAASLGNTGIQ FAYGLMLGMGSAV
Sbjct  59   LLFKLAAPAVIVYMINNFMSMSTQIFSGHLGNLELAAASLGNTGIQGFAYGLMLGMGSAV  118

Query  432  ETLCGQAFGAGKYELLGIYLQRStvlltltgvllalIYVFSEPILIFLG  578
            ETLCGQA+G  KYE+LG+YLQRSTVLLTLTGV L LIYVFS+PIL+FLG
Sbjct  119  ETLCGQAYGGRKYEMLGVYLQRSTVLLTLTGVFLTLIYVFSKPILLFLG  167



>gb|KDO75454.1| hypothetical protein CISIN_1g010798mg [Citrus sinensis]
Length=456

 Score =   191 bits (485),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 98/161 (61%), Positives = 129/161 (80%), Gaps = 9/161 (6%)
 Frame = +3

Query  96   GAAYDPLPESDGVVSSPPHEESEASNELESILMDTGIPRWQRLKLATWIELKLLCYLAAP  275
             A Y P+ ES         E ++AS  LE++L DT +  ++RL++A+W+ELKLL  LAAP
Sbjct  7    AAQYQPIIES---------EATDASRRLENVLSDTNLSCFKRLQIASWLELKLLVRLAAP  57

Query  276  AVVVYMINYLMSMSTQIFSGHLGNLELAAASLGNTGIQIFAYGLMLGMGSAVETLCGQAF  455
            AV VY+IN LMS+ST++F GHLGNLELAAASLGN+GIQ+FAYGLMLGMGSAVETLCGQA+
Sbjct  58   AVFVYLINNLMSLSTRVFCGHLGNLELAAASLGNSGIQLFAYGLMLGMGSAVETLCGQAY  117

Query  456  GAGKYELLGIYLQRStvlltltgvllalIYVFSEPILIFLG  578
            GAG+YE+LG+Y+QR+T +L  TGV + ++Y+F +P+LI LG
Sbjct  118  GAGRYEMLGVYMQRATFVLLATGVPVMMVYIFCKPMLILLG  158



>ref|XP_006297470.1| hypothetical protein CARUB_v10013491mg [Capsella rubella]
 gb|EOA30368.1| hypothetical protein CARUB_v10013491mg [Capsella rubella]
Length=507

 Score =   192 bits (488),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 119/167 (71%), Positives = 132/167 (79%), Gaps = 4/167 (2%)
 Frame = +3

Query  81   MDSS-NGAAYDPLPESDGVVSSPPHEESEASNELESILMDTGIPRWQRLKLATWIELKLL  257
            MDSS N     PL     +  SP   ES  + ELE++L D   P  QRL+ AT IE KLL
Sbjct  1    MDSSQNDGVSQPLLHPPQL--SPSTTESN-NGELETVLSDVETPLLQRLRKATMIESKLL  57

Query  258  CYLAAPAVVVYMINYLMSMSTQIFSGHLGNLELAAASLGNTGIQIFAYGLMLGMGSAVET  437
              LAAPAV+VYMINYLMSMSTQIFSGHLGNLELAAASLGNTGIQ+FAYGLMLGMGSAVET
Sbjct  58   FNLAAPAVIVYMINYLMSMSTQIFSGHLGNLELAAASLGNTGIQVFAYGLMLGMGSAVET  117

Query  438  LCGQAFGAGKYELLGIYLQRStvlltltgvllalIYVFSEPILIFLG  578
            LCGQA+G  KYE+LG+YLQRSTVLLTLTG+LL L+YVFSEP L+ LG
Sbjct  118  LCGQAYGGKKYEMLGVYLQRSTVLLTLTGLLLTLLYVFSEPFLLLLG  164



>gb|KGN43522.1| Mate efflux family protein [Cucumis sativus]
Length=507

 Score =   192 bits (488),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 108/157 (69%), Positives = 127/157 (81%), Gaps = 6/157 (4%)
 Frame = +3

Query  108  DPLPESDGVVSSPPHEESEASNELESILMDTGIPRWQRLKLATWIELKLLCYLAAPAVVV  287
            +PL E     S+P H+    S ELE+IL DT +    R++ A WIELKLL  LAAPAV V
Sbjct  8    EPLVEQ----SAPKHDA--VSGELENILSDTQLRYVVRIRRAAWIELKLLSKLAAPAVFV  61

Query  288  YMINYLMSMSTQIFSGHLGNLELAAASLGNTGIQIFAYGLMLGMGSAVETLCGQAFGAGK  467
            Y+IN LMSMST+IFSG LGNL+LAAASLGN G+QIFAYGLMLGMGSAVETLCGQA+GAGK
Sbjct  62   YLINNLMSMSTRIFSGQLGNLQLAAASLGNNGVQIFAYGLMLGMGSAVETLCGQAYGAGK  121

Query  468  YELLGIYLQRStvlltltgvllalIYVFSEPILIFLG  578
            YE+LGIYLQRST+LLT+   LL L+Y+FS+PIL+FLG
Sbjct  122  YEMLGIYLQRSTILLTMVAFLLTLLYIFSKPILLFLG  158



>ref|XP_004144588.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Cucumis sativus]
Length=507

 Score =   192 bits (488),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 108/157 (69%), Positives = 127/157 (81%), Gaps = 6/157 (4%)
 Frame = +3

Query  108  DPLPESDGVVSSPPHEESEASNELESILMDTGIPRWQRLKLATWIELKLLCYLAAPAVVV  287
            +PL E     S+P H+    S ELE+IL DT +    R++ A WIELKLL  LAAPAV V
Sbjct  8    EPLVEQ----SAPKHDA--VSGELENILSDTQLRYVVRIRRAAWIELKLLSKLAAPAVFV  61

Query  288  YMINYLMSMSTQIFSGHLGNLELAAASLGNTGIQIFAYGLMLGMGSAVETLCGQAFGAGK  467
            Y+IN LMSMST+IFSG LGNL+LAAASLGN G+QIFAYGLMLGMGSAVETLCGQA+GAGK
Sbjct  62   YLINNLMSMSTRIFSGQLGNLQLAAASLGNNGVQIFAYGLMLGMGSAVETLCGQAYGAGK  121

Query  468  YELLGIYLQRStvlltltgvllalIYVFSEPILIFLG  578
            YE+LGIYLQRST+LLT+   LL L+Y+FS+PIL+FLG
Sbjct  122  YEMLGIYLQRSTILLTMVAFLLTLLYIFSKPILLFLG  158



>ref|NP_188806.1| MATE efflux family protein [Arabidopsis thaliana]
 dbj|BAB02363.1| unnamed protein product [Arabidopsis thaliana]
 gb|AAU05531.1| At3g21690 [Arabidopsis thaliana]
 gb|AEE76538.1| MATE efflux family protein [Arabidopsis thaliana]
Length=506

 Score =   191 bits (486),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 118/167 (71%), Positives = 131/167 (78%), Gaps = 5/167 (3%)
 Frame = +3

Query  81   MDSS-NGAAYDPLPESDGVVSSPPHEESEASNELESILMDTGIPRWQRLKLATWIELKLL  257
            MDSS N   + PL          P      + ELE++L D   P + RL+ AT IE KLL
Sbjct  1    MDSSPNDGVHQPLLHP----QPSPSPPESTNGELETVLSDVETPLFLRLRKATIIESKLL  56

Query  258  CYLAAPAVVVYMINYLMSMSTQIFSGHLGNLELAAASLGNTGIQIFAYGLMLGMGSAVET  437
              LAAPAV+VYMINYLMSMSTQIFSGHLGNLELAAASLGNTGIQ+FAYGLMLGMGSAVET
Sbjct  57   FNLAAPAVIVYMINYLMSMSTQIFSGHLGNLELAAASLGNTGIQVFAYGLMLGMGSAVET  116

Query  438  LCGQAFGAGKYELLGIYLQRStvlltltgvllalIYVFSEPILIFLG  578
            LCGQA+G  KYE+LG+YLQRSTVLLTLTG+LL LIYVFSEPIL+FLG
Sbjct  117  LCGQAYGGRKYEMLGVYLQRSTVLLTLTGLLLTLIYVFSEPILLFLG  163



>gb|AAM20595.1| integral membrane protein, putative [Arabidopsis thaliana]
Length=506

 Score =   191 bits (486),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 118/167 (71%), Positives = 131/167 (78%), Gaps = 5/167 (3%)
 Frame = +3

Query  81   MDSS-NGAAYDPLPESDGVVSSPPHEESEASNELESILMDTGIPRWQRLKLATWIELKLL  257
            MDSS N   + PL          P      + ELE++L D   P + RL+ AT IE KLL
Sbjct  1    MDSSPNDGVHQPLLHP----QPSPSPPESTNGELETVLSDVETPLFLRLRKATIIESKLL  56

Query  258  CYLAAPAVVVYMINYLMSMSTQIFSGHLGNLELAAASLGNTGIQIFAYGLMLGMGSAVET  437
              LAAPAV+VYMINYLMSMSTQIFSGHLGNLELAAASLGNTGIQ+FAYGLMLGMGSAVET
Sbjct  57   FNLAAPAVIVYMINYLMSMSTQIFSGHLGNLELAAASLGNTGIQVFAYGLMLGMGSAVET  116

Query  438  LCGQAFGAGKYELLGIYLQRStvlltltgvllalIYVFSEPILIFLG  578
            LCGQA+G  KYE+LG+YLQRSTVLLTLTG+LL LIYVFSEPIL+FLG
Sbjct  117  LCGQAYGGRKYEMLGVYLQRSTVLLTLTGLLLTLIYVFSEPILLFLG  163



>ref|XP_008455433.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Cucumis melo]
Length=515

 Score =   191 bits (486),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 104/139 (75%), Positives = 121/139 (87%), Gaps = 0/139 (0%)
 Frame = +3

Query  162  EASNELESILMDTGIPRWQRLKLATWIELKLLCYLAAPAVVVYMINYLMSMSTQIFSGHL  341
            + S+ELE IL DT +   +R   ATWIE+KL+ YLAAPAV VY+INYLMSMSTQ+FSGHL
Sbjct  33   KTSDELEKILSDTQLSVVRRYSQATWIEMKLMFYLAAPAVFVYVINYLMSMSTQVFSGHL  92

Query  342  GNLELAAASLGNTGIQIFAYGLMLGMGSAVETLCGQAFGAGKYELLGIYLQRStvlltlt  521
            GNLELAA+SLGN GIQ+FAYGLMLGMGSAVETLCGQA+GA KY +LGIYLQRST+LLTLT
Sbjct  93   GNLELAASSLGNNGIQLFAYGLMLGMGSAVETLCGQAYGAQKYNMLGIYLQRSTILLTLT  152

Query  522  gvllalIYVFSEPILIFLG  578
            G +L +IY+F +PILIFLG
Sbjct  153  GFVLTIIYIFCKPILIFLG  171



>gb|KDO75453.1| hypothetical protein CISIN_1g010798mg [Citrus sinensis]
Length=501

 Score =   190 bits (483),  Expect = 5e-54, Method: Compositional matrix adjust.
 Identities = 98/161 (61%), Positives = 129/161 (80%), Gaps = 9/161 (6%)
 Frame = +3

Query  96   GAAYDPLPESDGVVSSPPHEESEASNELESILMDTGIPRWQRLKLATWIELKLLCYLAAP  275
             A Y P+ ES         E ++AS  LE++L DT +  ++RL++A+W+ELKLL  LAAP
Sbjct  7    AAQYQPIIES---------EATDASRRLENVLSDTNLSCFKRLQIASWLELKLLVRLAAP  57

Query  276  AVVVYMINYLMSMSTQIFSGHLGNLELAAASLGNTGIQIFAYGLMLGMGSAVETLCGQAF  455
            AV VY+IN LMS+ST++F GHLGNLELAAASLGN+GIQ+FAYGLMLGMGSAVETLCGQA+
Sbjct  58   AVFVYLINNLMSLSTRVFCGHLGNLELAAASLGNSGIQLFAYGLMLGMGSAVETLCGQAY  117

Query  456  GAGKYELLGIYLQRStvlltltgvllalIYVFSEPILIFLG  578
            GAG+YE+LG+Y+QR+T +L  TGV + ++Y+F +P+LI LG
Sbjct  118  GAGRYEMLGVYMQRATFVLLATGVPVMMVYIFCKPMLILLG  158



>emb|CDY39493.1| BnaA01g24950D [Brassica napus]
Length=503

 Score =   190 bits (483),  Expect = 6e-54, Method: Compositional matrix adjust.
 Identities = 118/167 (71%), Positives = 129/167 (77%), Gaps = 5/167 (3%)
 Frame = +3

Query  81   MDSS-NGAAYDPLPESDGVVSSPPHEESEASNELESILMDTGIPRWQRLKLATWIELKLL  257
            MDS+     Y PL + D +  SP  E +    ELE  L D   P + RL+ AT IE KLL
Sbjct  1    MDSAQTDGVYQPLLQPDQL--SPLPESNNC--ELERGLADVETPLFLRLRKATMIETKLL  56

Query  258  CYLAAPAVVVYMINYLMSMSTQIFSGHLGNLELAAASLGNTGIQIFAYGLMLGMGSAVET  437
              LAAPAV+VYMINYLMSMSTQIFSGHLGNLELAAASLGN GIQ+FAYGLMLGMGSAVET
Sbjct  57   FKLAAPAVIVYMINYLMSMSTQIFSGHLGNLELAAASLGNRGIQVFAYGLMLGMGSAVET  116

Query  438  LCGQAFGAGKYELLGIYLQRStvlltltgvllalIYVFSEPILIFLG  578
            LCGQAFG  KYE+LG+YLQRS VLLTLTGVLL  IYVFSE IL+FLG
Sbjct  117  LCGQAFGGRKYEMLGVYLQRSIVLLTLTGVLLTSIYVFSENILLFLG  163



>ref|XP_006389632.1| hypothetical protein POPTR_0021s00810g [Populus trichocarpa]
 gb|ERP48546.1| hypothetical protein POPTR_0021s00810g [Populus trichocarpa]
Length=501

 Score =   190 bits (482),  Expect = 6e-54, Method: Compositional matrix adjust.
 Identities = 100/144 (69%), Positives = 123/144 (85%), Gaps = 1/144 (1%)
 Frame = +3

Query  150  HEESE-ASNELESILMDTGIPRWQRLKLATWIELKLLCYLAAPAVVVYMINYLMSMSTQI  326
            H++ E  S+ELE IL DT  P  +R++ A+W+ELKLL +LAAPAV+VY++N ++SMSTQI
Sbjct  15   HDDHETVSDELEQILTDTEAPYSKRIRSASWVELKLLFHLAAPAVIVYLLNNVVSMSTQI  74

Query  327  FSGHLGNLELAAASLGNTGIQIFAYGLMLGMGSAVETLCGQAFGAGKYELLGIYLQRStv  506
            F GHLGNLELAA SLGNTGIQ+FAYGLMLGMGSAVETLCGQA+GA ++E+LGIYLQRSTV
Sbjct  75   FCGHLGNLELAAVSLGNTGIQVFAYGLMLGMGSAVETLCGQAYGANRHEMLGIYLQRSTV  134

Query  507  lltltgvllalIYVFSEPILIFLG  578
            LL   G+ L +IY+FS+PILI LG
Sbjct  135  LLMAAGIPLMMIYIFSKPILILLG  158



>ref|XP_011047996.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Populus euphratica]
Length=499

 Score =   190 bits (482),  Expect = 8e-54, Method: Compositional matrix adjust.
 Identities = 97/143 (68%), Positives = 122/143 (85%), Gaps = 1/143 (1%)
 Frame = +3

Query  150  HEESEASNELESILMDTGIPRWQRLKLATWIELKLLCYLAAPAVVVYMINYLMSMSTQIF  329
            H+E+  S+ELE IL DT  P ++R++ A+W+E+KLL  LAAPAV+VY++N ++SMSTQIF
Sbjct  15   HDETR-SSELEQILADTEAPYFKRIRSASWVEMKLLFRLAAPAVIVYLLNNVVSMSTQIF  73

Query  330  SGHLGNLELAAASLGNTGIQIFAYGLMLGMGSAVETLCGQAFGAGKYELLGIYLQRStvl  509
             GHLGNLELAA SLGNTGIQ+FAYGLMLGMGSAVETLCGQAFGA +YE+LG+YLQRST+L
Sbjct  74   CGHLGNLELAAVSLGNTGIQMFAYGLMLGMGSAVETLCGQAFGAHRYEMLGVYLQRSTIL  133

Query  510  ltltgvllalIYVFSEPILIFLG  578
            L    + L +IY+FSEP+L+ LG
Sbjct  134  LMAAAIPLMVIYIFSEPLLMLLG  156



>ref|XP_006389631.1| hypothetical protein POPTR_0021s00800g [Populus trichocarpa]
 gb|ERP48545.1| hypothetical protein POPTR_0021s00800g [Populus trichocarpa]
Length=499

 Score =   190 bits (482),  Expect = 8e-54, Method: Compositional matrix adjust.
 Identities = 98/143 (69%), Positives = 123/143 (86%), Gaps = 1/143 (1%)
 Frame = +3

Query  150  HEESEASNELESILMDTGIPRWQRLKLATWIELKLLCYLAAPAVVVYMINYLMSMSTQIF  329
            H+E+  S+ELE IL DT  P ++R++ A+W+ELKLL +LAAPAV+VY++N ++SMSTQIF
Sbjct  15   HDETR-SSELEQILADTEAPYFKRIRSASWVELKLLFHLAAPAVIVYLLNNVVSMSTQIF  73

Query  330  SGHLGNLELAAASLGNTGIQIFAYGLMLGMGSAVETLCGQAFGAGKYELLGIYLQRStvl  509
             GHLGNLELAA SLGNTGIQ+FAYGLMLGMGSAVETLCGQAFGA +YE+LG+YLQRST+L
Sbjct  74   CGHLGNLELAAVSLGNTGIQMFAYGLMLGMGSAVETLCGQAFGAHRYEMLGVYLQRSTIL  133

Query  510  ltltgvllalIYVFSEPILIFLG  578
            L  T + L +IY+F EP+L+ LG
Sbjct  134  LMATAIPLMVIYIFCEPLLMLLG  156



>ref|XP_006449030.1| hypothetical protein CICLE_v10014983mg [Citrus clementina]
 gb|ESR62270.1| hypothetical protein CICLE_v10014983mg [Citrus clementina]
Length=501

 Score =   189 bits (481),  Expect = 9e-54, Method: Compositional matrix adjust.
 Identities = 98/161 (61%), Positives = 129/161 (80%), Gaps = 9/161 (6%)
 Frame = +3

Query  96   GAAYDPLPESDGVVSSPPHEESEASNELESILMDTGIPRWQRLKLATWIELKLLCYLAAP  275
             A Y P+ ES         E ++AS  LE++L DT +  ++RL++A+W+ELKLL  LAAP
Sbjct  7    AAQYQPIIES---------EATDASCRLENVLSDTNLSCFKRLQIASWLELKLLVRLAAP  57

Query  276  AVVVYMINYLMSMSTQIFSGHLGNLELAAASLGNTGIQIFAYGLMLGMGSAVETLCGQAF  455
            AV VY+IN LMS+ST++F GHLGNLELAAASLGN+GIQ+FAYGLMLGMGSAVETLCGQA+
Sbjct  58   AVFVYLINNLMSLSTRVFCGHLGNLELAAASLGNSGIQLFAYGLMLGMGSAVETLCGQAY  117

Query  456  GAGKYELLGIYLQRStvlltltgvllalIYVFSEPILIFLG  578
            GAG+YE+LG+Y+QR+T +L  TGV + ++Y+F +P+LI LG
Sbjct  118  GAGRYEMLGVYMQRATFVLLATGVPVMMVYIFCKPMLILLG  158



>ref|XP_010930122.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Elaeis guineensis]
Length=492

 Score =   189 bits (480),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 106/144 (74%), Positives = 123/144 (85%), Gaps = 3/144 (2%)
 Frame = +3

Query  147  PHEESEASNELESILMDTGIPRWQRLKLATWIELKLLCYLAAPAVVVYMINYLMSMSTQI  326
            PH    +   LESIL +  +P  +RL+LAT +E+KLL  +AAPAV+VYM+N+LMSMSTQI
Sbjct  7    PHG---SRGRLESILTNPSVPWVRRLQLATIVEMKLLIRIAAPAVMVYMVNFLMSMSTQI  63

Query  327  FSGHLGNLELAAASLGNTGIQIFAYGLMLGMGSAVETLCGQAFGAGKYELLGIYLQRStv  506
            FSGHLGNLELAAASLGNTGIQ+FAYGLMLGMGSAVETLCGQA+GA KYE+LGIYLQRST+
Sbjct  64   FSGHLGNLELAAASLGNTGIQVFAYGLMLGMGSAVETLCGQAYGAHKYEMLGIYLQRSTI  123

Query  507  lltltgvllalIYVFSEPILIFLG  578
            LLT TGV LA+IY FS PIL+ LG
Sbjct  124  LLTTTGVPLAVIYAFSRPILVLLG  147



>gb|AGT17221.1| transparent testa 12 protein [Saccharum hybrid cultivar R570]
Length=524

 Score =   189 bits (481),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 109/152 (72%), Positives = 125/152 (82%), Gaps = 6/152 (4%)
 Frame = +3

Query  141  SPP-----HEESEA-SNELESILMDTGIPRWQRLKLATWIELKLLCYLAAPAVVVYMINY  302
            +PP     H   EA S +LESIL DT +P  +R+  A+ +E++LL  LAAPAV+VYMINY
Sbjct  18   APPSPGSGHGHGEAVSGQLESILSDTSLPWGRRMVAASVVEMRLLVRLAAPAVLVYMINY  77

Query  303  LMSMSTQIFSGHLGNLELAAASLGNTGIQIFAYGLMLGMGSAVETLCGQAFGAGKYELLG  482
            LMSMSTQIFSGHLG LELAAASLGNTGIQ+FAYGLMLGMGSAVETLCGQA+GA KYE+LG
Sbjct  78   LMSMSTQIFSGHLGTLELAAASLGNTGIQVFAYGLMLGMGSAVETLCGQAYGAHKYEMLG  137

Query  483  IYLQRStvlltltgvllalIYVFSEPILIFLG  578
            IYLQRST+LL  TGV LA+IY FS PIL+ LG
Sbjct  138  IYLQRSTILLMATGVPLAVIYAFSRPILVLLG  169



>tpg|DAA50098.1| TPA: putative MATE efflux family protein [Zea mays]
Length=432

 Score =   187 bits (476),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 103/144 (72%), Positives = 120/144 (83%), Gaps = 1/144 (1%)
 Frame = +3

Query  150  HEESEA-SNELESILMDTGIPRWQRLKLATWIELKLLCYLAAPAVVVYMINYLMSMSTQI  326
            H   EA S +LESIL D  +P  +R+  A+ +E++LL  LAAPAV+VYMINYLMSMSTQI
Sbjct  29   HSHGEAVSGQLESILSDASLPWRRRMLSASMVEMRLLVRLAAPAVLVYMINYLMSMSTQI  88

Query  327  FSGHLGNLELAAASLGNTGIQIFAYGLMLGMGSAVETLCGQAFGAGKYELLGIYLQRStv  506
            FSGHLG LELAAASLGNTGIQ+FAYGLMLGMGSAVETLCGQA+GA KY++LGIYLQRST+
Sbjct  89   FSGHLGTLELAAASLGNTGIQVFAYGLMLGMGSAVETLCGQAYGAHKYDMLGIYLQRSTI  148

Query  507  lltltgvllalIYVFSEPILIFLG  578
            LL  TGV L ++Y FS PIL+ LG
Sbjct  149  LLMATGVPLTVLYAFSRPILVLLG  172



>gb|KHG27903.1| Protein TRANSPARENT TESTA 12 -like protein [Gossypium arboreum]
Length=506

 Score =   189 bits (479),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 114/157 (73%), Positives = 127/157 (81%), Gaps = 4/157 (3%)
 Frame = +3

Query  108  DPLPESDGVVSSPPHEESEASNELESILMDTGIPRWQRLKLATWIELKLLCYLAAPAVVV  287
            +PL +S    +S    ES  S+ELE +L D      +R   AT IE KLL +LAAPAV+V
Sbjct  11   EPLLQSQ---TSDTKSES-TSSELEDVLSDGNSSLLERWGKATCIESKLLFHLAAPAVIV  66

Query  288  YMINYLMSMSTQIFSGHLGNLELAAASLGNTGIQIFAYGLMLGMGSAVETLCGQAFGAGK  467
            YMINYLMSMSTQIFSGHLGNLELAAASLGNTGIQIFAYGLMLGMGSAVETLCGQAFGA K
Sbjct  67   YMINYLMSMSTQIFSGHLGNLELAAASLGNTGIQIFAYGLMLGMGSAVETLCGQAFGAHK  126

Query  468  YELLGIYLQRStvlltltgvllalIYVFSEPILIFLG  578
            Y++LGIYLQRS VLLT TG+LL LIYVFS+PIL+ LG
Sbjct  127  YDMLGIYLQRSAVLLTFTGILLTLIYVFSKPILLLLG  163



>ref|XP_008230142.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Prunus mume]
Length=517

 Score =   189 bits (480),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 105/139 (76%), Positives = 120/139 (86%), Gaps = 0/139 (0%)
 Frame = +3

Query  162  EASNELESILMDTGIPRWQRLKLATWIELKLLCYLAAPAVVVYMINYLMSMSTQIFSGHL  341
             +SNELE +L DT  P  +RLK A WIE KLL YLAAPAV+VYMINY+MSMSTQIF+GHL
Sbjct  38   HSSNELERVLSDTDRPFLERLKPALWIESKLLFYLAAPAVIVYMINYVMSMSTQIFAGHL  97

Query  342  GNLELAAASLGNTGIQIFAYGLMLGMGSAVETLCGQAFGAGKYELLGIYLQRStvlltlt  521
            GNLELAAASLGN GI IF+YGL+LGMGSAVETLCGQA+GA KYE+LGIYLQRST+LLTL 
Sbjct  98   GNLELAAASLGNNGILIFSYGLLLGMGSAVETLCGQAYGAHKYEMLGIYLQRSTILLTLG  157

Query  522  gvllalIYVFSEPILIFLG  578
            GVLL ++Y++  PILI LG
Sbjct  158  GVLLTIVYIYYRPILILLG  176



>gb|KGN43524.1| hypothetical protein Csa_7G043660 [Cucumis sativus]
Length=485

 Score =   188 bits (478),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 108/157 (69%), Positives = 125/157 (80%), Gaps = 6/157 (4%)
 Frame = +3

Query  108  DPLPESDGVVSSPPHEESEASNELESILMDTGIPRWQRLKLATWIELKLLCYLAAPAVVV  287
            +PL E     S+  HE    S ELE+IL DT +    R++ A WIELKLL  LAAPAV V
Sbjct  8    EPLVEK----SAAKHEA--VSGELENILSDTQLRYVVRIRRAAWIELKLLSKLAAPAVFV  61

Query  288  YMINYLMSMSTQIFSGHLGNLELAAASLGNTGIQIFAYGLMLGMGSAVETLCGQAFGAGK  467
            Y+IN LMSMST+IFSG LGNL+LAAASLGN GIQ FAYGLMLGMGSAVETLCGQA+GAGK
Sbjct  62   YLINNLMSMSTRIFSGQLGNLQLAAASLGNNGIQSFAYGLMLGMGSAVETLCGQAYGAGK  121

Query  468  YELLGIYLQRStvlltltgvllalIYVFSEPILIFLG  578
            YE+LGIYLQRST+LLT+   LL L+Y+FS+PIL+FLG
Sbjct  122  YEMLGIYLQRSTILLTMVAFLLTLLYIFSKPILLFLG  158



>gb|ACF85423.1| unknown [Zea mays]
 gb|ACR35764.1| unknown [Zea mays]
 gb|AFW68308.1| putative MATE efflux family protein [Zea mays]
Length=513

 Score =   189 bits (479),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 109/166 (66%), Positives = 126/166 (76%), Gaps = 0/166 (0%)
 Frame = +3

Query  81   MDSSNGAAYDPLPESDGVVSSPPHEESEASNELESILMDTGIPRWQRLKLATWIELKLLC  260
            M S+ G     L       SS  H E+  S +LESIL D  +P   R+  A+ +E++LL 
Sbjct  1    MGSAGGGGESKLESPLLGASSTGHGEAVVSGQLESILGDASVPWGTRMASASAVEMRLLV  60

Query  261  YLAAPAVVVYMINYLMSMSTQIFSGHLGNLELAAASLGNTGIQIFAYGLMLGMGSAVETL  440
             LAAPAV+VYMINYLMSMSTQIFSGHLG LELAAASLGNTGIQ+FAYGLMLGMGSAVETL
Sbjct  61   RLAAPAVLVYMINYLMSMSTQIFSGHLGTLELAAASLGNTGIQVFAYGLMLGMGSAVETL  120

Query  441  CGQAFGAGKYELLGIYLQRStvlltltgvllalIYVFSEPILIFLG  578
            CGQA+GA KY++LGIYLQRSTVLL  TGV LA +Y FS P+L+ LG
Sbjct  121  CGQAYGAHKYDMLGIYLQRSTVLLMATGVPLAALYAFSRPVLVLLG  166



>ref|XP_011037771.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Populus euphratica]
Length=499

 Score =   188 bits (478),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 98/153 (64%), Positives = 122/153 (80%), Gaps = 0/153 (0%)
 Frame = +3

Query  120  ESDGVVSSPPHEESEASNELESILMDTGIPRWQRLKLATWIELKLLCYLAAPAVVVYMIN  299
            ++  + S   H +   SNELE IL +   P  +R++LA+W+ELKLL  LAAPAV+VY++N
Sbjct  4    DTSRLSSKVSHHDETVSNELEEILTNNQSPYSKRVRLASWVELKLLFQLAAPAVIVYLLN  63

Query  300  YLMSMSTQIFSGHLGNLELAAASLGNTGIQIFAYGLMLGMGSAVETLCGQAFGAGKYELL  479
             ++SMSTQIF GHLGNLELAA SLGN GIQ+FAYGL+LGMGSAVETLCGQA+GA  YE+L
Sbjct  64   NVISMSTQIFCGHLGNLELAAVSLGNNGIQVFAYGLLLGMGSAVETLCGQAYGANSYEIL  123

Query  480  GIYLQRStvlltltgvllalIYVFSEPILIFLG  578
            GIYLQRST+LL L  + L +IY+FS+PILI LG
Sbjct  124  GIYLQRSTILLMLAALPLLVIYIFSKPILILLG  156



>ref|XP_004515070.1| PREDICTED: protein TRANSPARENT TESTA 12-like isoform X1 [Cicer 
arietinum]
Length=512

 Score =   188 bits (478),  Expect = 4e-53, Method: Compositional matrix adjust.
 Identities = 100/142 (70%), Positives = 125/142 (88%), Gaps = 0/142 (0%)
 Frame = +3

Query  153  EESEASNELESILMDTGIPRWQRLKLATWIELKLLCYLAAPAVVVYMINYLMSMSTQIFS  332
             + E+  ELE IL ++ +P  +R++LAT +ELKLL YLAAP+V+VY++N + SMSTQIFS
Sbjct  28   SKHESDGELERILSNSSVPFIKRIQLATRVELKLLFYLAAPSVIVYLLNNVTSMSTQIFS  87

Query  333  GHLGNLELAAASLGNTGIQIFAYGLMLGMGSAVETLCGQAFGAGKYELLGIYLQRStvll  512
            GH+GNLELAAASLGN GIQ+FAYGLMLGMGSAVETLCGQAFGA KY++LGIYLQ+S+VLL
Sbjct  88   GHIGNLELAAASLGNNGIQVFAYGLMLGMGSAVETLCGQAFGAKKYDMLGIYLQKSSVLL  147

Query  513  tltgvllalIYVFSEPILIFLG  578
            TL G++L LIY+FS+PILIF+G
Sbjct  148  TLAGLILTLIYIFSKPILIFIG  169



>gb|ACZ55931.1| MATE transporter 2 [Zea mays]
Length=511

 Score =   188 bits (478),  Expect = 4e-53, Method: Compositional matrix adjust.
 Identities = 109/166 (66%), Positives = 126/166 (76%), Gaps = 0/166 (0%)
 Frame = +3

Query  81   MDSSNGAAYDPLPESDGVVSSPPHEESEASNELESILMDTGIPRWQRLKLATWIELKLLC  260
            M S+ G     L       SS  H E+  S +LESIL D  +P   R+  A+ +E++LL 
Sbjct  1    MGSAGGGGESKLESPLLGASSTGHGEAVVSGQLESILGDASVPWGTRMASASAVEMRLLV  60

Query  261  YLAAPAVVVYMINYLMSMSTQIFSGHLGNLELAAASLGNTGIQIFAYGLMLGMGSAVETL  440
             LAAPAV+VYMINYLMSMSTQIFSGHLG LELAAASLGNTGIQ+FAYGLMLGMGSAVETL
Sbjct  61   RLAAPAVLVYMINYLMSMSTQIFSGHLGTLELAAASLGNTGIQVFAYGLMLGMGSAVETL  120

Query  441  CGQAFGAGKYELLGIYLQRStvlltltgvllalIYVFSEPILIFLG  578
            CGQA+GA KY++LGIYLQRSTVLL  TGV LA +Y FS P+L+ LG
Sbjct  121  CGQAYGAHKYDMLGIYLQRSTVLLMATGVPLAALYAFSRPVLLLLG  166



>gb|KJB30571.1| hypothetical protein B456_005G149900 [Gossypium raimondii]
Length=505

 Score =   188 bits (477),  Expect = 5e-53, Method: Compositional matrix adjust.
 Identities = 114/160 (71%), Positives = 127/160 (79%), Gaps = 4/160 (3%)
 Frame = +3

Query  99   AAYDPLPESDGVVSSPPHEESEASNELESILMDTGIPRWQRLKLATWIELKLLCYLAAPA  278
            A   PL +S    +S    ES  S+ELE +L D      +R   AT IE KLL +LAAPA
Sbjct  8    AIRKPLFQSQ---TSDTKSES-TSSELEDVLSDGNSSLLERWGKATCIESKLLFHLAAPA  63

Query  279  VVVYMINYLMSMSTQIFSGHLGNLELAAASLGNTGIQIFAYGLMLGMGSAVETLCGQAFG  458
            V+VYMINYLMSMSTQIFSGHLGNLELAAASLGNTGIQ+FAYGLMLGMGSAVETLCGQAFG
Sbjct  64   VIVYMINYLMSMSTQIFSGHLGNLELAAASLGNTGIQVFAYGLMLGMGSAVETLCGQAFG  123

Query  459  AGKYELLGIYLQRStvlltltgvllalIYVFSEPILIFLG  578
            A KY++LGIYLQRS VLLT TG+LL LIYVFS+PIL+ LG
Sbjct  124  AHKYDMLGIYLQRSAVLLTFTGILLTLIYVFSKPILLLLG  163



>ref|XP_007132552.1| hypothetical protein PHAVU_011G104200g [Phaseolus vulgaris]
 gb|ESW04546.1| hypothetical protein PHAVU_011G104200g [Phaseolus vulgaris]
Length=517

 Score =   188 bits (477),  Expect = 6e-53, Method: Compositional matrix adjust.
 Identities = 104/138 (75%), Positives = 120/138 (87%), Gaps = 0/138 (0%)
 Frame = +3

Query  165  ASNELESILMDTGIPRWQRLKLATWIELKLLCYLAAPAVVVYMINYLMSMSTQIFSGHLG  344
            +S ELE IL D  +P  +R+  ATW+ELKLL  LAAPAV+VY++NY+MSMSTQIF GHLG
Sbjct  37   SSGELEQILTDISLPYSKRVGAATWLELKLLFNLAAPAVIVYLLNYVMSMSTQIFCGHLG  96

Query  345  NLELAAASLGNTGIQIFAYGLMLGMGSAVETLCGQAFGAGKYELLGIYLQRStvlltltg  524
            NLELAA+SLGN GIQIFAYGLMLGMGSAVETLCGQA+GA KY +LGIYLQRSTVLL+L G
Sbjct  97   NLELAASSLGNNGIQIFAYGLMLGMGSAVETLCGQAYGAKKYHMLGIYLQRSTVLLSLAG  156

Query  525  vllalIYVFSEPILIFLG  578
            VLL +IYVF+EPIL+ LG
Sbjct  157  VLLTIIYVFAEPILLMLG  174



>ref|NP_001149176.1| transparent testa 12 protein [Zea mays]
 gb|ACG34462.1| transparent testa 12 protein [Zea mays]
Length=513

 Score =   187 bits (476),  Expect = 7e-53, Method: Compositional matrix adjust.
 Identities = 104/144 (72%), Positives = 120/144 (83%), Gaps = 1/144 (1%)
 Frame = +3

Query  150  HEESEA-SNELESILMDTGIPRWQRLKLATWIELKLLCYLAAPAVVVYMINYLMSMSTQI  326
            H   EA S +LESIL D  +P  QR+  A+ +E++LL  LAAPAV+VYMINYLMSMSTQI
Sbjct  29   HSHGEAVSGQLESILSDASLPWRQRMLSASMVEMRLLVRLAAPAVLVYMINYLMSMSTQI  88

Query  327  FSGHLGNLELAAASLGNTGIQIFAYGLMLGMGSAVETLCGQAFGAGKYELLGIYLQRStv  506
            FSGHLG LELAAASLGNTGIQ+FAYGLMLGMGSAVETLCGQA+GA KY++LGIYLQRST+
Sbjct  89   FSGHLGTLELAAASLGNTGIQVFAYGLMLGMGSAVETLCGQAYGAHKYDMLGIYLQRSTI  148

Query  507  lltltgvllalIYVFSEPILIFLG  578
            LL  TGV L ++Y FS PIL+ LG
Sbjct  149  LLMATGVPLTVLYAFSRPILVLLG  172



>ref|XP_004982537.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Setaria italica]
Length=512

 Score =   187 bits (476),  Expect = 7e-53, Method: Compositional matrix adjust.
 Identities = 104/143 (73%), Positives = 118/143 (83%), Gaps = 0/143 (0%)
 Frame = +3

Query  150  HEESEASNELESILMDTGIPRWQRLKLATWIELKLLCYLAAPAVVVYMINYLMSMSTQIF  329
            H     S  LESIL D  +P  +R+  AT +E++LL  LAAPAVVVYMINYLMSMSTQIF
Sbjct  28   HGVEAVSGRLESILSDESLPWGRRMSAATLVEMRLLVRLAAPAVVVYMINYLMSMSTQIF  87

Query  330  SGHLGNLELAAASLGNTGIQIFAYGLMLGMGSAVETLCGQAFGAGKYELLGIYLQRStvl  509
            SGHLG LELAAASLGNTGIQ+FAYGLMLGMGSAVETLCGQA+GA KY++LG+YLQRSTVL
Sbjct  88   SGHLGTLELAAASLGNTGIQVFAYGLMLGMGSAVETLCGQAYGAHKYDMLGVYLQRSTVL  147

Query  510  ltltgvllalIYVFSEPILIFLG  578
            L  TGV LA++Y FS PIL+ LG
Sbjct  148  LMATGVPLAVLYAFSRPILVLLG  170



>ref|XP_009398220.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Musa acuminata 
subsp. malaccensis]
Length=524

 Score =   187 bits (476),  Expect = 7e-53, Method: Compositional matrix adjust.
 Identities = 114/187 (61%), Positives = 136/187 (73%), Gaps = 18/187 (10%)
 Frame = +3

Query  33   EQAAPRFPPHHLTNSVMDSSNG---AAYDPLP--ESDGVVSSPPHEESEASNELESILMD  197
            E ++P   P H      D  +G    A  PLP   +DG            S +LESIL D
Sbjct  9    ELSSPLIFPAH------DDGHGLPLQASTPLPPVAADGTAHG-------TSGKLESILND  55

Query  198  TGIPRWQRLKLATWIELKLLCYLAAPAVVVYMINYLMSMSTQIFSGHLGNLELAAASLGN  377
            T IP  +R+ LA+ IE++LL  LAAPA++VY+IN++MSMSTQIFSGHLGN+ELAAASLGN
Sbjct  56   TSIPWLRRVGLASLIEMRLLLSLAAPAIIVYLINFVMSMSTQIFSGHLGNVELAAASLGN  115

Query  378  TGIQIFAYGLMLGMGSAVETLCGQAFGAGKYELLGIYLQRStvlltltgvllalIYVFSE  557
            TGIQIFAYG+MLGMGSAVETLCGQA+GA KYE+LG+YLQRSTVLL  TGV LA+IY  S 
Sbjct  116  TGIQIFAYGIMLGMGSAVETLCGQAYGAHKYEMLGVYLQRSTVLLMATGVPLAVIYALSR  175

Query  558  PILIFLG  578
            PIL+ LG
Sbjct  176  PILVLLG  182



>ref|XP_011047997.1| PREDICTED: protein TRANSPARENT TESTA 12-like isoform X1 [Populus 
euphratica]
Length=500

 Score =   187 bits (475),  Expect = 9e-53, Method: Compositional matrix adjust.
 Identities = 96/143 (67%), Positives = 120/143 (84%), Gaps = 0/143 (0%)
 Frame = +3

Query  150  HEESEASNELESILMDTGIPRWQRLKLATWIELKLLCYLAAPAVVVYMINYLMSMSTQIF  329
            H++    +ELE IL DT  P ++R++ A+W+ELKLL +LAAPAV+ Y++N ++SMSTQIF
Sbjct  15   HDDETVGDELEQILTDTEAPYFKRIRSASWVELKLLLHLAAPAVIDYLLNNVVSMSTQIF  74

Query  330  SGHLGNLELAAASLGNTGIQIFAYGLMLGMGSAVETLCGQAFGAGKYELLGIYLQRStvl  509
             GHLGNLELAA SLGN GIQ+FAYGLMLGMGSAVETLCGQA+GA ++E+LGIYLQRS VL
Sbjct  75   CGHLGNLELAAVSLGNNGIQVFAYGLMLGMGSAVETLCGQAYGANRHEMLGIYLQRSAVL  134

Query  510  ltltgvllalIYVFSEPILIFLG  578
            L  TG+ L +IY+FS+PILI LG
Sbjct  135  LMATGIPLMMIYIFSKPILILLG  157



>ref|XP_006468029.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Citrus sinensis]
Length=501

 Score =   187 bits (474),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 97/161 (60%), Positives = 128/161 (80%), Gaps = 9/161 (6%)
 Frame = +3

Query  96   GAAYDPLPESDGVVSSPPHEESEASNELESILMDTGIPRWQRLKLATWIELKLLCYLAAP  275
             A Y P+ ES         E ++AS  LE++L DT +  ++RL++A+W+ELKLL  LAAP
Sbjct  7    AAQYQPIIES---------EATDASCRLENVLSDTNLSCFKRLQIASWLELKLLVRLAAP  57

Query  276  AVVVYMINYLMSMSTQIFSGHLGNLELAAASLGNTGIQIFAYGLMLGMGSAVETLCGQAF  455
            AV VY+IN LMS+ST++F GHLGNLELAAASLGN+GIQ+ AYGLMLGMGSAVETLCGQA+
Sbjct  58   AVFVYLINNLMSLSTRVFCGHLGNLELAAASLGNSGIQLLAYGLMLGMGSAVETLCGQAY  117

Query  456  GAGKYELLGIYLQRStvlltltgvllalIYVFSEPILIFLG  578
            GAG+YE+LG+Y+QR+T +L  TGV + ++Y+F +P+LI LG
Sbjct  118  GAGRYEMLGVYMQRATFVLLATGVPVMMVYIFCKPMLILLG  158



>gb|ACZ55932.1| MATE transporter 2 [Zea mays]
 gb|ACZ55933.1| MATE transporter 2 [Zea mays]
Length=513

 Score =   187 bits (474),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 103/143 (72%), Positives = 119/143 (83%), Gaps = 0/143 (0%)
 Frame = +3

Query  150  HEESEASNELESILMDTGIPRWQRLKLATWIELKLLCYLAAPAVVVYMINYLMSMSTQIF  329
            H E+  S +LESIL D  +P   R+  A+ +E++LL  LAAPAV+VYMINYLMSMSTQIF
Sbjct  26   HGETAVSGQLESILGDASVPWGTRMASASAVEMRLLVRLAAPAVLVYMINYLMSMSTQIF  85

Query  330  SGHLGNLELAAASLGNTGIQIFAYGLMLGMGSAVETLCGQAFGAGKYELLGIYLQRStvl  509
            SGHLG LELAAASLGNTGIQ+FAYGLMLGMGSAVETLCGQA+GA KY++LGIYLQRSTVL
Sbjct  86   SGHLGTLELAAASLGNTGIQVFAYGLMLGMGSAVETLCGQAYGAHKYDMLGIYLQRSTVL  145

Query  510  ltltgvllalIYVFSEPILIFLG  578
            L  TGV LA +Y FS P+L+ LG
Sbjct  146  LMATGVPLAALYAFSRPVLLLLG  168



>ref|XP_008441737.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Cucumis melo]
Length=496

 Score =   186 bits (473),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 98/142 (69%), Positives = 122/142 (86%), Gaps = 0/142 (0%)
 Frame = +3

Query  153  EESEASNELESILMDTGIPRWQRLKLATWIELKLLCYLAAPAVVVYMINYLMSMSTQIFS  332
             ++  ++ELE++L +T +P   R   ATWIE+KLL YLAAPA++VYM+NYLM+M TQIFS
Sbjct  12   NKNACNDELETLLSNTHLPLLHRYTQATWIEMKLLFYLAAPAILVYMMNYLMTMFTQIFS  71

Query  333  GHLGNLELAAASLGNTGIQIFAYGLMLGMGSAVETLCGQAFGAGKYELLGIYLQRStvll  512
            GHLGNLELAA+SLGN GIQ+FAYGLMLGMGSAVETLCGQA+GA K+E+LGIYLQRS +LL
Sbjct  72   GHLGNLELAASSLGNNGIQLFAYGLMLGMGSAVETLCGQAYGAEKHEMLGIYLQRSAILL  131

Query  513  tltgvllalIYVFSEPILIFLG  578
            TLTG +L ++Y+F +PILI LG
Sbjct  132  TLTGFVLTIVYIFCKPILIILG  153



>ref|XP_002273739.2| PREDICTED: protein TRANSPARENT TESTA 12 [Vitis vinifera]
Length=509

 Score =   186 bits (473),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 105/166 (63%), Positives = 131/166 (79%), Gaps = 1/166 (1%)
 Frame = +3

Query  81   MDSSNGAAYDPLPESDGVVSSPPHEESEASNELESILMDTGIPRWQRLKLATWIELKLLC  260
            M S +   + P+ ES    SS      E+S+ELE +L D  +P  +RL+ ATWIELKLL 
Sbjct  1    MGSQDDQLHTPILESMQR-SSSTGSTFESSSELEKVLSDLQLPWLRRLRTATWIELKLLF  59

Query  261  YLAAPAVVVYMINYLMSMSTQIFSGHLGNLELAAASLGNTGIQIFAYGLMLGMGSAVETL  440
             LAAPAV+VY+IN  MS+ST++F+GHLGNLELAAASLGN+GIQ+FAYGLMLGMGSAVETL
Sbjct  60   RLAAPAVLVYLINNAMSLSTRVFAGHLGNLELAAASLGNSGIQLFAYGLMLGMGSAVETL  119

Query  441  CGQAFGAGKYELLGIYLQRStvlltltgvllalIYVFSEPILIFLG  578
            CGQA+GA + E+LGIYLQR+TV+LT TG  L +IYVF++PIL+ LG
Sbjct  120  CGQAYGANRSEMLGIYLQRATVVLTATGFPLTVIYVFAKPILLLLG  165



>ref|NP_001050524.1| Os03g0572900 [Oryza sativa Japonica Group]
 gb|AAS01970.1| putative MATE efflux family protein [Oryza sativa Japonica Group]
 gb|ABF97219.1| MATE efflux family protein, expressed [Oryza sativa Japonica 
Group]
 dbj|BAF12438.1| Os03g0572900 [Oryza sativa Japonica Group]
 dbj|BAG95442.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEE59388.1| hypothetical protein OsJ_11504 [Oryza sativa Japonica Group]
Length=500

 Score =   186 bits (472),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 107/138 (78%), Positives = 120/138 (87%), Gaps = 0/138 (0%)
 Frame = +3

Query  165  ASNELESILMDTGIPRWQRLKLATWIELKLLCYLAAPAVVVYMINYLMSMSTQIFSGHLG  344
            AS  LESIL D+ +P  +R   AT IEL LL  +AAPAVV+YMINYLMSMSTQIFSGHLG
Sbjct  14   ASGRLESILSDSSMPLARRAWAATTIELGLLTRIAAPAVVMYMINYLMSMSTQIFSGHLG  73

Query  345  NLELAAASLGNTGIQIFAYGLMLGMGSAVETLCGQAFGAGKYELLGIYLQRStvlltltg  524
            NLELAAASLGN GIQ+FAYGLMLGMGSAVETLCGQAFGA KY++LG+YLQRS VLLT+TG
Sbjct  74   NLELAAASLGNNGIQMFAYGLMLGMGSAVETLCGQAFGAHKYDMLGVYLQRSAVLLTITG  133

Query  525  vllalIYVFSEPILIFLG  578
            V LA+IY FSEPIL+F+G
Sbjct  134  VPLAVIYGFSEPILVFMG  151



>tpg|DAA50097.1| TPA: putative MATE efflux family protein, partial [Zea mays]
Length=167

 Score =   177 bits (449),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 104/140 (74%), Positives = 115/140 (82%), Gaps = 3/140 (2%)
 Frame = +3

Query  159  SEASNELESILMDTGIPRWQRLKLATWIELKLLCYLAAPAVVVYMINYLMSMSTQIFSGH  338
            ++AS  LESIL             A  IEL+LL  LAAPAVV+YMINYLMSMSTQIFSGH
Sbjct  7    ADASERLESILTAE---AAASPWAAAAIELRLLTRLAAPAVVMYMINYLMSMSTQIFSGH  63

Query  339  LGNLELAAASLGNTGIQIFAYGLMLGMGSAVETLCGQAFGAGKYELLGIYLQRStvlltl  518
            LGNLELAAASLGN G+Q+FAYGLMLGMGSAVETLCGQA+GA KYE+LGIYLQRS VLL +
Sbjct  64   LGNLELAAASLGNAGVQMFAYGLMLGMGSAVETLCGQAYGAHKYEMLGIYLQRSAVLLCV  123

Query  519  tgvllalIYVFSEPILIFLG  578
            TGV LA+IY FSEPIL+FLG
Sbjct  124  TGVPLAVIYAFSEPILVFLG  143



>gb|EEC75610.1| hypothetical protein OsI_12322 [Oryza sativa Indica Group]
Length=500

 Score =   186 bits (472),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 107/138 (78%), Positives = 120/138 (87%), Gaps = 0/138 (0%)
 Frame = +3

Query  165  ASNELESILMDTGIPRWQRLKLATWIELKLLCYLAAPAVVVYMINYLMSMSTQIFSGHLG  344
            AS  LESIL D+ +P  +R   AT IEL LL  +AAPAVV+YMINYLMSMSTQIFSGHLG
Sbjct  14   ASGRLESILSDSSMPLARRAWAATTIELGLLTRIAAPAVVMYMINYLMSMSTQIFSGHLG  73

Query  345  NLELAAASLGNTGIQIFAYGLMLGMGSAVETLCGQAFGAGKYELLGIYLQRStvlltltg  524
            NLELAAASLGN GIQ+FAYGLMLGMGSAVETLCGQAFGA KY++LG+YLQRS VLLT+TG
Sbjct  74   NLELAAASLGNNGIQMFAYGLMLGMGSAVETLCGQAFGAHKYDMLGVYLQRSAVLLTITG  133

Query  525  vllalIYVFSEPILIFLG  578
            V LA+IY FSEPIL+F+G
Sbjct  134  VPLAVIYGFSEPILVFMG  151



>gb|ABF97220.1| MATE efflux family protein, expressed [Oryza sativa Japonica 
Group]
Length=495

 Score =   186 bits (472),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 107/138 (78%), Positives = 120/138 (87%), Gaps = 0/138 (0%)
 Frame = +3

Query  165  ASNELESILMDTGIPRWQRLKLATWIELKLLCYLAAPAVVVYMINYLMSMSTQIFSGHLG  344
            AS  LESIL D+ +P  +R   AT IEL LL  +AAPAVV+YMINYLMSMSTQIFSGHLG
Sbjct  14   ASGRLESILSDSSMPLARRAWAATTIELGLLTRIAAPAVVMYMINYLMSMSTQIFSGHLG  73

Query  345  NLELAAASLGNTGIQIFAYGLMLGMGSAVETLCGQAFGAGKYELLGIYLQRStvlltltg  524
            NLELAAASLGN GIQ+FAYGLMLGMGSAVETLCGQAFGA KY++LG+YLQRS VLLT+TG
Sbjct  74   NLELAAASLGNNGIQMFAYGLMLGMGSAVETLCGQAFGAHKYDMLGVYLQRSAVLLTITG  133

Query  525  vllalIYVFSEPILIFLG  578
            V LA+IY FSEPIL+F+G
Sbjct  134  VPLAVIYGFSEPILVFMG  151



>ref|NP_001148084.1| transparent testa 12 protein [Zea mays]
 gb|ACG29679.1| transparent testa 12 protein [Zea mays]
Length=511

 Score =   186 bits (472),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 108/166 (65%), Positives = 126/166 (76%), Gaps = 0/166 (0%)
 Frame = +3

Query  81   MDSSNGAAYDPLPESDGVVSSPPHEESEASNELESILMDTGIPRWQRLKLATWIELKLLC  260
            M S+ G     L       SS  H E+  S +LESIL D  +P   R+  A+ +E++LL 
Sbjct  1    MGSAGGGGESKLESPLLGASSTGHGEAVVSGQLESILGDASVPWGTRMASASAVEMRLLV  60

Query  261  YLAAPAVVVYMINYLMSMSTQIFSGHLGNLELAAASLGNTGIQIFAYGLMLGMGSAVETL  440
             LAAPAV+VYMINYLMSMSTQIFSGHLG LELAAASLG+TGIQ+FAYGLMLGMGSAVETL
Sbjct  61   RLAAPAVLVYMINYLMSMSTQIFSGHLGTLELAAASLGHTGIQVFAYGLMLGMGSAVETL  120

Query  441  CGQAFGAGKYELLGIYLQRStvlltltgvllalIYVFSEPILIFLG  578
            CGQA+GA KY++LGIYLQRSTVLL  TGV LA +Y FS P+L+ LG
Sbjct  121  CGQAYGAHKYDMLGIYLQRSTVLLMATGVPLAALYAFSRPVLLLLG  166



>tpg|DAA50100.1| TPA: putative MATE efflux family protein [Zea mays]
Length=513

 Score =   186 bits (472),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 103/144 (72%), Positives = 120/144 (83%), Gaps = 1/144 (1%)
 Frame = +3

Query  150  HEESEA-SNELESILMDTGIPRWQRLKLATWIELKLLCYLAAPAVVVYMINYLMSMSTQI  326
            H   EA S +LESIL D  +P  +R+  A+ +E++LL  LAAPAV+VYMINYLMSMSTQI
Sbjct  29   HSHGEAVSGQLESILSDASLPWRRRMLSASMVEMRLLVRLAAPAVLVYMINYLMSMSTQI  88

Query  327  FSGHLGNLELAAASLGNTGIQIFAYGLMLGMGSAVETLCGQAFGAGKYELLGIYLQRStv  506
            FSGHLG LELAAASLGNTGIQ+FAYGLMLGMGSAVETLCGQA+GA KY++LGIYLQRST+
Sbjct  89   FSGHLGTLELAAASLGNTGIQVFAYGLMLGMGSAVETLCGQAYGAHKYDMLGIYLQRSTI  148

Query  507  lltltgvllalIYVFSEPILIFLG  578
            LL  TGV L ++Y FS PIL+ LG
Sbjct  149  LLMATGVPLTVLYAFSRPILVLLG  172



>emb|CDM85992.1| unnamed protein product [Triticum aestivum]
Length=512

 Score =   186 bits (471),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 101/139 (73%), Positives = 119/139 (86%), Gaps = 0/139 (0%)
 Frame = +3

Query  162  EASNELESILMDTGIPRWQRLKLATWIELKLLCYLAAPAVVVYMINYLMSMSTQIFSGHL  341
             ASNELE+IL D  +P  +R+  AT +E ++L  LAAPAV+VYMINY+MSMSTQIF+GHL
Sbjct  30   RASNELEAILNDDSVPWARRMCAATAVETRMLLRLAAPAVLVYMINYMMSMSTQIFAGHL  89

Query  342  GNLELAAASLGNTGIQIFAYGLMLGMGSAVETLCGQAFGAGKYELLGIYLQRStvlltlt  521
            G LELAAASLGNTGIQ+FAYGLMLGMGSAVETLCGQA+GA K+++LGIY+QRSTVLL  T
Sbjct  90   GTLELAAASLGNTGIQVFAYGLMLGMGSAVETLCGQAYGANKFDMLGIYMQRSTVLLMAT  149

Query  522  gvllalIYVFSEPILIFLG  578
            G+ LA+IYVF  PILI LG
Sbjct  150  GIPLAVIYVFCRPILILLG  168



>ref|XP_006650264.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Oryza brachyantha]
Length=499

 Score =   185 bits (470),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 106/137 (77%), Positives = 118/137 (86%), Gaps = 0/137 (0%)
 Frame = +3

Query  168  SNELESILMDTGIPRWQRLKLATWIELKLLCYLAAPAVVVYMINYLMSMSTQIFSGHLGN  347
            S  LESIL DT  P  +R   AT IEL LL  +AAPAVV+YMINYLMSMSTQIFSGHLGN
Sbjct  15   SGRLESILSDTSTPLARRAWAATAIELGLLTRIAAPAVVMYMINYLMSMSTQIFSGHLGN  74

Query  348  LELAAASLGNTGIQIFAYGLMLGMGSAVETLCGQAFGAGKYELLGIYLQRStvlltltgv  527
            LELAAASLGN GIQ+FAYGLMLGMGSAVETLCGQAFGA KY++LG+YLQRS VLLTLTGV
Sbjct  75   LELAAASLGNNGIQMFAYGLMLGMGSAVETLCGQAFGAHKYDMLGVYLQRSAVLLTLTGV  134

Query  528  llalIYVFSEPILIFLG  578
             LA++Y FSEP+L+F+G
Sbjct  135  PLAVVYAFSEPLLVFMG  151



>ref|XP_008676828.1| PREDICTED: transparent testa 12 protein isoform X1 [Zea mays]
 tpg|DAA50099.1| TPA: putative MATE efflux family protein [Zea mays]
Length=537

 Score =   186 bits (472),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 103/144 (72%), Positives = 120/144 (83%), Gaps = 1/144 (1%)
 Frame = +3

Query  150  HEESEA-SNELESILMDTGIPRWQRLKLATWIELKLLCYLAAPAVVVYMINYLMSMSTQI  326
            H   EA S +LESIL D  +P  +R+  A+ +E++LL  LAAPAV+VYMINYLMSMSTQI
Sbjct  29   HSHGEAVSGQLESILSDASLPWRRRMLSASMVEMRLLVRLAAPAVLVYMINYLMSMSTQI  88

Query  327  FSGHLGNLELAAASLGNTGIQIFAYGLMLGMGSAVETLCGQAFGAGKYELLGIYLQRStv  506
            FSGHLG LELAAASLGNTGIQ+FAYGLMLGMGSAVETLCGQA+GA KY++LGIYLQRST+
Sbjct  89   FSGHLGTLELAAASLGNTGIQVFAYGLMLGMGSAVETLCGQAYGAHKYDMLGIYLQRSTI  148

Query  507  lltltgvllalIYVFSEPILIFLG  578
            LL  TGV L ++Y FS PIL+ LG
Sbjct  149  LLMATGVPLTVLYAFSRPILVLLG  172



>ref|XP_004173828.1| PREDICTED: protein TRANSPARENT TESTA 12-like, partial [Cucumis 
sativus]
Length=307

 Score =   181 bits (458),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 96/142 (68%), Positives = 119/142 (84%), Gaps = 0/142 (0%)
 Frame = +3

Query  153  EESEASNELESILMDTGIPRWQRLKLATWIELKLLCYLAAPAVVVYMINYLMSMSTQIFS  332
             ++  ++ELE++L +T +P   R   ATWIE+KLL YLA PA+ VYM+NYLM+M TQIFS
Sbjct  12   NKNACNDELENLLSNTHLPLLHRYTQATWIEMKLLFYLATPAIFVYMMNYLMTMFTQIFS  71

Query  333  GHLGNLELAAASLGNTGIQIFAYGLMLGMGSAVETLCGQAFGAGKYELLGIYLQRStvll  512
            GHLGNLELAA+SLGN GIQIFAYGLMLGMGSAVETLCGQA+GA K+E+LGIYLQ+S +LL
Sbjct  72   GHLGNLELAASSLGNNGIQIFAYGLMLGMGSAVETLCGQAYGAEKHEMLGIYLQKSAILL  131

Query  513  tltgvllalIYVFSEPILIFLG  578
            TLTG +L ++Y+  +PILI LG
Sbjct  132  TLTGFVLTIVYISCKPILIILG  153



>ref|XP_010100632.1| Protein TRANSPARENT TESTA 12 [Morus notabilis]
 gb|EXB83380.1| Protein TRANSPARENT TESTA 12 [Morus notabilis]
Length=497

 Score =   185 bits (470),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 108/158 (68%), Positives = 127/158 (80%), Gaps = 4/158 (3%)
 Frame = +3

Query  117  PESDG----VVSSPPHEESEASNELESILMDTGIPRWQRLKLATWIELKLLCYLAAPAVV  284
            P SD     ++S  P    E+S ELE IL DT  P  +RL  A  +E +LL +LA PAV+
Sbjct  16   PPSDHASPPLLSPSPKTSHESSGELERILTDTTRPFLRRLGPALLMESRLLFHLAGPAVI  75

Query  285  VYMINYLMSMSTQIFSGHLGNLELAAASLGNTGIQIFAYGLMLGMGSAVETLCGQAFGAG  464
            VYMINYLMSMSTQI SGHLGNLELAA+SLGN G+QIFAYGLMLGMGSAVETLCGQA+GA 
Sbjct  76   VYMINYLMSMSTQIVSGHLGNLELAASSLGNNGVQIFAYGLMLGMGSAVETLCGQAYGAQ  135

Query  465  KYELLGIYLQRStvlltltgvllalIYVFSEPILIFLG  578
            KY +LGIYLQRST+LLTLTG+LL ++Y+FS+PIL+FLG
Sbjct  136  KYGMLGIYLQRSTILLTLTGILLTVVYIFSKPILLFLG  173



>gb|KDP20755.1| hypothetical protein JCGZ_21226 [Jatropha curcas]
Length=359

 Score =   182 bits (461),  Expect = 5e-52, Method: Compositional matrix adjust.
 Identities = 96/137 (70%), Positives = 116/137 (85%), Gaps = 0/137 (0%)
 Frame = +3

Query  168  SNELESILMDTGIPRWQRLKLATWIELKLLCYLAAPAVVVYMINYLMSMSTQIFSGHLGN  347
            ++ELE IL DT    + R++LA+W+ELKLL  +A PAV+VY++N ++SMSTQIF GHLGN
Sbjct  19   NSELEEILTDTETSSFTRIQLASWVELKLLFRIAGPAVIVYLLNNVVSMSTQIFVGHLGN  78

Query  348  LELAAASLGNTGIQIFAYGLMLGMGSAVETLCGQAFGAGKYELLGIYLQRStvlltltgv  527
            LELAA SLGNTGIQIFAYGL+LGMGSAVETLCGQA+GA KYE+LGIYLQRSTVLL    +
Sbjct  79   LELAAVSLGNTGIQIFAYGLLLGMGSAVETLCGQAYGAHKYEMLGIYLQRSTVLLMAASI  138

Query  528  llalIYVFSEPILIFLG  578
             L L+YVFS+P+LI LG
Sbjct  139  PLTLLYVFSKPLLILLG  155



>gb|KJB57729.1| hypothetical protein B456_009G178100 [Gossypium raimondii]
Length=357

 Score =   182 bits (461),  Expect = 5e-52, Method: Compositional matrix adjust.
 Identities = 104/173 (60%), Positives = 132/173 (76%), Gaps = 2/173 (1%)
 Frame = +3

Query  60   HHLTNSVMDSSNGAAYDPLPESDGVVSSPPHEESEASNELESILMDTGIPRWQRLKLATW  239
              L + ++++S    +  L  SDG  SS      E  + LE +L DT +P ++RL+LAT 
Sbjct  5    QELNHPILNNSMDDDHQHLLPSDG--SSGASHGHEVDSRLEKVLSDTELPFFKRLRLATL  62

Query  240  IELKLLCYLAAPAVVVYMINYLMSMSTQIFSGHLGNLELAAASLGNTGIQIFAYGLMLGM  419
            IE+KLL  LAAPAV VYMIN  MS+ST++F GHLGNLELAAASLGN+GIQ+ AYGLMLGM
Sbjct  63   IEMKLLFRLAAPAVFVYMINNAMSLSTRVFCGHLGNLELAAASLGNSGIQLLAYGLMLGM  122

Query  420  GSAVETLCGQAFGAGKYELLGIYLQRStvlltltgvllalIYVFSEPILIFLG  578
            GSAVETLCGQA+GA +Y++LGIYLQRS ++LTLTG+ L L Y+FS+PIL+ LG
Sbjct  123  GSAVETLCGQAYGALRYDMLGIYLQRSIIVLTLTGIPLMLAYIFSKPILMLLG  175



>ref|XP_006389633.1| hypothetical protein POPTR_0021s00820g [Populus trichocarpa]
 gb|ERP48547.1| hypothetical protein POPTR_0021s00820g [Populus trichocarpa]
Length=501

 Score =   184 bits (467),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 102/158 (65%), Positives = 128/158 (81%), Gaps = 4/158 (3%)
 Frame = +3

Query  108  DPLPESDGVVSSPPHEESEASNELESILMDTGIPRWQRLKLATWIELKLLCYLAAPAVVV  287
            DP P  D  +S   H++    +ELE IL DT  P ++R++ A+W+ELKLL +LAAPAV+V
Sbjct  4    DP-PRLDFKLSY--HDDETVGDELEQILTDTEAPYFKRIRSASWVELKLLFHLAAPAVIV  60

Query  288  YMINYLMSMSTQIFSGHLGNLELAAASLGNTGIQIFAYGLMLGMGSAVETLCGQAFGAGK  467
            Y++N ++SMSTQIF GHLGNLELAA SLGN GIQ+FAYGLMLGMGSAVETLCGQA+G+ +
Sbjct  61   YLLNNVVSMSTQIFCGHLGNLELAAVSLGNNGIQMFAYGLMLGMGSAVETLCGQAYGSNR  120

Query  468  YELLGIYLQRStvlltltgvl-lalIYVFSEPILIFLG  578
            +E+LGIYLQRSTVLL  TG+  L +IY+FS+PILI LG
Sbjct  121  HEMLGIYLQRSTVLLMATGIFPLMMIYIFSKPILILLG  158



>ref|XP_008455432.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Cucumis melo]
Length=513

 Score =   184 bits (466),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 104/156 (67%), Positives = 122/156 (78%), Gaps = 2/156 (1%)
 Frame = +3

Query  117  PESDGVVSSPP--HEESEASNELESILMDTGIPRWQRLKLATWIELKLLCYLAAPAVVVY  290
            P S  ++SS          + ELE IL DT +   +R   ATWIE+KLL YLAAPAV VY
Sbjct  16   PASAALLSSHSLCSNHHGGNEELERILSDTEMSAMERYSRATWIEIKLLFYLAAPAVFVY  75

Query  291  MINYLMSMSTQIFSGHLGNLELAAASLGNTGIQIFAYGLMLGMGSAVETLCGQAFGAGKY  470
            +INY MS STQIFSGHLGNLELAAASLGN GIQ+FAYGLMLGMGSAVETLCGQA+GA ++
Sbjct  76   IINYAMSTSTQIFSGHLGNLELAAASLGNNGIQVFAYGLMLGMGSAVETLCGQAYGAERF  135

Query  471  ELLGIYLQRStvlltltgvllalIYVFSEPILIFLG  578
            E+LGIYLQRS +LLT+TG+ L + YVF +PIL+FLG
Sbjct  136  EMLGIYLQRSAILLTITGLFLTIPYVFCKPILLFLG  171



>ref|XP_004295265.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Fragaria vesca 
subsp. vesca]
Length=509

 Score =   184 bits (466),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 97/149 (65%), Positives = 122/149 (82%), Gaps = 0/149 (0%)
 Frame = +3

Query  132  VVSSPPHEESEASNELESILMDTGIPRWQRLKLATWIELKLLCYLAAPAVVVYMINYLMS  311
            ++S         S+ELE  L +T +P + RL+ ATW+ELK+L  LAAPAVVVY++N ++S
Sbjct  15   LISKRSSSVQPVSSELEETLSNTELPYFHRLRRATWVELKILFRLAAPAVVVYLLNNVIS  74

Query  312  MSTQIFSGHLGNLELAAASLGNTGIQIFAYGLMLGMGSAVETLCGQAFGAGKYELLGIYL  491
            MSTQI+ GHLGNLELAA+SLGNTGIQ+FAYGLMLGMGSAVETLCGQA+GA KYE+LGIYL
Sbjct  75   MSTQIYCGHLGNLELAASSLGNTGIQVFAYGLMLGMGSAVETLCGQAYGAHKYEMLGIYL  134

Query  492  QRStvlltltgvllalIYVFSEPILIFLG  578
            QRST+LL  TG+ +  IY+FS+P+L+ LG
Sbjct  135  QRSTILLMATGIPVMFIYIFSKPLLLALG  163



>ref|XP_004144494.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Cucumis sativus]
 gb|KGN43528.1| hypothetical protein Csa_7G044190 [Cucumis sativus]
Length=513

 Score =   184 bits (466),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 104/156 (67%), Positives = 123/156 (79%), Gaps = 2/156 (1%)
 Frame = +3

Query  117  PESDGVVSSPP--HEESEASNELESILMDTGIPRWQRLKLATWIELKLLCYLAAPAVVVY  290
            P S  ++SS          + ELE IL DT I    R + ATWIE+KLL YLAAPAV VY
Sbjct  16   PASAALLSSHSLCSNHHGGNEELERILSDTEISVMDRYRRATWIEIKLLFYLAAPAVFVY  75

Query  291  MINYLMSMSTQIFSGHLGNLELAAASLGNTGIQIFAYGLMLGMGSAVETLCGQAFGAGKY  470
            +INY MS STQIFSGHLGNLELAA+SLGN GIQ+FAYGLMLGMGSAVETLCGQA+GA ++
Sbjct  76   IINYTMSTSTQIFSGHLGNLELAASSLGNNGIQVFAYGLMLGMGSAVETLCGQAYGAERF  135

Query  471  ELLGIYLQRStvlltltgvllalIYVFSEPILIFLG  578
            E+LGIYLQRST+LLT+TG+ L + Y+F +PIL+FLG
Sbjct  136  EMLGIYLQRSTILLTITGIFLTIPYIFCKPILLFLG  171



>ref|XP_003562349.1| PREDICTED: protein TRANSPARENT TESTA 12-like isoform X1 [Brachypodium 
distachyon]
Length=494

 Score =   183 bits (464),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 104/144 (72%), Positives = 118/144 (82%), Gaps = 0/144 (0%)
 Frame = +3

Query  147  PHEESEASNELESILMDTGIPRWQRLKLATWIELKLLCYLAAPAVVVYMINYLMSMSTQI  326
            P  E      LESIL D+ +P  +R   AT +EL  L  L APAVV+YMINYLMSMSTQI
Sbjct  3    PGGEDGGGGRLESILTDSSLPLGERAWAATRVELGTLARLVAPAVVMYMINYLMSMSTQI  62

Query  327  FSGHLGNLELAAASLGNTGIQIFAYGLMLGMGSAVETLCGQAFGAGKYELLGIYLQRStv  506
            FSGHLGNLELAAASLGNTGIQ+FAYGLMLGMGSAVETLCGQA+GA KY++LG+YLQRS V
Sbjct  63   FSGHLGNLELAAASLGNTGIQMFAYGLMLGMGSAVETLCGQAYGAQKYDMLGVYLQRSAV  122

Query  507  lltltgvllalIYVFSEPILIFLG  578
            LL+ TG+ LA+IY FSEPIL+FLG
Sbjct  123  LLSCTGIPLAVIYAFSEPILLFLG  146



>ref|XP_011096076.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Sesamum indicum]
Length=509

 Score =   183 bits (465),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 96/156 (62%), Positives = 122/156 (78%), Gaps = 7/156 (4%)
 Frame = +3

Query  111  PLPESDGVVSSPPHEESEASNELESILMDTGIPRWQRLKLATWIELKLLCYLAAPAVVVY  290
            P P SD V        S +S+ELE +L D  +P  +R + ATWIELKLL  LAAPAV++Y
Sbjct  18   PPPPSDAV-------ASHSSSELEKVLSDADLPCLKRYRKATWIELKLLFKLAAPAVMMY  70

Query  291  MINYLMSMSTQIFSGHLGNLELAAASLGNTGIQIFAYGLMLGMGSAVETLCGQAFGAGKY  470
            +IN  MSMST+IFSGHLGNLE AAA LGN GIQ+FAYGL+LGMGSAVETLCGQA+GAG+Y
Sbjct  71   LINNAMSMSTRIFSGHLGNLEFAAACLGNQGIQLFAYGLLLGMGSAVETLCGQAYGAGRY  130

Query  471  ELLGIYLQRStvlltltgvllalIYVFSEPILIFLG  578
            E+LG+YLQR+TV+L +  + + ++YV S P+L+F+G
Sbjct  131  EMLGVYLQRATVVLMMFSLPIVVVYVLSRPLLLFIG  166



>ref|XP_004982535.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Setaria italica]
Length=499

 Score =   183 bits (464),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 105/135 (78%), Positives = 114/135 (84%), Gaps = 0/135 (0%)
 Frame = +3

Query  174  ELESILMDTGIPRWQRLKLATWIELKLLCYLAAPAVVVYMINYLMSMSTQIFSGHLGNLE  353
             LESIL D   P  +R   A  IEL+LL  LAAPAVV+YMINYLMSMSTQIFSGHLGNLE
Sbjct  16   RLESILTDASSPWTRRAWAAGGIELRLLARLAAPAVVMYMINYLMSMSTQIFSGHLGNLE  75

Query  354  LAAASLGNTGIQIFAYGLMLGMGSAVETLCGQAFGAGKYELLGIYLQRStvlltltgvll  533
            LAAASLGNTGIQ+FAYGLMLGMGSAVETLCGQA+GA KYE+LGIYLQRS VLL  TG+ L
Sbjct  76   LAAASLGNTGIQMFAYGLMLGMGSAVETLCGQAYGAQKYEMLGIYLQRSAVLLCGTGIPL  135

Query  534  alIYVFSEPILIFLG  578
            A+IY FSEPIL+ LG
Sbjct  136  AVIYAFSEPILVLLG  150



>gb|AAS01962.1| putative MATE efflux family protein [Oryza sativa Japonica Group]
Length=534

 Score =   183 bits (465),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 102/135 (76%), Positives = 117/135 (87%), Gaps = 0/135 (0%)
 Frame = +3

Query  174  ELESILMDTGIPRWQRLKLATWIELKLLCYLAAPAVVVYMINYLMSMSTQIFSGHLGNLE  353
            ELESIL D  +P  +R+  AT +E++L+  LAAPAV+VYMINYLMSMSTQIFSGHLG LE
Sbjct  44   ELESILGDETVPWARRMWAATGVEMRLMLRLAAPAVLVYMINYLMSMSTQIFSGHLGTLE  103

Query  354  LAAASLGNTGIQIFAYGLMLGMGSAVETLCGQAFGAGKYELLGIYLQRStvlltltgvll  533
            LAAASLGNTGIQ+FAYGLMLGMGSAVETLCGQA+GA KY++LG+YLQRSTVLL  TGV L
Sbjct  104  LAAASLGNTGIQVFAYGLMLGMGSAVETLCGQAYGAHKYDMLGVYLQRSTVLLMATGVPL  163

Query  534  alIYVFSEPILIFLG  578
            A+IY FS PIL+ LG
Sbjct  164  AVIYAFSRPILVLLG  178



>gb|ABF97209.1| MATE efflux family protein, expressed [Oryza sativa Japonica 
Group]
 gb|EEE59385.1| hypothetical protein OsJ_11501 [Oryza sativa Japonica Group]
Length=520

 Score =   183 bits (464),  Expect = 4e-51, Method: Compositional matrix adjust.
 Identities = 102/135 (76%), Positives = 117/135 (87%), Gaps = 0/135 (0%)
 Frame = +3

Query  174  ELESILMDTGIPRWQRLKLATWIELKLLCYLAAPAVVVYMINYLMSMSTQIFSGHLGNLE  353
            ELESIL D  +P  +R+  AT +E++L+  LAAPAV+VYMINYLMSMSTQIFSGHLG LE
Sbjct  44   ELESILGDETVPWARRMWAATGVEMRLMLRLAAPAVLVYMINYLMSMSTQIFSGHLGTLE  103

Query  354  LAAASLGNTGIQIFAYGLMLGMGSAVETLCGQAFGAGKYELLGIYLQRStvlltltgvll  533
            LAAASLGNTGIQ+FAYGLMLGMGSAVETLCGQA+GA KY++LG+YLQRSTVLL  TGV L
Sbjct  104  LAAASLGNTGIQVFAYGLMLGMGSAVETLCGQAYGAHKYDMLGVYLQRSTVLLMATGVPL  163

Query  534  alIYVFSEPILIFLG  578
            A+IY FS PIL+ LG
Sbjct  164  AVIYAFSRPILVLLG  178



>ref|XP_006389634.1| hypothetical protein POPTR_0021s00830g [Populus trichocarpa]
 gb|ERP48548.1| hypothetical protein POPTR_0021s00830g [Populus trichocarpa]
Length=486

 Score =   182 bits (462),  Expect = 4e-51, Method: Compositional matrix adjust.
 Identities = 105/175 (60%), Positives = 133/175 (76%), Gaps = 7/175 (4%)
 Frame = +3

Query  60   HHLTNSVMDSSNG--AAYDPLPESDGVVSSPPHEESEASNELESILMDTGIPRWQRLKLA  233
            + + N++ DSS G    + P+     ++   P +E   S+ELE +L DT +  ++RL+ A
Sbjct  4    NSIENTIDDSSTGNDEIHQPM-----LLDKQPSQEPVISSELEDVLSDTSLSYFKRLQRA  58

Query  234  TWIELKLLCYLAAPAVVVYMINYLMSMSTQIFSGHLGNLELAAASLGNTGIQIFAYGLML  413
            T+IELK L  LA PAVVVY++N ++SMSTQI  GHLGNLELAA+SLGN GIQIFAYGLML
Sbjct  59   TFIELKTLFQLAGPAVVVYLLNNVISMSTQILCGHLGNLELAASSLGNNGIQIFAYGLML  118

Query  414  GMGSAVETLCGQAFGAGKYELLGIYLQRStvlltltgvllalIYVFSEPILIFLG  578
            GMGSAVETLCGQA+GA KYE+LGIYLQRSTVLL  TG+ L +IY+FS+ +LI LG
Sbjct  119  GMGSAVETLCGQAYGAHKYEILGIYLQRSTVLLMATGIPLMMIYIFSKSLLILLG  173



>gb|KJB69294.1| hypothetical protein B456_011G014800 [Gossypium raimondii]
Length=497

 Score =   182 bits (463),  Expect = 4e-51, Method: Compositional matrix adjust.
 Identities = 101/179 (56%), Positives = 130/179 (73%), Gaps = 13/179 (7%)
 Frame = +3

Query  81   MDSSNGAAYDPLPESDGVVSSPPHEES-------------EASNELESILMDTGIPRWQR  221
            MDS     + PL  S      PP                 +  ++LE +L+D  +P ++R
Sbjct  1    MDSQQEQLHQPLQNSMHGHRQPPQTPELSSSESSDAGSVYDVDSKLEKVLLDNELPYFKR  60

Query  222  LKLATWIELKLLCYLAAPAVVVYMINYLMSMSTQIFSGHLGNLELAAASLGNTGIQIFAY  401
            L+LA+WIEL+LL +LA PAV VY+IN  MS+ST+I+ GHLGNLELAAASLGN+GIQ+ AY
Sbjct  61   LRLASWIELRLLFHLAGPAVFVYLINNFMSLSTRIYCGHLGNLELAAASLGNSGIQLLAY  120

Query  402  GLMLGMGSAVETLCGQAFGAGKYELLGIYLQRStvlltltgvllalIYVFSEPILIFLG  578
            GLMLGMGSAVETLCGQA+GA +Y +LG+YLQRST++LTLTG+ L L+YVFS+PI+I LG
Sbjct  121  GLMLGMGSAVETLCGQAYGAHRYSMLGVYLQRSTIVLTLTGIPLVLVYVFSKPIMIVLG  179



>gb|KJB57730.1| hypothetical protein B456_009G178100 [Gossypium raimondii]
Length=499

 Score =   182 bits (463),  Expect = 4e-51, Method: Compositional matrix adjust.
 Identities = 104/173 (60%), Positives = 132/173 (76%), Gaps = 2/173 (1%)
 Frame = +3

Query  60   HHLTNSVMDSSNGAAYDPLPESDGVVSSPPHEESEASNELESILMDTGIPRWQRLKLATW  239
              L + ++++S    +  L  SDG  SS      E  + LE +L DT +P ++RL+LAT 
Sbjct  5    QELNHPILNNSMDDDHQHLLPSDG--SSGASHGHEVDSRLEKVLSDTELPFFKRLRLATL  62

Query  240  IELKLLCYLAAPAVVVYMINYLMSMSTQIFSGHLGNLELAAASLGNTGIQIFAYGLMLGM  419
            IE+KLL  LAAPAV VYMIN  MS+ST++F GHLGNLELAAASLGN+GIQ+ AYGLMLGM
Sbjct  63   IEMKLLFRLAAPAVFVYMINNAMSLSTRVFCGHLGNLELAAASLGNSGIQLLAYGLMLGM  122

Query  420  GSAVETLCGQAFGAGKYELLGIYLQRStvlltltgvllalIYVFSEPILIFLG  578
            GSAVETLCGQA+GA +Y++LGIYLQRS ++LTLTG+ L L Y+FS+PIL+ LG
Sbjct  123  GSAVETLCGQAYGALRYDMLGIYLQRSIIVLTLTGIPLMLAYIFSKPILMLLG  175



>ref|XP_006449716.1| hypothetical protein CICLE_v10014968mg [Citrus clementina]
 gb|ESR62956.1| hypothetical protein CICLE_v10014968mg [Citrus clementina]
Length=508

 Score =   182 bits (463),  Expect = 4e-51, Method: Compositional matrix adjust.
 Identities = 101/171 (59%), Positives = 130/171 (76%), Gaps = 6/171 (4%)
 Frame = +3

Query  66   LTNSVMDSSNGAAYDPLPESDGVVSSPPHEESEASNELESILMDTGIPRWQRLKLATWIE  245
            + +S  D +N   ++P+ +S+G       E    S+ELE  L D  +  +QR+K ATWIE
Sbjct  1    MDSSNTDINNNNVHEPMLQSNG------SEVEPVSSELEEALSDDSLSFFQRIKKATWIE  54

Query  246  LKLLCYLAAPAVVVYMINYLMSMSTQIFSGHLGNLELAAASLGNTGIQIFAYGLMLGMGS  425
            LK L  LAAPA++VYM+N L+SMSTQIF GHLGNLELAA SLG+TGIQ+FA+GLMLGMGS
Sbjct  55   LKNLFRLAAPAILVYMLNNLVSMSTQIFCGHLGNLELAAVSLGSTGIQVFAFGLMLGMGS  114

Query  426  AVETLCGQAFGAGKYELLGIYLQRStvlltltgvllalIYVFSEPILIFLG  578
            A ETLCGQA+GA KY++LG+YLQRS V+LT TG+ L +IY+FS+ IL+ LG
Sbjct  115  ATETLCGQAYGAQKYDMLGVYLQRSAVILTATGIPLMVIYIFSKQILLLLG  165



>gb|EEC75606.1| hypothetical protein OsI_12318 [Oryza sativa Indica Group]
Length=520

 Score =   183 bits (464),  Expect = 5e-51, Method: Compositional matrix adjust.
 Identities = 102/135 (76%), Positives = 117/135 (87%), Gaps = 0/135 (0%)
 Frame = +3

Query  174  ELESILMDTGIPRWQRLKLATWIELKLLCYLAAPAVVVYMINYLMSMSTQIFSGHLGNLE  353
            ELESIL D  +P  +R+  AT +E++L+  LAAPAV+VYMINYLMSMSTQIFSGHLG LE
Sbjct  44   ELESILGDETVPWARRMWAATEVEMRLMLRLAAPAVLVYMINYLMSMSTQIFSGHLGTLE  103

Query  354  LAAASLGNTGIQIFAYGLMLGMGSAVETLCGQAFGAGKYELLGIYLQRStvlltltgvll  533
            LAAASLGNTGIQ+FAYGLMLGMGSAVETLCGQA+GA KY++LG+YLQRSTVLL  TGV L
Sbjct  104  LAAASLGNTGIQVFAYGLMLGMGSAVETLCGQAYGAHKYDMLGVYLQRSTVLLMATGVPL  163

Query  534  alIYVFSEPILIFLG  578
            A+IY FS PIL+ LG
Sbjct  164  AVIYAFSRPILVLLG  178



>gb|KJB57728.1| hypothetical protein B456_009G178100 [Gossypium raimondii]
Length=518

 Score =   182 bits (463),  Expect = 5e-51, Method: Compositional matrix adjust.
 Identities = 104/173 (60%), Positives = 132/173 (76%), Gaps = 2/173 (1%)
 Frame = +3

Query  60   HHLTNSVMDSSNGAAYDPLPESDGVVSSPPHEESEASNELESILMDTGIPRWQRLKLATW  239
              L + ++++S    +  L  SDG  SS      E  + LE +L DT +P ++RL+LAT 
Sbjct  5    QELNHPILNNSMDDDHQHLLPSDG--SSGASHGHEVDSRLEKVLSDTELPFFKRLRLATL  62

Query  240  IELKLLCYLAAPAVVVYMINYLMSMSTQIFSGHLGNLELAAASLGNTGIQIFAYGLMLGM  419
            IE+KLL  LAAPAV VYMIN  MS+ST++F GHLGNLELAAASLGN+GIQ+ AYGLMLGM
Sbjct  63   IEMKLLFRLAAPAVFVYMINNAMSLSTRVFCGHLGNLELAAASLGNSGIQLLAYGLMLGM  122

Query  420  GSAVETLCGQAFGAGKYELLGIYLQRStvlltltgvllalIYVFSEPILIFLG  578
            GSAVETLCGQA+GA +Y++LGIYLQRS ++LTLTG+ L L Y+FS+PIL+ LG
Sbjct  123  GSAVETLCGQAYGALRYDMLGIYLQRSIIVLTLTGIPLMLAYIFSKPILMLLG  175



>ref|XP_011048000.1| PREDICTED: protein TRANSPARENT TESTA 12-like isoform X2 [Populus 
euphratica]
Length=505

 Score =   182 bits (462),  Expect = 7e-51, Method: Compositional matrix adjust.
 Identities = 104/175 (59%), Positives = 133/175 (76%), Gaps = 7/175 (4%)
 Frame = +3

Query  60   HHLTNSVMDSSNG--AAYDPLPESDGVVSSPPHEESEASNELESILMDTGIPRWQRLKLA  233
            + + N++ DSS G    + P+     ++   P +E   S+ELE +L DT +  ++RL+ A
Sbjct  22   NSIENTIDDSSTGNDEIHQPM-----LLDKQPSQEPVISSELEDVLSDTSLSYFKRLQRA  76

Query  234  TWIELKLLCYLAAPAVVVYMINYLMSMSTQIFSGHLGNLELAAASLGNTGIQIFAYGLML  413
            T+IELK L  LA PA+VVY++N ++SMSTQI  GHLGNLELAA+SLGN GIQIFAYGLML
Sbjct  77   TFIELKTLFQLAGPAIVVYLLNNVISMSTQILCGHLGNLELAASSLGNNGIQIFAYGLML  136

Query  414  GMGSAVETLCGQAFGAGKYELLGIYLQRStvlltltgvllalIYVFSEPILIFLG  578
            GMGSAVETLCGQA+GA KYE+LGIYLQRSTVLL  TG+ L +IY+FS+ +LI LG
Sbjct  137  GMGSAVETLCGQAYGAQKYEMLGIYLQRSTVLLMATGIPLMMIYIFSKSLLILLG  191



>ref|XP_003562350.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Brachypodium distachyon]
Length=512

 Score =   182 bits (462),  Expect = 7e-51, Method: Compositional matrix adjust.
 Identities = 100/136 (74%), Positives = 117/136 (86%), Gaps = 0/136 (0%)
 Frame = +3

Query  171  NELESILMDTGIPRWQRLKLATWIELKLLCYLAAPAVVVYMINYLMSMSTQIFSGHLGNL  350
             +LESIL D  +P  +R+  AT +EL++L  LAAPAV+VYMINYLMSMSTQIFSGHLG L
Sbjct  33   RQLESILSDESVPWGRRMCAATAVELRMLIRLAAPAVLVYMINYLMSMSTQIFSGHLGTL  92

Query  351  ELAAASLGNTGIQIFAYGLMLGMGSAVETLCGQAFGAGKYELLGIYLQRStvlltltgvl  530
            ELAAASLGNTGIQ+FAYGLMLGMGSAVETLCGQA+GA K+++LGIY+QRSTVLL  TGV 
Sbjct  93   ELAAASLGNTGIQVFAYGLMLGMGSAVETLCGQAYGASKFDMLGIYMQRSTVLLMATGVP  152

Query  531  lalIYVFSEPILIFLG  578
            LA++Y FS PIL+ LG
Sbjct  153  LAVLYAFSRPILVLLG  168



>gb|KJB69293.1| hypothetical protein B456_011G014800 [Gossypium raimondii]
Length=522

 Score =   182 bits (461),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 101/179 (56%), Positives = 130/179 (73%), Gaps = 13/179 (7%)
 Frame = +3

Query  81   MDSSNGAAYDPLPESDGVVSSPPHEES-------------EASNELESILMDTGIPRWQR  221
            MDS     + PL  S      PP                 +  ++LE +L+D  +P ++R
Sbjct  1    MDSQQEQLHQPLQNSMHGHRQPPQTPELSSSESSDAGSVYDVDSKLEKVLLDNELPYFKR  60

Query  222  LKLATWIELKLLCYLAAPAVVVYMINYLMSMSTQIFSGHLGNLELAAASLGNTGIQIFAY  401
            L+LA+WIEL+LL +LA PAV VY+IN  MS+ST+I+ GHLGNLELAAASLGN+GIQ+ AY
Sbjct  61   LRLASWIELRLLFHLAGPAVFVYLINNFMSLSTRIYCGHLGNLELAAASLGNSGIQLLAY  120

Query  402  GLMLGMGSAVETLCGQAFGAGKYELLGIYLQRStvlltltgvllalIYVFSEPILIFLG  578
            GLMLGMGSAVETLCGQA+GA +Y +LG+YLQRST++LTLTG+ L L+YVFS+PI+I LG
Sbjct  121  GLMLGMGSAVETLCGQAYGAHRYSMLGVYLQRSTIVLTLTGIPLVLVYVFSKPIMIVLG  179



>ref|XP_011047999.1| PREDICTED: protein TRANSPARENT TESTA 12-like isoform X1 [Populus 
euphratica]
Length=534

 Score =   182 bits (462),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 104/175 (59%), Positives = 133/175 (76%), Gaps = 7/175 (4%)
 Frame = +3

Query  60   HHLTNSVMDSSNG--AAYDPLPESDGVVSSPPHEESEASNELESILMDTGIPRWQRLKLA  233
            + + N++ DSS G    + P+     ++   P +E   S+ELE +L DT +  ++RL+ A
Sbjct  22   NSIENTIDDSSTGNDEIHQPM-----LLDKQPSQEPVISSELEDVLSDTSLSYFKRLQRA  76

Query  234  TWIELKLLCYLAAPAVVVYMINYLMSMSTQIFSGHLGNLELAAASLGNTGIQIFAYGLML  413
            T+IELK L  LA PA+VVY++N ++SMSTQI  GHLGNLELAA+SLGN GIQIFAYGLML
Sbjct  77   TFIELKTLFQLAGPAIVVYLLNNVISMSTQILCGHLGNLELAASSLGNNGIQIFAYGLML  136

Query  414  GMGSAVETLCGQAFGAGKYELLGIYLQRStvlltltgvllalIYVFSEPILIFLG  578
            GMGSAVETLCGQA+GA KYE+LGIYLQRSTVLL  TG+ L +IY+FS+ +LI LG
Sbjct  137  GMGSAVETLCGQAYGAQKYEMLGIYLQRSTVLLMATGIPLMMIYIFSKSLLILLG  191



>ref|XP_006467446.1| PREDICTED: protein TRANSPARENT TESTA 12-like isoform X2 [Citrus 
sinensis]
 ref|XP_006467447.1| PREDICTED: protein TRANSPARENT TESTA 12-like isoform X3 [Citrus 
sinensis]
Length=488

 Score =   181 bits (460),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 99/158 (63%), Positives = 124/158 (78%), Gaps = 6/158 (4%)
 Frame = +3

Query  105  YDPLPESDGVVSSPPHEESEASNELESILMDTGIPRWQRLKLATWIELKLLCYLAAPAVV  284
            ++P+ +S+G       E    S+ELE  L D  +  +QR+K ATWIELK L  LAAPA++
Sbjct  13   HEPMLQSNG------SEVEPVSSELEEALSDDSLSFFQRIKKATWIELKNLFRLAAPAIL  66

Query  285  VYMINYLMSMSTQIFSGHLGNLELAAASLGNTGIQIFAYGLMLGMGSAVETLCGQAFGAG  464
            VYM+N L++MSTQIF GHLGNLELAA SLGNTGIQ+FAYGLMLGMGSA ETLCGQA+GA 
Sbjct  67   VYMLNNLVAMSTQIFCGHLGNLELAAVSLGNTGIQVFAYGLMLGMGSATETLCGQAYGAQ  126

Query  465  KYELLGIYLQRStvlltltgvllalIYVFSEPILIFLG  578
            KY++LG+YLQRS V+LT TG+ L +IY+FS+ IL+ LG
Sbjct  127  KYDMLGVYLQRSAVILTATGIPLMVIYIFSKQILLLLG  164



>gb|KHG25345.1| Protein TRANSPARENT TESTA 12 -like protein [Gossypium arboreum]
Length=518

 Score =   182 bits (461),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 107/173 (62%), Positives = 132/173 (76%), Gaps = 6/173 (3%)
 Frame = +3

Query  60   HHLTNSVMDSSNGAAYDPLPESDGVVSSPPHEESEASNELESILMDTGIPRWQRLKLATW  239
            H + N+ MD      +  L  SDG  SS      E  + LE +L DT +P ++RL+LAT 
Sbjct  9    HPILNNSMDDD----HQHLLPSDG--SSGASHGHEVDSGLEKVLSDTELPFFKRLRLATL  62

Query  240  IELKLLCYLAAPAVVVYMINYLMSMSTQIFSGHLGNLELAAASLGNTGIQIFAYGLMLGM  419
            IE+KLL  LAAPAV VYMIN  MS+ST++F GHLGNLELAAASLGN+GIQ+ AYGLMLGM
Sbjct  63   IEMKLLFRLAAPAVFVYMINNAMSLSTRVFCGHLGNLELAAASLGNSGIQLLAYGLMLGM  122

Query  420  GSAVETLCGQAFGAGKYELLGIYLQRStvlltltgvllalIYVFSEPILIFLG  578
            GSAVETLCGQA+GA +Y++LGIYLQRST++LTLTG+ L L Y+FS+PIL+ LG
Sbjct  123  GSAVETLCGQAYGALRYDMLGIYLQRSTIVLTLTGIPLMLAYIFSKPILMLLG  175



>ref|XP_004982536.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Setaria italica]
Length=516

 Score =   181 bits (460),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 111/176 (63%), Positives = 130/176 (74%), Gaps = 10/176 (6%)
 Frame = +3

Query  81   MDSSNGAAYDPLPESD---GVVSSPPHEES-------EASNELESILMDTGIPRWQRLKL  230
            M ++  AA D  P         S+PP   +       E S +LESIL D  +P  +R+  
Sbjct  1    MGNAAEAAGDSKPLQSPLLAACSAPPPATTSGGGGGHEVSGQLESILSDGSLPWPRRVLA  60

Query  231  ATWIELKLLCYLAAPAVVVYMINYLMSMSTQIFSGHLGNLELAAASLGNTGIQIFAYGLM  410
            A+ +EL+LL  LAAPAVVVYMINYLMSMSTQIFSGHLG LELAAASLGN GIQ+FAYGLM
Sbjct  61   ASAVELRLLARLAAPAVVVYMINYLMSMSTQIFSGHLGTLELAAASLGNNGIQMFAYGLM  120

Query  411  LGMGSAVETLCGQAFGAGKYELLGIYLQRStvlltltgvllalIYVFSEPILIFLG  578
            LGMGSAVETLCGQA+GA K+++LGIYLQR+T+LL  TGV LA+IY FS PILI LG
Sbjct  121  LGMGSAVETLCGQAYGALKHDMLGIYLQRATILLMATGVPLAVIYAFSRPILILLG  176



>gb|KDO78208.1| hypothetical protein CISIN_1g010561mg [Citrus sinensis]
Length=507

 Score =   180 bits (457),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 99/158 (63%), Positives = 124/158 (78%), Gaps = 6/158 (4%)
 Frame = +3

Query  105  YDPLPESDGVVSSPPHEESEASNELESILMDTGIPRWQRLKLATWIELKLLCYLAAPAVV  284
            ++P+ +S+G       E    S+ELE  L D  +  +QR+K ATWIELK L  LAAPA++
Sbjct  13   HEPMLQSNG------SEVEPVSSELEEALSDDSLSFFQRIKKATWIELKNLFRLAAPAIL  66

Query  285  VYMINYLMSMSTQIFSGHLGNLELAAASLGNTGIQIFAYGLMLGMGSAVETLCGQAFGAG  464
            VYM+N L++MSTQIF GHLGNLELAA SLGNTGIQ+FAYGLMLGMGSA ETLCGQA+GA 
Sbjct  67   VYMLNNLVAMSTQIFCGHLGNLELAAVSLGNTGIQVFAYGLMLGMGSATETLCGQAYGAQ  126

Query  465  KYELLGIYLQRStvlltltgvllalIYVFSEPILIFLG  578
            KY++LG+YLQRS V+LT TG+ L +IY+FS+ IL+ LG
Sbjct  127  KYDMLGVYLQRSAVILTATGIPLMVIYIFSKQILLLLG  164



>ref|XP_006467445.1| PREDICTED: protein TRANSPARENT TESTA 12-like isoform X1 [Citrus 
sinensis]
Length=507

 Score =   180 bits (457),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 99/158 (63%), Positives = 124/158 (78%), Gaps = 6/158 (4%)
 Frame = +3

Query  105  YDPLPESDGVVSSPPHEESEASNELESILMDTGIPRWQRLKLATWIELKLLCYLAAPAVV  284
            ++P+ +S+G       E    S+ELE  L D  +  +QR+K ATWIELK L  LAAPA++
Sbjct  13   HEPMLQSNG------SEVEPVSSELEEALSDDSLSFFQRIKKATWIELKNLFRLAAPAIL  66

Query  285  VYMINYLMSMSTQIFSGHLGNLELAAASLGNTGIQIFAYGLMLGMGSAVETLCGQAFGAG  464
            VYM+N L++MSTQIF GHLGNLELAA SLGNTGIQ+FAYGLMLGMGSA ETLCGQA+GA 
Sbjct  67   VYMLNNLVAMSTQIFCGHLGNLELAAVSLGNTGIQVFAYGLMLGMGSATETLCGQAYGAQ  126

Query  465  KYELLGIYLQRStvlltltgvllalIYVFSEPILIFLG  578
            KY++LG+YLQRS V+LT TG+ L +IY+FS+ IL+ LG
Sbjct  127  KYDMLGVYLQRSAVILTATGIPLMVIYIFSKQILLLLG  164



>ref|XP_008347106.1| PREDICTED: LOW QUALITY PROTEIN: protein TRANSPARENT TESTA 12-like 
[Malus domestica]
Length=508

 Score =   180 bits (457),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 101/159 (64%), Positives = 125/159 (79%), Gaps = 6/159 (4%)
 Frame = +3

Query  120  ESDGVVSSP---PHEESE---ASNELESILMDTGIPRWQRLKLATWIELKLLCYLAAPAV  281
             SD  +S P   P   S     S+ELE  L +T +  +QRL+ ATW+E K+L  LAAPAV
Sbjct  4    SSDSDLSEPMLVPKTSSLQQIVSSELEDTLNNTDLSNFQRLRTATWLETKILYRLAAPAV  63

Query  282  VVYMINYLMSMSTQIFSGHLGNLELAAASLGNTGIQIFAYGLMLGMGSAVETLCGQAFGA  461
            VVY++N ++SMSTQIF GHLGNLELAA+SLGNTGIQ+FAYGLMLGMGSAVETLCGQA+GA
Sbjct  64   VVYLLNNVISMSTQIFCGHLGNLELAASSLGNTGIQVFAYGLMLGMGSAVETLCGQAYGA  123

Query  462  GKYELLGIYLQRStvlltltgvllalIYVFSEPILIFLG  578
             KYE+LGIY+QRST+LL  TG+ L  +Y+FS+P+L+ LG
Sbjct  124  HKYEMLGIYMQRSTILLLATGIPLXXVYIFSKPLLLALG  162



>gb|KGN64598.1| hypothetical protein Csa_1G071120 [Cucumis sativus]
Length=496

 Score =   180 bits (456),  Expect = 4e-50, Method: Compositional matrix adjust.
 Identities = 96/142 (68%), Positives = 119/142 (84%), Gaps = 0/142 (0%)
 Frame = +3

Query  153  EESEASNELESILMDTGIPRWQRLKLATWIELKLLCYLAAPAVVVYMINYLMSMSTQIFS  332
             ++  ++ELE++L +T +P   R   ATWIE+KLL YLA PA+ VYM+NYLM+M TQIFS
Sbjct  12   NKNACNDELENLLSNTHLPLLHRYTQATWIEMKLLFYLATPAIFVYMMNYLMTMFTQIFS  71

Query  333  GHLGNLELAAASLGNTGIQIFAYGLMLGMGSAVETLCGQAFGAGKYELLGIYLQRStvll  512
            GHLGNLELAA+SLGN GIQIFAYGLMLGMGSAVETLCGQA+GA K+E+LGIYLQ+S +LL
Sbjct  72   GHLGNLELAASSLGNNGIQIFAYGLMLGMGSAVETLCGQAYGAEKHEMLGIYLQKSAILL  131

Query  513  tltgvllalIYVFSEPILIFLG  578
            TLTG +L ++Y+  +PILI LG
Sbjct  132  TLTGFVLTIVYISCKPILIILG  153



>ref|XP_004293282.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Fragaria vesca 
subsp. vesca]
Length=525

 Score =   180 bits (457),  Expect = 5e-50, Method: Compositional matrix adjust.
 Identities = 96/153 (63%), Positives = 124/153 (81%), Gaps = 6/153 (4%)
 Frame = +3

Query  138  SSPPHE------ESEASNELESILMDTGIPRWQRLKLATWIELKLLCYLAAPAVVVYMIN  299
            S P +E        E S+ LE +L DT +P ++RL+LATWIELKLL  LAAPAV VY++N
Sbjct  13   SEPAYESLASASHGEESSSLEKVLSDTQLPYFKRLRLATWIELKLLFRLAAPAVFVYVVN  72

Query  300  YLMSMSTQIFSGHLGNLELAAASLGNTGIQIFAYGLMLGMGSAVETLCGQAFGAGKYELL  479
              MS+ST++F+GHLGNLELAAASLGN+GIQ+FAYGLMLGMGSAVETLCGQA+GA  Y++L
Sbjct  73   NTMSVSTRVFAGHLGNLELAAASLGNSGIQLFAYGLMLGMGSAVETLCGQAYGAQMYDML  132

Query  480  GIYLQRStvlltltgvllalIYVFSEPILIFLG  578
            GIYLQR+TV+L++TG+ L  +++ S+PIL+  G
Sbjct  133  GIYLQRATVVLSITGIPLLAVFILSKPILLLFG  165



>gb|KCW76957.1| hypothetical protein EUGRSUZ_D01316 [Eucalyptus grandis]
Length=458

 Score =   178 bits (451),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 98/165 (59%), Positives = 122/165 (74%), Gaps = 14/165 (8%)
 Frame = +3

Query  126  DGVVSSPPHEESE--------------ASNELESILMDTGIPRWQRLKLATWIELKLLCY  263
            DG+++S   ++ +               S+ LE +L DT +PR++RL  AT IEL  L  
Sbjct  7    DGIIASDESDQHQEPLLQPKQQPTAETVSSALEDMLSDTELPRFRRLSRATRIELNTLFR  66

Query  264  LAAPAVVVYMINYLMSMSTQIFSGHLGNLELAAASLGNTGIQIFAYGLMLGMGSAVETLC  443
            LAAPAVVVY++N + SMSTQIF GHLGNLELAAASLGN GIQIFAYGLMLGMGSAVETLC
Sbjct  67   LAAPAVVVYLLNNVTSMSTQIFCGHLGNLELAAASLGNNGIQIFAYGLMLGMGSAVETLC  126

Query  444  GQAFGAGKYELLGIYLQRStvlltltgvllalIYVFSEPILIFLG  578
            GQA+GA KYE+LG+YLQRST+LL  T + +  IY+FS+ +L+ LG
Sbjct  127  GQAYGAHKYEMLGVYLQRSTILLMATAIPVMFIYIFSKQLLLLLG  171



>ref|XP_007149972.1| hypothetical protein PHAVU_005G115000g [Phaseolus vulgaris]
 gb|ESW21966.1| hypothetical protein PHAVU_005G115000g [Phaseolus vulgaris]
Length=507

 Score =   179 bits (453),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 97/147 (66%), Positives = 120/147 (82%), Gaps = 1/147 (1%)
 Frame = +3

Query  141  SPPHEESEASN-ELESILMDTGIPRWQRLKLATWIELKLLCYLAAPAVVVYMINYLMSMS  317
            +P       SN ELE IL D  +P  +R+  A  +E +LL +LAAPAVVVY+INY+MSMS
Sbjct  19   TPRSNSKHGSNGELERILTDDTLPFLRRVGAALCVEFRLLFFLAAPAVVVYLINYVMSMS  78

Query  318  TQIFSGHLGNLELAAASLGNTGIQIFAYGLMLGMGSAVETLCGQAFGAGKYELLGIYLQR  497
            TQIFSGHLGNLELAA++LGN GIQ+FAYGLMLGMGSAVETLCGQA+GA K+ +LG+Y+QR
Sbjct  79   TQIFSGHLGNLELAASALGNNGIQVFAYGLMLGMGSAVETLCGQAYGARKFGMLGVYMQR  138

Query  498  StvlltltgvllalIYVFSEPILIFLG  578
            STVLL+L G+++ +IY FSE IL+FLG
Sbjct  139  STVLLSLAGIVVTVIYAFSERILLFLG  165



>ref|XP_010278701.1| PREDICTED: protein TRANSPARENT TESTA 12 [Nelumbo nucifera]
Length=506

 Score =   179 bits (453),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 94/146 (64%), Positives = 121/146 (83%), Gaps = 0/146 (0%)
 Frame = +3

Query  138  SSPPHEESEASNELESILMDTGIPRWQRLKLATWIELKLLCYLAAPAVVVYMINYLMSMS  317
            ++P  ++ + + +LE IL DT +   +RL+ A  IELKLL +LA PA  VYMINY+MSMS
Sbjct  15   TNPDSDQPQNNEQLERILSDTQLSTLKRLQSAIVIELKLLFHLATPAAFVYMINYVMSMS  74

Query  318  TQIFSGHLGNLELAAASLGNTGIQIFAYGLMLGMGSAVETLCGQAFGAGKYELLGIYLQR  497
            T++FSGHLGNLELAA SLGN+GIQ+ AYGLMLGMGSAVETLCGQA+G  +YE+LGIYLQR
Sbjct  75   TRVFSGHLGNLELAAVSLGNSGIQLLAYGLMLGMGSAVETLCGQAYGGRRYEMLGIYLQR  134

Query  498  StvlltltgvllalIYVFSEPILIFL  575
            ST++L  TG+ +A++Y+FS+PILIFL
Sbjct  135  STIILMATGIPIAVLYIFSKPILIFL  160



>gb|EMT13253.1| Protein TRANSPARENT TESTA 12 [Aegilops tauschii]
Length=498

 Score =   179 bits (453),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 99/142 (70%), Positives = 117/142 (82%), Gaps = 0/142 (0%)
 Frame = +3

Query  153  EESEASNELESILMDTGIPRWQRLKLATWIELKLLCYLAAPAVVVYMINYLMSMSTQIFS  332
            +E  AS  LESIL D+  PR +R+  A  IEL +L  LA PAV++YMIN+LMSMSTQIFS
Sbjct  5    DEHGASARLESILTDSSAPRAERVWAAGAIELGMLLRLAVPAVIMYMINFLMSMSTQIFS  64

Query  333  GHLGNLELAAASLGNTGIQIFAYGLMLGMGSAVETLCGQAFGAGKYELLGIYLQRStvll  512
            GHLG+LELAAASLGNTG+Q+FAYGLMLGMGSAVETLCGQA+G  KY++LG YLQRS V+L
Sbjct  65   GHLGSLELAAASLGNTGVQMFAYGLMLGMGSAVETLCGQAYGGHKYDMLGTYLQRSAVIL  124

Query  513  tltgvllalIYVFSEPILIFLG  578
              TG+ LA+IY FSEPIL+ LG
Sbjct  125  CCTGIPLAVIYAFSEPILLLLG  146



>ref|XP_007026054.1| MATE efflux family protein isoform 1 [Theobroma cacao]
 gb|EOY28676.1| MATE efflux family protein isoform 1 [Theobroma cacao]
Length=515

 Score =   178 bits (452),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 100/152 (66%), Positives = 124/152 (82%), Gaps = 7/152 (5%)
 Frame = +3

Query  144  PPHEESEAS-------NELESILMDTGIPRWQRLKLATWIELKLLCYLAAPAVVVYMINY  302
            PP  ES AS       + LE +L D  +  ++RL+LA+WIEL+L+  LAAPA+ VYMIN 
Sbjct  21   PPQPESGASTSHRYVDSRLEKVLSDPELSFFKRLRLASWIELRLIFSLAAPAIFVYMINN  80

Query  303  LMSMSTQIFSGHLGNLELAAASLGNTGIQIFAYGLMLGMGSAVETLCGQAFGAGKYELLG  482
             MS+ST++F GHLGNLELAAASLGN+G+Q+FAYGLMLGMGSAVETLCGQA+GA +Y +LG
Sbjct  81   AMSLSTRVFCGHLGNLELAAASLGNSGVQLFAYGLMLGMGSAVETLCGQAYGALRYNMLG  140

Query  483  IYLQRStvlltltgvllalIYVFSEPILIFLG  578
            +YLQRST++LTLTG+ LAL YVFS+PILI LG
Sbjct  141  VYLQRSTIVLTLTGIPLALAYVFSKPILILLG  172



>gb|KDP20756.1| hypothetical protein JCGZ_21227 [Jatropha curcas]
Length=999

 Score =   182 bits (462),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 100/137 (73%), Positives = 118/137 (86%), Gaps = 0/137 (0%)
 Frame = +3

Query  168  SNELESILMDTGIPRWQRLKLATWIELKLLCYLAAPAVVVYMINYLMSMSTQIFSGHLGN  347
            S+ELE IL +T     QR + AT +ELK L YLAAPA+VVY++N ++SMSTQI  GHLGN
Sbjct  30   SDELEQILCNTQFTYLQRTRKATLVELKTLFYLAAPAIVVYLLNNVVSMSTQILVGHLGN  89

Query  348  LELAAASLGNTGIQIFAYGLMLGMGSAVETLCGQAFGAGKYELLGIYLQRStvlltltgv  527
            LELAAASLGNTGIQ+FAYGLMLGMGSAVETLCGQA+GAGKY++LG+YLQRST+LLT TG+
Sbjct  90   LELAAASLGNTGIQVFAYGLMLGMGSAVETLCGQAYGAGKYDMLGVYLQRSTILLTATGI  149

Query  528  llalIYVFSEPILIFLG  578
             + LIYVFS+PILI LG
Sbjct  150  PITLIYVFSKPILILLG  166


 Score =   173 bits (438),  Expect = 5e-46, Method: Compositional matrix adjust.
 Identities = 103/182 (57%), Positives = 126/182 (69%), Gaps = 13/182 (7%)
 Frame = +3

Query  33   EQAAPRFPPHHLTNSVMDSSNGAAYDPLPESDGVVSSPPHEESEASNELESILMDTGIPR  212
            E+   +F  +   N + ++ N       P        PP      S+ELE IL +  +  
Sbjct  488  EEKREKFSTYRKINHMANNQNSLLRKHSP--------PP-----VSSELEDILSNMELSY  534

Query  213  WQRLKLATWIELKLLCYLAAPAVVVYMINYLMSMSTQIFSGHLGNLELAAASLGNTGIQI  392
             QRLK A  +ELK L  LA PAV+VY++N ++SMSTQIF GHLGNLELAAASLGNTGIQ+
Sbjct  535  SQRLKSAVLVELKTLFLLAGPAVIVYLLNNVVSMSTQIFCGHLGNLELAAASLGNTGIQV  594

Query  393  FAYGLMLGMGSAVETLCGQAFGAGKYELLGIYLQRStvlltltgvllalIYVFSEPILIF  572
            FAYGLMLGMGSAVETLCGQA+GA KYE+LG+YLQRSTV+LT  G+ L LIY FS+ IL+ 
Sbjct  595  FAYGLMLGMGSAVETLCGQAYGAHKYEMLGVYLQRSTVILTAAGIPLTLIYAFSKQILLL  654

Query  573  LG  578
            LG
Sbjct  655  LG  656



>ref|XP_010052837.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Eucalyptus grandis]
 gb|KCW76956.1| hypothetical protein EUGRSUZ_D01316 [Eucalyptus grandis]
Length=514

 Score =   178 bits (451),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 98/165 (59%), Positives = 122/165 (74%), Gaps = 14/165 (8%)
 Frame = +3

Query  126  DGVVSSPPHEESE--------------ASNELESILMDTGIPRWQRLKLATWIELKLLCY  263
            DG+++S   ++ +               S+ LE +L DT +PR++RL  AT IEL  L  
Sbjct  7    DGIIASDESDQHQEPLLQPKQQPTAETVSSALEDMLSDTELPRFRRLSRATRIELNTLFR  66

Query  264  LAAPAVVVYMINYLMSMSTQIFSGHLGNLELAAASLGNTGIQIFAYGLMLGMGSAVETLC  443
            LAAPAVVVY++N + SMSTQIF GHLGNLELAAASLGN GIQIFAYGLMLGMGSAVETLC
Sbjct  67   LAAPAVVVYLLNNVTSMSTQIFCGHLGNLELAAASLGNNGIQIFAYGLMLGMGSAVETLC  126

Query  444  GQAFGAGKYELLGIYLQRStvlltltgvllalIYVFSEPILIFLG  578
            GQA+GA KYE+LG+YLQRST+LL  T + +  IY+FS+ +L+ LG
Sbjct  127  GQAYGAHKYEMLGVYLQRSTILLMATAIPVMFIYIFSKQLLLLLG  171



>ref|XP_007026055.1| MATE efflux family protein, expressed isoform 2 [Theobroma cacao]
 gb|EOY28677.1| MATE efflux family protein, expressed isoform 2 [Theobroma cacao]
Length=516

 Score =   178 bits (451),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 100/152 (66%), Positives = 124/152 (82%), Gaps = 7/152 (5%)
 Frame = +3

Query  144  PPHEESEAS-------NELESILMDTGIPRWQRLKLATWIELKLLCYLAAPAVVVYMINY  302
            PP  ES AS       + LE +L D  +  ++RL+LA+WIEL+L+  LAAPA+ VYMIN 
Sbjct  21   PPQPESGASTSHRYVDSRLEKVLSDPELSFFKRLRLASWIELRLIFSLAAPAIFVYMINN  80

Query  303  LMSMSTQIFSGHLGNLELAAASLGNTGIQIFAYGLMLGMGSAVETLCGQAFGAGKYELLG  482
             MS+ST++F GHLGNLELAAASLGN+G+Q+FAYGLMLGMGSAVETLCGQA+GA +Y +LG
Sbjct  81   AMSLSTRVFCGHLGNLELAAASLGNSGVQLFAYGLMLGMGSAVETLCGQAYGALRYNMLG  140

Query  483  IYLQRStvlltltgvllalIYVFSEPILIFLG  578
            +YLQRST++LTLTG+ LAL YVFS+PILI LG
Sbjct  141  VYLQRSTIVLTLTGIPLALAYVFSKPILILLG  172



>ref|XP_007212447.1| hypothetical protein PRUPE_ppa017237mg, partial [Prunus persica]
 gb|EMJ13646.1| hypothetical protein PRUPE_ppa017237mg, partial [Prunus persica]
Length=490

 Score =   177 bits (450),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 100/154 (65%), Positives = 126/154 (82%), Gaps = 7/154 (5%)
 Frame = +3

Query  138  SSPPHEESEASNE-------LESILMDTGIPRWQRLKLATWIELKLLCYLAAPAVVVYMI  296
            S P     EASN+       LE +L DT +P ++RL+LATWIEL LL  LAAPAV+VY++
Sbjct  15   SEPDSTALEASNQGDGLESPLEKVLSDTQLPSFKRLRLATWIELNLLFRLAAPAVLVYVV  74

Query  297  NYLMSMSTQIFSGHLGNLELAAASLGNTGIQIFAYGLMLGMGSAVETLCGQAFGAGKYEL  476
            N  MS+ST++F+GHLGNLELAAASLGN+G+Q+FAYGLMLGMGSAVETLCGQA+GA KY++
Sbjct  75   NNFMSLSTRVFAGHLGNLELAAASLGNSGVQLFAYGLMLGMGSAVETLCGQAYGAEKYDM  134

Query  477  LGIYLQRStvlltltgvllalIYVFSEPILIFLG  578
            LGIYLQR+T++LTLTG+ L LI++ S+PILI  G
Sbjct  135  LGIYLQRATIVLTLTGLPLLLIFLLSKPILILFG  168



>gb|EMS63519.1| Protein TRANSPARENT TESTA 12 [Triticum urartu]
Length=498

 Score =   178 bits (451),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 98/142 (69%), Positives = 117/142 (82%), Gaps = 0/142 (0%)
 Frame = +3

Query  153  EESEASNELESILMDTGIPRWQRLKLATWIELKLLCYLAAPAVVVYMINYLMSMSTQIFS  332
            +E  AS  LESIL D+  PR +R+  A  IEL +L  LA PAV++YMIN+LMSMSTQIFS
Sbjct  5    DEHGASARLESILTDSSAPRAERMWAAGAIELGMLLRLAVPAVIMYMINFLMSMSTQIFS  64

Query  333  GHLGNLELAAASLGNTGIQIFAYGLMLGMGSAVETLCGQAFGAGKYELLGIYLQRStvll  512
            GHLG+LELAAASLGNTG+Q+FAYGLMLGMGSAVETLCGQA+G  KY++LG YLQRS V+L
Sbjct  65   GHLGSLELAAASLGNTGVQMFAYGLMLGMGSAVETLCGQAYGGHKYDMLGTYLQRSAVIL  124

Query  513  tltgvllalIYVFSEPILIFLG  578
              TG+ LA+IY FSEP+L+ LG
Sbjct  125  CCTGIPLAVIYAFSEPLLLLLG  146



>emb|CDM86677.1| unnamed protein product [Triticum aestivum]
Length=495

 Score =   177 bits (450),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 98/142 (69%), Positives = 117/142 (82%), Gaps = 0/142 (0%)
 Frame = +3

Query  153  EESEASNELESILMDTGIPRWQRLKLATWIELKLLCYLAAPAVVVYMINYLMSMSTQIFS  332
            +E  AS  LESIL D+  PR +R+  A  IEL +L  LA PAV++YMIN+LMSMSTQIFS
Sbjct  5    DEHGASARLESILTDSSAPRAERMWAAGAIELGMLLRLAVPAVIMYMINFLMSMSTQIFS  64

Query  333  GHLGNLELAAASLGNTGIQIFAYGLMLGMGSAVETLCGQAFGAGKYELLGIYLQRStvll  512
            GHLG+LELAAASLGNTG+Q+FAYGLMLGMGSAVETLCGQA+G  KY++LG YLQRS V+L
Sbjct  65   GHLGSLELAAASLGNTGVQMFAYGLMLGMGSAVETLCGQAYGGHKYDMLGTYLQRSAVIL  124

Query  513  tltgvllalIYVFSEPILIFLG  578
              TG+ LA+IY FSEP+L+ LG
Sbjct  125  CCTGIPLAVIYAFSEPLLLLLG  146



>ref|XP_009345545.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Pyrus x bretschneideri]
Length=509

 Score =   177 bits (450),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 101/159 (64%), Positives = 124/159 (78%), Gaps = 6/159 (4%)
 Frame = +3

Query  120  ESDGVVSSP---PHEESE---ASNELESILMDTGIPRWQRLKLATWIELKLLCYLAAPAV  281
             SD  +S P   P   S     S+ELE  L +T +  +QRL+ ATW+E K L  LAAPAV
Sbjct  4    SSDSDLSEPMLVPKTSSLQQIVSSELEDTLNNTDLSNFQRLRTATWLETKTLYRLAAPAV  63

Query  282  VVYMINYLMSMSTQIFSGHLGNLELAAASLGNTGIQIFAYGLMLGMGSAVETLCGQAFGA  461
            VVY++N ++SMSTQI  GHLGNLELAA+SLGNTGIQ+FAYGLMLGMGSAVETLCGQA+GA
Sbjct  64   VVYLLNNVISMSTQILCGHLGNLELAASSLGNTGIQVFAYGLMLGMGSAVETLCGQAYGA  123

Query  462  GKYELLGIYLQRStvlltltgvllalIYVFSEPILIFLG  578
             KYE+LGIY+QRST+LL  TG+ L +IY+FS+P+L+ LG
Sbjct  124  HKYEMLGIYMQRSTILLVATGIPLMIIYIFSKPLLLALG  162



>ref|XP_007211777.1| hypothetical protein PRUPE_ppa004182mg [Prunus persica]
 gb|EMJ12976.1| hypothetical protein PRUPE_ppa004182mg [Prunus persica]
Length=525

 Score =   177 bits (450),  Expect = 4e-49, Method: Compositional matrix adjust.
 Identities = 100/154 (65%), Positives = 127/154 (82%), Gaps = 7/154 (5%)
 Frame = +3

Query  138  SSPPHEESEASNE-------LESILMDTGIPRWQRLKLATWIELKLLCYLAAPAVVVYMI  296
            S P    +EAS         LE +L DT +  ++RL+LA+WIELKLL  LAAPAV+VY++
Sbjct  15   SEPDSAAAEASGHGDGLESLLEKVLSDTQLSSFKRLRLASWIELKLLFRLAAPAVLVYIV  74

Query  297  NYLMSMSTQIFSGHLGNLELAAASLGNTGIQIFAYGLMLGMGSAVETLCGQAFGAGKYEL  476
            NYLMS+ST++F+GHLGNLELAAASLGN+G+Q+FAYGLMLGMGSAVETLCGQA+GA KY++
Sbjct  75   NYLMSLSTRVFAGHLGNLELAAASLGNSGVQLFAYGLMLGMGSAVETLCGQAYGAEKYDM  134

Query  477  LGIYLQRStvlltltgvllalIYVFSEPILIFLG  578
            LGIYLQR+T++LTLTG+ L LI++ S+PILI  G
Sbjct  135  LGIYLQRATIVLTLTGLPLLLIFLLSKPILILFG  168



>ref|XP_009361725.1| PREDICTED: protein TRANSPARENT TESTA 12-like isoform X1 [Pyrus 
x bretschneideri]
Length=509

 Score =   177 bits (450),  Expect = 4e-49, Method: Compositional matrix adjust.
 Identities = 101/159 (64%), Positives = 124/159 (78%), Gaps = 6/159 (4%)
 Frame = +3

Query  120  ESDGVVSSP---PHEESE---ASNELESILMDTGIPRWQRLKLATWIELKLLCYLAAPAV  281
             SD  +S P   P   S     S+ELE  L +T +  +QRL+ ATW+E K L  LAAPAV
Sbjct  4    SSDSDLSEPMLVPKTSSLQQIVSSELEDTLNNTDLSNFQRLRTATWLETKTLYRLAAPAV  63

Query  282  VVYMINYLMSMSTQIFSGHLGNLELAAASLGNTGIQIFAYGLMLGMGSAVETLCGQAFGA  461
            VVY++N ++SMSTQI  GHLGNLELAA+SLGNTGIQ+FAYGLMLGMGSAVETLCGQA+GA
Sbjct  64   VVYLLNNVISMSTQILCGHLGNLELAASSLGNTGIQVFAYGLMLGMGSAVETLCGQAYGA  123

Query  462  GKYELLGIYLQRStvlltltgvllalIYVFSEPILIFLG  578
             KYE+LGIY+QRST+LL  TG+ L +IY+FS+P+L+ LG
Sbjct  124  HKYEMLGIYMQRSTILLVATGIPLMIIYIFSKPLLLALG  162



>ref|XP_008664995.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Zea mays]
 tpg|DAA50101.1| TPA: putative MATE efflux family protein [Zea mays]
Length=500

 Score =   177 bits (449),  Expect = 4e-49, Method: Compositional matrix adjust.
 Identities = 106/139 (76%), Positives = 115/139 (83%), Gaps = 5/139 (4%)
 Frame = +3

Query  165  ASNELESILMDTGIPR-WQRLKLATWIELKLLCYLAAPAVVVYMINYLMSMSTQIFSGHL  341
            AS +LES+L  +     W     A  IEL+LL  LAAPAVV YMINYLMSMSTQIFSGHL
Sbjct  11   ASAQLESVLTSSSSSFPWA----AAAIELRLLTRLAAPAVVTYMINYLMSMSTQIFSGHL  66

Query  342  GNLELAAASLGNTGIQIFAYGLMLGMGSAVETLCGQAFGAGKYELLGIYLQRStvlltlt  521
            GNLELAAASLGNTG+QIFAYGLMLGMGSAVETLCGQA+GA KYE+LGIYLQRS VLL  T
Sbjct  67   GNLELAAASLGNTGVQIFAYGLMLGMGSAVETLCGQAYGAHKYEMLGIYLQRSAVLLCAT  126

Query  522  gvllalIYVFSEPILIFLG  578
            GV LA+IY FSEPIL+FLG
Sbjct  127  GVPLAVIYAFSEPILVFLG  145



>ref|XP_009361804.1| PREDICTED: protein TRANSPARENT TESTA 12-like isoform X2 [Pyrus 
x bretschneideri]
Length=509

 Score =   177 bits (449),  Expect = 4e-49, Method: Compositional matrix adjust.
 Identities = 101/159 (64%), Positives = 124/159 (78%), Gaps = 6/159 (4%)
 Frame = +3

Query  120  ESDGVVSSP---PHEESE---ASNELESILMDTGIPRWQRLKLATWIELKLLCYLAAPAV  281
             SD  +S P   P   S     S+ELE  L +T +  +QRL+ ATW+E K L  LAAPAV
Sbjct  4    SSDSDLSEPMLVPKTSSLQQIVSSELEDTLNNTDLSNFQRLRTATWLETKTLYRLAAPAV  63

Query  282  VVYMINYLMSMSTQIFSGHLGNLELAAASLGNTGIQIFAYGLMLGMGSAVETLCGQAFGA  461
            VVY++N ++SMSTQI  GHLGNLELAA+SLGNTGIQ+FAYGLMLGMGSAVETLCGQA+GA
Sbjct  64   VVYLLNNVISMSTQILCGHLGNLELAASSLGNTGIQVFAYGLMLGMGSAVETLCGQAYGA  123

Query  462  GKYELLGIYLQRStvlltltgvllalIYVFSEPILIFLG  578
             KYE+LGIY+QRST+LL  TG+ L +IY+FS+P+L+ LG
Sbjct  124  HKYEMLGIYMQRSTILLVATGIPLMIIYIFSKPLLLALG  162



>ref|XP_002273901.2| PREDICTED: protein TRANSPARENT TESTA 12-like [Vitis vinifera]
Length=508

 Score =   177 bits (449),  Expect = 4e-49, Method: Compositional matrix adjust.
 Identities = 101/166 (61%), Positives = 129/166 (78%), Gaps = 2/166 (1%)
 Frame = +3

Query  81   MDSSNGAAYDPLPESDGVVSSPPHEESEASNELESILMDTGIPRWQRLKLATWIELKLLC  260
            MDS +   + P+ ES    SS      E+S+ELE +L D  +P  +RL  ATWIELKLL 
Sbjct  1    MDSQDDQLHTPILESMQC-SSSTGNTFESSSELEKVLSDLQLPWLRRLLKATWIELKLLF  59

Query  261  YLAAPAVVVYMINYLMSMSTQIFSGHLGNLELAAASLGNTGIQIFAYGLMLGMGSAVETL  440
             LAAPA++VY+IN  MS+ST++F+GHLGNLELAAA+LG + IQ+ AYGLMLGMGSAVETL
Sbjct  60   RLAAPAILVYLINNAMSLSTRVFAGHLGNLELAAATLGKSSIQL-AYGLMLGMGSAVETL  118

Query  441  CGQAFGAGKYELLGIYLQRStvlltltgvllalIYVFSEPILIFLG  578
            CGQA+GA +YE+LG+YLQR+TV+LT TG  L +IYVF++PIL+ LG
Sbjct  119  CGQAYGADRYEMLGVYLQRATVVLTATGFPLTVIYVFAKPILLLLG  164



>gb|KDO78210.1| hypothetical protein CISIN_1g043801mg, partial [Citrus sinensis]
Length=215

 Score =   169 bits (428),  Expect = 8e-49, Method: Compositional matrix adjust.
 Identities = 90/127 (71%), Positives = 109/127 (86%), Gaps = 0/127 (0%)
 Frame = +3

Query  198  TGIPRWQRLKLATWIELKLLCYLAAPAVVVYMINYLMSMSTQIFSGHLGNLELAAASLGN  377
            T +  +QR+K ATWIELK L  LAAPA++VYM+N L++MSTQIF GHLGNLELAA SLGN
Sbjct  10   TSLSFFQRIKKATWIELKSLFRLAAPAILVYMLNNLVAMSTQIFCGHLGNLELAAVSLGN  69

Query  378  TGIQIFAYGLMLGMGSAVETLCGQAFGAGKYELLGIYLQRStvlltltgvllalIYVFSE  557
            TGIQ+FAYGLMLGMGSA ETLCGQA+GA KY++LG+YLQRS V+LT TG+ L +IY+FS+
Sbjct  70   TGIQVFAYGLMLGMGSATETLCGQAYGAQKYDMLGVYLQRSAVILTATGIPLMVIYIFSK  129

Query  558  PILIFLG  578
             IL+ LG
Sbjct  130  QILLLLG  136



>ref|XP_009345550.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Pyrus x bretschneideri]
Length=509

 Score =   176 bits (446),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 92/137 (67%), Positives = 116/137 (85%), Gaps = 0/137 (0%)
 Frame = +3

Query  168  SNELESILMDTGIPRWQRLKLATWIELKLLCYLAAPAVVVYMINYLMSMSTQIFSGHLGN  347
            S+ELE  L +T    +QRL+ ATW+E K LC LAAPAVVVY++N ++++STQIF GHLGN
Sbjct  26   SSELEDTLNNTDFSYFQRLRTATWLEAKTLCRLAAPAVVVYLLNNVITLSTQIFCGHLGN  85

Query  348  LELAAASLGNTGIQIFAYGLMLGMGSAVETLCGQAFGAGKYELLGIYLQRStvlltltgv  527
            LELAA+SLGN GIQ+F +GLMLGMGSAVETLCGQA+GA KYE+LGIY+QRST+LL  TG+
Sbjct  86   LELAASSLGNIGIQVFTFGLMLGMGSAVETLCGQAYGAHKYEMLGIYMQRSTILLVATGI  145

Query  528  llalIYVFSEPILIFLG  578
             L +IY+FS+P+L+ LG
Sbjct  146  PLMIIYIFSKPLLLALG  162



>ref|XP_008371179.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Malus domestica]
Length=340

 Score =   172 bits (437),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 99/181 (55%), Positives = 131/181 (72%), Gaps = 14/181 (8%)
 Frame = +3

Query  57   PHHLTNSVMDSSNGAAYDPLPESDGVVSSPPHEESEASNE-------LESILMDTGIPRW  215
            PH L    M S +       P    ++ S P   ++AS++       LE +L DT +P +
Sbjct  12   PHXLFGPKMXSQH-------PLHQPILHSEPEPVAQASSDGDGVDFLLEKVLSDTQLPSF  64

Query  216  QRLKLATWIELKLLCYLAAPAVVVYMINYLMSMSTQIFSGHLGNLELAAASLGNTGIQIF  395
            +R + ATWIELKLL  LAAPAV+VY+IN  MS+S ++F+GHLGNLELAAASLGN GIQ+ 
Sbjct  65   KRFRSATWIELKLLFRLAAPAVLVYVINNSMSLSARVFAGHLGNLELAAASLGNNGIQLL  124

Query  396  AYGLMLGMGSAVETLCGQAFGAGKYELLGIYLQRStvlltltgvllalIYVFSEPILIFL  575
            AYGLMLGMGSAVETLCGQA+GA KY++L IYLQR+T++L+LTG+ L  I++ ++P+LI L
Sbjct  125  AYGLMLGMGSAVETLCGQAYGAQKYDMLSIYLQRATIVLSLTGLPLLAIFLLTKPMLILL  184

Query  576  G  578
            G
Sbjct  185  G  185



>ref|XP_010093281.1| Protein TRANSPARENT TESTA 12 [Morus notabilis]
 gb|EXB53806.1| Protein TRANSPARENT TESTA 12 [Morus notabilis]
Length=534

 Score =   176 bits (447),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 103/166 (62%), Positives = 127/166 (77%), Gaps = 2/166 (1%)
 Frame = +3

Query  81   MDSSNGAAYDPLPESDGVVSSPPHEESEASNELESILMDTGIPRWQRLKLATWIELKLLC  260
            M+S N   ++P+  +    S    E    S+ELE  L ++ +  ++R + AT +ELK L 
Sbjct  1    MESINNDLHEPILATKEASSILSPEA--ISSELEETLSNSDLSYFRRFQAATCLELKTLY  58

Query  261  YLAAPAVVVYMINYLMSMSTQIFSGHLGNLELAAASLGNTGIQIFAYGLMLGMGSAVETL  440
             LAAPAV+VY++N + SMSTQI  GHLGNL+LAAASLGNTGIQ+FAYGLMLGMGSAVETL
Sbjct  59   RLAAPAVIVYLLNNVTSMSTQILCGHLGNLQLAAASLGNTGIQVFAYGLMLGMGSAVETL  118

Query  441  CGQAFGAGKYELLGIYLQRStvlltltgvllalIYVFSEPILIFLG  578
            CGQA+GA KYELLG+YLQRST+LL  TGV L LIY+FS+PILIFLG
Sbjct  119  CGQAYGAHKYELLGVYLQRSTILLMATGVPLTLIYIFSKPILIFLG  164



>ref|XP_011048008.1| PREDICTED: protein TRANSPARENT TESTA 12-like isoform X3 [Populus 
euphratica]
Length=485

 Score =   175 bits (444),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 101/173 (58%), Positives = 131/173 (76%), Gaps = 3/173 (2%)
 Frame = +3

Query  66   LTNSVMDS--SNGAAYDPLPESDGVVSSPPHEESEASNELESILMDTGIPRWQRLKLATW  239
            +T + MDS  S G   +PL  S     +  H   EA + LE++L DT +  + RL LA+W
Sbjct  1    MTTAKMDSKESRGELQEPLLLSSAKPETNDHYH-EADSRLENVLNDTNLSYFMRLGLASW  59

Query  240  IELKLLCYLAAPAVVVYMINYLMSMSTQIFSGHLGNLELAAASLGNTGIQIFAYGLMLGM  419
            IELKLL  LAAPAV VY+IN  +S+ST+IFSGHLGNLE A+ SL N+G+Q+F YGLMLGM
Sbjct  60   IELKLLFRLAAPAVFVYLINNSLSLSTRIFSGHLGNLEFASVSLANSGVQLFVYGLMLGM  119

Query  420  GSAVETLCGQAFGAGKYELLGIYLQRStvlltltgvllalIYVFSEPILIFLG  578
            GSAVETLCGQ++GA ++E+LG +LQR+TV+LTLTG+ LA +YVF++PILI LG
Sbjct  120  GSAVETLCGQSYGAQRFEMLGTFLQRATVVLTLTGIPLAAVYVFAKPILILLG  172



>ref|XP_010052836.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Eucalyptus grandis]
 gb|KCW76955.1| hypothetical protein EUGRSUZ_D01315 [Eucalyptus grandis]
Length=512

 Score =   176 bits (445),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 92/138 (67%), Positives = 117/138 (85%), Gaps = 3/138 (2%)
 Frame = +3

Query  147  PHEESEASNELESILMDTGIPRWQRLKLATWIELKLLCYLAAPAVVVYMINYLMSMSTQI  326
            PH+     ++LE++L D  +  + RL+LATWIELKLL YLAAPAV+VYMIN  MS+ST+I
Sbjct  32   PHQ---VDSKLETVLTDMELTYFNRLRLATWIELKLLFYLAAPAVMVYMINNFMSLSTRI  88

Query  327  FSGHLGNLELAAASLGNTGIQIFAYGLMLGMGSAVETLCGQAFGAGKYELLGIYLQRStv  506
            F+GHLGNLELAAA+LGN+GIQ+FAYGLMLGMGSAVETLCGQA+G+ +Y +LGIY+QR+ V
Sbjct  89   FAGHLGNLELAAANLGNSGIQLFAYGLMLGMGSAVETLCGQAYGSSRYNMLGIYMQRAMV  148

Query  507  lltltgvllalIYVFSEP  560
            +LT TG+ L +IYV S+P
Sbjct  149  VLTATGIPLTIIYVLSKP  166



>ref|XP_008371177.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Malus domestica]
Length=316

 Score =   171 bits (434),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 97/157 (62%), Positives = 122/157 (78%), Gaps = 5/157 (3%)
 Frame = +3

Query  123  SDGVVSSP---PHEESE--ASNELESILMDTGIPRWQRLKLATWIELKLLCYLAAPAVVV  287
            SD  +S P   P    +   S+ELE  L +T    +QRL+ ATW+E K L  LAAPAVVV
Sbjct  5    SDNDLSEPMLVPKTSLQQIVSSELEDTLNNTEFSYFQRLRTATWLETKTLYRLAAPAVVV  64

Query  288  YMINYLMSMSTQIFSGHLGNLELAAASLGNTGIQIFAYGLMLGMGSAVETLCGQAFGAGK  467
            Y++N +++MSTQIF GHLGNLELAA+SLGN GIQ+FA+GLMLGMGSAVETLCGQA+GA K
Sbjct  65   YLLNNVITMSTQIFCGHLGNLELAASSLGNIGIQVFAFGLMLGMGSAVETLCGQAYGAHK  124

Query  468  YELLGIYLQRStvlltltgvllalIYVFSEPILIFLG  578
            YE+LGIY+QRST+LL  TG+ L + Y+FS+P+L+ LG
Sbjct  125  YEMLGIYMQRSTILLXATGIPLXIXYIFSKPLLLALG  161



>ref|XP_007026057.1| MATE efflux family protein [Theobroma cacao]
 gb|EOY28679.1| MATE efflux family protein [Theobroma cacao]
Length=512

 Score =   176 bits (445),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 101/166 (61%), Positives = 121/166 (73%), Gaps = 4/166 (2%)
 Frame = +3

Query  81   MDSSNGAAYDPLPESDGVVSSPPHEESEASNELESILMDTGIPRWQRLKLATWIELKLLC  260
            +D +    + PL       S  P      S+ LE  L D  +  + R++ ATWIEL +L 
Sbjct  9    IDCAENEVHQPLLHYYKSFSPEPC----VSDLLEDTLSDNSLSLFWRIQRATWIELGILF  64

Query  261  YLAAPAVVVYMINYLMSMSTQIFSGHLGNLELAAASLGNTGIQIFAYGLMLGMGSAVETL  440
            +LAAPAVVVY+ N L+SMSTQIF GHLGNLELAAASLGN GIQ FAYGLMLGMGSAVETL
Sbjct  65   HLAAPAVVVYLFNNLISMSTQIFCGHLGNLELAAASLGNNGIQTFAYGLMLGMGSAVETL  124

Query  441  CGQAFGAGKYELLGIYLQRStvlltltgvllalIYVFSEPILIFLG  578
            CGQA+GA KY +LGIYLQRST+LL  TG+ L +IY+FS+PIL+ LG
Sbjct  125  CGQAYGANKYGMLGIYLQRSTILLMATGIPLMIIYIFSKPILLLLG  170



>ref|XP_002464321.1| hypothetical protein SORBIDRAFT_01g016100 [Sorghum bicolor]
 gb|EER91319.1| hypothetical protein SORBIDRAFT_01g016100 [Sorghum bicolor]
Length=503

 Score =   175 bits (444),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 97/113 (86%), Positives = 105/113 (93%), Gaps = 0/113 (0%)
 Frame = +3

Query  240  IELKLLCYLAAPAVVVYMINYLMSMSTQIFSGHLGNLELAAASLGNTGIQIFAYGLMLGM  419
            IEL+LL  LAAPAVV+YMINYLMSMSTQIFSGHLGNLELAAASLGNTGIQIFAYGLMLGM
Sbjct  41   IELRLLTRLAAPAVVMYMINYLMSMSTQIFSGHLGNLELAAASLGNTGIQIFAYGLMLGM  100

Query  420  GSAVETLCGQAFGAGKYELLGIYLQRStvlltltgvllalIYVFSEPILIFLG  578
            GSAVETLCGQA+GA KY++LGIYLQRS VLL  TGV LA++Y FSEPIL+FLG
Sbjct  101  GSAVETLCGQAYGAQKYDMLGIYLQRSAVLLCATGVPLAVVYAFSEPILVFLG  153



>ref|XP_008371097.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Malus domestica]
Length=316

 Score =   171 bits (433),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 97/157 (62%), Positives = 122/157 (78%), Gaps = 5/157 (3%)
 Frame = +3

Query  123  SDGVVSSP---PHEESE--ASNELESILMDTGIPRWQRLKLATWIELKLLCYLAAPAVVV  287
            SD  +S P   P    +   S+ELE  L +T    +QRL+ ATW+E K L  LAAPAVVV
Sbjct  5    SDNDLSEPMLVPKTSLQQIVSSELEDTLNNTEFSYFQRLRTATWLETKTLYRLAAPAVVV  64

Query  288  YMINYLMSMSTQIFSGHLGNLELAAASLGNTGIQIFAYGLMLGMGSAVETLCGQAFGAGK  467
            Y++N +++MSTQIF GHLGNLELAA+SLGN GIQ+FA+GLMLGMGSAVETLCGQA+GA K
Sbjct  65   YLLNNVITMSTQIFCGHLGNLELAASSLGNIGIQVFAFGLMLGMGSAVETLCGQAYGAHK  124

Query  468  YELLGIYLQRStvlltltgvllalIYVFSEPILIFLG  578
            YE+LGIY+QRST+LL  TG+ L + Y+FS+P+L+ LG
Sbjct  125  YEMLGIYMQRSTILLXATGIPLXIXYIFSKPLLLALG  161



>ref|XP_008664994.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Zea mays]
Length=493

 Score =   175 bits (444),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 104/142 (73%), Positives = 116/142 (82%), Gaps = 3/142 (2%)
 Frame = +3

Query  153  EESEASNELESILMDTGIPRWQRLKLATWIELKLLCYLAAPAVVVYMINYLMSMSTQIFS  332
            + ++AS  LESIL             A  IEL+LL  LAAPAVV+YMINYLMSMSTQIFS
Sbjct  5    DGADASERLESILTAEAA---ASPWAAAAIELRLLTRLAAPAVVMYMINYLMSMSTQIFS  61

Query  333  GHLGNLELAAASLGNTGIQIFAYGLMLGMGSAVETLCGQAFGAGKYELLGIYLQRStvll  512
            GHLGNLELAAASLGN G+Q+FAYGLMLGMGSAVETLCGQA+GA KYE+LGIYLQRS VLL
Sbjct  62   GHLGNLELAAASLGNAGVQMFAYGLMLGMGSAVETLCGQAYGAHKYEMLGIYLQRSAVLL  121

Query  513  tltgvllalIYVFSEPILIFLG  578
             +TGV LA+IY FSEPIL+FLG
Sbjct  122  CVTGVPLAVIYAFSEPILVFLG  143



>ref|XP_011048006.1| PREDICTED: protein TRANSPARENT TESTA 12-like isoform X1 [Populus 
euphratica]
Length=519

 Score =   175 bits (444),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 101/173 (58%), Positives = 131/173 (76%), Gaps = 3/173 (2%)
 Frame = +3

Query  66   LTNSVMDS--SNGAAYDPLPESDGVVSSPPHEESEASNELESILMDTGIPRWQRLKLATW  239
            +T + MDS  S G   +PL  S     +  H   EA + LE++L DT +  + RL LA+W
Sbjct  1    MTTAKMDSKESRGELQEPLLLSSAKPETNDHYH-EADSRLENVLNDTNLSYFMRLGLASW  59

Query  240  IELKLLCYLAAPAVVVYMINYLMSMSTQIFSGHLGNLELAAASLGNTGIQIFAYGLMLGM  419
            IELKLL  LAAPAV VY+IN  +S+ST+IFSGHLGNLE A+ SL N+G+Q+F YGLMLGM
Sbjct  60   IELKLLFRLAAPAVFVYLINNSLSLSTRIFSGHLGNLEFASVSLANSGVQLFVYGLMLGM  119

Query  420  GSAVETLCGQAFGAGKYELLGIYLQRStvlltltgvllalIYVFSEPILIFLG  578
            GSAVETLCGQ++GA ++E+LG +LQR+TV+LTLTG+ LA +YVF++PILI LG
Sbjct  120  GSAVETLCGQSYGAQRFEMLGTFLQRATVVLTLTGIPLAAVYVFAKPILILLG  172



>gb|EYU29855.1| hypothetical protein MIMGU_mgv1a004845mg [Erythranthe guttata]
Length=507

 Score =   175 bits (444),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 98/167 (59%), Positives = 123/167 (74%), Gaps = 9/167 (5%)
 Frame = +3

Query  84   DSSNGAAYDPL--PESDGVVSSPPHEESEASNELESILMDTGIPRWQRLKLATWIELKLL  257
             S N    +PL  P S+G          E S+ELE +L DT +  W+R + A  IEL+ L
Sbjct  3    SSKNKGVSEPLLEPNSNG-------GTEEVSSELEDVLCDTTLSGWRRFQKAIVIELRYL  55

Query  258  CYLAAPAVVVYMINYLMSMSTQIFSGHLGNLELAAASLGNTGIQIFAYGLMLGMGSAVET  437
              LA PAVVVY++N ++SMSTQIF GHLGNLELAA++LGN G+Q+ AYGLMLGMGSAVET
Sbjct  56   LRLAGPAVVVYLLNSVISMSTQIFCGHLGNLELAASALGNNGVQLLAYGLMLGMGSAVET  115

Query  438  LCGQAFGAGKYELLGIYLQRStvlltltgvllalIYVFSEPILIFLG  578
            LCGQA+GA +YE+LGIY+QRS +LL  TG+ L LIY+FS+P+LI LG
Sbjct  116  LCGQAYGAQQYEMLGIYMQRSIILLMATGIPLMLIYIFSKPLLILLG  162



>ref|XP_011048007.1| PREDICTED: protein TRANSPARENT TESTA 12-like isoform X2 [Populus 
euphratica]
Length=514

 Score =   175 bits (444),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 101/173 (58%), Positives = 131/173 (76%), Gaps = 3/173 (2%)
 Frame = +3

Query  66   LTNSVMDS--SNGAAYDPLPESDGVVSSPPHEESEASNELESILMDTGIPRWQRLKLATW  239
            +T + MDS  S G   +PL  S     +  H   EA + LE++L DT +  + RL LA+W
Sbjct  1    MTTAKMDSKESRGELQEPLLLSSAKPETNDHYH-EADSRLENVLNDTNLSYFMRLGLASW  59

Query  240  IELKLLCYLAAPAVVVYMINYLMSMSTQIFSGHLGNLELAAASLGNTGIQIFAYGLMLGM  419
            IELKLL  LAAPAV VY+IN  +S+ST+IFSGHLGNLE A+ SL N+G+Q+F YGLMLGM
Sbjct  60   IELKLLFRLAAPAVFVYLINNSLSLSTRIFSGHLGNLEFASVSLANSGVQLFVYGLMLGM  119

Query  420  GSAVETLCGQAFGAGKYELLGIYLQRStvlltltgvllalIYVFSEPILIFLG  578
            GSAVETLCGQ++GA ++E+LG +LQR+TV+LTLTG+ LA +YVF++PILI LG
Sbjct  120  GSAVETLCGQSYGAQRFEMLGTFLQRATVVLTLTGIPLAAVYVFAKPILILLG  172



>ref|XP_007212986.1| hypothetical protein PRUPE_ppa022523mg [Prunus persica]
 gb|EMJ14185.1| hypothetical protein PRUPE_ppa022523mg [Prunus persica]
Length=487

 Score =   175 bits (443),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 93/138 (67%), Positives = 115/138 (83%), Gaps = 0/138 (0%)
 Frame = +3

Query  165  ASNELESILMDTGIPRWQRLKLATWIELKLLCYLAAPAVVVYMINYLMSMSTQIFSGHLG  344
             S ELE  L +T +  +QRL+  TW+ELK+L  LAAPAVVVY++N ++SMSTQIF GHLG
Sbjct  4    VSRELEDTLNNTELSYFQRLRTGTWLELKILFRLAAPAVVVYLLNNVISMSTQIFCGHLG  63

Query  345  NLELAAASLGNTGIQIFAYGLMLGMGSAVETLCGQAFGAGKYELLGIYLQRStvlltltg  524
            NLELAA+SLGNTGIQ+FAYGLMLGMGSAVETLCGQA+GA KY++LGIY+QRST+LL  T 
Sbjct  64   NLELAASSLGNTGIQVFAYGLMLGMGSAVETLCGQAYGAHKYDMLGIYMQRSTILLLATS  123

Query  525  vllalIYVFSEPILIFLG  578
            + L +IY+F + IL+ LG
Sbjct  124  IPLMIIYIFCKQILLGLG  141



>ref|XP_011096071.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Sesamum indicum]
Length=512

 Score =   175 bits (443),  Expect = 4e-48, Method: Compositional matrix adjust.
 Identities = 95/157 (61%), Positives = 119/157 (76%), Gaps = 4/157 (3%)
 Frame = +3

Query  108  DPLPESDGVVSSPPHEESEASNELESILMDTGIPRWQRLKLATWIELKLLCYLAAPAVVV  287
             PL E+      PP    E S++LE IL D G+    R K ATW+ELKLL  LAAPA++V
Sbjct  12   QPLVENQ----PPPPVGEEVSSDLEQILTDDGLTFSTRYKKATWVELKLLTRLAAPAIIV  67

Query  288  YMINYLMSMSTQIFSGHLGNLELAAASLGNTGIQIFAYGLMLGMGSAVETLCGQAFGAGK  467
            Y++N L++MSTQIF G LGNLELA ++L N GIQ+F YG+MLGMGSAVETLCGQA+GA K
Sbjct  68   YLLNNLLNMSTQIFCGQLGNLELAGSALANNGIQLFVYGVMLGMGSAVETLCGQAYGAHK  127

Query  468  YELLGIYLQRStvlltltgvllalIYVFSEPILIFLG  578
            YE+LGIYLQRST+LL  TG+ L  +Y+FS+P+L+ LG
Sbjct  128  YEMLGIYLQRSTILLVATGIPLLFLYIFSKPLLLLLG  164



>ref|XP_008224820.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Prunus mume]
Length=523

 Score =   174 bits (442),  Expect = 5e-48, Method: Compositional matrix adjust.
 Identities = 100/154 (65%), Positives = 126/154 (82%), Gaps = 7/154 (5%)
 Frame = +3

Query  138  SSPPHEESEASNE-------LESILMDTGIPRWQRLKLATWIELKLLCYLAAPAVVVYMI  296
            S P    +EAS         LE +L DT +  ++RL+LATWIELKLL  LAAPAV+VY++
Sbjct  15   SEPDLAAAEASGHGDGFESPLEKVLSDTQLSSFKRLRLATWIELKLLFRLAAPAVLVYIV  74

Query  297  NYLMSMSTQIFSGHLGNLELAAASLGNTGIQIFAYGLMLGMGSAVETLCGQAFGAGKYEL  476
            NYLMS+ST++F+GHLGNLELAAASLGN+GIQ+FAYGLMLGMGSA+ETLCGQA+GA  Y++
Sbjct  75   NYLMSLSTRLFAGHLGNLELAAASLGNSGIQLFAYGLMLGMGSALETLCGQAYGAENYDM  134

Query  477  LGIYLQRStvlltltgvllalIYVFSEPILIFLG  578
            LGIYLQR+T++LTLTG+ L LI++ S+PILI  G
Sbjct  135  LGIYLQRATIVLTLTGLPLLLIFLLSKPILILFG  168



>ref|XP_008224822.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Prunus mume]
Length=507

 Score =   174 bits (442),  Expect = 5e-48, Method: Compositional matrix adjust.
 Identities = 97/159 (61%), Positives = 119/159 (75%), Gaps = 5/159 (3%)
 Frame = +3

Query  117  PESDGVVSSP-----PHEESEASNELESILMDTGIPRWQRLKLATWIELKLLCYLAAPAV  281
            P SD  +S P            S ELE  L +T +  +QR +  TW+ELK L  LAAPAV
Sbjct  3    PSSDNELSEPLLLSKSSSMHIVSRELEDTLNNTELSYFQRFRTGTWLELKTLFRLAAPAV  62

Query  282  VVYMINYLMSMSTQIFSGHLGNLELAAASLGNTGIQIFAYGLMLGMGSAVETLCGQAFGA  461
            VVY++N ++SMSTQIF GHLGNLELAA+SLGNTGIQ+FAYGLMLGMGSAVETLCGQA+GA
Sbjct  63   VVYLLNNVISMSTQIFCGHLGNLELAASSLGNTGIQVFAYGLMLGMGSAVETLCGQAYGA  122

Query  462  GKYELLGIYLQRStvlltltgvllalIYVFSEPILIFLG  578
             KY++LGIY+QRST+LL  T + L +IY+F + IL+ LG
Sbjct  123  HKYDMLGIYMQRSTILLLATSIPLMIIYIFCKEILLGLG  161



>emb|CDM86696.1| unnamed protein product [Triticum aestivum]
Length=499

 Score =   174 bits (441),  Expect = 6e-48, Method: Compositional matrix adjust.
 Identities = 98/138 (71%), Positives = 114/138 (83%), Gaps = 0/138 (0%)
 Frame = +3

Query  165  ASNELESILMDTGIPRWQRLKLATWIELKLLCYLAAPAVVVYMINYLMSMSTQIFSGHLG  344
            AS  LESIL DT  P  +R   A  +EL+LL  LAAPAVVVYMIN++MSMSTQI  GHLG
Sbjct  13   ASCRLESILTDTSAPLAERAWAAGTVELRLLARLAAPAVVVYMINFVMSMSTQILCGHLG  72

Query  345  NLELAAASLGNTGIQIFAYGLMLGMGSAVETLCGQAFGAGKYELLGIYLQRStvlltltg  524
             LELAAASLGNTG+Q FAYGLMLGMGSAVETLCGQA+GA KY++LGIYLQRS +LL LTG
Sbjct  73   TLELAAASLGNTGVQTFAYGLMLGMGSAVETLCGQAYGAHKYDMLGIYLQRSVILLALTG  132

Query  525  vllalIYVFSEPILIFLG  578
            + LA++Y FSEP+L+ +G
Sbjct  133  IPLAVMYAFSEPLLLLMG  150



>ref|XP_010546899.1| PREDICTED: protein TRANSPARENT TESTA 12-like isoform X1 [Tarenaya 
hassleriana]
 ref|XP_010546908.1| PREDICTED: protein TRANSPARENT TESTA 12-like isoform X2 [Tarenaya 
hassleriana]
Length=503

 Score =   174 bits (441),  Expect = 6e-48, Method: Compositional matrix adjust.
 Identities = 93/152 (61%), Positives = 126/152 (83%), Gaps = 0/152 (0%)
 Frame = +3

Query  123  SDGVVSSPPHEESEASNELESILMDTGIPRWQRLKLATWIELKLLCYLAAPAVVVYMINY  302
            ++ ++ SP  +ESEA + LES+L DT +P ++RL LA+ +E+K L +LAAPAV VY+IN 
Sbjct  10   NNPLLDSPKPQESEADHRLESVLSDTHLPYFRRLYLASMLEMKFLFHLAAPAVFVYLINN  69

Query  303  LMSMSTQIFSGHLGNLELAAASLGNTGIQIFAYGLMLGMGSAVETLCGQAFGAGKYELLG  482
             MS+ T+IF+GHLG+LELAA+SLGN+G  +F YGL+LGMGSAVETLCGQA GA +YE++G
Sbjct  70   GMSILTRIFAGHLGSLELAASSLGNSGFNMFTYGLLLGMGSAVETLCGQAHGAHRYEMMG  129

Query  483  IYLQRStvlltltgvllalIYVFSEPILIFLG  578
            +YLQRSTV+L LTG+ + L++VFS+PIL FLG
Sbjct  130  VYLQRSTVVLALTGLPMTLLFVFSKPILTFLG  161



>dbj|BAF47751.1| multi antimicrobial extrusion family protein [Nicotiana tabacum]
Length=500

 Score =   174 bits (441),  Expect = 7e-48, Method: Compositional matrix adjust.
 Identities = 93/137 (68%), Positives = 119/137 (87%), Gaps = 0/137 (0%)
 Frame = +3

Query  168  SNELESILMDTGIPRWQRLKLATWIELKLLCYLAAPAVVVYMINYLMSMSTQIFSGHLGN  347
            S+ELE +L DT +P ++RL+ A+WIE +LL  LAAP+V VYMIN  MSMST+IFSG LGN
Sbjct  21   SSELEEVLSDTQLPYFRRLRYASWIEFQLLYRLAAPSVAVYMINNAMSMSTRIFSGQLGN  80

Query  348  LELAAASLGNTGIQIFAYGLMLGMGSAVETLCGQAFGAGKYELLGIYLQRStvlltltgv  527
            L+LAAASLGN GIQ+FAYGLMLGMGSAVETLCGQA+GA +YE+LG+YLQR+TV+L++TG+
Sbjct  81   LQLAAASLGNQGIQLFAYGLMLGMGSAVETLCGQAYGAHRYEMLGVYLQRATVVLSVTGI  140

Query  528  llalIYVFSEPILIFLG  578
             L ++Y+FS+ IL+ LG
Sbjct  141  PLTVVYLFSKNILLALG  157



>ref|XP_009790570.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Nicotiana sylvestris]
Length=500

 Score =   174 bits (440),  Expect = 7e-48, Method: Compositional matrix adjust.
 Identities = 93/137 (68%), Positives = 119/137 (87%), Gaps = 0/137 (0%)
 Frame = +3

Query  168  SNELESILMDTGIPRWQRLKLATWIELKLLCYLAAPAVVVYMINYLMSMSTQIFSGHLGN  347
            S+ELE +L DT +P ++RL+ A+WIE +LL  LAAP+V VYMIN  MSMST+IFSG LGN
Sbjct  21   SSELEEVLSDTQLPYFRRLRYASWIEFQLLYRLAAPSVAVYMINNAMSMSTRIFSGQLGN  80

Query  348  LELAAASLGNTGIQIFAYGLMLGMGSAVETLCGQAFGAGKYELLGIYLQRStvlltltgv  527
            L+LAAASLGN GIQ+FAYGLMLGMGSAVETLCGQA+GA +YE+LG+YLQR+TV+L++TG+
Sbjct  81   LQLAAASLGNQGIQLFAYGLMLGMGSAVETLCGQAYGAHRYEMLGVYLQRATVVLSVTGI  140

Query  528  llalIYVFSEPILIFLG  578
             L ++Y+FS+ IL+ LG
Sbjct  141  PLTVVYLFSKNILLALG  157



>gb|EYU29854.1| hypothetical protein MIMGU_mgv1a005159mg [Erythranthe guttata]
Length=495

 Score =   174 bits (440),  Expect = 9e-48, Method: Compositional matrix adjust.
 Identities = 98/165 (59%), Positives = 121/165 (73%), Gaps = 2/165 (1%)
 Frame = +3

Query  84   DSSNGAAYDPLPESDGVVSSPPHEESEASNELESILMDTGIPRWQRLKLATWIELKLLCY  263
              + GA   PL ES     + P    E S+ELE IL D  +  W+R + A+ IEL+    
Sbjct  4    SENKGAVNQPLLESYK--PALPEAAEEVSSELEEILSDATLSWWRRYQKASVIELRYFFR  61

Query  264  LAAPAVVVYMINYLMSMSTQIFSGHLGNLELAAASLGNTGIQIFAYGLMLGMGSAVETLC  443
            LA PAV+VY++N + SMSTQIF GHLGNLELAA+SLGN GIQ+ AYGLMLGMGSAVETLC
Sbjct  62   LAGPAVIVYLLNNVTSMSTQIFCGHLGNLELAASSLGNNGIQLLAYGLMLGMGSAVETLC  121

Query  444  GQAFGAGKYELLGIYLQRStvlltltgvllalIYVFSEPILIFLG  578
            GQA+GA KYE+LGIY+QRS VLL +TG+ L L+Y+F +PIL+ LG
Sbjct  122  GQAYGAHKYEMLGIYMQRSVVLLMVTGLPLMLVYIFCKPILLLLG  166



>ref|XP_006389638.1| MATE efflux family protein [Populus trichocarpa]
 gb|ERP48552.1| MATE efflux family protein [Populus trichocarpa]
Length=508

 Score =   174 bits (440),  Expect = 9e-48, Method: Compositional matrix adjust.
 Identities = 101/168 (60%), Positives = 128/168 (76%), Gaps = 3/168 (2%)
 Frame = +3

Query  81   MDS--SNGAAYDPLPESDGVVSSPPHEESEASNELESILMDTGIPRWQRLKLATWIELKL  254
            MDS  S G   +PL  S     +  H   EA + LE++L DT +  + RL LA+WIELKL
Sbjct  1    MDSKESRGELQEPLVLSSTEPETNDHYH-EADSRLENVLNDTNLSYFMRLGLASWIELKL  59

Query  255  LCYLAAPAVVVYMINYLMSMSTQIFSGHLGNLELAAASLGNTGIQIFAYGLMLGMGSAVE  434
            L  LAAPAV VY+IN  +S+ST+IFSGHLGNLE AA SL N+G+Q+F YGLMLGMGSAVE
Sbjct  60   LFRLAAPAVFVYLINNSLSLSTRIFSGHLGNLEFAAVSLANSGVQLFVYGLMLGMGSAVE  119

Query  435  TLCGQAFGAGKYELLGIYLQRStvlltltgvllalIYVFSEPILIFLG  578
            TLCGQ++GA ++E+LG +LQR+TV+LTLTG+ LA +YVF++PILI LG
Sbjct  120  TLCGQSYGAQRFEMLGTFLQRATVVLTLTGIPLAAVYVFAKPILILLG  167



>ref|XP_007026056.1| MATE efflux family protein [Theobroma cacao]
 gb|EOY28678.1| MATE efflux family protein [Theobroma cacao]
Length=519

 Score =   174 bits (440),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 95/143 (66%), Positives = 118/143 (83%), Gaps = 0/143 (0%)
 Frame = +3

Query  150  HEESEASNELESILMDTGIPRWQRLKLATWIELKLLCYLAAPAVVVYMINYLMSMSTQIF  329
            H   E  + LE +L D+ +  ++RL+LA+ IEL+LL  LAAPAV VYMIN  MS+ST++F
Sbjct  34   HRGHEVDSRLEKVLTDSDLSFFKRLRLASGIELRLLFRLAAPAVFVYMINNAMSLSTRVF  93

Query  330  SGHLGNLELAAASLGNTGIQIFAYGLMLGMGSAVETLCGQAFGAGKYELLGIYLQRStvl  509
             GHLGNLELAAASLGN+GIQ+ AYGLMLGMGSAVETLCGQA+GA +Y++LG+YLQRST++
Sbjct  94   CGHLGNLELAAASLGNSGIQLLAYGLMLGMGSAVETLCGQAYGALRYDMLGVYLQRSTIV  153

Query  510  ltltgvllalIYVFSEPILIFLG  578
            LTLTG+ L + YV SEPILI LG
Sbjct  154  LTLTGIPLTVAYVLSEPILILLG  176



>emb|CDM86692.1| unnamed protein product [Triticum aestivum]
Length=499

 Score =   173 bits (439),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 100/144 (69%), Positives = 115/144 (80%), Gaps = 1/144 (1%)
 Frame = +3

Query  150  HE-ESEASNELESILMDTGIPRWQRLKLATWIELKLLCYLAAPAVVVYMINYLMSMSTQI  326
            HE E  AS  LESIL DT  P   R  LA  +EL+LL  LA PAVVVYMIN++MSMSTQI
Sbjct  7    HEHEHAASCRLESILTDTSAPLATRAWLAGAVELRLLARLATPAVVVYMINFVMSMSTQI  66

Query  327  FSGHLGNLELAAASLGNTGIQIFAYGLMLGMGSAVETLCGQAFGAGKYELLGIYLQRStv  506
              GHLG LELAAASLGNTG+Q  AYGLMLGMGSAVETLCGQA+GA KY++LGIYLQRS +
Sbjct  67   LCGHLGTLELAAASLGNTGVQTMAYGLMLGMGSAVETLCGQAYGAHKYDMLGIYLQRSVI  126

Query  507  lltltgvllalIYVFSEPILIFLG  578
            LL LTG+ LA++Y FSEP+L+ +G
Sbjct  127  LLGLTGIPLAVMYAFSEPLLLLMG  150



>ref|XP_008224821.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Prunus mume]
Length=513

 Score =   173 bits (439),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 100/154 (65%), Positives = 124/154 (81%), Gaps = 7/154 (5%)
 Frame = +3

Query  138  SSPPHEESEASNE-------LESILMDTGIPRWQRLKLATWIELKLLCYLAAPAVVVYMI  296
            S P     EASN        LE +L DT +P ++RL+ ATWIEL LL  LAAPAV+VY++
Sbjct  15   SEPDSTAPEASNHGDGLESPLEKVLSDTQLPFFKRLRSATWIELNLLFRLAAPAVLVYVV  74

Query  297  NYLMSMSTQIFSGHLGNLELAAASLGNTGIQIFAYGLMLGMGSAVETLCGQAFGAGKYEL  476
            N  MS+ST++F+GHLGNLELAAASLGN+GIQ+FAYGLMLGMGSAVETLCGQA+GA KY++
Sbjct  75   NNSMSLSTRVFAGHLGNLELAAASLGNSGIQLFAYGLMLGMGSAVETLCGQAYGAEKYDM  134

Query  477  LGIYLQRStvlltltgvllalIYVFSEPILIFLG  578
            LGIYLQR+T++LTLTG+ L LI++ S+PILI  G
Sbjct  135  LGIYLQRATIVLTLTGLPLLLIFLLSKPILILFG  168



>ref|XP_009618512.1| PREDICTED: protein TRANSPARENT TESTA 12-like isoform X2 [Nicotiana 
tomentosiformis]
Length=418

 Score =   171 bits (434),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 102/158 (65%), Positives = 122/158 (77%), Gaps = 6/158 (4%)
 Frame = +3

Query  108  DPLPESDGVVSSPPHEESEA-SNELESILMDTGIPRWQRLKLATWIELKLLCYLAAPAVV  284
            +PL ES+     PP   +E  S ELE IL DT +   QR   A+ IEL+ L  LAAPA++
Sbjct  12   EPLLESE-----PPTLAAEQISPELEEILSDTSLSHLQRFGRASVIELRNLFRLAAPAII  66

Query  285  VYMINYLMSMSTQIFSGHLGNLELAAASLGNTGIQIFAYGLMLGMGSAVETLCGQAFGAG  464
            VY++N   SMSTQIF GHLGNLELAAASLGN+GIQ+ AYG+MLGMGSAVETLCGQA+GA 
Sbjct  67   VYLLNNTTSMSTQIFCGHLGNLELAAASLGNSGIQLLAYGVMLGMGSAVETLCGQAYGAH  126

Query  465  KYELLGIYLQRStvlltltgvllalIYVFSEPILIFLG  578
            KYE+LGIYLQRST+LL LTG+ L + Y+FS+PILI LG
Sbjct  127  KYEMLGIYLQRSTILLMLTGIPLTVAYLFSKPILILLG  164



>gb|EPS61219.1| hypothetical protein M569_13580, partial [Genlisea aurea]
Length=159

 Score =   164 bits (415),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 84/139 (60%), Positives = 112/139 (81%), Gaps = 0/139 (0%)
 Frame = +3

Query  162  EASNELESILMDTGIPRWQRLKLATWIELKLLCYLAAPAVVVYMINYLMSMSTQIFSGHL  341
            E S++LE  L +T +P+W+RL+ A  IEL++L  LA PAV+ Y++  ++S STQIF GH+
Sbjct  2    EVSSDLEDALSNTAVPQWRRLERAVRIELRILSRLAGPAVISYLLGNVISTSTQIFCGHI  61

Query  342  GNLELAAASLGNTGIQIFAYGLMLGMGSAVETLCGQAFGAGKYELLGIYLQRStvlltlt  521
            GNLELAA+SLGN G+Q+ AYG+MLGMGSAVETLCGQA+GA +YE+LG+Y+QRST+LL  T
Sbjct  62   GNLELAASSLGNNGVQLLAYGVMLGMGSAVETLCGQAYGAHRYEMLGMYMQRSTILLMAT  121

Query  522  gvllalIYVFSEPILIFLG  578
            G+ L L Y FS P+L+ LG
Sbjct  122  GIPLMLFYAFSRPLLVLLG  140



>ref|XP_009798076.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Nicotiana sylvestris]
Length=509

 Score =   173 bits (438),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 100/165 (61%), Positives = 124/165 (75%), Gaps = 4/165 (2%)
 Frame = +3

Query  84   DSSNGAAYDPLPESDGVVSSPPHEESEASNELESILMDTGIPRWQRLKLATWIELKLLCY  263
                G   +PL ES+     P    ++ S+ELE IL DT +   QR   A+ +EL+ L  
Sbjct  5    SQDKGPPNEPLLESE----PPTLAAAKISSELEEILSDTSLSHLQRFGRASVVELRNLFR  60

Query  264  LAAPAVVVYMINYLMSMSTQIFSGHLGNLELAAASLGNTGIQIFAYGLMLGMGSAVETLC  443
            LAAPA++VY++N + SMSTQIF GHLGNLELAAASLGN+GIQ+ AYG+MLGMGSAVETLC
Sbjct  61   LAAPAIIVYLLNNITSMSTQIFCGHLGNLELAAASLGNSGIQLLAYGVMLGMGSAVETLC  120

Query  444  GQAFGAGKYELLGIYLQRStvlltltgvllalIYVFSEPILIFLG  578
            GQA+GA KYE+LGIYLQRST+LL LTG+ L + Y+FS+PILI LG
Sbjct  121  GQAYGAHKYEMLGIYLQRSTILLMLTGIPLTVAYLFSKPILILLG  165



>gb|EYU27797.1| hypothetical protein MIMGU_mgv1a004389mg [Erythranthe guttata]
Length=530

 Score =   173 bits (439),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 90/140 (64%), Positives = 113/140 (81%), Gaps = 0/140 (0%)
 Frame = +3

Query  159  SEASNELESILMDTGIPRWQRLKLATWIELKLLCYLAAPAVVVYMINYLMSMSTQIFSGH  338
            + +S+ELE +L DT +P   R K ATWIEL+LL  LAAPAV++YMIN  MSMST+IFSGH
Sbjct  34   THSSSELEKVLSDTDLPFLTRYKKATWIELRLLFKLAAPAVMMYMINNAMSMSTRIFSGH  93

Query  339  LGNLELAAASLGNTGIQIFAYGLMLGMGSAVETLCGQAFGAGKYELLGIYLQRStvlltl  518
            LGNLE AAA LGN GIQ+FAYGL+LGMGSAVETLCGQA+GA +YE+LG+YLQR+TV+L L
Sbjct  94   LGNLEFAAACLGNQGIQLFAYGLLLGMGSAVETLCGQAYGARRYEMLGVYLQRATVVLML  153

Query  519  tgvllalIYVFSEPILIFLG  578
              + +  +Y+ S  IL+ +G
Sbjct  154  FSLPIVAVYLLSRQILLLIG  173



>ref|XP_006363107.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Solanum tuberosum]
Length=500

 Score =   172 bits (437),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 99/157 (63%), Positives = 123/157 (78%), Gaps = 5/157 (3%)
 Frame = +3

Query  108  DPLPESDGVVSSPPHEESEASNELESILMDTGIPRWQRLKLATWIELKLLCYLAAPAVVV  287
            +PL ES+      P    + S+ELE IL DT + R QR + A+ IEL+ L  LAAP+++V
Sbjct  5    EPLLESE-----EPILAEQISSELEEILSDTSLSRIQRFRRASVIELRNLFRLAAPSIIV  59

Query  288  YMINYLMSMSTQIFSGHLGNLELAAASLGNTGIQIFAYGLMLGMGSAVETLCGQAFGAGK  467
            Y++N + SMSTQIF GHLGNLELAAASLGN+GIQ+ AYG+MLGMGSAVETLCGQA+G  K
Sbjct  60   YLLNNVTSMSTQIFCGHLGNLELAAASLGNSGIQLLAYGVMLGMGSAVETLCGQAYGGHK  119

Query  468  YELLGIYLQRStvlltltgvllalIYVFSEPILIFLG  578
            YE+LGIYLQRST+LL LTG+ L + Y+FS+PILI LG
Sbjct  120  YEMLGIYLQRSTILLMLTGIPLMVAYLFSKPILILLG  156



>ref|XP_006348109.1| PREDICTED: protein TRANSPARENT TESTA 12-like isoform X2 [Solanum 
tuberosum]
Length=427

 Score =   171 bits (434),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 93/138 (67%), Positives = 118/138 (86%), Gaps = 0/138 (0%)
 Frame = +3

Query  165  ASNELESILMDTGIPRWQRLKLATWIELKLLCYLAAPAVVVYMINYLMSMSTQIFSGHLG  344
            AS+ELE +L D  +P +QRL+ A WIE +LL  LAAPA+ VYMIN  MSMST+IFSG LG
Sbjct  19   ASSELEEVLSDFQLPYFQRLRSAFWIEFQLLFRLAAPAIAVYMINNAMSMSTRIFSGQLG  78

Query  345  NLELAAASLGNTGIQIFAYGLMLGMGSAVETLCGQAFGAGKYELLGIYLQRStvlltltg  524
            NL+LAAASLGN GIQ+ AYGLMLGMGSAVETLCGQA+GA +Y++LG+YLQRST++L++TG
Sbjct  79   NLQLAAASLGNQGIQLCAYGLMLGMGSAVETLCGQAYGANRYDMLGVYLQRSTIVLSITG  138

Query  525  vllalIYVFSEPILIFLG  578
            + LA++Y+FS+ IL+ LG
Sbjct  139  IPLAVVYLFSKNILLALG  156



>ref|XP_009618511.1| PREDICTED: protein TRANSPARENT TESTA 12-like isoform X1 [Nicotiana 
tomentosiformis]
Length=439

 Score =   171 bits (434),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 102/158 (65%), Positives = 122/158 (77%), Gaps = 6/158 (4%)
 Frame = +3

Query  108  DPLPESDGVVSSPPHEESEA-SNELESILMDTGIPRWQRLKLATWIELKLLCYLAAPAVV  284
            +PL ES+     PP   +E  S ELE IL DT +   QR   A+ IEL+ L  LAAPA++
Sbjct  12   EPLLESE-----PPTLAAEQISPELEEILSDTSLSHLQRFGRASVIELRNLFRLAAPAII  66

Query  285  VYMINYLMSMSTQIFSGHLGNLELAAASLGNTGIQIFAYGLMLGMGSAVETLCGQAFGAG  464
            VY++N   SMSTQIF GHLGNLELAAASLGN+GIQ+ AYG+MLGMGSAVETLCGQA+GA 
Sbjct  67   VYLLNNTTSMSTQIFCGHLGNLELAAASLGNSGIQLLAYGVMLGMGSAVETLCGQAYGAH  126

Query  465  KYELLGIYLQRStvlltltgvllalIYVFSEPILIFLG  578
            KYE+LGIYLQRST+LL LTG+ L + Y+FS+PILI LG
Sbjct  127  KYEMLGIYLQRSTILLMLTGIPLTVAYLFSKPILILLG  164



>ref|XP_008364095.1| PREDICTED: protein TRANSPARENT TESTA 12-like isoform X5 [Malus 
domestica]
Length=509

 Score =   172 bits (437),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 99/181 (55%), Positives = 131/181 (72%), Gaps = 14/181 (8%)
 Frame = +3

Query  57   PHHLTNSVMDSSNGAAYDPLPESDGVVSSPPHEESEASNE-------LESILMDTGIPRW  215
            PH L    M S +       P    ++ S P   ++AS++       LE +L DT +P +
Sbjct  12   PHXLFGPKMXSQH-------PLHQPILHSEPEPVAQASSDGDGVDFLLEKVLSDTQLPSF  64

Query  216  QRLKLATWIELKLLCYLAAPAVVVYMINYLMSMSTQIFSGHLGNLELAAASLGNTGIQIF  395
            +R + ATWIELKLL  LAAPAV+VY+IN  MS+S ++F+GHLGNLELAAASLGN GIQ+ 
Sbjct  65   KRFRSATWIELKLLFRLAAPAVLVYVINNSMSLSARVFAGHLGNLELAAASLGNNGIQLL  124

Query  396  AYGLMLGMGSAVETLCGQAFGAGKYELLGIYLQRStvlltltgvllalIYVFSEPILIFL  575
            AYGLMLGMGSAVETLCGQA+GA KY++L IYLQR+T++L+LTG+ L  I++ ++P+LI L
Sbjct  125  AYGLMLGMGSAVETLCGQAYGAQKYDMLSIYLQRATIVLSLTGLPLLAIFLLTKPMLILL  184

Query  576  G  578
            G
Sbjct  185  G  185



>gb|KDP20757.1| hypothetical protein JCGZ_21228 [Jatropha curcas]
Length=301

 Score =   168 bits (425),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 90/143 (63%), Positives = 114/143 (80%), Gaps = 0/143 (0%)
 Frame = +3

Query  150  HEESEASNELESILMDTGIPRWQRLKLATWIELKLLCYLAAPAVVVYMINYLMSMSTQIF  329
            + E   S+ELE IL ++ IP +QR + ATW+ELK +  LAAPA VVY++N ++SMST I 
Sbjct  3    NNEKPVSSELEQILSNSEIPCFQRPRRATWLELKTVFSLAAPAAVVYLLNNVVSMSTLIL  62

Query  330  SGHLGNLELAAASLGNTGIQIFAYGLMLGMGSAVETLCGQAFGAGKYELLGIYLQRStvl  509
             GHLGNL+LA+ASL N GIQ+FA+GL+LGMGSAVETLCGQA+GA KYE+LGIYLQRST++
Sbjct  63   CGHLGNLQLASASLSNNGIQLFAFGLLLGMGSAVETLCGQAYGAQKYEMLGIYLQRSTIV  122

Query  510  ltltgvllalIYVFSEPILIFLG  578
            L  T + L LIY  S+PIL+ LG
Sbjct  123  LMATSIPLTLIYALSKPILVLLG  145



>ref|XP_009362007.1| PREDICTED: protein TRANSPARENT TESTA 12-like isoform X2 [Pyrus 
x bretschneideri]
Length=444

 Score =   171 bits (434),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 89/155 (57%), Positives = 111/155 (72%), Gaps = 14/155 (9%)
 Frame = +3

Query  57   PHHLTNSVMDSSNGAAYDPLPESDGVVSSPPHEESEASNE-------LESILMDTGIPRW  215
            PHHL    M S +       P    ++ S P   ++AS +       LE +L DT +P +
Sbjct  12   PHHLFGPKMSSQH-------PLHQPILHSEPEPAAQASRDGEGVDFLLEKVLSDTQLPSF  64

Query  216  QRLKLATWIELKLLCYLAAPAVVVYMINYLMSMSTQIFSGHLGNLELAAASLGNTGIQIF  395
            +R +LATWIELKLL  LAAPAV+VY+IN  MS+S ++F+GHLGNLELAAASLGN GIQ+ 
Sbjct  65   KRFRLATWIELKLLFRLAAPAVLVYVINNSMSLSARVFAGHLGNLELAAASLGNNGIQLL  124

Query  396  AYGLMLGMGSAVETLCGQAFGAGKYELLGIYLQRS  500
            AYGLMLGMGSAVETLCGQA+GA KY++L IYLQR+
Sbjct  125  AYGLMLGMGSAVETLCGQAYGAQKYDMLSIYLQRA  159



>ref|XP_004231608.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Solanum lycopersicum]
Length=504

 Score =   172 bits (437),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 100/157 (64%), Positives = 124/157 (79%), Gaps = 1/157 (1%)
 Frame = +3

Query  108  DPLPESDGVVSSPPHEESEASNELESILMDTGIPRWQRLKLATWIELKLLCYLAAPAVVV  287
            +PL ES+  + +    E + S+ELE IL DT +   QR K A+ IEL+ L  LAAPA++V
Sbjct  5    EPLLESESPILASAATE-KISSELEEILSDTSLSCIQRFKRASVIELRNLFRLAAPAIIV  63

Query  288  YMINYLMSMSTQIFSGHLGNLELAAASLGNTGIQIFAYGLMLGMGSAVETLCGQAFGAGK  467
            Y++N + SMSTQIF GHLGNLELAAASLGN+GIQ+ AYG+MLGMGSAVETLCGQA+G  K
Sbjct  64   YLLNNVTSMSTQIFCGHLGNLELAAASLGNSGIQLLAYGVMLGMGSAVETLCGQAYGGHK  123

Query  468  YELLGIYLQRStvlltltgvllalIYVFSEPILIFLG  578
            YE+LGIYLQRST+LL LTG+ L + Y+FS+PILI LG
Sbjct  124  YEMLGIYLQRSTILLMLTGLPLMVAYLFSKPILILLG  160



>gb|EYU29852.1| hypothetical protein MIMGU_mgv1a004818mg [Erythranthe guttata]
Length=508

 Score =   172 bits (437),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 95/165 (58%), Positives = 122/165 (74%), Gaps = 5/165 (3%)
 Frame = +3

Query  84   DSSNGAAYDPLPESDGVVSSPPHEESEASNELESILMDTGIPRWQRLKLATWIELKLLCY  263
              + G   DPL ES     S      E S+ELE +L DT +  W+R + A  IEL+ L  
Sbjct  4    SKNKGETTDPLLES-----SYGGGVEEVSSELEDVLCDTTLSGWRRFQKAIVIELRYLLR  58

Query  264  LAAPAVVVYMINYLMSMSTQIFSGHLGNLELAAASLGNTGIQIFAYGLMLGMGSAVETLC  443
            LA PAV+VY++N ++SMSTQIF GHLGNLELAA++LGN G+Q+ AYGLMLGMGSAVETLC
Sbjct  59   LAGPAVLVYLLNSVVSMSTQIFCGHLGNLELAASALGNNGVQLLAYGLMLGMGSAVETLC  118

Query  444  GQAFGAGKYELLGIYLQRStvlltltgvllalIYVFSEPILIFLG  578
            GQA+GA +YE+LGIY+QRS +LL LTG+ L  +Y+FS+P+L+ LG
Sbjct  119  GQAYGAQQYEMLGIYMQRSVILLMLTGIPLTFVYIFSKPLLVLLG  163



>ref|XP_002518493.1| multidrug resistance pump, putative [Ricinus communis]
 gb|EEF43880.1| multidrug resistance pump, putative [Ricinus communis]
Length=510

 Score =   172 bits (437),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 95/140 (68%), Positives = 115/140 (82%), Gaps = 0/140 (0%)
 Frame = +3

Query  159  SEASNELESILMDTGIPRWQRLKLATWIELKLLCYLAAPAVVVYMINYLMSMSTQIFSGH  338
            S  S+ELE IL +T +  +QRLK A  +ELK+L  LA PAV VY++N ++SMSTQIF GH
Sbjct  28   SPVSSELEEILSNTNLSCFQRLKKAALLELKILFRLAGPAVFVYLLNNVVSMSTQIFCGH  87

Query  339  LGNLELAAASLGNTGIQIFAYGLMLGMGSAVETLCGQAFGAGKYELLGIYLQRStvlltl  518
            LGNL+LAAASLGNTGIQ+FAYGLMLGMGSAVETLCGQA+GA KYE+LG+YLQRS +LL  
Sbjct  88   LGNLQLAAASLGNTGIQVFAYGLMLGMGSAVETLCGQAYGAHKYEMLGVYLQRSAILLAA  147

Query  519  tgvllalIYVFSEPILIFLG  578
            TG+ L +IY FS+ IL+ LG
Sbjct  148  TGIPLTIIYSFSKQILLLLG  167



>ref|XP_009608373.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Nicotiana tomentosiformis]
 dbj|BAF47752.1| multi antimicrobial extrusion family protein [Nicotiana tabacum]
Length=500

 Score =   172 bits (436),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 94/137 (69%), Positives = 120/137 (88%), Gaps = 0/137 (0%)
 Frame = +3

Query  168  SNELESILMDTGIPRWQRLKLATWIELKLLCYLAAPAVVVYMINYLMSMSTQIFSGHLGN  347
            S+ELE +L D+ +P ++RL+ A+WIE +LL  LAAP+V VYMIN  MSMST+IFSG LGN
Sbjct  21   SSELEEVLSDSQLPYFRRLRYASWIEFQLLYRLAAPSVAVYMINNAMSMSTRIFSGQLGN  80

Query  348  LELAAASLGNTGIQIFAYGLMLGMGSAVETLCGQAFGAGKYELLGIYLQRStvlltltgv  527
            L+LAAASLGN GIQ+FAYGLMLGMGSAVETLCGQA+GA +YE+LG+YLQR+TV+L+LTG+
Sbjct  81   LQLAAASLGNQGIQLFAYGLMLGMGSAVETLCGQAYGAHRYEMLGVYLQRATVVLSLTGI  140

Query  528  llalIYVFSEPILIFLG  578
             LA++Y+FS+ IL+ LG
Sbjct  141  PLAVVYLFSKNILLALG  157



>ref|XP_008364096.1| PREDICTED: protein TRANSPARENT TESTA 12-like isoform X6 [Malus 
domestica]
Length=462

 Score =   171 bits (434),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 99/181 (55%), Positives = 131/181 (72%), Gaps = 14/181 (8%)
 Frame = +3

Query  57   PHHLTNSVMDSSNGAAYDPLPESDGVVSSPPHEESEASNE-------LESILMDTGIPRW  215
            PH L    M S +       P    ++ S P   ++AS++       LE +L DT +P +
Sbjct  12   PHXLFGPKMXSQH-------PLHQPILHSEPEPVAQASSDGDGVDFLLEKVLSDTQLPSF  64

Query  216  QRLKLATWIELKLLCYLAAPAVVVYMINYLMSMSTQIFSGHLGNLELAAASLGNTGIQIF  395
            +R + ATWIELKLL  LAAPAV+VY+IN  MS+S ++F+GHLGNLELAAASLGN GIQ+ 
Sbjct  65   KRFRSATWIELKLLFRLAAPAVLVYVINNSMSLSARVFAGHLGNLELAAASLGNNGIQLL  124

Query  396  AYGLMLGMGSAVETLCGQAFGAGKYELLGIYLQRStvlltltgvllalIYVFSEPILIFL  575
            AYGLMLGMGSAVETLCGQA+GA KY++L IYLQR+T++L+LTG+ L  I++ ++P+LI L
Sbjct  125  AYGLMLGMGSAVETLCGQAYGAQKYDMLSIYLQRATIVLSLTGLPLLAIFLLTKPMLILL  184

Query  576  G  578
            G
Sbjct  185  G  185



>ref|XP_002518495.1| multidrug resistance pump, putative [Ricinus communis]
 gb|EEF43882.1| multidrug resistance pump, putative [Ricinus communis]
Length=503

 Score =   172 bits (436),  Expect = 4e-47, Method: Compositional matrix adjust.
 Identities = 95/150 (63%), Positives = 119/150 (79%), Gaps = 3/150 (2%)
 Frame = +3

Query  138  SSPP---HEESEASNELESILMDTGIPRWQRLKLATWIELKLLCYLAAPAVVVYMINYLM  308
            SSP    H   E ++ LE IL DT +P  +RL+LA+ IELKLL  LAAPAV VYMIN  M
Sbjct  14   SSPEPELHAHCEVNSRLEKILNDTQLPYLKRLRLASVIELKLLFRLAAPAVFVYMINNFM  73

Query  309  SMSTQIFSGHLGNLELAAASLGNTGIQIFAYGLMLGMGSAVETLCGQAFGAGKYELLGIY  488
            S+ST++F+GHLGNLELAAA+LGN+GIQ+ AYG MLGMGSAVETLCGQA+GA + E+LGIY
Sbjct  74   SLSTRVFAGHLGNLELAAAALGNSGIQLLAYGFMLGMGSAVETLCGQAYGAHRNEMLGIY  133

Query  489  LQRStvlltltgvllalIYVFSEPILIFLG  578
            LQR+TV+LT+T + +  IY+ S+ IL+ LG
Sbjct  134  LQRATVVLTITAIPMTAIYLVSKQILLLLG  163



>ref|XP_009361291.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Pyrus x bretschneideri]
 ref|XP_009361361.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Pyrus x bretschneideri]
Length=509

 Score =   172 bits (436),  Expect = 4e-47, Method: Compositional matrix adjust.
 Identities = 96/159 (60%), Positives = 120/159 (75%), Gaps = 6/159 (4%)
 Frame = +3

Query  120  ESDGVVSSP---PHEESE---ASNELESILMDTGIPRWQRLKLATWIELKLLCYLAAPAV  281
             SD  +S P   P   S      +ELE  L +T    +QRL+ ATW+E K LC LAAPAV
Sbjct  4    SSDNDLSEPMLVPKTSSLQQIVRSELEDTLNNTDFSYFQRLRTATWLETKTLCRLAAPAV  63

Query  282  VVYMINYLMSMSTQIFSGHLGNLELAAASLGNTGIQIFAYGLMLGMGSAVETLCGQAFGA  461
            VVY++N ++++STQIF GHLGNLELAA+SLGN GIQ+F +GLMLGMGSAVETLCGQA+GA
Sbjct  64   VVYLLNNVITLSTQIFCGHLGNLELAASSLGNIGIQVFTFGLMLGMGSAVETLCGQAYGA  123

Query  462  GKYELLGIYLQRStvlltltgvllalIYVFSEPILIFLG  578
             KYE+LGIY+Q ST LL  TG+ L +IY+FS+P+L+ LG
Sbjct  124  HKYEMLGIYMQISTTLLVATGIPLTIIYIFSKPLLLALG  162



>ref|XP_008364094.1| PREDICTED: protein TRANSPARENT TESTA 12-like isoform X4 [Malus 
domestica]
Length=528

 Score =   172 bits (437),  Expect = 4e-47, Method: Compositional matrix adjust.
 Identities = 99/181 (55%), Positives = 131/181 (72%), Gaps = 14/181 (8%)
 Frame = +3

Query  57   PHHLTNSVMDSSNGAAYDPLPESDGVVSSPPHEESEASNE-------LESILMDTGIPRW  215
            PH L    M S +       P    ++ S P   ++AS++       LE +L DT +P +
Sbjct  12   PHXLFGPKMXSQH-------PLHQPILHSEPEPVAQASSDGDGVDFLLEKVLSDTQLPSF  64

Query  216  QRLKLATWIELKLLCYLAAPAVVVYMINYLMSMSTQIFSGHLGNLELAAASLGNTGIQIF  395
            +R + ATWIELKLL  LAAPAV+VY+IN  MS+S ++F+GHLGNLELAAASLGN GIQ+ 
Sbjct  65   KRFRSATWIELKLLFRLAAPAVLVYVINNSMSLSARVFAGHLGNLELAAASLGNNGIQLL  124

Query  396  AYGLMLGMGSAVETLCGQAFGAGKYELLGIYLQRStvlltltgvllalIYVFSEPILIFL  575
            AYGLMLGMGSAVETLCGQA+GA KY++L IYLQR+T++L+LTG+ L  I++ ++P+LI L
Sbjct  125  AYGLMLGMGSAVETLCGQAYGAQKYDMLSIYLQRATIVLSLTGLPLLAIFLLTKPMLILL  184

Query  576  G  578
            G
Sbjct  185  G  185



>ref|XP_008364093.1| PREDICTED: protein TRANSPARENT TESTA 12-like isoform X3 [Malus 
domestica]
Length=531

 Score =   172 bits (437),  Expect = 4e-47, Method: Compositional matrix adjust.
 Identities = 99/181 (55%), Positives = 131/181 (72%), Gaps = 14/181 (8%)
 Frame = +3

Query  57   PHHLTNSVMDSSNGAAYDPLPESDGVVSSPPHEESEASNE-------LESILMDTGIPRW  215
            PH L    M S +       P    ++ S P   ++AS++       LE +L DT +P +
Sbjct  12   PHXLFGPKMXSQH-------PLHQPILHSEPEPVAQASSDGDGVDFLLEKVLSDTQLPSF  64

Query  216  QRLKLATWIELKLLCYLAAPAVVVYMINYLMSMSTQIFSGHLGNLELAAASLGNTGIQIF  395
            +R + ATWIELKLL  LAAPAV+VY+IN  MS+S ++F+GHLGNLELAAASLGN GIQ+ 
Sbjct  65   KRFRSATWIELKLLFRLAAPAVLVYVINNSMSLSARVFAGHLGNLELAAASLGNNGIQLL  124

Query  396  AYGLMLGMGSAVETLCGQAFGAGKYELLGIYLQRStvlltltgvllalIYVFSEPILIFL  575
            AYGLMLGMGSAVETLCGQA+GA KY++L IYLQR+T++L+LTG+ L  I++ ++P+LI L
Sbjct  125  AYGLMLGMGSAVETLCGQAYGAQKYDMLSIYLQRATIVLSLTGLPLLAIFLLTKPMLILL  184

Query  576  G  578
            G
Sbjct  185  G  185



>ref|XP_006597580.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Glycine max]
Length=505

 Score =   172 bits (435),  Expect = 4e-47, Method: Compositional matrix adjust.
 Identities = 90/149 (60%), Positives = 119/149 (80%), Gaps = 0/149 (0%)
 Frame = +3

Query  132  VVSSPPHEESEASNELESILMDTGIPRWQRLKLATWIELKLLCYLAAPAVVVYMINYLMS  311
            +++S  H    A + LE +L D  +P  +R+  ATWIEL LL  LAAPA++VY+ N LMS
Sbjct  14   LINSTHHHHHSADSRLEEVLSDPTLPWSKRILSATWIELNLLFPLAAPAILVYVFNNLMS  73

Query  312  MSTQIFSGHLGNLELAAASLGNTGIQIFAYGLMLGMGSAVETLCGQAFGAGKYELLGIYL  491
              T+ F+GHLGNLELAAA+LGN+GIQ+FAYGLMLGMGSAVETLCGQA+GA KYE+LGIY+
Sbjct  74   NVTRAFAGHLGNLELAAANLGNSGIQLFAYGLMLGMGSAVETLCGQAYGANKYEMLGIYM  133

Query  492  QRStvlltltgvllalIYVFSEPILIFLG  578
            QR+ ++LT+TG+ L ++Y+F +PIL+ LG
Sbjct  134  QRAIIVLTITGIPLTVVYIFCKPILLLLG  162



>ref|XP_008364091.1| PREDICTED: protein TRANSPARENT TESTA 12-like isoform X1 [Malus 
domestica]
Length=538

 Score =   172 bits (437),  Expect = 4e-47, Method: Compositional matrix adjust.
 Identities = 99/181 (55%), Positives = 131/181 (72%), Gaps = 14/181 (8%)
 Frame = +3

Query  57   PHHLTNSVMDSSNGAAYDPLPESDGVVSSPPHEESEASNE-------LESILMDTGIPRW  215
            PH L    M S +       P    ++ S P   ++AS++       LE +L DT +P +
Sbjct  12   PHXLFGPKMXSQH-------PLHQPILHSEPEPVAQASSDGDGVDFLLEKVLSDTQLPSF  64

Query  216  QRLKLATWIELKLLCYLAAPAVVVYMINYLMSMSTQIFSGHLGNLELAAASLGNTGIQIF  395
            +R + ATWIELKLL  LAAPAV+VY+IN  MS+S ++F+GHLGNLELAAASLGN GIQ+ 
Sbjct  65   KRFRSATWIELKLLFRLAAPAVLVYVINNSMSLSARVFAGHLGNLELAAASLGNNGIQLL  124

Query  396  AYGLMLGMGSAVETLCGQAFGAGKYELLGIYLQRStvlltltgvllalIYVFSEPILIFL  575
            AYGLMLGMGSAVETLCGQA+GA KY++L IYLQR+T++L+LTG+ L  I++ ++P+LI L
Sbjct  125  AYGLMLGMGSAVETLCGQAYGAQKYDMLSIYLQRATIVLSLTGLPLLAIFLLTKPMLILL  184

Query  576  G  578
            G
Sbjct  185  G  185



>ref|XP_008364092.1| PREDICTED: protein TRANSPARENT TESTA 12-like isoform X2 [Malus 
domestica]
Length=535

 Score =   172 bits (436),  Expect = 4e-47, Method: Compositional matrix adjust.
 Identities = 99/181 (55%), Positives = 131/181 (72%), Gaps = 14/181 (8%)
 Frame = +3

Query  57   PHHLTNSVMDSSNGAAYDPLPESDGVVSSPPHEESEASNE-------LESILMDTGIPRW  215
            PH L    M S +       P    ++ S P   ++AS++       LE +L DT +P +
Sbjct  12   PHXLFGPKMXSQH-------PLHQPILHSEPEPVAQASSDGDGVDFLLEKVLSDTQLPSF  64

Query  216  QRLKLATWIELKLLCYLAAPAVVVYMINYLMSMSTQIFSGHLGNLELAAASLGNTGIQIF  395
            +R + ATWIELKLL  LAAPAV+VY+IN  MS+S ++F+GHLGNLELAAASLGN GIQ+ 
Sbjct  65   KRFRSATWIELKLLFRLAAPAVLVYVINNSMSLSARVFAGHLGNLELAAASLGNNGIQLL  124

Query  396  AYGLMLGMGSAVETLCGQAFGAGKYELLGIYLQRStvlltltgvllalIYVFSEPILIFL  575
            AYGLMLGMGSAVETLCGQA+GA KY++L IYLQR+T++L+LTG+ L  I++ ++P+LI L
Sbjct  125  AYGLMLGMGSAVETLCGQAYGAQKYDMLSIYLQRATIVLSLTGLPLLAIFLLTKPMLILL  184

Query  576  G  578
            G
Sbjct  185  G  185



>gb|KHN33034.1| Protein TRANSPARENT TESTA 12 [Glycine soja]
Length=504

 Score =   172 bits (435),  Expect = 5e-47, Method: Compositional matrix adjust.
 Identities = 90/149 (60%), Positives = 119/149 (80%), Gaps = 0/149 (0%)
 Frame = +3

Query  132  VVSSPPHEESEASNELESILMDTGIPRWQRLKLATWIELKLLCYLAAPAVVVYMINYLMS  311
            +++S  H    A + LE +L D  +P  +R+  ATWIEL LL  LAAPA++VY+ N LMS
Sbjct  13   LINSTHHHHHSADSRLEEVLSDPTLPWSKRILSATWIELNLLFPLAAPAILVYVFNNLMS  72

Query  312  MSTQIFSGHLGNLELAAASLGNTGIQIFAYGLMLGMGSAVETLCGQAFGAGKYELLGIYL  491
              T+ F+GHLGNLELAAA+LGN+GIQ+FAYGLMLGMGSAVETLCGQA+GA KYE+LGIY+
Sbjct  73   NVTRAFAGHLGNLELAAANLGNSGIQLFAYGLMLGMGSAVETLCGQAYGANKYEMLGIYM  132

Query  492  QRStvlltltgvllalIYVFSEPILIFLG  578
            QR+ ++LT+TG+ L ++Y+F +PIL+ LG
Sbjct  133  QRAIIVLTITGIPLTVVYIFCKPILLLLG  161



>gb|EPS67796.1| hypothetical protein M569_06975, partial [Genlisea aurea]
Length=484

 Score =   171 bits (434),  Expect = 5e-47, Method: Compositional matrix adjust.
 Identities = 93/147 (63%), Positives = 117/147 (80%), Gaps = 4/147 (3%)
 Frame = +3

Query  138  SSPPHEESEASNELESILMDTGIPRWQRLKLATWIELKLLCYLAAPAVVVYMINYLMSMS  317
            SSP     E S+ LE +L +  + RW+RL+ AT IELK+LC LA PAVV Y++  ++SMS
Sbjct  9    SSP----EEISSHLEDVLSNAEMARWRRLQKATSIELKILCRLAGPAVVSYLLGNVISMS  64

Query  318  TQIFSGHLGNLELAAASLGNTGIQIFAYGLMLGMGSAVETLCGQAFGAGKYELLGIYLQR  497
            TQIF GH+GNLELAA+SLGN G+Q+ AYG+MLGMGSAVETLCGQA+GA +YE+LGIY+QR
Sbjct  65   TQIFCGHVGNLELAASSLGNNGVQLLAYGVMLGMGSAVETLCGQAYGAHRYEMLGIYMQR  124

Query  498  StvlltltgvllalIYVFSEPILIFLG  578
            S VLL  TG+ + LIY FSEP+L+ LG
Sbjct  125  SAVLLMATGIPMMLIYAFSEPLLLLLG  151



>ref|XP_011048004.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Populus euphratica]
 ref|XP_011048005.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Populus euphratica]
Length=513

 Score =   172 bits (435),  Expect = 5e-47, Method: Compositional matrix adjust.
 Identities = 92/134 (69%), Positives = 117/134 (87%), Gaps = 0/134 (0%)
 Frame = +3

Query  168  SNELESILMDTGIPRWQRLKLATWIELKLLCYLAAPAVVVYMINYLMSMSTQIFSGHLGN  347
            S+ELE IL +  + R +RL  ATW+ELK+L  LAAPA+VVYM+N+L+S+STQ+F GHLGN
Sbjct  34   SSELEDILSNMELSRSKRLLRATWVELKILFPLAAPAIVVYMLNFLVSISTQMFCGHLGN  93

Query  348  LELAAASLGNTGIQIFAYGLMLGMGSAVETLCGQAFGAGKYELLGIYLQRStvlltltgv  527
            LELAAASLGNTG+Q F +G+MLGMGSAVETLCGQA+GA KYE+LG+Y+QRST+LLTLTG+
Sbjct  94   LELAAASLGNTGVQGFVFGIMLGMGSAVETLCGQAYGANKYEMLGVYMQRSTILLTLTGL  153

Query  528  llalIYVFSEPILI  569
            +L  IY+F +PIL+
Sbjct  154  ILMFIYIFCKPILL  167



>ref|XP_009760618.1| PREDICTED: LOW QUALITY PROTEIN: protein TRANSPARENT TESTA 12 
[Nicotiana sylvestris]
Length=504

 Score =   171 bits (434),  Expect = 6e-47, Method: Compositional matrix adjust.
 Identities = 93/138 (67%), Positives = 121/138 (88%), Gaps = 0/138 (0%)
 Frame = +3

Query  165  ASNELESILMDTGIPRWQRLKLATWIELKLLCYLAAPAVVVYMINYLMSMSTQIFSGHLG  344
            AS+ELE +L D+ +P +QRL+ A+WI+ +LL  LAAPAV VYMIN  MS+ST+IFSG LG
Sbjct  23   ASSELEEVLSDSQLPYFQRLRSASWIKFQLLFRLAAPAVAVYMINNAMSISTRIFSGQLG  82

Query  345  NLELAAASLGNTGIQIFAYGLMLGMGSAVETLCGQAFGAGKYELLGIYLQRStvlltltg  524
            NL+LAAASLG+ GIQ+FAYGLMLGMGSAVETLCGQA+GA +YE+LG+YLQRST++L+LTG
Sbjct  83   NLQLAAASLGDQGIQLFAYGLMLGMGSAVETLCGQAYGAHRYEMLGVYLQRSTIVLSLTG  142

Query  525  vllalIYVFSEPILIFLG  578
            + LA++Y+FS+ +L+ LG
Sbjct  143  IPLAVVYLFSKNLLLALG  160



>gb|ABK24492.1| unknown [Picea sitchensis]
Length=513

 Score =   171 bits (434),  Expect = 6e-47, Method: Compositional matrix adjust.
 Identities = 93/139 (67%), Positives = 112/139 (81%), Gaps = 1/139 (1%)
 Frame = +3

Query  162  EASNELESILMDTGIPRW-QRLKLATWIELKLLCYLAAPAVVVYMINYLMSMSTQIFSGH  338
            +  N LE IL +     W + ++ A ++E KLLC LA PAV+VYM+NY+MSM+TQIFSGH
Sbjct  20   DDKNRLEVILSNADDQPWIKMMRDAVFLESKLLCRLALPAVIVYMVNYIMSMATQIFSGH  79

Query  339  LGNLELAAASLGNTGIQIFAYGLMLGMGSAVETLCGQAFGAGKYELLGIYLQRStvlltl  518
            LGNLELAAASLGN GIQ+FAYGLMLGMGSAVETLCGQA+GA  Y++LGIYLQRSTVLL  
Sbjct  80   LGNLELAAASLGNRGIQVFAYGLMLGMGSAVETLCGQAYGAKNYDMLGIYLQRSTVLLMA  139

Query  519  tgvllalIYVFSEPILIFL  575
              + L LIYVFS+P+L+ L
Sbjct  140  AAIPLTLIYVFSKPLLLLL  158



>emb|CDM86687.1| unnamed protein product [Triticum aestivum]
Length=501

 Score =   171 bits (433),  Expect = 9e-47, Method: Compositional matrix adjust.
 Identities = 97/138 (70%), Positives = 114/138 (83%), Gaps = 0/138 (0%)
 Frame = +3

Query  165  ASNELESILMDTGIPRWQRLKLATWIELKLLCYLAAPAVVVYMINYLMSMSTQIFSGHLG  344
            AS  LESIL DT  P  +R  LA  +EL+LL  LAAPAVVVYMIN++MSMSTQI  GHLG
Sbjct  15   ASCLLESILTDTSAPLARRAWLAGAVELRLLARLAAPAVVVYMINFVMSMSTQILCGHLG  74

Query  345  NLELAAASLGNTGIQIFAYGLMLGMGSAVETLCGQAFGAGKYELLGIYLQRStvlltltg  524
             LELAAASLGN G+Q FA+GLMLGMGSAVETLCGQA+GA KY++LGIYLQRS +LL LTG
Sbjct  75   TLELAAASLGNCGVQTFAFGLMLGMGSAVETLCGQAYGAHKYDMLGIYLQRSVILLGLTG  134

Query  525  vllalIYVFSEPILIFLG  578
            + LA++Y FSEP+L+ +G
Sbjct  135  IPLAVMYAFSEPLLLLMG  152



>ref|XP_009345548.1| PREDICTED: protein TRANSPARENT TESTA 12-like isoform X2 [Pyrus 
x bretschneideri]
Length=455

 Score =   169 bits (429),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 89/155 (57%), Positives = 111/155 (72%), Gaps = 14/155 (9%)
 Frame = +3

Query  57   PHHLTNSVMDSSNGAAYDPLPESDGVVSSPPHEESEASNE-------LESILMDTGIPRW  215
            PHHL    M S +       P    ++ S P   ++AS +       LE +L DT +P +
Sbjct  12   PHHLFGPKMSSQH-------PLHQPILHSEPEPAAQASRDGEGVDFLLEKVLSDTQLPSF  64

Query  216  QRLKLATWIELKLLCYLAAPAVVVYMINYLMSMSTQIFSGHLGNLELAAASLGNTGIQIF  395
            +R +LATWIELKLL  LAAPAV+VY+IN  MS+S ++F+GHLGNLELAAASLGN GIQ+ 
Sbjct  65   KRFRLATWIELKLLFRLAAPAVLVYVINNSMSLSARVFAGHLGNLELAAASLGNNGIQLL  124

Query  396  AYGLMLGMGSAVETLCGQAFGAGKYELLGIYLQRS  500
            AYGLMLGMGSAVETLCGQA+GA KY++L IYLQR+
Sbjct  125  AYGLMLGMGSAVETLCGQAYGAQKYDMLSIYLQRA  159



>ref|XP_004232716.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Solanum lycopersicum]
Length=499

 Score =   170 bits (431),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 93/138 (67%), Positives = 118/138 (86%), Gaps = 0/138 (0%)
 Frame = +3

Query  165  ASNELESILMDTGIPRWQRLKLATWIELKLLCYLAAPAVVVYMINYLMSMSTQIFSGHLG  344
            AS+ELE +L D  +P +QRL+ A WIE +LL  LAAPAV VY+IN  MSMST+IFSG LG
Sbjct  19   ASSELEEVLSDFQLPYFQRLRSAFWIEFQLLFRLAAPAVAVYLINNAMSMSTRIFSGQLG  78

Query  345  NLELAAASLGNTGIQIFAYGLMLGMGSAVETLCGQAFGAGKYELLGIYLQRStvlltltg  524
            NL+LAAASLGN GIQ+ AYGLMLGMGSAVETLCGQA+GA +Y++LG+YLQRST++L++TG
Sbjct  79   NLQLAAASLGNQGIQLCAYGLMLGMGSAVETLCGQAYGANRYDMLGVYLQRSTIVLSITG  138

Query  525  vllalIYVFSEPILIFLG  578
            + LA++Y+FS+ IL+ LG
Sbjct  139  IPLAVVYIFSKNILLALG  156



>ref|XP_009361903.1| PREDICTED: protein TRANSPARENT TESTA 12-like isoform X1 [Pyrus 
x bretschneideri]
Length=528

 Score =   171 bits (432),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 89/155 (57%), Positives = 111/155 (72%), Gaps = 14/155 (9%)
 Frame = +3

Query  57   PHHLTNSVMDSSNGAAYDPLPESDGVVSSPPHEESEASNE-------LESILMDTGIPRW  215
            PHHL    M S +       P    ++ S P   ++AS +       LE +L DT +P +
Sbjct  12   PHHLFGPKMSSQH-------PLHQPILHSEPEPAAQASRDGEGVDFLLEKVLSDTQLPSF  64

Query  216  QRLKLATWIELKLLCYLAAPAVVVYMINYLMSMSTQIFSGHLGNLELAAASLGNTGIQIF  395
            +R +LATWIELKLL  LAAPAV+VY+IN  MS+S ++F+GHLGNLELAAASLGN GIQ+ 
Sbjct  65   KRFRLATWIELKLLFRLAAPAVLVYVINNSMSLSARVFAGHLGNLELAAASLGNNGIQLL  124

Query  396  AYGLMLGMGSAVETLCGQAFGAGKYELLGIYLQRS  500
            AYGLMLGMGSAVETLCGQA+GA KY++L IYLQR+
Sbjct  125  AYGLMLGMGSAVETLCGQAYGAQKYDMLSIYLQRA  159



>ref|XP_006348110.1| PREDICTED: protein TRANSPARENT TESTA 12-like isoform X3 [Solanum 
tuberosum]
Length=499

 Score =   170 bits (430),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 93/138 (67%), Positives = 118/138 (86%), Gaps = 0/138 (0%)
 Frame = +3

Query  165  ASNELESILMDTGIPRWQRLKLATWIELKLLCYLAAPAVVVYMINYLMSMSTQIFSGHLG  344
            AS+ELE +L D  +P +QRL+ A WIE +LL  LAAPA+ VYMIN  MSMST+IFSG LG
Sbjct  19   ASSELEEVLSDFQLPYFQRLRSAFWIEFQLLFRLAAPAIAVYMINNAMSMSTRIFSGQLG  78

Query  345  NLELAAASLGNTGIQIFAYGLMLGMGSAVETLCGQAFGAGKYELLGIYLQRStvlltltg  524
            NL+LAAASLGN GIQ+ AYGLMLGMGSAVETLCGQA+GA +Y++LG+YLQRST++L++TG
Sbjct  79   NLQLAAASLGNQGIQLCAYGLMLGMGSAVETLCGQAYGANRYDMLGVYLQRSTIVLSITG  138

Query  525  vllalIYVFSEPILIFLG  578
            + LA++Y+FS+ IL+ LG
Sbjct  139  IPLAVVYLFSKNILLALG  156



>ref|XP_006348108.1| PREDICTED: protein TRANSPARENT TESTA 12-like isoform X1 [Solanum 
tuberosum]
Length=499

 Score =   170 bits (430),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 93/138 (67%), Positives = 118/138 (86%), Gaps = 0/138 (0%)
 Frame = +3

Query  165  ASNELESILMDTGIPRWQRLKLATWIELKLLCYLAAPAVVVYMINYLMSMSTQIFSGHLG  344
            AS+ELE +L D  +P +QRL+ A WIE +LL  LAAPA+ VYMIN  MSMST+IFSG LG
Sbjct  19   ASSELEEVLSDFQLPYFQRLRSAFWIEFQLLFRLAAPAIAVYMINNAMSMSTRIFSGQLG  78

Query  345  NLELAAASLGNTGIQIFAYGLMLGMGSAVETLCGQAFGAGKYELLGIYLQRStvlltltg  524
            NL+LAAASLGN GIQ+ AYGLMLGMGSAVETLCGQA+GA +Y++LG+YLQRST++L++TG
Sbjct  79   NLQLAAASLGNQGIQLCAYGLMLGMGSAVETLCGQAYGANRYDMLGVYLQRSTIVLSITG  138

Query  525  vllalIYVFSEPILIFLG  578
            + LA++Y+FS+ IL+ LG
Sbjct  139  IPLAVVYLFSKNILLALG  156



>ref|XP_009345546.1| PREDICTED: protein TRANSPARENT TESTA 12-like isoform X1 [Pyrus 
x bretschneideri]
 ref|XP_009345547.1| PREDICTED: protein TRANSPARENT TESTA 12-like isoform X1 [Pyrus 
x bretschneideri]
Length=528

 Score =   170 bits (431),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 89/155 (57%), Positives = 111/155 (72%), Gaps = 14/155 (9%)
 Frame = +3

Query  57   PHHLTNSVMDSSNGAAYDPLPESDGVVSSPPHEESEASNE-------LESILMDTGIPRW  215
            PHHL    M S +       P    ++ S P   ++AS +       LE +L DT +P +
Sbjct  12   PHHLFGPKMSSQH-------PLHQPILHSEPEPAAQASRDGEGVDFLLEKVLSDTQLPSF  64

Query  216  QRLKLATWIELKLLCYLAAPAVVVYMINYLMSMSTQIFSGHLGNLELAAASLGNTGIQIF  395
            +R +LATWIELKLL  LAAPAV+VY+IN  MS+S ++F+GHLGNLELAAASLGN GIQ+ 
Sbjct  65   KRFRLATWIELKLLFRLAAPAVLVYVINNSMSLSARVFAGHLGNLELAAASLGNNGIQLL  124

Query  396  AYGLMLGMGSAVETLCGQAFGAGKYELLGIYLQRS  500
            AYGLMLGMGSAVETLCGQA+GA KY++L IYLQR+
Sbjct  125  AYGLMLGMGSAVETLCGQAYGAQKYDMLSIYLQRA  159



>ref|XP_006389636.1| hypothetical protein POPTR_0021s00860g [Populus trichocarpa]
 gb|ERP48550.1| hypothetical protein POPTR_0021s00860g [Populus trichocarpa]
Length=513

 Score =   170 bits (430),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 91/134 (68%), Positives = 116/134 (87%), Gaps = 0/134 (0%)
 Frame = +3

Query  168  SNELESILMDTGIPRWQRLKLATWIELKLLCYLAAPAVVVYMINYLMSMSTQIFSGHLGN  347
            S+ELE IL +  + R +R+  ATW+ELK+L  LAAPA+VVYM+NYL+S+STQ+F GHLGN
Sbjct  34   SSELEDILSNMELSRSKRILRATWVELKILFPLAAPAIVVYMLNYLVSISTQMFCGHLGN  93

Query  348  LELAAASLGNTGIQIFAYGLMLGMGSAVETLCGQAFGAGKYELLGIYLQRStvlltltgv  527
            LELAAASLGN G+Q F +G+MLGMGSAVETLCGQA+GA KYE+LG+Y+QRST+LLTLTG+
Sbjct  94   LELAAASLGNMGVQGFVFGIMLGMGSAVETLCGQAYGANKYEMLGVYMQRSTILLTLTGL  153

Query  528  llalIYVFSEPILI  569
            +L  IY+F +PIL+
Sbjct  154  ILMFIYIFCKPILL  167



>gb|EMT19998.1| hypothetical protein F775_52364 [Aegilops tauschii]
Length=957

 Score =   173 bits (438),  Expect = 4e-46, Method: Composition-based stats.
 Identities = 91/116 (78%), Positives = 105/116 (91%), Gaps = 0/116 (0%)
 Frame = +3

Query  231  ATWIELKLLCYLAAPAVVVYMINYLMSMSTQIFSGHLGNLELAAASLGNTGIQIFAYGLM  410
            AT +E+++L  LAAPAV+VYMINYLMSMSTQIFSGHLG LELAAASLGNTGIQ+FAYGLM
Sbjct  4    ATAVEMRMLVRLAAPAVLVYMINYLMSMSTQIFSGHLGTLELAAASLGNTGIQVFAYGLM  63

Query  411  LGMGSAVETLCGQAFGAGKYELLGIYLQRStvlltltgvllalIYVFSEPILIFLG  578
            LGMGSAVETLCGQA+GA K+++LGIY+QRSTVLL  TG+ LA++Y FS PILI LG
Sbjct  64   LGMGSAVETLCGQAYGANKFDMLGIYMQRSTVLLMATGIPLAVLYAFSRPILILLG  119



>ref|XP_010533820.1| PREDICTED: protein TRANSPARENT TESTA 12-like isoform X4 [Tarenaya 
hassleriana]
Length=315

 Score =   165 bits (417),  Expect = 5e-46, Method: Compositional matrix adjust.
 Identities = 91/147 (62%), Positives = 118/147 (80%), Gaps = 4/147 (3%)
 Frame = +3

Query  138  SSPPHEESEASNELESILMDTGIPRWQRLKLATWIELKLLCYLAAPAVVVYMINYLMSMS  317
            + PP    EA + LES+L D+ +P ++RL LA+ IELK L +LAAPAV VY+IN  MS+ 
Sbjct  17   TKPP----EADHRLESVLSDSHLPYFRRLYLASMIELKFLFHLAAPAVFVYVINNGMSIL  72

Query  318  TQIFSGHLGNLELAAASLGNTGIQIFAYGLMLGMGSAVETLCGQAFGAGKYELLGIYLQR  497
            T+IF+GHLG+L+LAA SLGN+G  +F YGL+LGMGSAVETLCGQA GA +YE+LG+YLQR
Sbjct  73   TRIFAGHLGSLQLAAVSLGNSGFNMFTYGLLLGMGSAVETLCGQAHGAHRYEMLGVYLQR  132

Query  498  StvlltltgvllalIYVFSEPILIFLG  578
            STV+L LTG+ + ++YV S+PIL FLG
Sbjct  133  STVVLALTGLPMTVLYVLSKPILTFLG  159



>ref|XP_010468355.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Camelina sativa]
Length=438

 Score =   168 bits (425),  Expect = 5e-46, Method: Compositional matrix adjust.
 Identities = 96/113 (85%), Positives = 106/113 (94%), Gaps = 0/113 (0%)
 Frame = +3

Query  240  IELKLLCYLAAPAVVVYMINYLMSMSTQIFSGHLGNLELAAASLGNTGIQIFAYGLMLGM  419
            IE KLL  LAAPAV+VYMINYLMSMSTQIF GHLGNLELAAASLGNTGIQ+FAYGL+LGM
Sbjct  2    IESKLLFNLAAPAVIVYMINYLMSMSTQIFPGHLGNLELAAASLGNTGIQVFAYGLLLGM  61

Query  420  GSAVETLCGQAFGAGKYELLGIYLQRStvlltltgvllalIYVFSEPILIFLG  578
            GSAVETLCGQA+GA KYE+LG+YLQRSTVLLTLT ++L L+YVFSEPIL+FLG
Sbjct  62   GSAVETLCGQAYGARKYEMLGVYLQRSTVLLTLTSLVLTLLYVFSEPILLFLG  114



>ref|XP_010533821.1| PREDICTED: protein TRANSPARENT TESTA 12-like isoform X5 [Tarenaya 
hassleriana]
 ref|XP_010533822.1| PREDICTED: protein TRANSPARENT TESTA 12-like isoform X6 [Tarenaya 
hassleriana]
Length=313

 Score =   165 bits (417),  Expect = 5e-46, Method: Compositional matrix adjust.
 Identities = 91/147 (62%), Positives = 118/147 (80%), Gaps = 4/147 (3%)
 Frame = +3

Query  138  SSPPHEESEASNELESILMDTGIPRWQRLKLATWIELKLLCYLAAPAVVVYMINYLMSMS  317
            + PP    EA + LES+L D+ +P ++RL LA+ IELK L +LAAPAV VY+IN  MS+ 
Sbjct  17   TKPP----EADHRLESVLSDSHLPYFRRLYLASMIELKFLFHLAAPAVFVYVINNGMSIL  72

Query  318  TQIFSGHLGNLELAAASLGNTGIQIFAYGLMLGMGSAVETLCGQAFGAGKYELLGIYLQR  497
            T+IF+GHLG+L+LAA SLGN+G  +F YGL+LGMGSAVETLCGQA GA +YE+LG+YLQR
Sbjct  73   TRIFAGHLGSLQLAAVSLGNSGFNMFTYGLLLGMGSAVETLCGQAHGAHRYEMLGVYLQR  132

Query  498  StvlltltgvllalIYVFSEPILIFLG  578
            STV+L LTG+ + ++YV S+PIL FLG
Sbjct  133  STVVLALTGLPMTVLYVLSKPILTFLG  159



>ref|XP_009417226.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Musa acuminata 
subsp. malaccensis]
Length=495

 Score =   169 bits (427),  Expect = 6e-46, Method: Compositional matrix adjust.
 Identities = 97/137 (71%), Positives = 114/137 (83%), Gaps = 0/137 (0%)
 Frame = +3

Query  168  SNELESILMDTGIPRWQRLKLATWIELKLLCYLAAPAVVVYMINYLMSMSTQIFSGHLGN  347
            S  LESIL D  +   +RL  AT +E++LL  LAAPAVVVYM+N L+S+ TQ+FSGHLGN
Sbjct  14   SRRLESILADLTMSWPRRLWSATTVEMQLLFPLAAPAVVVYMLNNLLSLGTQVFSGHLGN  73

Query  348  LELAAASLGNTGIQIFAYGLMLGMGSAVETLCGQAFGAGKYELLGIYLQRStvlltltgv  527
            LELAA+SLGN GIQIFAYGLMLGMGSAVETLCGQA+GA KYE+LGIYLQRSTVLL  TG+
Sbjct  74   LELAASSLGNNGIQIFAYGLMLGMGSAVETLCGQAYGAHKYEMLGIYLQRSTVLLMATGI  133

Query  528  llalIYVFSEPILIFLG  578
             LA++Y FS P+L+ LG
Sbjct  134  PLAVVYAFSRPLLLLLG  150



>ref|XP_010533819.1| PREDICTED: protein TRANSPARENT TESTA 12-like isoform X3 [Tarenaya 
hassleriana]
Length=320

 Score =   165 bits (417),  Expect = 7e-46, Method: Compositional matrix adjust.
 Identities = 91/147 (62%), Positives = 118/147 (80%), Gaps = 4/147 (3%)
 Frame = +3

Query  138  SSPPHEESEASNELESILMDTGIPRWQRLKLATWIELKLLCYLAAPAVVVYMINYLMSMS  317
            + PP    EA + LES+L D+ +P ++RL LA+ IELK L +LAAPAV VY+IN  MS+ 
Sbjct  17   TKPP----EADHRLESVLSDSHLPYFRRLYLASMIELKFLFHLAAPAVFVYVINNGMSIL  72

Query  318  TQIFSGHLGNLELAAASLGNTGIQIFAYGLMLGMGSAVETLCGQAFGAGKYELLGIYLQR  497
            T+IF+GHLG+L+LAA SLGN+G  +F YGL+LGMGSAVETLCGQA GA +YE+LG+YLQR
Sbjct  73   TRIFAGHLGSLQLAAVSLGNSGFNMFTYGLLLGMGSAVETLCGQAHGAHRYEMLGVYLQR  132

Query  498  StvlltltgvllalIYVFSEPILIFLG  578
            STV+L LTG+ + ++YV S+PIL FLG
Sbjct  133  STVVLALTGLPMTVLYVLSKPILTFLG  159



>ref|XP_010533818.1| PREDICTED: protein TRANSPARENT TESTA 12-like isoform X2 [Tarenaya 
hassleriana]
Length=328

 Score =   165 bits (417),  Expect = 7e-46, Method: Compositional matrix adjust.
 Identities = 91/147 (62%), Positives = 118/147 (80%), Gaps = 4/147 (3%)
 Frame = +3

Query  138  SSPPHEESEASNELESILMDTGIPRWQRLKLATWIELKLLCYLAAPAVVVYMINYLMSMS  317
            + PP    EA + LES+L D+ +P ++RL LA+ IELK L +LAAPAV VY+IN  MS+ 
Sbjct  17   TKPP----EADHRLESVLSDSHLPYFRRLYLASMIELKFLFHLAAPAVFVYVINNGMSIL  72

Query  318  TQIFSGHLGNLELAAASLGNTGIQIFAYGLMLGMGSAVETLCGQAFGAGKYELLGIYLQR  497
            T+IF+GHLG+L+LAA SLGN+G  +F YGL+LGMGSAVETLCGQA GA +YE+LG+YLQR
Sbjct  73   TRIFAGHLGSLQLAAVSLGNSGFNMFTYGLLLGMGSAVETLCGQAHGAHRYEMLGVYLQR  132

Query  498  StvlltltgvllalIYVFSEPILIFLG  578
            STV+L LTG+ + ++YV S+PIL FLG
Sbjct  133  STVVLALTGLPMTVLYVLSKPILTFLG  159



>ref|XP_009614256.1| PREDICTED: LOW QUALITY PROTEIN: protein TRANSPARENT TESTA 12 
[Nicotiana tomentosiformis]
Length=503

 Score =   168 bits (426),  Expect = 9e-46, Method: Compositional matrix adjust.
 Identities = 93/138 (67%), Positives = 120/138 (87%), Gaps = 0/138 (0%)
 Frame = +3

Query  165  ASNELESILMDTGIPRWQRLKLATWIELKLLCYLAAPAVVVYMINYLMSMSTQIFSGHLG  344
            AS+ELE +L D+ +P +QRL+ A+WIE +LL  LAAPAV VYMIN  MS+ST+IFSG LG
Sbjct  23   ASSELEEVLSDSQLPYFQRLRSASWIEFQLLFRLAAPAVAVYMINNAMSISTRIFSGQLG  82

Query  345  NLELAAASLGNTGIQIFAYGLMLGMGSAVETLCGQAFGAGKYELLGIYLQRStvlltltg  524
            NL+LAAASLG+ GIQ+FAYGLMLGMGSAVETLCGQA+ A ++E+LG+YLQRSTV+L+LTG
Sbjct  83   NLQLAAASLGDQGIQLFAYGLMLGMGSAVETLCGQAYXAHRHEMLGVYLQRSTVVLSLTG  142

Query  525  vllalIYVFSEPILIFLG  578
            + LA++Y+FS+ +L+ LG
Sbjct  143  IPLAVVYLFSKNLLLALG  160



>ref|XP_009614258.1| PREDICTED: protein TRANSPARENT TESTA 12-like isoform X2 [Nicotiana 
tomentosiformis]
Length=432

 Score =   167 bits (422),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 96/157 (61%), Positives = 122/157 (78%), Gaps = 4/157 (3%)
 Frame = +3

Query  108  DPLPESDGVVSSPPHEESEASNELESILMDTGIPRWQRLKLATWIELKLLCYLAAPAVVV  287
            +PL E    V +  H     S+ELE+IL DT +  +++L  A+ +ELK L  LAAP+++V
Sbjct  12   EPLLEPKEPVVAVEH----VSSELENILSDTSLSNFEQLGRASVVELKNLFRLAAPSIIV  67

Query  288  YMINYLMSMSTQIFSGHLGNLELAAASLGNTGIQIFAYGLMLGMGSAVETLCGQAFGAGK  467
            Y++N + SMSTQIF GHLGNLELAAASLGN GIQ+ AYG+MLGMGSAVETLCGQA+GA K
Sbjct  68   YLLNNITSMSTQIFCGHLGNLELAAASLGNEGIQLLAYGVMLGMGSAVETLCGQAYGAHK  127

Query  468  YELLGIYLQRStvlltltgvllalIYVFSEPILIFLG  578
            YE LGIYLQRST+LL L+G+ + + Y+FS+PILI LG
Sbjct  128  YESLGIYLQRSTILLMLSGIPIMVAYLFSKPILILLG  164



>ref|XP_004232715.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Solanum lycopersicum]
Length=504

 Score =   167 bits (424),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 95/152 (63%), Positives = 119/152 (78%), Gaps = 5/152 (3%)
 Frame = +3

Query  138  SSPPHEESEA-----SNELESILMDTGIPRWQRLKLATWIELKLLCYLAAPAVVVYMINY  302
            S P  EE EA     S+ELE IL+D  +  +QRL+ A+ +E   L  LAAPA++VY++N 
Sbjct  8    SEPLIEEKEATVEHVSSELEDILLDARLSHFQRLRRASAVEFSNLFRLAAPAIIVYLLNN  67

Query  303  LMSMSTQIFSGHLGNLELAAASLGNTGIQIFAYGLMLGMGSAVETLCGQAFGAGKYELLG  482
            + S+STQIF GHLGNLELAAASLGN GIQ+ AYG+MLGMGSAVETLCGQA+GA KYE LG
Sbjct  68   VTSVSTQIFCGHLGNLELAAASLGNEGIQLLAYGVMLGMGSAVETLCGQAYGAHKYETLG  127

Query  483  IYLQRStvlltltgvllalIYVFSEPILIFLG  578
            IYLQRST+LL L+G+ + + Y++S+PILI LG
Sbjct  128  IYLQRSTILLMLSGIPIMVAYLYSKPILILLG  159



>ref|XP_010533817.1| PREDICTED: protein TRANSPARENT TESTA 12-like isoform X1 [Tarenaya 
hassleriana]
Length=351

 Score =   164 bits (416),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 91/147 (62%), Positives = 118/147 (80%), Gaps = 4/147 (3%)
 Frame = +3

Query  138  SSPPHEESEASNELESILMDTGIPRWQRLKLATWIELKLLCYLAAPAVVVYMINYLMSMS  317
            + PP    EA + LES+L D+ +P ++RL LA+ IELK L +LAAPAV VY+IN  MS+ 
Sbjct  17   TKPP----EADHRLESVLSDSHLPYFRRLYLASMIELKFLFHLAAPAVFVYVINNGMSIL  72

Query  318  TQIFSGHLGNLELAAASLGNTGIQIFAYGLMLGMGSAVETLCGQAFGAGKYELLGIYLQR  497
            T+IF+GHLG+L+LAA SLGN+G  +F YGL+LGMGSAVETLCGQA GA +YE+LG+YLQR
Sbjct  73   TRIFAGHLGSLQLAAVSLGNSGFNMFTYGLLLGMGSAVETLCGQAHGAHRYEMLGVYLQR  132

Query  498  StvlltltgvllalIYVFSEPILIFLG  578
            STV+L LTG+ + ++YV S+PIL FLG
Sbjct  133  STVVLALTGLPMTVLYVLSKPILTFLG  159



>emb|CDY33130.1| BnaCnng07010D [Brassica napus]
Length=308

 Score =   163 bits (412),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 110/169 (65%), Positives = 121/169 (72%), Gaps = 19/169 (11%)
 Frame = +3

Query  81   MDSSN-GAAYDPL--PESDGVVSSPPHEESEASNELESILMDTGIPRWQRLKLATWIELK  251
            MDSS     Y PL  P +DG V   P  ES ++ ELE +L D   P + RL+ AT IE K
Sbjct  1    MDSSQYDGVYQPLLYPPADGTVPLSPSTES-SNGELERVLSDVETPFFHRLREATMIESK  59

Query  252  LLCYLAAPAVVVYMINYLMSMSTQIFSGHLGNLELAAASLGNTGIQIFAYGLMLGMGSAV  431
            LL  LAAPAV+VYMI               GNLELAAASLGNTGIQI AYGLMLGMGSAV
Sbjct  60   LLFKLAAPAVIVYMI---------------GNLELAAASLGNTGIQISAYGLMLGMGSAV  104

Query  432  ETLCGQAFGAGKYELLGIYLQRStvlltltgvllalIYVFSEPILIFLG  578
            ETLCGQAFG  KYE+LGIYLQRSTVLLTLTG+LL LIYVFS+PIL+FLG
Sbjct  105  ETLCGQAFGGRKYEMLGIYLQRSTVLLTLTGLLLTLIYVFSKPILLFLG  153



>ref|XP_006348111.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Solanum tuberosum]
Length=509

 Score =   167 bits (423),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 95/147 (65%), Positives = 117/147 (80%), Gaps = 5/147 (3%)
 Frame = +3

Query  153  EESEA-----SNELESILMDTGIPRWQRLKLATWIELKLLCYLAAPAVVVYMINYLMSMS  317
            E+ EA     S+ELE IL DT +  +QRL  A+ +E + L  LAAPA++VY++N + SMS
Sbjct  18   EQKEAAVEHVSSELEDILSDTRLSHFQRLGRASAVEFRNLFRLAAPAIIVYLLNNVTSMS  77

Query  318  TQIFSGHLGNLELAAASLGNTGIQIFAYGLMLGMGSAVETLCGQAFGAGKYELLGIYLQR  497
            TQIF GHLGNLELAAASLGN GIQ+ AYG+MLGMGSAVETLCGQA+GA KYE LGIYLQR
Sbjct  78   TQIFCGHLGNLELAAASLGNEGIQLLAYGVMLGMGSAVETLCGQAYGAHKYETLGIYLQR  137

Query  498  StvlltltgvllalIYVFSEPILIFLG  578
            ST+LL L+G+ + + Y+FS+PILI LG
Sbjct  138  STILLMLSGIPIMVAYLFSKPILILLG  164



>ref|XP_006651561.1| PREDICTED: protein TRANSPARENT TESTA 12-like [Oryza brachyantha]
Length=497

 Score =   166 bits (421),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 93/146 (64%), Positives = 115/146 (79%), Gaps = 0/146 (0%)
 Frame = +3

Query  141  SPPHEESEASNELESILMDTGIPRWQRLKLATWIELKLLCYLAAPAVVVYMINYLMSMST  320
            + P    E S  LE IL D   P  +R+  A  +E++LL  +AAPA+VVY++N ++S+ST
Sbjct  6    ASPSSSHELSRRLEGILRDGEAPWARRVCKAAVVEVRLLMPIAAPAIVVYVLNNVLSIST  65

Query  321  QIFSGHLGNLELAAASLGNTGIQIFAYGLMLGMGSAVETLCGQAFGAGKYELLGIYLQRS  500
            QIF GHLGNLELAA+SLGN GIQIFAYGLMLGMGSAVETLCGQA+GA KY++LG+Y+QRS
Sbjct  66   QIFCGHLGNLELAASSLGNNGIQIFAYGLMLGMGSAVETLCGQAYGAHKYDMLGVYMQRS  125

Query  501  tvlltltgvllalIYVFSEPILIFLG  578
            TVLL  TGV LA++Y FS PIL+ LG
Sbjct  126  TVLLMATGVPLAVLYAFSRPILVLLG  151



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 696633491985