BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFF037A24

Length=627
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009620765.1|  PREDICTED: uncharacterized protein At3g15000...    310   8e-101   
ref|XP_009620767.1|  PREDICTED: uncharacterized protein At3g15000...    309   9e-101   Nicotiana tomentosiformis
ref|XP_009620762.1|  PREDICTED: uncharacterized protein At3g15000...    310   1e-100   Nicotiana tomentosiformis
ref|XP_009620766.1|  PREDICTED: uncharacterized protein At3g15000...    309   1e-100   
ref|XP_009620763.1|  PREDICTED: uncharacterized protein At3g15000...    310   2e-100   
ref|XP_009803761.1|  PREDICTED: uncharacterized protein At3g15000...    307   7e-100   Nicotiana sylvestris
ref|XP_006360053.1|  PREDICTED: uncharacterized protein At3g15000...    298   3e-96    Solanum tuberosum [potatoes]
ref|XP_004248249.1|  PREDICTED: uncharacterized protein At3g15000...    297   4e-96    Solanum lycopersicum
ref|XP_004251891.1|  PREDICTED: uncharacterized protein At3g15000...    292   8e-94    Solanum lycopersicum
ref|XP_011098243.1|  PREDICTED: uncharacterized protein At3g15000...    291   5e-93    Sesamum indicum [beniseed]
ref|XP_006358944.1|  PREDICTED: uncharacterized protein At3g15000...    285   2e-91    
ref|XP_006358943.1|  PREDICTED: uncharacterized protein At3g15000...    285   3e-91    Solanum tuberosum [potatoes]
ref|XP_010060675.1|  PREDICTED: uncharacterized protein At3g15000...    284   2e-90    Eucalyptus grandis [rose gum]
ref|XP_009593525.1|  PREDICTED: uncharacterized protein At3g15000...    281   5e-90    Nicotiana tomentosiformis
ref|XP_007149407.1|  hypothetical protein PHAVU_005G067700g             281   9e-90    Phaseolus vulgaris [French bean]
gb|EPS74428.1|  hypothetical protein M569_00328                         280   1e-89    Genlisea aurea
ref|XP_009801659.1|  PREDICTED: uncharacterized protein At3g15000...    280   2e-89    Nicotiana sylvestris
ref|XP_010279101.1|  PREDICTED: uncharacterized protein At3g15000...    280   6e-89    Nelumbo nucifera [Indian lotus]
ref|XP_010277765.1|  PREDICTED: uncharacterized protein At3g15000...    275   1e-87    Nelumbo nucifera [Indian lotus]
gb|KHN36874.1|  Hypothetical protein glysoja_001605                     276   2e-87    Glycine soja [wild soybean]
ref|XP_003540481.1|  PREDICTED: uncharacterized protein At3g15000...    273   3e-87    Glycine max [soybeans]
ref|XP_002285388.1|  PREDICTED: uncharacterized protein At3g15000...    275   6e-87    Vitis vinifera
ref|XP_003543219.1|  PREDICTED: uncharacterized protein At3g15000...    274   6e-87    Glycine max [soybeans]
gb|KDP36270.1|  hypothetical protein JCGZ_09835                         273   8e-87    Jatropha curcas
gb|EYU26338.1|  hypothetical protein MIMGU_mgv1a004972mg                276   2e-86    Erythranthe guttata [common monkey flower]
ref|XP_004489047.1|  PREDICTED: uncharacterized protein At3g15000...    270   2e-85    Cicer arietinum [garbanzo]
emb|CAN66606.1|  hypothetical protein VITISV_017553                     267   4e-84    Vitis vinifera
ref|XP_010535050.1|  PREDICTED: uncharacterized protein At3g15000...    265   7e-84    Tarenaya hassleriana [spider flower]
ref|XP_008226518.1|  PREDICTED: uncharacterized protein At3g15000...    265   2e-83    Prunus mume [ume]
emb|CDX82454.1|  BnaA03g33670D                                          263   5e-83    
emb|CDX75801.1|  BnaC03g38840D                                          263   1e-82    
ref|XP_009340185.1|  PREDICTED: uncharacterized protein At3g15000...    263   1e-82    Pyrus x bretschneideri [bai li]
ref|XP_010064468.1|  PREDICTED: uncharacterized protein At3g15000...    259   1e-82    
ref|XP_007213851.1|  hypothetical protein PRUPE_ppa006643mg             262   2e-82    Prunus persica
ref|XP_004168263.1|  PREDICTED: uncharacterized protein At3g15000...    258   2e-82    
ref|NP_566496.1|  RNA-editing factor interacting protein 1              261   4e-82    Arabidopsis thaliana [mouse-ear cress]
ref|XP_002882907.1|  hypothetical protein ARALYDRAFT_478926             261   5e-82    
ref|XP_009335187.1|  PREDICTED: uncharacterized protein At3g15000...    259   2e-81    Pyrus x bretschneideri [bai li]
emb|CDX98522.1|  BnaC05g38530D                                          259   2e-81    
gb|KDO48326.1|  hypothetical protein CISIN_1g012088mg                   259   2e-81    Citrus sinensis [apfelsine]
ref|XP_010108256.1|  hypothetical protein L484_018677                   260   5e-81    Morus notabilis
ref|XP_009146297.1|  PREDICTED: uncharacterized protein At3g15000...    259   5e-81    Brassica rapa
ref|XP_006451722.1|  hypothetical protein CICLE_v10008185mg             261   5e-81    Citrus clementina [clementine]
ref|XP_006852447.1|  hypothetical protein AMTR_s00021p00105410          259   6e-81    Amborella trichopoda
gb|KDO48325.1|  hypothetical protein CISIN_1g012088mg                   260   6e-81    Citrus sinensis [apfelsine]
ref|XP_007021687.1|  Cobalt ion binding                                 258   6e-81    
ref|XP_006485661.1|  PREDICTED: uncharacterized protein At3g15000...    260   7e-81    Citrus sinensis [apfelsine]
ref|XP_010487314.1|  PREDICTED: uncharacterized protein At3g15000...    255   7e-81    Camelina sativa [gold-of-pleasure]
ref|XP_006297678.1|  hypothetical protein CARUB_v10013708mg             259   1e-80    
gb|KEH38632.1|  plastid developmental protein DAG                       257   1e-80    Medicago truncatula
gb|KGN53589.1|  hypothetical protein Csa_4G083630                       258   2e-80    Cucumis sativus [cucumbers]
ref|XP_010502420.1|  PREDICTED: uncharacterized protein At3g15000...    257   2e-80    Camelina sativa [gold-of-pleasure]
gb|KJB13211.1|  hypothetical protein B456_002G062600                    257   2e-80    Gossypium raimondii
ref|XP_002524267.1|  DAG protein, chloroplast precursor, putative       256   2e-80    
ref|XP_004137307.1|  PREDICTED: uncharacterized protein At3g15000...    257   3e-80    
ref|XP_010487313.1|  PREDICTED: uncharacterized protein At3g15000...    257   3e-80    
ref|XP_010465436.1|  PREDICTED: uncharacterized protein At3g15000...    257   3e-80    Camelina sativa [gold-of-pleasure]
ref|XP_004143682.1|  PREDICTED: uncharacterized protein At3g15000...    254   6e-80    
gb|KGN50312.1|  hypothetical protein Csa_5G167045                       254   8e-80    Cucumis sativus [cucumbers]
ref|XP_008365857.1|  PREDICTED: uncharacterized protein At3g15000...    254   4e-79    
ref|XP_006407023.1|  hypothetical protein EUTSA_v10020847mg             254   5e-79    Eutrema salsugineum [saltwater cress]
gb|KJB61599.1|  hypothetical protein B456_009G369000                    253   6e-79    Gossypium raimondii
emb|CDX97626.1|  BnaA05g24530D                                          252   7e-79    
gb|KDP32518.1|  hypothetical protein JCGZ_14721                         253   7e-79    Jatropha curcas
ref|XP_008451724.1|  PREDICTED: uncharacterized protein At3g15000...    253   1e-78    Cucumis melo [Oriental melon]
ref|XP_010064120.1|  PREDICTED: uncharacterized protein At3g15000...    249   1e-78    
gb|KFK38849.1|  hypothetical protein AALP_AA3G168200                    253   1e-78    Arabis alpina [alpine rockcress]
ref|XP_008382067.1|  PREDICTED: uncharacterized protein At3g15000...    251   3e-78    
ref|XP_008382068.1|  PREDICTED: uncharacterized protein At3g15000...    251   4e-78    
ref|XP_008382065.1|  PREDICTED: uncharacterized protein At3g15000...    251   4e-78    
gb|ABK26281.1|  unknown                                                 247   5e-78    Picea sitchensis
ref|XP_008382066.1|  PREDICTED: uncharacterized protein At3g15000...    251   6e-78    
ref|XP_002894432.1|  hypothetical protein ARALYDRAFT_892358             249   2e-77    Arabidopsis lyrata subsp. lyrata
ref|XP_010675416.1|  PREDICTED: uncharacterized protein At3g15000...    250   4e-77    
ref|XP_006370177.1|  hypothetical protein POPTR_0001s40390g             248   8e-77    
ref|XP_008365859.1|  PREDICTED: uncharacterized protein At3g15000...    245   1e-76    
ref|XP_011006500.1|  PREDICTED: uncharacterized protein At3g15000...    246   3e-76    Populus euphratica
ref|XP_009116545.1|  PREDICTED: uncharacterized protein At3g15000...    244   5e-76    Brassica rapa
ref|XP_011006499.1|  PREDICTED: uncharacterized protein At3g15000...    246   5e-76    Populus euphratica
ref|XP_006660821.1|  PREDICTED: uncharacterized protein At3g15000...    245   8e-76    
ref|XP_009342294.1|  PREDICTED: uncharacterized protein At3g15000...    238   1e-75    Pyrus x bretschneideri [bai li]
gb|ADE77519.1|  unknown                                                 240   2e-75    Picea sitchensis
gb|ABK92532.1|  unknown                                                 244   4e-75    Populus trichocarpa [western balsam poplar]
ref|XP_002316870.1|  unknown mitochondrial family protein               244   4e-75    Populus trichocarpa [western balsam poplar]
ref|XP_008437005.1|  PREDICTED: uncharacterized protein At3g15000...    243   5e-75    Cucumis melo [Oriental melon]
ref|XP_011029551.1|  PREDICTED: uncharacterized protein At3g15000...    243   5e-75    Populus euphratica
ref|XP_010489836.1|  PREDICTED: uncharacterized protein At3g15000...    235   1e-74    Camelina sativa [gold-of-pleasure]
dbj|BAJ86595.1|  predicted protein                                      242   2e-74    Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_002465768.1|  hypothetical protein SORBIDRAFT_01g045460          240   7e-74    Sorghum bicolor [broomcorn]
gb|AFW89500.1|  DAG protein                                             240   1e-73    
ref|NP_001149362.1|  DAG protein                                        240   1e-73    
ref|XP_008451723.1|  PREDICTED: uncharacterized protein At3g15000...    241   2e-73    Cucumis melo [Oriental melon]
ref|XP_010235342.1|  PREDICTED: uncharacterized protein At3g15000...    239   5e-73    Brachypodium distachyon [annual false brome]
ref|XP_004974019.1|  PREDICTED: uncharacterized protein At3g15000...    237   1e-72    Setaria italica
ref|XP_008365858.1|  PREDICTED: uncharacterized protein LOC103429...    236   2e-72    
ref|NP_001063625.1|  Os09g0509000                                       236   2e-72    
ref|XP_009386372.1|  PREDICTED: uncharacterized protein At3g15000...    238   2e-72    Musa acuminata subsp. malaccensis [pisang utan]
gb|KEH39765.1|  plastid developmental protein DAG                       234   3e-72    Medicago truncatula
ref|NP_001062627.1|  Os09g0132600                                       236   3e-72    
gb|EAZ08203.1|  hypothetical protein OsI_30464                          236   3e-72    Oryza sativa Indica Group [Indian rice]
dbj|BAJ93961.1|  predicted protein                                      236   4e-72    Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_009386371.1|  PREDICTED: uncharacterized protein At3g15000...    238   4e-72    Musa acuminata subsp. malaccensis [pisang utan]
dbj|BAJ90563.1|  predicted protein                                      236   4e-72    Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_009403805.1|  PREDICTED: uncharacterized protein At3g15000...    237   6e-72    Musa acuminata subsp. malaccensis [pisang utan]
gb|EMS56704.1|  hypothetical protein TRIUR3_21760                       241   6e-72    Triticum urartu
gb|EAZ45317.1|  hypothetical protein OsJ_29960                          234   1e-71    Oryza sativa Japonica Group [Japonica rice]
ref|XP_004294105.1|  PREDICTED: uncharacterized protein At3g15000...    232   1e-70    Fragaria vesca subsp. vesca
ref|XP_008777201.1|  PREDICTED: uncharacterized protein At3g15000...    233   2e-70    Phoenix dactylifera
ref|XP_009421014.1|  PREDICTED: uncharacterized protein At3g15000...    233   2e-70    Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_002462644.1|  hypothetical protein SORBIDRAFT_02g029455          223   3e-70    
ref|XP_010929499.1|  PREDICTED: uncharacterized protein At3g15000...    233   3e-70    Elaeis guineensis
ref|XP_008797096.1|  PREDICTED: uncharacterized protein At3g15000...    232   3e-70    Phoenix dactylifera
ref|XP_010942336.1|  PREDICTED: uncharacterized protein At3g15000...    232   4e-70    Elaeis guineensis
emb|CDY20096.1|  BnaA01g29060D                                          228   5e-70    Brassica napus [oilseed rape]
gb|ABR17737.1|  unknown                                                 224   8e-70    Picea sitchensis
ref|XP_008367934.1|  PREDICTED: uncharacterized protein LOC103431545    226   3e-69    
ref|XP_006843609.1|  hypothetical protein AMTR_s00007p00143190          229   7e-69    Amborella trichopoda
gb|KJB61600.1|  hypothetical protein B456_009G369000                    226   2e-68    Gossypium raimondii
ref|XP_010463450.1|  PREDICTED: uncharacterized protein At3g15000...    217   3e-66    Camelina sativa [gold-of-pleasure]
ref|XP_002465769.1|  hypothetical protein SORBIDRAFT_01g045470          218   5e-66    
ref|XP_010264603.1|  PREDICTED: uncharacterized protein At3g15000...    222   5e-65    Nelumbo nucifera [Indian lotus]
ref|XP_010542306.1|  PREDICTED: uncharacterized protein At3g15000...    211   6e-65    Tarenaya hassleriana [spider flower]
emb|CDY32326.1|  BnaC01g36450D                                          214   2e-64    Brassica napus [oilseed rape]
gb|AFK37344.1|  unknown                                                 201   2e-60    Medicago truncatula
gb|AFK34838.1|  unknown                                                 201   2e-60    Medicago truncatula
gb|KEH32304.1|  plastid developmental protein DAG                       201   2e-60    Medicago truncatula
ref|XP_004508192.1|  PREDICTED: uncharacterized protein At3g15000...    201   2e-60    Cicer arietinum [garbanzo]
gb|KHN03339.1|  Hypothetical protein glysoja_004365                     200   5e-60    Glycine soja [wild soybean]
ref|XP_008458407.1|  PREDICTED: uncharacterized protein At3g15000...    198   2e-59    Cucumis melo [Oriental melon]
ref|XP_006392807.1|  hypothetical protein EUTSA_v10012347mg             197   3e-59    
gb|KHN02942.1|  Hypothetical protein glysoja_009808                     197   7e-59    Glycine soja [wild soybean]
ref|XP_009383895.1|  PREDICTED: uncharacterized protein At3g15000...    197   9e-59    Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010685524.1|  PREDICTED: mediator of RNA polymerase II tra...    207   2e-58    Beta vulgaris subsp. vulgaris [field beet]
ref|XP_004165245.1|  PREDICTED: uncharacterized protein At3g15000...    196   2e-58    
gb|ACU24586.1|  unknown                                                 196   2e-58    Glycine max [soybeans]
ref|XP_010109587.1|  hypothetical protein L484_005246                   195   3e-58    Morus notabilis
ref|XP_004150496.1|  PREDICTED: uncharacterized protein At3g15000...    195   7e-58    
ref|XP_010547005.1|  PREDICTED: uncharacterized protein At3g15000...    193   7e-58    Tarenaya hassleriana [spider flower]
ref|XP_008784778.1|  PREDICTED: DAG protein, chloroplastic-like         195   7e-58    Phoenix dactylifera
ref|XP_010921620.1|  PREDICTED: uncharacterized protein At3g15000...    195   8e-58    Elaeis guineensis
ref|XP_006407900.1|  hypothetical protein EUTSA_v10021360mg             194   2e-57    Eutrema salsugineum [saltwater cress]
ref|XP_006654216.1|  PREDICTED: uncharacterized protein At3g15000...    192   2e-57    Oryza brachyantha
ref|XP_006354278.1|  PREDICTED: uncharacterized protein At3g15000...    193   2e-57    Solanum tuberosum [potatoes]
ref|XP_004229268.1|  PREDICTED: uncharacterized protein At3g15000...    193   3e-57    Solanum lycopersicum
gb|AFK47907.1|  unknown                                                 195   4e-57    Lotus japonicus
gb|KFK38143.1|  hypothetical protein AALP_AA3G075000                    192   4e-57    Arabis alpina [alpine rockcress]
ref|XP_002884610.1|  hypothetical protein ARALYDRAFT_477997             192   4e-57    
ref|XP_002516969.1|  DAG protein, chloroplast precursor, putative       192   5e-57    Ricinus communis
ref|XP_010259473.1|  PREDICTED: uncharacterized protein At3g15000...    192   5e-57    Nelumbo nucifera [Indian lotus]
ref|XP_007154308.1|  hypothetical protein PHAVU_003G107700g             192   6e-57    Phaseolus vulgaris [French bean]
ref|XP_002272388.1|  PREDICTED: uncharacterized protein At3g15000...    192   9e-57    Vitis vinifera
gb|ADE77263.1|  unknown                                                 191   2e-56    Picea sitchensis
ref|XP_009134930.1|  PREDICTED: uncharacterized protein At3g15000...    191   2e-56    Brassica rapa
ref|XP_009124645.1|  PREDICTED: uncharacterized protein At3g15000...    189   5e-56    Brassica rapa
ref|XP_004976818.1|  PREDICTED: uncharacterized protein At3g15000...    189   6e-56    Setaria italica
ref|XP_008223248.1|  PREDICTED: DAG protein, chloroplastic              189   8e-56    Prunus mume [ume]
ref|XP_010689774.1|  PREDICTED: DAG protein, chloroplastic-like         189   8e-56    Beta vulgaris subsp. vulgaris [field beet]
ref|XP_010486211.1|  PREDICTED: uncharacterized protein At3g15000...    189   9e-56    Camelina sativa [gold-of-pleasure]
ref|NP_974243.1|  multiple organellar RNA editing factor 3              188   1e-55    Arabidopsis thaliana [mouse-ear cress]
ref|XP_011071420.1|  PREDICTED: DAG protein, chloroplastic              189   1e-55    Sesamum indicum [beniseed]
emb|CDY08033.1|  BnaC03g34900D                                          187   1e-55    Brassica napus [oilseed rape]
ref|XP_009758237.1|  PREDICTED: DAG protein, chloroplastic-like         189   1e-55    Nicotiana sylvestris
gb|KJB38555.1|  hypothetical protein B456_006G260400                    187   2e-55    Gossypium raimondii
gb|KHG18939.1|  hypothetical protein F383_03121                         187   2e-55    Gossypium arboreum [tree cotton]
ref|XP_003568685.1|  PREDICTED: uncharacterized protein At3g15000...    188   2e-55    Brachypodium distachyon [annual false brome]
ref|XP_010464270.1|  PREDICTED: uncharacterized protein At3g15000...    187   2e-55    Camelina sativa [gold-of-pleasure]
ref|XP_008340777.1|  PREDICTED: uncharacterized protein At3g15000...    188   2e-55    Malus domestica [apple tree]
gb|KDP27842.1|  hypothetical protein JCGZ_18922                         187   3e-55    Jatropha curcas
ref|XP_002448533.1|  hypothetical protein SORBIDRAFT_06g028620          187   3e-55    Sorghum bicolor [broomcorn]
ref|XP_007223708.1|  hypothetical protein PRUPE_ppa010098mg             187   4e-55    Prunus persica
ref|XP_006848369.1|  hypothetical protein AMTR_s00013p00196470          187   4e-55    
ref|XP_010445020.1|  PREDICTED: uncharacterized protein At3g15000...    186   7e-55    Camelina sativa [gold-of-pleasure]
ref|XP_004296867.1|  PREDICTED: uncharacterized protein At3g15000...    186   8e-55    Fragaria vesca subsp. vesca
ref|XP_010269600.1|  PREDICTED: uncharacterized protein At3g15000...    186   9e-55    Nelumbo nucifera [Indian lotus]
gb|ABF97301.1|  DAG protein, chloroplast precursor, putative, exp...    185   1e-54    Oryza sativa Japonica Group [Japonica rice]
ref|NP_187335.1|  multiple organellar RNA editing factor 3              186   1e-54    Arabidopsis thaliana [mouse-ear cress]
gb|EYU45530.1|  hypothetical protein MIMGU_mgv1a012634mg                185   2e-54    Erythranthe guttata [common monkey flower]
gb|AFW59460.1|  DAG protein                                             185   2e-54    
ref|XP_006298387.1|  hypothetical protein CARUB_v10014458mg             185   2e-54    
ref|NP_001152375.1|  DAG protein                                        185   3e-54    Zea mays [maize]
ref|XP_010039379.1|  PREDICTED: DAG protein, chloroplastic              185   4e-54    Eucalyptus grandis [rose gum]
emb|CDO98829.1|  unnamed protein product                                185   5e-54    Coffea canephora [robusta coffee]
ref|XP_007035660.1|  Plastid developmental protein DAG                  184   8e-54    
dbj|BAK07084.1|  predicted protein                                      184   1e-53    Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_009414137.1|  PREDICTED: uncharacterized protein At3g15000...    183   2e-53    Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_008458408.1|  PREDICTED: uncharacterized protein At3g15000...    181   3e-53    Cucumis melo [Oriental melon]
gb|KJB38557.1|  hypothetical protein B456_006G260400                    179   7e-53    Gossypium raimondii
ref|XP_002315492.2|  hypothetical protein POPTR_0010s00930g             181   1e-52    Populus trichocarpa [western balsam poplar]
gb|KGN47419.1|  hypothetical protein Csa_6G318660                       179   1e-52    Cucumis sativus [cucumbers]
gb|KDO71758.1|  hypothetical protein CISIN_1g025802mg                   180   2e-52    Citrus sinensis [apfelsine]
ref|XP_011009083.1|  PREDICTED: DAG protein, chloroplastic-like         180   3e-52    Populus euphratica
ref|XP_006419501.1|  hypothetical protein CICLE_v10005719mg             179   4e-52    Citrus clementina [clementine]
gb|KDO48327.1|  hypothetical protein CISIN_1g012088mg                   182   4e-52    Citrus sinensis [apfelsine]
ref|XP_004150495.1|  PREDICTED: uncharacterized protein At3g15000...    178   5e-52    
gb|AAS07172.1|  putative chloroplast differentiation and palisade...    176   1e-51    Oryza sativa Japonica Group [Japonica rice]
gb|ABK93700.1|  unknown                                                 178   2e-51    Populus trichocarpa [western balsam poplar]
emb|CBI20208.3|  unnamed protein product                                176   5e-51    Vitis vinifera
ref|XP_008456056.1|  PREDICTED: uncharacterized protein At3g15000...    175   6e-51    Cucumis melo [Oriental melon]
gb|KDO71759.1|  hypothetical protein CISIN_1g025802mg                   174   7e-51    Citrus sinensis [apfelsine]
gb|AFW89501.1|  hypothetical protein ZEAMMB73_355013                    173   1e-50    
ref|XP_010542307.1|  PREDICTED: uncharacterized protein At3g15000...    175   6e-50    Tarenaya hassleriana [spider flower]
gb|EMS68528.1|  hypothetical protein TRIUR3_12497                       173   1e-49    Triticum urartu
gb|EMT05556.1|  hypothetical protein F775_52370                         170   8e-48    
gb|EMS47466.1|  hypothetical protein TRIUR3_28031                       169   2e-47    Triticum urartu
ref|XP_008355406.1|  PREDICTED: uncharacterized protein At3g15000...    166   6e-47    
gb|EMT29592.1|  hypothetical protein F775_32958                         169   6e-47    
ref|XP_002862182.1|  predicted protein                                  161   3e-46    
gb|ADE77774.1|  unknown                                                 158   9e-44    Picea sitchensis
gb|ACG45203.1|  DAG protein                                             157   1e-43    Zea mays [maize]
gb|KJB28478.1|  hypothetical protein B456_005G052100                    156   3e-43    Gossypium raimondii
gb|KHG10615.1|  DAG, chloroplastic                                      155   7e-43    Gossypium arboreum [tree cotton]
ref|XP_002532881.1|  DAG protein, chloroplast precursor, putative       155   1e-42    
gb|EPS66780.1|  hypothetical protein M569_07993                         154   2e-42    Genlisea aurea
ref|XP_006851197.1|  hypothetical protein AMTR_s00043p00203580          152   1e-41    Amborella trichopoda
ref|XP_011080093.1|  PREDICTED: DAG protein, chloroplastic-like         152   2e-41    Sesamum indicum [beniseed]
ref|XP_010261841.1|  PREDICTED: uncharacterized protein At3g15000...    150   4e-41    Nelumbo nucifera [Indian lotus]
emb|CDY23734.1|  BnaC04g43880D                                          150   7e-41    Brassica napus [oilseed rape]
emb|CAN77774.1|  hypothetical protein VITISV_021886                     149   8e-41    Vitis vinifera
ref|XP_006489670.1|  PREDICTED: uncharacterized protein At3g15000...    150   1e-40    Citrus sinensis [apfelsine]
ref|XP_002272872.1|  PREDICTED: uncharacterized protein At3g15000...    149   1e-40    Vitis vinifera
ref|XP_010262413.1|  PREDICTED: DAG protein, chloroplastic              150   1e-40    Nelumbo nucifera [Indian lotus]
gb|KDP29703.1|  hypothetical protein JCGZ_18638                         149   1e-40    Jatropha curcas
gb|KDO54083.1|  hypothetical protein CISIN_1g025989mg                   149   1e-40    Citrus sinensis [apfelsine]
ref|XP_007024643.1|  Plastid developmental protein DAG isoform 1        148   2e-40    
ref|XP_010942948.1|  PREDICTED: uncharacterized protein At3g15000...    149   2e-40    Elaeis guineensis
ref|XP_009775265.1|  PREDICTED: DAG protein, chloroplastic-like         149   2e-40    Nicotiana sylvestris
ref|XP_007024644.1|  Plastid developmental protein DAG isoform 2        148   3e-40    
ref|XP_007216380.1|  hypothetical protein PRUPE_ppa021073mg             147   3e-40    
ref|XP_010109586.1|  hypothetical protein L484_005245                   154   3e-40    Morus notabilis
ref|XP_007035204.1|  Differentiation and greening-like 1                148   5e-40    
ref|XP_010267853.1|  PREDICTED: DAG protein, chloroplastic-like         148   6e-40    Nelumbo nucifera [Indian lotus]
gb|ABK24009.1|  unknown                                                 148   6e-40    Picea sitchensis
gb|KJB68918.1|  hypothetical protein B456_011G059700                    146   7e-40    Gossypium raimondii
ref|NP_001240266.1|  uncharacterized protein LOC100788853               147   7e-40    Glycine max [soybeans]
ref|XP_008802961.1|  PREDICTED: DAG protein, chloroplastic-like         147   8e-40    Phoenix dactylifera
gb|AAF69548.1|AC008007_23  F12M16.16                                    150   8e-40    Arabidopsis thaliana [mouse-ear cress]
ref|XP_006593426.1|  PREDICTED: uncharacterized protein LOC100788...    148   9e-40    
ref|XP_008228356.1|  PREDICTED: uncharacterized protein At3g15000...    145   9e-40    Prunus mume [ume]
gb|KDP40691.1|  hypothetical protein JCGZ_24690                         145   2e-39    Jatropha curcas
ref|XP_006364567.1|  PREDICTED: uncharacterized protein At3g15000...    146   2e-39    Solanum tuberosum [potatoes]
ref|XP_004134048.1|  PREDICTED: DAG protein, chloroplastic-like         146   2e-39    Cucumis sativus [cucumbers]
gb|KHF98583.1|  hypothetical protein F383_16164                         144   2e-39    Gossypium arboreum [tree cotton]
ref|XP_006465909.1|  PREDICTED: uncharacterized protein At3g15000...    144   2e-39    Citrus sinensis [apfelsine]
gb|EYU33927.1|  hypothetical protein MIMGU_mgv1a013091mg                145   3e-39    Erythranthe guttata [common monkey flower]
gb|EYU27861.1|  hypothetical protein MIMGU_mgv1a013217mg                145   3e-39    Erythranthe guttata [common monkey flower]
ref|XP_002271431.2|  PREDICTED: uncharacterized protein At3g15000...    146   3e-39    Vitis vinifera
gb|EPS60543.1|  hypothetical protein M569_14261                         141   3e-39    Genlisea aurea
ref|XP_004240482.1|  PREDICTED: DAG protein, chloroplastic-like         145   3e-39    Solanum lycopersicum
ref|XP_004497969.1|  PREDICTED: uncharacterized protein At3g15000...    144   6e-39    Cicer arietinum [garbanzo]
gb|ABK21318.1|  unknown                                                 145   6e-39    Picea sitchensis
ref|XP_009587003.1|  PREDICTED: DAG protein, chloroplastic-like         144   6e-39    Nicotiana tomentosiformis
gb|AFK35502.1|  unknown                                                 144   6e-39    Medicago truncatula
ref|NP_177397.1|  putative plastid developmental protein DAG            143   6e-39    Arabidopsis thaliana [mouse-ear cress]
ref|XP_010265003.1|  PREDICTED: DAG protein, chloroplastic-like         145   7e-39    Nelumbo nucifera [Indian lotus]
ref|XP_009143860.1|  PREDICTED: uncharacterized protein At3g15000...    144   7e-39    Brassica rapa
ref|XP_006294783.1|  hypothetical protein CARUB_v10023834mg             145   7e-39    
ref|XP_009141314.1|  PREDICTED: uncharacterized protein At3g15000...    144   8e-39    Brassica rapa
ref|XP_009105914.1|  PREDICTED: uncharacterized protein At3g15000...    143   8e-39    Brassica rapa
emb|CDY17174.1|  BnaA05g10140D                                          144   9e-39    Brassica napus [oilseed rape]
emb|CDY37719.1|  BnaA04g19490D                                          144   9e-39    Brassica napus [oilseed rape]
ref|XP_002315577.2|  hypothetical protein POPTR_0010s07890g             144   9e-39    Populus trichocarpa [western balsam poplar]
emb|CDX72924.1|  BnaC06g33720D                                          143   9e-39    
ref|XP_010537621.1|  PREDICTED: uncharacterized protein At3g15000...    143   1e-38    Tarenaya hassleriana [spider flower]
emb|CDY19491.1|  BnaC04g11080D                                          144   1e-38    Brassica napus [oilseed rape]
ref|XP_010933065.1|  PREDICTED: DAG protein, chloroplastic-like         144   1e-38    
ref|NP_181067.1|  putative plastid developmental protein DAG            144   1e-38    Arabidopsis thaliana [mouse-ear cress]
ref|XP_008438483.1|  PREDICTED: DAG protein, chloroplastic              144   1e-38    Cucumis melo [Oriental melon]
gb|ACU14891.1|  unknown                                                 144   1e-38    Glycine max [soybeans]
ref|XP_006294883.1|  hypothetical protein CARUB_v10023932mg             144   1e-38    
ref|XP_010416005.1|  PREDICTED: uncharacterized protein At3g15000...    142   1e-38    Camelina sativa [gold-of-pleasure]
ref|XP_004232761.1|  PREDICTED: DAG protein, chloroplastic              144   2e-38    Solanum lycopersicum
ref|XP_006365865.1|  PREDICTED: DAG protein, chloroplastic-like         143   2e-38    Solanum tuberosum [potatoes]
gb|EYU46416.1|  hypothetical protein MIMGU_mgv1a010813mg                145   2e-38    Erythranthe guttata [common monkey flower]
emb|CDX96416.1|  BnaA07g30270D                                          142   2e-38    
ref|XP_010556915.1|  PREDICTED: uncharacterized protein At3g15000...    144   2e-38    Tarenaya hassleriana [spider flower]
ref|XP_010908920.1|  PREDICTED: DAG protein, chloroplastic-like         144   2e-38    Elaeis guineensis
ref|XP_009624175.1|  PREDICTED: DAG protein, chloroplastic-like         143   2e-38    Nicotiana tomentosiformis
ref|XP_010428140.1|  PREDICTED: uncharacterized protein At3g15000...    142   2e-38    Camelina sativa [gold-of-pleasure]
ref|XP_009358006.1|  PREDICTED: DAG protein, chloroplastic-like         143   3e-38    Pyrus x bretschneideri [bai li]
ref|XP_010538368.1|  PREDICTED: DAG protein, chloroplastic-like         143   3e-38    
ref|XP_008801402.1|  PREDICTED: DAG protein, chloroplastic-like         143   3e-38    
ref|XP_010461113.1|  PREDICTED: DAG protein, chloroplastic-like         143   3e-38    
ref|XP_002285392.1|  PREDICTED: DAG protein, chloroplastic              143   3e-38    
ref|XP_008789768.1|  PREDICTED: DAG protein, chloroplastic-like         143   4e-38    
ref|XP_002879451.1|  hypothetical protein ARALYDRAFT_482286             142   4e-38    
gb|EPS69137.1|  hypothetical protein M569_05632                         142   4e-38    
ref|XP_010499838.1|  PREDICTED: DAG protein, chloroplastic-like         142   4e-38    
ref|XP_002312591.2|  plastid developmental protein DAG                  143   4e-38    
ref|XP_006426674.1|  hypothetical protein CICLE_v10026560mg             141   4e-38    
ref|XP_002283211.1|  PREDICTED: DAG protein, chloroplastic              142   5e-38    
ref|XP_010478682.1|  PREDICTED: uncharacterized protein At3g15000...    142   5e-38    
gb|KFK31046.1|  hypothetical protein AALP_AA6G061300                    142   5e-38    
ref|XP_006303341.1|  hypothetical protein CARUB_v10010207mg             142   5e-38    
ref|XP_010241002.1|  PREDICTED: DAG protein, chloroplastic-like         142   6e-38    
emb|CDP03777.1|  unnamed protein product                                142   6e-38    
ref|XP_011096169.1|  PREDICTED: DAG protein, chloroplastic              142   6e-38    
emb|CAA75116.1|  DAL1 protein                                           142   6e-38    
gb|AFK48881.1|  unknown                                                 142   6e-38    
ref|XP_002890997.1|  hypothetical protein ARALYDRAFT_473448             142   7e-38    
ref|XP_010942949.1|  PREDICTED: DAG protein, chloroplastic-like i...    142   9e-38    
ref|XP_006409615.1|  hypothetical protein EUTSA_v10022834mg             142   1e-37    
ref|NP_180901.1|  protein differentiation and greening-like 1           141   1e-37    
emb|CAB06698.1|  plastid protein                                        140   1e-37    
ref|XP_009774543.1|  PREDICTED: DAG protein, chloroplastic              141   1e-37    
emb|CDO99683.1|  unnamed protein product                                141   1e-37    
ref|XP_007021140.1|  Plastid developmental protein DAG                  141   1e-37    
ref|XP_009388436.1|  PREDICTED: DAG protein, chloroplastic-like         141   1e-37    
gb|AAM66959.1|  plastid protein                                         141   1e-37    
ref|XP_010509890.1|  PREDICTED: uncharacterized protein At3g15000...    141   1e-37    
ref|XP_010924005.1|  PREDICTED: DAG protein, chloroplastic-like         141   1e-37    
ref|XP_010928623.1|  PREDICTED: DAG protein, chloroplastic-like         141   1e-37    
ref|XP_010540781.1|  PREDICTED: DAG protein, chloroplastic              141   2e-37    
ref|XP_011030445.1|  PREDICTED: DAG protein, chloroplastic-like         141   2e-37    
ref|NP_001131166.1|  uncharacterized protein LOC100192474               140   2e-37    
ref|XP_008808804.1|  PREDICTED: DAG protein, chloroplastic-like i...    141   2e-37    
ref|XP_009104853.1|  PREDICTED: uncharacterized protein At3g15000...    140   2e-37    
ref|XP_010684668.1|  PREDICTED: DAG protein, chloroplastic              141   2e-37    
ref|XP_006857454.1|  hypothetical protein AMTR_s00067p00179200          139   2e-37    
ref|XP_002316698.1|  hypothetical protein POPTR_0011s03550g             141   2e-37    
ref|XP_009334216.1|  PREDICTED: DAG protein, chloroplastic-like         141   2e-37    
ref|XP_010413866.1|  PREDICTED: uncharacterized protein At3g15000...    140   2e-37    
ref|XP_010471280.1|  PREDICTED: uncharacterized protein At3g15000...    139   2e-37    
ref|XP_009414548.1|  PREDICTED: DAG protein, chloroplastic              141   2e-37    
ref|XP_011009500.1|  PREDICTED: DAG protein, chloroplastic              140   2e-37    
gb|KFK36418.1|  hypothetical protein AALP_AA4G121400                    140   3e-37    
ref|XP_010023873.1|  PREDICTED: DAG protein, chloroplastic-like         140   3e-37    
ref|XP_010469478.1|  PREDICTED: uncharacterized protein At3g15000...    140   3e-37    
ref|XP_009141475.1|  PREDICTED: uncharacterized protein At3g15000...    140   3e-37    
ref|XP_006410684.1|  hypothetical protein EUTSA_v10017195mg             140   3e-37    
emb|CDX84224.1|  BnaC04g09860D                                          140   3e-37    
ref|XP_006659103.1|  PREDICTED: DAG protein, chloroplastic-like         140   4e-37    
ref|XP_008797413.1|  PREDICTED: DAG protein, chloroplastic-like i...    140   4e-37    
ref|XP_006475256.1|  PREDICTED: DAG protein, chloroplastic-like i...    140   4e-37    
ref|XP_009102325.1|  PREDICTED: uncharacterized protein At3g15000...    140   4e-37    
ref|XP_007144062.1|  hypothetical protein PHAVU_007G125200g             140   4e-37    
ref|XP_010492816.1|  PREDICTED: DAG protein, chloroplastic-like         140   4e-37    
ref|NP_174536.1|  putative plastid developmental protein DAG            140   5e-37    
ref|NP_001149488.1|  LOC100283114                                       139   5e-37    
emb|CAD41861.2|  OSJNBa0041A02.8                                        139   5e-37    
ref|XP_003580460.1|  PREDICTED: DAG protein, chloroplastic-like         139   5e-37    
ref|XP_004976696.1|  PREDICTED: DAG protein, chloroplastic-like         139   6e-37    
ref|XP_011029779.1|  PREDICTED: DAG protein, chloroplastic-like         140   6e-37    
ref|XP_003573360.1|  PREDICTED: DAG protein, chloroplastic              139   6e-37    
ref|XP_006452115.1|  hypothetical protein CICLE_v10009235mg             140   7e-37    
ref|XP_004972887.1|  PREDICTED: DAG protein, chloroplastic-like         139   7e-37    
ref|XP_002447049.1|  hypothetical protein SORBIDRAFT_06g027510          139   8e-37    
ref|XP_009397798.1|  PREDICTED: uncharacterized protein At3g15000...    139   8e-37    
ref|XP_007223742.1|  hypothetical protein PRUPE_ppa010500mg             139   9e-37    
ref|XP_010665791.1|  PREDICTED: DAG protein, chloroplastic              139   1e-36    
ref|XP_009143687.1|  PREDICTED: uncharacterized protein At3g15000...    139   1e-36    
ref|XP_004151975.1|  PREDICTED: DAG protein, chloroplastic-like         139   1e-36    
ref|NP_001154468.1|  putative plastid developmental protein DAG         137   1e-36    
ref|XP_009781613.1|  PREDICTED: DAG protein, chloroplastic-like         139   1e-36    
ref|XP_002445021.1|  hypothetical protein SORBIDRAFT_07g002970          139   1e-36    
ref|NP_001060965.1|  Os08g0139100                                       139   1e-36    
ref|XP_008367229.1|  PREDICTED: DAG protein, chloroplastic-like         139   1e-36    
ref|XP_008386040.1|  PREDICTED: DAG protein, chloroplastic-like         139   1e-36    
gb|KDP39003.1|  hypothetical protein JCGZ_00760                         138   1e-36    
gb|KJB28479.1|  hypothetical protein B456_005G052100                    139   2e-36    
emb|CDX68262.1|  BnaA07g23020D                                          137   2e-36    
ref|XP_006304167.1|  hypothetical protein CARUB_v10010192mg             139   2e-36    
ref|NP_001151266.1|  DAG protein                                        138   2e-36    
ref|XP_010931876.1|  PREDICTED: DAG protein, chloroplastic-like i...    139   2e-36    
ref|XP_006302864.1|  hypothetical protein CARUB_v10020995mg             137   2e-36    
ref|XP_010458542.1|  PREDICTED: DAG protein, chloroplastic-like         138   2e-36    
ref|XP_002862198.1|  hypothetical protein ARALYDRAFT_921093             138   2e-36    
gb|ACN27869.1|  unknown                                                 138   2e-36    
ref|XP_010476063.1|  PREDICTED: DAG protein, chloroplastic-like         138   2e-36    
gb|EEC82876.1|  hypothetical protein OsI_27756                          138   3e-36    
gb|KJB45635.1|  hypothetical protein B456_007G317600                    137   3e-36    
gb|KHG02689.1|  DAG, chloroplastic                                      137   3e-36    
ref|XP_009148480.1|  PREDICTED: DAG protein, chloroplastic              137   3e-36    
ref|XP_009597288.1|  PREDICTED: DAG protein, chloroplastic              137   3e-36    
dbj|BAJ99034.1|  predicted protein                                      137   3e-36    
ref|XP_007211990.1|  hypothetical protein PRUPE_ppa011005mg             137   3e-36    
ref|XP_003545788.1|  PREDICTED: DAG protein, chloroplastic isofor...    137   3e-36    
ref|XP_009110725.1|  PREDICTED: DAG protein, chloroplastic-like         137   4e-36    
ref|XP_008365919.1|  PREDICTED: DAG protein, chloroplastic-like         137   4e-36    
gb|KHG09730.1|  DAG, chloroplastic                                      137   4e-36    
gb|KJB22087.1|  hypothetical protein B456_004G028600                    137   5e-36    
gb|AAM65001.1|  DAG protein, putative                                   137   5e-36    
ref|XP_006410485.1|  hypothetical protein EUTSA_v10017201mg             137   5e-36    
ref|XP_002887438.1|  predicted protein                                  136   5e-36    
ref|XP_009372130.1|  PREDICTED: DAG protein, chloroplastic-like         138   5e-36    
ref|XP_008226759.1|  PREDICTED: DAG protein, chloroplastic              137   5e-36    
ref|XP_002518590.1|  DAG protein, chloroplast precursor, putative       137   5e-36    
ref|NP_172610.1|  multiple organellar RNA editing factor 9              137   5e-36    
emb|CDY49781.1|  BnaCnng17940D                                          137   5e-36    
gb|KFK43423.1|  hypothetical protein AALP_AA1G123900                    137   6e-36    
emb|CDY31675.1|  BnaA05g08720D                                          137   6e-36    
ref|XP_006417357.1|  hypothetical protein EUTSA_v10008605mg             137   7e-36    
ref|XP_009355554.1|  PREDICTED: DAG protein, chloroplastic              137   7e-36    
ref|XP_002889867.1|  hypothetical protein ARALYDRAFT_471280             137   8e-36    
ref|XP_004294316.1|  PREDICTED: DAG protein, chloroplastic              137   8e-36    
sp|Q38732.1|DAG_ANTMA  RecName: Full=DAG protein, chloroplastic; ...    136   9e-36    
emb|CDX79597.1|  BnaC03g19330D                                          136   1e-35    
ref|XP_010533846.1|  PREDICTED: DAG protein, chloroplastic              136   1e-35    
ref|XP_010505024.1|  PREDICTED: uncharacterized protein At3g15000...    136   1e-35    
gb|EYU21318.1|  hypothetical protein MIMGU_mgv1a013864mg                135   1e-35    
gb|KEH41103.1|  plastid developmental protein DAG                       134   1e-35    
ref|XP_008224177.1|  PREDICTED: DAG protein, chloroplastic              134   1e-35    
ref|XP_010516697.1|  PREDICTED: uncharacterized protein At3g15000...    136   1e-35    
ref|XP_010057694.1|  PREDICTED: DAG protein, chloroplastic              136   2e-35    
emb|CDY65831.1|  BnaAnng21120D                                          135   2e-35    
emb|CBI37159.3|  unnamed protein product                                133   2e-35    
ref|XP_007148282.1|  hypothetical protein PHAVU_006G195100g             135   3e-35    
ref|XP_004485674.1|  PREDICTED: DAG protein, chloroplastic-like i...    135   3e-35    
ref|XP_003593397.1|  DAG protein                                        135   3e-35    
emb|CDY57037.1|  BnaC08g14930D                                          135   3e-35    
ref|XP_003570764.1|  PREDICTED: DAG protein, chloroplastic-like         135   3e-35    
gb|KFK41678.1|  hypothetical protein AALP_AA2G158700                    134   4e-35    
gb|ACU13265.1|  unknown                                                 134   5e-35    
ref|XP_009402976.1|  PREDICTED: uncharacterized protein At3g15000...    135   5e-35    
ref|XP_008354192.1|  PREDICTED: DAG protein, chloroplastic-like         134   5e-35    
ref|XP_008797412.1|  PREDICTED: DAG protein, chloroplastic-like i...    134   7e-35    
gb|ACJ85878.1|  unknown                                                 134   8e-35    
ref|XP_011072591.1|  PREDICTED: uncharacterized protein At3g15000...    133   8e-35    
gb|KFK44996.1|  hypothetical protein AALP_AA1G330600                    134   9e-35    
ref|XP_003590806.1|  Plastid protein                                    134   9e-35    
gb|KCW60279.1|  hypothetical protein EUGRSUZ_H02992                     133   9e-35    
dbj|BAJ87670.1|  predicted protein                                      134   1e-34    
dbj|BAK01694.1|  predicted protein                                      134   2e-34    
gb|EMS46088.1|  hypothetical protein TRIUR3_15945                       130   2e-34    
ref|NP_001236832.1|  uncharacterized protein LOC100306054               133   2e-34    
ref|XP_010261847.1|  PREDICTED: DAG protein, chloroplastic isofor...    132   3e-34    
emb|CDY65020.1|  BnaCnng45730D                                          131   3e-34    
ref|XP_010261846.1|  PREDICTED: DAG protein, chloroplastic isofor...    132   3e-34    
gb|AHA84249.1|  chloroplast DAG protein                                 132   3e-34    
gb|AFW57409.1|  hypothetical protein ZEAMMB73_570539                    130   4e-34    
emb|CDX97960.1|  BnaA06g07110D                                          130   4e-34    
emb|CDY20996.1|  BnaA08g25290D                                          129   6e-34    
ref|XP_008355405.1|  PREDICTED: uncharacterized protein At3g15000...    132   8e-34    
ref|XP_010931875.1|  PREDICTED: DAG protein, chloroplastic-like i...    132   1e-33    
ref|XP_003563919.1|  PREDICTED: DAG protein, chloroplastic-like         131   1e-33    
ref|XP_006656573.1|  PREDICTED: DAG protein, chloroplastic-like         129   1e-33    
ref|XP_008808805.1|  PREDICTED: DAG protein, chloroplastic-like i...    131   1e-33    
ref|XP_003557177.1|  PREDICTED: DAG protein, chloroplastic-like         131   1e-33    
ref|XP_002436376.1|  hypothetical protein SORBIDRAFT_10g001390          130   1e-33    
ref|XP_006653735.1|  PREDICTED: serine/arginine repetitive matrix...    137   2e-33    
gb|AFK45843.1|  unknown                                                 130   2e-33    
ref|XP_010261844.1|  PREDICTED: DAG protein, chloroplastic isofor...    130   2e-33    
ref|XP_006345901.1|  PREDICTED: DAG protein, chloroplastic-like         130   2e-33    
gb|KDO74392.1|  hypothetical protein CISIN_1g027488mg                   129   2e-33    
ref|XP_004239751.1|  PREDICTED: DAG protein, chloroplastic              130   2e-33    
gb|AFK37887.1|  unknown                                                 129   4e-33    
dbj|BAC22214.1|  putative plastid protein                               129   4e-33    
ref|NP_001056622.1|  Os06g0116600                                       127   5e-33    
gb|KHN13142.1|  DAG protein, chloroplastic                              127   6e-33    
ref|NP_001150208.1|  DAG protein                                        129   7e-33    
ref|XP_008648144.1|  PREDICTED: uncharacterized protein LOC100383...    129   7e-33    
gb|KJB69888.1|  hypothetical protein B456_011G060000                    127   1e-32    
ref|XP_009802051.1|  PREDICTED: DAG protein, chloroplastic-like         129   1e-32    
gb|KJB22088.1|  hypothetical protein B456_004G028600                    127   1e-32    
ref|XP_004964371.1|  PREDICTED: uncharacterized protein At3g15000...    128   1e-32    
gb|KJB68921.1|  hypothetical protein B456_011G059700                    126   1e-32    
gb|KDP20839.1|  hypothetical protein JCGZ_21310                         128   1e-32    
gb|EAZ09699.1|  hypothetical protein OsI_31983                          129   3e-32    
ref|XP_004965835.1|  PREDICTED: uncharacterized protein At3g15000...    127   5e-32    
ref|XP_011083316.1|  PREDICTED: uncharacterized protein At3g15000...    126   6e-32    
ref|XP_010092271.1|  hypothetical protein L484_021132                   126   1e-31    
ref|XP_009346487.1|  PREDICTED: DAG protein, chloroplastic-like         124   1e-31    
ref|XP_010416006.1|  PREDICTED: uncharacterized protein At3g15000...    124   2e-31    
emb|CDY58181.1|  BnaCnng32800D                                          124   2e-31    
ref|XP_010428141.1|  PREDICTED: uncharacterized protein At3g15000...    123   2e-31    
gb|KJB62666.1|  hypothetical protein B456_009G429000                    124   3e-31    
gb|KJB68920.1|  hypothetical protein B456_011G059700                    123   3e-31    
gb|KGN57938.1|  hypothetical protein Csa_3G399450                       125   3e-31    
ref|XP_010537624.1|  PREDICTED: uncharacterized protein At3g15000...    123   3e-31    
ref|XP_010537622.1|  PREDICTED: uncharacterized protein At3g15000...    123   3e-31    
ref|XP_008368220.1|  PREDICTED: uncharacterized protein At3g15000...    126   5e-31    
gb|AFK33889.1|  unknown                                                 122   6e-31    
emb|CDX74079.1|  BnaA03g29680D                                          119   6e-30    
gb|EMT33368.1|  hypothetical protein F775_17264                         122   7e-30    
ref|XP_009623922.1|  PREDICTED: DAG protein, chloroplastic-like         121   8e-30    
ref|XP_009342318.1|  PREDICTED: uncharacterized protein At3g15000...    121   2e-29    
ref|XP_010268156.1|  PREDICTED: uncharacterized protein At3g15000...    123   2e-29    
gb|KFK41679.1|  hypothetical protein AALP_AA2G158800                    118   2e-29    
gb|EAY80372.1|  hypothetical protein OsI_35548                          122   5e-29    
gb|ACF87463.1|  unknown                                                 121   7e-29    
ref|XP_011087721.1|  PREDICTED: uncharacterized protein At3g15000...    121   8e-29    
ref|XP_010237830.1|  PREDICTED: uncharacterized protein At3g15000...    121   9e-29    
ref|XP_006663301.1|  PREDICTED: uncharacterized protein At3g15000...    119   1e-28    
gb|ABK24691.1|  unknown                                                 121   1e-28    
ref|XP_006858488.1|  hypothetical protein AMTR_s00071p00125410          120   1e-28    
ref|NP_001067510.1|  Os11g0216400                                       120   2e-28    
ref|XP_009775694.1|  PREDICTED: uncharacterized protein At3g15000...    120   2e-28    
ref|XP_010060671.1|  PREDICTED: uncharacterized protein LOC104448...    116   2e-28    
dbj|BAJ87292.1|  predicted protein                                      120   2e-28    
ref|XP_008781845.1|  PREDICTED: uncharacterized protein LOC103701...    116   2e-28    
ref|XP_009619771.1|  PREDICTED: uncharacterized protein At3g15000...    120   2e-28    
emb|CDJ26573.1|  unnamed protein product                                120   2e-28    
ref|XP_008781844.1|  PREDICTED: uncharacterized protein LOC103701...    116   2e-28    
ref|XP_010681781.1|  PREDICTED: uncharacterized protein At3g15000...    120   2e-28    
ref|XP_009408577.1|  PREDICTED: uncharacterized protein At3g15000...    120   3e-28    
ref|XP_010434330.1|  PREDICTED: DAG protein, chloroplastic-like         119   3e-28    
ref|XP_002449368.1|  hypothetical protein SORBIDRAFT_05g008690          119   3e-28    
ref|XP_010912635.1|  PREDICTED: DAG protein, chloroplastic-like         119   3e-28    
gb|EPS57228.1|  hypothetical protein M569_17592                         117   4e-28    
gb|KHG13811.1|  DAG, chloroplastic                                      114   5e-28    
ref|XP_008786517.1|  PREDICTED: uncharacterized protein At3g15000...    119   6e-28    



>ref|XP_009620765.1| PREDICTED: uncharacterized protein At3g15000, mitochondrial isoform 
X4 [Nicotiana tomentosiformis]
Length=432

 Score =   310 bits (795),  Expect = 8e-101, Method: Compositional matrix adjust.
 Identities = 155/195 (79%), Positives = 167/195 (86%), Gaps = 5/195 (3%)
 Frame = +3

Query  48   MAT-LLSRSLITAGKQLFRSYSSLTPPRNFLAFSSFRLRPLVSVSPAVCQLYPAAYT-AV  221
            MAT  L+RSL+TA     RSY+S+ PP +  AFS  RLRPL++V+  +    P     AV
Sbjct  1    MATRYLTRSLLTA---FTRSYTSIAPPSSLSAFSLLRLRPLIAVAANLKNASPPPTPFAV  57

Query  222  RGLATRQTSSSLNDPNPNWSNRPPKETILLDGCDFEHWLIVMEKPEGDPTRDEIIDSYIK  401
            RG ATRQTSSSLNDPNPNWSNRPPKETILLDGCDFEHWL+VMEKPEGDPTRDEIIDSYIK
Sbjct  58   RGFATRQTSSSLNDPNPNWSNRPPKETILLDGCDFEHWLVVMEKPEGDPTRDEIIDSYIK  117

Query  402  TLAQVVGSEEEARMKIYSVSTRHYYAFGALVSEELSYKLKELKGVRWVLPDSYLDVKNKD  581
            TLA +VGSEEEARMKIYSVSTRHYYAFGALVSEELSYKLKEL  VRWVLPDSYLDV+NKD
Sbjct  118  TLATIVGSEEEARMKIYSVSTRHYYAFGALVSEELSYKLKELPRVRWVLPDSYLDVRNKD  177

Query  582  YGGEPFINGQAVPYD  626
            YGGEPFINGQAVPYD
Sbjct  178  YGGEPFINGQAVPYD  192



>ref|XP_009620767.1| PREDICTED: uncharacterized protein At3g15000, mitochondrial isoform 
X6 [Nicotiana tomentosiformis]
Length=403

 Score =   309 bits (792),  Expect = 9e-101, Method: Compositional matrix adjust.
 Identities = 155/195 (79%), Positives = 167/195 (86%), Gaps = 5/195 (3%)
 Frame = +3

Query  48   MAT-LLSRSLITAGKQLFRSYSSLTPPRNFLAFSSFRLRPLVSVSPAVCQLYPAAYT-AV  221
            MAT  L+RSL+TA     RSY+S+ PP +  AFS  RLRPL++V+  +    P     AV
Sbjct  1    MATRYLTRSLLTA---FTRSYTSIAPPSSLSAFSLLRLRPLIAVAANLKNASPPPTPFAV  57

Query  222  RGLATRQTSSSLNDPNPNWSNRPPKETILLDGCDFEHWLIVMEKPEGDPTRDEIIDSYIK  401
            RG ATRQTSSSLNDPNPNWSNRPPKETILLDGCDFEHWL+VMEKPEGDPTRDEIIDSYIK
Sbjct  58   RGFATRQTSSSLNDPNPNWSNRPPKETILLDGCDFEHWLVVMEKPEGDPTRDEIIDSYIK  117

Query  402  TLAQVVGSEEEARMKIYSVSTRHYYAFGALVSEELSYKLKELKGVRWVLPDSYLDVKNKD  581
            TLA +VGSEEEARMKIYSVSTRHYYAFGALVSEELSYKLKEL  VRWVLPDSYLDV+NKD
Sbjct  118  TLATIVGSEEEARMKIYSVSTRHYYAFGALVSEELSYKLKELPRVRWVLPDSYLDVRNKD  177

Query  582  YGGEPFINGQAVPYD  626
            YGGEPFINGQAVPYD
Sbjct  178  YGGEPFINGQAVPYD  192



>ref|XP_009620762.1| PREDICTED: uncharacterized protein At3g15000, mitochondrial isoform 
X1 [Nicotiana tomentosiformis]
Length=454

 Score =   310 bits (795),  Expect = 1e-100, Method: Compositional matrix adjust.
 Identities = 155/195 (79%), Positives = 167/195 (86%), Gaps = 5/195 (3%)
 Frame = +3

Query  48   MAT-LLSRSLITAGKQLFRSYSSLTPPRNFLAFSSFRLRPLVSVSPAVCQLYPAAYT-AV  221
            MAT  L+RSL+TA     RSY+S+ PP +  AFS  RLRPL++V+  +    P     AV
Sbjct  1    MATRYLTRSLLTA---FTRSYTSIAPPSSLSAFSLLRLRPLIAVAANLKNASPPPTPFAV  57

Query  222  RGLATRQTSSSLNDPNPNWSNRPPKETILLDGCDFEHWLIVMEKPEGDPTRDEIIDSYIK  401
            RG ATRQTSSSLNDPNPNWSNRPPKETILLDGCDFEHWL+VMEKPEGDPTRDEIIDSYIK
Sbjct  58   RGFATRQTSSSLNDPNPNWSNRPPKETILLDGCDFEHWLVVMEKPEGDPTRDEIIDSYIK  117

Query  402  TLAQVVGSEEEARMKIYSVSTRHYYAFGALVSEELSYKLKELKGVRWVLPDSYLDVKNKD  581
            TLA +VGSEEEARMKIYSVSTRHYYAFGALVSEELSYKLKEL  VRWVLPDSYLDV+NKD
Sbjct  118  TLATIVGSEEEARMKIYSVSTRHYYAFGALVSEELSYKLKELPRVRWVLPDSYLDVRNKD  177

Query  582  YGGEPFINGQAVPYD  626
            YGGEPFINGQAVPYD
Sbjct  178  YGGEPFINGQAVPYD  192



>ref|XP_009620766.1| PREDICTED: uncharacterized protein At3g15000, mitochondrial isoform 
X5 [Nicotiana tomentosiformis]
Length=417

 Score =   309 bits (792),  Expect = 1e-100, Method: Compositional matrix adjust.
 Identities = 155/195 (79%), Positives = 167/195 (86%), Gaps = 5/195 (3%)
 Frame = +3

Query  48   MAT-LLSRSLITAGKQLFRSYSSLTPPRNFLAFSSFRLRPLVSVSPAVCQLYPAAYT-AV  221
            MAT  L+RSL+TA     RSY+S+ PP +  AFS  RLRPL++V+  +    P     AV
Sbjct  1    MATRYLTRSLLTA---FTRSYTSIAPPSSLSAFSLLRLRPLIAVAANLKNASPPPTPFAV  57

Query  222  RGLATRQTSSSLNDPNPNWSNRPPKETILLDGCDFEHWLIVMEKPEGDPTRDEIIDSYIK  401
            RG ATRQTSSSLNDPNPNWSNRPPKETILLDGCDFEHWL+VMEKPEGDPTRDEIIDSYIK
Sbjct  58   RGFATRQTSSSLNDPNPNWSNRPPKETILLDGCDFEHWLVVMEKPEGDPTRDEIIDSYIK  117

Query  402  TLAQVVGSEEEARMKIYSVSTRHYYAFGALVSEELSYKLKELKGVRWVLPDSYLDVKNKD  581
            TLA +VGSEEEARMKIYSVSTRHYYAFGALVSEELSYKLKEL  VRWVLPDSYLDV+NKD
Sbjct  118  TLATIVGSEEEARMKIYSVSTRHYYAFGALVSEELSYKLKELPRVRWVLPDSYLDVRNKD  177

Query  582  YGGEPFINGQAVPYD  626
            YGGEPFINGQAVPYD
Sbjct  178  YGGEPFINGQAVPYD  192



>ref|XP_009620763.1| PREDICTED: uncharacterized protein At3g15000, mitochondrial isoform 
X2 [Nicotiana tomentosiformis]
 ref|XP_009620764.1| PREDICTED: uncharacterized protein At3g15000, mitochondrial isoform 
X3 [Nicotiana tomentosiformis]
Length=439

 Score =   310 bits (794),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 155/195 (79%), Positives = 167/195 (86%), Gaps = 5/195 (3%)
 Frame = +3

Query  48   MAT-LLSRSLITAGKQLFRSYSSLTPPRNFLAFSSFRLRPLVSVSPAVCQLYPAAYT-AV  221
            MAT  L+RSL+TA     RSY+S+ PP +  AFS  RLRPL++V+  +    P     AV
Sbjct  1    MATRYLTRSLLTA---FTRSYTSIAPPSSLSAFSLLRLRPLIAVAANLKNASPPPTPFAV  57

Query  222  RGLATRQTSSSLNDPNPNWSNRPPKETILLDGCDFEHWLIVMEKPEGDPTRDEIIDSYIK  401
            RG ATRQTSSSLNDPNPNWSNRPPKETILLDGCDFEHWL+VMEKPEGDPTRDEIIDSYIK
Sbjct  58   RGFATRQTSSSLNDPNPNWSNRPPKETILLDGCDFEHWLVVMEKPEGDPTRDEIIDSYIK  117

Query  402  TLAQVVGSEEEARMKIYSVSTRHYYAFGALVSEELSYKLKELKGVRWVLPDSYLDVKNKD  581
            TLA +VGSEEEARMKIYSVSTRHYYAFGALVSEELSYKLKEL  VRWVLPDSYLDV+NKD
Sbjct  118  TLATIVGSEEEARMKIYSVSTRHYYAFGALVSEELSYKLKELPRVRWVLPDSYLDVRNKD  177

Query  582  YGGEPFINGQAVPYD  626
            YGGEPFINGQAVPYD
Sbjct  178  YGGEPFINGQAVPYD  192



>ref|XP_009803761.1| PREDICTED: uncharacterized protein At3g15000, mitochondrial-like 
[Nicotiana sylvestris]
Length=397

 Score =   307 bits (786),  Expect = 7e-100, Method: Compositional matrix adjust.
 Identities = 156/198 (79%), Positives = 169/198 (85%), Gaps = 8/198 (4%)
 Frame = +3

Query  48   MAT-LLSRSLITAGKQLFRSYSSL---TPPRNFLAFSSFRLRPLVSVSPAVCQ-LYPAAY  212
            MAT  L+RSL TA   L R Y+SL   TPP +  +FS  RLRPL++V+    + + PA  
Sbjct  1    MATRYLTRSLFTA---LSRPYTSLSLSTPPPSIFSFSLLRLRPLIAVAAVNLRSVSPAVA  57

Query  213  TAVRGLATRQTSSSLNDPNPNWSNRPPKETILLDGCDFEHWLIVMEKPEGDPTRDEIIDS  392
            T+ RG ATRQTSSSLNDPNPNWSNRPPKETILLDGCDFEHWL+VMEKPEGDPTRDEIIDS
Sbjct  58   TSFRGFATRQTSSSLNDPNPNWSNRPPKETILLDGCDFEHWLVVMEKPEGDPTRDEIIDS  117

Query  393  YIKTLAQVVGSEEEARMKIYSVSTRHYYAFGALVSEELSYKLKELKGVRWVLPDSYLDVK  572
            YIKTLA+VVGSEEEARMKIYSVSTRHYYAFGALVSEELSYKLKE+  V WVLPDSYLDVK
Sbjct  118  YIKTLAKVVGSEEEARMKIYSVSTRHYYAFGALVSEELSYKLKEVPKVSWVLPDSYLDVK  177

Query  573  NKDYGGEPFINGQAVPYD  626
            NKDYGGEPFINGQAVPYD
Sbjct  178  NKDYGGEPFINGQAVPYD  195



>ref|XP_006360053.1| PREDICTED: uncharacterized protein At3g15000, mitochondrial-like 
[Solanum tuberosum]
Length=411

 Score =   298 bits (763),  Expect = 3e-96, Method: Compositional matrix adjust.
 Identities = 155/199 (78%), Positives = 167/199 (84%), Gaps = 10/199 (5%)
 Frame = +3

Query  48   MAT-LLSRSLITAGKQLFRSYS--SLTPPRNFLAFSSFRLRPLVSVSPAVCQLYPA---A  209
            MAT  L+RSL+T    L RSY   SL+ P    +FS  R RPL++V+  +    PA   A
Sbjct  1    MATRYLTRSLLTT---LSRSYIPLSLSTPL-PSSFSLLRFRPLIAVAANLRTFTPATLTA  56

Query  210  YTAVRGLATRQTSSSLNDPNPNWSNRPPKETILLDGCDFEHWLIVMEKPEGDPTRDEIID  389
             T++RG ATRQTSSSLNDPNPNWSNRPPKETILLDGCDFEHWL+VMEKPEGDPTRDEIID
Sbjct  57   ATSLRGFATRQTSSSLNDPNPNWSNRPPKETILLDGCDFEHWLVVMEKPEGDPTRDEIID  116

Query  390  SYIKTLAQVVGSEEEARMKIYSVSTRHYYAFGALVSEELSYKLKELKGVRWVLPDSYLDV  569
            SYIKTLA +VGSEEEARMKIYSVSTRHYYAFGALVSEELSYKLKEL  VRWVLPDSYLDV
Sbjct  117  SYIKTLATIVGSEEEARMKIYSVSTRHYYAFGALVSEELSYKLKELPKVRWVLPDSYLDV  176

Query  570  KNKDYGGEPFINGQAVPYD  626
            KNKDYGGEPFINGQAVPYD
Sbjct  177  KNKDYGGEPFINGQAVPYD  195



>ref|XP_004248249.1| PREDICTED: uncharacterized protein At3g15000, mitochondrial-like 
[Solanum lycopersicum]
Length=391

 Score =   297 bits (761),  Expect = 4e-96, Method: Compositional matrix adjust.
 Identities = 155/201 (77%), Positives = 167/201 (83%), Gaps = 14/201 (7%)
 Frame = +3

Query  48   MAT-LLSRSLITAGKQLFRSYSSL---TP-PRNFLAFSSFRLRPLVSVSPAVCQLYPAAY  212
            MAT  L+RSL+T    L RSY++L   TP P    +FS  R RPL++V+  +    PA  
Sbjct  1    MATRYLTRSLLTT---LSRSYTTLSLSTPLPS---SFSLLRFRPLIAVAANLRTFTPATL  54

Query  213  TAV---RGLATRQTSSSLNDPNPNWSNRPPKETILLDGCDFEHWLIVMEKPEGDPTRDEI  383
            TA    RG ATRQTSSSLNDPNPNWSNRPPKETILLDGCDFEHWL+VMEKPEGDPTRDEI
Sbjct  55   TAATSFRGFATRQTSSSLNDPNPNWSNRPPKETILLDGCDFEHWLVVMEKPEGDPTRDEI  114

Query  384  IDSYIKTLAQVVGSEEEARMKIYSVSTRHYYAFGALVSEELSYKLKELKGVRWVLPDSYL  563
            IDSYIKTLA +VGSEEEARMKIYSVSTRHY+AFGALVSEELSYKLKEL  VRWVLPDSYL
Sbjct  115  IDSYIKTLATIVGSEEEARMKIYSVSTRHYFAFGALVSEELSYKLKELPKVRWVLPDSYL  174

Query  564  DVKNKDYGGEPFINGQAVPYD  626
            DVKNKDYGGEPFINGQAVPYD
Sbjct  175  DVKNKDYGGEPFINGQAVPYD  195



>ref|XP_004251891.1| PREDICTED: uncharacterized protein At3g15000, mitochondrial [Solanum 
lycopersicum]
Length=429

 Score =   292 bits (748),  Expect = 8e-94, Method: Compositional matrix adjust.
 Identities = 145/190 (76%), Positives = 158/190 (83%), Gaps = 3/190 (2%)
 Frame = +3

Query  57   LLSRSLITAGKQLFRSYSSLTPPRNFLAFSSFRLRPLVSVSPAVCQLYPAAYTAVRGLAT  236
            + SRSL+ A K+   S+S  T P     +S   LRPL +V+  +  + PA     RG AT
Sbjct  1    MASRSLLNAFKRSCNSFSLSTTPS---TYSLHLLRPLHAVAANLRNVSPAPTPFSRGFAT  57

Query  237  RQTSSSLNDPNPNWSNRPPKETILLDGCDFEHWLIVMEKPEGDPTRDEIIDSYIKTLAQV  416
            RQTSSSLNDPNPNWSNRPPKETILLDGCDFEHWL+VMEKPEGDPTRDEIIDSYIKTLA +
Sbjct  58   RQTSSSLNDPNPNWSNRPPKETILLDGCDFEHWLVVMEKPEGDPTRDEIIDSYIKTLATI  117

Query  417  VGSEEEARMKIYSVSTRHYYAFGALVSEELSYKLKELKGVRWVLPDSYLDVKNKDYGGEP  596
            VGSEEEARMKIYSVSTRHY+AFGALVSEELSYKLKEL  VRWVLPDSYLDV+NKDYGGEP
Sbjct  118  VGSEEEARMKIYSVSTRHYFAFGALVSEELSYKLKELPKVRWVLPDSYLDVRNKDYGGEP  177

Query  597  FINGQAVPYD  626
            FINGQAVPYD
Sbjct  178  FINGQAVPYD  187



>ref|XP_011098243.1| PREDICTED: uncharacterized protein At3g15000, mitochondrial [Sesamum 
indicum]
Length=440

 Score =   291 bits (744),  Expect = 5e-93, Method: Compositional matrix adjust.
 Identities = 156/200 (78%), Positives = 163/200 (82%), Gaps = 9/200 (5%)
 Frame = +3

Query  48   MAT-LLSRSLITAGKQLFRSY-SSLTPPRNFLAFSS---FRLRPLVSVSPA--VCQLYPA  206
            MAT  L+RSL T  KQ   S  S  T     L  SS   FRLRPLV+ + A    +L PA
Sbjct  1    MATRYLARSLFTTTKQSLASVLSHSTASSAVLPNSSSFLFRLRPLVAAASASYFRRLAPA  60

Query  207  AYTAVRGLATRQTSSSLNDPNPNWSNRPPKETILLDGCDFEHWLIVMEKPEGDPTRDEII  386
              T  RG ATRQT+SSL+DPNPNWSNRPPKETILLDGCDFEHWL+VMEKPEGDPTRDEII
Sbjct  61   LST--RGFATRQTTSSLSDPNPNWSNRPPKETILLDGCDFEHWLVVMEKPEGDPTRDEII  118

Query  387  DSYIKTLAQVVGSEEEARMKIYSVSTRHYYAFGALVSEELSYKLKELKGVRWVLPDSYLD  566
            DSYIKTLA VVGSEEEARMKIYSVSTRHYYAFGALVSEELSYKLKEL  VRWVLPDSYLD
Sbjct  119  DSYIKTLAMVVGSEEEARMKIYSVSTRHYYAFGALVSEELSYKLKELPRVRWVLPDSYLD  178

Query  567  VKNKDYGGEPFINGQAVPYD  626
            VKNKDYGGEPFINGQAVPYD
Sbjct  179  VKNKDYGGEPFINGQAVPYD  198



>ref|XP_006358944.1| PREDICTED: uncharacterized protein At3g15000, mitochondrial-like 
isoform X2 [Solanum tuberosum]
Length=378

 Score =   285 bits (728),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 145/190 (76%), Positives = 158/190 (83%), Gaps = 3/190 (2%)
 Frame = +3

Query  57   LLSRSLITAGKQLFRSYSSLTPPRNFLAFSSFRLRPLVSVSPAVCQLYPAAYTAVRGLAT  236
            + SRSL+ A K   RS +SL+        S  RLR L +V+  +  + PA  T  RG AT
Sbjct  1    MASRSLLNAFK---RSCNSLSLSTTPSTSSLHRLRSLSAVAANLRNVSPAPTTFSRGFAT  57

Query  237  RQTSSSLNDPNPNWSNRPPKETILLDGCDFEHWLIVMEKPEGDPTRDEIIDSYIKTLAQV  416
            RQTSSSLNDPNPNWSNRPPKETILLDGCDFEHWL+VMEKPEGDPTRDEIIDSYIKTLA +
Sbjct  58   RQTSSSLNDPNPNWSNRPPKETILLDGCDFEHWLVVMEKPEGDPTRDEIIDSYIKTLATI  117

Query  417  VGSEEEARMKIYSVSTRHYYAFGALVSEELSYKLKELKGVRWVLPDSYLDVKNKDYGGEP  596
            VGSEE+ARMKIYSVSTRHY+AFGALVSEELSYKLKEL  VRWVLPDSYLDV+NKDYGGEP
Sbjct  118  VGSEEDARMKIYSVSTRHYFAFGALVSEELSYKLKELPKVRWVLPDSYLDVRNKDYGGEP  177

Query  597  FINGQAVPYD  626
            FINGQAVPYD
Sbjct  178  FINGQAVPYD  187



>ref|XP_006358943.1| PREDICTED: uncharacterized protein At3g15000, mitochondrial-like 
isoform X1 [Solanum tuberosum]
Length=403

 Score =   285 bits (728),  Expect = 3e-91, Method: Compositional matrix adjust.
 Identities = 145/190 (76%), Positives = 158/190 (83%), Gaps = 3/190 (2%)
 Frame = +3

Query  57   LLSRSLITAGKQLFRSYSSLTPPRNFLAFSSFRLRPLVSVSPAVCQLYPAAYTAVRGLAT  236
            + SRSL+ A K   RS +SL+        S  RLR L +V+  +  + PA  T  RG AT
Sbjct  1    MASRSLLNAFK---RSCNSLSLSTTPSTSSLHRLRSLSAVAANLRNVSPAPTTFSRGFAT  57

Query  237  RQTSSSLNDPNPNWSNRPPKETILLDGCDFEHWLIVMEKPEGDPTRDEIIDSYIKTLAQV  416
            RQTSSSLNDPNPNWSNRPPKETILLDGCDFEHWL+VMEKPEGDPTRDEIIDSYIKTLA +
Sbjct  58   RQTSSSLNDPNPNWSNRPPKETILLDGCDFEHWLVVMEKPEGDPTRDEIIDSYIKTLATI  117

Query  417  VGSEEEARMKIYSVSTRHYYAFGALVSEELSYKLKELKGVRWVLPDSYLDVKNKDYGGEP  596
            VGSEE+ARMKIYSVSTRHY+AFGALVSEELSYKLKEL  VRWVLPDSYLDV+NKDYGGEP
Sbjct  118  VGSEEDARMKIYSVSTRHYFAFGALVSEELSYKLKELPKVRWVLPDSYLDVRNKDYGGEP  177

Query  597  FINGQAVPYD  626
            FINGQAVPYD
Sbjct  178  FINGQAVPYD  187



>ref|XP_010060675.1| PREDICTED: uncharacterized protein At3g15000, mitochondrial-like 
isoform X1 [Eucalyptus grandis]
 ref|XP_010060676.1| PREDICTED: uncharacterized protein At3g15000, mitochondrial-like 
isoform X1 [Eucalyptus grandis]
 ref|XP_010060677.1| PREDICTED: uncharacterized protein At3g15000, mitochondrial-like 
isoform X2 [Eucalyptus grandis]
 gb|KCW67479.1| hypothetical protein EUGRSUZ_F01219 [Eucalyptus grandis]
Length=434

 Score =   284 bits (726),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 134/159 (84%), Positives = 142/159 (89%), Gaps = 0/159 (0%)
 Frame = +3

Query  150  FRLRPLVSVSPAVCQLYPAAYTAVRGLATRQTSSSLNDPNPNWSNRPPKETILLDGCDFE  329
             RLRPL + S    +   AA  ++R  ATR TSSSLNDPNPNWSNRPPKETILLDGCDFE
Sbjct  47   HRLRPLSAASAEFGRRAAAAAPSIRSFATRTTSSSLNDPNPNWSNRPPKETILLDGCDFE  106

Query  330  HWLIVMEKPEGDPTRDEIIDSYIKTLAQVVGSEEEARMKIYSVSTRHYYAFGALVSEELS  509
            HWL+VMEKPEGDPTRD+IIDSYIKTLAQ+VGSEEEARMKIYSVSTRHY+AFGALVSEELS
Sbjct  107  HWLVVMEKPEGDPTRDDIIDSYIKTLAQIVGSEEEARMKIYSVSTRHYFAFGALVSEELS  166

Query  510  YKLKELKGVRWVLPDSYLDVKNKDYGGEPFINGQAVPYD  626
            YKLKEL  VRWVLPDSYLDVKNKDYGGEPFINGQAVPYD
Sbjct  167  YKLKELPRVRWVLPDSYLDVKNKDYGGEPFINGQAVPYD  205



>ref|XP_009593525.1| PREDICTED: uncharacterized protein At3g15000, mitochondrial-like 
[Nicotiana tomentosiformis]
Length=381

 Score =   281 bits (719),  Expect = 5e-90, Method: Compositional matrix adjust.
 Identities = 152/195 (78%), Positives = 166/195 (85%), Gaps = 2/195 (1%)
 Frame = +3

Query  48   MAT-LLSRSLITAGKQLFRSYSSLTPPRNFLAFSSFRLRPLVSVSPAVCQ-LYPAAYTAV  221
            MAT  L+RSL TA  + + S S  TPP +  +FS  RLRPL++V+    + + PA  T+ 
Sbjct  1    MATRYLTRSLFTALSRSYTSLSLSTPPPSLSSFSLLRLRPLIAVTAVNLRSVSPAVATSF  60

Query  222  RGLATRQTSSSLNDPNPNWSNRPPKETILLDGCDFEHWLIVMEKPEGDPTRDEIIDSYIK  401
            RG ATRQTSSSLNDPNPNWSNRPPKETILLDGCDFEHWL+VMEKPEGDPTRDEIIDSYIK
Sbjct  61   RGFATRQTSSSLNDPNPNWSNRPPKETILLDGCDFEHWLVVMEKPEGDPTRDEIIDSYIK  120

Query  402  TLAQVVGSEEEARMKIYSVSTRHYYAFGALVSEELSYKLKELKGVRWVLPDSYLDVKNKD  581
            TLA+VVGSEEEARMKIYSVSTRHYYAFGALVSEEL YKLKEL  V WVLPDS+LDVKNKD
Sbjct  121  TLAKVVGSEEEARMKIYSVSTRHYYAFGALVSEELHYKLKELPRVSWVLPDSFLDVKNKD  180

Query  582  YGGEPFINGQAVPYD  626
            YGGEPFINGQAVPYD
Sbjct  181  YGGEPFINGQAVPYD  195



>ref|XP_007149407.1| hypothetical protein PHAVU_005G067700g [Phaseolus vulgaris]
 gb|ESW21401.1| hypothetical protein PHAVU_005G067700g [Phaseolus vulgaris]
Length=405

 Score =   281 bits (719),  Expect = 9e-90, Method: Compositional matrix adjust.
 Identities = 136/177 (77%), Positives = 153/177 (86%), Gaps = 0/177 (0%)
 Frame = +3

Query  96   FRSYSSLTPPRNFLAFSSFRLRPLVSVSPAVCQLYPAAYTAVRGLATRQTSSSLNDPNPN  275
            F S S   PP + L+  SF  R  V+ +P++C+L      ++R L+TR TSSSLNDPNPN
Sbjct  19   FLSRSLTFPPPSSLSALSFLRRISVAANPSLCRLLLPTTPSLRALSTRATSSSLNDPNPN  78

Query  276  WSNRPPKETILLDGCDFEHWLIVMEKPEGDPTRDEIIDSYIKTLAQVVGSEEEARMKIYS  455
            WSNRPPKETILLDGCDFEHWL+VMEKPEGDPTRDEIIDSYIKTL++V+GSEEEARMKIYS
Sbjct  79   WSNRPPKETILLDGCDFEHWLVVMEKPEGDPTRDEIIDSYIKTLSKVIGSEEEARMKIYS  138

Query  456  VSTRHYYAFGALVSEELSYKLKELKGVRWVLPDSYLDVKNKDYGGEPFINGQAVPYD  626
            VSTRHY+AFGALVSEELSYK+KEL GVRWVLPDSYL+VK KDYGGEPFINGQAVPYD
Sbjct  139  VSTRHYFAFGALVSEELSYKIKELPGVRWVLPDSYLNVKEKDYGGEPFINGQAVPYD  195



>gb|EPS74428.1| hypothetical protein M569_00328, partial [Genlisea aurea]
Length=363

 Score =   280 bits (715),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 136/162 (84%), Positives = 143/162 (88%), Gaps = 6/162 (4%)
 Frame = +3

Query  150  FRLRPLVSVSPAVCQLY---PAAYTAVRGLATRQTSSSLNDPNPNWSNRPPKETILLDGC  320
            FR+RPL + S   C  Y       ++ RG ATRQTSSSLNDPNPNWSNRPPKETILLDGC
Sbjct  2    FRIRPLAAAS---CGSYFRRTIPTSSTRGFATRQTSSSLNDPNPNWSNRPPKETILLDGC  58

Query  321  DFEHWLIVMEKPEGDPTRDEIIDSYIKTLAQVVGSEEEARMKIYSVSTRHYYAFGALVSE  500
            DFEHWL+VMEKPEGDPTRDEIIDSYIKTLA VVGSEEEARMKIYSVSTRHY+AFGALVSE
Sbjct  59   DFEHWLVVMEKPEGDPTRDEIIDSYIKTLAMVVGSEEEARMKIYSVSTRHYFAFGALVSE  118

Query  501  ELSYKLKELKGVRWVLPDSYLDVKNKDYGGEPFINGQAVPYD  626
            +LSYKLKEL  VRWVLPDSYLDVKNKDYGGEPFINGQAVPYD
Sbjct  119  DLSYKLKELPRVRWVLPDSYLDVKNKDYGGEPFINGQAVPYD  160



>ref|XP_009801659.1| PREDICTED: uncharacterized protein At3g15000, mitochondrial [Nicotiana 
sylvestris]
Length=410

 Score =   280 bits (717),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 153/195 (78%), Positives = 164/195 (84%), Gaps = 5/195 (3%)
 Frame = +3

Query  48   MAT-LLSRSLITAGKQLFRSYSSLTPPRNFLAFSSFRLRPLVSVSPAVCQLYPAAYT-AV  221
            MAT  L+RSL+TA     RSY+SL P     + S  RLRPL++V+  +    P     AV
Sbjct  1    MATRYLTRSLLTA---FTRSYTSLAPSSTLSSSSLLRLRPLIAVAANLKNASPPPTPFAV  57

Query  222  RGLATRQTSSSLNDPNPNWSNRPPKETILLDGCDFEHWLIVMEKPEGDPTRDEIIDSYIK  401
            RG ATRQTSSSLNDPNPNWSNRPPKETILLDGCDFEHWL+VMEKPEGDPTRDEIIDSYIK
Sbjct  58   RGFATRQTSSSLNDPNPNWSNRPPKETILLDGCDFEHWLVVMEKPEGDPTRDEIIDSYIK  117

Query  402  TLAQVVGSEEEARMKIYSVSTRHYYAFGALVSEELSYKLKELKGVRWVLPDSYLDVKNKD  581
            TLA +VGSEEEARMKIYSVSTRHYYAFGALVSEELSYKLKEL  VRWVLPDSYLDV+NKD
Sbjct  118  TLANIVGSEEEARMKIYSVSTRHYYAFGALVSEELSYKLKELPRVRWVLPDSYLDVRNKD  177

Query  582  YGGEPFINGQAVPYD  626
            YGGEPFINGQAVPYD
Sbjct  178  YGGEPFINGQAVPYD  192



>ref|XP_010279101.1| PREDICTED: uncharacterized protein At3g15000, mitochondrial-like 
[Nelumbo nucifera]
Length=444

 Score =   280 bits (717),  Expect = 6e-89, Method: Compositional matrix adjust.
 Identities = 142/193 (74%), Positives = 164/193 (85%), Gaps = 5/193 (3%)
 Frame = +3

Query  54   TLLSRSLITAGKQLFRSYSSLTPPRNFLAFSS--FRLRPLVSVSPAVCQLYPAAYTAVRG  227
            TL+S+  +T+      + +S++ PR  L  SS   RLRPLV+++   C+ +P++  ++R 
Sbjct  9    TLISKPSLTSIVSRAFTSASISGPRITLIPSSPLLRLRPLVALT-EFCR-FPSS-VSLRC  65

Query  228  LATRQTSSSLNDPNPNWSNRPPKETILLDGCDFEHWLIVMEKPEGDPTRDEIIDSYIKTL  407
             ATRQ++SSLNDPNPNWSNRPPKETILLDGCDFEHWL+VMEKPEG+PTRDEIIDSYIKTL
Sbjct  66   FATRQSASSLNDPNPNWSNRPPKETILLDGCDFEHWLVVMEKPEGEPTRDEIIDSYIKTL  125

Query  408  AQVVGSEEEARMKIYSVSTRHYYAFGALVSEELSYKLKELKGVRWVLPDSYLDVKNKDYG  587
            A VVGSE EARMKIYSVSTRHYYAFGALVSEELSYK+KEL  VRWVLPDSYLDVKNKDYG
Sbjct  126  AMVVGSEGEARMKIYSVSTRHYYAFGALVSEELSYKIKELPRVRWVLPDSYLDVKNKDYG  185

Query  588  GEPFINGQAVPYD  626
            GEPFINGQAVPYD
Sbjct  186  GEPFINGQAVPYD  198



>ref|XP_010277765.1| PREDICTED: uncharacterized protein At3g15000, mitochondrial-like 
[Nelumbo nucifera]
Length=384

 Score =   275 bits (703),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 141/193 (73%), Positives = 160/193 (83%), Gaps = 5/193 (3%)
 Frame = +3

Query  54   TLLSRSLITAGKQLFRSYSSLTPPRNFLAFSS--FRLRPLVSVSPAVCQLYPAAYTAVRG  227
            TL+++ ++ +      + +S++ PR  L  SS   RLRPLV++  A  + +P+    +R 
Sbjct  11   TLINKPILASIFSRTFASTSISVPRLTLISSSPLLRLRPLVAL--AEFRRFPSP-VGLRC  67

Query  228  LATRQTSSSLNDPNPNWSNRPPKETILLDGCDFEHWLIVMEKPEGDPTRDEIIDSYIKTL  407
             ATR TSSSLNDPNPNWSNRPPKETILLDGCDFEHWL+VMEKPEG+PTRDEIIDSYIKTL
Sbjct  68   FATRPTSSSLNDPNPNWSNRPPKETILLDGCDFEHWLVVMEKPEGEPTRDEIIDSYIKTL  127

Query  408  AQVVGSEEEARMKIYSVSTRHYYAFGALVSEELSYKLKELKGVRWVLPDSYLDVKNKDYG  587
            A VVGSEE ARMKIYSVSTRHYYAFGALVSEELSYK+KEL  VRWVLPDSYLDVKNKDYG
Sbjct  128  AMVVGSEEGARMKIYSVSTRHYYAFGALVSEELSYKIKELPRVRWVLPDSYLDVKNKDYG  187

Query  588  GEPFINGQAVPYD  626
            GEPFINGQAVPYD
Sbjct  188  GEPFINGQAVPYD  200



>gb|KHN36874.1| Hypothetical protein glysoja_001605 [Glycine soja]
Length=417

 Score =   276 bits (705),  Expect = 2e-87, Method: Compositional matrix adjust.
 Identities = 137/193 (71%), Positives = 157/193 (81%), Gaps = 12/193 (6%)
 Frame = +3

Query  48   MATLLSRSLITAGKQLFRSYSSLTPPRNFLAFSSFRLRPLVSVSPAVCQLYPAAYTAVRG  227
            +A  LSRSL TA           +PP   L+  SF  R  V+ +P++ + +     ++R 
Sbjct  14   LAPFLSRSLSTA----------PSPPS--LSALSFLRRISVAANPSLHRAFLPNSPSLRA  61

Query  228  LATRQTSSSLNDPNPNWSNRPPKETILLDGCDFEHWLIVMEKPEGDPTRDEIIDSYIKTL  407
            L+TR T+SSLNDPNPNWSNRPPKETILLDGCDFEHWL+VMEKPEGDPTRD+IIDSYIKTL
Sbjct  62   LSTRATTSSLNDPNPNWSNRPPKETILLDGCDFEHWLVVMEKPEGDPTRDDIIDSYIKTL  121

Query  408  AQVVGSEEEARMKIYSVSTRHYYAFGALVSEELSYKLKELKGVRWVLPDSYLDVKNKDYG  587
            A+V+GSEEEARMKIYSVSTRHY+AFGALVSEELSYK+KEL GVRWVLPDSYL+VK KDYG
Sbjct  122  AKVIGSEEEARMKIYSVSTRHYFAFGALVSEELSYKIKELPGVRWVLPDSYLNVKEKDYG  181

Query  588  GEPFINGQAVPYD  626
            GEPFINGQA PYD
Sbjct  182  GEPFINGQAAPYD  194



>ref|XP_003540481.1| PREDICTED: uncharacterized protein At3g15000, mitochondrial-like 
[Glycine max]
Length=363

 Score =   273 bits (699),  Expect = 3e-87, Method: Compositional matrix adjust.
 Identities = 141/197 (72%), Positives = 161/197 (82%), Gaps = 5/197 (3%)
 Frame = +3

Query  48   MAT-LLSR---SLITAGKQLFRSYSSLTPPRNFLAFSSFRLRPLVSVSPAVCQLYPAAYT  215
            MAT +LSR     +T    LFRS ++  P R  L   SF  R  V+ +P++ ++      
Sbjct  1    MATQILSRIFPKTLTLAPFLFRSLTT-APSRPSLPALSFLRRISVAANPSLRRVLLPNAP  59

Query  216  AVRGLATRQTSSSLNDPNPNWSNRPPKETILLDGCDFEHWLIVMEKPEGDPTRDEIIDSY  395
            ++R L+TR T+SSLNDPNPNWSNRPPKETILLDGCDFEHWL+VMEKPEGDPTRD+IIDSY
Sbjct  60   SLRALSTRATTSSLNDPNPNWSNRPPKETILLDGCDFEHWLVVMEKPEGDPTRDDIIDSY  119

Query  396  IKTLAQVVGSEEEARMKIYSVSTRHYYAFGALVSEELSYKLKELKGVRWVLPDSYLDVKN  575
            IKTLA+V+GSEEEARMKIYSVSTRHY+AFGALVSEELS KLKEL GVRWVLPDSYL+VK 
Sbjct  120  IKTLAKVIGSEEEARMKIYSVSTRHYFAFGALVSEELSIKLKELPGVRWVLPDSYLNVKE  179

Query  576  KDYGGEPFINGQAVPYD  626
            KDYGGEPFINGQAVPYD
Sbjct  180  KDYGGEPFINGQAVPYD  196



>ref|XP_002285388.1| PREDICTED: uncharacterized protein At3g15000, mitochondrial [Vitis 
vinifera]
Length=421

 Score =   275 bits (702),  Expect = 6e-87, Method: Compositional matrix adjust.
 Identities = 143/197 (73%), Positives = 160/197 (81%), Gaps = 5/197 (3%)
 Frame = +3

Query  48   MATL---LSRSLITAGKQLFRSYSSLT-PPRNFLAFSSFRLRPLVSVSPAVCQLYPAAYT  215
            MATL   L+RSL      + RS  SL+    +   FS  RLRPL + + +V +  P + T
Sbjct  1    MATLTRCLARSLPAFSSLISRSTPSLSLSTASCSTFSLLRLRPLSAAAVSVLRHLPQS-T  59

Query  216  AVRGLATRQTSSSLNDPNPNWSNRPPKETILLDGCDFEHWLIVMEKPEGDPTRDEIIDSY  395
            + R  +TRQTSSSLNDPNPNWSNRPPKETILLDGCDFEHWL+VMEKPEGDPTRDEIIDSY
Sbjct  60   SARSFSTRQTSSSLNDPNPNWSNRPPKETILLDGCDFEHWLVVMEKPEGDPTRDEIIDSY  119

Query  396  IKTLAQVVGSEEEARMKIYSVSTRHYYAFGALVSEELSYKLKELKGVRWVLPDSYLDVKN  575
            IKTLA +VGSEEEARMKIYSVSTR Y+AFGALVSEELS K+KEL  VRWVLPDSYLDVKN
Sbjct  120  IKTLAMIVGSEEEARMKIYSVSTRCYFAFGALVSEELSLKIKELPRVRWVLPDSYLDVKN  179

Query  576  KDYGGEPFINGQAVPYD  626
            KDYGGEPFI+G+AVPYD
Sbjct  180  KDYGGEPFIDGKAVPYD  196



>ref|XP_003543219.1| PREDICTED: uncharacterized protein At3g15000, mitochondrial-like 
[Glycine max]
Length=401

 Score =   274 bits (700),  Expect = 6e-87, Method: Compositional matrix adjust.
 Identities = 137/193 (71%), Positives = 156/193 (81%), Gaps = 12/193 (6%)
 Frame = +3

Query  48   MATLLSRSLITAGKQLFRSYSSLTPPRNFLAFSSFRLRPLVSVSPAVCQLYPAAYTAVRG  227
            +A  LSRSL TA           +PP   L+  SF  R  V+ +P++ +       ++R 
Sbjct  14   LAPFLSRSLSTA----------PSPPS--LSALSFLRRISVAANPSLHRALLPNSPSLRA  61

Query  228  LATRQTSSSLNDPNPNWSNRPPKETILLDGCDFEHWLIVMEKPEGDPTRDEIIDSYIKTL  407
            L+TR T+SSLNDPNPNWSNRPPKETILLDGCDFEHWL+VMEKPEGDPTRD+IIDSYIKTL
Sbjct  62   LSTRATTSSLNDPNPNWSNRPPKETILLDGCDFEHWLVVMEKPEGDPTRDDIIDSYIKTL  121

Query  408  AQVVGSEEEARMKIYSVSTRHYYAFGALVSEELSYKLKELKGVRWVLPDSYLDVKNKDYG  587
            A+V+GSEEEARMKIYSVSTRHY+AFGALVSEELSYK+KEL GVRWVLPDSYL+VK KDYG
Sbjct  122  AKVIGSEEEARMKIYSVSTRHYFAFGALVSEELSYKIKELPGVRWVLPDSYLNVKEKDYG  181

Query  588  GEPFINGQAVPYD  626
            GEPFINGQA PYD
Sbjct  182  GEPFINGQAAPYD  194



>gb|KDP36270.1| hypothetical protein JCGZ_09835 [Jatropha curcas]
Length=370

 Score =   273 bits (697),  Expect = 8e-87, Method: Compositional matrix adjust.
 Identities = 140/195 (72%), Positives = 157/195 (81%), Gaps = 4/195 (2%)
 Frame = +3

Query  48   MATLLSRSLITAGKQLFRSYSSLTPPRNF-LAFSSFR-LRPLVSVSPAVCQLYPAAYTAV  221
            MA+  +R+L T    L R +SSL+ P +   + S  R LRP+ + +         A+TA 
Sbjct  1    MASHPARTLFTTTNLLRRCFSSLSMPSHASRSLSVLRSLRPIYAAA-NFASFSSGAFTA-  58

Query  222  RGLATRQTSSSLNDPNPNWSNRPPKETILLDGCDFEHWLIVMEKPEGDPTRDEIIDSYIK  401
            R  +TR T+ SLNDP+PNWSNRPPKETILLDGCDFEHWL+VMEKPEGDPTRDEIID YIK
Sbjct  59   RSFSTRTTTLSLNDPSPNWSNRPPKETILLDGCDFEHWLVVMEKPEGDPTRDEIIDYYIK  118

Query  402  TLAQVVGSEEEARMKIYSVSTRHYYAFGALVSEELSYKLKELKGVRWVLPDSYLDVKNKD  581
            TLAQ+VGSEEEARMKIYSVSTR YYAFGALVSEELSYK+KEL  VRWVLPDSYLDVKNKD
Sbjct  119  TLAQIVGSEEEARMKIYSVSTRCYYAFGALVSEELSYKIKELPKVRWVLPDSYLDVKNKD  178

Query  582  YGGEPFINGQAVPYD  626
            YGGEPFINGQAVPYD
Sbjct  179  YGGEPFINGQAVPYD  193



>gb|EYU26338.1| hypothetical protein MIMGU_mgv1a004972mg [Erythranthe guttata]
Length=502

 Score =   276 bits (705),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 129/159 (81%), Positives = 144/159 (91%), Gaps = 1/159 (1%)
 Frame = +3

Query  150  FRLRPLVSVSPAVCQLYPAAYTAVRGLATRQTSSSLNDPNPNWSNRPPKETILLDGCDFE  329
            FR+RPLV+V+    +  PA  ++ RG ATRQTSSSLNDPNPNWSNRPPKETILLDGCDFE
Sbjct  120  FRVRPLVAVASIYGRAAPA-LSSTRGFATRQTSSSLNDPNPNWSNRPPKETILLDGCDFE  178

Query  330  HWLIVMEKPEGDPTRDEIIDSYIKTLAQVVGSEEEARMKIYSVSTRHYYAFGALVSEELS  509
            HWL+V+EKPEG+P RDEII +YIKTLA VVGSEEEARMKIYSVST+HY+AFGALVSEE+S
Sbjct  179  HWLVVLEKPEGEPMRDEIIQTYIKTLATVVGSEEEARMKIYSVSTKHYFAFGALVSEEVS  238

Query  510  YKLKELKGVRWVLPDSYLDVKNKDYGGEPFINGQAVPYD  626
             K+K+L GVRWVLPDSYLDVKNKDYGGEPFINGQAVPYD
Sbjct  239  NKIKDLPGVRWVLPDSYLDVKNKDYGGEPFINGQAVPYD  277



>ref|XP_004489047.1| PREDICTED: uncharacterized protein At3g15000, mitochondrial-like 
[Cicer arietinum]
Length=409

 Score =   270 bits (690),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 147/207 (71%), Positives = 161/207 (78%), Gaps = 19/207 (9%)
 Frame = +3

Query  15   FKRV-P*TLVAGMATLLSRSLITAGKQLFRSYSSLTPPRNFLAFSSFRLRPLVSVS--PA  185
            F RV P TL   + +  SRSL TA      S S+++    FL     RLRPL S +    
Sbjct  6    FSRVFPKTLT--LTSYFSRSLTTA---TLPSSSAIS----FLR----RLRPLSSAAFNSR  52

Query  186  VCQLYPAAYTAVRGLATRQTSSSLNDPNPNWSNRPPKETILLDGCDFEHWLIVMEKPEGD  365
               L P ++   R L+TR T+SSLNDPNPNWSNRPPKETILLDGCDFEHWL+VMEKPEGD
Sbjct  53   SVLLLPNSF---RSLSTRATTSSLNDPNPNWSNRPPKETILLDGCDFEHWLVVMEKPEGD  109

Query  366  PTRDEIIDSYIKTLAQVVGSEEEARMKIYSVSTRHYYAFGALVSEELSYKLKELKGVRWV  545
            PTRDEIID YIKTLA+VVGSEEEARMKIYSVSTRHY+AFGALVSEELSYKLKEL  VRWV
Sbjct  110  PTRDEIIDGYIKTLAEVVGSEEEARMKIYSVSTRHYFAFGALVSEELSYKLKELPKVRWV  169

Query  546  LPDSYLDVKNKDYGGEPFINGQAVPYD  626
            LPDSYL+VK KDYGGEPFINGQAVPYD
Sbjct  170  LPDSYLNVKEKDYGGEPFINGQAVPYD  196



>emb|CAN66606.1| hypothetical protein VITISV_017553 [Vitis vinifera]
Length=428

 Score =   267 bits (683),  Expect = 4e-84, Method: Compositional matrix adjust.
 Identities = 129/162 (80%), Positives = 142/162 (88%), Gaps = 1/162 (1%)
 Frame = +3

Query  141  FSSFRLRPLVSVSPAVCQLYPAAYTAVRGLATRQTSSSLNDPNPNWSNRPPKETILLDGC  320
            FS  RLRPL + + +V +  P + T+ R  +TRQTSSSLNDPNPNWSNRPPKETILLDGC
Sbjct  36   FSLLRLRPLSAAAVSVLRHLPQS-TSARSFSTRQTSSSLNDPNPNWSNRPPKETILLDGC  94

Query  321  DFEHWLIVMEKPEGDPTRDEIIDSYIKTLAQVVGSEEEARMKIYSVSTRHYYAFGALVSE  500
            DFEHWL+VMEKPEGDPTRDEIIDSYIKTLA +VGSEE ARMKIYSVSTR Y+AFGALVSE
Sbjct  95   DFEHWLVVMEKPEGDPTRDEIIDSYIKTLAMIVGSEEXARMKIYSVSTRCYFAFGALVSE  154

Query  501  ELSYKLKELKGVRWVLPDSYLDVKNKDYGGEPFINGQAVPYD  626
             LS K+KEL  VRWVLPDSYLDVKNKDYGGEPFI+G+AVPYD
Sbjct  155  XLSLKIKELPRVRWVLPDSYLDVKNKDYGGEPFIDGKAVPYD  196



>ref|XP_010535050.1| PREDICTED: uncharacterized protein At3g15000, mitochondrial [Tarenaya 
hassleriana]
Length=381

 Score =   265 bits (678),  Expect = 7e-84, Method: Compositional matrix adjust.
 Identities = 143/201 (71%), Positives = 156/201 (78%), Gaps = 5/201 (2%)
 Frame = +3

Query  33   TLVAGMATLLSRSLITAGKQLFRSYSSL--TPPRNFLAFSSF-RLRPLVSVSPAVCQLYP  203
            TL     +  ++SL     + F S  SL  TP  +F A S   R RPL +   +V +   
Sbjct  5    TLSRSTLSQRAKSLSILFARSFSSSPSLAKTPVPSFAASSLLSRSRPLAAALSSVIRGVG  64

Query  204  AAYTAVRGLATRQTSSSLNDPNPNWSNRPPKETILLDGCDFEHWLIVMEKPEGDPTRDEI  383
             A T  RGL+TR TSSSLNDPNPNWSNRPPKETILLDGCDFEHWLIVMEKPEGDPTRDEI
Sbjct  65   VAST--RGLSTRATSSSLNDPNPNWSNRPPKETILLDGCDFEHWLIVMEKPEGDPTRDEI  122

Query  384  IDSYIKTLAQVVGSEEEARMKIYSVSTRHYYAFGALVSEELSYKLKELKGVRWVLPDSYL  563
            ID YIKTLAQ+VGSEEEARMKIYSVSTR YYAFGALV EELS K+KEL  VRWVLPDSYL
Sbjct  123  IDYYIKTLAQIVGSEEEARMKIYSVSTRCYYAFGALVPEELSLKIKELPKVRWVLPDSYL  182

Query  564  DVKNKDYGGEPFINGQAVPYD  626
            DVKNKDYGGEPFI+G+AVPYD
Sbjct  183  DVKNKDYGGEPFIDGKAVPYD  203



>ref|XP_008226518.1| PREDICTED: uncharacterized protein At3g15000, mitochondrial [Prunus 
mume]
Length=418

 Score =   265 bits (678),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 141/203 (69%), Positives = 157/203 (77%), Gaps = 9/203 (4%)
 Frame = +3

Query  18   KRVP*TLVAGMATLLSRSLITAGKQLFRSYSSLTPPRNFLAFSSFRLRPLVSVSPAVCQL  197
            + +P TL   M++ LSRSL TA    F S +     R+ L+    RLRPL     +  +L
Sbjct  8    RSLPKTLA--MSSFLSRSLSTATSAAFLSTAQS---RSSLSLF-HRLRPLAGFVASAGKL  61

Query  198  YPAAYTAVRGLATRQTSSSLNDPNPNWSNRPPKETILLDGCDFEHWLIVMEKPEGDPTRD  377
             PA+   VR  +T  T+SSL DPNPNWSNRPPKETILLDGCDFEHWL+VM+ PEGD TRD
Sbjct  62   SPAS---VRCFSTNSTTSSLRDPNPNWSNRPPKETILLDGCDFEHWLVVMDPPEGDITRD  118

Query  378  EIIDSYIKTLAQVVGSEEEARMKIYSVSTRHYYAFGALVSEELSYKLKELKGVRWVLPDS  557
            EIIDSYIKTLA VVGSEEEARMKIYSVSTR YYAFGALVSEE SYK+KEL  VRWVLPDS
Sbjct  119  EIIDSYIKTLAAVVGSEEEARMKIYSVSTRCYYAFGALVSEETSYKIKELPKVRWVLPDS  178

Query  558  YLDVKNKDYGGEPFINGQAVPYD  626
            YLDVKNKDYGGEPFING+AVPYD
Sbjct  179  YLDVKNKDYGGEPFINGEAVPYD  201



>emb|CDX82454.1| BnaA03g33670D [Brassica napus]
Length=389

 Score =   263 bits (673),  Expect = 5e-83, Method: Compositional matrix adjust.
 Identities = 129/193 (67%), Positives = 157/193 (81%), Gaps = 11/193 (6%)
 Frame = +3

Query  48   MATLLSRSLITAGKQLFRSYSSLTPPRNFLAFSSFRLRPLVSVSPAVCQLYPAAYTAVRG  227
            +++LL+RS  ++   L ++ +S        + S+ R RPLV+   +V +     + + +G
Sbjct  18   LSSLLTRSFASSPAPLAKTPAS--------SLSTLRSRPLVAALSSVAR---GGFVSFKG  66

Query  228  LATRQTSSSLNDPNPNWSNRPPKETILLDGCDFEHWLIVMEKPEGDPTRDEIIDSYIKTL  407
            L+T+ TSSSLNDPNPNWSNRPPKETILLDGCDFEHWL+V+E PEGD TRDEIID YIKTL
Sbjct  67   LSTQATSSSLNDPNPNWSNRPPKETILLDGCDFEHWLVVVEPPEGDLTRDEIIDGYIKTL  126

Query  408  AQVVGSEEEARMKIYSVSTRHYYAFGALVSEELSYKLKELKGVRWVLPDSYLDVKNKDYG  587
            AQ+VGSEEEARMKIYSVSTR Y+AFGALVSE+LS+KLKEL  VRWVLPDSYLDV+NKDYG
Sbjct  127  AQIVGSEEEARMKIYSVSTRCYFAFGALVSEDLSHKLKELPKVRWVLPDSYLDVRNKDYG  186

Query  588  GEPFINGQAVPYD  626
            GEPFI+G+AVPYD
Sbjct  187  GEPFIDGKAVPYD  199



>emb|CDX75801.1| BnaC03g38840D [Brassica napus]
Length=399

 Score =   263 bits (672),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 128/193 (66%), Positives = 156/193 (81%), Gaps = 11/193 (6%)
 Frame = +3

Query  48   MATLLSRSLITAGKQLFRSYSSLTPPRNFLAFSSFRLRPLVSVSPAVCQLYPAAYTAVRG  227
            +++L +RS  ++   L ++ +S        + S+ R RPLV+   +V +     + + +G
Sbjct  18   LSSLFARSFASSSAPLAKTPAS--------SLSALRSRPLVAALSSVAR---GGFVSFKG  66

Query  228  LATRQTSSSLNDPNPNWSNRPPKETILLDGCDFEHWLIVMEKPEGDPTRDEIIDSYIKTL  407
            L+T+ TSSSLNDPNPNWSNRPPKETILLDGCDFEHWL+V+E PEGD TRDEIID YIKTL
Sbjct  67   LSTQATSSSLNDPNPNWSNRPPKETILLDGCDFEHWLVVVEPPEGDLTRDEIIDGYIKTL  126

Query  408  AQVVGSEEEARMKIYSVSTRHYYAFGALVSEELSYKLKELKGVRWVLPDSYLDVKNKDYG  587
            AQ+VGSEEEARMKIYSVSTR Y+AFGALVSE+LS+KLKEL  VRWVLPDSYLDV+NKDYG
Sbjct  127  AQIVGSEEEARMKIYSVSTRCYFAFGALVSEDLSHKLKELPKVRWVLPDSYLDVRNKDYG  186

Query  588  GEPFINGQAVPYD  626
            GEPFI+G+AVPYD
Sbjct  187  GEPFIDGKAVPYD  199



>ref|XP_009340185.1| PREDICTED: uncharacterized protein At3g15000, mitochondrial-like 
[Pyrus x bretschneideri]
Length=397

 Score =   263 bits (671),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 141/193 (73%), Positives = 153/193 (79%), Gaps = 5/193 (3%)
 Frame = +3

Query  48   MATLLSRSLITAGKQLFRSYSSLTPPRNFLAFSSFRLRPLVSVSPAVCQLYPAAYTAVRG  227
            MA+ LSRSL TA      S S+    R+       RLRPL  V  +  +L PA    VR 
Sbjct  16   MASFLSRSLSTATSAA--SLSTAAQSRSSSLSLLHRLRPLAGVMASAGRLSPAV---VRC  70

Query  228  LATRQTSSSLNDPNPNWSNRPPKETILLDGCDFEHWLIVMEKPEGDPTRDEIIDSYIKTL  407
            L+TR T+SSL DPNPNWSNRPPKETILLDGCDFEHWL+VME P+GD TRDEII+SYIKTL
Sbjct  71   LSTRSTTSSLRDPNPNWSNRPPKETILLDGCDFEHWLVVMEPPQGDITRDEIINSYIKTL  130

Query  408  AQVVGSEEEARMKIYSVSTRHYYAFGALVSEELSYKLKELKGVRWVLPDSYLDVKNKDYG  587
            A VVGSEEEARMKIYSVSTR YYAFGALVSEE+S K+KEL GVRWVLPDSYLDVKNKDYG
Sbjct  131  ATVVGSEEEARMKIYSVSTRCYYAFGALVSEEVSLKIKELPGVRWVLPDSYLDVKNKDYG  190

Query  588  GEPFINGQAVPYD  626
            GEPFINGQAVPYD
Sbjct  191  GEPFINGQAVPYD  203



>ref|XP_010064468.1| PREDICTED: uncharacterized protein At3g15000, mitochondrial-like 
[Eucalyptus grandis]
Length=287

 Score =   259 bits (661),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 122/131 (93%), Positives = 126/131 (96%), Gaps = 0/131 (0%)
 Frame = +3

Query  234  TRQTSSSLNDPNPNWSNRPPKETILLDGCDFEHWLIVMEKPEGDPTRDEIIDSYIKTLAQ  413
            TR T+SSLNDPNPNWSNRPPKETILLDGCDFEHWL+VMEKPEGDPTRDEII+SYIKTLAQ
Sbjct  72   TRSTASSLNDPNPNWSNRPPKETILLDGCDFEHWLVVMEKPEGDPTRDEIINSYIKTLAQ  131

Query  414  VVGSEEEARMKIYSVSTRHYYAFGALVSEELSYKLKELKGVRWVLPDSYLDVKNKDYGGE  593
            VVGSE EARMKIYSVSTRHY+AFGALVSEELSYKLKEL  VRWVLPDSYLDVKNKDY GE
Sbjct  132  VVGSEGEARMKIYSVSTRHYFAFGALVSEELSYKLKELPRVRWVLPDSYLDVKNKDYWGE  191

Query  594  PFINGQAVPYD  626
            PFINGQAVPYD
Sbjct  192  PFINGQAVPYD  202



>ref|XP_007213851.1| hypothetical protein PRUPE_ppa006643mg [Prunus persica]
 gb|EMJ15050.1| hypothetical protein PRUPE_ppa006643mg [Prunus persica]
Length=401

 Score =   262 bits (670),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 140/203 (69%), Positives = 156/203 (77%), Gaps = 9/203 (4%)
 Frame = +3

Query  18   KRVP*TLVAGMATLLSRSLITAGKQLFRSYSSLTPPRNFLAFSSFRLRPLVSVSPAVCQL  197
            + +P TL   M++ LSRSL TA    F S +     R+ L+    RLRPL     +  +L
Sbjct  8    RSLPKTLA--MSSFLSRSLSTATSAAFLSTAQS---RSSLSLF-HRLRPLAGFVASAGKL  61

Query  198  YPAAYTAVRGLATRQTSSSLNDPNPNWSNRPPKETILLDGCDFEHWLIVMEKPEGDPTRD  377
             PA+   V   +T  T+SSL DPNPNWSNRPPKETILLDGCDFEHWL+VM+ PEGD TRD
Sbjct  62   SPAS---VGCFSTNSTTSSLRDPNPNWSNRPPKETILLDGCDFEHWLVVMDPPEGDITRD  118

Query  378  EIIDSYIKTLAQVVGSEEEARMKIYSVSTRHYYAFGALVSEELSYKLKELKGVRWVLPDS  557
            EIIDSYIKTLA VVGSEEEARMKIYSVSTR YYAFGALVSEE SYK+KEL  VRWVLPDS
Sbjct  119  EIIDSYIKTLAAVVGSEEEARMKIYSVSTRCYYAFGALVSEETSYKIKELPKVRWVLPDS  178

Query  558  YLDVKNKDYGGEPFINGQAVPYD  626
            YLDVKNKDYGGEPFING+AVPYD
Sbjct  179  YLDVKNKDYGGEPFINGEAVPYD  201



>ref|XP_004168263.1| PREDICTED: uncharacterized protein At3g15000, mitochondrial-like, 
partial [Cucumis sativus]
Length=278

 Score =   258 bits (660),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 126/158 (80%), Positives = 138/158 (87%), Gaps = 1/158 (1%)
 Frame = +3

Query  153  RLRPLVSVSPAVCQLYPAAYTAVRGLATRQTSSSLNDPNPNWSNRPPKETILLDGCDFEH  332
            RLRPL ++  A  + + AA  ++R  +TR TSSSLNDPNPNWSNRPPKETILLDGCDFEH
Sbjct  45   RLRPLAAILAADFRCHSAA-PSLRDFSTRATSSSLNDPNPNWSNRPPKETILLDGCDFEH  103

Query  333  WLIVMEKPEGDPTRDEIIDSYIKTLAQVVGSEEEARMKIYSVSTRHYYAFGALVSEELSY  512
            WL+VMEKP+   TRDEIIDSYIKTLA VVGSEEEARMKIYSVSTR Y+AFG LVSEELSY
Sbjct  104  WLVVMEKPDEQLTRDEIIDSYIKTLAMVVGSEEEARMKIYSVSTRCYFAFGCLVSEELSY  163

Query  513  KLKELKGVRWVLPDSYLDVKNKDYGGEPFINGQAVPYD  626
            K+KEL  VRWVLPDSYLDVKNKDYGGEPFI+GQAVPYD
Sbjct  164  KIKELPKVRWVLPDSYLDVKNKDYGGEPFIDGQAVPYD  201



>ref|NP_566496.1| RNA-editing factor interacting protein 1 [Arabidopsis thaliana]
 sp|Q9LKA5.1|UMP1_ARATH RecName: Full=Uncharacterized protein At3g15000, mitochondrial 
[Arabidopsis thaliana]
 gb|AAL16196.1|AF428427_1 AT3g15000/K15M2_14 [Arabidopsis thaliana]
 dbj|BAA97063.1| unnamed protein product [Arabidopsis thaliana]
 gb|AAU94431.1| At3g15000 [Arabidopsis thaliana]
 dbj|BAE98564.1| hypothetical protein [Arabidopsis thaliana]
 gb|AEE75601.1| cobalt ion binding protein [Arabidopsis thaliana]
Length=395

 Score =   261 bits (667),  Expect = 4e-82, Method: Compositional matrix adjust.
 Identities = 137/200 (69%), Positives = 161/200 (81%), Gaps = 10/200 (5%)
 Frame = +3

Query  48   MAT-LLSRSLITAGKQ----LF-RSYSSLTPPRNFLAFSSF-RLRPLVSVSPAVCQLYPA  206
            MAT  +SRS++    +    LF RS++S  P     A S   R RPLV+   A   ++  
Sbjct  1    MATHTISRSILCRPAKSLSFLFTRSFASSAPLAKSPASSLLSRSRPLVA---AFSSVFRG  57

Query  207  AYTAVRGLATRQTSSSLNDPNPNWSNRPPKETILLDGCDFEHWLIVMEKPEGDPTRDEII  386
               +V+GL+T+ TSSSLNDPNPNWSNRPPKETILLDGCDFEHWL+V+E P+G+PTRDEII
Sbjct  58   GLVSVKGLSTQATSSSLNDPNPNWSNRPPKETILLDGCDFEHWLVVVEPPQGEPTRDEII  117

Query  387  DSYIKTLAQVVGSEEEARMKIYSVSTRHYYAFGALVSEELSYKLKELKGVRWVLPDSYLD  566
            DSYIKTLAQ+VGSE+EARMKIYSVSTR YYAFGALVSE+LS+KLKEL  VRWVLPDSYLD
Sbjct  118  DSYIKTLAQIVGSEDEARMKIYSVSTRCYYAFGALVSEDLSHKLKELSNVRWVLPDSYLD  177

Query  567  VKNKDYGGEPFINGQAVPYD  626
            V+NKDYGGEPFI+G+AVPYD
Sbjct  178  VRNKDYGGEPFIDGKAVPYD  197



>ref|XP_002882907.1| hypothetical protein ARALYDRAFT_478926 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH59166.1| hypothetical protein ARALYDRAFT_478926 [Arabidopsis lyrata subsp. 
lyrata]
Length=396

 Score =   261 bits (667),  Expect = 5e-82, Method: Compositional matrix adjust.
 Identities = 137/200 (69%), Positives = 160/200 (80%), Gaps = 10/200 (5%)
 Frame = +3

Query  48   MAT-LLSRSLITAGKQ----LF-RSYSSLTPPRNFLAFSSF-RLRPLVSVSPAVCQLYPA  206
            MAT  +SRS++    +    LF RS++S  P     A S   R RPLV+   A   ++  
Sbjct  1    MATHTISRSILCRPAKSLSLLFTRSFASSAPLVKIPASSLLSRSRPLVA---AFSSVFRG  57

Query  207  AYTAVRGLATRQTSSSLNDPNPNWSNRPPKETILLDGCDFEHWLIVMEKPEGDPTRDEII  386
               +V+GL+T+ TSSSLNDPNPNWSNRPPKETILLDGCDFEHWL+V+  PEGDPTRD+II
Sbjct  58   GLVSVKGLSTQATSSSLNDPNPNWSNRPPKETILLDGCDFEHWLVVVNPPEGDPTRDDII  117

Query  387  DSYIKTLAQVVGSEEEARMKIYSVSTRHYYAFGALVSEELSYKLKELKGVRWVLPDSYLD  566
            DSYIKTLAQ+VGSE+EARMKIYSVSTR YYAFGALVSE+LS+KLKEL  VRWVLPDSYLD
Sbjct  118  DSYIKTLAQIVGSEDEARMKIYSVSTRCYYAFGALVSEDLSHKLKELPNVRWVLPDSYLD  177

Query  567  VKNKDYGGEPFINGQAVPYD  626
            V+NKDYGGEPFI+G+AVPYD
Sbjct  178  VRNKDYGGEPFIDGKAVPYD  197



>ref|XP_009335187.1| PREDICTED: uncharacterized protein At3g15000, mitochondrial-like 
[Pyrus x bretschneideri]
Length=403

 Score =   259 bits (663),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 139/193 (72%), Positives = 153/193 (79%), Gaps = 4/193 (2%)
 Frame = +3

Query  48   MATLLSRSLITAGKQLFRSYSSLTPPRNFLAFSSFRLRPLVSVSPAVCQLYPAAYTAVRG  227
            +A+ LSRSL TA      S ++    R+       RLRPL  V  +  +L PA    VR 
Sbjct  16   VASFLSRSLSTATSATSLSTTAAQS-RSSSLSLLHRLRPLAGVMASAGRLSPAI---VRC  71

Query  228  LATRQTSSSLNDPNPNWSNRPPKETILLDGCDFEHWLIVMEKPEGDPTRDEIIDSYIKTL  407
            L+TR T+SSL DPNPNWSNRPPKETILLDGCDFEHWL+VME P+GD TRDEII+SYIKTL
Sbjct  72   LSTRSTTSSLRDPNPNWSNRPPKETILLDGCDFEHWLVVMEAPQGDITRDEIINSYIKTL  131

Query  408  AQVVGSEEEARMKIYSVSTRHYYAFGALVSEELSYKLKELKGVRWVLPDSYLDVKNKDYG  587
            A VVGSEEEARMKIYSVSTR YYAFGALVSEE+S K+KEL GVRWVLPDSYLDVKNKDYG
Sbjct  132  ATVVGSEEEARMKIYSVSTRCYYAFGALVSEEVSLKIKELPGVRWVLPDSYLDVKNKDYG  191

Query  588  GEPFINGQAVPYD  626
            GEPFINGQAVPYD
Sbjct  192  GEPFINGQAVPYD  204



>emb|CDX98522.1| BnaC05g38530D [Brassica napus]
Length=371

 Score =   259 bits (661),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 132/197 (67%), Positives = 156/197 (79%), Gaps = 9/197 (5%)
 Frame = +3

Query  54   TLLSRSLITAGKQLFRSYSSLTP----PRNFLAFSSF--RLRPLVSVSPAVCQLYPAAYT  215
            ++L R   +      RS++S  P    P   L  SS   R RPLV+   A+   +     
Sbjct  9    SILCRPAKSLSLLFTRSFASSAPLAKAPATSLYTSSLLTRSRPLVA---ALSSAFRGGLV  65

Query  216  AVRGLATRQTSSSLNDPNPNWSNRPPKETILLDGCDFEHWLIVMEKPEGDPTRDEIIDSY  395
            +V+GL+++ TSSSLNDP+PNWSNRPPKETILLDGCDFEHWL+V++ PEGDPTRDEIIDSY
Sbjct  66   SVKGLSSQATSSSLNDPSPNWSNRPPKETILLDGCDFEHWLVVVDPPEGDPTRDEIIDSY  125

Query  396  IKTLAQVVGSEEEARMKIYSVSTRHYYAFGALVSEELSYKLKELKGVRWVLPDSYLDVKN  575
            IKTLAQ+VGSEEEARMKIYSVSTR Y+AFGALVSE+LS+KLKEL  VRWVLPDSYLDV+N
Sbjct  126  IKTLAQIVGSEEEARMKIYSVSTRCYFAFGALVSEDLSHKLKELPKVRWVLPDSYLDVRN  185

Query  576  KDYGGEPFINGQAVPYD  626
            KDYGGEPFI+G+AVPYD
Sbjct  186  KDYGGEPFIDGKAVPYD  202



>gb|KDO48326.1| hypothetical protein CISIN_1g012088mg [Citrus sinensis]
Length=391

 Score =   259 bits (662),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 138/202 (68%), Positives = 150/202 (74%), Gaps = 14/202 (7%)
 Frame = +3

Query  33   TLVAGMATLLSRSLITAGKQLFRSYSSLTPPRNFLAFSSFRLRPL---VSVSPAVCQLYP  203
            T    +A+LLSRS  T    +  S  SL  P  FL     R RPL   V          P
Sbjct  15   TATKALASLLSRSFSTTATTIKPSSRSL--PLLFLN----RFRPLSTAVRFGSGGIVTGP  68

Query  204  AAYTAVRGLATRQTSSSLNDPNPNWSNRPPKETILLDGCDFEHWLIVMEKPEGDPTRDEI  383
            +A    RG++TR  ++SLND +PNWSNRPPKETILLDGCDFEHWL+VMEKPEGDPTRDEI
Sbjct  69   SA----RGMSTRPATASLNDSSPNWSNRPPKETILLDGCDFEHWLVVMEKPEGDPTRDEI  124

Query  384  IDSYIKTLAQVV-GSEEEARMKIYSVSTRHYYAFGALVSEELSYKLKELKGVRWVLPDSY  560
            ID YIKTLA V  G E+EARMKIYSVST+HYYAFGALV EE SYKLKEL GVRWVLPDSY
Sbjct  125  IDRYIKTLATVFDGREDEARMKIYSVSTKHYYAFGALVDEETSYKLKELPGVRWVLPDSY  184

Query  561  LDVKNKDYGGEPFINGQAVPYD  626
            LDVKNKDYGGEPFINGQAVPYD
Sbjct  185  LDVKNKDYGGEPFINGQAVPYD  206



>ref|XP_010108256.1| hypothetical protein L484_018677 [Morus notabilis]
 gb|EXC18496.1| hypothetical protein L484_018677 [Morus notabilis]
Length=462

 Score =   260 bits (665),  Expect = 5e-81, Method: Compositional matrix adjust.
 Identities = 135/204 (66%), Positives = 153/204 (75%), Gaps = 12/204 (6%)
 Frame = +3

Query  15   FKRVP*TLVAGMATLLSRSLITAGKQLFRSYSSLTPPRNFLAFSSFRLRPLVSVSPAVCQ  194
              R+P TL   +A+ LSRS  T         SSL        F   RLRPL         
Sbjct  5    LSRLPRTLT--LASYLSRSFSTTASVAHSRSSSL--------FLLHRLRPLAGAIATARG  54

Query  195  LYPAAYTAVRGLATRQTSSSLNDPNPNWSNRPPKETILLDGCDFEHWLIVMEKPEGDPTR  374
            + P+  + +R  +T  TSSSL DP+PNWSNRPPKETILLDGCDFEHWL+VME PEG+PTR
Sbjct  55   VSPS--SVLRSFSTNATSSSLKDPSPNWSNRPPKETILLDGCDFEHWLVVMEPPEGEPTR  112

Query  375  DEIIDSYIKTLAQVVGSEEEARMKIYSVSTRHYYAFGALVSEELSYKLKELKGVRWVLPD  554
            D+IIDSYIKTL+QVVGSEEEARMKIYSVSTR YYAFGALVSEE+SYK+KEL  VRWVLPD
Sbjct  113  DDIIDSYIKTLSQVVGSEEEARMKIYSVSTRCYYAFGALVSEEISYKIKELPRVRWVLPD  172

Query  555  SYLDVKNKDYGGEPFINGQAVPYD  626
            SYLDV+NKDYGGEPFI+G+AVPYD
Sbjct  173  SYLDVRNKDYGGEPFIDGKAVPYD  196



>ref|XP_009146297.1| PREDICTED: uncharacterized protein At3g15000, mitochondrial-like 
[Brassica rapa]
Length=402

 Score =   259 bits (661),  Expect = 5e-81, Method: Compositional matrix adjust.
 Identities = 130/195 (67%), Positives = 156/195 (80%), Gaps = 11/195 (6%)
 Frame = +3

Query  48   MATLLSRSLITAGKQLFRSYSSLTPPRNFLAFSSF--RLRPLVSVSPAVCQLYPAAYTAV  221
            ++ L +RS  ++   L +S      P   L  SS   R RPLV+   A+   +     +V
Sbjct  18   LSFLFTRSFASSSAPLAKS------PATSLYTSSLLTRSRPLVA---ALSSAFRGGLVSV  68

Query  222  RGLATRQTSSSLNDPNPNWSNRPPKETILLDGCDFEHWLIVMEKPEGDPTRDEIIDSYIK  401
            +GL+++ T+SSLNDP+PNWSNRPPKETILLDGCDFEHWL+V++ PEGDPTRDEIIDSYIK
Sbjct  69   KGLSSQATASSLNDPSPNWSNRPPKETILLDGCDFEHWLVVVDPPEGDPTRDEIIDSYIK  128

Query  402  TLAQVVGSEEEARMKIYSVSTRHYYAFGALVSEELSYKLKELKGVRWVLPDSYLDVKNKD  581
            TLAQ+VGSEEEARMKIYSVSTR Y+AFGALVSE+LS+KLKEL  VRWVLPDSYLDV+NKD
Sbjct  129  TLAQIVGSEEEARMKIYSVSTRCYFAFGALVSEDLSHKLKELPKVRWVLPDSYLDVRNKD  188

Query  582  YGGEPFINGQAVPYD  626
            YGGEPFI+G+AVPYD
Sbjct  189  YGGEPFIDGKAVPYD  203



>ref|XP_006451722.1| hypothetical protein CICLE_v10008185mg [Citrus clementina]
 gb|ESR64962.1| hypothetical protein CICLE_v10008185mg [Citrus clementina]
Length=471

 Score =   261 bits (666),  Expect = 5e-81, Method: Compositional matrix adjust.
 Identities = 138/202 (68%), Positives = 150/202 (74%), Gaps = 14/202 (7%)
 Frame = +3

Query  33   TLVAGMATLLSRSLITAGKQLFRSYSSLTPPRNFLAFSSFRLRPL---VSVSPAVCQLYP  203
            T    +A+LLSRS  T    +  S  SL  P  FL     R RPL   V          P
Sbjct  15   TATKALASLLSRSFSTTATTIKPSSRSL--PLLFLN----RFRPLSAAVRFGSGGIVTGP  68

Query  204  AAYTAVRGLATRQTSSSLNDPNPNWSNRPPKETILLDGCDFEHWLIVMEKPEGDPTRDEI  383
            +A    RG++TR  ++SLND +PNWSNRPPKETILLDGCDFEHWL+VMEKPEGDPTRDEI
Sbjct  69   SA----RGMSTRPATASLNDSSPNWSNRPPKETILLDGCDFEHWLVVMEKPEGDPTRDEI  124

Query  384  IDSYIKTLAQVV-GSEEEARMKIYSVSTRHYYAFGALVSEELSYKLKELKGVRWVLPDSY  560
            ID YIKTLA V  G E+EARMKIYSVST+HYYAFGALV EE SYKLKEL GVRWVLPDSY
Sbjct  125  IDRYIKTLATVFDGREDEARMKIYSVSTKHYYAFGALVDEETSYKLKELPGVRWVLPDSY  184

Query  561  LDVKNKDYGGEPFINGQAVPYD  626
            LDVKNKDYGGEPFINGQAVPYD
Sbjct  185  LDVKNKDYGGEPFINGQAVPYD  206



>ref|XP_006852447.1| hypothetical protein AMTR_s00021p00105410 [Amborella trichopoda]
 gb|ERN13914.1| hypothetical protein AMTR_s00021p00105410 [Amborella trichopoda]
Length=422

 Score =   259 bits (662),  Expect = 6e-81, Method: Compositional matrix adjust.
 Identities = 125/157 (80%), Positives = 137/157 (87%), Gaps = 1/157 (1%)
 Frame = +3

Query  156  LRPLVSVSPAVCQLYPAAYTAVRGLATRQTSSSLNDPNPNWSNRPPKETILLDGCDFEHW  335
            LRPL    PA+      + + +R  ATR T+SSLNDP+PNWSNRPPKETILLDGCDFEHW
Sbjct  52   LRPLSVAVPAINGHL-VSSSGLRCFATRPTTSSLNDPSPNWSNRPPKETILLDGCDFEHW  110

Query  336  LIVMEKPEGDPTRDEIIDSYIKTLAQVVGSEEEARMKIYSVSTRHYYAFGALVSEELSYK  515
            L+VME PEG+PTRD+IIDSYIKTLAQVVGSEEEARMKIYSVSTRHY+AFG LVSEELSYK
Sbjct  111  LVVMEPPEGEPTRDDIIDSYIKTLAQVVGSEEEARMKIYSVSTRHYFAFGCLVSEELSYK  170

Query  516  LKELKGVRWVLPDSYLDVKNKDYGGEPFINGQAVPYD  626
            LK L  VRWVLPDSYLDVKNKDYGGEPFI+G+AVPYD
Sbjct  171  LKPLPKVRWVLPDSYLDVKNKDYGGEPFIDGKAVPYD  207



>gb|KDO48325.1| hypothetical protein CISIN_1g012088mg [Citrus sinensis]
Length=471

 Score =   260 bits (665),  Expect = 6e-81, Method: Compositional matrix adjust.
 Identities = 138/202 (68%), Positives = 150/202 (74%), Gaps = 14/202 (7%)
 Frame = +3

Query  33   TLVAGMATLLSRSLITAGKQLFRSYSSLTPPRNFLAFSSFRLRPL---VSVSPAVCQLYP  203
            T    +A+LLSRS  T    +  S  SL  P  FL     R RPL   V          P
Sbjct  15   TATKALASLLSRSFSTTATTIKPSSRSL--PLLFLN----RFRPLSTAVRFGSGGIVTGP  68

Query  204  AAYTAVRGLATRQTSSSLNDPNPNWSNRPPKETILLDGCDFEHWLIVMEKPEGDPTRDEI  383
            +A    RG++TR  ++SLND +PNWSNRPPKETILLDGCDFEHWL+VMEKPEGDPTRDEI
Sbjct  69   SA----RGMSTRPATASLNDSSPNWSNRPPKETILLDGCDFEHWLVVMEKPEGDPTRDEI  124

Query  384  IDSYIKTLAQVV-GSEEEARMKIYSVSTRHYYAFGALVSEELSYKLKELKGVRWVLPDSY  560
            ID YIKTLA V  G E+EARMKIYSVST+HYYAFGALV EE SYKLKEL GVRWVLPDSY
Sbjct  125  IDRYIKTLATVFDGREDEARMKIYSVSTKHYYAFGALVDEETSYKLKELPGVRWVLPDSY  184

Query  561  LDVKNKDYGGEPFINGQAVPYD  626
            LDVKNKDYGGEPFINGQAVPYD
Sbjct  185  LDVKNKDYGGEPFINGQAVPYD  206



>ref|XP_007021687.1| Cobalt ion binding [Theobroma cacao]
 gb|EOY13212.1| Cobalt ion binding [Theobroma cacao]
Length=402

 Score =   258 bits (660),  Expect = 6e-81, Method: Compositional matrix adjust.
 Identities = 128/159 (81%), Positives = 140/159 (88%), Gaps = 5/159 (3%)
 Frame = +3

Query  153  RLR-PLVSVSPAVCQLYPAAYTAVRGLATRQTSSSLNDPNPNWSNRPPKETILLDGCDFE  329
            RLR PL S  P +C+   +   AV+  ATR   SSLNDPNPN+SNRPPKETILLDGCDFE
Sbjct  56   RLRAPLCS--PLLCRD--SLSPAVKSFATRAARSSLNDPNPNYSNRPPKETILLDGCDFE  111

Query  330  HWLIVMEKPEGDPTRDEIIDSYIKTLAQVVGSEEEARMKIYSVSTRHYYAFGALVSEELS  509
            HWL+VME P+ D TRD+IIDSYIKTLA++VGSEEEARMKIYSVSTRHYYAFGALVSEELS
Sbjct  112  HWLVVMEPPKEDATRDDIIDSYIKTLAKIVGSEEEARMKIYSVSTRHYYAFGALVSEELS  171

Query  510  YKLKELKGVRWVLPDSYLDVKNKDYGGEPFINGQAVPYD  626
            YK+KEL+GVRWVLPDSYLDVKNKDYGGEPFINGQAVPYD
Sbjct  172  YKIKELEGVRWVLPDSYLDVKNKDYGGEPFINGQAVPYD  210



>ref|XP_006485661.1| PREDICTED: uncharacterized protein At3g15000, mitochondrial-like 
[Citrus sinensis]
Length=471

 Score =   260 bits (665),  Expect = 7e-81, Method: Compositional matrix adjust.
 Identities = 138/202 (68%), Positives = 150/202 (74%), Gaps = 14/202 (7%)
 Frame = +3

Query  33   TLVAGMATLLSRSLITAGKQLFRSYSSLTPPRNFLAFSSFRLRPL---VSVSPAVCQLYP  203
            T    +A+LLSRS  T    +  S  SL  P  FL     R RPL   V          P
Sbjct  15   TATKALASLLSRSFSTTATTIKPSSRSL--PLLFLN----RFRPLSTAVRFGSGGIVTGP  68

Query  204  AAYTAVRGLATRQTSSSLNDPNPNWSNRPPKETILLDGCDFEHWLIVMEKPEGDPTRDEI  383
            +A    RG++TR  ++SLND +PNWSNRPPKETILLDGCDFEHWL+VMEKPEGDPTRDEI
Sbjct  69   SA----RGMSTRPATASLNDSSPNWSNRPPKETILLDGCDFEHWLVVMEKPEGDPTRDEI  124

Query  384  IDSYIKTLAQVV-GSEEEARMKIYSVSTRHYYAFGALVSEELSYKLKELKGVRWVLPDSY  560
            ID YIKTLA V  G E+EARMKIYSVST+HYYAFGALV EE SYKLKEL GVRWVLPDSY
Sbjct  125  IDRYIKTLATVFDGREDEARMKIYSVSTKHYYAFGALVDEETSYKLKELPGVRWVLPDSY  184

Query  561  LDVKNKDYGGEPFINGQAVPYD  626
            LDVKNKDYGGEPFINGQAVPYD
Sbjct  185  LDVKNKDYGGEPFINGQAVPYD  206



>ref|XP_010487314.1| PREDICTED: uncharacterized protein At3g15000, mitochondrial-like, 
partial [Camelina sativa]
Length=307

 Score =   255 bits (652),  Expect = 7e-81, Method: Compositional matrix adjust.
 Identities = 122/156 (78%), Positives = 140/156 (90%), Gaps = 2/156 (1%)
 Frame = +3

Query  159  RPLVSVSPAVCQLYPAAYTAVRGLATRQTSSSLNDPNPNWSNRPPKETILLDGCDFEHWL  338
            RPLV+   +V +       +V+GL+T+ TSSSL+DPNPNWSNRPPKETILLDGCDFEHWL
Sbjct  50   RPLVAAFSSVVRG--GGLVSVKGLSTQATSSSLSDPNPNWSNRPPKETILLDGCDFEHWL  107

Query  339  IVMEKPEGDPTRDEIIDSYIKTLAQVVGSEEEARMKIYSVSTRHYYAFGALVSEELSYKL  518
            +V+E PEG+PTRDEIIDSYIKTLAQ+VGSEEEARMKIYSVSTR YYAFGALVSE+LS+K+
Sbjct  108  VVVEPPEGEPTRDEIIDSYIKTLAQIVGSEEEARMKIYSVSTRCYYAFGALVSEDLSHKI  167

Query  519  KELKGVRWVLPDSYLDVKNKDYGGEPFINGQAVPYD  626
            KEL  VRWVLPDSYLDV+NKDYGGEPFI+G+AVPYD
Sbjct  168  KELPKVRWVLPDSYLDVRNKDYGGEPFIDGKAVPYD  203



>ref|XP_006297678.1| hypothetical protein CARUB_v10013708mg, partial [Capsella rubella]
 gb|EOA30576.1| hypothetical protein CARUB_v10013708mg, partial [Capsella rubella]
Length=444

 Score =   259 bits (661),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 124/156 (79%), Positives = 140/156 (90%), Gaps = 3/156 (2%)
 Frame = +3

Query  159  RPLVSVSPAVCQLYPAAYTAVRGLATRQTSSSLNDPNPNWSNRPPKETILLDGCDFEHWL  338
            RPLV+   +V +       +V+GL+T+ TSSSLNDPNPNWSNRPPKETILLDGCDFEHWL
Sbjct  93   RPLVAAFSSVVR---NGLVSVKGLSTQATSSSLNDPNPNWSNRPPKETILLDGCDFEHWL  149

Query  339  IVMEKPEGDPTRDEIIDSYIKTLAQVVGSEEEARMKIYSVSTRHYYAFGALVSEELSYKL  518
            +V+E PEGDPTRDEIIDSYIKTLAQ+VGSEEEARMKIYSVSTR YYAFGALVSE+LS+K+
Sbjct  150  VVVEPPEGDPTRDEIIDSYIKTLAQIVGSEEEARMKIYSVSTRCYYAFGALVSEDLSHKI  209

Query  519  KELKGVRWVLPDSYLDVKNKDYGGEPFINGQAVPYD  626
            KEL  VRWVLPDSYLDV+NKDYGGEPFI+G+AVPYD
Sbjct  210  KELPKVRWVLPDSYLDVRNKDYGGEPFIDGKAVPYD  245



>gb|KEH38632.1| plastid developmental protein DAG [Medicago truncatula]
Length=375

 Score =   257 bits (656),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 123/158 (78%), Positives = 135/158 (85%), Gaps = 3/158 (2%)
 Frame = +3

Query  153  RLRPLVSVSPAVCQLYPAAYTAVRGLATRQTSSSLNDPNPNWSNRPPKETILLDGCDFEH  332
            RLRPL + +     +      + R  +TR T+SSLNDPNPNWSNRPPKETILLDGCDFEH
Sbjct  41   RLRPLSATAITSRHIL---LPSFRAFSTRPTTSSLNDPNPNWSNRPPKETILLDGCDFEH  97

Query  333  WLIVMEKPEGDPTRDEIIDSYIKTLAQVVGSEEEARMKIYSVSTRHYYAFGALVSEELSY  512
            WL+VMEKPEGDPTRDEIIDSYIKTLA+V+GSEEEAR  IYSVSTRHY+AFGAL SEELSY
Sbjct  98   WLVVMEKPEGDPTRDEIIDSYIKTLAEVIGSEEEARKSIYSVSTRHYFAFGALCSEELSY  157

Query  513  KLKELKGVRWVLPDSYLDVKNKDYGGEPFINGQAVPYD  626
            KLKEL  VRWVLPDSYL+V+ KDYGGEPFINGQAVPYD
Sbjct  158  KLKELPKVRWVLPDSYLNVREKDYGGEPFINGQAVPYD  195



>gb|KGN53589.1| hypothetical protein Csa_4G083630 [Cucumis sativus]
Length=434

 Score =   258 bits (659),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 126/158 (80%), Positives = 138/158 (87%), Gaps = 1/158 (1%)
 Frame = +3

Query  153  RLRPLVSVSPAVCQLYPAAYTAVRGLATRQTSSSLNDPNPNWSNRPPKETILLDGCDFEH  332
            RLRPL ++  A  + + AA  ++R  +TR TSSSLNDPNPNWSNRPPKETILLDGCDFEH
Sbjct  45   RLRPLAAILAADFRCHSAA-PSLRDFSTRATSSSLNDPNPNWSNRPPKETILLDGCDFEH  103

Query  333  WLIVMEKPEGDPTRDEIIDSYIKTLAQVVGSEEEARMKIYSVSTRHYYAFGALVSEELSY  512
            WL+VMEKP+   TRDEIIDSYIKTLA VVGSEEEARMKIYSVSTR Y+AFG LVSEELSY
Sbjct  104  WLVVMEKPDEQLTRDEIIDSYIKTLAMVVGSEEEARMKIYSVSTRCYFAFGCLVSEELSY  163

Query  513  KLKELKGVRWVLPDSYLDVKNKDYGGEPFINGQAVPYD  626
            K+KEL  VRWVLPDSYLDVKNKDYGGEPFI+GQAVPYD
Sbjct  164  KIKELPKVRWVLPDSYLDVKNKDYGGEPFIDGQAVPYD  201



>ref|XP_010502420.1| PREDICTED: uncharacterized protein At3g15000, mitochondrial-like 
[Camelina sativa]
Length=409

 Score =   257 bits (657),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 122/156 (78%), Positives = 140/156 (90%), Gaps = 3/156 (2%)
 Frame = +3

Query  159  RPLVSVSPAVCQLYPAAYTAVRGLATRQTSSSLNDPNPNWSNRPPKETILLDGCDFEHWL  338
            RPLV+   +V +       +V+GL+T+ TSSSL+DPNPNWSNRPPKETILLDGCDFEHWL
Sbjct  50   RPLVAAFSSVVR---GGLVSVKGLSTQATSSSLSDPNPNWSNRPPKETILLDGCDFEHWL  106

Query  339  IVMEKPEGDPTRDEIIDSYIKTLAQVVGSEEEARMKIYSVSTRHYYAFGALVSEELSYKL  518
            +V+E PEG+PTRDEIIDSYIKTLAQ+VGSEEEARMKIYSVSTR YYAFGALVSE+LS+K+
Sbjct  107  VVVEPPEGEPTRDEIIDSYIKTLAQIVGSEEEARMKIYSVSTRCYYAFGALVSEDLSHKI  166

Query  519  KELKGVRWVLPDSYLDVKNKDYGGEPFINGQAVPYD  626
            KEL  VRWVLPDSYLDV+NKDYGGEPFI+G+AVPYD
Sbjct  167  KELPKVRWVLPDSYLDVRNKDYGGEPFIDGKAVPYD  202



>gb|KJB13211.1| hypothetical protein B456_002G062600 [Gossypium raimondii]
Length=399

 Score =   257 bits (656),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 119/137 (87%), Positives = 128/137 (93%), Gaps = 0/137 (0%)
 Frame = +3

Query  216  AVRGLATRQTSSSLNDPNPNWSNRPPKETILLDGCDFEHWLIVMEKPEGDPTRDEIIDSY  395
            AV+  +TR   SSLNDPNPN+SNRPPKETILLDGCDFEHWL+VME P+ D TRD+IIDSY
Sbjct  75   AVKSFSTRAARSSLNDPNPNYSNRPPKETILLDGCDFEHWLVVMEPPKEDATRDDIIDSY  134

Query  396  IKTLAQVVGSEEEARMKIYSVSTRHYYAFGALVSEELSYKLKELKGVRWVLPDSYLDVKN  575
            IKTLAQVVGSE+EARMKIYSVSTRHYYAFGALVSEE+SYK+KEL GVRWVLPDSYLDVKN
Sbjct  135  IKTLAQVVGSEDEARMKIYSVSTRHYYAFGALVSEEVSYKIKELPGVRWVLPDSYLDVKN  194

Query  576  KDYGGEPFINGQAVPYD  626
            KDYGGEPFINGQAVPYD
Sbjct  195  KDYGGEPFINGQAVPYD  211



>ref|XP_002524267.1| DAG protein, chloroplast precursor, putative [Ricinus communis]
 gb|EEF38106.1| DAG protein, chloroplast precursor, putative [Ricinus communis]
Length=389

 Score =   256 bits (655),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 145/201 (72%), Positives = 161/201 (80%), Gaps = 14/201 (7%)
 Frame = +3

Query  48   MAT-LLSRSLITAGKQLF----RSYSSL-TPPRNFLAFSSF--RLRPLVSVSPAVCQLYP  203
            MAT + SRSL+     +F    RS+SSL T P + L + SF   LRPL + S      YP
Sbjct  1    MATQIFSRSLLHKPTAVFSLLCRSFSSLPTKPTSPLVYRSFFRCLRPLAAAS-----QYP  55

Query  204  AAYTAVRGLATRQTSSSLNDPNPNWSNRPPKETILLDGCDFEHWLIVMEKPEGDPTRDEI  383
             + +     +TR T+SSLNDP+PNWSNRPPKETILLDGCDF HWL+VMEKPEGDPTRDEI
Sbjct  56   LSTSTRS-FSTRTTTSSLNDPSPNWSNRPPKETILLDGCDFNHWLVVMEKPEGDPTRDEI  114

Query  384  IDSYIKTLAQVVGSEEEARMKIYSVSTRHYYAFGALVSEELSYKLKELKGVRWVLPDSYL  563
            IDSYIKTLAQVVGSEEEARMKIYSVSTR YYAFGALVSEELSYK+KEL  VRWVLPDSYL
Sbjct  115  IDSYIKTLAQVVGSEEEARMKIYSVSTRCYYAFGALVSEELSYKIKELPRVRWVLPDSYL  174

Query  564  DVKNKDYGGEPFINGQAVPYD  626
            DVKNKDYGGEPFI+G+AVPYD
Sbjct  175  DVKNKDYGGEPFIDGKAVPYD  195



>ref|XP_004137307.1| PREDICTED: uncharacterized protein At3g15000, mitochondrial-like 
[Cucumis sativus]
Length=410

 Score =   257 bits (656),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 126/158 (80%), Positives = 138/158 (87%), Gaps = 1/158 (1%)
 Frame = +3

Query  153  RLRPLVSVSPAVCQLYPAAYTAVRGLATRQTSSSLNDPNPNWSNRPPKETILLDGCDFEH  332
            RLRPL ++  A  + + AA  ++R  +TR TSSSLNDPNPNWSNRPPKETILLDGCDFEH
Sbjct  45   RLRPLAAILAADFRCHSAA-PSLRDFSTRATSSSLNDPNPNWSNRPPKETILLDGCDFEH  103

Query  333  WLIVMEKPEGDPTRDEIIDSYIKTLAQVVGSEEEARMKIYSVSTRHYYAFGALVSEELSY  512
            WL+VMEKP+   TRDEIIDSYIKTLA VVGSEEEARMKIYSVSTR Y+AFG LVSEELSY
Sbjct  104  WLVVMEKPDEQLTRDEIIDSYIKTLAMVVGSEEEARMKIYSVSTRCYFAFGCLVSEELSY  163

Query  513  KLKELKGVRWVLPDSYLDVKNKDYGGEPFINGQAVPYD  626
            K+KEL  VRWVLPDSYLDVKNKDYGGEPFI+GQAVPYD
Sbjct  164  KIKELPKVRWVLPDSYLDVKNKDYGGEPFIDGQAVPYD  201



>ref|XP_010487313.1| PREDICTED: uncharacterized protein At3g15000, mitochondrial-like 
[Camelina sativa]
Length=410

 Score =   257 bits (656),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 122/156 (78%), Positives = 140/156 (90%), Gaps = 2/156 (1%)
 Frame = +3

Query  159  RPLVSVSPAVCQLYPAAYTAVRGLATRQTSSSLNDPNPNWSNRPPKETILLDGCDFEHWL  338
            RPLV+   +V +       +V+GL+T+ TSSSL+DPNPNWSNRPPKETILLDGCDFEHWL
Sbjct  50   RPLVAAFSSVVRG--GGLVSVKGLSTQATSSSLSDPNPNWSNRPPKETILLDGCDFEHWL  107

Query  339  IVMEKPEGDPTRDEIIDSYIKTLAQVVGSEEEARMKIYSVSTRHYYAFGALVSEELSYKL  518
            +V+E PEG+PTRDEIIDSYIKTLAQ+VGSEEEARMKIYSVSTR YYAFGALVSE+LS+K+
Sbjct  108  VVVEPPEGEPTRDEIIDSYIKTLAQIVGSEEEARMKIYSVSTRCYYAFGALVSEDLSHKI  167

Query  519  KELKGVRWVLPDSYLDVKNKDYGGEPFINGQAVPYD  626
            KEL  VRWVLPDSYLDV+NKDYGGEPFI+G+AVPYD
Sbjct  168  KELPKVRWVLPDSYLDVRNKDYGGEPFIDGKAVPYD  203



>ref|XP_010465436.1| PREDICTED: uncharacterized protein At3g15000, mitochondrial-like 
[Camelina sativa]
Length=411

 Score =   257 bits (656),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 122/156 (78%), Positives = 140/156 (90%), Gaps = 2/156 (1%)
 Frame = +3

Query  159  RPLVSVSPAVCQLYPAAYTAVRGLATRQTSSSLNDPNPNWSNRPPKETILLDGCDFEHWL  338
            RPLV+   +V +       +V+GL+T+ TSSSL+DPNPNWSNRPPKETILLDGCDFEHWL
Sbjct  50   RPLVAAFSSVVRG--GGLVSVKGLSTQATSSSLSDPNPNWSNRPPKETILLDGCDFEHWL  107

Query  339  IVMEKPEGDPTRDEIIDSYIKTLAQVVGSEEEARMKIYSVSTRHYYAFGALVSEELSYKL  518
            +V+E PEG+PTRDEIIDSYIKTLAQ+VGSEEEARMKIYSVSTR YYAFGALVSE+LS+K+
Sbjct  108  VVVEPPEGEPTRDEIIDSYIKTLAQIVGSEEEARMKIYSVSTRCYYAFGALVSEDLSHKI  167

Query  519  KELKGVRWVLPDSYLDVKNKDYGGEPFINGQAVPYD  626
            KEL  VRWVLPDSYLDV+NKDYGGEPFI+G+AVPYD
Sbjct  168  KELPKVRWVLPDSYLDVRNKDYGGEPFIDGKAVPYD  203



>ref|XP_004143682.1| PREDICTED: uncharacterized protein At3g15000, mitochondrial-like 
[Cucumis sativus]
 ref|XP_004172893.1| PREDICTED: uncharacterized protein At3g15000, mitochondrial-like 
[Cucumis sativus]
Length=350

 Score =   254 bits (649),  Expect = 6e-80, Method: Compositional matrix adjust.
 Identities = 127/158 (80%), Positives = 134/158 (85%), Gaps = 1/158 (1%)
 Frame = +3

Query  153  RLRPLVSVSPAVCQLYPAAYTAVRGLATRQTSSSLNDPNPNWSNRPPKETILLDGCDFEH  332
            R RPLV++  A  +    A T VR  ATR  SSSLNDPNPNWSNRPPKETILLDGCDFEH
Sbjct  47   RFRPLVAIPAADFRRLSPALT-VRDFATRVASSSLNDPNPNWSNRPPKETILLDGCDFEH  105

Query  333  WLIVMEKPEGDPTRDEIIDSYIKTLAQVVGSEEEARMKIYSVSTRHYYAFGALVSEELSY  512
            WLIVMEKP+   TRDEIIDSYIKTLA VVGSEEEARMKIYSVSTR Y+AFG LVSEELSY
Sbjct  106  WLIVMEKPDEQLTRDEIIDSYIKTLAMVVGSEEEARMKIYSVSTRCYFAFGCLVSEELSY  165

Query  513  KLKELKGVRWVLPDSYLDVKNKDYGGEPFINGQAVPYD  626
            K+KEL  VRWVLPDSYLDVKNK YGGEPFI+GQAVPYD
Sbjct  166  KIKELPKVRWVLPDSYLDVKNKSYGGEPFIHGQAVPYD  203



>gb|KGN50312.1| hypothetical protein Csa_5G167045 [Cucumis sativus]
Length=345

 Score =   254 bits (648),  Expect = 8e-80, Method: Compositional matrix adjust.
 Identities = 127/158 (80%), Positives = 134/158 (85%), Gaps = 1/158 (1%)
 Frame = +3

Query  153  RLRPLVSVSPAVCQLYPAAYTAVRGLATRQTSSSLNDPNPNWSNRPPKETILLDGCDFEH  332
            R RPLV++  A  +    A T VR  ATR  SSSLNDPNPNWSNRPPKETILLDGCDFEH
Sbjct  47   RFRPLVAIPAADFRRLSPALT-VRDFATRVASSSLNDPNPNWSNRPPKETILLDGCDFEH  105

Query  333  WLIVMEKPEGDPTRDEIIDSYIKTLAQVVGSEEEARMKIYSVSTRHYYAFGALVSEELSY  512
            WLIVMEKP+   TRDEIIDSYIKTLA VVGSEEEARMKIYSVSTR Y+AFG LVSEELSY
Sbjct  106  WLIVMEKPDEQLTRDEIIDSYIKTLAMVVGSEEEARMKIYSVSTRCYFAFGCLVSEELSY  165

Query  513  KLKELKGVRWVLPDSYLDVKNKDYGGEPFINGQAVPYD  626
            K+KEL  VRWVLPDSYLDVKNK YGGEPFI+GQAVPYD
Sbjct  166  KIKELPKVRWVLPDSYLDVKNKSYGGEPFIHGQAVPYD  203



>ref|XP_008365857.1| PREDICTED: uncharacterized protein At3g15000, mitochondrial-like 
isoform X1 [Malus domestica]
Length=409

 Score =   254 bits (649),  Expect = 4e-79, Method: Compositional matrix adjust.
 Identities = 126/159 (79%), Positives = 135/159 (85%), Gaps = 3/159 (2%)
 Frame = +3

Query  150  FRLRPLVSVSPAVCQLYPAAYTAVRGLATRQTSSSLNDPNPNWSNRPPKETILLDGCDFE  329
             RL PL  V  +  +L PA    VR L+TR T+SSL DPNPNWSNRPPKETILLDGCDFE
Sbjct  69   HRLHPLAGVMASAGRLSPAI---VRCLSTRSTTSSLRDPNPNWSNRPPKETILLDGCDFE  125

Query  330  HWLIVMEKPEGDPTRDEIIDSYIKTLAQVVGSEEEARMKIYSVSTRHYYAFGALVSEELS  509
            HWL+VME P+G  TRDEII+SYIKTLA VVGSEEEARMKIYSVSTR YYAFGALVSEE+S
Sbjct  126  HWLVVMEAPQGVITRDEIINSYIKTLATVVGSEEEARMKIYSVSTRCYYAFGALVSEEVS  185

Query  510  YKLKELKGVRWVLPDSYLDVKNKDYGGEPFINGQAVPYD  626
             K+KEL GVRWVLPDSYLDVKNKDYGGEPFINGQA PYD
Sbjct  186  LKIKELPGVRWVLPDSYLDVKNKDYGGEPFINGQAXPYD  224



>ref|XP_006407023.1| hypothetical protein EUTSA_v10020847mg [Eutrema salsugineum]
 gb|ESQ48476.1| hypothetical protein EUTSA_v10020847mg [Eutrema salsugineum]
Length=407

 Score =   254 bits (648),  Expect = 5e-79, Method: Compositional matrix adjust.
 Identities = 118/141 (84%), Positives = 131/141 (93%), Gaps = 0/141 (0%)
 Frame = +3

Query  204  AAYTAVRGLATRQTSSSLNDPNPNWSNRPPKETILLDGCDFEHWLIVMEKPEGDPTRDEI  383
                +V+GL+T+ TSSSLNDPNPNWSNRPPKETILLDGCDFEHWL+V+E PEGDPTRDEI
Sbjct  62   GGLVSVKGLSTQATSSSLNDPNPNWSNRPPKETILLDGCDFEHWLVVVEPPEGDPTRDEI  121

Query  384  IDSYIKTLAQVVGSEEEARMKIYSVSTRHYYAFGALVSEELSYKLKELKGVRWVLPDSYL  563
            IDSYIK LAQ+VGSEEEARMKIYSVSTR YYAFGALVSE+LS+K+KEL  VRWVLPDSYL
Sbjct  122  IDSYIKILAQIVGSEEEARMKIYSVSTRCYYAFGALVSEDLSHKIKELPKVRWVLPDSYL  181

Query  564  DVKNKDYGGEPFINGQAVPYD  626
            DV+NKDYGGEPFI+G+AVPYD
Sbjct  182  DVRNKDYGGEPFIDGKAVPYD  202



>gb|KJB61599.1| hypothetical protein B456_009G369000 [Gossypium raimondii]
Length=410

 Score =   253 bits (647),  Expect = 6e-79, Method: Compositional matrix adjust.
 Identities = 118/139 (85%), Positives = 128/139 (92%), Gaps = 0/139 (0%)
 Frame = +3

Query  210  YTAVRGLATRQTSSSLNDPNPNWSNRPPKETILLDGCDFEHWLIVMEKPEGDPTRDEIID  389
            +  V+  +TR   SSLNDP+PN+SNRPPKETILLDGCDFEHWL+V+E P+ D TRDEIID
Sbjct  73   FPTVKSFSTRAARSSLNDPSPNYSNRPPKETILLDGCDFEHWLVVVEPPKEDATRDEIID  132

Query  390  SYIKTLAQVVGSEEEARMKIYSVSTRHYYAFGALVSEELSYKLKELKGVRWVLPDSYLDV  569
            SYIKTLAQVVGSE+EARMKIYSVSTRHYYAFGALVSEELSYK+KEL GVRWVLPDSYLDV
Sbjct  133  SYIKTLAQVVGSEDEARMKIYSVSTRHYYAFGALVSEELSYKIKELPGVRWVLPDSYLDV  192

Query  570  KNKDYGGEPFINGQAVPYD  626
            KNKDYGGEPFINGQAVPYD
Sbjct  193  KNKDYGGEPFINGQAVPYD  211



>emb|CDX97626.1| BnaA05g24530D [Brassica napus]
Length=364

 Score =   252 bits (643),  Expect = 7e-79, Method: Compositional matrix adjust.
 Identities = 131/197 (66%), Positives = 154/197 (78%), Gaps = 13/197 (7%)
 Frame = +3

Query  54   TLLSRSLITAGKQLFRSYSSLTP----PRNFLAFSSF--RLRPLVSVSPAVCQLYPAAYT  215
            ++L R   +      RS++S  P    P + L  SS   R RPLV+          +A+ 
Sbjct  9    SILCRPAKSLSFLFTRSFASSAPLAKSPVSSLYTSSLLTRSRPLVAA-------LSSAFR  61

Query  216  AVRGLATRQTSSSLNDPNPNWSNRPPKETILLDGCDFEHWLIVMEKPEGDPTRDEIIDSY  395
               GL+++ TSSSLNDP+PNWSNRPPKETILLDGCDFEHWL+V++ PEGDPTRDEIIDSY
Sbjct  62   GGLGLSSQATSSSLNDPSPNWSNRPPKETILLDGCDFEHWLVVVDPPEGDPTRDEIIDSY  121

Query  396  IKTLAQVVGSEEEARMKIYSVSTRHYYAFGALVSEELSYKLKELKGVRWVLPDSYLDVKN  575
            IKTLAQ+VGSEEEARMKIYSVSTR Y+AFGALVSE+LS+KLKEL  VRWVLPDSYLDV+N
Sbjct  122  IKTLAQIVGSEEEARMKIYSVSTRCYFAFGALVSEDLSHKLKELPKVRWVLPDSYLDVRN  181

Query  576  KDYGGEPFINGQAVPYD  626
            KDYGGEPFI+G+AVPYD
Sbjct  182  KDYGGEPFIDGKAVPYD  198



>gb|KDP32518.1| hypothetical protein JCGZ_14721 [Jatropha curcas]
Length=409

 Score =   253 bits (647),  Expect = 7e-79, Method: Compositional matrix adjust.
 Identities = 138/192 (72%), Positives = 154/192 (80%), Gaps = 5/192 (3%)
 Frame = +3

Query  54   TLLSRSLITAGKQLFRSYSSLTP-PRNFLAFSSFRLRPLVSVSPAVCQLYPAAYTAVRGL  230
            T +++SL++   + F S  S +P  R+F    S  LRPL + +  V     A  T     
Sbjct  15   TTINKSLVSLLSRYFSSLPSTSPGSRSFCFLRS--LRPLFTATNFVSSNSRALTTRS--F  70

Query  231  ATRQTSSSLNDPNPNWSNRPPKETILLDGCDFEHWLIVMEKPEGDPTRDEIIDSYIKTLA  410
            +TR T+SSLNDP+PNWSNRPPKETILLDGCDFEHWL+VMEKPEGDPTRDEIID YIKTLA
Sbjct  71   STRTTTSSLNDPSPNWSNRPPKETILLDGCDFEHWLVVMEKPEGDPTRDEIIDYYIKTLA  130

Query  411  QVVGSEEEARMKIYSVSTRHYYAFGALVSEELSYKLKELKGVRWVLPDSYLDVKNKDYGG  590
            Q+VGSEEEARMKIYSVSTR YYAFGALVSEELSYK+KEL  VRWVLPDSYLDVKNKDYGG
Sbjct  131  QIVGSEEEARMKIYSVSTRCYYAFGALVSEELSYKIKELPKVRWVLPDSYLDVKNKDYGG  190

Query  591  EPFINGQAVPYD  626
            EPFINGQAVPYD
Sbjct  191  EPFINGQAVPYD  202



>ref|XP_008451724.1| PREDICTED: uncharacterized protein At3g15000, mitochondrial [Cucumis 
melo]
Length=427

 Score =   253 bits (647),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 121/141 (86%), Positives = 128/141 (91%), Gaps = 0/141 (0%)
 Frame = +3

Query  204  AAYTAVRGLATRQTSSSLNDPNPNWSNRPPKETILLDGCDFEHWLIVMEKPEGDPTRDEI  383
            +A  +VR  +TR TSSSLNDPNPNWSNRPPKETILLDGCDFEHWL+VMEKP+   TRDEI
Sbjct  61   SAAPSVRDFSTRATSSSLNDPNPNWSNRPPKETILLDGCDFEHWLVVMEKPDEQLTRDEI  120

Query  384  IDSYIKTLAQVVGSEEEARMKIYSVSTRHYYAFGALVSEELSYKLKELKGVRWVLPDSYL  563
            IDSYIKTLA VVGSEEEARMKIYSVSTR Y+AFG LVSEELSYK+KEL  VRWVLPDSYL
Sbjct  121  IDSYIKTLAMVVGSEEEARMKIYSVSTRCYFAFGCLVSEELSYKIKELPKVRWVLPDSYL  180

Query  564  DVKNKDYGGEPFINGQAVPYD  626
            DVKNKDYGGEPFINGQAVPYD
Sbjct  181  DVKNKDYGGEPFINGQAVPYD  201



>ref|XP_010064120.1| PREDICTED: uncharacterized protein At3g15000, mitochondrial-like 
[Eucalyptus grandis]
Length=281

 Score =   249 bits (635),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 117/124 (94%), Positives = 119/124 (96%), Gaps = 0/124 (0%)
 Frame = +3

Query  255  LNDPNPNWSNRPPKETILLDGCDFEHWLIVMEKPEGDPTRDEIIDSYIKTLAQVVGSEEE  434
            LNDPNPNWSNRPPKETILLDGCDFEHWL+VMEKPEGDP RDEII SYIKTLAQVVGSE E
Sbjct  79   LNDPNPNWSNRPPKETILLDGCDFEHWLVVMEKPEGDPPRDEIIHSYIKTLAQVVGSEGE  138

Query  435  ARMKIYSVSTRHYYAFGALVSEELSYKLKELKGVRWVLPDSYLDVKNKDYGGEPFINGQA  614
            ARMKIYSVSTRHY+AFGALVSEELSYKLKEL  VRWVLPDSYLDVKNKDYGGEPFINGQA
Sbjct  139  ARMKIYSVSTRHYFAFGALVSEELSYKLKELPRVRWVLPDSYLDVKNKDYGGEPFINGQA  198

Query  615  VPYD  626
            VPYD
Sbjct  199  VPYD  202



>gb|KFK38849.1| hypothetical protein AALP_AA3G168200 [Arabis alpina]
Length=414

 Score =   253 bits (645),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 121/156 (78%), Positives = 137/156 (88%), Gaps = 3/156 (2%)
 Frame = +3

Query  159  RPLVSVSPAVCQLYPAAYTAVRGLATRQTSSSLNDPNPNWSNRPPKETILLDGCDFEHWL  338
            RPLV+   +V +       + + L+T+ TSSSLNDPNPNWSNRPPKETILLDGCDFEHWL
Sbjct  50   RPLVAAFSSVLR---GGLVSAKSLSTQATSSSLNDPNPNWSNRPPKETILLDGCDFEHWL  106

Query  339  IVMEKPEGDPTRDEIIDSYIKTLAQVVGSEEEARMKIYSVSTRHYYAFGALVSEELSYKL  518
            +V+E PEG+PTRDEIIDSYIK LAQ+VGSEEEARMKIYSVSTR YYAFGALVSE+LS+KL
Sbjct  107  VVVEPPEGEPTRDEIIDSYIKVLAQIVGSEEEARMKIYSVSTRCYYAFGALVSEDLSHKL  166

Query  519  KELKGVRWVLPDSYLDVKNKDYGGEPFINGQAVPYD  626
            KEL  VRWVLPDSYLDV+NKDYGGEPFI+G+AVPYD
Sbjct  167  KELPKVRWVLPDSYLDVRNKDYGGEPFIDGKAVPYD  202



>ref|XP_008382067.1| PREDICTED: uncharacterized protein At3g15000, mitochondrial isoform 
X3 [Malus domestica]
Length=388

 Score =   251 bits (641),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 124/155 (80%), Positives = 133/155 (86%), Gaps = 3/155 (2%)
 Frame = +3

Query  162  PLVSVSPAVCQLYPAAYTAVRGLATRQTSSSLNDPNPNWSNRPPKETILLDGCDFEHWLI  341
            PL  V  +  +L PA     R L+TR T+SSL DPNPNWSNRPPKETILLDGCDFEHWL+
Sbjct  52   PLAGVMASXGRLSPAI---XRCLSTRSTTSSLRDPNPNWSNRPPKETILLDGCDFEHWLV  108

Query  342  VMEKPEGDPTRDEIIDSYIKTLAQVVGSEEEARMKIYSVSTRHYYAFGALVSEELSYKLK  521
            VME P+G  TRDEII+SYIKTLA VVGSEEEARMKIYSVSTR YYAFGALVSEE+S K+K
Sbjct  109  VMEAPQGXITRDEIINSYIKTLATVVGSEEEARMKIYSVSTRCYYAFGALVSEEVSLKIK  168

Query  522  ELKGVRWVLPDSYLDVKNKDYGGEPFINGQAVPYD  626
            EL GVRWVLPDSYLDVKNKDYGGEPFINGQAVPYD
Sbjct  169  ELPGVRWVLPDSYLDVKNKDYGGEPFINGQAVPYD  203



>ref|XP_008382068.1| PREDICTED: uncharacterized protein At3g15000, mitochondrial isoform 
X4 [Malus domestica]
Length=388

 Score =   251 bits (640),  Expect = 4e-78, Method: Compositional matrix adjust.
 Identities = 124/155 (80%), Positives = 133/155 (86%), Gaps = 3/155 (2%)
 Frame = +3

Query  162  PLVSVSPAVCQLYPAAYTAVRGLATRQTSSSLNDPNPNWSNRPPKETILLDGCDFEHWLI  341
            PL  V  +  +L PA     R L+TR T+SSL DPNPNWSNRPPKETILLDGCDFEHWL+
Sbjct  52   PLAGVMASXGRLSPAI---XRCLSTRSTTSSLRDPNPNWSNRPPKETILLDGCDFEHWLV  108

Query  342  VMEKPEGDPTRDEIIDSYIKTLAQVVGSEEEARMKIYSVSTRHYYAFGALVSEELSYKLK  521
            VME P+G  TRDEII+SYIKTLA VVGSEEEARMKIYSVSTR YYAFGALVSEE+S K+K
Sbjct  109  VMEAPQGXITRDEIINSYIKTLATVVGSEEEARMKIYSVSTRCYYAFGALVSEEVSLKIK  168

Query  522  ELKGVRWVLPDSYLDVKNKDYGGEPFINGQAVPYD  626
            EL GVRWVLPDSYLDVKNKDYGGEPFINGQAVPYD
Sbjct  169  ELPGVRWVLPDSYLDVKNKDYGGEPFINGQAVPYD  203



>ref|XP_008382065.1| PREDICTED: uncharacterized protein At3g15000, mitochondrial isoform 
X1 [Malus domestica]
Length=403

 Score =   251 bits (641),  Expect = 4e-78, Method: Compositional matrix adjust.
 Identities = 124/155 (80%), Positives = 133/155 (86%), Gaps = 3/155 (2%)
 Frame = +3

Query  162  PLVSVSPAVCQLYPAAYTAVRGLATRQTSSSLNDPNPNWSNRPPKETILLDGCDFEHWLI  341
            PL  V  +  +L PA     R L+TR T+SSL DPNPNWSNRPPKETILLDGCDFEHWL+
Sbjct  52   PLAGVMASXGRLSPAI---XRCLSTRSTTSSLRDPNPNWSNRPPKETILLDGCDFEHWLV  108

Query  342  VMEKPEGDPTRDEIIDSYIKTLAQVVGSEEEARMKIYSVSTRHYYAFGALVSEELSYKLK  521
            VME P+G  TRDEII+SYIKTLA VVGSEEEARMKIYSVSTR YYAFGALVSEE+S K+K
Sbjct  109  VMEAPQGXITRDEIINSYIKTLATVVGSEEEARMKIYSVSTRCYYAFGALVSEEVSLKIK  168

Query  522  ELKGVRWVLPDSYLDVKNKDYGGEPFINGQAVPYD  626
            EL GVRWVLPDSYLDVKNKDYGGEPFINGQAVPYD
Sbjct  169  ELPGVRWVLPDSYLDVKNKDYGGEPFINGQAVPYD  203



>gb|ABK26281.1| unknown [Picea sitchensis]
Length=274

 Score =   247 bits (630),  Expect = 5e-78, Method: Compositional matrix adjust.
 Identities = 119/166 (72%), Positives = 134/166 (81%), Gaps = 6/166 (4%)
 Frame = +3

Query  129  NFLAFSSFRLRPLVSVSPAVCQLYPAAYTAVRGLATRQTSSSLNDPNPNWSNRPPKETIL  308
            + + F S R    VS+S       P A   +R  +   T+SS+ DP+PNWSNRPPKETIL
Sbjct  45   SLIGFRSMRFLGAVSIS------QPPARVHLRCFSAIPTNSSMTDPSPNWSNRPPKETIL  98

Query  309  LDGCDFEHWLIVMEKPEGDPTRDEIIDSYIKTLAQVVGSEEEARMKIYSVSTRHYYAFGA  488
            LDGCD+EHWLIVME PEG+PTRDEIIDSYIKTLAQ+VGSEEEARMKIYSVST+HY+AFG 
Sbjct  99   LDGCDYEHWLIVMEPPEGNPTRDEIIDSYIKTLAQIVGSEEEARMKIYSVSTKHYFAFGC  158

Query  489  LVSEELSYKLKELKGVRWVLPDSYLDVKNKDYGGEPFINGQAVPYD  626
            LVSEELSYK+K L  VRWVLPDSYLD + KDYGGEPFINGQAVPYD
Sbjct  159  LVSEELSYKIKPLPNVRWVLPDSYLDPRTKDYGGEPFINGQAVPYD  204



>ref|XP_008382066.1| PREDICTED: uncharacterized protein At3g15000, mitochondrial isoform 
X2 [Malus domestica]
Length=403

 Score =   251 bits (640),  Expect = 6e-78, Method: Compositional matrix adjust.
 Identities = 124/155 (80%), Positives = 133/155 (86%), Gaps = 3/155 (2%)
 Frame = +3

Query  162  PLVSVSPAVCQLYPAAYTAVRGLATRQTSSSLNDPNPNWSNRPPKETILLDGCDFEHWLI  341
            PL  V  +  +L PA     R L+TR T+SSL DPNPNWSNRPPKETILLDGCDFEHWL+
Sbjct  52   PLAGVMASXGRLSPAI---XRCLSTRSTTSSLRDPNPNWSNRPPKETILLDGCDFEHWLV  108

Query  342  VMEKPEGDPTRDEIIDSYIKTLAQVVGSEEEARMKIYSVSTRHYYAFGALVSEELSYKLK  521
            VME P+G  TRDEII+SYIKTLA VVGSEEEARMKIYSVSTR YYAFGALVSEE+S K+K
Sbjct  109  VMEAPQGXITRDEIINSYIKTLATVVGSEEEARMKIYSVSTRCYYAFGALVSEEVSLKIK  168

Query  522  ELKGVRWVLPDSYLDVKNKDYGGEPFINGQAVPYD  626
            EL GVRWVLPDSYLDVKNKDYGGEPFINGQAVPYD
Sbjct  169  ELPGVRWVLPDSYLDVKNKDYGGEPFINGQAVPYD  203



>ref|XP_002894432.1| hypothetical protein ARALYDRAFT_892358 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH70691.1| hypothetical protein ARALYDRAFT_892358 [Arabidopsis lyrata subsp. 
lyrata]
Length=410

 Score =   249 bits (637),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 132/200 (66%), Positives = 154/200 (77%), Gaps = 14/200 (7%)
 Frame = +3

Query  60   LSRSLITAGKQLF-----RSYSSLTPPRNFLAFSSF------RLRPLVSVSPAVCQLYPA  206
            +SRS++    + F     RS+SS +P  N  A S        R R LV+       L  A
Sbjct  3    ISRSILRRPAKSFSSLFTRSFSSSSPLANSPAVSRSASSLLNRSRSLVA---GFSALVRA  59

Query  207  AYTAVRGLATRQTSSSLNDPNPNWSNRPPKETILLDGCDFEHWLIVMEKPEGDPTRDEII  386
              ++ R ++T+ TSSSLNDPNPNWSN+PPKETILLDGCDFEHWL+VMEKPEGD TRDEII
Sbjct  60   GVSSARCMSTQATSSSLNDPNPNWSNKPPKETILLDGCDFEHWLVVMEKPEGDLTRDEII  119

Query  387  DSYIKTLAQVVGSEEEARMKIYSVSTRHYYAFGALVSEELSYKLKELKGVRWVLPDSYLD  566
            D YIKTLAQVVGSEEEARMKIYSVS + Y+AFGALVSE+LSYK+KEL  VRWVLPDSYLD
Sbjct  120  DYYIKTLAQVVGSEEEARMKIYSVSHKCYFAFGALVSEDLSYKIKELPKVRWVLPDSYLD  179

Query  567  VKNKDYGGEPFINGQAVPYD  626
            VK+K+YGGEPFI+G+AVPYD
Sbjct  180  VKSKNYGGEPFIDGKAVPYD  199



>ref|XP_010675416.1| PREDICTED: uncharacterized protein At3g15000, mitochondrial [Beta 
vulgaris subsp. vulgaris]
Length=446

 Score =   250 bits (638),  Expect = 4e-77, Method: Compositional matrix adjust.
 Identities = 125/179 (70%), Positives = 143/179 (80%), Gaps = 1/179 (1%)
 Frame = +3

Query  93   LFRSYSSLTPPRNFLAFSSFRLRPLVSVSPAVCQLYPAAYT-AVRGLATRQTSSSLNDPN  269
            L R +S+ T   + L+ + F L    S++     L PA+ + A R  ATR + +SL+D N
Sbjct  27   LSRPFSAATTTSSALSRAHFSLLRASSIALCGASLSPASSSGAFRTFATRPSQTSLSDNN  86

Query  270  PNWSNRPPKETILLDGCDFEHWLIVMEKPEGDPTRDEIIDSYIKTLAQVVGSEEEARMKI  449
             NWSNRPPKETILLDGCDFEHWL+V E P  + TRD+IIDSYIKTLAQ+VGSEEEARMKI
Sbjct  87   SNWSNRPPKETILLDGCDFEHWLVVTEPPAENATRDDIIDSYIKTLAQIVGSEEEARMKI  146

Query  450  YSVSTRHYYAFGALVSEELSYKLKELKGVRWVLPDSYLDVKNKDYGGEPFINGQAVPYD  626
            YSVST+HY+AFGALVSEELSYKLKEL  VRWVLPDSYLDVKNKDYGGEPFINGQAVPYD
Sbjct  147  YSVSTKHYFAFGALVSEELSYKLKELPNVRWVLPDSYLDVKNKDYGGEPFINGQAVPYD  205



>ref|XP_006370177.1| hypothetical protein POPTR_0001s40390g [Populus trichocarpa]
 gb|ERP66746.1| hypothetical protein POPTR_0001s40390g [Populus trichocarpa]
Length=392

 Score =   248 bits (632),  Expect = 8e-77, Method: Compositional matrix adjust.
 Identities = 114/124 (92%), Positives = 120/124 (97%), Gaps = 0/124 (0%)
 Frame = +3

Query  255  LNDPNPNWSNRPPKETILLDGCDFEHWLIVMEKPEGDPTRDEIIDSYIKTLAQVVGSEEE  434
            LNDP+PNWSNRPPKETILLDGCDFEHWL+VMEKPEGDPTRDEIIDSYIKTLAQVVGSEEE
Sbjct  78   LNDPSPNWSNRPPKETILLDGCDFEHWLVVMEKPEGDPTRDEIIDSYIKTLAQVVGSEEE  137

Query  435  ARMKIYSVSTRHYYAFGALVSEELSYKLKELKGVRWVLPDSYLDVKNKDYGGEPFINGQA  614
            AR KIYSVSTR YYAFGALV EE+SYK+KELK VRWVLPDSYLDVKNKDYGGEPFI+G+A
Sbjct  138  ARRKIYSVSTRCYYAFGALVPEEVSYKIKELKNVRWVLPDSYLDVKNKDYGGEPFIDGKA  197

Query  615  VPYD  626
            VPYD
Sbjct  198  VPYD  201



>ref|XP_008365859.1| PREDICTED: uncharacterized protein At3g15000, mitochondrial-like 
isoform X3 [Malus domestica]
Length=332

 Score =   245 bits (626),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 118/136 (87%), Positives = 125/136 (92%), Gaps = 0/136 (0%)
 Frame = +3

Query  219  VRGLATRQTSSSLNDPNPNWSNRPPKETILLDGCDFEHWLIVMEKPEGDPTRDEIIDSYI  398
            VR L+TR T+SSL DPNPNWSNRPPKETILLDGCDFEHWL+VME P+G  TRDEII+SYI
Sbjct  12   VRCLSTRSTTSSLRDPNPNWSNRPPKETILLDGCDFEHWLVVMEAPQGVITRDEIINSYI  71

Query  399  KTLAQVVGSEEEARMKIYSVSTRHYYAFGALVSEELSYKLKELKGVRWVLPDSYLDVKNK  578
            KTLA VVGSEEEARMKIYSVSTR YYAFGALVSEE+S K+KEL GVRWVLPDSYLDVKNK
Sbjct  72   KTLATVVGSEEEARMKIYSVSTRCYYAFGALVSEEVSLKIKELPGVRWVLPDSYLDVKNK  131

Query  579  DYGGEPFINGQAVPYD  626
            DYGGEPFINGQA PYD
Sbjct  132  DYGGEPFINGQAXPYD  147



>ref|XP_011006500.1| PREDICTED: uncharacterized protein At3g15000, mitochondrial isoform 
X2 [Populus euphratica]
Length=395

 Score =   246 bits (628),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 135/190 (71%), Positives = 154/190 (81%), Gaps = 7/190 (4%)
 Frame = +3

Query  63   SRSLITAGKQLFRSYSSLTPPRNFLAFSSFR--LRPLVSVSPAVCQLYPAAYTAVRGLAT  236
            S++LI++   L RS++S +P     + S  R  LRPL   S A       +  ++R  ++
Sbjct  17   SQTLISS--ILSRSFTSHSPTSTACSSSLLRRFLRPL---SAATNINRSVSRISIRSFSS  71

Query  237  RQTSSSLNDPNPNWSNRPPKETILLDGCDFEHWLIVMEKPEGDPTRDEIIDSYIKTLAQV  416
             Q SSSLNDP+PNWSNRPPKETILLDGCDFEHWL+VMEKPEGDPTRDEIIDSYIKTLAQV
Sbjct  72   SQKSSSLNDPSPNWSNRPPKETILLDGCDFEHWLVVMEKPEGDPTRDEIIDSYIKTLAQV  131

Query  417  VGSEEEARMKIYSVSTRHYYAFGALVSEELSYKLKELKGVRWVLPDSYLDVKNKDYGGEP  596
            VGSEEEAR KIYSVSTR YYAFGALV EE+SYK+KELK VRWVLPDSYLDVKNKDYGGEP
Sbjct  132  VGSEEEARRKIYSVSTRCYYAFGALVPEEVSYKIKELKNVRWVLPDSYLDVKNKDYGGEP  191

Query  597  FINGQAVPYD  626
            FI+G+AVPYD
Sbjct  192  FIDGKAVPYD  201



>ref|XP_009116545.1| PREDICTED: uncharacterized protein At3g15000, mitochondrial-like 
[Brassica rapa]
Length=333

 Score =   244 bits (622),  Expect = 5e-76, Method: Compositional matrix adjust.
 Identities = 126/196 (64%), Positives = 153/196 (78%), Gaps = 8/196 (4%)
 Frame = +3

Query  48   MATL-LSRSLITAGKQLFRSYSSLTPPRNFLAFSSF--RLRPLVSVSPAVCQLYPAAYTA  218
            MAT  +SRS+    + L RS++S  P     A  S     RPL +   A+  +    + +
Sbjct  1    MATRSISRSIP---RLLTRSFASSAPLSKTPAAPSLLSSSRPLAAA--ALSSVLRGGFVS  55

Query  219  VRGLATRQTSSSLNDPNPNWSNRPPKETILLDGCDFEHWLIVMEKPEGDPTRDEIIDSYI  398
            V+GL+++ T+SSL DP+PNWSNRPPKETILLDGCDFEHWL+V++ P+GD TRDEIID YI
Sbjct  56   VKGLSSQATASSLKDPSPNWSNRPPKETILLDGCDFEHWLVVVDPPQGDLTRDEIIDGYI  115

Query  399  KTLAQVVGSEEEARMKIYSVSTRHYYAFGALVSEELSYKLKELKGVRWVLPDSYLDVKNK  578
            KTLAQ+VG EEEARMKIYSVS R Y+AFGALVSE+LS+KLKEL  VRWVLPDSYLDV+NK
Sbjct  116  KTLAQIVGGEEEARMKIYSVSHRCYFAFGALVSEDLSHKLKELPNVRWVLPDSYLDVRNK  175

Query  579  DYGGEPFINGQAVPYD  626
            DYGGEPFI+G+AVPYD
Sbjct  176  DYGGEPFIDGRAVPYD  191



>ref|XP_011006499.1| PREDICTED: uncharacterized protein At3g15000, mitochondrial isoform 
X1 [Populus euphratica]
Length=407

 Score =   246 bits (627),  Expect = 5e-76, Method: Compositional matrix adjust.
 Identities = 135/190 (71%), Positives = 154/190 (81%), Gaps = 7/190 (4%)
 Frame = +3

Query  63   SRSLITAGKQLFRSYSSLTPPRNFLAFSSFR--LRPLVSVSPAVCQLYPAAYTAVRGLAT  236
            S++LI++   L RS++S +P     + S  R  LRPL   S A       +  ++R  ++
Sbjct  17   SQTLISS--ILSRSFTSHSPTSTACSSSLLRRFLRPL---SAATNINRSVSRISIRSFSS  71

Query  237  RQTSSSLNDPNPNWSNRPPKETILLDGCDFEHWLIVMEKPEGDPTRDEIIDSYIKTLAQV  416
             Q SSSLNDP+PNWSNRPPKETILLDGCDFEHWL+VMEKPEGDPTRDEIIDSYIKTLAQV
Sbjct  72   SQKSSSLNDPSPNWSNRPPKETILLDGCDFEHWLVVMEKPEGDPTRDEIIDSYIKTLAQV  131

Query  417  VGSEEEARMKIYSVSTRHYYAFGALVSEELSYKLKELKGVRWVLPDSYLDVKNKDYGGEP  596
            VGSEEEAR KIYSVSTR YYAFGALV EE+SYK+KELK VRWVLPDSYLDVKNKDYGGEP
Sbjct  132  VGSEEEARRKIYSVSTRCYYAFGALVPEEVSYKIKELKNVRWVLPDSYLDVKNKDYGGEP  191

Query  597  FINGQAVPYD  626
            FI+G+AVPYD
Sbjct  192  FIDGKAVPYD  201



>ref|XP_006660821.1| PREDICTED: uncharacterized protein At3g15000, mitochondrial-like 
[Oryza brachyantha]
Length=397

 Score =   245 bits (626),  Expect = 8e-76, Method: Compositional matrix adjust.
 Identities = 128/175 (73%), Positives = 136/175 (78%), Gaps = 16/175 (9%)
 Frame = +3

Query  138  AFSSFRLRPLVSVSPAVCQLYPAAYT-------AVRGLATRQTSSSLNDPNPNWSNRPPK  296
            A SS  LRPL     A   L PAA           R  AT+  +SSL D +PNWSNRPPK
Sbjct  16   AASSRLLRPLA----AAGSLLPAALAPSAPRAAGARCFATQPATSSLRDSSPNWSNRPPK  71

Query  297  ETILLDGCDFEHWLIVMEKPEGDP-----TRDEIIDSYIKTLAQVVGSEEEARMKIYSVS  461
            ETILLDGCDFEHWL+VME P GDP     TRDEIIDSYIKTLAQVVGSEEEAR KIYSVS
Sbjct  72   ETILLDGCDFEHWLVVMEPPPGDPSNPEPTRDEIIDSYIKTLAQVVGSEEEARHKIYSVS  131

Query  462  TRHYYAFGALVSEELSYKLKELKGVRWVLPDSYLDVKNKDYGGEPFINGQAVPYD  626
            TRHY+AFGALVSEE+SYK+KEL  VRWVLPDSYLDVKNKDYGGEPFING+AVPYD
Sbjct  132  TRHYFAFGALVSEEVSYKIKELPKVRWVLPDSYLDVKNKDYGGEPFINGEAVPYD  186



>ref|XP_009342294.1| PREDICTED: uncharacterized protein At3g15000, mitochondrial-like 
[Pyrus x bretschneideri]
Length=200

 Score =   238 bits (607),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 127/186 (68%), Positives = 142/186 (76%), Gaps = 4/186 (2%)
 Frame = +3

Query  45   GMATLLSRSLITAGKQLFRSYSSLTPPRNFLAFSSFRLRPLVSVSPAVCQLYPAAYTAVR  224
             +A+ LSRSL TA      S ++    R+       RLRPL  V  +  +L PA    VR
Sbjct  15   AVASFLSRSLSTATSATSLS-TTAAQSRSSSLSLLHRLRPLAGVMASAGRLSPAI---VR  70

Query  225  GLATRQTSSSLNDPNPNWSNRPPKETILLDGCDFEHWLIVMEKPEGDPTRDEIIDSYIKT  404
             L+TR T+SSL DPNPNWSNRPPKETILLDGCDFEHWL+VME P+GD TRDEII+SYIKT
Sbjct  71   CLSTRSTTSSLRDPNPNWSNRPPKETILLDGCDFEHWLVVMEAPQGDITRDEIINSYIKT  130

Query  405  LAQVVGSEEEARMKIYSVSTRHYYAFGALVSEELSYKLKELKGVRWVLPDSYLDVKNKDY  584
            LA VVGSEEEARMKIYSVSTR YYAFGALVSEE+S K+KEL GVRWVLPDSYLDVKNKDY
Sbjct  131  LATVVGSEEEARMKIYSVSTRCYYAFGALVSEEVSLKIKELPGVRWVLPDSYLDVKNKDY  190

Query  585  GGEPFI  602
            GG   +
Sbjct  191  GGTDML  196



>gb|ADE77519.1| unknown [Picea sitchensis]
Length=280

 Score =   240 bits (613),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 110/136 (81%), Positives = 121/136 (89%), Gaps = 0/136 (0%)
 Frame = +3

Query  219  VRGLATRQTSSSLNDPNPNWSNRPPKETILLDGCDFEHWLIVMEKPEGDPTRDEIIDSYI  398
             R  A   T+SS+ DP+PNWSNRPPKETILLDGCD+EHWLIV+E PEG PTRDEIIDSYI
Sbjct  66   TRSFAANPTTSSMTDPSPNWSNRPPKETILLDGCDYEHWLIVLEPPEGSPTRDEIIDSYI  125

Query  399  KTLAQVVGSEEEARMKIYSVSTRHYYAFGALVSEELSYKLKELKGVRWVLPDSYLDVKNK  578
            KTL+QVVGSEEEARMKIYSVST+HY+AFG L+SEELSYKLK +K VRWVLPDSYLD + K
Sbjct  126  KTLSQVVGSEEEARMKIYSVSTKHYFAFGCLISEELSYKLKPMKNVRWVLPDSYLDPRTK  185

Query  579  DYGGEPFINGQAVPYD  626
             YGGEPFINGQAVPYD
Sbjct  186  SYGGEPFINGQAVPYD  201



>gb|ABK92532.1| unknown [Populus trichocarpa]
Length=413

 Score =   244 bits (622),  Expect = 4e-75, Method: Compositional matrix adjust.
 Identities = 112/124 (90%), Positives = 121/124 (98%), Gaps = 0/124 (0%)
 Frame = +3

Query  255  LNDPNPNWSNRPPKETILLDGCDFEHWLIVMEKPEGDPTRDEIIDSYIKTLAQVVGSEEE  434
            LNDP+PNWSNRPPKETILLDGCDFEHWL+VM+KPEGDPTRDEIIDSYIKTLA+VVGSEEE
Sbjct  77   LNDPSPNWSNRPPKETILLDGCDFEHWLVVMDKPEGDPTRDEIIDSYIKTLAEVVGSEEE  136

Query  435  ARMKIYSVSTRHYYAFGALVSEELSYKLKELKGVRWVLPDSYLDVKNKDYGGEPFINGQA  614
            AR KIYSVSTR Y+AFGALVSEE+SYK+KELK VRWVLPDSYLDVKNKDYGGEPFI+G+A
Sbjct  137  ARKKIYSVSTRCYFAFGALVSEEVSYKIKELKNVRWVLPDSYLDVKNKDYGGEPFIDGKA  196

Query  615  VPYD  626
            VPYD
Sbjct  197  VPYD  200



>ref|XP_002316870.1| unknown mitochondrial family protein [Populus trichocarpa]
 gb|EEE97482.1| unknown mitochondrial family protein [Populus trichocarpa]
Length=413

 Score =   244 bits (622),  Expect = 4e-75, Method: Compositional matrix adjust.
 Identities = 112/124 (90%), Positives = 121/124 (98%), Gaps = 0/124 (0%)
 Frame = +3

Query  255  LNDPNPNWSNRPPKETILLDGCDFEHWLIVMEKPEGDPTRDEIIDSYIKTLAQVVGSEEE  434
            LNDP+PNWSNRPPKETILLDGCDFEHWL+VM+KPEGDPTRDEIIDSYIKTLA+VVGSEEE
Sbjct  77   LNDPSPNWSNRPPKETILLDGCDFEHWLVVMDKPEGDPTRDEIIDSYIKTLAEVVGSEEE  136

Query  435  ARMKIYSVSTRHYYAFGALVSEELSYKLKELKGVRWVLPDSYLDVKNKDYGGEPFINGQA  614
            AR KIYSVSTR Y+AFGALVSEE+SYK+KELK VRWVLPDSYLDVKNKDYGGEPFI+G+A
Sbjct  137  ARKKIYSVSTRCYFAFGALVSEEVSYKIKELKNVRWVLPDSYLDVKNKDYGGEPFIDGKA  196

Query  615  VPYD  626
            VPYD
Sbjct  197  VPYD  200



>ref|XP_008437005.1| PREDICTED: uncharacterized protein At3g15000, mitochondrial-like 
[Cucumis melo]
Length=382

 Score =   243 bits (619),  Expect = 5e-75, Method: Compositional matrix adjust.
 Identities = 121/159 (76%), Positives = 132/159 (83%), Gaps = 3/159 (2%)
 Frame = +3

Query  153  RLRPLVSVSPA-VCQLYPAAYTAVRGLATRQTSSSLNDPNPNWSNRPPKETILLDGCDFE  329
            R RPL ++  A   +L PA    V+  +TR  SSSLNDPNPNWSNR PKETILLDGCDFE
Sbjct  47   RFRPLAAIPAADFRRLSPAP--TVKDFSTRVASSSLNDPNPNWSNRTPKETILLDGCDFE  104

Query  330  HWLIVMEKPEGDPTRDEIIDSYIKTLAQVVGSEEEARMKIYSVSTRHYYAFGALVSEELS  509
            HWL+VME P+   TRDEIIDSYIKTLA VVGSEEEARMKIYSVSTR Y+AFG LVSEELS
Sbjct  105  HWLVVMENPDEQLTRDEIIDSYIKTLAMVVGSEEEARMKIYSVSTRCYFAFGCLVSEELS  164

Query  510  YKLKELKGVRWVLPDSYLDVKNKDYGGEPFINGQAVPYD  626
            YK+KEL  VRWVLPDSYLDVKNK YGGEPFI+G+AVPYD
Sbjct  165  YKIKELPKVRWVLPDSYLDVKNKSYGGEPFIDGEAVPYD  203



>ref|XP_011029551.1| PREDICTED: uncharacterized protein At3g15000, mitochondrial-like 
[Populus euphratica]
Length=403

 Score =   243 bits (621),  Expect = 5e-75, Method: Compositional matrix adjust.
 Identities = 112/124 (90%), Positives = 121/124 (98%), Gaps = 0/124 (0%)
 Frame = +3

Query  255  LNDPNPNWSNRPPKETILLDGCDFEHWLIVMEKPEGDPTRDEIIDSYIKTLAQVVGSEEE  434
            LNDP+PNWSNRPPKETILLDGCDFEHWL+VM+KPEGDPTRDEIIDSYIKTLA+VVGSEEE
Sbjct  77   LNDPSPNWSNRPPKETILLDGCDFEHWLVVMDKPEGDPTRDEIIDSYIKTLAEVVGSEEE  136

Query  435  ARMKIYSVSTRHYYAFGALVSEELSYKLKELKGVRWVLPDSYLDVKNKDYGGEPFINGQA  614
            AR KIYSVSTR Y+AFGALVSEE+SYK+KELK VRWVLPDSYLDVKNKDYGGEPFI+G+A
Sbjct  137  ARKKIYSVSTRCYFAFGALVSEEVSYKIKELKNVRWVLPDSYLDVKNKDYGGEPFIDGRA  196

Query  615  VPYD  626
            VPYD
Sbjct  197  VPYD  200



>ref|XP_010489836.1| PREDICTED: uncharacterized protein At3g15000, mitochondrial-like 
[Camelina sativa]
Length=193

 Score =   235 bits (600),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 112/145 (77%), Positives = 129/145 (89%), Gaps = 2/145 (1%)
 Frame = +3

Query  159  RPLVSVSPAVCQLYPAAYTAVRGLATRQTSSSLNDPNPNWSNRPPKETILLDGCDFEHWL  338
            RPLV+   +V +       +V+GL+T+ TSSSL+DPNPNWSNRPPKETILLDGCDFEHWL
Sbjct  50   RPLVAAFSSVVR--GGGLVSVKGLSTQATSSSLSDPNPNWSNRPPKETILLDGCDFEHWL  107

Query  339  IVMEKPEGDPTRDEIIDSYIKTLAQVVGSEEEARMKIYSVSTRHYYAFGALVSEELSYKL  518
            +V+E PEG+PTRDEIIDSYIKTLAQ+VGSEEEARMKIYSVSTR YYAFGALVSE+LS+K+
Sbjct  108  VVVEPPEGEPTRDEIIDSYIKTLAQIVGSEEEARMKIYSVSTRCYYAFGALVSEDLSHKI  167

Query  519  KELKGVRWVLPDSYLDVKNKDYGGE  593
            KEL  VRWVLPDSYLDV+NKDYGG+
Sbjct  168  KELPKVRWVLPDSYLDVRNKDYGGK  192



>dbj|BAJ86595.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=416

 Score =   242 bits (617),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 118/146 (81%), Positives = 126/146 (86%), Gaps = 5/146 (3%)
 Frame = +3

Query  204  AAYTAVRGLATRQTSSSLNDPNPNWSNRPPKETILLDGCDFEHWLIVMEKPEGDP-----  368
            AA  AVR  AT+  +SSL D +PNWSNRPPKETILLDGCDFEHWL+VME P GD      
Sbjct  45   AARGAVRCFATQPATSSLRDNSPNWSNRPPKETILLDGCDFEHWLVVMEPPAGDAANPDV  104

Query  369  TRDEIIDSYIKTLAQVVGSEEEARMKIYSVSTRHYYAFGALVSEELSYKLKELKGVRWVL  548
            TRDEIIDSYIKTLAQVVGSE+EAR KIYSVSTRHY+AFGALVSEELSYKLKEL  VRWVL
Sbjct  105  TRDEIIDSYIKTLAQVVGSEQEARQKIYSVSTRHYFAFGALVSEELSYKLKELPKVRWVL  164

Query  549  PDSYLDVKNKDYGGEPFINGQAVPYD  626
            PDSYLDV+NKDYGGEPFI G+AVPYD
Sbjct  165  PDSYLDVRNKDYGGEPFIGGEAVPYD  190



>ref|XP_002465768.1| hypothetical protein SORBIDRAFT_01g045460 [Sorghum bicolor]
 gb|EER92766.1| hypothetical protein SORBIDRAFT_01g045460 [Sorghum bicolor]
Length=388

 Score =   240 bits (612),  Expect = 7e-74, Method: Compositional matrix adjust.
 Identities = 116/142 (82%), Positives = 124/142 (87%), Gaps = 5/142 (4%)
 Frame = +3

Query  216  AVRGLATRQTSSSLNDPNPNWSNRPPKETILLDGCDFEHWLIVMEKPEGDP-----TRDE  380
             VR  AT+  +SSL D +PNWSNRPPKETILLDGCDFEHWL+VME P GD      TRDE
Sbjct  49   GVRCFATQPATSSLRDSSPNWSNRPPKETILLDGCDFEHWLVVMEPPPGDASNPDITRDE  108

Query  381  IIDSYIKTLAQVVGSEEEARMKIYSVSTRHYYAFGALVSEELSYKLKELKGVRWVLPDSY  560
            IIDSYIKTLAQ+VGSEEEAR KIYSVSTRHY+AFGALVSEELSYKLKE+  VRWVLPDSY
Sbjct  109  IIDSYIKTLAQIVGSEEEARQKIYSVSTRHYFAFGALVSEELSYKLKEMPKVRWVLPDSY  168

Query  561  LDVKNKDYGGEPFINGQAVPYD  626
            LDVKNKDYGGEPFING+AVPYD
Sbjct  169  LDVKNKDYGGEPFINGEAVPYD  190



>gb|AFW89500.1| DAG protein [Zea mays]
Length=410

 Score =   240 bits (612),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 116/141 (82%), Positives = 123/141 (87%), Gaps = 5/141 (4%)
 Frame = +3

Query  219  VRGLATRQTSSSLNDPNPNWSNRPPKETILLDGCDFEHWLIVMEKPEGDP-----TRDEI  383
            VR  AT+  +SSL D +PNWSNRPPKETILLDGCDFEHWL++ME P GD      TRDEI
Sbjct  51   VRCFATQPATSSLRDSSPNWSNRPPKETILLDGCDFEHWLVIMEPPPGDASNPDITRDEI  110

Query  384  IDSYIKTLAQVVGSEEEARMKIYSVSTRHYYAFGALVSEELSYKLKELKGVRWVLPDSYL  563
            IDSYIKTLAQVVGSEEEAR KIYSVSTRHY+ FGALVSEELSYKLKE+  VRWVLPDSYL
Sbjct  111  IDSYIKTLAQVVGSEEEARQKIYSVSTRHYFGFGALVSEELSYKLKEIPKVRWVLPDSYL  170

Query  564  DVKNKDYGGEPFINGQAVPYD  626
            DVKNKDYGGEPFINGQAVPYD
Sbjct  171  DVKNKDYGGEPFINGQAVPYD  191



>ref|NP_001149362.1| DAG protein [Zea mays]
 gb|ACG35154.1| DAG protein [Zea mays]
Length=420

 Score =   240 bits (613),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 116/141 (82%), Positives = 123/141 (87%), Gaps = 5/141 (4%)
 Frame = +3

Query  219  VRGLATRQTSSSLNDPNPNWSNRPPKETILLDGCDFEHWLIVMEKPEGDP-----TRDEI  383
            VR  AT+  +SSL D +PNWSNRPPKETILLDGCDFEHWL++ME P GD      TRDEI
Sbjct  52   VRCFATQPATSSLRDSSPNWSNRPPKETILLDGCDFEHWLVIMEPPPGDASNPDITRDEI  111

Query  384  IDSYIKTLAQVVGSEEEARMKIYSVSTRHYYAFGALVSEELSYKLKELKGVRWVLPDSYL  563
            IDSYIKTLAQVVGSEEEAR KIYSVSTRHY+ FGALVSEELSYKLKE+  VRWVLPDSYL
Sbjct  112  IDSYIKTLAQVVGSEEEARQKIYSVSTRHYFGFGALVSEELSYKLKEIPKVRWVLPDSYL  171

Query  564  DVKNKDYGGEPFINGQAVPYD  626
            DVKNKDYGGEPFINGQAVPYD
Sbjct  172  DVKNKDYGGEPFINGQAVPYD  192



>ref|XP_008451723.1| PREDICTED: uncharacterized protein At3g15000, mitochondrial-like 
[Cucumis melo]
Length=472

 Score =   241 bits (615),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 120/155 (77%), Positives = 132/155 (85%), Gaps = 1/155 (1%)
 Frame = +3

Query  162  PLVSVSPAVCQLYPAAYTAVRGLATRQTSSSLNDPNPNWSNRPPKETILLDGCDFEHWLI  341
            PL ++  A    + AA  +VR  +TR TSSS+ DPNPN S+RPPKETILLDGCDFEHWL+
Sbjct  45   PLAAILAADFLCHSAA-PSVRVFSTRSTSSSIKDPNPNSSSRPPKETILLDGCDFEHWLV  103

Query  342  VMEKPEGDPTRDEIIDSYIKTLAQVVGSEEEARMKIYSVSTRHYYAFGALVSEELSYKLK  521
            VMEKP+   TRDEIID+YIKTLA VVGSEEEARMKIYSVSTR Y+AFG LVSEELSYK+K
Sbjct  104  VMEKPDDQLTRDEIIDTYIKTLAMVVGSEEEARMKIYSVSTRCYFAFGCLVSEELSYKIK  163

Query  522  ELKGVRWVLPDSYLDVKNKDYGGEPFINGQAVPYD  626
            EL  VRWVLPDSYLDVKNKDYGGEPFINGQAVPYD
Sbjct  164  ELPKVRWVLPDSYLDVKNKDYGGEPFINGQAVPYD  198



>ref|XP_010235342.1| PREDICTED: uncharacterized protein At3g15000, mitochondrial [Brachypodium 
distachyon]
Length=452

 Score =   239 bits (611),  Expect = 5e-73, Method: Compositional matrix adjust.
 Identities = 115/141 (82%), Positives = 124/141 (88%), Gaps = 5/141 (4%)
 Frame = +3

Query  219  VRGLATRQTSSSLNDPNPNWSNRPPKETILLDGCDFEHWLIVMEKPEGDP-----TRDEI  383
            VR  AT+  +SSL D +PNWSNRPPKETILLDGCDFEHWL+VME P GD      TRDEI
Sbjct  54   VRCFATQPATSSLRDSSPNWSNRPPKETILLDGCDFEHWLVVMEPPPGDASNPEITRDEI  113

Query  384  IDSYIKTLAQVVGSEEEARMKIYSVSTRHYYAFGALVSEELSYKLKELKGVRWVLPDSYL  563
            IDSYIKTLAQ+VGSEEEA+ KIYSVSTRHY+AFGALVSEELSYKLKEL  VRWVLPDSYL
Sbjct  114  IDSYIKTLAQIVGSEEEAKQKIYSVSTRHYFAFGALVSEELSYKLKELPKVRWVLPDSYL  173

Query  564  DVKNKDYGGEPFINGQAVPYD  626
            DV+NKDYGGEPFING+AVPYD
Sbjct  174  DVRNKDYGGEPFINGEAVPYD  194



>ref|XP_004974019.1| PREDICTED: uncharacterized protein At3g15000, mitochondrial-like 
[Setaria italica]
Length=403

 Score =   237 bits (605),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 114/143 (80%), Positives = 123/143 (86%), Gaps = 5/143 (3%)
 Frame = +3

Query  213  TAVRGLATRQTSSSLNDPNPNWSNRPPKETILLDGCDFEHWLIVMEKPEGDP-----TRD  377
              +R  AT+  +SSL D +PNWSNRPPKETILLDGCDFEHWL+VME P+GDP     TRD
Sbjct  56   AGIRCFATQPATSSLRDSSPNWSNRPPKETILLDGCDFEHWLVVMEPPQGDPANPDVTRD  115

Query  378  EIIDSYIKTLAQVVGSEEEARMKIYSVSTRHYYAFGALVSEELSYKLKELKGVRWVLPDS  557
            EII  YI+TLA VVGSEEEAR KIYSVSTRHY+AFGALVSEELSYKLKEL  VRWVLPDS
Sbjct  116  EIIKGYIETLASVVGSEEEARQKIYSVSTRHYFAFGALVSEELSYKLKELPKVRWVLPDS  175

Query  558  YLDVKNKDYGGEPFINGQAVPYD  626
            YLDVKNKDYGGEPFING+AVPYD
Sbjct  176  YLDVKNKDYGGEPFINGEAVPYD  198



>ref|XP_008365858.1| PREDICTED: uncharacterized protein LOC103429486 isoform X2 [Malus 
domestica]
Length=383

 Score =   236 bits (602),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 115/154 (75%), Positives = 127/154 (82%), Gaps = 3/154 (2%)
 Frame = +3

Query  153  RLRPLVSVSPAVCQLYPAAYTAVRGLATRQTSSSLNDPNPNWSNRPPKETILLDGCDFEH  332
            RL PL  V  +  +L PA    VR L+TR T+SSL DPNPNWSNRPPKETILLDGCDFEH
Sbjct  70   RLHPLAGVMASAGRLSPAI---VRCLSTRSTTSSLRDPNPNWSNRPPKETILLDGCDFEH  126

Query  333  WLIVMEKPEGDPTRDEIIDSYIKTLAQVVGSEEEARMKIYSVSTRHYYAFGALVSEELSY  512
            WL+VME P+G  TRDEII+SYIKTLA VVGSEEEARMKIYSVSTR YYAFGALVSEE+S 
Sbjct  127  WLVVMEAPQGVITRDEIINSYIKTLATVVGSEEEARMKIYSVSTRCYYAFGALVSEEVSL  186

Query  513  KLKELKGVRWVLPDSYLDVKNKDYGGEPFINGQA  614
            K+KEL GVRWVLPDSYLDVKNKDYG +  + G+ 
Sbjct  187  KIKELPGVRWVLPDSYLDVKNKDYGDQGTLKGEG  220



>ref|NP_001063625.1| Os09g0509000 [Oryza sativa Japonica Group]
 dbj|BAF25539.1| Os09g0509000 [Oryza sativa Japonica Group]
 dbj|BAG97502.1| unnamed protein product [Oryza sativa Japonica Group]
Length=396

 Score =   236 bits (603),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 114/138 (83%), Positives = 122/138 (88%), Gaps = 5/138 (4%)
 Frame = +3

Query  228  LATRQTSSSLNDPNPNWSNRPPKETILLDGCDFEHWLIVMEKPEGDP-----TRDEIIDS  392
             AT+  +SSL D +PNWSNRPPKETILLDGCDFEHWL+V+E P GDP     TRDEIID 
Sbjct  54   FATQPATSSLRDSSPNWSNRPPKETILLDGCDFEHWLVVVEPPPGDPSNPEPTRDEIIDG  113

Query  393  YIKTLAQVVGSEEEARMKIYSVSTRHYYAFGALVSEELSYKLKELKGVRWVLPDSYLDVK  572
            YIKTLAQVVGSEEEAR KIYSVSTRHY+AFGALVSEELSYKLKEL  VRWVLPDSYLDV+
Sbjct  114  YIKTLAQVVGSEEEARHKIYSVSTRHYFAFGALVSEELSYKLKELPKVRWVLPDSYLDVR  173

Query  573  NKDYGGEPFINGQAVPYD  626
            NKDYGGEPFING+AVPYD
Sbjct  174  NKDYGGEPFINGEAVPYD  191



>ref|XP_009386372.1| PREDICTED: uncharacterized protein At3g15000, mitochondrial-like 
isoform X2 [Musa acuminata subsp. malaccensis]
Length=453

 Score =   238 bits (606),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 128/199 (64%), Positives = 144/199 (72%), Gaps = 16/199 (8%)
 Frame = +3

Query  57   LLSRSLITAGKQLFRSYSSLTPPRNFLAFSS--FRLRPLVSVSPAVCQLYP-------AA  209
            +  R LI     L RS  +L+ P   L   S   R RPLV    AV   YP       A 
Sbjct  1    MTQRILIAKLHTLCRSSRALSLP---LVCPSPLLRFRPLV----AVATEYPLLRLNSFAD  53

Query  210  YTAVRGLATRQTSSSLNDPNPNWSNRPPKETILLDGCDFEHWLIVMEKPEGDPTRDEIID  389
             +  R  +TR T+SSLNDP+PNWSNRPPKETILLDGCDFEHWL+VME  +   TRDEIID
Sbjct  54   ASGTRFFSTRPTTSSLNDPSPNWSNRPPKETILLDGCDFEHWLVVMEPADPSLTRDEIID  113

Query  390  SYIKTLAQVVGSEEEARMKIYSVSTRHYYAFGALVSEELSYKLKELKGVRWVLPDSYLDV  569
            SYIKTL+QV+GSEEEARM IYSVST+HY+AFG  VSEE+SYK+K L  VRWVLPDSYLDV
Sbjct  114  SYIKTLSQVLGSEEEARMSIYSVSTKHYFAFGCKVSEEISYKIKPLPKVRWVLPDSYLDV  173

Query  570  KNKDYGGEPFINGQAVPYD  626
            KNKDYGGEPFI+G AVPYD
Sbjct  174  KNKDYGGEPFIDGTAVPYD  192



>gb|KEH39765.1| plastid developmental protein DAG [Medicago truncatula]
Length=327

 Score =   234 bits (596),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 117/178 (66%), Positives = 133/178 (75%), Gaps = 11/178 (6%)
 Frame = +3

Query  123  PRNFLAFSSFRLRPLVSVSPAVCQLYPAAYTAV----------RGLATRQTSSSLNDPNP  272
            P+    F S  L    ++S  +C+L P    AV          R L+TR T+SSLND NP
Sbjct  11   PKTLTPFFSRSLSTTTTLS-FLCRLRPLTAAAVTSRHILLPSFRALSTRPTTSSLNDQNP  69

Query  273  NWSNRPPKETILLDGCDFEHWLIVMEKPEGDPTRDEIIDSYIKTLAQVVGSEEEARMKIY  452
            NWSN  PKETILLDGCDFEHWL++ME P+GD TRDEIID YIKT A+V+G+EE AR  IY
Sbjct  70   NWSNPSPKETILLDGCDFEHWLVIMETPDGDATRDEIIDGYIKTFAEVIGNEELARKNIY  129

Query  453  SVSTRHYYAFGALVSEELSYKLKELKGVRWVLPDSYLDVKNKDYGGEPFINGQAVPYD  626
            SVSTRHY+AFGA+ SEELSYKL EL  VRWVLPDSYL+VK KDYGGEPFINGQAVPYD
Sbjct  130  SVSTRHYFAFGAVCSEELSYKLNELPKVRWVLPDSYLNVKEKDYGGEPFINGQAVPYD  187



>ref|NP_001062627.1| Os09g0132600 [Oryza sativa Japonica Group]
 dbj|BAD22293.1| putative plastid protein [Oryza sativa Japonica Group]
 dbj|BAD34133.1| putative plastid protein [Oryza sativa Japonica Group]
 dbj|BAF24541.1| Os09g0132600 [Oryza sativa Japonica Group]
 gb|EAZ43834.1| hypothetical protein OsJ_28452 [Oryza sativa Japonica Group]
 dbj|BAG98694.1| unnamed protein product [Oryza sativa Japonica Group]
Length=398

 Score =   236 bits (602),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 113/140 (81%), Positives = 123/140 (88%), Gaps = 5/140 (4%)
 Frame = +3

Query  222  RGLATRQTSSSLNDPNPNWSNRPPKETILLDGCDFEHWLIVMEKPEGDP-----TRDEII  386
            R  AT+  +SSL D +PNWSNRPPKETILLDGCDFEHWL+VM+ P GDP     TRDEII
Sbjct  48   RCFATQPATSSLRDSSPNWSNRPPKETILLDGCDFEHWLVVMDPPPGDPSNPEPTRDEII  107

Query  387  DSYIKTLAQVVGSEEEARMKIYSVSTRHYYAFGALVSEELSYKLKELKGVRWVLPDSYLD  566
            D YIKTLAQ+VGSE+EAR KIYSVSTRHY+AFGALVSEELSYKLKEL  VRWVLPDSYLD
Sbjct  108  DGYIKTLAQIVGSEDEARHKIYSVSTRHYFAFGALVSEELSYKLKELPKVRWVLPDSYLD  167

Query  567  VKNKDYGGEPFINGQAVPYD  626
            V+NKDYGGEPFING+AVPYD
Sbjct  168  VRNKDYGGEPFINGEAVPYD  187



>gb|EAZ08203.1| hypothetical protein OsI_30464 [Oryza sativa Indica Group]
Length=398

 Score =   236 bits (602),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 113/140 (81%), Positives = 123/140 (88%), Gaps = 5/140 (4%)
 Frame = +3

Query  222  RGLATRQTSSSLNDPNPNWSNRPPKETILLDGCDFEHWLIVMEKPEGDP-----TRDEII  386
            R  AT+  +SSL D +PNWSNRPPKETILLDGCDFEHWL+VM+ P GDP     TRDEII
Sbjct  48   RCFATQPATSSLRDSSPNWSNRPPKETILLDGCDFEHWLVVMDPPPGDPSNPEPTRDEII  107

Query  387  DSYIKTLAQVVGSEEEARMKIYSVSTRHYYAFGALVSEELSYKLKELKGVRWVLPDSYLD  566
            D YIKTLAQ+VGSE+EAR KIYSVSTRHY+AFGALVSEELSYKLKEL  VRWVLPDSYLD
Sbjct  108  DGYIKTLAQIVGSEDEARHKIYSVSTRHYFAFGALVSEELSYKLKELPKVRWVLPDSYLD  167

Query  567  VKNKDYGGEPFINGQAVPYD  626
            V+NKDYGGEPFING+AVPYD
Sbjct  168  VRNKDYGGEPFINGEAVPYD  187



>dbj|BAJ93961.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=415

 Score =   236 bits (602),  Expect = 4e-72, Method: Compositional matrix adjust.
 Identities = 127/177 (72%), Positives = 137/177 (77%), Gaps = 18/177 (10%)
 Frame = +3

Query  138  AFSSFRLRPLVSVSPAVCQLYPAA---------YTAVRGLATRQTSSSLNDPNPNWSNRP  290
            A +S  LRPL     A   L PAA         + A R  AT+  +SSL D +PNWSNRP
Sbjct  18   AAASRFLRPLA----AAGSLLPAALVPSPAAAPWAAARRFATQPANSSLRDSSPNWSNRP  73

Query  291  PKETILLDGCDFEHWLIVMEKPEGDP-----TRDEIIDSYIKTLAQVVGSEEEARMKIYS  455
            PKETILLDGCDFEHWL+VME P GD      TRDEIID YIKTLAQVVGSE+EARMKIYS
Sbjct  74   PKETILLDGCDFEHWLVVMEPPPGDGANPDVTRDEIIDGYIKTLAQVVGSEDEARMKIYS  133

Query  456  VSTRHYYAFGALVSEELSYKLKELKGVRWVLPDSYLDVKNKDYGGEPFINGQAVPYD  626
            VSTRHY+AFGALVSEELSYKLKEL  VRWVLPDSYLDV+NKDYGGEPFI+GQAVPYD
Sbjct  134  VSTRHYFAFGALVSEELSYKLKELPKVRWVLPDSYLDVRNKDYGGEPFIDGQAVPYD  190



>ref|XP_009386371.1| PREDICTED: uncharacterized protein At3g15000, mitochondrial-like 
isoform X1 [Musa acuminata subsp. malaccensis]
Length=468

 Score =   238 bits (606),  Expect = 4e-72, Method: Compositional matrix adjust.
 Identities = 128/199 (64%), Positives = 144/199 (72%), Gaps = 16/199 (8%)
 Frame = +3

Query  57   LLSRSLITAGKQLFRSYSSLTPPRNFLAFSS--FRLRPLVSVSPAVCQLYP-------AA  209
            +  R LI     L RS  +L+ P   L   S   R RPLV    AV   YP       A 
Sbjct  1    MTQRILIAKLHTLCRSSRALSLP---LVCPSPLLRFRPLV----AVATEYPLLRLNSFAD  53

Query  210  YTAVRGLATRQTSSSLNDPNPNWSNRPPKETILLDGCDFEHWLIVMEKPEGDPTRDEIID  389
             +  R  +TR T+SSLNDP+PNWSNRPPKETILLDGCDFEHWL+VME  +   TRDEIID
Sbjct  54   ASGTRFFSTRPTTSSLNDPSPNWSNRPPKETILLDGCDFEHWLVVMEPADPSLTRDEIID  113

Query  390  SYIKTLAQVVGSEEEARMKIYSVSTRHYYAFGALVSEELSYKLKELKGVRWVLPDSYLDV  569
            SYIKTL+QV+GSEEEARM IYSVST+HY+AFG  VSEE+SYK+K L  VRWVLPDSYLDV
Sbjct  114  SYIKTLSQVLGSEEEARMSIYSVSTKHYFAFGCKVSEEISYKIKPLPKVRWVLPDSYLDV  173

Query  570  KNKDYGGEPFINGQAVPYD  626
            KNKDYGGEPFI+G AVPYD
Sbjct  174  KNKDYGGEPFIDGTAVPYD  192



>dbj|BAJ90563.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=415

 Score =   236 bits (602),  Expect = 4e-72, Method: Compositional matrix adjust.
 Identities = 127/177 (72%), Positives = 137/177 (77%), Gaps = 18/177 (10%)
 Frame = +3

Query  138  AFSSFRLRPLVSVSPAVCQLYPAA---------YTAVRGLATRQTSSSLNDPNPNWSNRP  290
            A +S  LRPL     A   L PAA         + A R  AT+  +SSL D +PNWSNRP
Sbjct  18   AAASRFLRPLA----AAGSLLPAALVPSPAAAPWAAARRFATQPANSSLRDSSPNWSNRP  73

Query  291  PKETILLDGCDFEHWLIVMEKPEGDP-----TRDEIIDSYIKTLAQVVGSEEEARMKIYS  455
            PKETILLDGCDFEHWL+VME P GD      TRDEIID YIKTLAQVVGSE+EARMKIYS
Sbjct  74   PKETILLDGCDFEHWLVVMEPPPGDGANPDVTRDEIIDGYIKTLAQVVGSEDEARMKIYS  133

Query  456  VSTRHYYAFGALVSEELSYKLKELKGVRWVLPDSYLDVKNKDYGGEPFINGQAVPYD  626
            VSTRHY+AFGALVSEELSYKLKEL  VRWVLPDSYLDV+NKDYGGEPFI+GQAVPYD
Sbjct  134  VSTRHYFAFGALVSEELSYKLKELPKVRWVLPDSYLDVRNKDYGGEPFIDGQAVPYD  190



>ref|XP_009403805.1| PREDICTED: uncharacterized protein At3g15000, mitochondrial-like 
[Musa acuminata subsp. malaccensis]
Length=460

 Score =   237 bits (604),  Expect = 6e-72, Method: Compositional matrix adjust.
 Identities = 116/166 (70%), Positives = 133/166 (80%), Gaps = 9/166 (5%)
 Frame = +3

Query  150  FRLRPLVSVSPAVCQLYP-------AAYTAVRGLATRQTSSSLNDPNPNWSNRPPKETIL  308
             R RPL++ + A    YP            +R  +TR T+SSLNDP+PNWSNRPPKETIL
Sbjct  31   LRFRPLLAAAAAFD--YPLLRLSSTCGAAGLRCFSTRPTTSSLNDPSPNWSNRPPKETIL  88

Query  309  LDGCDFEHWLIVMEKPEGDPTRDEIIDSYIKTLAQVVGSEEEARMKIYSVSTRHYYAFGA  488
            LDGCDFEHWL+VME P+   TRDEIIDSYIKTLA+V+GSEEEARM IYSVST+HY+AFG 
Sbjct  89   LDGCDFEHWLVVMEPPDPALTRDEIIDSYIKTLAEVLGSEEEARMSIYSVSTKHYFAFGC  148

Query  489  LVSEELSYKLKELKGVRWVLPDSYLDVKNKDYGGEPFINGQAVPYD  626
             VSEE+SYK+K L  VRWVLPDSYLDVKNKDYGGEPFI+G+AVPYD
Sbjct  149  KVSEEISYKIKPLSKVRWVLPDSYLDVKNKDYGGEPFIDGKAVPYD  194



>gb|EMS56704.1| hypothetical protein TRIUR3_21760 [Triticum urartu]
Length=648

 Score =   241 bits (616),  Expect = 6e-72, Method: Compositional matrix adjust.
 Identities = 118/146 (81%), Positives = 126/146 (86%), Gaps = 5/146 (3%)
 Frame = +3

Query  204  AAYTAVRGLATRQTSSSLNDPNPNWSNRPPKETILLDGCDFEHWLIVMEKPEGDP-----  368
            AA  AVR  AT+  +SSL D +PNWSNRPPKETILLDGCDFEHWL+VME P GD      
Sbjct  45   AARGAVRCFATQPATSSLRDSSPNWSNRPPKETILLDGCDFEHWLVVMEPPAGDAANPDI  104

Query  369  TRDEIIDSYIKTLAQVVGSEEEARMKIYSVSTRHYYAFGALVSEELSYKLKELKGVRWVL  548
            TRDEIIDSYIKTLAQVVGSE+EAR KIYSVSTRHY+AFGALVSEELSYKLKEL  VRWVL
Sbjct  105  TRDEIIDSYIKTLAQVVGSEQEARQKIYSVSTRHYFAFGALVSEELSYKLKELPKVRWVL  164

Query  549  PDSYLDVKNKDYGGEPFINGQAVPYD  626
            PDSYLDV+NKDYGGEPFI G+AVPYD
Sbjct  165  PDSYLDVRNKDYGGEPFIGGEAVPYD  190



>gb|EAZ45317.1| hypothetical protein OsJ_29960 [Oryza sativa Japonica Group]
Length=396

 Score =   234 bits (598),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 113/136 (83%), Positives = 121/136 (89%), Gaps = 5/136 (4%)
 Frame = +3

Query  234  TRQTSSSLNDPNPNWSNRPPKETILLDGCDFEHWLIVMEKPEGDP-----TRDEIIDSYI  398
            T+  +SSL D +PNWSNRPPKETILLDGCDFEHWL+V+E P GDP     TRDEIID YI
Sbjct  56   TQPATSSLRDSSPNWSNRPPKETILLDGCDFEHWLVVVEPPPGDPSNPEPTRDEIIDGYI  115

Query  399  KTLAQVVGSEEEARMKIYSVSTRHYYAFGALVSEELSYKLKELKGVRWVLPDSYLDVKNK  578
            KTLAQVVGSEEEAR KIYSVSTRHY+AFGALVSEELSYKLKEL  VRWVLPDSYLDV+NK
Sbjct  116  KTLAQVVGSEEEARHKIYSVSTRHYFAFGALVSEELSYKLKELPKVRWVLPDSYLDVRNK  175

Query  579  DYGGEPFINGQAVPYD  626
            DYGGEPFING+AVPYD
Sbjct  176  DYGGEPFINGEAVPYD  191



>ref|XP_004294105.1| PREDICTED: uncharacterized protein At3g15000, mitochondrial-like 
[Fragaria vesca subsp. vesca]
Length=408

 Score =   232 bits (591),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 110/136 (81%), Positives = 120/136 (88%), Gaps = 0/136 (0%)
 Frame = +3

Query  219  VRGLATRQTSSSLNDPNPNWSNRPPKETILLDGCDFEHWLIVMEKPEGDPTRDEIIDSYI  398
            VR  +   T+SSL DPNPNWSNRPPKETILLDGCDFEHWL+VME PE + TR+E+I  YI
Sbjct  71   VRCFSANATTSSLRDPNPNWSNRPPKETILLDGCDFEHWLVVMEPPEENTTREELIKEYI  130

Query  399  KTLAQVVGSEEEARMKIYSVSTRHYYAFGALVSEELSYKLKELKGVRWVLPDSYLDVKNK  578
            KTLA VVGSEEEARMKIYSVST+ Y+AFGALVSEELSYKLK+L  VRWVLPDSYLDVKNK
Sbjct  131  KTLAMVVGSEEEARMKIYSVSTKCYFAFGALVSEELSYKLKDLPKVRWVLPDSYLDVKNK  190

Query  579  DYGGEPFINGQAVPYD  626
            DYGGEPFING+AV YD
Sbjct  191  DYGGEPFINGEAVAYD  206



>ref|XP_008777201.1| PREDICTED: uncharacterized protein At3g15000, mitochondrial-like 
[Phoenix dactylifera]
Length=451

 Score =   233 bits (594),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 129/204 (63%), Positives = 150/204 (74%), Gaps = 14/204 (7%)
 Frame = +3

Query  39   VAGMATLLSRSLITAGKQLF-RSYSSLTPPRNFLAF---SSFRLRPLVSVSPAVCQL-YP  203
            +AG A +     ++    LF RS++S       LAF   SS  LR L +V P V  L  P
Sbjct  1    MAGRALISKLPSVSLSPLLFSRSFASRA-----LAFARPSSSLLR-LRAVLPLVDSLRLP  54

Query  204  AA---YTAVRGLATRQTSSSLNDPNPNWSNRPPKETILLDGCDFEHWLIVMEKPEGDPTR  374
             A   +  VR  + R T+SSLNDP+PNWSNRPPKETILLDGCDFEHWL+VME P+   TR
Sbjct  55   VAGGCFGEVRCFSARPTTSSLNDPSPNWSNRPPKETILLDGCDFEHWLVVMEPPDPSLTR  114

Query  375  DEIIDSYIKTLAQVVGSEEEARMKIYSVSTRHYYAFGALVSEELSYKLKELKGVRWVLPD  554
            DEIIDSYIKTLAQ++GSEEEA+  IYSVST+HY+AFG  VSEE SYK+K L  VRWVLPD
Sbjct  115  DEIIDSYIKTLAQILGSEEEAKKSIYSVSTKHYFAFGCKVSEETSYKIKPLPKVRWVLPD  174

Query  555  SYLDVKNKDYGGEPFINGQAVPYD  626
            SYLDVKNKDYGGEPFI+G+AVPYD
Sbjct  175  SYLDVKNKDYGGEPFIDGKAVPYD  198



>ref|XP_009421014.1| PREDICTED: uncharacterized protein At3g15000, mitochondrial-like 
[Musa acuminata subsp. malaccensis]
Length=467

 Score =   233 bits (594),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 109/141 (77%), Positives = 124/141 (88%), Gaps = 0/141 (0%)
 Frame = +3

Query  204  AAYTAVRGLATRQTSSSLNDPNPNWSNRPPKETILLDGCDFEHWLIVMEKPEGDPTRDEI  383
            A+    R  +TR T+SSLNDP+PNWSNRPPKETILLDGCDFEHWL+V+E P+   TRDEI
Sbjct  52   ASGLGTRCFSTRPTTSSLNDPSPNWSNRPPKETILLDGCDFEHWLVVVEPPDPSLTRDEI  111

Query  384  IDSYIKTLAQVVGSEEEARMKIYSVSTRHYYAFGALVSEELSYKLKELKGVRWVLPDSYL  563
            IDSYIKTLA+V+GSEEEARM IYSVST+HY+AFG  VSEE+SYK+K L  VRWVLPDSYL
Sbjct  112  IDSYIKTLAEVLGSEEEARMSIYSVSTKHYFAFGCKVSEEISYKIKPLPKVRWVLPDSYL  171

Query  564  DVKNKDYGGEPFINGQAVPYD  626
            DVKNKDYGGEPFI+G+AVPYD
Sbjct  172  DVKNKDYGGEPFIDGKAVPYD  192



>ref|XP_002462644.1| hypothetical protein SORBIDRAFT_02g029455 [Sorghum bicolor]
 gb|EER99165.1| hypothetical protein SORBIDRAFT_02g029455 [Sorghum bicolor]
Length=150

 Score =   223 bits (567),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 103/136 (76%), Positives = 118/136 (87%), Gaps = 0/136 (0%)
 Frame = +3

Query  219  VRGLATRQTSSSLNDPNPNWSNRPPKETILLDGCDFEHWLIVMEKPEGDPTRDEIIDSYI  398
             R  AT+  +SS  D +PNW +RPP+ETILLDGCDFEHW +VM+ P GDP R+EIIDSYI
Sbjct  3    TRLFATQPVTSSRRDSSPNWDSRPPRETILLDGCDFEHWFVVMQPPPGDPAREEIIDSYI  62

Query  399  KTLAQVVGSEEEARMKIYSVSTRHYYAFGALVSEELSYKLKELKGVRWVLPDSYLDVKNK  578
            K L++VVGSEE+AR KIYSVSTRHY+AFGALVSEE+S+K+KEL  VRWVLPDSYLDV NK
Sbjct  63   KVLSKVVGSEEKARQKIYSVSTRHYFAFGALVSEEISHKIKELPNVRWVLPDSYLDVDNK  122

Query  579  DYGGEPFINGQAVPYD  626
            DYGGEPFINGQAVPYD
Sbjct  123  DYGGEPFINGQAVPYD  138



>ref|XP_010929499.1| PREDICTED: uncharacterized protein At3g15000, mitochondrial-like 
[Elaeis guineensis]
Length=470

 Score =   233 bits (593),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 111/136 (82%), Positives = 121/136 (89%), Gaps = 0/136 (0%)
 Frame = +3

Query  219  VRGLATRQTSSSLNDPNPNWSNRPPKETILLDGCDFEHWLIVMEKPEGDPTRDEIIDSYI  398
            VR  +TR T+SSLNDP+PNWSNRPPKETILLDGCDFEHWLIVME P+   TRDEIIDSYI
Sbjct  63   VRCFSTRPTTSSLNDPSPNWSNRPPKETILLDGCDFEHWLIVMEPPDPSLTRDEIIDSYI  122

Query  399  KTLAQVVGSEEEARMKIYSVSTRHYYAFGALVSEELSYKLKELKGVRWVLPDSYLDVKNK  578
            KTLAQV+GSEEEAR  IYSVST+HY+AFG  VSEE SYK+K L  VRWVLPDSYLDVKNK
Sbjct  123  KTLAQVLGSEEEARKSIYSVSTKHYFAFGCKVSEETSYKIKPLPKVRWVLPDSYLDVKNK  182

Query  579  DYGGEPFINGQAVPYD  626
            DYGGEPFI+G+AVPYD
Sbjct  183  DYGGEPFIDGKAVPYD  198



>ref|XP_008797096.1| PREDICTED: uncharacterized protein At3g15000, mitochondrial-like 
[Phoenix dactylifera]
Length=448

 Score =   232 bits (591),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 110/136 (81%), Positives = 121/136 (89%), Gaps = 0/136 (0%)
 Frame = +3

Query  219  VRGLATRQTSSSLNDPNPNWSNRPPKETILLDGCDFEHWLIVMEKPEGDPTRDEIIDSYI  398
            VR  +TR T+SSLNDP+PNWSNRPPKETILLDGCDFEHWLIVME P+   TRDEIIDSYI
Sbjct  63   VRCFSTRPTTSSLNDPSPNWSNRPPKETILLDGCDFEHWLIVMEPPDPSLTRDEIIDSYI  122

Query  399  KTLAQVVGSEEEARMKIYSVSTRHYYAFGALVSEELSYKLKELKGVRWVLPDSYLDVKNK  578
            KTLAQV+GSEEEA+  IYSVST+HY+AFG  VSEE SYK+K L  VRWVLPDSYLDVKNK
Sbjct  123  KTLAQVLGSEEEAKQSIYSVSTKHYFAFGCKVSEETSYKIKPLPKVRWVLPDSYLDVKNK  182

Query  579  DYGGEPFINGQAVPYD  626
            DYGGEPFI+G+AVPYD
Sbjct  183  DYGGEPFIDGKAVPYD  198



>ref|XP_010942336.1| PREDICTED: uncharacterized protein At3g15000, mitochondrial-like 
[Elaeis guineensis]
Length=451

 Score =   232 bits (591),  Expect = 4e-70, Method: Compositional matrix adjust.
 Identities = 108/136 (79%), Positives = 121/136 (89%), Gaps = 0/136 (0%)
 Frame = +3

Query  219  VRGLATRQTSSSLNDPNPNWSNRPPKETILLDGCDFEHWLIVMEKPEGDPTRDEIIDSYI  398
            VR  +TR T+SSLNDP+PNWSNRPPKETILLDGCDFEHWL+V+E P+   TRDEIIDSYI
Sbjct  63   VRCFSTRPTTSSLNDPSPNWSNRPPKETILLDGCDFEHWLVVVEPPDPSLTRDEIIDSYI  122

Query  399  KTLAQVVGSEEEARMKIYSVSTRHYYAFGALVSEELSYKLKELKGVRWVLPDSYLDVKNK  578
            KTLAQV+GSEEEA+  IYSVST+HY+AFG  VSEE SYK+K L  VRWVLPDSYLDVKNK
Sbjct  123  KTLAQVLGSEEEAKKSIYSVSTKHYFAFGCKVSEETSYKIKPLPKVRWVLPDSYLDVKNK  182

Query  579  DYGGEPFINGQAVPYD  626
            DYGGEPFI+G+AVPYD
Sbjct  183  DYGGEPFIDGKAVPYD  198



>emb|CDY20096.1| BnaA01g29060D [Brassica napus]
Length=314

 Score =   228 bits (580),  Expect = 5e-70, Method: Compositional matrix adjust.
 Identities = 106/128 (83%), Positives = 120/128 (94%), Gaps = 0/128 (0%)
 Frame = +3

Query  243  TSSSLNDPNPNWSNRPPKETILLDGCDFEHWLIVMEKPEGDPTRDEIIDSYIKTLAQVVG  422
            T+SSL DP+PNWSNRPPKETILLDGCDFEHWL+V++ P+GD TRDEIID Y+KTLAQ+VG
Sbjct  43   TASSLKDPSPNWSNRPPKETILLDGCDFEHWLVVVDPPQGDLTRDEIIDGYVKTLAQIVG  102

Query  423  SEEEARMKIYSVSTRHYYAFGALVSEELSYKLKELKGVRWVLPDSYLDVKNKDYGGEPFI  602
            SEEEARMKIYSVS R Y+AFGALVSE+LS+KLKEL  VRWVLPDSYLDV+NKDYGGEPFI
Sbjct  103  SEEEARMKIYSVSHRCYFAFGALVSEDLSHKLKELPNVRWVLPDSYLDVRNKDYGGEPFI  162

Query  603  NGQAVPYD  626
            +G+AVPYD
Sbjct  163  DGRAVPYD  170



>gb|ABR17737.1| unknown [Picea sitchensis]
Length=224

 Score =   224 bits (571),  Expect = 8e-70, Method: Compositional matrix adjust.
 Identities = 120/203 (59%), Positives = 144/203 (71%), Gaps = 11/203 (5%)
 Frame = +3

Query  36   LVAGMATLLSRSLITA---GKQLFRSYSSLTPPRNF-LAFSSFRLRPLVSVSPAVCQLYP  203
            ++ G A LL  SL  +   G   F + ++L    N  ++ + FR    +    AV    P
Sbjct  2    MILGRALLLRPSLGISSNRGAAFFTTRAALQSAFNGRVSTAGFRGGKFLG---AVSIARP  58

Query  204  AAYT--AVRGLATRQTSSSLNDPNPNWSNRPPKETILLDGCDFEHWLIVMEKPEGDPTRD  377
             A      R  A   T+SS+ DP+PNW  RPPKET+LLDGCD+EHWLIVME P+G PTRD
Sbjct  59   PALVLQKTRSFAANPTTSSMTDPSPNW--RPPKETMLLDGCDYEHWLIVMEPPQGSPTRD  116

Query  378  EIIDSYIKTLAQVVGSEEEARMKIYSVSTRHYYAFGALVSEELSYKLKELKGVRWVLPDS  557
            EIIDSYIKTL+QVVGSEEEARMKIYSVST+HY+AFG L+SEELSYKLK ++ VRWVL DS
Sbjct  117  EIIDSYIKTLSQVVGSEEEARMKIYSVSTKHYFAFGCLISEELSYKLKPMENVRWVLLDS  176

Query  558  YLDVKNKDYGGEPFINGQAVPYD  626
            Y+D + K YGGEPFINGQAVPYD
Sbjct  177  YVDPRTKSYGGEPFINGQAVPYD  199



>ref|XP_008367934.1| PREDICTED: uncharacterized protein LOC103431545 [Malus domestica]
Length=321

 Score =   226 bits (575),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 106/132 (80%), Positives = 117/132 (89%), Gaps = 0/132 (0%)
 Frame = +3

Query  219  VRGLATRQTSSSLNDPNPNWSNRPPKETILLDGCDFEHWLIVMEKPEGDPTRDEIIDSYI  398
            VR L+T+ T+SSL DPNPNWSNRPPKETILLDGCDFEHWL+VME P+G  TRDEII+SYI
Sbjct  12   VRCLSTKSTTSSLRDPNPNWSNRPPKETILLDGCDFEHWLVVMEAPQGVITRDEIINSYI  71

Query  399  KTLAQVVGSEEEARMKIYSVSTRHYYAFGALVSEELSYKLKELKGVRWVLPDSYLDVKNK  578
            KTLA VVGSEEEARMKIYSVSTR YYAFGALVSEE+S K+KEL GVRWVLPDSYLDVKNK
Sbjct  72   KTLATVVGSEEEARMKIYSVSTRCYYAFGALVSEEVSLKIKELPGVRWVLPDSYLDVKNK  131

Query  579  DYGGEPFINGQA  614
            DYG +  + G+ 
Sbjct  132  DYGDQGTLKGEG  143



>ref|XP_006843609.1| hypothetical protein AMTR_s00007p00143190 [Amborella trichopoda]
 gb|ERN05284.1| hypothetical protein AMTR_s00007p00143190 [Amborella trichopoda]
Length=471

 Score =   229 bits (584),  Expect = 7e-69, Method: Compositional matrix adjust.
 Identities = 107/135 (79%), Positives = 121/135 (90%), Gaps = 0/135 (0%)
 Frame = +3

Query  222  RGLATRQTSSSLNDPNPNWSNRPPKETILLDGCDFEHWLIVMEKPEGDPTRDEIIDSYIK  401
            RG +++ T SSL D +PNWSNRPPKETI+LDGCDFEHWL+V+E+PEG+PTRDEII +YIK
Sbjct  65   RGFSSQATISSLRDLSPNWSNRPPKETIVLDGCDFEHWLVVLEQPEGNPTRDEIIGTYIK  124

Query  402  TLAQVVGSEEEARMKIYSVSTRHYYAFGALVSEELSYKLKELKGVRWVLPDSYLDVKNKD  581
            TLAQV+GSEEEAR  IYSVSTR YYAFG +VSEELSYK+K L  VRWVLPDSYLDVKNK 
Sbjct  125  TLAQVLGSEEEARKSIYSVSTRCYYAFGCIVSEELSYKIKNLPRVRWVLPDSYLDVKNKL  184

Query  582  YGGEPFINGQAVPYD  626
            YGGEPFI+GQAVPYD
Sbjct  185  YGGEPFIDGQAVPYD  199



>gb|KJB61600.1| hypothetical protein B456_009G369000 [Gossypium raimondii]
Length=400

 Score =   226 bits (576),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 109/139 (78%), Positives = 119/139 (86%), Gaps = 10/139 (7%)
 Frame = +3

Query  210  YTAVRGLATRQTSSSLNDPNPNWSNRPPKETILLDGCDFEHWLIVMEKPEGDPTRDEIID  389
            +  V+  +TR   SSLNDP+PN+SNRPPKETILLDGCDFEHWL+V+E P+ D TRDEIID
Sbjct  73   FPTVKSFSTRAARSSLNDPSPNYSNRPPKETILLDGCDFEHWLVVVEPPKEDATRDEIID  132

Query  390  SYIKTLAQVVGSEEEARMKIYSVSTRHYYAFGALVSEELSYKLKELKGVRWVLPDSYLDV  569
            SYIKTLAQVVGSE+EARMKIYSVSTRHYYAFGALVSEELSYK+K          DSYLDV
Sbjct  133  SYIKTLAQVVGSEDEARMKIYSVSTRHYYAFGALVSEELSYKIK----------DSYLDV  182

Query  570  KNKDYGGEPFINGQAVPYD  626
            KNKDYGGEPFINGQAVPYD
Sbjct  183  KNKDYGGEPFINGQAVPYD  201



>ref|XP_010463450.1| PREDICTED: uncharacterized protein At3g15000, mitochondrial-like 
[Camelina sativa]
Length=289

 Score =   217 bits (552),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 122/208 (59%), Positives = 147/208 (71%), Gaps = 17/208 (8%)
 Frame = +3

Query  48   MAT-LLSRSLITAGKQLF-----RSYSSLTPPRNFLAFSSF------RLRPLVSVSPAVC  191
            MAT  +SRS++    + F     RS++S +P  NF A S        R RPLV+    + 
Sbjct  1    MATQTVSRSIVGRPAKSFALLFKRSFASSSPLANFPAASLSASTSLNRSRPLVAGFSTL-  59

Query  192  QLYPAAYTAVRGLATRQTSSSLNDPNPNWSNRPPKET---ILLDGCDFEHWLIVMEKPEG  362
             L      + R L+   TSSSLN PNPN SNRPP E    +  DGCD+EHWL+VM+ PEG
Sbjct  60   -LVRGGLFSARDLSRHATSSSLNGPNPNCSNRPPPEETNELEFDGCDYEHWLVVMDTPEG  118

Query  363  DPTRDEIIDSYIKTLAQVVGSEEEARMKIYSVSTRHYYAFGALVSEELSYKLKELKGVRW  542
            D TRDEIIDSYIKTLAQVVGSEEEARMKIYSVS R Y+AFGALVS+++S K+ +L  V++
Sbjct  119  DLTRDEIIDSYIKTLAQVVGSEEEARMKIYSVSHRCYFAFGALVSQDVSLKINDLPKVKY  178

Query  543  VLPDSYLDVKNKDYGGEPFINGQAVPYD  626
            VLPDSY+DVK KDYGGEPFING+AVPYD
Sbjct  179  VLPDSYMDVKKKDYGGEPFINGKAVPYD  206



>ref|XP_002465769.1| hypothetical protein SORBIDRAFT_01g045470 [Sorghum bicolor]
 gb|EER92767.1| hypothetical protein SORBIDRAFT_01g045470 [Sorghum bicolor]
Length=347

 Score =   218 bits (556),  Expect = 5e-66, Method: Compositional matrix adjust.
 Identities = 107/142 (75%), Positives = 120/142 (85%), Gaps = 6/142 (4%)
 Frame = +3

Query  219  VRGLATRQTSSSLNDPNPNWSN-RPPKETILLDGCDFEHWLIVMEKPEGDPT-----RDE  380
            +R  AT+  +SSL D +PNW N RP KE ILLDGCDFEHWL+VME P GDP+     RDE
Sbjct  47   LRCFATQPATSSLRDSSPNWINTRPSKEMILLDGCDFEHWLVVMEPPPGDPSNPDIPRDE  106

Query  381  IIDSYIKTLAQVVGSEEEARMKIYSVSTRHYYAFGALVSEELSYKLKELKGVRWVLPDSY  560
            IIDSYIKTLAQVVGSEEEAR KIYSVSTRHY+AFGALV EE+SYKLKE+  VRWVLPDSY
Sbjct  107  IIDSYIKTLAQVVGSEEEARQKIYSVSTRHYFAFGALVPEEVSYKLKEMPKVRWVLPDSY  166

Query  561  LDVKNKDYGGEPFINGQAVPYD  626
            L+V+ KDYGGEPF+NG+AVPYD
Sbjct  167  LNVQTKDYGGEPFVNGEAVPYD  188



>ref|XP_010264603.1| PREDICTED: uncharacterized protein At3g15000, mitochondrial-like 
[Nelumbo nucifera]
Length=582

 Score =   222 bits (565),  Expect = 5e-65, Method: Compositional matrix adjust.
 Identities = 112/155 (72%), Positives = 124/155 (80%), Gaps = 8/155 (5%)
 Frame = +3

Query  162  PLVSVSPAVCQLYPAAYTAVRGLATRQTSSSLNDPNPNWSNRPPKETILLDGCDFEHWLI  341
            P VSV+     +       VR L+TR    S+ND     SNRPPKETILLDGCDFEHWL+
Sbjct  64   PWVSVAGNNNDMVSNGVLVVRNLSTR----SMNDS----SNRPPKETILLDGCDFEHWLV  115

Query  342  VMEKPEGDPTRDEIIDSYIKTLAQVVGSEEEARMKIYSVSTRHYYAFGALVSEELSYKLK  521
            VME P+ + TRDEIIDSYIKTLAQV+GSE+EAR KIYSVSTRHY+AFG LVSEELSYK+K
Sbjct  116  VMEPPDPNITRDEIIDSYIKTLAQVLGSEDEARRKIYSVSTRHYFAFGCLVSEELSYKIK  175

Query  522  ELKGVRWVLPDSYLDVKNKDYGGEPFINGQAVPYD  626
            EL  VRWVLPDSYLDVKNK YGGEPFI+GQAVPYD
Sbjct  176  ELPRVRWVLPDSYLDVKNKSYGGEPFIDGQAVPYD  210



>ref|XP_010542306.1| PREDICTED: uncharacterized protein At3g15000, mitochondrial-like 
[Tarenaya hassleriana]
Length=215

 Score =   211 bits (538),  Expect = 6e-65, Method: Compositional matrix adjust.
 Identities = 110/166 (66%), Positives = 128/166 (77%), Gaps = 17/166 (10%)
 Frame = +3

Query  135  LAFSSF--RLRPLVSVSPAVCQLYPAAYTAVRGLATRQTSSSLNDPNPNWSNRPPKETIL  308
            LA SS   R RPL +          A  + +RG A+ +  S+        SNR PKETIL
Sbjct  41   LAASSLLTRTRPLAAA---------ALSSVIRGDASTRGFST------QASNRVPKETIL  85

Query  309  LDGCDFEHWLIVMEKPEGDPTRDEIIDSYIKTLAQVVGSEEEARMKIYSVSTRHYYAFGA  488
            LDGCDFEHWL++M KPEG+P+RDEIID YIKTLAQ+VGSEEEARMKIYSVSTR YYAFGA
Sbjct  86   LDGCDFEHWLVIMNKPEGEPSRDEIIDYYIKTLAQIVGSEEEARMKIYSVSTRCYYAFGA  145

Query  489  LVSEELSYKLKELKGVRWVLPDSYLDVKNKDYGGEPFINGQAVPYD  626
            LVSE+LSY++KEL  VR VLPDSY+DV+NKDYGGEPFI+G+AVPYD
Sbjct  146  LVSEKLSYEIKELPNVRDVLPDSYMDVENKDYGGEPFIDGKAVPYD  191



>emb|CDY32326.1| BnaC01g36450D [Brassica napus]
Length=353

 Score =   214 bits (545),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 101/142 (71%), Positives = 121/142 (85%), Gaps = 3/142 (2%)
 Frame = +3

Query  153  RLRPLVSVSPAVCQLYPAAYTAVRGLATRQTSSSLNDPNPNWSNRPPKETILLDGCDFEH  332
            R RPL +   A+  +    + +V+GL+++ T+SSL DP+PNWSNRPPKETILLDGCDFEH
Sbjct  79   RSRPLAA---ALSSVLRGGFVSVKGLSSQATASSLKDPSPNWSNRPPKETILLDGCDFEH  135

Query  333  WLIVMEKPEGDPTRDEIIDSYIKTLAQVVGSEEEARMKIYSVSTRHYYAFGALVSEELSY  512
            WL+V++ P+GD TRDEIID YIKTLAQ+VGSEEEARMKIYSVS R Y+AFGALVSE+LS+
Sbjct  136  WLVVVDPPQGDLTRDEIIDGYIKTLAQIVGSEEEARMKIYSVSHRCYFAFGALVSEDLSH  195

Query  513  KLKELKGVRWVLPDSYLDVKNK  578
            KLKEL  VRWVLPDSYLDV+NK
Sbjct  196  KLKELPNVRWVLPDSYLDVRNK  217



>gb|AFK37344.1| unknown [Medicago truncatula]
Length=263

 Score =   201 bits (512),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 100/158 (63%), Positives = 123/158 (78%), Gaps = 2/158 (1%)
 Frame = +3

Query  153  RLRPLVSVSPAVCQLYPAAYT-AVRGLATRQTSSSLNDPNPNWSNRPPKETILLDGCDFE  329
            R R   ++S A  Q  P  ++  VR  ++    S LNDP+PNWSNRPPKETILLDGCD+E
Sbjct  31   RTRFAFALSSAFRQTLPIPHSFPVRFKSSGSGYSPLNDPSPNWSNRPPKETILLDGCDYE  90

Query  330  HWLIVMEKPEG-DPTRDEIIDSYIKTLAQVVGSEEEARMKIYSVSTRHYYAFGALVSEEL  506
            HWLI+ME P+   P+ DE+++SY+KTLAQV+GSEEEA+ KIYSVST  Y  FGALVSEEL
Sbjct  91   HWLIIMEFPDNPKPSEDEMVNSYVKTLAQVLGSEEEAKKKIYSVSTSTYIGFGALVSEEL  150

Query  507  SYKLKELKGVRWVLPDSYLDVKNKDYGGEPFINGQAVP  620
            SYK+KEL GV WVLPDSYLDV NKDYGG+ F++G+ +P
Sbjct  151  SYKIKELPGVLWVLPDSYLDVPNKDYGGDLFVDGKVIP  188



>gb|AFK34838.1| unknown [Medicago truncatula]
Length=263

 Score =   201 bits (512),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 100/158 (63%), Positives = 123/158 (78%), Gaps = 2/158 (1%)
 Frame = +3

Query  153  RLRPLVSVSPAVCQLYPAAYT-AVRGLATRQTSSSLNDPNPNWSNRPPKETILLDGCDFE  329
            R R   ++S A  Q  P  ++  VR  ++    S LNDP+PNWSNRPPKETILLDGCD+E
Sbjct  31   RTRFAFALSSASRQTLPIPHSFPVRFKSSGSGYSPLNDPSPNWSNRPPKETILLDGCDYE  90

Query  330  HWLIVMEKPEG-DPTRDEIIDSYIKTLAQVVGSEEEARMKIYSVSTRHYYAFGALVSEEL  506
            HWLI+ME P+   P+ DE+++SY+KTLAQV+GSEEEA+ KIYSVST  Y  FGALVSEEL
Sbjct  91   HWLIIMEFPDNPKPSEDEMVNSYVKTLAQVLGSEEEAKKKIYSVSTSTYIGFGALVSEEL  150

Query  507  SYKLKELKGVRWVLPDSYLDVKNKDYGGEPFINGQAVP  620
            SYK+KEL GV WVLPDSYLDV NKDYGG+ F++G+ +P
Sbjct  151  SYKIKELPGVLWVLPDSYLDVPNKDYGGDLFVDGKVIP  188



>gb|KEH32304.1| plastid developmental protein DAG [Medicago truncatula]
Length=263

 Score =   201 bits (512),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 100/158 (63%), Positives = 123/158 (78%), Gaps = 2/158 (1%)
 Frame = +3

Query  153  RLRPLVSVSPAVCQLYPAAYT-AVRGLATRQTSSSLNDPNPNWSNRPPKETILLDGCDFE  329
            R R   ++S A  Q  P  ++  VR  ++    S LNDP+PNWSNRPPKETILLDGCD+E
Sbjct  31   RTRFAFALSSASRQTLPIPHSFPVRFKSSGSGYSPLNDPSPNWSNRPPKETILLDGCDYE  90

Query  330  HWLIVMEKPEG-DPTRDEIIDSYIKTLAQVVGSEEEARMKIYSVSTRHYYAFGALVSEEL  506
            HWLI+ME P+   P+ DE+++SY+KTLAQV+GSEEEA+ KIYSVST  Y  FGALVSEEL
Sbjct  91   HWLIIMEFPDNPKPSEDEMVNSYVKTLAQVLGSEEEAKKKIYSVSTSTYIGFGALVSEEL  150

Query  507  SYKLKELKGVRWVLPDSYLDVKNKDYGGEPFINGQAVP  620
            SYK+KEL GV WVLPDSYLDV NKDYGG+ F++G+ +P
Sbjct  151  SYKIKELPGVLWVLPDSYLDVPNKDYGGDLFVDGKVIP  188



>ref|XP_004508192.1| PREDICTED: uncharacterized protein At3g15000, mitochondrial-like 
[Cicer arietinum]
Length=261

 Score =   201 bits (511),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 98/145 (68%), Positives = 116/145 (80%), Gaps = 2/145 (1%)
 Frame = +3

Query  192  QLYPAAYT-AVRGLATRQTSSSLNDPNPNWSNRPPKETILLDGCDFEHWLIVMEKPEG-D  365
            Q  P  Y+  VR  ++    S LNDP+PNWSNRPPKETILLDGCD+EHWLIVME P+   
Sbjct  42   QTLPVPYSFPVRLKSSGSGYSPLNDPSPNWSNRPPKETILLDGCDYEHWLIVMEFPDNPK  101

Query  366  PTRDEIIDSYIKTLAQVVGSEEEARMKIYSVSTRHYYAFGALVSEELSYKLKELKGVRWV  545
            P+ DE+++SY+KTLAQV+GSEEEA+ KIYSVST  Y  FGAL+SEELSYKLKEL GV WV
Sbjct  102  PSEDEMVNSYVKTLAQVLGSEEEAKKKIYSVSTSTYTGFGALISEELSYKLKELPGVLWV  161

Query  546  LPDSYLDVKNKDYGGEPFINGQAVP  620
            LPDSYLDV NKDYGG+ F++G  +P
Sbjct  162  LPDSYLDVPNKDYGGDLFVDGNVIP  186



>gb|KHN03339.1| Hypothetical protein glysoja_004365 [Glycine soja]
Length=247

 Score =   200 bits (508),  Expect = 5e-60, Method: Compositional matrix adjust.
 Identities = 96/142 (68%), Positives = 118/142 (83%), Gaps = 2/142 (1%)
 Frame = +3

Query  198  YPAAYTAVRGLATRQTSSSLNDPNPNWSNRPPKETILLDGCDFEHWLIVMEKPEG-DPTR  374
            +PA++ AVR  ++    S LNDP+PNWSNRPPKETILLDGCD+EHWLIVME P+   P+ 
Sbjct  45   HPASF-AVRTQSSGSGYSPLNDPSPNWSNRPPKETILLDGCDYEHWLIVMEFPDNPKPSE  103

Query  375  DEIIDSYIKTLAQVVGSEEEARMKIYSVSTRHYYAFGALVSEELSYKLKELKGVRWVLPD  554
            D +++SY+KTLAQV+GSEEEA+ KIYSVST  Y  FGAL+SEELSYK+KEL GV WVLPD
Sbjct  104  DHMVNSYVKTLAQVLGSEEEAKKKIYSVSTSTYTGFGALISEELSYKVKELPGVLWVLPD  163

Query  555  SYLDVKNKDYGGEPFINGQAVP  620
            SYLDV NKDYGG+ F++G+ +P
Sbjct  164  SYLDVPNKDYGGDLFVDGKVIP  185



>ref|XP_008458407.1| PREDICTED: uncharacterized protein At3g15000, mitochondrial-like 
[Cucumis melo]
Length=254

 Score =   198 bits (504),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 93/144 (65%), Positives = 116/144 (81%), Gaps = 1/144 (1%)
 Frame = +3

Query  192  QLYPAAYT-AVRGLATRQTSSSLNDPNPNWSNRPPKETILLDGCDFEHWLIVMEKPEGDP  368
            Q+ P ++   +R  A+    S LNDP+PNWSNRPPKETILLDGCD+EHWLIV+E P+  P
Sbjct  50   QIIPTSFNLPIRFKASGSGYSPLNDPSPNWSNRPPKETILLDGCDYEHWLIVLEFPDPKP  109

Query  369  TRDEIIDSYIKTLAQVVGSEEEARMKIYSVSTRHYYAFGALVSEELSYKLKELKGVRWVL  548
            + +E++++Y+KTLA VVGSEEEA+ KIYSVST  Y  FGAL+SEELSYK+KEL GV WVL
Sbjct  110  SEEEMVNTYVKTLAAVVGSEEEAKTKIYSVSTTTYTGFGALISEELSYKVKELPGVLWVL  169

Query  549  PDSYLDVKNKDYGGEPFINGQAVP  620
            PDSYLDV NKDYGG+ F++G  +P
Sbjct  170  PDSYLDVPNKDYGGDLFVDGMVIP  193



>ref|XP_006392807.1| hypothetical protein EUTSA_v10012347mg, partial [Eutrema salsugineum]
 gb|ESQ30093.1| hypothetical protein EUTSA_v10012347mg, partial [Eutrema salsugineum]
Length=228

 Score =   197 bits (501),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 104/159 (65%), Positives = 121/159 (76%), Gaps = 11/159 (7%)
 Frame = +3

Query  153  RLRPLVSVSPAVCQLYPAAYTAVRGLATRQTSSSLNDPNPNWSNRPPKETILLDGCDFEH  332
            R RPLV+       +  A   + R L+T  TS SLND NP  S+       L+ GCDFEH
Sbjct  42   RSRPLVA---GFSTMVRAGLFSARDLSTPATSPSLNDTNPTSSS-------LVAGCDFEH  91

Query  333  WLIVMEKPEGDPTRDEIIDSYIKTLAQVVGS-EEEARMKIYSVSTRHYYAFGALVSEELS  509
            WL+VME P+G+ TRDEIIDSY+KTLAQVVGS EEEARMKIYSVS R Y+AFGALVSE+LS
Sbjct  92   WLVVMEAPQGNLTRDEIIDSYVKTLAQVVGSTEEEARMKIYSVSHRCYFAFGALVSEDLS  151

Query  510  YKLKELKGVRWVLPDSYLDVKNKDYGGEPFINGQAVPYD  626
             K+K+L  V+ VLPDSYLDV+NKDYGGEPFING+AVPYD
Sbjct  152  NKIKDLPNVKCVLPDSYLDVENKDYGGEPFINGKAVPYD  190



>gb|KHN02942.1| Hypothetical protein glysoja_009808 [Glycine soja]
Length=249

 Score =   197 bits (500),  Expect = 7e-59, Method: Compositional matrix adjust.
 Identities = 92/136 (68%), Positives = 113/136 (83%), Gaps = 1/136 (1%)
 Frame = +3

Query  216  AVRGLATRQTSSSLNDPNPNWSNRPPKETILLDGCDFEHWLIVMEKPEG-DPTRDEIIDS  392
            AVR  ++    S LNDP+PNWSNRPPKETILLDGCD+EHWLIVME P+   P+ D ++++
Sbjct  52   AVRTQSSGSGYSPLNDPSPNWSNRPPKETILLDGCDYEHWLIVMEFPDNPKPSEDHMVNA  111

Query  393  YIKTLAQVVGSEEEARMKIYSVSTRHYYAFGALVSEELSYKLKELKGVRWVLPDSYLDVK  572
            Y+KTLAQV+GSEE+A+ KIYSVST  Y  FGAL+SEELSYK+KEL GV WVLPDSYLDV 
Sbjct  112  YVKTLAQVLGSEEDAKNKIYSVSTSTYTGFGALISEELSYKVKELPGVLWVLPDSYLDVP  171

Query  573  NKDYGGEPFINGQAVP  620
            NKDYGG+ F++G+ +P
Sbjct  172  NKDYGGDLFVDGKVIP  187



>ref|XP_009383895.1| PREDICTED: uncharacterized protein At3g15000, mitochondrial-like 
[Musa acuminata subsp. malaccensis]
 ref|XP_009383896.1| PREDICTED: uncharacterized protein At3g15000, mitochondrial-like 
[Musa acuminata subsp. malaccensis]
Length=253

 Score =   197 bits (500),  Expect = 9e-59, Method: Compositional matrix adjust.
 Identities = 97/149 (65%), Positives = 115/149 (77%), Gaps = 5/149 (3%)
 Frame = +3

Query  174  VSPAVCQLYPAAYTAVRGLATRQTSSSLNDPNPNWSNRPPKETILLDGCDFEHWLIVMEK  353
             +PA+  L+ A Y    G       S LNDP+PNWSNRPPKETILLDGCD+EHWLIVME 
Sbjct  43   AAPALPWLFVARYKTTSGSGY----SPLNDPSPNWSNRPPKETILLDGCDYEHWLIVMEF  98

Query  354  PEGD-PTRDEIIDSYIKTLAQVVGSEEEARMKIYSVSTRHYYAFGALVSEELSYKLKELK  530
            PEG  P+ DE+I +Y+KTLA VVGSEEEA+ +IYSVST  Y  FGAL+SEELSYK+K L 
Sbjct  99   PEGSKPSEDEMIGAYVKTLAAVVGSEEEAKTRIYSVSTTTYTGFGALISEELSYKVKGLP  158

Query  531  GVRWVLPDSYLDVKNKDYGGEPFINGQAV  617
            GV WVLPDSYLDV NKDYGG+ F++G+ +
Sbjct  159  GVLWVLPDSYLDVPNKDYGGDLFVDGKVI  187



>ref|XP_010685524.1| PREDICTED: mediator of RNA polymerase II transcription subunit 
12-like [Beta vulgaris subsp. vulgaris]
Length=779

 Score =   207 bits (526),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 96/135 (71%), Positives = 111/135 (82%), Gaps = 6/135 (4%)
 Frame = +3

Query  222  RGLATRQTSSSLNDPNPNWSNRPPKETILLDGCDFEHWLIVMEKPEGDPTRDEIIDSYIK  401
            R  ATR + SS ++      NRPPKET++L+GCD+EHWL+V+E P+   TRDEIID YIK
Sbjct  80   RSFATRLSDSSSSN------NRPPKETMMLEGCDYEHWLVVVEPPDPQLTRDEIIDGYIK  133

Query  402  TLAQVVGSEEEARMKIYSVSTRHYYAFGALVSEELSYKLKELKGVRWVLPDSYLDVKNKD  581
            TLA V+GSEEEARMKIYSVSTRHY+AF AL+SEEL YKLK+L  VRWVLPDSY+DVKNK 
Sbjct  134  TLAHVIGSEEEARMKIYSVSTRHYFAFSALMSEELGYKLKDLPNVRWVLPDSYMDVKNKT  193

Query  582  YGGEPFINGQAVPYD  626
            Y GEPFINGQ VPYD
Sbjct  194  YAGEPFINGQPVPYD  208



>ref|XP_004165245.1| PREDICTED: uncharacterized protein At3g15000, mitochondrial-like 
[Cucumis sativus]
 gb|KGN47420.1| hypothetical protein Csa_6G318670 [Cucumis sativus]
Length=277

 Score =   196 bits (499),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 95/145 (66%), Positives = 118/145 (81%), Gaps = 2/145 (1%)
 Frame = +3

Query  192  QLYPAAYT-AVRGLATRQTSSSLNDPNPNWSNRPPKETILLDGCDFEHWLIVMEKP-EGD  365
            Q+ PA++   +R  A+    S LNDP+PNWSNRPPKETILLDGCD+EHWLIV+E P +  
Sbjct  51   QIIPASFNLPIRFKASGSGYSPLNDPSPNWSNRPPKETILLDGCDYEHWLIVLEFPNDPK  110

Query  366  PTRDEIIDSYIKTLAQVVGSEEEARMKIYSVSTRHYYAFGALVSEELSYKLKELKGVRWV  545
            P+ +E++++Y+KTLA VVGSEEEA+ KIYSVST  Y  FGAL+SEELSYK+KEL GV WV
Sbjct  111  PSEEEMVNTYVKTLAAVVGSEEEAKKKIYSVSTTTYTGFGALISEELSYKVKELPGVLWV  170

Query  546  LPDSYLDVKNKDYGGEPFINGQAVP  620
            LPDSYLDV NKDYGG+ FI+G+ +P
Sbjct  171  LPDSYLDVPNKDYGGDLFIDGKVIP  195



>gb|ACU24586.1| unknown [Glycine max]
Length=249

 Score =   196 bits (497),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 92/136 (68%), Positives = 112/136 (82%), Gaps = 1/136 (1%)
 Frame = +3

Query  216  AVRGLATRQTSSSLNDPNPNWSNRPPKETILLDGCDFEHWLIVMEKPEG-DPTRDEIIDS  392
            AVR  ++    S LNDP PNWSNRPPKETILLDGCD+EHWLIVME P+   P+ D ++++
Sbjct  52   AVRTQSSGSGYSPLNDPFPNWSNRPPKETILLDGCDYEHWLIVMEFPDNPKPSEDHMVNA  111

Query  393  YIKTLAQVVGSEEEARMKIYSVSTRHYYAFGALVSEELSYKLKELKGVRWVLPDSYLDVK  572
            Y+KTLAQV+GSEE+A+ KIYSVST  Y  FGAL+SEELSYK+KEL GV WVLPDSYLDV 
Sbjct  112  YVKTLAQVLGSEEDAKNKIYSVSTSTYTGFGALISEELSYKVKELPGVLWVLPDSYLDVP  171

Query  573  NKDYGGEPFINGQAVP  620
            NKDYGG+ F++G+ +P
Sbjct  172  NKDYGGDLFVDGKVIP  187



>ref|XP_010109587.1| hypothetical protein L484_005246 [Morus notabilis]
 gb|EXC23296.1| hypothetical protein L484_005246 [Morus notabilis]
Length=237

 Score =   195 bits (495),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 98/145 (68%), Positives = 114/145 (79%), Gaps = 2/145 (1%)
 Frame = +3

Query  192  QLYPAAYTA-VRGLATRQTSSSLNDPNPNWSNRPPKETILLDGCDFEHWLIVMEKP-EGD  365
            QL P    A VR   +    S LNDP+PNWSNRPPKETILLDGCD+EHWLIVME P    
Sbjct  44   QLVPEPVKAPVRFKNSGSGYSPLNDPSPNWSNRPPKETILLDGCDYEHWLIVMEFPVNPK  103

Query  366  PTRDEIIDSYIKTLAQVVGSEEEARMKIYSVSTRHYYAFGALVSEELSYKLKELKGVRWV  545
            P+ +E++DSY+KTLA+V+GSEEEA+ KIYSVST  Y  FGAL+SEELS K+KEL GV WV
Sbjct  104  PSEEEMVDSYVKTLAKVLGSEEEAKKKIYSVSTTTYTGFGALISEELSLKVKELPGVLWV  163

Query  546  LPDSYLDVKNKDYGGEPFINGQAVP  620
            LPDSYLDV NKDYGG+ FI+G+ VP
Sbjct  164  LPDSYLDVPNKDYGGDLFIDGKVVP  188



>ref|XP_004150496.1| PREDICTED: uncharacterized protein At3g15000, mitochondrial-like 
[Cucumis sativus]
Length=277

 Score =   195 bits (496),  Expect = 7e-58, Method: Compositional matrix adjust.
 Identities = 94/145 (65%), Positives = 118/145 (81%), Gaps = 2/145 (1%)
 Frame = +3

Query  192  QLYPAAYT-AVRGLATRQTSSSLNDPNPNWSNRPPKETILLDGCDFEHWLIVMEKP-EGD  365
            Q+ PA++   +R  A+    S LNDP+PNWSNRPPKETILLDGCD+EHWLIV++ P +  
Sbjct  51   QIIPASFNLPIRFKASGSGYSPLNDPSPNWSNRPPKETILLDGCDYEHWLIVLDFPNDPK  110

Query  366  PTRDEIIDSYIKTLAQVVGSEEEARMKIYSVSTRHYYAFGALVSEELSYKLKELKGVRWV  545
            P+ +E++++Y+KTLA VVGSEEEA+ KIYSVST  Y  FGAL+SEELSYK+KEL GV WV
Sbjct  111  PSEEEMVNTYVKTLAAVVGSEEEAKKKIYSVSTTTYTGFGALISEELSYKVKELPGVLWV  170

Query  546  LPDSYLDVKNKDYGGEPFINGQAVP  620
            LPDSYLDV NKDYGG+ FI+G+ +P
Sbjct  171  LPDSYLDVPNKDYGGDLFIDGKVIP  195



>ref|XP_010547005.1| PREDICTED: uncharacterized protein At3g15000, mitochondrial [Tarenaya 
hassleriana]
Length=219

 Score =   193 bits (491),  Expect = 7e-58, Method: Compositional matrix adjust.
 Identities = 88/123 (72%), Positives = 105/123 (85%), Gaps = 0/123 (0%)
 Frame = +3

Query  249  SSLNDPNPNWSNRPPKETILLDGCDFEHWLIVMEKPEGDPTRDEIIDSYIKTLAQVVGSE  428
            S LNDP+PNWSNRPPKETILLDGCD+EHWLIVME P+  PT DE+I++Y+KTLA V+GSE
Sbjct  71   SPLNDPSPNWSNRPPKETILLDGCDYEHWLIVMEFPDPKPTEDEMINAYVKTLASVIGSE  130

Query  429  EEARMKIYSVSTRHYYAFGALVSEELSYKLKELKGVRWVLPDSYLDVKNKDYGGEPFING  608
            EEA+ KIYSV T  Y  FGAL+SEELSYK+K L GV WVLPDSYLDV NKDYGG+ +++G
Sbjct  131  EEAKKKIYSVCTTTYTGFGALISEELSYKVKGLPGVLWVLPDSYLDVPNKDYGGDLYVDG  190

Query  609  QAV  617
            + +
Sbjct  191  KVI  193



>ref|XP_008784778.1| PREDICTED: DAG protein, chloroplastic-like [Phoenix dactylifera]
Length=280

 Score =   195 bits (496),  Expect = 7e-58, Method: Compositional matrix adjust.
 Identities = 112/197 (57%), Positives = 132/197 (67%), Gaps = 13/197 (7%)
 Frame = +3

Query  48   MATLLSRSLITAGKQLFRSYSSLTPPRNFLAFSS----FRLRPLVSVSPAVCQLYPAAYT  215
            MA L  RS+ +    L R+ +S  P R+ L+  S    FRL   V          PA + 
Sbjct  1    MAALARRSVSSL---LSRALASSPPLRSPLSLPSPLHPFRLSIAVL---ETLHRSPALWA  54

Query  216  AVRGLATRQTS--SSLNDPNPNWSNRPPKETILLDGCDFEHWLIVMEKPEG-DPTRDEII  386
                L T   S  S LNDP+PNWSNRPPKETILLDGCD+EHWLIVME PE   P+ DE+I
Sbjct  55   VPARLKTTSGSGYSPLNDPSPNWSNRPPKETILLDGCDYEHWLIVMEFPENPKPSEDEMI  114

Query  387  DSYIKTLAQVVGSEEEARMKIYSVSTRHYYAFGALVSEELSYKLKELKGVRWVLPDSYLD  566
             +Y+KTLA VVGSEEEA+ KIYSV T  Y  FGAL+SEELSYK+K L GV WVLPDSYLD
Sbjct  115  AAYVKTLASVVGSEEEAKKKIYSVCTTTYTGFGALISEELSYKVKGLPGVLWVLPDSYLD  174

Query  567  VKNKDYGGEPFINGQAV  617
            V NKDYGG+ FI+G+ +
Sbjct  175  VPNKDYGGDLFIDGKVI  191



>ref|XP_010921620.1| PREDICTED: uncharacterized protein At3g15000, mitochondrial [Elaeis 
guineensis]
Length=268

 Score =   195 bits (495),  Expect = 8e-58, Method: Compositional matrix adjust.
 Identities = 97/142 (68%), Positives = 111/142 (78%), Gaps = 3/142 (2%)
 Frame = +3

Query  201  PAAYTAVRGLATRQTS--SSLNDPNPNWSNRPPKETILLDGCDFEHWLIVMEKPEG-DPT  371
            PA +  +  L T   S  S LNDP+PNWSNRPPKETILLDGCD+EHWLIVME PE   P+
Sbjct  50   PAPWAVLARLKTTSGSGYSPLNDPSPNWSNRPPKETILLDGCDYEHWLIVMEFPENPKPS  109

Query  372  RDEIIDSYIKTLAQVVGSEEEARMKIYSVSTRHYYAFGALVSEELSYKLKELKGVRWVLP  551
             DE+I SY+KTLA VVGSEEEA+ KIYSV T  Y  FGAL+SEELSYK+K L GV WVLP
Sbjct  110  EDEMIASYVKTLAAVVGSEEEAKKKIYSVCTTTYTGFGALISEELSYKVKGLPGVLWVLP  169

Query  552  DSYLDVKNKDYGGEPFINGQAV  617
            DSYLDV NKDYGG+ FI+G+ +
Sbjct  170  DSYLDVPNKDYGGDLFIDGKVI  191



>ref|XP_006407900.1| hypothetical protein EUTSA_v10021360mg [Eutrema salsugineum]
 gb|ESQ49353.1| hypothetical protein EUTSA_v10021360mg [Eutrema salsugineum]
Length=258

 Score =   194 bits (492),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 95/153 (62%), Positives = 112/153 (73%), Gaps = 0/153 (0%)
 Frame = +3

Query  162  PLVSVSPAVCQLYPAAYTAVRGLATRQTSSSLNDPNPNWSNRPPKETILLDGCDFEHWLI  341
            PLV    +   +    YTA R   +    S LNDP+PNWSNRPPKETILLDGCD+EHWLI
Sbjct  42   PLVDKVSSTRTVLGPCYTATRPKTSGSGYSPLNDPSPNWSNRPPKETILLDGCDYEHWLI  101

Query  342  VMEKPEGDPTRDEIIDSYIKTLAQVVGSEEEARMKIYSVSTRHYYAFGALVSEELSYKLK  521
            VME  +  PT DE+I++Y+KTL  VVGSEEEA+ KIYSV T  Y  FGAL+SEELS K+K
Sbjct  102  VMEFTDPKPTEDEMINAYVKTLTSVVGSEEEAKKKIYSVCTSTYTGFGALISEELSCKVK  161

Query  522  ELKGVRWVLPDSYLDVKNKDYGGEPFINGQAVP  620
             L GV WVLPDSYLDV NKDYGG+ +I G+ +P
Sbjct  162  GLPGVLWVLPDSYLDVPNKDYGGDLYIEGKVIP  194



>ref|XP_006654216.1| PREDICTED: uncharacterized protein At3g15000, mitochondrial-like 
[Oryza brachyantha]
Length=237

 Score =   192 bits (489),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 101/182 (55%), Positives = 124/182 (68%), Gaps = 5/182 (3%)
 Frame = +3

Query  75   ITAGKQLFRSYSSLTPPRNFLAFSSFRLRPLVSVSPAVCQLYPAAYTAVRGLATRQTSSS  254
            + AG    R+ S+L   R      + RL PL S    +  L P +  A          S 
Sbjct  1    MLAGAAARRNLSTLLSSRAL----ARRLAPLASAPSYLTPLAPLSRGANTSSLGGSGYSP  56

Query  255  LNDPNPNWSNRPPKETILLDGCDFEHWLIVMEKP-EGDPTRDEIIDSYIKTLAQVVGSEE  431
            LNDP+PNWSNRPPKETILLDGCD+EHWLIVME P +  P+ ++++ +Y+KTLA VVGSEE
Sbjct  57   LNDPSPNWSNRPPKETILLDGCDYEHWLIVMEFPTDRKPSEEDMVAAYVKTLAAVVGSEE  116

Query  432  EARMKIYSVSTRHYYAFGALVSEELSYKLKELKGVRWVLPDSYLDVKNKDYGGEPFINGQ  611
            EA+ KIYSV T  Y  FGAL+SEELSYK+K L GV WVLPDSYLDV NKDYGG+ F++GQ
Sbjct  117  EAKKKIYSVCTTTYTGFGALISEELSYKVKGLPGVLWVLPDSYLDVPNKDYGGDLFVDGQ  176

Query  612  AV  617
             +
Sbjct  177  VI  178



>ref|XP_006354278.1| PREDICTED: uncharacterized protein At3g15000, mitochondrial-like 
[Solanum tuberosum]
Length=260

 Score =   193 bits (491),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 92/143 (64%), Positives = 112/143 (78%), Gaps = 1/143 (1%)
 Frame = +3

Query  192  QLYPA-AYTAVRGLATRQTSSSLNDPNPNWSNRPPKETILLDGCDFEHWLIVMEKPEGDP  368
            Q YP+  +   R  +T    S LNDP+PNWSNRPPKETILLDGCD+EHWLIVME PE  P
Sbjct  44   QYYPSEQFVPTRPKSTGSGYSPLNDPSPNWSNRPPKETILLDGCDYEHWLIVMEFPEPKP  103

Query  369  TRDEIIDSYIKTLAQVVGSEEEARMKIYSVSTRHYYAFGALVSEELSYKLKELKGVRWVL  548
            + +++I++Y+KT+A VVGSEEEA+ KIYSV T  Y  FG L+SEELSYK+K L GV WVL
Sbjct  104  SEEDMINAYVKTIAAVVGSEEEAKKKIYSVCTTTYTGFGVLISEELSYKVKGLPGVLWVL  163

Query  549  PDSYLDVKNKDYGGEPFINGQAV  617
            PDSYLDV NKDYGG+ FI+G+ +
Sbjct  164  PDSYLDVPNKDYGGDQFIDGKVI  186



>ref|XP_004229268.1| PREDICTED: uncharacterized protein At3g15000, mitochondrial [Solanum 
lycopersicum]
Length=259

 Score =   193 bits (490),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 90/143 (63%), Positives = 114/143 (80%), Gaps = 1/143 (1%)
 Frame = +3

Query  192  QLYPA-AYTAVRGLATRQTSSSLNDPNPNWSNRPPKETILLDGCDFEHWLIVMEKPEGDP  368
            Q YP+  + + R  ++    S LNDP+PNWSNRPPKETILLDGCD+EHWLIVME P+  P
Sbjct  43   QYYPSEQFVSTRPKSSGSGYSPLNDPSPNWSNRPPKETILLDGCDYEHWLIVMEFPDPKP  102

Query  369  TRDEIIDSYIKTLAQVVGSEEEARMKIYSVSTRHYYAFGALVSEELSYKLKELKGVRWVL  548
            + +++I++Y+KT+A VVGSEEEA+ KIYSV T  Y  FG L+SEELSYK+K+L GV WVL
Sbjct  103  SEEDMINAYVKTIAAVVGSEEEAKKKIYSVCTTTYTGFGVLISEELSYKVKDLPGVLWVL  162

Query  549  PDSYLDVKNKDYGGEPFINGQAV  617
            PDSYLDV NKDYGG+ FI+G+ +
Sbjct  163  PDSYLDVPNKDYGGDQFIDGKVI  185



>gb|AFK47907.1| unknown [Lotus japonicus]
Length=336

 Score =   195 bits (496),  Expect = 4e-57, Method: Compositional matrix adjust.
 Identities = 92/136 (68%), Positives = 111/136 (82%), Gaps = 1/136 (1%)
 Frame = +3

Query  216  AVRGLATRQTSSSLNDPNPNWSNRPPKETILLDGCDFEHWLIVMEKPEG-DPTRDEIIDS  392
            +VR  ++    S LNDP+PNWSNRPPKETILLDGCD+EHWLIVME PE   P+  E++++
Sbjct  52   SVRTKSSGSGYSPLNDPSPNWSNRPPKETILLDGCDYEHWLIVMEFPENPKPSEQEMVNA  111

Query  393  YIKTLAQVVGSEEEARMKIYSVSTRHYYAFGALVSEELSYKLKELKGVRWVLPDSYLDVK  572
            Y+KTL Q+VGSEEEA  KIYSVST  Y  FGAL+SEELSYK+KEL GV WVLPDSYLDV 
Sbjct  112  YVKTLTQIVGSEEEAMKKIYSVSTHTYTGFGALISEELSYKVKELPGVLWVLPDSYLDVP  171

Query  573  NKDYGGEPFINGQAVP  620
            NKDYGG+ F++G+ +P
Sbjct  172  NKDYGGDLFVDGKVIP  187



>gb|KFK38143.1| hypothetical protein AALP_AA3G075000 [Arabis alpina]
Length=246

 Score =   192 bits (488),  Expect = 4e-57, Method: Compositional matrix adjust.
 Identities = 91/140 (65%), Positives = 107/140 (76%), Gaps = 0/140 (0%)
 Frame = +3

Query  201  PAAYTAVRGLATRQTSSSLNDPNPNWSNRPPKETILLDGCDFEHWLIVMEKPEGDPTRDE  380
            P+ Y   R   +    S LNDP+PNWSNRPPKETILLDGCD+EHWLIVME  +  PT DE
Sbjct  51   PSCYITTRLKTSGSGYSPLNDPSPNWSNRPPKETILLDGCDYEHWLIVMEFTDPKPTEDE  110

Query  381  IIDSYIKTLAQVVGSEEEARMKIYSVSTRHYYAFGALVSEELSYKLKELKGVRWVLPDSY  560
            +I++Y+KTL  VVGSEEEA+ KIYSV T  Y  FGAL+SEELS K+K L GV WVLPDSY
Sbjct  111  MINAYVKTLTSVVGSEEEAKKKIYSVCTSTYTGFGALISEELSCKVKGLPGVLWVLPDSY  170

Query  561  LDVKNKDYGGEPFINGQAVP  620
            LDV NKDYGG+ +I G+ +P
Sbjct  171  LDVPNKDYGGDLYIEGKVIP  190



>ref|XP_002884610.1| hypothetical protein ARALYDRAFT_477997 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH60869.1| hypothetical protein ARALYDRAFT_477997 [Arabidopsis lyrata subsp. 
lyrata]
Length=240

 Score =   192 bits (487),  Expect = 4e-57, Method: Compositional matrix adjust.
 Identities = 91/138 (66%), Positives = 108/138 (78%), Gaps = 0/138 (0%)
 Frame = +3

Query  207  AYTAVRGLATRQTSSSLNDPNPNWSNRPPKETILLDGCDFEHWLIVMEKPEGDPTRDEII  386
             Y + R   +    S LNDP+PNWSNRPPKETILLDGCD+EHWLIVME  +  PT +E+I
Sbjct  51   CYISTRLKTSGSGYSPLNDPSPNWSNRPPKETILLDGCDYEHWLIVMEFTDPKPTEEEMI  110

Query  387  DSYIKTLAQVVGSEEEARMKIYSVSTRHYYAFGALVSEELSYKLKELKGVRWVLPDSYLD  566
            +SY+KTL  V+GSEEEA+ KIYSVST  Y  FGAL+SEELS K+KEL GV WVLPDSYLD
Sbjct  111  NSYVKTLTSVLGSEEEAKKKIYSVSTSTYTGFGALISEELSCKVKELPGVLWVLPDSYLD  170

Query  567  VKNKDYGGEPFINGQAVP  620
            V NKDYGG+ +I G+ +P
Sbjct  171  VPNKDYGGDLYIEGEVIP  188



>ref|XP_002516969.1| DAG protein, chloroplast precursor, putative [Ricinus communis]
 gb|EEF45583.1| DAG protein, chloroplast precursor, putative [Ricinus communis]
Length=262

 Score =   192 bits (489),  Expect = 5e-57, Method: Compositional matrix adjust.
 Identities = 95/152 (63%), Positives = 119/152 (78%), Gaps = 5/152 (3%)
 Frame = +3

Query  165  LVSVSPAVCQLYPAAYTAVRGLATRQTSSSLNDPNPNWSNRPPKETILLDGCDFEHWLIV  344
            L+S +P + +L+P      R   +R   S LNDP+PNWSNRPPKE+ILLDGCD+EHWLIV
Sbjct  38   LLSKNP-LSELHP---NPTRSKTSRSGYSPLNDPSPNWSNRPPKESILLDGCDYEHWLIV  93

Query  345  MEKP-EGDPTRDEIIDSYIKTLAQVVGSEEEARMKIYSVSTRHYYAFGALVSEELSYKLK  521
            ME P +  P+ +E+I++Y+KTLA V+GSEEEA+ KIYSVST  Y  FGAL+SEELSYKLK
Sbjct  94   MEFPNDPKPSEEEMINAYVKTLASVLGSEEEAKKKIYSVSTTTYTGFGALISEELSYKLK  153

Query  522  ELKGVRWVLPDSYLDVKNKDYGGEPFINGQAV  617
             L GV WVLPDSYLDV NKDYGG+ F++G+ +
Sbjct  154  GLPGVLWVLPDSYLDVPNKDYGGDLFVDGKVI  185



>ref|XP_010259473.1| PREDICTED: uncharacterized protein At3g15000, mitochondrial-like 
[Nelumbo nucifera]
Length=243

 Score =   192 bits (487),  Expect = 5e-57, Method: Compositional matrix adjust.
 Identities = 102/192 (53%), Positives = 130/192 (68%), Gaps = 10/192 (5%)
 Frame = +3

Query  48   MATLLSRSLITAGKQLFRSYSSLTPPRNFLAFSSFRLRPLVSVSPAVCQLYPAAYT-AVR  224
            M+ L  R+L++   +   S SSL P R+  A +   ++  +          P   T  +R
Sbjct  1    MSHLTRRTLVSLLSRTINSSSSLLPVRSRFALAVLDMQHRLPT--------PEPRTIPIR  52

Query  225  GLATRQTSSSLNDPNPNWSNRPPKETILLDGCDFEHWLIVMEKP-EGDPTRDEIIDSYIK  401
               +    S LNDP+PNWSNRPPKETILLDGCD+EHWLIVME P +  P+ +E+I +Y+K
Sbjct  53   SKTSASGYSPLNDPSPNWSNRPPKETILLDGCDYEHWLIVMEFPADPKPSEEEMIATYVK  112

Query  402  TLAQVVGSEEEARMKIYSVSTRHYYAFGALVSEELSYKLKELKGVRWVLPDSYLDVKNKD  581
            TLA VVGSEE+A+ KIYSV T  Y  FGAL+SEELSYK+K L GV WVLPDSYLDV NKD
Sbjct  113  TLAAVVGSEEKAKKKIYSVCTTTYTGFGALISEELSYKVKGLPGVLWVLPDSYLDVPNKD  172

Query  582  YGGEPFINGQAV  617
            YGG+ FI+G+ +
Sbjct  173  YGGDLFIDGKVI  184



>ref|XP_007154308.1| hypothetical protein PHAVU_003G107700g [Phaseolus vulgaris]
 gb|ESW26302.1| hypothetical protein PHAVU_003G107700g [Phaseolus vulgaris]
Length=249

 Score =   192 bits (487),  Expect = 6e-57, Method: Compositional matrix adjust.
 Identities = 90/135 (67%), Positives = 111/135 (82%), Gaps = 1/135 (1%)
 Frame = +3

Query  219  VRGLATRQTSSSLNDPNPNWSNRPPKETILLDGCDFEHWLIVMEKPEG-DPTRDEIIDSY  395
            VR  ++    S LNDP+PNWSNRPPKETILLDGCD+EHWLIVME P+   P+ D ++++Y
Sbjct  53   VRRKSSGSGYSPLNDPSPNWSNRPPKETILLDGCDYEHWLIVMEFPDNPKPSEDHMVNAY  112

Query  396  IKTLAQVVGSEEEARMKIYSVSTRHYYAFGALVSEELSYKLKELKGVRWVLPDSYLDVKN  575
            +KTLA V+GSEEEA+ KIYSVST  Y  FGAL+SEELSYK+K+L GV WVLPDSYLDV N
Sbjct  113  VKTLAHVLGSEEEAKKKIYSVSTSTYTGFGALISEELSYKVKDLPGVLWVLPDSYLDVPN  172

Query  576  KDYGGEPFINGQAVP  620
            KDYGG+ F++G+ +P
Sbjct  173  KDYGGDLFVDGKVIP  187



>ref|XP_002272388.1| PREDICTED: uncharacterized protein At3g15000, mitochondrial [Vitis 
vinifera]
 emb|CAN69219.1| hypothetical protein VITISV_012015 [Vitis vinifera]
 emb|CBI22962.3| unnamed protein product [Vitis vinifera]
Length=260

 Score =   192 bits (487),  Expect = 9e-57, Method: Compositional matrix adjust.
 Identities = 91/124 (73%), Positives = 105/124 (85%), Gaps = 1/124 (1%)
 Frame = +3

Query  249  SSLNDPNPNWSNRPPKETILLDGCDFEHWLIVMEKP-EGDPTRDEIIDSYIKTLAQVVGS  425
            S LNDP+PNWSNRPPKETILLDGCD+EHWLIVME P +  P+ DE+I +Y+KTLA VVGS
Sbjct  66   SPLNDPSPNWSNRPPKETILLDGCDYEHWLIVMEFPNDSKPSEDEMIAAYVKTLAAVVGS  125

Query  426  EEEARMKIYSVSTRHYYAFGALVSEELSYKLKELKGVRWVLPDSYLDVKNKDYGGEPFIN  605
            EEEA+ KIYSV T  Y  FGAL+SEELSYK+KEL GV WVLPDSYLDV NKDYGG+ FI+
Sbjct  126  EEEAKKKIYSVCTTTYTGFGALISEELSYKVKELPGVLWVLPDSYLDVPNKDYGGDLFID  185

Query  606  GQAV  617
            G+ +
Sbjct  186  GKVI  189



>gb|ADE77263.1| unknown [Picea sitchensis]
Length=258

 Score =   191 bits (485),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 100/167 (60%), Positives = 120/167 (72%), Gaps = 2/167 (1%)
 Frame = +3

Query  123  PRNFLAFSSFRLRPLVSVSPAVCQLYPAAYTAVRGLATRQTSSSLNDPNPNWSNRPPKET  302
            P N   F    L+   ++ P + Q     YT VR   +    S LNDP+PNWSNRPPKET
Sbjct  22   PLNSTFFGYKTLKYSSAIIPHLIQTPFGRYT-VRCKTSGSGYSPLNDPSPNWSNRPPKET  80

Query  303  ILLDGCDFEHWLIVMEKPEG-DPTRDEIIDSYIKTLAQVVGSEEEARMKIYSVSTRHYYA  479
            ILLDGCD+EHWLIVME P+   P  +E+I +YIKTLA VVGSEEEA+ KIYSVST  Y  
Sbjct  81   ILLDGCDYEHWLIVMEFPKDPKPPEEEMIAAYIKTLASVVGSEEEAKKKIYSVSTHTYTG  140

Query  480  FGALVSEELSYKLKELKGVRWVLPDSYLDVKNKDYGGEPFINGQAVP  620
            FGAL+SEELSYK+K L GV WVLPDSY+DV NKDYGG+ F++G+ +P
Sbjct  141  FGALISEELSYKVKGLPGVLWVLPDSYIDVPNKDYGGDLFVDGKVIP  187



>ref|XP_009134930.1| PREDICTED: uncharacterized protein At3g15000, mitochondrial-like 
[Brassica rapa]
Length=245

 Score =   191 bits (484),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 91/138 (66%), Positives = 106/138 (77%), Gaps = 0/138 (0%)
 Frame = +3

Query  207  AYTAVRGLATRQTSSSLNDPNPNWSNRPPKETILLDGCDFEHWLIVMEKPEGDPTRDEII  386
             Y   R   +    S LNDP+PNWSNRPPKETILLDGCD+EHWLIVME  +  PT DE+I
Sbjct  52   CYMPTRPKTSGSGYSPLNDPSPNWSNRPPKETILLDGCDYEHWLIVMEFNDPKPTEDEMI  111

Query  387  DSYIKTLAQVVGSEEEARMKIYSVSTRHYYAFGALVSEELSYKLKELKGVRWVLPDSYLD  566
            ++Y+KTL  VVGSEEEA+ KIYSVST  Y  FGAL+SEELS K+K L GV WVLPDSYLD
Sbjct  112  NAYVKTLTSVVGSEEEAKKKIYSVSTSTYTGFGALISEELSCKVKGLPGVLWVLPDSYLD  171

Query  567  VKNKDYGGEPFINGQAVP  620
            V NKDYGG+ +I G+ +P
Sbjct  172  VPNKDYGGDLYIEGKVIP  189



>ref|XP_009124645.1| PREDICTED: uncharacterized protein At3g15000, mitochondrial [Brassica 
rapa]
Length=247

 Score =   189 bits (481),  Expect = 5e-56, Method: Compositional matrix adjust.
 Identities = 90/138 (65%), Positives = 104/138 (75%), Gaps = 0/138 (0%)
 Frame = +3

Query  207  AYTAVRGLATRQTSSSLNDPNPNWSNRPPKETILLDGCDFEHWLIVMEKPEGDPTRDEII  386
             Y   R   +    S LNDP+PNWSNRPPKETILLDGCD+EHWLIVME  +  PT DE+I
Sbjct  55   CYVTTRPKTSGSGYSPLNDPSPNWSNRPPKETILLDGCDYEHWLIVMEFADPKPTEDEMI  114

Query  387  DSYIKTLAQVVGSEEEARMKIYSVSTRHYYAFGALVSEELSYKLKELKGVRWVLPDSYLD  566
             +Y+KTL  VVGSEEEA+ KIYSV T  Y  FGAL+SEELS K+K L GV WVLPDSYLD
Sbjct  115  SAYVKTLTSVVGSEEEAKKKIYSVCTSTYTGFGALISEELSCKVKGLPGVLWVLPDSYLD  174

Query  567  VKNKDYGGEPFINGQAVP  620
            V NKDYGG+ +I G+ +P
Sbjct  175  VPNKDYGGDLYIEGKVIP  192



>ref|XP_004976818.1| PREDICTED: uncharacterized protein At3g15000, mitochondrial-like 
[Setaria italica]
Length=253

 Score =   189 bits (481),  Expect = 6e-56, Method: Compositional matrix adjust.
 Identities = 98/160 (61%), Positives = 118/160 (74%), Gaps = 6/160 (4%)
 Frame = +3

Query  153  RLRPLVSVSPAVCQLYPAAYTAVRGLATRQTSSS----LNDPNPNWSNRPPKETILLDGC  320
            RL PL + + A   L P A  A RG  T  +  S    LNDP+PNWSNRPPKETILLDGC
Sbjct  25   RLGPLAAAA-ASAHLTPWAMLASRGAKTASSGGSGYSPLNDPSPNWSNRPPKETILLDGC  83

Query  321  DFEHWLIVMEKP-EGDPTRDEIIDSYIKTLAQVVGSEEEARMKIYSVSTRHYYAFGALVS  497
            D+EHWLIVME P +  P+ +E++ +Y+KTL  VVGSEEEA+ KIYSV T  Y  FGAL+S
Sbjct  84   DYEHWLIVMEFPTDPKPSEEEMVAAYVKTLTAVVGSEEEAKKKIYSVCTTTYTGFGALIS  143

Query  498  EELSYKLKELKGVRWVLPDSYLDVKNKDYGGEPFINGQAV  617
            EELSYK+K L GV WVLPDSYLDV NKDYGG+ F++G+ +
Sbjct  144  EELSYKVKGLPGVLWVLPDSYLDVPNKDYGGDLFVDGKVI  183



>ref|XP_008223248.1| PREDICTED: DAG protein, chloroplastic [Prunus mume]
Length=265

 Score =   189 bits (481),  Expect = 8e-56, Method: Compositional matrix adjust.
 Identities = 90/136 (66%), Positives = 107/136 (79%), Gaps = 0/136 (0%)
 Frame = +3

Query  213  TAVRGLATRQTSSSLNDPNPNWSNRPPKETILLDGCDFEHWLIVMEKPEGDPTRDEIIDS  392
            T  R   + Q  S LND  PNWSNRPPKETILLDGCD+EHWLIVME  +  P+ +E+I+S
Sbjct  54   TTTRSKHSGQGYSPLNDATPNWSNRPPKETILLDGCDYEHWLIVMEYDDPKPSEEEMINS  113

Query  393  YIKTLAQVVGSEEEARMKIYSVSTRHYYAFGALVSEELSYKLKELKGVRWVLPDSYLDVK  572
            Y+KTLA V+GSEEEA+ KIYSVST  Y  FGAL+SEELS K+K L GV WVLPDSYLDV 
Sbjct  114  YVKTLATVLGSEEEAKKKIYSVSTTTYTGFGALISEELSLKVKGLPGVLWVLPDSYLDVP  173

Query  573  NKDYGGEPFINGQAVP  620
            NKDYGG+ +I+G+ +P
Sbjct  174  NKDYGGDLYIDGKVIP  189



>ref|XP_010689774.1| PREDICTED: DAG protein, chloroplastic-like [Beta vulgaris subsp. 
vulgaris]
Length=257

 Score =   189 bits (480),  Expect = 8e-56, Method: Compositional matrix adjust.
 Identities = 89/124 (72%), Positives = 105/124 (85%), Gaps = 1/124 (1%)
 Frame = +3

Query  249  SSLNDPNPNWSNRPPKETILLDGCDFEHWLIVMEKP-EGDPTRDEIIDSYIKTLAQVVGS  425
            S LNDP+PNW+NRPPKETILLDGCD+EHWLIVME P +  P+ +E+++SY+  LAQVVGS
Sbjct  60   SPLNDPSPNWTNRPPKETILLDGCDYEHWLIVMEFPNDPKPSDEEMVNSYVNILAQVVGS  119

Query  426  EEEARMKIYSVSTRHYYAFGALVSEELSYKLKELKGVRWVLPDSYLDVKNKDYGGEPFIN  605
            EEEAR KIYSVST  Y  FGAL+SEELSYK+K L GV WVLPDSYLDV NKDYGG+ FI+
Sbjct  120  EEEARKKIYSVSTTTYTGFGALISEELSYKVKALPGVLWVLPDSYLDVPNKDYGGDLFID  179

Query  606  GQAV  617
            G+ +
Sbjct  180  GKVI  183



>ref|XP_010486211.1| PREDICTED: uncharacterized protein At3g15000, mitochondrial-like 
[Camelina sativa]
Length=241

 Score =   189 bits (479),  Expect = 9e-56, Method: Compositional matrix adjust.
 Identities = 96/157 (61%), Positives = 113/157 (72%), Gaps = 1/157 (1%)
 Frame = +3

Query  150  FRLRPLVSVSPAVCQLYPAAYTAVRGLATRQTSSSLNDPNPNWSNRPPKETILLDGCDFE  329
            F L  L  VS +   L P  Y + R   +    S LNDP+PNWSNRPPKETILLDGCD+E
Sbjct  33   FALPLLEKVSSSRTGLGPC-YISTRLKTSGSGYSPLNDPSPNWSNRPPKETILLDGCDYE  91

Query  330  HWLIVMEKPEGDPTRDEIIDSYIKTLAQVVGSEEEARMKIYSVSTRHYYAFGALVSEELS  509
            HWLIVME  +  PT +E+I SY+KTL  V+GSEEEA+ KIYSV T  Y  FGAL+SEELS
Sbjct  92   HWLIVMEFTDPKPTEEEMISSYVKTLTSVLGSEEEAKKKIYSVCTSTYTGFGALISEELS  151

Query  510  YKLKELKGVRWVLPDSYLDVKNKDYGGEPFINGQAVP  620
             K+K L GV WVLPDSYLDV NKDYGG+ +I G+ +P
Sbjct  152  CKVKGLPGVLWVLPDSYLDVPNKDYGGDLYIEGKVIP  188



>ref|NP_974243.1| multiple organellar RNA editing factor 3 [Arabidopsis thaliana]
 gb|AAO22791.1| putative DAG protein [Arabidopsis thaliana]
 gb|AAO42445.1| putative DAG protein [Arabidopsis thaliana]
 gb|AEE74460.1| multiple organellar RNA editing factor 3 [Arabidopsis thaliana]
Length=244

 Score =   188 bits (478),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 93/159 (58%), Positives = 114/159 (72%), Gaps = 1/159 (1%)
 Frame = +3

Query  144  SSFRLRPLVSVSPAVCQLYPAAYTAVRGLATRQTSSSLNDPNPNWSNRPPKETILLDGCD  323
            S F +  +  VS +   L P  Y + R   +    S LNDP+PNWSNRPPKETILLDGCD
Sbjct  35   SRFAMPLIEKVSSSRTSLGPC-YISTRPKTSGSGYSPLNDPSPNWSNRPPKETILLDGCD  93

Query  324  FEHWLIVMEKPEGDPTRDEIIDSYIKTLAQVVGSEEEARMKIYSVSTRHYYAFGALVSEE  503
            +EHWLIVME  +  PT +E+I+SY+KTL  V+G EEEA+ KIYSV T  Y  FGAL+SEE
Sbjct  94   YEHWLIVMEFTDPKPTEEEMINSYVKTLTSVLGCEEEAKKKIYSVCTSTYTGFGALISEE  153

Query  504  LSYKLKELKGVRWVLPDSYLDVKNKDYGGEPFINGQAVP  620
            LS K+K L GV WVLPDSYLDV NKDYGG+ ++ G+ +P
Sbjct  154  LSCKVKALPGVLWVLPDSYLDVPNKDYGGDLYVEGKVIP  192



>ref|XP_011071420.1| PREDICTED: DAG protein, chloroplastic [Sesamum indicum]
Length=258

 Score =   189 bits (479),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 89/124 (72%), Positives = 104/124 (84%), Gaps = 1/124 (1%)
 Frame = +3

Query  249  SSLNDPNPNWSNRPPKETILLDGCDFEHWLIVME-KPEGDPTRDEIIDSYIKTLAQVVGS  425
            S LNDP+PNWSNRPPKETILLDGCD+EHWLIVME   +  PT +E+ID+Y+KTLA VVGS
Sbjct  56   SPLNDPSPNWSNRPPKETILLDGCDYEHWLIVMEFNSDPKPTEEEMIDAYVKTLASVVGS  115

Query  426  EEEARMKIYSVSTRHYYAFGALVSEELSYKLKELKGVRWVLPDSYLDVKNKDYGGEPFIN  605
            EEEA+ KIYSV T  Y  FGAL+SEELSYK+K L GV WVLPDSYLDV NKDYGG+ F++
Sbjct  116  EEEAKKKIYSVCTTTYTGFGALISEELSYKVKGLPGVLWVLPDSYLDVPNKDYGGDLFVD  175

Query  606  GQAV  617
            G+ +
Sbjct  176  GKVI  179



>emb|CDY08033.1| BnaC03g34900D [Brassica napus]
Length=215

 Score =   187 bits (475),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 89/138 (64%), Positives = 105/138 (76%), Gaps = 0/138 (0%)
 Frame = +3

Query  207  AYTAVRGLATRQTSSSLNDPNPNWSNRPPKETILLDGCDFEHWLIVMEKPEGDPTRDEII  386
             Y   R   +    S LNDP+PNWSNRPPKETILLDGCD+EHWLIVME  +  PT DE+I
Sbjct  54   CYIPTRPKTSGSGYSPLNDPSPNWSNRPPKETILLDGCDYEHWLIVMEFDDPKPTEDEMI  113

Query  387  DSYIKTLAQVVGSEEEARMKIYSVSTRHYYAFGALVSEELSYKLKELKGVRWVLPDSYLD  566
            ++Y+KTL  VVG +EEA+ KIYSVST  Y  FGAL+SEELS K+K L GV WVLPDSYLD
Sbjct  114  NAYVKTLTSVVGRQEEAKKKIYSVSTSTYTGFGALISEELSCKVKGLPGVLWVLPDSYLD  173

Query  567  VKNKDYGGEPFINGQAVP  620
            V NKDYGG+ +I G+ +P
Sbjct  174  VPNKDYGGDLYIEGKVIP  191



>ref|XP_009758237.1| PREDICTED: DAG protein, chloroplastic-like [Nicotiana sylvestris]
Length=259

 Score =   189 bits (479),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 91/146 (62%), Positives = 112/146 (77%), Gaps = 5/146 (3%)
 Frame = +3

Query  180  PAVCQLYPAAYTAVRGLATRQTSSSLNDPNPNWSNRPPKETILLDGCDFEHWLIVMEKPE  359
            P+  Q +P      R  ++    S LNDP+PNWSNRPPKETILLDGCD+EHWLIV+E P+
Sbjct  44   PSSEQFFP-----TRPKSSGSGYSPLNDPSPNWSNRPPKETILLDGCDYEHWLIVLEFPD  98

Query  360  GDPTRDEIIDSYIKTLAQVVGSEEEARMKIYSVSTRHYYAFGALVSEELSYKLKELKGVR  539
              P  +E+I++Y+KTLA VVGSEEEA+ KIYSV T  Y  FGAL+SEELSYK+K L GV 
Sbjct  99   PKPLEEEMINAYVKTLAAVVGSEEEAKKKIYSVCTTTYTGFGALISEELSYKVKGLPGVL  158

Query  540  WVLPDSYLDVKNKDYGGEPFINGQAV  617
            WVLPDSYLDV NKDYGG+ F++G+ +
Sbjct  159  WVLPDSYLDVPNKDYGGDLFVDGKVI  184



>gb|KJB38555.1| hypothetical protein B456_006G260400 [Gossypium raimondii]
Length=210

 Score =   187 bits (474),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 87/124 (70%), Positives = 104/124 (84%), Gaps = 1/124 (1%)
 Frame = +3

Query  249  SSLNDPNPNWSNRPPKETILLDGCDFEHWLIVMEKPEG-DPTRDEIIDSYIKTLAQVVGS  425
            S LNDP+PNWSNRPPKETILLDGCD+EHWLIV+E PE   P+ +E+ID+Y+KTLA VVGS
Sbjct  60   SPLNDPSPNWSNRPPKETILLDGCDYEHWLIVLEFPEDPKPSEEEMIDAYVKTLASVVGS  119

Query  426  EEEARMKIYSVSTRHYYAFGALVSEELSYKLKELKGVRWVLPDSYLDVKNKDYGGEPFIN  605
            EEEA+ +IYSV T  Y  FGAL+SEELSYK+K L  V WVLPDSYLDV NKDYGG+ F++
Sbjct  120  EEEAKKRIYSVCTTRYTGFGALISEELSYKVKGLPHVLWVLPDSYLDVPNKDYGGDLFVD  179

Query  606  GQAV  617
            G+ +
Sbjct  180  GKVI  183



>gb|KHG18939.1| hypothetical protein F383_03121 [Gossypium arboreum]
Length=210

 Score =   187 bits (474),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 91/139 (65%), Positives = 111/139 (80%), Gaps = 5/139 (4%)
 Frame = +3

Query  216  AVRGLATRQTSSS----LNDPNPNWSNRPPKETILLDGCDFEHWLIVMEKPEG-DPTRDE  380
            A + L   +TS+S    LNDP+PNWSNRPPKETILLDGCD+EHWLIV+E PE   P+ +E
Sbjct  45   ATKILTRTKTSASGYSPLNDPSPNWSNRPPKETILLDGCDYEHWLIVLEFPEDPKPSEEE  104

Query  381  IIDSYIKTLAQVVGSEEEARMKIYSVSTRHYYAFGALVSEELSYKLKELKGVRWVLPDSY  560
            +ID+Y+KTLA VVGSEEEA+ +IYSV T  Y  FGAL+SEELSYK+K L  V WVLPDSY
Sbjct  105  MIDAYVKTLASVVGSEEEAKKRIYSVCTTRYTGFGALISEELSYKVKGLPRVLWVLPDSY  164

Query  561  LDVKNKDYGGEPFINGQAV  617
            LDV NKDYGG+ F++G+ +
Sbjct  165  LDVPNKDYGGDLFVDGKVI  183



>ref|XP_003568685.1| PREDICTED: uncharacterized protein At3g15000, mitochondrial [Brachypodium 
distachyon]
Length=250

 Score =   188 bits (477),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 99/174 (57%), Positives = 120/174 (69%), Gaps = 12/174 (7%)
 Frame = +3

Query  108  SSLTPPRNFLAFSSFRLRPLVSVSPAVCQLYPAA---YTAVRGLATRQTSSSLNDPNPNW  278
            SS  P R FL        PL + + +   L P A     A   L  +   S LNDP+PNW
Sbjct  16   SSRAPHRRFL--------PLAAAAVSSAHLAPWAPPSRGAKTALPGKSGYSPLNDPSPNW  67

Query  279  SNRPPKETILLDGCDFEHWLIVMEKP-EGDPTRDEIIDSYIKTLAQVVGSEEEARMKIYS  455
            SNRPPKETILLDGCD+EHWLIVME P +  P+ +E++ +Y+KTL  V+GSEEEA+ KIYS
Sbjct  68   SNRPPKETILLDGCDYEHWLIVMEFPTDPKPSEEEMVAAYVKTLTAVIGSEEEAKKKIYS  127

Query  456  VSTRHYYAFGALVSEELSYKLKELKGVRWVLPDSYLDVKNKDYGGEPFINGQAV  617
            V T  Y  FGAL+SEELSYK+K L GV WVLPDSYLDV NKDYGG+ FI+G+ +
Sbjct  128  VCTTTYTGFGALISEELSYKVKGLPGVLWVLPDSYLDVPNKDYGGDLFIDGKVI  181



>ref|XP_010464270.1| PREDICTED: uncharacterized protein At3g15000, mitochondrial-like 
[Camelina sativa]
Length=239

 Score =   187 bits (476),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 95/157 (61%), Positives = 113/157 (72%), Gaps = 1/157 (1%)
 Frame = +3

Query  150  FRLRPLVSVSPAVCQLYPAAYTAVRGLATRQTSSSLNDPNPNWSNRPPKETILLDGCDFE  329
            F L  L  VS +   L P  Y + R   +    S LNDP+PNWSNRPPKETILLDGCD+E
Sbjct  30   FALPLLEKVSSSRTGLGPC-YISTRLKTSGSGYSPLNDPSPNWSNRPPKETILLDGCDYE  88

Query  330  HWLIVMEKPEGDPTRDEIIDSYIKTLAQVVGSEEEARMKIYSVSTRHYYAFGALVSEELS  509
            HWLIVME  +  PT +E+I++Y+ TL  VVGSEEEA+ KIYSV T  Y  FGAL+SEELS
Sbjct  89   HWLIVMEFTDPKPTEEEMINAYVNTLTSVVGSEEEAKKKIYSVCTSTYTGFGALISEELS  148

Query  510  YKLKELKGVRWVLPDSYLDVKNKDYGGEPFINGQAVP  620
             K+K L GV WVLPDSYLDV NKDYGG+ +I G+ +P
Sbjct  149  CKVKGLPGVLWVLPDSYLDVPNKDYGGDLYIEGKVIP  185



>ref|XP_008340777.1| PREDICTED: uncharacterized protein At3g15000, mitochondrial [Malus 
domestica]
Length=259

 Score =   188 bits (477),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 94/143 (66%), Positives = 115/143 (80%), Gaps = 3/143 (2%)
 Frame = +3

Query  201  PAAYTA-VRGLATRQTS--SSLNDPNPNWSNRPPKETILLDGCDFEHWLIVMEKPEGDPT  371
            PA  +A VR L+++  S  S LND +PNWSNRPPKETILLDGCD+EHWLIVME  +  P+
Sbjct  47   PAPGSANVRTLSSKSGSGYSPLNDASPNWSNRPPKETILLDGCDYEHWLIVMEFEDPKPS  106

Query  372  RDEIIDSYIKTLAQVVGSEEEARMKIYSVSTRHYYAFGALVSEELSYKLKELKGVRWVLP  551
             +E+I+SY+KTLA V+GSEEEA+ KIYSVST  Y  FGAL+SEELS K+K L GV WVLP
Sbjct  107  DEEMINSYVKTLATVLGSEEEAKKKIYSVSTSTYTGFGALISEELSLKVKGLPGVLWVLP  166

Query  552  DSYLDVKNKDYGGEPFINGQAVP  620
            DSYLDV NKDYGG+ +I+G+ +P
Sbjct  167  DSYLDVPNKDYGGDLYIDGKVIP  189



>gb|KDP27842.1| hypothetical protein JCGZ_18922 [Jatropha curcas]
Length=242

 Score =   187 bits (475),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 88/124 (71%), Positives = 106/124 (85%), Gaps = 1/124 (1%)
 Frame = +3

Query  249  SSLNDPNPNWSNRPPKETILLDGCDFEHWLIVMEKP-EGDPTRDEIIDSYIKTLAQVVGS  425
            S LNDP+PNWSNRPPKETILLDGCD+EHWLIVME P +  PT +E+I++Y+KTLA VVGS
Sbjct  65   SPLNDPSPNWSNRPPKETILLDGCDYEHWLIVMEFPTDPKPTEEEMINAYVKTLATVVGS  124

Query  426  EEEARMKIYSVSTRHYYAFGALVSEELSYKLKELKGVRWVLPDSYLDVKNKDYGGEPFIN  605
            E+EA+ KIYSVST  Y  FGAL+SEELS+K+K L GV WVLPDSYLDV NKDYGG+ F++
Sbjct  125  EDEAKKKIYSVSTSTYTGFGALISEELSHKVKGLPGVLWVLPDSYLDVPNKDYGGDLFVD  184

Query  606  GQAV  617
            G+ +
Sbjct  185  GKVI  188



>ref|XP_002448533.1| hypothetical protein SORBIDRAFT_06g028620 [Sorghum bicolor]
 gb|EES12861.1| hypothetical protein SORBIDRAFT_06g028620 [Sorghum bicolor]
Length=244

 Score =   187 bits (475),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 102/176 (58%), Positives = 124/176 (70%), Gaps = 14/176 (8%)
 Frame = +3

Query  105  YSSLTPPRNFLAFSSFRLRPLVSVSPAVCQLYPAAYTAVRGLATRQTSSS----LNDPNP  272
            YSS   PR        RL PL + + A   + P A  A RG  T  +  S    LNDP+P
Sbjct  17   YSSRALPR--------RLVPLAASA-ASAHVAPWALLASRGARTASSGGSGYSPLNDPSP  67

Query  273  NWSNRPPKETILLDGCDFEHWLIVMEKP-EGDPTRDEIIDSYIKTLAQVVGSEEEARMKI  449
            NWSNRPPKETILLDGCD+EHWLIVME P +  P+ +E++ +Y+KTLA V+GSEEEA+ KI
Sbjct  68   NWSNRPPKETILLDGCDYEHWLIVMEFPTDPKPSEEEMVGAYVKTLAAVLGSEEEAKKKI  127

Query  450  YSVSTRHYYAFGALVSEELSYKLKELKGVRWVLPDSYLDVKNKDYGGEPFINGQAV  617
            YSV T  Y  FGAL+SEELSYK+K L GV WVLPDSYLDV NKDYGG+ F++G+ +
Sbjct  128  YSVCTSTYTGFGALISEELSYKVKGLPGVLWVLPDSYLDVPNKDYGGDLFVDGKVI  183



>ref|XP_007223708.1| hypothetical protein PRUPE_ppa010098mg [Prunus persica]
 gb|EMJ24907.1| hypothetical protein PRUPE_ppa010098mg [Prunus persica]
Length=264

 Score =   187 bits (476),  Expect = 4e-55, Method: Compositional matrix adjust.
 Identities = 89/133 (67%), Positives = 106/133 (80%), Gaps = 0/133 (0%)
 Frame = +3

Query  222  RGLATRQTSSSLNDPNPNWSNRPPKETILLDGCDFEHWLIVMEKPEGDPTRDEIIDSYIK  401
            R   + Q  S LND  PNWSNRPPKETILLDGCD+EHWLIVME  +  P+ +E+I+SY+K
Sbjct  56   RSKHSGQGYSPLNDATPNWSNRPPKETILLDGCDYEHWLIVMEYDDPKPSEEEMINSYVK  115

Query  402  TLAQVVGSEEEARMKIYSVSTRHYYAFGALVSEELSYKLKELKGVRWVLPDSYLDVKNKD  581
            TLA V+GSEEEA+ KIYSVST  Y  FGAL+SEELS K+K L GV WVLPDSYLDV NKD
Sbjct  116  TLATVLGSEEEAKKKIYSVSTTTYTGFGALISEELSLKVKGLPGVLWVLPDSYLDVPNKD  175

Query  582  YGGEPFINGQAVP  620
            YGG+ +I+G+ +P
Sbjct  176  YGGDLYIDGKVIP  188



>ref|XP_006848369.1| hypothetical protein AMTR_s00013p00196470 [Amborella trichopoda]
 gb|ERN09950.1| hypothetical protein AMTR_s00013p00196470 [Amborella trichopoda]
Length=258

 Score =   187 bits (475),  Expect = 4e-55, Method: Compositional matrix adjust.
 Identities = 89/124 (72%), Positives = 104/124 (84%), Gaps = 1/124 (1%)
 Frame = +3

Query  249  SSLNDPNPNWSNRPPKETILLDGCDFEHWLIVMEKPEG-DPTRDEIIDSYIKTLAQVVGS  425
            S LNDP+PNWSNRPPKETI+LDGCD+EHWLIVME PE   P+ DE+I +Y+KTLA VVGS
Sbjct  47   SPLNDPSPNWSNRPPKETIMLDGCDYEHWLIVMEFPEDPKPSEDEMIAAYVKTLAAVVGS  106

Query  426  EEEARMKIYSVSTRHYYAFGALVSEELSYKLKELKGVRWVLPDSYLDVKNKDYGGEPFIN  605
            EEEA+ KIYSV T  Y  FGAL+SEELSYK+K L GV WVLPDSYLDV NKDYGG+ F++
Sbjct  107  EEEAKKKIYSVCTTTYTGFGALISEELSYKVKGLPGVLWVLPDSYLDVPNKDYGGDLFVD  166

Query  606  GQAV  617
            G+ +
Sbjct  167  GKVI  170



>ref|XP_010445020.1| PREDICTED: uncharacterized protein At3g15000, mitochondrial [Camelina 
sativa]
Length=241

 Score =   186 bits (473),  Expect = 7e-55, Method: Compositional matrix adjust.
 Identities = 94/157 (60%), Positives = 113/157 (72%), Gaps = 1/157 (1%)
 Frame = +3

Query  150  FRLRPLVSVSPAVCQLYPAAYTAVRGLATRQTSSSLNDPNPNWSNRPPKETILLDGCDFE  329
            F L  L  VS +   L P  Y + R   +    S LNDP+PNWSNRPPKETILLDGCD+E
Sbjct  33   FALPLLEKVSSSRTGLGPC-YISTRLKTSGSGYSPLNDPSPNWSNRPPKETILLDGCDYE  91

Query  330  HWLIVMEKPEGDPTRDEIIDSYIKTLAQVVGSEEEARMKIYSVSTRHYYAFGALVSEELS  509
            HWLIVME  +  PT +E+I++Y+ TL  V+GSEEEA+ KIYSV T  Y  FGAL+SEELS
Sbjct  92   HWLIVMEFTDPKPTEEEMINAYVNTLTSVLGSEEEAKKKIYSVCTSTYTGFGALISEELS  151

Query  510  YKLKELKGVRWVLPDSYLDVKNKDYGGEPFINGQAVP  620
             K+K L GV WVLPDSYLDV NKDYGG+ +I G+ +P
Sbjct  152  CKVKGLPGVLWVLPDSYLDVPNKDYGGDLYIEGKVIP  188



>ref|XP_004296867.1| PREDICTED: uncharacterized protein At3g15000, mitochondrial [Fragaria 
vesca subsp. vesca]
Length=223

 Score =   186 bits (471),  Expect = 8e-55, Method: Compositional matrix adjust.
 Identities = 86/124 (69%), Positives = 104/124 (84%), Gaps = 0/124 (0%)
 Frame = +3

Query  249  SSLNDPNPNWSNRPPKETILLDGCDFEHWLIVMEKPEGDPTRDEIIDSYIKTLAQVVGSE  428
            S LND +PNW+NRPPKETILLDGCD+EHWLIV+E  +  P+ +E+I+SY+KTLA VVGSE
Sbjct  62   SPLNDTSPNWNNRPPKETILLDGCDYEHWLIVLEFSDPKPSEEEMINSYVKTLASVVGSE  121

Query  429  EEARMKIYSVSTRHYYAFGALVSEELSYKLKELKGVRWVLPDSYLDVKNKDYGGEPFING  608
            EEA+ KIYSVST  Y  FGAL+SEELS K+KE  GV WVLPDSYLDV NKDYGG+ +I+G
Sbjct  122  EEAKKKIYSVSTTTYTGFGALISEELSLKVKEQPGVLWVLPDSYLDVPNKDYGGDLYIDG  181

Query  609  QAVP  620
            + +P
Sbjct  182  KVIP  185



>ref|XP_010269600.1| PREDICTED: uncharacterized protein At3g15000, mitochondrial-like 
[Nelumbo nucifera]
Length=248

 Score =   186 bits (473),  Expect = 9e-55, Method: Compositional matrix adjust.
 Identities = 88/124 (71%), Positives = 103/124 (83%), Gaps = 1/124 (1%)
 Frame = +3

Query  249  SSLNDPNPNWSNRPPKETILLDGCDFEHWLIVMEKP-EGDPTRDEIIDSYIKTLAQVVGS  425
            S LNDP+PNWSNRPPKETILLDGCD+EHWLIVME P +  P+ DE+I +Y+KTL  +VGS
Sbjct  61   SPLNDPSPNWSNRPPKETILLDGCDYEHWLIVMEFPNDPKPSEDEMIATYVKTLTAIVGS  120

Query  426  EEEARMKIYSVSTRHYYAFGALVSEELSYKLKELKGVRWVLPDSYLDVKNKDYGGEPFIN  605
            EEEA+ KIYSV T  Y  FGAL+SEELSYK+K L GV WVLPDSYLDV NKDYGG+ FI+
Sbjct  121  EEEAKKKIYSVCTTTYTGFGALISEELSYKVKGLPGVLWVLPDSYLDVPNKDYGGDLFID  180

Query  606  GQAV  617
            G+ +
Sbjct  181  GKVI  184



>gb|ABF97301.1| DAG protein, chloroplast precursor, putative, expressed [Oryza 
sativa Japonica Group]
 dbj|BAH01063.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEC75635.1| hypothetical protein OsI_12374 [Oryza sativa Indica Group]
 gb|EEE59403.1| hypothetical protein OsJ_11545 [Oryza sativa Japonica Group]
Length=228

 Score =   185 bits (470),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 90/137 (66%), Positives = 108/137 (79%), Gaps = 5/137 (4%)
 Frame = +3

Query  222  RGLATRQTSSS----LNDPNPNWSNRPPKETILLDGCDFEHWLIVMEKP-EGDPTRDEII  386
            RG  T  +  S    LNDP+PNWSNRPPKETILLDGCD+EHWLIVME P +  P+ ++++
Sbjct  47   RGAKTASSGGSGYSPLNDPSPNWSNRPPKETILLDGCDYEHWLIVMEFPTDPKPSEEDMV  106

Query  387  DSYIKTLAQVVGSEEEARMKIYSVSTRHYYAFGALVSEELSYKLKELKGVRWVLPDSYLD  566
             +Y+KTLA VVGSEEEA+ KIYSV T  Y  FGAL+SEELSYK+K L GV WVLPDSYLD
Sbjct  107  AAYVKTLAAVVGSEEEAKKKIYSVCTTTYTGFGALISEELSYKVKGLPGVLWVLPDSYLD  166

Query  567  VKNKDYGGEPFINGQAV  617
            V NKDYGG+ F++GQ +
Sbjct  167  VPNKDYGGDLFVDGQVI  183



>ref|NP_187335.1| multiple organellar RNA editing factor 3 [Arabidopsis thaliana]
 gb|AAF63819.1| DAG protein, putative [Arabidopsis thaliana]
 gb|AEE74459.1| multiple organellar RNA editing factor 3 [Arabidopsis thaliana]
Length=244

 Score =   186 bits (471),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 92/159 (58%), Positives = 114/159 (72%), Gaps = 1/159 (1%)
 Frame = +3

Query  144  SSFRLRPLVSVSPAVCQLYPAAYTAVRGLATRQTSSSLNDPNPNWSNRPPKETILLDGCD  323
            S F +  +  VS +   L P  Y + R   +    S LNDP+PNWSNRPPKETILLDGCD
Sbjct  35   SRFAMPLIEKVSSSRTSLGPC-YISTRPKTSGSGYSPLNDPSPNWSNRPPKETILLDGCD  93

Query  324  FEHWLIVMEKPEGDPTRDEIIDSYIKTLAQVVGSEEEARMKIYSVSTRHYYAFGALVSEE  503
            +EHWLIVME  +  PT +E+I+SY+KTL  V+G +EEA+ KIYSV T  Y  FGAL+SEE
Sbjct  94   YEHWLIVMEFTDPKPTEEEMINSYVKTLTSVLGWQEEAKKKIYSVCTSTYTGFGALISEE  153

Query  504  LSYKLKELKGVRWVLPDSYLDVKNKDYGGEPFINGQAVP  620
            LS K+K L GV WVLPDSYLDV NKDYGG+ ++ G+ +P
Sbjct  154  LSCKVKALPGVLWVLPDSYLDVPNKDYGGDLYVEGKVIP  192



>gb|EYU45530.1| hypothetical protein MIMGU_mgv1a012634mg [Erythranthe guttata]
Length=244

 Score =   185 bits (470),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 88/124 (71%), Positives = 103/124 (83%), Gaps = 1/124 (1%)
 Frame = +3

Query  249  SSLNDPNPNWSNRPPKETILLDGCDFEHWLIVME-KPEGDPTRDEIIDSYIKTLAQVVGS  425
            S LNDP+PNWSNRPPKETILLDGCD+EHWLIVME   E  PT +E+ID+Y+KTLA V+GS
Sbjct  57   SPLNDPSPNWSNRPPKETILLDGCDYEHWLIVMEFDKEPKPTEEEMIDTYVKTLASVIGS  116

Query  426  EEEARMKIYSVSTRHYYAFGALVSEELSYKLKELKGVRWVLPDSYLDVKNKDYGGEPFIN  605
            EEEA+ KIYSV T  Y  FGAL+SEELS K+K L GV WVLPDSYLDV NKDYGG+ F++
Sbjct  117  EEEAKKKIYSVCTSTYTGFGALISEELSSKVKGLPGVLWVLPDSYLDVPNKDYGGDLFVD  176

Query  606  GQAV  617
            G+ +
Sbjct  177  GKVI  180



>gb|AFW59460.1| DAG protein [Zea mays]
Length=246

 Score =   185 bits (470),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 98/162 (60%), Positives = 118/162 (73%), Gaps = 10/162 (6%)
 Frame = +3

Query  153  RLRPLVSV--SPAVCQLYPAAYTAVRGLATRQTSSS----LNDPNPNWSNRPPKETILLD  314
            RL PL +   SP V    P    A RG  T  +  S    LNDP+PNWSNRPPKETILLD
Sbjct  26   RLGPLAAAAASPHVA---PWPLLAPRGARTASSGGSGHSPLNDPSPNWSNRPPKETILLD  82

Query  315  GCDFEHWLIVMEKP-EGDPTRDEIIDSYIKTLAQVVGSEEEARMKIYSVSTRHYYAFGAL  491
            GCD+EHWLIVME P +  P+ +E++ +Y+KTLA V+GSEEEA+ KIYSV T  Y  FGAL
Sbjct  83   GCDYEHWLIVMEFPTDPKPSEEEMVAAYVKTLAAVLGSEEEAKKKIYSVCTSTYTGFGAL  142

Query  492  VSEELSYKLKELKGVRWVLPDSYLDVKNKDYGGEPFINGQAV  617
            +SEELSYK+K L GV WVLPDSYLDV NKDYGG+ F++G+ +
Sbjct  143  ISEELSYKVKGLPGVLWVLPDSYLDVPNKDYGGDLFVDGKVI  184



>ref|XP_006298387.1| hypothetical protein CARUB_v10014458mg, partial [Capsella rubella]
 gb|EOA31285.1| hypothetical protein CARUB_v10014458mg, partial [Capsella rubella]
Length=253

 Score =   185 bits (470),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 94/157 (60%), Positives = 113/157 (72%), Gaps = 1/157 (1%)
 Frame = +3

Query  150  FRLRPLVSVSPAVCQLYPAAYTAVRGLATRQTSSSLNDPNPNWSNRPPKETILLDGCDFE  329
            F L  L  V  A   L P  Y + R   +    S LNDP+PNWSNRPPKETILLDGCD+E
Sbjct  49   FALPLLEKVFSARTGLGPC-YLSTRLKTSGSGYSPLNDPSPNWSNRPPKETILLDGCDYE  107

Query  330  HWLIVMEKPEGDPTRDEIIDSYIKTLAQVVGSEEEARMKIYSVSTRHYYAFGALVSEELS  509
            HWLIVME  +  P+ +E+I++Y+KTL  V+GSEEEA+ KIYSV T  Y  FGAL+SEELS
Sbjct  108  HWLIVMEFTDPKPSEEEMINAYVKTLTSVLGSEEEAKKKIYSVCTSTYTGFGALISEELS  167

Query  510  YKLKELKGVRWVLPDSYLDVKNKDYGGEPFINGQAVP  620
             K+K L GV WVLPDSYLDV NKDYGG+ +I G+ +P
Sbjct  168  CKVKGLPGVLWVLPDSYLDVPNKDYGGDLYIEGKVIP  204



>ref|NP_001152375.1| DAG protein [Zea mays]
 gb|ACG47310.1| DAG protein [Zea mays]
Length=244

 Score =   185 bits (469),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 91/147 (62%), Positives = 111/147 (76%), Gaps = 5/147 (3%)
 Frame = +3

Query  192  QLYPAAYTAVRGLATRQTSSS----LNDPNPNWSNRPPKETILLDGCDFEHWLIVMEKP-  356
             + P    A RG  T  +  S    LNDP+PNWSNRPPKETILLDGCD+EHWLIVME P 
Sbjct  38   HVAPWPLLAPRGARTASSGGSGHSPLNDPSPNWSNRPPKETILLDGCDYEHWLIVMEFPT  97

Query  357  EGDPTRDEIIDSYIKTLAQVVGSEEEARMKIYSVSTRHYYAFGALVSEELSYKLKELKGV  536
            +  P+ +E++ +Y+KTLA V+GSEEEA+ KIYSV T  Y  FGAL+SEELSYK+K L GV
Sbjct  98   DPKPSEEEMVAAYVKTLAAVLGSEEEAKKKIYSVCTSTYTGFGALISEELSYKVKGLPGV  157

Query  537  RWVLPDSYLDVKNKDYGGEPFINGQAV  617
             WVLPDSYLDV NKDYGG+ F++G+ +
Sbjct  158  LWVLPDSYLDVPNKDYGGDLFVDGKVI  184



>ref|XP_010039379.1| PREDICTED: DAG protein, chloroplastic [Eucalyptus grandis]
 gb|KCW84747.1| hypothetical protein EUGRSUZ_B01560 [Eucalyptus grandis]
 gb|KCW84748.1| hypothetical protein EUGRSUZ_B01560 [Eucalyptus grandis]
Length=269

 Score =   185 bits (470),  Expect = 4e-54, Method: Compositional matrix adjust.
 Identities = 86/124 (69%), Positives = 104/124 (84%), Gaps = 1/124 (1%)
 Frame = +3

Query  249  SSLNDPNPNWSNRPPKETILLDGCDFEHWLIVMEKP-EGDPTRDEIIDSYIKTLAQVVGS  425
            S LNDP+PNWSNRPPKETILLDGCD+EHWLIVME P +  P+ +E+I++Y+KTLA VVGS
Sbjct  69   SPLNDPSPNWSNRPPKETILLDGCDYEHWLIVMEFPTDPKPSEEEMINAYVKTLASVVGS  128

Query  426  EEEARMKIYSVSTRHYYAFGALVSEELSYKLKELKGVRWVLPDSYLDVKNKDYGGEPFIN  605
            EEEA+ KIYSV +  Y  FG L+SEELSYK+K L GV WVLPDSYLDV NKDYGG+ F++
Sbjct  129  EEEAKKKIYSVCSTTYTGFGCLISEELSYKVKGLPGVLWVLPDSYLDVPNKDYGGDLFVD  188

Query  606  GQAV  617
            G+ +
Sbjct  189  GKVI  192



>emb|CDO98829.1| unnamed protein product [Coffea canephora]
Length=262

 Score =   185 bits (469),  Expect = 5e-54, Method: Compositional matrix adjust.
 Identities = 92/155 (59%), Positives = 115/155 (74%), Gaps = 2/155 (1%)
 Frame = +3

Query  162  PLVSVSPAVCQLYPAAYTAV-RGLATRQTSSSLNDPNPNWSNRPPKETILLDGCDFEHWL  338
            PL+++     +  P  Y  + R   +    S LNDP+PNWSNRPPKETILLDGCD+EHWL
Sbjct  29   PLLNLHNETPEAAPIPYNILTRNRTSGSGYSPLNDPSPNWSNRPPKETILLDGCDYEHWL  88

Query  339  IVMEKP-EGDPTRDEIIDSYIKTLAQVVGSEEEARMKIYSVSTRHYYAFGALVSEELSYK  515
            IVME P +  P+ +E+++ Y+KTLA VVGSEEEA+ KIYSV T  Y  FGAL+SEELSYK
Sbjct  89   IVMEFPNDPKPSDEEMVNIYVKTLASVVGSEEEAKKKIYSVCTTTYTGFGALISEELSYK  148

Query  516  LKELKGVRWVLPDSYLDVKNKDYGGEPFINGQAVP  620
            +K L  V WVLPDSYLDV NKDYGG+ F++G+ +P
Sbjct  149  VKGLPDVLWVLPDSYLDVPNKDYGGDLFVDGKVIP  183



>ref|XP_007035660.1| Plastid developmental protein DAG [Theobroma cacao]
 gb|EOY06586.1| Plastid developmental protein DAG [Theobroma cacao]
Length=238

 Score =   184 bits (466),  Expect = 8e-54, Method: Compositional matrix adjust.
 Identities = 90/138 (65%), Positives = 108/138 (78%), Gaps = 5/138 (4%)
 Frame = +3

Query  219  VRGLATRQTSSS----LNDPNPNWSNRPPKETILLDGCDFEHWLIVMEKPEG-DPTRDEI  383
            V+ L   +TS S    LNDP+PNWSNRPPKETILLDGCD+EHWLIV+E P+   P+ +E+
Sbjct  50   VKILTRNRTSGSGYSPLNDPSPNWSNRPPKETILLDGCDYEHWLIVLEFPDDPKPSEEEM  109

Query  384  IDSYIKTLAQVVGSEEEARMKIYSVSTRHYYAFGALVSEELSYKLKELKGVRWVLPDSYL  563
            ID+Y+KTLA VVGSEEEA+ +IYSV T  Y  FGAL+SEELSYK K L  V WVLPDSY 
Sbjct  110  IDAYVKTLASVVGSEEEAKKRIYSVCTTTYTGFGALISEELSYKFKGLLRVLWVLPDSYH  169

Query  564  DVKNKDYGGEPFINGQAV  617
            DV NKDYGG+ F+NG+ +
Sbjct  170  DVPNKDYGGDLFVNGKVI  187



>dbj|BAK07084.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=252

 Score =   184 bits (466),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 87/140 (62%), Positives = 108/140 (77%), Gaps = 1/140 (1%)
 Frame = +3

Query  201  PAAYTAVRGLATRQTSSSLNDPNPNWSNRPPKETILLDGCDFEHWLIVMEKP-EGDPTRD  377
            P +  A   L  R   S LNDP+PNWSNRPPKETILLDGCD+EHWLIVME P +  P+ +
Sbjct  45   PPSRGAKTALPGRPGHSPLNDPSPNWSNRPPKETILLDGCDYEHWLIVMEFPADPKPSEE  104

Query  378  EIIDSYIKTLAQVVGSEEEARMKIYSVSTRHYYAFGALVSEELSYKLKELKGVRWVLPDS  557
            +++ +Y+KTL  V+GSEEEA+ KIYSV T  Y  FGAL+SEELSY++K L GV WVLPDS
Sbjct  105  DMVAAYVKTLTAVLGSEEEAKKKIYSVCTTTYTGFGALISEELSYRVKGLPGVLWVLPDS  164

Query  558  YLDVKNKDYGGEPFINGQAV  617
            YLDV NKDYGG+ F++G+ +
Sbjct  165  YLDVPNKDYGGDLFVDGKVI  184



>ref|XP_009414137.1| PREDICTED: uncharacterized protein At3g15000, mitochondrial-like 
[Musa acuminata subsp. malaccensis]
Length=259

 Score =   183 bits (465),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 87/124 (70%), Positives = 103/124 (83%), Gaps = 1/124 (1%)
 Frame = +3

Query  249  SSLNDPNPNWSNRPPKETILLDGCDFEHWLIVMEKPEG-DPTRDEIIDSYIKTLAQVVGS  425
            S LNDP+PNWSNRPPKETILLDGCD+EHWLIVME P+   P+ +E+I +Y+KTLA VV S
Sbjct  73   SPLNDPSPNWSNRPPKETILLDGCDYEHWLIVMEFPQDPKPSEEEMIAAYVKTLAAVVSS  132

Query  426  EEEARMKIYSVSTRHYYAFGALVSEELSYKLKELKGVRWVLPDSYLDVKNKDYGGEPFIN  605
            EEEA+ KIYSV T  Y  FGAL+SEELSYK+K L GV WVLPDSYLDV NKDYGG+ F++
Sbjct  133  EEEAKKKIYSVCTTTYTGFGALISEELSYKVKGLPGVLWVLPDSYLDVPNKDYGGDLFVD  192

Query  606  GQAV  617
            G+ +
Sbjct  193  GKVI  196



>ref|XP_008458408.1| PREDICTED: uncharacterized protein At3g15000, mitochondrial-like 
[Cucumis melo]
Length=215

 Score =   181 bits (460),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 88/145 (61%), Positives = 111/145 (77%), Gaps = 2/145 (1%)
 Frame = +3

Query  192  QLYPAAYT-AVRGLATRQTSSSLNDPNPNWSNRPPKETILLDGCDFEHWLIVMEKP-EGD  365
            Q+ P ++   +R  A+   SS LNDP+PN S RPPKE+I  DGCD+EHWLIV+E P +  
Sbjct  50   QIIPNSFNLPIRCKASESESSPLNDPSPNSSKRPPKESIPYDGCDYEHWLIVLEFPNDPK  109

Query  366  PTRDEIIDSYIKTLAQVVGSEEEARMKIYSVSTRHYYAFGALVSEELSYKLKELKGVRWV  545
            P+ +E+++SY+KTLA VVGSEEEA+ KIYSV T  Y  FGAL+SEELS K+KEL GVRWV
Sbjct  110  PSEEEMVNSYVKTLAAVVGSEEEAKEKIYSVCTTTYTGFGALISEELSRKMKELPGVRWV  169

Query  546  LPDSYLDVKNKDYGGEPFINGQAVP  620
             PDSY DV NKDYGG+ FI+G+ +P
Sbjct  170  FPDSYQDVPNKDYGGDLFIDGKVIP  194



>gb|KJB38557.1| hypothetical protein B456_006G260400 [Gossypium raimondii]
Length=175

 Score =   179 bits (454),  Expect = 7e-53, Method: Compositional matrix adjust.
 Identities = 85/115 (74%), Positives = 97/115 (84%), Gaps = 1/115 (1%)
 Frame = +3

Query  249  SSLNDPNPNWSNRPPKETILLDGCDFEHWLIVMEKPEG-DPTRDEIIDSYIKTLAQVVGS  425
            S LNDP+PNWSNRPPKETILLDGCD+EHWLIV+E PE   P+ +E+ID+Y+KTLA VVGS
Sbjct  60   SPLNDPSPNWSNRPPKETILLDGCDYEHWLIVLEFPEDPKPSEEEMIDAYVKTLASVVGS  119

Query  426  EEEARMKIYSVSTRHYYAFGALVSEELSYKLKELKGVRWVLPDSYLDVKNKDYGG  590
            EEEA+ +IYSV T  Y  FGAL+SEELSYK+K L  V WVLPDSYLDV NKDYGG
Sbjct  120  EEEAKKRIYSVCTTRYTGFGALISEELSYKVKGLPHVLWVLPDSYLDVPNKDYGG  174



>ref|XP_002315492.2| hypothetical protein POPTR_0010s00930g [Populus trichocarpa]
 gb|EEF01663.2| hypothetical protein POPTR_0010s00930g [Populus trichocarpa]
Length=261

 Score =   181 bits (460),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 87/136 (64%), Positives = 106/136 (78%), Gaps = 1/136 (1%)
 Frame = +3

Query  213  TAVRGLATRQTSSSLNDPNPNWSNRPPKETILLDGCDFEHWLIVMEKP-EGDPTRDEIID  389
            T  R   T    S LNDP+PNW+NRPPKETILLDGCD+ HWLIVME P +  PT +E+I+
Sbjct  46   TLTRSKTTGSGYSPLNDPSPNWTNRPPKETILLDGCDYNHWLIVMEFPNDPKPTEEEMIN  105

Query  390  SYIKTLAQVVGSEEEARMKIYSVSTRHYYAFGALVSEELSYKLKELKGVRWVLPDSYLDV  569
            +Y+KTL+ V+GSEEEA+  IYSVST  Y  FGAL+SEELSYK+K L GV WVLPDSYLDV
Sbjct  106  AYVKTLSSVLGSEEEAKKSIYSVSTTTYTGFGALISEELSYKVKALPGVLWVLPDSYLDV  165

Query  570  KNKDYGGEPFINGQAV  617
             NKDYGG+ + +G+ +
Sbjct  166  PNKDYGGDLYEDGKVI  181



>gb|KGN47419.1| hypothetical protein Csa_6G318660 [Cucumis sativus]
Length=216

 Score =   179 bits (455),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 87/145 (60%), Positives = 111/145 (77%), Gaps = 2/145 (1%)
 Frame = +3

Query  192  QLYPAAYT-AVRGLATRQTSSSLNDPNPNWSNRPPKETILLDGCDFEHWLIVMEKP-EGD  365
            Q+ P ++   +R  A+   SS LNDP+PN S RPPK++I  DGCD+EHWLIV+E P +  
Sbjct  50   QITPNSFNLPIRCKASESESSLLNDPSPNSSKRPPKDSIPYDGCDYEHWLIVLEFPNDPK  109

Query  366  PTRDEIIDSYIKTLAQVVGSEEEARMKIYSVSTRHYYAFGALVSEELSYKLKELKGVRWV  545
            P+ +E+++SY+KTLA VVGSEEEA+ KIYSV T  Y  FGAL+SEELS K+KEL GVRWV
Sbjct  110  PSEEEMVNSYVKTLAAVVGSEEEAKEKIYSVCTTTYTGFGALISEELSRKMKELPGVRWV  169

Query  546  LPDSYLDVKNKDYGGEPFINGQAVP  620
             PDSY DV NKDYGG+ FI+G+ +P
Sbjct  170  FPDSYQDVPNKDYGGDLFIDGKVIP  194



>gb|KDO71758.1| hypothetical protein CISIN_1g025802mg [Citrus sinensis]
Length=248

 Score =   180 bits (457),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 93/171 (54%), Positives = 122/171 (71%), Gaps = 10/171 (6%)
 Frame = +3

Query  111  SLTPPRNFLAFSSF-RLRPLVSVSPAVCQLYPAAYTAVRGLATRQTSSSLNDPNPNWSNR  287
            +LT PR+ LA     + +P +   P +C   PA +       +  + S LNDP+PNWSNR
Sbjct  17   TLTSPRSRLAIPILNKQQPQIGPDP-ICN--PARFKT-----SGSSYSPLNDPSPNWSNR  68

Query  288  PPKETILLDGCDFEHWLIVMEKPE-GDPTRDEIIDSYIKTLAQVVGSEEEARMKIYSVST  464
            PPKETI+LDGCD++HWLIVME P   + + +E+I++Y+KTLA VVGSEEEA+ KIYSV T
Sbjct  69   PPKETIMLDGCDYQHWLIVMEFPNPSELSEEEMINAYVKTLAAVVGSEEEAKKKIYSVCT  128

Query  465  RHYYAFGALVSEELSYKLKELKGVRWVLPDSYLDVKNKDYGGEPFINGQAV  617
              Y  FGAL+ EELSYK+K   GV WVLPDSY+DV NKDYGG+ F++G+ +
Sbjct  129  TTYTGFGALIDEELSYKVKGQPGVLWVLPDSYIDVPNKDYGGDLFVDGKVI  179



>ref|XP_011009083.1| PREDICTED: DAG protein, chloroplastic-like [Populus euphratica]
Length=261

 Score =   180 bits (457),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 87/136 (64%), Positives = 106/136 (78%), Gaps = 1/136 (1%)
 Frame = +3

Query  213  TAVRGLATRQTSSSLNDPNPNWSNRPPKETILLDGCDFEHWLIVMEKP-EGDPTRDEIID  389
            T  R   T    S LNDP+PNW+NRPPKETILLDGCD+ HWLIVME P +  PT +E+I+
Sbjct  46   TLTRPKTTGSGYSPLNDPSPNWTNRPPKETILLDGCDYNHWLIVMEFPNDPKPTEEEMIN  105

Query  390  SYIKTLAQVVGSEEEARMKIYSVSTRHYYAFGALVSEELSYKLKELKGVRWVLPDSYLDV  569
            +Y+KTL+ V+GSEEEA+  IYSVST  Y  FGAL+SEELSYK+K L GV WVLPDSYLDV
Sbjct  106  AYVKTLSSVLGSEEEAKKSIYSVSTTTYTGFGALISEELSYKVKALPGVLWVLPDSYLDV  165

Query  570  KNKDYGGEPFINGQAV  617
             NKDYGG+ + +G+ +
Sbjct  166  PNKDYGGDLYEDGKVI  181



>ref|XP_006419501.1| hypothetical protein CICLE_v10005719mg [Citrus clementina]
 ref|XP_006489032.1| PREDICTED: uncharacterized protein At3g15000, mitochondrial-like 
[Citrus sinensis]
 gb|ESR32741.1| hypothetical protein CICLE_v10005719mg [Citrus clementina]
Length=248

 Score =   179 bits (455),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 93/171 (54%), Positives = 121/171 (71%), Gaps = 10/171 (6%)
 Frame = +3

Query  111  SLTPPRNFLAFSSF-RLRPLVSVSPAVCQLYPAAYTAVRGLATRQTSSSLNDPNPNWSNR  287
            +LT PR+ LA     + +P +   P +C   PA +       +  + S LNDP+PNWSNR
Sbjct  17   TLTSPRSRLAIPILNKQQPQIGPDP-ICN--PARFKT-----SGSSYSPLNDPSPNWSNR  68

Query  288  PPKETILLDGCDFEHWLIVMEKPE-GDPTRDEIIDSYIKTLAQVVGSEEEARMKIYSVST  464
            PPKETI+LDGCD++HWLIVME P     + +E+I++Y+KTLA VVGSEEEA+ KIYSV T
Sbjct  69   PPKETIMLDGCDYQHWLIVMEFPNPSGLSEEEMINAYVKTLAAVVGSEEEAKKKIYSVCT  128

Query  465  RHYYAFGALVSEELSYKLKELKGVRWVLPDSYLDVKNKDYGGEPFINGQAV  617
              Y  FGAL+ EELSYK+K   GV WVLPDSY+DV NKDYGG+ F++G+ +
Sbjct  129  TTYTGFGALIDEELSYKVKGQPGVLWVLPDSYIDVPNKDYGGDLFVDGKVI  179



>gb|KDO48327.1| hypothetical protein CISIN_1g012088mg [Citrus sinensis]
Length=354

 Score =   182 bits (463),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 108/201 (54%), Positives = 118/201 (59%), Gaps = 49/201 (24%)
 Frame = +3

Query  33   TLVAGMATLLSRSLITAGKQLFRSYSSLTPPRNFLAFSSFRLRPL---VSVSPAVCQLYP  203
            T    +A+LLSRS  T    +  S  SL  P  FL     R RPL   V          P
Sbjct  15   TATKALASLLSRSFSTTATTIKPSSRSL--PLLFLN----RFRPLSTAVRFGSGGIVTGP  68

Query  204  AAYTAVRGLATRQTSSSLNDPNPNWSNRPPKETILLDGCDFEHWLIVMEKPEGDPTRDEI  383
            +A    RG++TR  ++SLND +PNWSNRPPKETILLDGCDFEHWLI              
Sbjct  69   SA----RGMSTRPATASLNDSSPNWSNRPPKETILLDGCDFEHWLI--------------  110

Query  384  IDSYIKTLAQVVGSEEEARMKIYSVSTRHYYAFGALVSEELSYKLKELKGVRWVLPDSYL  563
                                  YSVST+HYYAFGALV EE SYKLKEL GVRWVLPDSYL
Sbjct  111  ----------------------YSVSTKHYYAFGALVDEETSYKLKELPGVRWVLPDSYL  148

Query  564  DVKNKDYGGEPFINGQAVPYD  626
            DVKNKDYGGEPFINGQAVPYD
Sbjct  149  DVKNKDYGGEPFINGQAVPYD  169



>ref|XP_004150495.1| PREDICTED: uncharacterized protein At3g15000, mitochondrial-like 
[Cucumis sativus]
 ref|XP_004165246.1| PREDICTED: uncharacterized protein At3g15000, mitochondrial-like 
[Cucumis sativus]
Length=216

 Score =   178 bits (452),  Expect = 5e-52, Method: Compositional matrix adjust.
 Identities = 86/145 (59%), Positives = 111/145 (77%), Gaps = 2/145 (1%)
 Frame = +3

Query  192  QLYPAAYT-AVRGLATRQTSSSLNDPNPNWSNRPPKETILLDGCDFEHWLIVMEKP-EGD  365
            Q+ P ++   +R  A+   SS LNDP+PN S RPPK++I  DGCD+EHWLIV++ P +  
Sbjct  50   QITPNSFNLPIRCKASESESSLLNDPSPNSSKRPPKDSIPYDGCDYEHWLIVLDFPNDPK  109

Query  366  PTRDEIIDSYIKTLAQVVGSEEEARMKIYSVSTRHYYAFGALVSEELSYKLKELKGVRWV  545
            P+ +E+++SY+KTLA VVGSEEEA+ KIYSV T  Y  FGAL+SEELS K+KEL GVRWV
Sbjct  110  PSEEEMVNSYVKTLAAVVGSEEEAKEKIYSVCTTTYTGFGALISEELSRKMKELPGVRWV  169

Query  546  LPDSYLDVKNKDYGGEPFINGQAVP  620
             PDSY DV NKDYGG+ FI+G+ +P
Sbjct  170  FPDSYQDVPNKDYGGDLFIDGKVIP  194



>gb|AAS07172.1| putative chloroplast differentiation and palisade development-related 
protein [Oryza sativa Japonica Group]
Length=180

 Score =   176 bits (446),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 87/128 (68%), Positives = 101/128 (79%), Gaps = 5/128 (4%)
 Frame = +3

Query  222  RGLATRQTSSS----LNDPNPNWSNRPPKETILLDGCDFEHWLIVMEKP-EGDPTRDEII  386
            RG  T  +  S    LNDP+PNWSNRPPKETILLDGCD+EHWLIVME P +  P+ ++++
Sbjct  47   RGAKTASSGGSGYSPLNDPSPNWSNRPPKETILLDGCDYEHWLIVMEFPTDPKPSEEDMV  106

Query  387  DSYIKTLAQVVGSEEEARMKIYSVSTRHYYAFGALVSEELSYKLKELKGVRWVLPDSYLD  566
             +Y+KTLA VVGSEEEA+ KIYSV T  Y  FGAL+SEELSYK+K L GV WVLPDSYLD
Sbjct  107  AAYVKTLAAVVGSEEEAKKKIYSVCTTTYTGFGALISEELSYKVKGLPGVLWVLPDSYLD  166

Query  567  VKNKDYGG  590
            V NKDYGG
Sbjct  167  VPNKDYGG  174



>gb|ABK93700.1| unknown [Populus trichocarpa]
Length=261

 Score =   178 bits (452),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 86/136 (63%), Positives = 105/136 (77%), Gaps = 1/136 (1%)
 Frame = +3

Query  213  TAVRGLATRQTSSSLNDPNPNWSNRPPKETILLDGCDFEHWLIVMEKP-EGDPTRDEIID  389
            T  R   T    S LNDP+PNW+NR PKETILLDGCD+ HWLIVME P +  PT +E+I+
Sbjct  46   TLTRSKTTGSGYSPLNDPSPNWTNRQPKETILLDGCDYNHWLIVMEFPNDPKPTEEEMIN  105

Query  390  SYIKTLAQVVGSEEEARMKIYSVSTRHYYAFGALVSEELSYKLKELKGVRWVLPDSYLDV  569
            +Y+KTL+ V+GSEEEA+  IYSVST  Y  FGAL+SEELSYK+K L GV WVLPDSYLDV
Sbjct  106  AYVKTLSSVLGSEEEAKKSIYSVSTTTYTGFGALISEELSYKVKALPGVLWVLPDSYLDV  165

Query  570  KNKDYGGEPFINGQAV  617
             NKDYGG+ + +G+ +
Sbjct  166  PNKDYGGDLYEDGKVI  181



>emb|CBI20208.3| unnamed protein product [Vitis vinifera]
Length=229

 Score =   176 bits (446),  Expect = 5e-51, Method: Compositional matrix adjust.
 Identities = 84/94 (89%), Positives = 89/94 (95%), Gaps = 0/94 (0%)
 Frame = +3

Query  345  MEKPEGDPTRDEIIDSYIKTLAQVVGSEEEARMKIYSVSTRHYYAFGALVSEELSYKLKE  524
            MEKPEGDPTRDEIIDSYIKTLA +VGSEEEARMKIYSVSTR Y+AFGALVSEELS K+KE
Sbjct  1    MEKPEGDPTRDEIIDSYIKTLAMIVGSEEEARMKIYSVSTRCYFAFGALVSEELSLKIKE  60

Query  525  LKGVRWVLPDSYLDVKNKDYGGEPFINGQAVPYD  626
            L  VRWVLPDSYLDVKNKDYGGEPFI+G+AVPYD
Sbjct  61   LPRVRWVLPDSYLDVKNKDYGGEPFIDGKAVPYD  94



>ref|XP_008456056.1| PREDICTED: uncharacterized protein At3g15000, mitochondrial-like 
[Cucumis melo]
Length=213

 Score =   175 bits (444),  Expect = 6e-51, Method: Compositional matrix adjust.
 Identities = 105/201 (52%), Positives = 131/201 (65%), Gaps = 20/201 (10%)
 Frame = +3

Query  48   MATLLSRSL---ITAGKQLFRSYSSLT-----PPRNFLAFSSFRLRPLVSVSPAVCQLYP  203
            MATL SRSL   +  G    RS+ + T                RLRPL ++  A      
Sbjct  1    MATLFSRSLPKTLILGSTFSRSFLAATGAAVSASSRSSFSLLRRLRPLAAIIAADFGFLS  60

Query  204  AAYTAVRGLATRQTSSSLNDPNPNWSNRPPKETILLDGCDFEHWLIVMEKPEGDPTRDEI  383
            +A T+VR  +T       +DP PN    PP  T   DGCDF+HWL+VM+    + TRDE+
Sbjct  61   SA-TSVRYFSTS------DDPKPNG---PP--TFSDDGCDFKHWLVVMDLRGAELTRDEM  108

Query  384  IDSYIKTLAQVVGSEEEARMKIYSVSTRHYYAFGALVSEELSYKLKELKGVRWVLPDSYL  563
            I+ YIKTLA VVGSEEEARMK+YSVST+ +++FG LVSEELS+K+KEL  V WV+PDSY 
Sbjct  109  INIYIKTLAMVVGSEEEARMKMYSVSTKFFFSFGCLVSEELSHKIKELPKVLWVIPDSYT  168

Query  564  DVKNKDYGGEPFINGQAVPYD  626
            D++NK+YGGEPFINGQAVPYD
Sbjct  169  DIENKNYGGEPFINGQAVPYD  189



>gb|KDO71759.1| hypothetical protein CISIN_1g025802mg [Citrus sinensis]
Length=177

 Score =   174 bits (441),  Expect = 7e-51, Method: Compositional matrix adjust.
 Identities = 92/166 (55%), Positives = 117/166 (70%), Gaps = 10/166 (6%)
 Frame = +3

Query  111  SLTPPRNFLAFSSF-RLRPLVSVSPAVCQLYPAAYTAVRGLATRQTSSSLNDPNPNWSNR  287
            +LT PR+ LA     + +P +   P +C   PA +       +  + S LNDP+PNWSNR
Sbjct  17   TLTSPRSRLAIPILNKQQPQIGPDP-ICN--PARFKT-----SGSSYSPLNDPSPNWSNR  68

Query  288  PPKETILLDGCDFEHWLIVMEKPE-GDPTRDEIIDSYIKTLAQVVGSEEEARMKIYSVST  464
            PPKETI+LDGCD++HWLIVME P   + + +E+I++Y+KTLA VVGSEEEA+ KIYSV T
Sbjct  69   PPKETIMLDGCDYQHWLIVMEFPNPSELSEEEMINAYVKTLAAVVGSEEEAKKKIYSVCT  128

Query  465  RHYYAFGALVSEELSYKLKELKGVRWVLPDSYLDVKNKDYGGEPFI  602
              Y  FGAL+ EELSYK+K   GV WVLPDSY+DV NKDYGG  F+
Sbjct  129  TTYTGFGALIDEELSYKVKGQPGVLWVLPDSYIDVPNKDYGGRYFL  174



>gb|AFW89501.1| hypothetical protein ZEAMMB73_355013 [Zea mays]
Length=163

 Score =   173 bits (438),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 84/106 (79%), Positives = 90/106 (85%), Gaps = 5/106 (5%)
 Frame = +3

Query  219  VRGLATRQTSSSLNDPNPNWSNRPPKETILLDGCDFEHWLIVMEKPEGDP-----TRDEI  383
            VR  AT+  +SSL D +PNWSNRPPKETILLDGCDFEHWL++ME P GD      TRDEI
Sbjct  51   VRCFATQPATSSLRDSSPNWSNRPPKETILLDGCDFEHWLVIMEPPPGDASNPDITRDEI  110

Query  384  IDSYIKTLAQVVGSEEEARMKIYSVSTRHYYAFGALVSEELSYKLK  521
            IDSYIKTLAQVVGSEEEAR KIYSVSTRHY+ FGALVSEELSYKLK
Sbjct  111  IDSYIKTLAQVVGSEEEARQKIYSVSTRHYFGFGALVSEELSYKLK  156



>ref|XP_010542307.1| PREDICTED: uncharacterized protein At3g15000, mitochondrial-like 
[Tarenaya hassleriana]
Length=281

 Score =   175 bits (443),  Expect = 6e-50, Method: Compositional matrix adjust.
 Identities = 84/94 (89%), Positives = 89/94 (95%), Gaps = 0/94 (0%)
 Frame = +3

Query  345  MEKPEGDPTRDEIIDSYIKTLAQVVGSEEEARMKIYSVSTRHYYAFGALVSEELSYKLKE  524
            MEKPEGDPTRDEIID YIKTL+Q+VG EEEARMKIYSVSTR YYAFGALVSEELSYK+KE
Sbjct  1    MEKPEGDPTRDEIIDYYIKTLSQIVGCEEEARMKIYSVSTRCYYAFGALVSEELSYKIKE  60

Query  525  LKGVRWVLPDSYLDVKNKDYGGEPFINGQAVPYD  626
            L  VRWVLPDSYLDVKNKDYGGEPFI+G+AVPYD
Sbjct  61   LPNVRWVLPDSYLDVKNKDYGGEPFIDGKAVPYD  94



>gb|EMS68528.1| hypothetical protein TRIUR3_12497 [Triticum urartu]
Length=248

 Score =   173 bits (438),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 86/136 (63%), Positives = 102/136 (75%), Gaps = 1/136 (1%)
 Frame = +3

Query  201  PAAYTAVRGLATRQTSSSLNDPNPNWSNRPPKETILLDGCDFEHWLIVMEKP-EGDPTRD  377
            P +  A   L  R   S LNDP+PNWSNRPPKETILLDGCD+EHWLIVME P +  P+ +
Sbjct  45   PPSRGAKTALPGRPGYSPLNDPSPNWSNRPPKETILLDGCDYEHWLIVMEFPADPKPSEE  104

Query  378  EIIDSYIKTLAQVVGSEEEARMKIYSVSTRHYYAFGALVSEELSYKLKELKGVRWVLPDS  557
            +++ +Y+KTL  V+GSEEEA+ KIYSV T  Y  FGAL+SEELSYK+K L GV WVLPDS
Sbjct  105  DMVAAYVKTLTAVLGSEEEAKKKIYSVCTTTYTGFGALISEELSYKVKGLPGVLWVLPDS  164

Query  558  YLDVKNKDYGGEPFIN  605
            YLDV NKDYG    I+
Sbjct  165  YLDVPNKDYGDGKVIH  180



>gb|EMT05556.1| hypothetical protein F775_52370 [Aegilops tauschii]
Length=312

 Score =   170 bits (431),  Expect = 8e-48, Method: Compositional matrix adjust.
 Identities = 84/136 (62%), Positives = 100/136 (74%), Gaps = 1/136 (1%)
 Frame = +3

Query  201  PAAYTAVRGLATRQTSSSLNDPNPNWSNRPPKETILLDGCDFEHWLIVMEKP-EGDPTRD  377
            P +  A   L  R   S L  P+PNWSNRPPKETILLDGCD+EHWLIVME P +  P+ +
Sbjct  101  PPSRGAKTALPGRPGYSPLTAPSPNWSNRPPKETILLDGCDYEHWLIVMESPADPKPSEE  160

Query  378  EIIDSYIKTLAQVVGSEEEARMKIYSVSTRHYYAFGALVSEELSYKLKELKGVRWVLPDS  557
            +++ +Y+KTL  V+GSEEEA+ KIYSV T  Y  FGAL+SEELSYK+K L GV WVLPDS
Sbjct  161  DMVAAYVKTLTAVLGSEEEAKKKIYSVCTTTYTGFGALISEELSYKVKGLPGVLWVLPDS  220

Query  558  YLDVKNKDYGGEPFIN  605
            YLDV NKDYG    I+
Sbjct  221  YLDVPNKDYGDGKVIH  236



>gb|EMS47466.1| hypothetical protein TRIUR3_28031 [Triticum urartu]
Length=312

 Score =   169 bits (428),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 84/99 (85%), Positives = 88/99 (89%), Gaps = 5/99 (5%)
 Frame = +3

Query  345  MEKPEGDP-----TRDEIIDSYIKTLAQVVGSEEEARMKIYSVSTRHYYAFGALVSEELS  509
            ME P GD      TRDEIID YIKTLAQVVGSE+EARMKIYSVSTRHY+AFGALVSEELS
Sbjct  1    MEPPPGDGANPDVTRDEIIDGYIKTLAQVVGSEDEARMKIYSVSTRHYFAFGALVSEELS  60

Query  510  YKLKELKGVRWVLPDSYLDVKNKDYGGEPFINGQAVPYD  626
            YKLKEL  VRWVLPDSYLDV+NKDYGGEPFI+GQAVPYD
Sbjct  61   YKLKELPKVRWVLPDSYLDVRNKDYGGEPFIDGQAVPYD  99



>ref|XP_008355406.1| PREDICTED: uncharacterized protein At3g15000, mitochondrial-like 
[Malus domestica]
Length=241

 Score =   166 bits (420),  Expect = 6e-47, Method: Compositional matrix adjust.
 Identities = 83/94 (88%), Positives = 87/94 (93%), Gaps = 0/94 (0%)
 Frame = +3

Query  345  MEKPEGDPTRDEIIDSYIKTLAQVVGSEEEARMKIYSVSTRHYYAFGALVSEELSYKLKE  524
            ME P+GD TRDEII+SYIKTLA VVGSEEEARMKIYSVSTR YYAFGALVSEE+S K+KE
Sbjct  1    MEAPQGDVTRDEIINSYIKTLATVVGSEEEARMKIYSVSTRCYYAFGALVSEEVSLKIKE  60

Query  525  LKGVRWVLPDSYLDVKNKDYGGEPFINGQAVPYD  626
            L GVR VLPDSYLDVKNKDYGGEPFINGQAVPYD
Sbjct  61   LPGVRXVLPDSYLDVKNKDYGGEPFINGQAVPYD  94



>gb|EMT29592.1| hypothetical protein F775_32958 [Aegilops tauschii]
Length=340

 Score =   169 bits (427),  Expect = 6e-47, Method: Compositional matrix adjust.
 Identities = 83/99 (84%), Positives = 87/99 (88%), Gaps = 5/99 (5%)
 Frame = +3

Query  345  MEKPEGDP-----TRDEIIDSYIKTLAQVVGSEEEARMKIYSVSTRHYYAFGALVSEELS  509
            ME P GD      TRDEIIDSYIKTLAQVVGSE+EAR KIYSVSTRHY+AFGALVSEELS
Sbjct  1    MEPPAGDAANPDVTRDEIIDSYIKTLAQVVGSEQEARQKIYSVSTRHYFAFGALVSEELS  60

Query  510  YKLKELKGVRWVLPDSYLDVKNKDYGGEPFINGQAVPYD  626
            YKLKEL  VRWVLPDSYLDV+NKDYGGEPFI G+AVPYD
Sbjct  61   YKLKELPKVRWVLPDSYLDVRNKDYGGEPFIGGEAVPYD  99



>ref|XP_002862182.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH38440.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
Length=147

 Score =   161 bits (407),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 75/101 (74%), Positives = 87/101 (86%), Gaps = 3/101 (3%)
 Frame = +3

Query  159  RPLVSVSPAVCQLYPAAYTAVRGLATRQTSSSLNDPNPNWSNRPPKETILLDGCDFEHWL  338
            RPLV+   A   ++     +V+GL+T+ TSSSLNDPNPNWSNRPPKETILLDGCDFEHWL
Sbjct  50   RPLVA---AFSSVFRGGLVSVKGLSTQATSSSLNDPNPNWSNRPPKETILLDGCDFEHWL  106

Query  339  IVMEKPEGDPTRDEIIDSYIKTLAQVVGSEEEARMKIYSVS  461
            +V+  PEGDPTRD+IIDSYIKTLAQ+VGSE+EARMKIYSVS
Sbjct  107  VVVNPPEGDPTRDDIIDSYIKTLAQIVGSEDEARMKIYSVS  147



>gb|ADE77774.1| unknown [Picea sitchensis]
Length=251

 Score =   158 bits (399),  Expect = 9e-44, Method: Compositional matrix adjust.
 Identities = 83/162 (51%), Positives = 114/162 (70%), Gaps = 7/162 (4%)
 Frame = +3

Query  141  FSSFRLRPLVSVSPAVCQLYPAAYTAVRGLATR-QTSSSLNDPNPNWSNRPPKETILLDG  317
            + SF    L + S  +   YP +  A++  + + + + ++ND   + S+R PKETILL G
Sbjct  38   YCSFLYNSLCASSAVI--RYPKSTIAIKPNSHKTKINCAIND---SSSSRAPKETILLPG  92

Query  318  CDFEHWLIVMEKPEG-DPTRDEIIDSYIKTLAQVVGSEEEARMKIYSVSTRHYYAFGALV  494
            CD+EHWLIVME P+   PT +E++D+YI TLA+VVGSEEEA+ KIY++ST  Y  F A +
Sbjct  93   CDYEHWLIVMEFPKDPKPTSEEMVDTYINTLAKVVGSEEEAKKKIYALSTTTYTGFQANI  152

Query  495  SEELSYKLKELKGVRWVLPDSYLDVKNKDYGGEPFINGQAVP  620
            SEELS K K L GV WVLPDSY+DV NKDYGG+ F++G+ +P
Sbjct  153  SEELSEKCKGLPGVLWVLPDSYIDVPNKDYGGDKFVDGKVIP  194



>gb|ACG45203.1| DAG protein [Zea mays]
Length=246

 Score =   157 bits (398),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 96/162 (59%), Positives = 116/162 (72%), Gaps = 10/162 (6%)
 Frame = +3

Query  153  RLRPLVSV--SPAVCQLYPAAYTAVRGLATRQTSSS----LNDPNPNWSNRPPKETILLD  314
            RL PL +   SP V    P    A RG  T  +  S    LNDP+P WS RPPKETILLD
Sbjct  26   RLGPLAAAAASPHVA---PWPLLAPRGARTASSGGSGHSPLNDPSPXWSXRPPKETILLD  82

Query  315  GCDFEHWLIVMEKP-EGDPTRDEIIDSYIKTLAQVVGSEEEARMKIYSVSTRHYYAFGAL  491
            GCD+EHWLIVME P +  P+ +E++ +Y+KTLA V+GSEEEA+ KIYSV T  Y  FGAL
Sbjct  83   GCDYEHWLIVMEFPTDPKPSEEEMVAAYVKTLAAVLGSEEEAKKKIYSVCTSTYTGFGAL  142

Query  492  VSEELSYKLKELKGVRWVLPDSYLDVKNKDYGGEPFINGQAV  617
            +SEELSYK+K L GV WVLPDSYLDV NKDYGG+ F++G+ +
Sbjct  143  ISEELSYKVKGLPGVLWVLPDSYLDVPNKDYGGDLFVDGKVI  184



>gb|KJB28478.1| hypothetical protein B456_005G052100 [Gossypium raimondii]
Length=242

 Score =   156 bits (394),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 96/204 (47%), Positives = 126/204 (62%), Gaps = 11/204 (5%)
 Frame = +3

Query  33   TLVAGMATLLSRSLITA---GKQLFRSYSSLTPPRNFLAFSSFRLRPLVSVSPAV-C-QL  197
            TL     + L+R L  +    K+L  S S   PP   +    F  RPL  +S AV C  L
Sbjct  4    TLTRAATSTLTRHLTLSFILPKRLLSSKSITHPPP--IPSLRFSRRPLTPLSHAVRCLPL  61

Query  198  YPAAYTAVRGLATRQTSSSLNDPNP--NWSNRPPKETI-LLDGCDFEHWLIVMEKPEGD-  365
             P  +T++R    R  +S+ +  N   N+S+RPP E   L  GCD+EHWLIVM+KP G+ 
Sbjct  62   VPTRFTSIRCRVNRSGNSAYSPLNSGSNFSDRPPTEMAPLFPGCDYEHWLIVMDKPGGEG  121

Query  366  PTRDEIIDSYIKTLAQVVGSEEEARMKIYSVSTRHYYAFGALVSEELSYKLKELKGVRWV  545
             T+ E+ID YIKTLA+VVGSEEEA+ KIY+VS   Y+ FG  + EE S KL+ L GV +V
Sbjct  122  ATKQEMIDCYIKTLAKVVGSEEEAKKKIYNVSCERYFGFGCEIDEETSNKLEGLPGVLFV  181

Query  546  LPDSYLDVKNKDYGGEPFINGQAV  617
            LPDSY+D + KDYG E F+NG+ V
Sbjct  182  LPDSYVDPEYKDYGAELFVNGEIV  205



>gb|KHG10615.1| DAG, chloroplastic [Gossypium arboreum]
Length=242

 Score =   155 bits (392),  Expect = 7e-43, Method: Compositional matrix adjust.
 Identities = 97/205 (47%), Positives = 126/205 (61%), Gaps = 13/205 (6%)
 Frame = +3

Query  33   TLVAGMATLLSR----SLITAGKQLFRSYSSLTPPRNFLAFSSFRLRPLVSVSPAV-C-Q  194
            TL     + L+R    SLI   + L     +  PP   L FS    RPL  +S AV C  
Sbjct  4    TLTRAATSTLTRHFSLSLILPKRLLSSKSITHPPPIPSLRFSR---RPLTPLSHAVRCLP  60

Query  195  LYPAAYTAVRGLATRQTSSSLNDPNP--NWSNRPPKETI-LLDGCDFEHWLIVMEKPEGD  365
            L P  +T++R    R  +S+ +  N   N+S+RPP E   L  GCD+EHWLIVM+KP G+
Sbjct  61   LAPTRFTSIRCRVNRSGNSAYSPLNSGSNFSDRPPTEMAPLFPGCDYEHWLIVMDKPGGE  120

Query  366  -PTRDEIIDSYIKTLAQVVGSEEEARMKIYSVSTRHYYAFGALVSEELSYKLKELKGVRW  542
              T+ E+ID YIKTLA+VVGSEEEA+ KIY+VS   Y+ FG  + EE S KL+ L GV +
Sbjct  121  GATKQEMIDCYIKTLAKVVGSEEEAKKKIYNVSCERYFGFGCEIDEETSNKLEGLPGVLF  180

Query  543  VLPDSYLDVKNKDYGGEPFINGQAV  617
            VLPDSY+D + KDYG E F+NG+ V
Sbjct  181  VLPDSYVDPEYKDYGAELFVNGEIV  205



>ref|XP_002532881.1| DAG protein, chloroplast precursor, putative [Ricinus communis]
 gb|EEF29510.1| DAG protein, chloroplast precursor, putative [Ricinus communis]
Length=248

 Score =   155 bits (391),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 81/160 (51%), Positives = 110/160 (69%), Gaps = 4/160 (3%)
 Frame = +3

Query  150  FRLRPLVSVSPAVCQLYPAAYTAVRGLATRQTSSSLNDPNP--NWSNRPPKETI-LLDGC  320
            F  R L+ +S AV  + P  +T++R    R  +S+ +  N   N+S+RPP E   L  GC
Sbjct  52   FTRRSLLPLSHAVHSIKPTRFTSIRCRVNRAGNSAYSPLNSGSNFSDRPPNEMAPLFPGC  111

Query  321  DFEHWLIVMEKPEGD-PTRDEIIDSYIKTLAQVVGSEEEARMKIYSVSTRHYYAFGALVS  497
            D+EHWLIVM+KP G+  T+ ++ID YI+TLA+VVGSEEEA+ KIY+VS   Y+ FG  + 
Sbjct  112  DYEHWLIVMDKPGGEGATKQQMIDCYIQTLAKVVGSEEEAKKKIYNVSCERYFGFGCEID  171

Query  498  EELSYKLKELKGVRWVLPDSYLDVKNKDYGGEPFINGQAV  617
            EE S KL+ L GV +VLPDSY+D +NKDYG E F+NG+ V
Sbjct  172  EETSNKLEGLPGVLFVLPDSYVDPENKDYGAELFVNGEIV  211



>gb|EPS66780.1| hypothetical protein M569_07993 [Genlisea aurea]
Length=242

 Score =   154 bits (390),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 93/206 (45%), Positives = 124/206 (60%), Gaps = 17/206 (8%)
 Frame = +3

Query  48   MATLLSRSLI--------TAGKQLFRSYSSLTPPRNFLAFSSFRLRPLVSVSPAVCQ---  194
            MA  ++RS++        +A  Q     S+++ P     F  F +    S +PA+     
Sbjct  1    MAAAVARSVLNLRSIGARSASIQRRLLSSTISKPPRLAGFFRFDVSISRSAAPALSHSVR  60

Query  195  -LYPAAYTAVRGLATRQTS--SSLNDPNPNWSNRPPKETI-LLDGCDFEHWLIVMEKPEG  362
             L PA    VR    R  S  S LN    N+S+RPP E   L  GCD+EHWLIVM+KP G
Sbjct  61   VLVPARVNPVRCRVNRSGSAYSPLNS-GSNFSDRPPTEMAPLFPGCDYEHWLIVMDKPGG  119

Query  363  D-PTRDEIIDSYIKTLAQVVGSEEEARMKIYSVSTRHYYAFGALVSEELSYKLKELKGVR  539
            +  T++++ID YIKTLAQV+GSEEEA+ KIY+VS   Y+ FG  + EE S KL+ L GV 
Sbjct  120  EGATKEQMIDCYIKTLAQVLGSEEEAKKKIYNVSCERYFGFGCEIDEETSNKLEGLPGVL  179

Query  540  WVLPDSYLDVKNKDYGGEPFINGQAV  617
            +VLPDSY+D +NKDYG E F+NG+ V
Sbjct  180  FVLPDSYVDAENKDYGAELFVNGEIV  205



>ref|XP_006851197.1| hypothetical protein AMTR_s00043p00203580 [Amborella trichopoda]
 gb|ERN12778.1| hypothetical protein AMTR_s00043p00203580 [Amborella trichopoda]
Length=241

 Score =   152 bits (384),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 94/193 (49%), Positives = 115/193 (60%), Gaps = 15/193 (8%)
 Frame = +3

Query  54   TLLSRS-LITAGKQLFRSYSSLTPPRNFLAFSSFRLR--PLVSVSPAVCQLYPAAYTAVR  224
            TL+S S L TA      S S+L P   FL  SSF L+  PL S               V 
Sbjct  13   TLISPSYLSTAANPRSSSPSTLVPVSRFLRPSSFGLKLLPLASFQ----------TKTVN  62

Query  225  GLATRQTSSSLNDPNPNWSNRPPKETILLDGCDFEHWLIVMEKPEG-DPTRDEIIDSYIK  401
            GL  R T         + SN P +ETILL GCD+ HWLIVME P+   PTR+E+I++Y+ 
Sbjct  63   GLMVRATVDGDYSSKRSSSNEP-RETILLPGCDYNHWLIVMEFPKDPKPTREEMIETYLN  121

Query  402  TLAQVVGSEEEARMKIYSVSTRHYYAFGALVSEELSYKLKELKGVRWVLPDSYLDVKNKD  581
            TLA V+GS EEA+  +Y+ ST  Y  F   VSEE S K K L GV WVLPDSY+DVKNKD
Sbjct  122  TLATVLGSMEEAKKNMYAFSTTTYTGFQCTVSEETSEKFKGLPGVLWVLPDSYIDVKNKD  181

Query  582  YGGEPFINGQAVP  620
            YGG+ +ING+ +P
Sbjct  182  YGGDKYINGEIIP  194



>ref|XP_011080093.1| PREDICTED: DAG protein, chloroplastic-like [Sesamum indicum]
Length=243

 Score =   152 bits (383),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 91/207 (44%), Positives = 125/207 (60%), Gaps = 18/207 (9%)
 Frame = +3

Query  48   MATLLSRSLIT-------AGKQLFRSY--SSLTPPRNFLAFSSFRLRPLVSVSPAVCQLY  200
            MA  ++RS++T       A   L R +  S+++ P +    +  R+    SV+PA+    
Sbjct  1    MAASIARSILTVRSTGATASLLLHRRFFSSTVSKPPSLPGLARLRISTTRSVTPALSHTI  60

Query  201  ----PAAYTAVRGLATRQTS--SSLNDPNPNWSNRPPKETI-LLDGCDFEHWLIVMEKPE  359
                P     VR    R  S  S LN    N+S+RPP E   L  GCD+EHWLIVM+KP 
Sbjct  61   RFSSPTRINQVRCRVNRSGSAYSPLNS-GSNFSDRPPTEMAPLFPGCDYEHWLIVMDKPG  119

Query  360  GD-PTRDEIIDSYIKTLAQVVGSEEEARMKIYSVSTRHYYAFGALVSEELSYKLKELKGV  536
            G+  T+ ++ID YI+TLA+VVGSEEEA+ +IY+VS   Y+ FG  + EE S KL+ L GV
Sbjct  120  GEGATKQQMIDCYIQTLAKVVGSEEEAKKRIYNVSCERYFGFGCEIDEETSNKLEGLPGV  179

Query  537  RWVLPDSYLDVKNKDYGGEPFINGQAV  617
             +VLPDSY+D +NKDYG E F+NG+ V
Sbjct  180  LFVLPDSYVDPENKDYGAELFVNGEIV  206



>ref|XP_010261841.1| PREDICTED: uncharacterized protein At3g15000, mitochondrial isoform 
X1 [Nelumbo nucifera]
 ref|XP_010261842.1| PREDICTED: uncharacterized protein At3g15000, mitochondrial isoform 
X1 [Nelumbo nucifera]
 ref|XP_010261843.1| PREDICTED: uncharacterized protein At3g15000, mitochondrial isoform 
X1 [Nelumbo nucifera]
Length=235

 Score =   150 bits (380),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 79/176 (45%), Positives = 103/176 (59%), Gaps = 20/176 (11%)
 Frame = +3

Query  111  SLTPPRNFLAFSSFRLRPLVSVSPAVCQLYP----AAYTAVRGLATRQTSSSLNDPNPNW  278
            S  P  +F+     R  PLVS S      +P    + +    G AT  T           
Sbjct  47   SSMPSSSFIPLLCCRYMPLVSTSVIFPLRWPFSPSSNFRCFSGNATEST-----------  95

Query  279  SNRPPKETILLDGCDFEHWLIVMEKPEGDPTRDEIIDSYIKTLAQVVGSEEEARMKIYSV  458
                 ++   + GCD+EHWL+VME P+G+P RD+IID YIKTL+  +GS EEA+  IYSV
Sbjct  96   -----RKQTFIQGCDYEHWLVVMEPPKGNPLRDDIIDIYIKTLSMALGSTEEAKKSIYSV  150

Query  459  STRHYYAFGALVSEELSYKLKELKGVRWVLPDSYLDVKNKDYGGEPFINGQAVPYD  626
            ST++YYAFG  +S++   KL  L  VRWVLPDSYL     DYGGEPFI+G+ VPY+
Sbjct  151  STKYYYAFGCKLSQKFINKLNSLPNVRWVLPDSYLYASENDYGGEPFIDGKVVPYE  206



>emb|CDY23734.1| BnaC04g43880D [Brassica napus]
Length=228

 Score =   150 bits (378),  Expect = 7e-41, Method: Compositional matrix adjust.
 Identities = 87/183 (48%), Positives = 119/183 (65%), Gaps = 10/183 (5%)
 Frame = +3

Query  87   KQLFRSYSSLTPPRNFLAFSSFRLRPLVSVSPAVCQLYPAA--YTAVRGLATRQTS--SS  254
            + LF S + ++PP+     S+ R     S   +V    P++  +T++R LA R  S  S 
Sbjct  13   RSLFPSTTLVSPPK---LPSTVRCGGFSSGRDSVGSRLPSSTRFTSIRCLANRSGSAYSP  69

Query  255  LNDPNPNWSNRPPKETI-LLDGCDFEHWLIVMEKPEGD-PTRDEIIDSYIKTLAQVVGSE  428
            LN    N+S+RPP E   L  GCD+EHWLIVM+KP G+  T+ E+ID Y++TLA+VVGSE
Sbjct  70   LNS-GSNFSDRPPTEMAPLFPGCDYEHWLIVMDKPGGEGATKQEMIDCYVQTLAKVVGSE  128

Query  429  EEARMKIYSVSTRHYYAFGALVSEELSYKLKELKGVRWVLPDSYLDVKNKDYGGEPFING  608
            EEA+ +IY+VS   Y  FG  + EE S KL+ L GV +VLPDSY+D +NKDYG E F+NG
Sbjct  129  EEAKKRIYNVSCERYLGFGCEIDEETSTKLEGLPGVLFVLPDSYVDPENKDYGAELFVNG  188

Query  609  QAV  617
            + V
Sbjct  189  EIV  191



>emb|CAN77774.1| hypothetical protein VITISV_021886 [Vitis vinifera]
Length=212

 Score =   149 bits (376),  Expect = 8e-41, Method: Compositional matrix adjust.
 Identities = 65/107 (61%), Positives = 84/107 (79%), Gaps = 0/107 (0%)
 Frame = +3

Query  306  LLDGCDFEHWLIVMEKPEGDPTRDEIIDSYIKTLAQVVGSEEEARMKIYSVSTRHYYAFG  485
            +LDGCD+EHWL+VME P+  P RDEI+  YI+TLA V+ SEEEA+  IYSVST++YYAFG
Sbjct  67   ILDGCDYEHWLVVMEAPQRYPLRDEIVRGYIRTLAMVLKSEEEAKKSIYSVSTKYYYAFG  126

Query  486  ALVSEELSYKLKELKGVRWVLPDSYLDVKNKDYGGEPFINGQAVPYD  626
              ++E L++++K L  V+WVLPDSYL      YGGEPF+NG+ VPYD
Sbjct  127  CKIAENLAHQIKSLPNVKWVLPDSYLCHGGNGYGGEPFVNGEVVPYD  173



>ref|XP_006489670.1| PREDICTED: uncharacterized protein At3g15000, mitochondrial-like 
[Citrus sinensis]
Length=245

 Score =   150 bits (378),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 82/165 (50%), Positives = 106/165 (64%), Gaps = 4/165 (2%)
 Frame = +3

Query  135  LAFSSFRLRPLVSVSPAVCQLYPAAYTAVRGLATRQTSSSLNDPNP--NWSNRPPKETI-  305
            L FS     PL      +  L    +  +R  A R  +S+ +  N   N+S+RPP E   
Sbjct  44   LLFSRRAAAPLSHAVGLISPLPSTRFCQIRCRANRSGNSAYSPLNSGSNFSDRPPTEMAP  103

Query  306  LLDGCDFEHWLIVMEKPEGD-PTRDEIIDSYIKTLAQVVGSEEEARMKIYSVSTRHYYAF  482
            L  GCD+EHWLIVM+KP G+  T+ ++ID YIKTLAQVVGSEEEA+ KIY+VS   Y+ F
Sbjct  104  LFPGCDYEHWLIVMDKPGGEGATKQQMIDCYIKTLAQVVGSEEEAKKKIYNVSCERYFGF  163

Query  483  GALVSEELSYKLKELKGVRWVLPDSYLDVKNKDYGGEPFINGQAV  617
            G  + EE S KL+ L GV +VLPDSY+D +NKDYG E F+NG+ V
Sbjct  164  GCELDEETSNKLEGLPGVLFVLPDSYVDPENKDYGAELFVNGEIV  208



>ref|XP_002272872.1| PREDICTED: uncharacterized protein At3g15000, mitochondrial [Vitis 
vinifera]
 emb|CBI35859.3| unnamed protein product [Vitis vinifera]
Length=212

 Score =   149 bits (375),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 65/107 (61%), Positives = 84/107 (79%), Gaps = 0/107 (0%)
 Frame = +3

Query  306  LLDGCDFEHWLIVMEKPEGDPTRDEIIDSYIKTLAQVVGSEEEARMKIYSVSTRHYYAFG  485
            +LDGCD+EHWL+VME P+  P RDEI+  YI+TLA V+ SEEEA+  IYSVST++YYAFG
Sbjct  67   ILDGCDYEHWLVVMEAPQRYPLRDEIVRGYIRTLAMVLRSEEEAKKSIYSVSTKYYYAFG  126

Query  486  ALVSEELSYKLKELKGVRWVLPDSYLDVKNKDYGGEPFINGQAVPYD  626
              ++E L++++K L  V+WVLPDSYL      YGGEPF+NG+ VPYD
Sbjct  127  CKIAENLAHQIKSLPNVKWVLPDSYLCHGGNGYGGEPFVNGEVVPYD  173



>ref|XP_010262413.1| PREDICTED: DAG protein, chloroplastic [Nelumbo nucifera]
Length=245

 Score =   150 bits (378),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 91/206 (44%), Positives = 126/206 (61%), Gaps = 12/206 (6%)
 Frame = +3

Query  33   TLVAGMATLLSRSLITAG-----KQLFRSYSSLTPPRNFLAFSSFRLRPLVSVSPAVCQL  197
            T+ A +A  ++ S  +       K+LF S +S++       F   R RP V +S +V  +
Sbjct  4    TVAAAIARAITSSRCSTSSHLLCKRLFSSPTSISGAPPLPGFLRGR-RPSVLLSHSVRVI  62

Query  198  YPAAY--TAVRGLATRQTSSSLNDPNP--NWSNRPPKETI-LLDGCDFEHWLIVMEKPEG  362
             P A     +R    R   S+ +  N   N+S+RPP E   L  GCD+EHWLIVM+KP G
Sbjct  63   SPGAVRLNPIRCRVNRSGDSAYSPLNSGSNFSDRPPTEMAPLFPGCDYEHWLIVMDKPGG  122

Query  363  D-PTRDEIIDSYIKTLAQVVGSEEEARMKIYSVSTRHYYAFGALVSEELSYKLKELKGVR  539
            +  T+ ++ID YI+TLA+VVGSEEEA+ KIY+VS   Y+ FG  + EE S KL+ L GV 
Sbjct  123  EGATKQQMIDCYIQTLAKVVGSEEEAKKKIYNVSCDRYFGFGCEIDEETSNKLEGLPGVL  182

Query  540  WVLPDSYLDVKNKDYGGEPFINGQAV  617
            +VLPDSY+D +NKDYG E F+NG+ V
Sbjct  183  FVLPDSYVDAENKDYGAELFVNGEIV  208



>gb|KDP29703.1| hypothetical protein JCGZ_18638 [Jatropha curcas]
Length=241

 Score =   149 bits (377),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 76/158 (48%), Positives = 108/158 (68%), Gaps = 4/158 (3%)
 Frame = +3

Query  156  LRPLVSVSPAVCQLYPAAYTAVRGLATRQTSSSLNDPNP--NWSNRPPKETI-LLDGCDF  326
            L PL    P++    P  +TA+R    R  +S+ +  N   N+S+RPP E   L  GCD+
Sbjct  47   LLPLSHAVPSIRSADPTRFTAIRCRVNRAGNSAYSPLNSGSNFSDRPPNEMAPLFPGCDY  106

Query  327  EHWLIVMEKPEGD-PTRDEIIDSYIKTLAQVVGSEEEARMKIYSVSTRHYYAFGALVSEE  503
            EHWLIVM+KP G+  T++++I+ Y++TLA+V+GSEEEA+ KIY+VS   Y+ FG  + EE
Sbjct  107  EHWLIVMDKPGGEGATKEQMIECYVQTLAKVLGSEEEAKKKIYNVSCERYFGFGCEIDEE  166

Query  504  LSYKLKELKGVRWVLPDSYLDVKNKDYGGEPFINGQAV  617
             S KL+ L GV +VLPDSY+D +NKDYG E ++NG+ V
Sbjct  167  TSNKLEGLPGVLFVLPDSYVDPENKDYGAELYVNGEIV  204



>gb|KDO54083.1| hypothetical protein CISIN_1g025989mg [Citrus sinensis]
Length=245

 Score =   149 bits (377),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 82/165 (50%), Positives = 106/165 (64%), Gaps = 4/165 (2%)
 Frame = +3

Query  135  LAFSSFRLRPLVSVSPAVCQLYPAAYTAVRGLATRQTSSSLNDPNP--NWSNRPPKETI-  305
            L FS     PL      +  L    +  +R  A R  +S+ +  N   N+S+RPP E   
Sbjct  44   LLFSRRAAAPLSHAVGLISPLPSTRFCQIRCRANRSGNSAYSPLNSGSNFSDRPPTEMAP  103

Query  306  LLDGCDFEHWLIVMEKPEGD-PTRDEIIDSYIKTLAQVVGSEEEARMKIYSVSTRHYYAF  482
            L  GCD+EHWLIVM+KP G+  T+ ++ID YIKTLAQVVGSEEEA+ KIY+VS   Y+ F
Sbjct  104  LFPGCDYEHWLIVMDKPGGEGATKQQMIDCYIKTLAQVVGSEEEAKKKIYNVSCERYFGF  163

Query  483  GALVSEELSYKLKELKGVRWVLPDSYLDVKNKDYGGEPFINGQAV  617
            G  + EE S KL+ L GV +VLPDSY+D +NKDYG E F+NG+ V
Sbjct  164  GCELDEETSNKLEGLPGVLFVLPDSYVDPENKDYGAELFVNGEIV  208



>ref|XP_007024643.1| Plastid developmental protein DAG isoform 1 [Theobroma cacao]
 gb|EOY27265.1| Plastid developmental protein DAG isoform 1 [Theobroma cacao]
Length=214

 Score =   148 bits (374),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 66/107 (62%), Positives = 85/107 (79%), Gaps = 0/107 (0%)
 Frame = +3

Query  306  LLDGCDFEHWLIVMEKPEGDPTRDEIIDSYIKTLAQVVGSEEEARMKIYSVSTRHYYAFG  485
            L++GCD+EHW +VME P+G P RDEI+D+YIKTLA  +GSEEEA+  IYSVST++YYAFG
Sbjct  77   LVEGCDYEHWFVVMEAPKGYPLRDEIVDTYIKTLAMALGSEEEAKKSIYSVSTKYYYAFG  136

Query  486  ALVSEELSYKLKELKGVRWVLPDSYLDVKNKDYGGEPFINGQAVPYD  626
                E+L++KLK L  V+WVLPDSYL   +  YGGEPF++G+ V YD
Sbjct  137  CKGPEDLTFKLKSLPNVKWVLPDSYLVHGDNSYGGEPFLDGKVVQYD  183



>ref|XP_010942948.1| PREDICTED: uncharacterized protein At3g15000, mitochondrial-like 
isoform X1 [Elaeis guineensis]
Length=239

 Score =   149 bits (376),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 82/163 (50%), Positives = 108/163 (66%), Gaps = 7/163 (4%)
 Frame = +3

Query  150  FRLRPLV-SVSPAVCQLYPAAYTAVRGLATRQTSSS---LND-PNPNWSNRPPKETI-LL  311
             RLRP    +S A  +   A   +VR +A R   S+   LN  P   +S+RPP E   L 
Sbjct  40   LRLRPTPPGLSHAAVRFGAARLNSVRCMARRAGDSAYSPLNSGPGGGFSDRPPTEMAPLF  99

Query  312  DGCDFEHWLIVMEKPEGD-PTRDEIIDSYIKTLAQVVGSEEEARMKIYSVSTRHYYAFGA  488
             GCD+EHWLIVM+KP G+  T+ ++ID YI+TLA+VVGSEEEA+ +IY+VS   Y+ FG 
Sbjct  100  PGCDYEHWLIVMDKPGGEGATKQQMIDCYIQTLAKVVGSEEEAKKRIYNVSCERYFGFGC  159

Query  489  LVSEELSYKLKELKGVRWVLPDSYLDVKNKDYGGEPFINGQAV  617
             + EE S KL+ L GV +VLPDSY+D +NKDYG E F+NG+ V
Sbjct  160  KIDEETSNKLEGLPGVLFVLPDSYVDPENKDYGAELFVNGEIV  202



>ref|XP_009775265.1| PREDICTED: DAG protein, chloroplastic-like [Nicotiana sylvestris]
Length=230

 Score =   149 bits (375),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 81/169 (48%), Positives = 109/169 (64%), Gaps = 5/169 (3%)
 Frame = +3

Query  123  PRNFLAFSSFRLRPLVSVSPAVCQLYPAA--YTAVRGLATRQTSSSLNDPNPNWSNRPPK  296
            P++  A   F+ R   S+S A+  + P +      R  A R   S LN    N+ +RPP 
Sbjct  26   PKSIPANFPFQTRSTPSISHAIRAVAPGSDRINTTRCRANRSAYSPLNS-GSNFGDRPPT  84

Query  297  ETI-LLDGCDFEHWLIVMEKPEGD-PTRDEIIDSYIKTLAQVVGSEEEARMKIYSVSTRH  470
            E   L  GCD+EHWLIVM+KP G+  T+ ++ID YI+TLA+VVGSEEEA+ +IY+VS   
Sbjct  85   EMAPLFPGCDYEHWLIVMDKPGGEGATKQQMIDCYIQTLAKVVGSEEEAKKRIYNVSCER  144

Query  471  YYAFGALVSEELSYKLKELKGVRWVLPDSYLDVKNKDYGGEPFINGQAV  617
            Y+ FG  + EE S KL+ L GV +VLPDSY+D +NKDYG E F+NG+ V
Sbjct  145  YFGFGCEIDEETSNKLEGLPGVLFVLPDSYVDPENKDYGAELFVNGEIV  193



>ref|XP_007024644.1| Plastid developmental protein DAG isoform 2 [Theobroma cacao]
 gb|EOY27266.1| Plastid developmental protein DAG isoform 2 [Theobroma cacao]
Length=226

 Score =   148 bits (374),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 66/107 (62%), Positives = 85/107 (79%), Gaps = 0/107 (0%)
 Frame = +3

Query  306  LLDGCDFEHWLIVMEKPEGDPTRDEIIDSYIKTLAQVVGSEEEARMKIYSVSTRHYYAFG  485
            L++GCD+EHW +VME P+G P RDEI+D+YIKTLA  +GSEEEA+  IYSVST++YYAFG
Sbjct  89   LVEGCDYEHWFVVMEAPKGYPLRDEIVDTYIKTLAMALGSEEEAKKSIYSVSTKYYYAFG  148

Query  486  ALVSEELSYKLKELKGVRWVLPDSYLDVKNKDYGGEPFINGQAVPYD  626
                E+L++KLK L  V+WVLPDSYL   +  YGGEPF++G+ V YD
Sbjct  149  CKGPEDLTFKLKSLPNVKWVLPDSYLVHGDNSYGGEPFLDGKVVQYD  195



>ref|XP_007216380.1| hypothetical protein PRUPE_ppa021073mg, partial [Prunus persica]
 gb|EMJ17579.1| hypothetical protein PRUPE_ppa021073mg, partial [Prunus persica]
Length=183

 Score =   147 bits (370),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 65/107 (61%), Positives = 83/107 (78%), Gaps = 0/107 (0%)
 Frame = +3

Query  306  LLDGCDFEHWLIVMEKPEGDPTRDEIIDSYIKTLAQVVGSEEEARMKIYSVSTRHYYAFG  485
            L+DGCD+EHWL+VME P+G P RDEII+ YI+TLA  +GS E+A+  IYSVST++YYAFG
Sbjct  62   LVDGCDYEHWLVVMEPPKGYPLRDEIINGYIQTLATALGSAEKAKKSIYSVSTKYYYAFG  121

Query  486  ALVSEELSYKLKELKGVRWVLPDSYLDVKNKDYGGEPFINGQAVPYD  626
              V E L++K+K L  V+WVLPDSYL     DYGGEP ++G  +PYD
Sbjct  122  CKVPENLTFKIKSLTNVKWVLPDSYLCHGENDYGGEPLVDGVVIPYD  168



>ref|XP_010109586.1| hypothetical protein L484_005245 [Morus notabilis]
 gb|EXC23295.1| hypothetical protein L484_005245 [Morus notabilis]
Length=484

 Score =   154 bits (388),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 83/147 (56%), Positives = 101/147 (69%), Gaps = 6/147 (4%)
 Frame = +3

Query  192  QLYP-AAYTAVRGLATRQTSSSLNDPNPNWSN--RPPKETILLDGCDFEHWLIVMEKPEG  362
            QL P +A   +R   T  +  S +DP   W N      ETI +DGCDFEHWL++M  PE 
Sbjct  52   QLVPDSARPPLRFCTTTASPPSRDDPI--WGNPTEEVDETITIDGCDFEHWLVIMRFPED  109

Query  363  -DPTRDEIIDSYIKTLAQVVGSEEEARMKIYSVSTRHYYAFGALVSEELSYKLKELKGVR  539
              P+ DE++D+YIKTLA VVGSEEEA+ KIYSVST  +  FGALVS +LS  LK L GV 
Sbjct  110  PKPSEDEMVDTYIKTLAAVVGSEEEAKKKIYSVSTTTFTGFGALVSRDLSQNLKGLPGVL  169

Query  540  WVLPDSYLDVKNKDYGGEPFINGQAVP  620
            WVLPDSYLDV NKDYGG+  ++G+ VP
Sbjct  170  WVLPDSYLDVPNKDYGGDLLVDGKVVP  196



>ref|XP_007035204.1| Differentiation and greening-like 1 [Theobroma cacao]
 gb|EOY06130.1| Differentiation and greening-like 1 [Theobroma cacao]
Length=241

 Score =   148 bits (373),  Expect = 5e-40, Method: Compositional matrix adjust.
 Identities = 93/206 (45%), Positives = 128/206 (62%), Gaps = 18/206 (9%)
 Frame = +3

Query  48   MATLLSRSLITAGKQLFRSYSSLTPPRNFLAFSS-----------FRLRPLVSVSPAV--  188
            MA  L+R+  +A  + +R+ S L+P R  L+ +S           F  RPL  +S AV  
Sbjct  1    MAQTLTRAASSAVTR-YRTISVLSPKR-LLSTTSITHPTPIPSLLFSRRPLTPLSHAVRA  58

Query  189  CQLYPAAYTAVRGLATRQTSS-SLNDPNPNWSNRPPKETI-LLDGCDFEHWLIVMEKPEG  362
              L P  +TA+R    R  +S S  +   N+S+RPP E   L  GCD++HWLIVM+KP G
Sbjct  59   LPLVPTRFTAIRCRVNRSGNSYSPLNSGSNFSDRPPTEMAPLFPGCDYQHWLIVMDKPGG  118

Query  363  D-PTRDEIIDSYIKTLAQVVGSEEEARMKIYSVSTRHYYAFGALVSEELSYKLKELKGVR  539
            +  T+ ++ID YI+TLA+VVGS+EEA  +IY+VS   Y AFG  + EE S KL+ L GV 
Sbjct  119  EGATKQQMIDCYIETLAKVVGSKEEAIKRIYNVSCERYLAFGCEIDEETSQKLEGLPGVL  178

Query  540  WVLPDSYLDVKNKDYGGEPFINGQAV  617
            +VLPDSY+D + KDYG E F+NG+ V
Sbjct  179  FVLPDSYVDPEYKDYGAELFVNGEIV  204



>ref|XP_010267853.1| PREDICTED: DAG protein, chloroplastic-like [Nelumbo nucifera]
Length=242

 Score =   148 bits (373),  Expect = 6e-40, Method: Compositional matrix adjust.
 Identities = 85/200 (43%), Positives = 116/200 (58%), Gaps = 20/200 (10%)
 Frame = +3

Query  51   ATLLSRSLITAGKQLFRSYSSLTPPRNFLAFSSFRLRPLVS---------VSPAVCQLYP  203
            ++LLS+ +I         ++ L P  +   ++S    PLV           SP  C    
Sbjct  6    SSLLSKMIICPSSH----FTDLKPRSSVSVYASISRVPLVPSYRFNSAPYFSPRPCLSSS  61

Query  204  AAYTAVRGLATRQTSSSLNDPNPNWSNRPPKETILLDGCDFEHWLIVMEKPEG-DPTRDE  380
            +  T+ R    R  +S  ++      N  P+ETILL GCD+ HWLIVME P+   PTR++
Sbjct  62   SLSTSTRAAVDRDYTSRRSN------NNEPRETILLPGCDYNHWLIVMEFPKDPAPTREQ  115

Query  381  IIDSYIKTLAQVVGSEEEARMKIYSVSTRHYYAFGALVSEELSYKLKELKGVRWVLPDSY  560
            +ID+Y+ TLA V+GS EEA+  +Y+ ST  Y  F   VSEE S K K L GV WVLPDSY
Sbjct  116  MIDTYLNTLATVLGSMEEAKKNMYAFSTTTYTGFQCTVSEETSEKFKGLPGVLWVLPDSY  175

Query  561  LDVKNKDYGGEPFINGQAVP  620
            +DVKNKDYGG+ +ING+ +P
Sbjct  176  IDVKNKDYGGDKYINGEIIP  195



>gb|ABK24009.1| unknown [Picea sitchensis]
 gb|ACN40337.1| unknown [Picea sitchensis]
Length=244

 Score =   148 bits (373),  Expect = 6e-40, Method: Compositional matrix adjust.
 Identities = 79/157 (50%), Positives = 103/157 (66%), Gaps = 5/157 (3%)
 Frame = +3

Query  162  PLVSVSPAVCQL--YPAAYTAVRGLATRQTS-SSLNDPNPNWSNRPPKETI-LLDGCDFE  329
            PL ++S  V      P +   VR   T  +  S LN+ +PNWS+RPP ET  L  GCD+E
Sbjct  48   PLFAISHGVVHAPKVPVSRLTVRCKVTNNSGYSPLNNSSPNWSDRPPVETAPLFPGCDYE  107

Query  330  HWLIVMEKP-EGDPTRDEIIDSYIKTLAQVVGSEEEARMKIYSVSTRHYYAFGALVSEEL  506
            HWLIVM+ P EG  T+ E+ID YI+TLA+V+GSEE A+  IY+VS   Y+ FG  + EE 
Sbjct  108  HWLIVMDHPNEGKATKQEMIDCYIQTLAKVLGSEEAAKKSIYNVSCERYFGFGCQIDEET  167

Query  507  SYKLKELKGVRWVLPDSYLDVKNKDYGGEPFINGQAV  617
            S KL  L GV +VLPDSY+D + KDYGGE  ++G+ V
Sbjct  168  SNKLVGLPGVVFVLPDSYVDAEYKDYGGELLVDGKIV  204



>gb|KJB68918.1| hypothetical protein B456_011G059700 [Gossypium raimondii]
Length=191

 Score =   146 bits (368),  Expect = 7e-40, Method: Compositional matrix adjust.
 Identities = 66/109 (61%), Positives = 86/109 (79%), Gaps = 1/109 (1%)
 Frame = +3

Query  303  ILLDGCDFEHWLIVMEKPEGDPTRDEIIDSYIKTLAQVVGSEEEARMKIYSVSTRHYYAF  482
            +L++GCD+EHW +VME P+G P RDEI+ +YIKTLA  +GSEE+A+  IYSVST++YYAF
Sbjct  51   VLVEGCDYEHWFVVMEAPKGYPLRDEIVSTYIKTLAMALGSEEDAKKSIYSVSTKYYYAF  110

Query  483  GALVSEELSYKLKELKGVRWVLPDSYL-DVKNKDYGGEPFINGQAVPYD  626
            G  V E+L +K+K L  V+WVLPDSY  D  +  YGGEPFI+G+ VPYD
Sbjct  111  GCEVPEDLVFKIKTLPNVKWVLPDSYSGDPGDNSYGGEPFIDGKVVPYD  159



>ref|NP_001240266.1| uncharacterized protein LOC100788853 [Glycine max]
 gb|ACU23832.1| unknown [Glycine max]
 gb|KHN19074.1| DAG protein, chloroplastic [Glycine soja]
Length=225

 Score =   147 bits (371),  Expect = 7e-40, Method: Compositional matrix adjust.
 Identities = 82/181 (45%), Positives = 106/181 (59%), Gaps = 11/181 (6%)
 Frame = +3

Query  81   AGKQLFRSYSSLTPPRNFLAFSSFRLRPLVSVSPAVCQLYPAAYTAVRGLATRQTSSSLN  260
            + K L   Y   TP  NF   ++ RL P +      C    AA       A R +SS+ N
Sbjct  9    SAKTLTLPYHPKTPISNFTPVTNLRLPPSIVTRTRNCNRIRAALDGDFS-AKRSSSSNNN  67

Query  261  DPNPNWSNRPPKETILLDGCDFEHWLIVMEKPEG-DPTRDEIIDSYIKTLAQVVGSEEEA  437
            D          +ETI+L GCD+ HWLIVME P+   PTR+++ID+Y+ TLA V+GS EEA
Sbjct  68   DQ---------RETIMLPGCDYNHWLIVMEFPKDPAPTREQMIDTYLDTLATVLGSMEEA  118

Query  438  RMKIYSVSTRHYYAFGALVSEELSYKLKELKGVRWVLPDSYLDVKNKDYGGEPFINGQAV  617
            +  +Y+ ST  Y  F   V E  S K K L GV WVLPDSY+DVKNKDYGG+ +ING+ +
Sbjct  119  KKNMYAFSTTTYTGFQCTVDEATSEKFKGLPGVLWVLPDSYIDVKNKDYGGDKYINGEII  178

Query  618  P  620
            P
Sbjct  179  P  179



>ref|XP_008802961.1| PREDICTED: DAG protein, chloroplastic-like [Phoenix dactylifera]
Length=244

 Score =   147 bits (372),  Expect = 8e-40, Method: Compositional matrix adjust.
 Identities = 89/185 (48%), Positives = 117/185 (63%), Gaps = 12/185 (6%)
 Frame = +3

Query  99   RSYSSLTPPRNFLAFSSFR--LRPLVSVSPAV----CQLYPAAYTAVRGLATRQTSSSLN  260
            RS  +L   + FLA S F   L  L S SP +     +L  A   +VR +A R   S+ +
Sbjct  23   RSPLTLIISKRFLASSPFAAGLLGLRSSSPGLSRVAVRLGVARINSVRCMARRAGDSAYS  82

Query  261  DPNPN----WSNRPPKETI-LLDGCDFEHWLIVMEKPEGD-PTRDEIIDSYIKTLAQVVG  422
              N      +S+RPP E   L  GCD+EHWLIVM+KP G+  T+ ++ID YI+TLA+VVG
Sbjct  83   PLNSGSGGGFSDRPPTEMAPLFPGCDYEHWLIVMDKPGGEGATKQQMIDCYIQTLAKVVG  142

Query  423  SEEEARMKIYSVSTRHYYAFGALVSEELSYKLKELKGVRWVLPDSYLDVKNKDYGGEPFI  602
            SEEEA+ KIY+VS   Y+ FG  + EE S KL+ L GV +VLPDSY+D +NKDYG E F+
Sbjct  143  SEEEAKKKIYNVSCERYFGFGCEIDEETSNKLEGLPGVLFVLPDSYVDPENKDYGAELFV  202

Query  603  NGQAV  617
            NG+ V
Sbjct  203  NGEIV  207



>gb|AAF69548.1|AC008007_23 F12M16.16 [Arabidopsis thaliana]
Length=358

 Score =   150 bits (379),  Expect = 8e-40, Method: Compositional matrix adjust.
 Identities = 71/86 (83%), Positives = 79/86 (92%), Gaps = 0/86 (0%)
 Frame = +3

Query  369  TRDEIIDSYIKTLAQVVGSEEEARMKIYSVSTRHYYAFGALVSEELSYKLKELKGVRWVL  548
             RDEIID YIKTLAQVVGSEEEARMKIYSVS + Y+AFGALVSE+LS+K+KEL  V+WVL
Sbjct  64   ARDEIIDYYIKTLAQVVGSEEEARMKIYSVSHKCYFAFGALVSEDLSHKIKELPKVKWVL  123

Query  549  PDSYLDVKNKDYGGEPFINGQAVPYD  626
            PDSYLD KNKDYGGEPFI+G+AVPYD
Sbjct  124  PDSYLDGKNKDYGGEPFIDGKAVPYD  149



>ref|XP_006593426.1| PREDICTED: uncharacterized protein LOC100788853 isoform X1 [Glycine 
max]
Length=270

 Score =   148 bits (373),  Expect = 9e-40, Method: Compositional matrix adjust.
 Identities = 83/190 (44%), Positives = 110/190 (58%), Gaps = 11/190 (6%)
 Frame = +3

Query  54   TLLSRSLITAGKQLFRSYSSLTPPRNFLAFSSFRLRPLVSVSPAVCQLYPAAYTAVRGLA  233
            T+ + +   + K L   Y   TP  NF   ++ RL P +      C    AA       A
Sbjct  45   TMATVTFSFSAKTLTLPYHPKTPISNFTPVTNLRLPPSIVTRTRNCNRIRAALDGDFS-A  103

Query  234  TRQTSSSLNDPNPNWSNRPPKETILLDGCDFEHWLIVMEKPEG-DPTRDEIIDSYIKTLA  410
             R +SS+ ND          +ETI+L GCD+ HWLIVME P+   PTR+++ID+Y+ TLA
Sbjct  104  KRSSSSNNNDQ---------RETIMLPGCDYNHWLIVMEFPKDPAPTREQMIDTYLDTLA  154

Query  411  QVVGSEEEARMKIYSVSTRHYYAFGALVSEELSYKLKELKGVRWVLPDSYLDVKNKDYGG  590
             V+GS EEA+  +Y+ ST  Y  F   V E  S K K L GV WVLPDSY+DVKNKDYGG
Sbjct  155  TVLGSMEEAKKNMYAFSTTTYTGFQCTVDEATSEKFKGLPGVLWVLPDSYIDVKNKDYGG  214

Query  591  EPFINGQAVP  620
            + +ING+ +P
Sbjct  215  DKYINGEIIP  224



>ref|XP_008228356.1| PREDICTED: uncharacterized protein At3g15000, mitochondrial [Prunus 
mume]
Length=186

 Score =   145 bits (367),  Expect = 9e-40, Method: Compositional matrix adjust.
 Identities = 65/107 (61%), Positives = 84/107 (79%), Gaps = 0/107 (0%)
 Frame = +3

Query  306  LLDGCDFEHWLIVMEKPEGDPTRDEIIDSYIKTLAQVVGSEEEARMKIYSVSTRHYYAFG  485
            L++GCD+EHWL+VME P+G P RDEII+ YI+TLA  +GS E+A+  IYSVST++YYAFG
Sbjct  62   LVEGCDYEHWLVVMEPPKGYPLRDEIINGYIQTLATALGSAEKAKKSIYSVSTKYYYAFG  121

Query  486  ALVSEELSYKLKELKGVRWVLPDSYLDVKNKDYGGEPFINGQAVPYD  626
              V E+L++K+K L  V+WVLPDSYL     DYGGEP ++G  VPYD
Sbjct  122  CKVPEKLTFKIKSLPNVKWVLPDSYLCHGENDYGGEPLVDGGVVPYD  168



>gb|KDP40691.1| hypothetical protein JCGZ_24690 [Jatropha curcas]
Length=202

 Score =   145 bits (366),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 65/107 (61%), Positives = 83/107 (78%), Gaps = 0/107 (0%)
 Frame = +3

Query  306  LLDGCDFEHWLIVMEKPEGDPTRDEIIDSYIKTLAQVVGSEEEARMKIYSVSTRHYYAFG  485
            +L+ CD++HWL+VME P+  P RDEII+ Y+KTLA  +GSEE+A+  IYSVST++YYAFG
Sbjct  61   ILEDCDYKHWLVVMEAPKEYPLRDEIINRYVKTLAMALGSEEKAKESIYSVSTKYYYAFG  120

Query  486  ALVSEELSYKLKELKGVRWVLPDSYLDVKNKDYGGEPFINGQAVPYD  626
              VSE L+YK+K L  V+WVLPDSYL      YGGEPF +G+ VPYD
Sbjct  121  CNVSENLTYKIKSLPDVKWVLPDSYLCCGESSYGGEPFFDGEVVPYD  167



>ref|XP_006364567.1| PREDICTED: uncharacterized protein At3g15000, mitochondrial-like 
[Solanum tuberosum]
Length=239

 Score =   146 bits (369),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 90/196 (46%), Positives = 117/196 (60%), Gaps = 5/196 (3%)
 Frame = +3

Query  39   VAGMAT-LLSRSLITAGKQLFRSYSSLTPPRNFLAFSSFRLRPLVSVSPAVCQLYPAAYT  215
            +AG AT L S S+  A  +L  S + L P       S+FR    +  S  V         
Sbjct  9    MAGSATPLQSTSVSLAAGELSLSIAVLKPTNLAGRSSTFRRNSSLH-SIRVGNTNSGRVN  67

Query  216  AVRGLATRQTSSSLNDPNPNWSNRPPKETI-LLDGCDFEHWLIVMEKPEGD-PTRDEIID  389
             +   A R   S LN    N+ +RPP E   L  GCD+EHWLIVM+KP G+  T+ ++ID
Sbjct  68   TIVCKANRSAYSPLNS-GSNYGDRPPTEMAPLFPGCDYEHWLIVMDKPGGEGATKQQMID  126

Query  390  SYIKTLAQVVGSEEEARMKIYSVSTRHYYAFGALVSEELSYKLKELKGVRWVLPDSYLDV  569
             YI+TLA+VVGSEEEA+ KIY+VS   Y+ FG  + EE S KL+ L GV +VLPDSY+D 
Sbjct  127  CYIQTLAKVVGSEEEAKKKIYNVSCERYFGFGCEIDEETSNKLEGLPGVLFVLPDSYVDP  186

Query  570  KNKDYGGEPFINGQAV  617
            +NKDYG E F+NG+ V
Sbjct  187  ENKDYGAELFVNGEIV  202



>ref|XP_004134048.1| PREDICTED: DAG protein, chloroplastic-like [Cucumis sativus]
 ref|XP_004166023.1| PREDICTED: DAG protein, chloroplastic-like [Cucumis sativus]
 gb|KGN56832.1| hypothetical protein Csa_3G134800 [Cucumis sativus]
Length=243

 Score =   146 bits (369),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 83/182 (46%), Positives = 122/182 (67%), Gaps = 6/182 (3%)
 Frame = +3

Query  87   KQLFRSYSSLTPPRNFLAFSSFRLRPLVSVSPAVCQL-YPAAYTAVRGLATRQTSSSLN-  260
            ++LF S S+LT P +  +F+  R R L  +S AV  +   + + ++R  ++R  +SS + 
Sbjct  26   RRLFSSSSTLTHPTSPSSFT-LRRRSLPLLSHAVRSIPSTSRFDSLRCFSSRPGNSSYSP  84

Query  261  -DPNPNWSNRPPKETI-LLDGCDFEHWLIVMEKPEGD-PTRDEIIDSYIKTLAQVVGSEE  431
             + N N++ RPP E   L  GCD+EHWLIVM+KP G+  T+ ++ID YI+TLA++VGSEE
Sbjct  85   LNSNSNFNERPPTEMAPLFPGCDYEHWLIVMDKPGGEGATKQQMIDCYIQTLAKIVGSEE  144

Query  432  EARMKIYSVSTRHYYAFGALVSEELSYKLKELKGVRWVLPDSYLDVKNKDYGGEPFINGQ  611
            EA+ +IY+VS   Y+ FG  + EE S KL+ L GV +VLPDSY+D + KDYG E  +NG+
Sbjct  145  EAKKRIYNVSCERYFGFGCELDEETSNKLEGLPGVLFVLPDSYVDPEYKDYGAELLVNGE  204

Query  612  AV  617
             V
Sbjct  205  IV  206



>gb|KHF98583.1| hypothetical protein F383_16164 [Gossypium arboreum]
Length=191

 Score =   144 bits (364),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 65/109 (60%), Positives = 86/109 (79%), Gaps = 1/109 (1%)
 Frame = +3

Query  303  ILLDGCDFEHWLIVMEKPEGDPTRDEIIDSYIKTLAQVVGSEEEARMKIYSVSTRHYYAF  482
            +L++GCD+EHW +VME P+G P RDEI+++YIKTLA  +GSEE+A+  IYSVST++YYAF
Sbjct  51   VLVEGCDYEHWFVVMEAPKGYPLRDEIVNTYIKTLAMALGSEEDAKKSIYSVSTKYYYAF  110

Query  483  GALVSEELSYKLKELKGVRWVLPDSYL-DVKNKDYGGEPFINGQAVPYD  626
            G  V E+L +K+K L  V+WVLPDSY  D  +  YGGEPFI+G+  PYD
Sbjct  111  GCKVPEDLVFKIKTLPNVKWVLPDSYSGDPGDNSYGGEPFIDGKVGPYD  159



>ref|XP_006465909.1| PREDICTED: uncharacterized protein At3g15000, mitochondrial-like 
[Citrus sinensis]
Length=187

 Score =   144 bits (364),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 62/107 (58%), Positives = 84/107 (79%), Gaps = 0/107 (0%)
 Frame = +3

Query  306  LLDGCDFEHWLIVMEKPEGDPTRDEIIDSYIKTLAQVVGSEEEARMKIYSVSTRHYYAFG  485
            LL+GCD++HWL+VME P+G P RDEI++ Y+KTLA  +G EE+A+  IYSVST++YYAFG
Sbjct  49   LLEGCDYKHWLVVMEAPKGYPPRDEIVNGYVKTLASALGCEEDAKKSIYSVSTKYYYAFG  108

Query  486  ALVSEELSYKLKELKGVRWVLPDSYLDVKNKDYGGEPFINGQAVPYD  626
              V E+ +YK++ L  V+WVLPDSYL      YGGEPF++G+ VPY+
Sbjct  109  CKVPEDFAYKIRSLPNVKWVLPDSYLCHGESGYGGEPFVDGEVVPYN  155



>gb|EYU33927.1| hypothetical protein MIMGU_mgv1a013091mg [Erythranthe guttata]
 gb|EYU33928.1| hypothetical protein MIMGU_mgv1a013091mg [Erythranthe guttata]
 gb|EYU33929.1| hypothetical protein MIMGU_mgv1a013091mg [Erythranthe guttata]
Length=231

 Score =   145 bits (367),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 75/140 (54%), Positives = 96/140 (69%), Gaps = 4/140 (3%)
 Frame = +3

Query  204  AAYTAVRGLATRQTSSSLNDPNPNWSNRPPKETILLDGCDFEHWLIVMEKPEG-DPTRDE  380
            AA+TAVR L   Q SS  +       +R   ETI+L GCD+ HWLIVME P+   P+R++
Sbjct  46   AAFTAVRALTDGQYSSKRSGGGGGGEDR---ETIMLPGCDYNHWLIVMEFPKDPAPSREQ  102

Query  381  IIDSYIKTLAQVVGSEEEARMKIYSVSTRHYYAFGALVSEELSYKLKELKGVRWVLPDSY  560
            +ID+YI TLA V+GS +EA+  +Y+ ST  Y  F   VSEE S K K L GV WVLPDSY
Sbjct  103  MIDTYIDTLATVLGSIDEAKKNMYAFSTTTYTGFQCTVSEETSEKFKGLPGVLWVLPDSY  162

Query  561  LDVKNKDYGGEPFINGQAVP  620
            +DVKNKDYGG+ +ING+ +P
Sbjct  163  IDVKNKDYGGDKYINGEIIP  182



>gb|EYU27861.1| hypothetical protein MIMGU_mgv1a013217mg [Erythranthe guttata]
 gb|EYU27862.1| hypothetical protein MIMGU_mgv1a013217mg [Erythranthe guttata]
 gb|EYU27863.1| hypothetical protein MIMGU_mgv1a013217mg [Erythranthe guttata]
Length=227

 Score =   145 bits (367),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 74/140 (53%), Positives = 95/140 (68%), Gaps = 7/140 (5%)
 Frame = +3

Query  204  AAYTAVRGLATRQTSSSLNDPNPNWSNRPPKETILLDGCDFEHWLIVMEKPEG-DPTRDE  380
            AA+TAVR L   + S+         S    +ETI+L GCD+ HWLIVME P+   PTRD+
Sbjct  48   AAFTAVRALGDGEYSAKRR------SGGEERETIMLPGCDYNHWLIVMEFPKDPAPTRDQ  101

Query  381  IIDSYIKTLAQVVGSEEEARMKIYSVSTRHYYAFGALVSEELSYKLKELKGVRWVLPDSY  560
            +ID+Y+ TLA V+GS EEA+  +Y+ ST  Y  F   VSEE S K K L GV WVLPDSY
Sbjct  102  MIDTYLNTLATVLGSMEEAKKNMYAFSTTTYTGFQCTVSEETSEKFKGLPGVLWVLPDSY  161

Query  561  LDVKNKDYGGEPFINGQAVP  620
            +DVKNKDYGG+ ++NG+ +P
Sbjct  162  IDVKNKDYGGDKYVNGEIIP  181



>ref|XP_002271431.2| PREDICTED: uncharacterized protein At3g15000, mitochondrial-like 
[Vitis vinifera]
Length=240

 Score =   146 bits (368),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 95/206 (46%), Positives = 127/206 (62%), Gaps = 23/206 (11%)
 Frame = +3

Query  48   MATLLSRSLITAGKQLFRSYSSL-----TPP-----RNFLAFSSFRLRPL-VSVSPAV--  188
            MA  +SRS++     L  S  SL     TPP     + FL+ S  + RP+ V   PA+  
Sbjct  5    MAAKISRSIMA----LRSSSQSLLTLRSTPPLSSLSKRFLSSSLQQPRPVPVRFWPAIPL  60

Query  189  -CQLYPAAYTAVRGLATRQTSSSLNDPNPNWSNRPPKETI-LLDGCDFEHWLIVMEKPEG  362
              +L    +   R  A +   S LN    N+S+RPP E   L  GCD+EHWLIVM+KP G
Sbjct  61   SSRLNQVRFRVNR--AGKSGYSPLNS-GSNFSDRPPTEMAPLFPGCDYEHWLIVMDKPGG  117

Query  363  D-PTRDEIIDSYIKTLAQVVGSEEEARMKIYSVSTRHYYAFGALVSEELSYKLKELKGVR  539
            +  T+ ++ID YI+TLA+VVGSEEEA+ KIY+VS   Y+ FG  + EE S KL++L GV 
Sbjct  118  EGATKHQMIDCYIQTLAKVVGSEEEAKKKIYNVSCERYFGFGCEIDEETSNKLEDLPGVL  177

Query  540  WVLPDSYLDVKNKDYGGEPFINGQAV  617
            +VLPDSY+D +NKDYG E F+NG+ V
Sbjct  178  FVLPDSYVDPENKDYGAELFVNGEIV  203



>gb|EPS60543.1| hypothetical protein M569_14261, partial [Genlisea aurea]
Length=102

 Score =   141 bits (356),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 68/92 (74%), Positives = 78/92 (85%), Gaps = 1/92 (1%)
 Frame = +3

Query  249  SSLNDPNPNWSNRPPKETILLDGCDFEHWLIVME-KPEGDPTRDEIIDSYIKTLAQVVGS  425
            S LNDP+PNWSNRPPKETILLDGCD+EHWLIVME   +  P+ +E+IDSY+KTLA V+GS
Sbjct  10   SPLNDPSPNWSNRPPKETILLDGCDYEHWLIVMEFNSDPKPSEEEMIDSYVKTLASVLGS  69

Query  426  EEEARMKIYSVSTRHYYAFGALVSEELSYKLK  521
            EEEA+ KIYSV T  Y  FGAL+SEELSYKLK
Sbjct  70   EEEAKKKIYSVCTTTYTGFGALISEELSYKLK  101



>ref|XP_004240482.1| PREDICTED: DAG protein, chloroplastic-like [Solanum lycopersicum]
Length=239

 Score =   145 bits (367),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 92/198 (46%), Positives = 118/198 (60%), Gaps = 7/198 (4%)
 Frame = +3

Query  36   LVAGMATLL-SRSLITAGKQLFRSYSSLTP-PRNFLAFSSFRLRPLVSVSPAVCQLYPAA  209
            ++AG AT   S S+  A  +L  S S   P P NF   SS   R  +  S  V       
Sbjct  8    MMAGSATPFPSTSVYLAAGEL--SLSIPVPKPTNFAGRSSTFRRNSILHSIRVENPNSGR  65

Query  210  YTAVRGLATRQTSSSLNDPNPNWSNRPPKETI-LLDGCDFEHWLIVMEKPEGD-PTRDEI  383
               +   A R   S LN    N+ +RPP E   L  GCD+EHWLIVM+KP G+  T+ ++
Sbjct  66   VNTIVCKANRSAYSPLNS-GSNYGDRPPTEMAPLFPGCDYEHWLIVMDKPGGEGATKQQM  124

Query  384  IDSYIKTLAQVVGSEEEARMKIYSVSTRHYYAFGALVSEELSYKLKELKGVRWVLPDSYL  563
            ID YI+TLA+VVGSEEEA+ KIY+VS   Y+ FG  + EE S KL+ L GV +VLPDSY+
Sbjct  125  IDCYIQTLAKVVGSEEEAKKKIYNVSCERYFGFGCEIDEETSNKLEGLPGVLFVLPDSYV  184

Query  564  DVKNKDYGGEPFINGQAV  617
            D +NKDYG E F+NG+ V
Sbjct  185  DPENKDYGAELFVNGEIV  202



>ref|XP_004497969.1| PREDICTED: uncharacterized protein At3g15000, mitochondrial-like 
[Cicer arietinum]
Length=216

 Score =   144 bits (364),  Expect = 6e-39, Method: Compositional matrix adjust.
 Identities = 89/192 (46%), Positives = 115/192 (60%), Gaps = 15/192 (8%)
 Frame = +3

Query  48   MATLLSRSLITAGKQLFRSYSSLTPPRNFLAFSSFRLRPLVSVSPAVCQLYPAAYTAVRG  227
            MA LLS S            SSL  P N L FSS   R     +P+    YP     +  
Sbjct  1    MARLLSLSTFP---------SSLLLPSNRL-FSS--TRGPYKATPSSFSRYPTVRCRMNR  48

Query  228  LATRQTSSSLNDPNPNWSNRPPKETI-LLDGCDFEHWLIVMEKPEGD-PTRDEIIDSYIK  401
                 T S LN  N N+S+RPP +   L  GCD+EHWLIVM+KP G+  T+ ++ID Y++
Sbjct  49   TGN-STYSPLNSGNSNFSDRPPTDMAPLFPGCDYEHWLIVMDKPGGEGATKQQMIDCYVQ  107

Query  402  TLAQVVGSEEEARMKIYSVSTRHYYAFGALVSEELSYKLKELKGVRWVLPDSYLDVKNKD  581
            TLA V+GSEEEA+ KIY+VS   Y+ FG  + EE S KL+ L GV +VLPDSY+D ++KD
Sbjct  108  TLAMVLGSEEEAKKKIYNVSCERYFGFGCEIDEETSTKLEGLPGVLFVLPDSYVDPEHKD  167

Query  582  YGGEPFINGQAV  617
            YG E F+NG+ V
Sbjct  168  YGAELFVNGEIV  179



>gb|ABK21318.1| unknown [Picea sitchensis]
Length=265

 Score =   145 bits (367),  Expect = 6e-39, Method: Compositional matrix adjust.
 Identities = 79/157 (50%), Positives = 104/157 (66%), Gaps = 5/157 (3%)
 Frame = +3

Query  162  PLVSVSPAVCQLYPAAYT--AVRGLATRQTS-SSLNDPNPNWSNRPPKETI-LLDGCDFE  329
            PLV+VS    Q    + +   VR   T  +  S L++ +PNWS+RPP ET  L  GCD+E
Sbjct  69   PLVAVSHGAVQAPKVSVSRLTVRCKVTNNSGYSPLSNSSPNWSDRPPVETAPLFPGCDYE  128

Query  330  HWLIVMEKP-EGDPTRDEIIDSYIKTLAQVVGSEEEARMKIYSVSTRHYYAFGALVSEEL  506
            HWLIVM+ P EG  T+ E+ID YI+TLA+V+GSEE A+  IY+VS   Y+ FG  + EE 
Sbjct  129  HWLIVMDPPNEGKATKQEMIDCYIQTLAKVLGSEEAAKKSIYNVSCERYFGFGCQIDEET  188

Query  507  SYKLKELKGVRWVLPDSYLDVKNKDYGGEPFINGQAV  617
            S KL  L GV +VLPDSY+D + KDYGGE  ++G+ V
Sbjct  189  SNKLVGLPGVVFVLPDSYVDAEYKDYGGELLVDGKIV  225



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 893169593250