BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFF037A19

Length=505
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009797256.1|  PREDICTED: uncharacterized protein LOC104243716    172   1e-49   Nicotiana sylvestris
ref|XP_009631591.1|  PREDICTED: uncharacterized protein LOC104121329    169   2e-48   Nicotiana tomentosiformis
ref|XP_009626744.1|  PREDICTED: uncharacterized protein LOC104117398    167   1e-47   Nicotiana tomentosiformis
ref|XP_009791619.1|  PREDICTED: uncharacterized protein LOC104238836    165   7e-47   Nicotiana sylvestris
emb|CDP14558.1|  unnamed protein product                                163   4e-46   Coffea canephora [robusta coffee]
ref|XP_006359698.1|  PREDICTED: uncharacterized protein LOC102599645    160   6e-45   Solanum tuberosum [potatoes]
ref|XP_004231042.1|  PREDICTED: uncharacterized protein LOC101266077    157   8e-44   Solanum lycopersicum
ref|XP_004505820.1|  PREDICTED: uncharacterized protein LOC101509009    152   8e-42   Cicer arietinum [garbanzo]
ref|XP_007131714.1|  hypothetical protein PHAVU_011G035700g             151   1e-41   Phaseolus vulgaris [French bean]
ref|XP_004147043.1|  PREDICTED: uncharacterized protein LOC101219501    151   1e-41   Cucumis sativus [cucumbers]
ref|XP_002278836.1|  PREDICTED: uncharacterized protein LOC100243471    150   3e-41   Vitis vinifera
ref|XP_010265995.1|  PREDICTED: uncharacterized protein LOC104603629    150   3e-41   Nelumbo nucifera [Indian lotus]
emb|CAN73631.1|  hypothetical protein VITISV_026643                     150   3e-41   Vitis vinifera
ref|XP_010107666.1|  hypothetical protein L484_008383                   148   2e-40   
ref|XP_008457698.1|  PREDICTED: uncharacterized protein LOC103497...    147   4e-40   Cucumis melo [Oriental melon]
ref|XP_008457697.1|  PREDICTED: uncharacterized protein LOC103497...    147   4e-40   
gb|KDO68071.1|  hypothetical protein CISIN_1g024365mg                   147   5e-40   Citrus sinensis [apfelsine]
ref|XP_006422593.1|  hypothetical protein CICLE_v10028931mg             147   6e-40   
ref|XP_002534148.1|  DNA binding protein, putative                      147   6e-40   
ref|XP_010266832.1|  PREDICTED: uncharacterized protein LOC104604256    147   7e-40   Nelumbo nucifera [Indian lotus]
ref|XP_007041832.1|  Basic-leucine zipper (bZIP) transcription fa...    145   7e-40   
ref|XP_006422601.1|  hypothetical protein CICLE_v10028931mg             147   1e-39   
ref|XP_007041826.1|  Basic-leucine zipper transcription factor fa...    145   2e-39   
ref|XP_007041828.1|  Basic-leucine zipper transcription factor fa...    145   2e-39   
ref|XP_010028728.1|  PREDICTED: uncharacterized protein LOC104418944    144   6e-39   Eucalyptus grandis [rose gum]
ref|XP_007041827.1|  Basic-leucine zipper transcription factor fa...    145   6e-39   
ref|XP_003607180.1|  hypothetical protein MTR_4g073100                  144   8e-39   Medicago truncatula
ref|XP_008236021.1|  PREDICTED: uncharacterized protein LOC103334...    144   8e-39   Prunus mume [ume]
ref|XP_008236016.1|  PREDICTED: uncharacterized protein LOC103334...    144   1e-38   Prunus mume [ume]
ref|XP_007201303.1|  hypothetical protein PRUPE_ppa009913mg             144   1e-38   Prunus persica
gb|KHG28517.1|  Protein FD -like protein                                143   2e-38   Gossypium arboreum [tree cotton]
ref|XP_002305521.2|  bZIP transcription factor family protein           140   3e-37   
ref|XP_006384577.1|  hypothetical protein POPTR_0004s18120g             140   3e-37   
gb|KJB32659.1|  hypothetical protein B456_005G254200                    139   6e-37   Gossypium raimondii
gb|KJB15817.1|  hypothetical protein B456_002G197800                    139   7e-37   Gossypium raimondii
ref|XP_010530900.1|  PREDICTED: uncharacterized protein LOC104807371    137   5e-36   Tarenaya hassleriana [spider flower]
ref|XP_011046685.1|  PREDICTED: uncharacterized protein LOC105141...    137   5e-36   Populus euphratica
ref|XP_011046689.1|  PREDICTED: uncharacterized protein LOC105141...    137   5e-36   Populus euphratica
ref|XP_011046688.1|  PREDICTED: uncharacterized protein LOC105141...    136   6e-36   Populus euphratica
gb|KDP29660.1|  hypothetical protein JCGZ_18822                         137   6e-36   Jatropha curcas
gb|KJB12146.1|  hypothetical protein B456_002G003000                    135   1e-35   Gossypium raimondii
gb|KJB12148.1|  hypothetical protein B456_002G003000                    135   1e-35   Gossypium raimondii
ref|XP_010690366.1|  PREDICTED: uncharacterized protein LOC104903923    136   2e-35   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_006409392.1|  hypothetical protein EUTSA_v10022810mg             135   2e-35   Eutrema salsugineum [saltwater cress]
gb|AFP19453.1|  bZIP transcription factor family protein 2              135   2e-35   Camellia sinensis [black tea]
ref|XP_006409393.1|  hypothetical protein EUTSA_v10022810mg             135   3e-35   
ref|XP_010526894.1|  PREDICTED: uncharacterized protein LOC104804328    134   4e-35   Tarenaya hassleriana [spider flower]
gb|KFK30142.1|  hypothetical protein AALP_AA7G222200                    134   5e-35   Arabis alpina [alpine rockcress]
ref|XP_006284366.1|  hypothetical protein CARUB_v10005538mg             134   5e-35   Capsella rubella
ref|XP_006590380.1|  PREDICTED: bZIP transcription factor bZIP121...    134   8e-35   
ref|XP_010432347.1|  PREDICTED: uncharacterized protein LOC104716633    133   1e-34   Camelina sativa [gold-of-pleasure]
ref|XP_010437531.1|  PREDICTED: uncharacterized protein LOC104721282    133   1e-34   
gb|KHN39873.1|  hypothetical protein glysoja_020613                     133   1e-34   Glycine soja [wild soybean]
ref|XP_002869111.1|  bZIP transcription factor family protein           132   2e-34   Arabidopsis lyrata subsp. lyrata
ref|XP_010447005.1|  PREDICTED: uncharacterized protein LOC104729711    132   2e-34   Camelina sativa [gold-of-pleasure]
ref|NP_567974.1|  transcription factor bZIP19                           132   2e-34   Arabidopsis thaliana [mouse-ear cress]
gb|AAM63358.1|  putative transcription factor                           132   2e-34   Arabidopsis thaliana [mouse-ear cress]
ref|NP_001237296.1|  bZIP transcription factor bZIP121                  132   3e-34   
ref|XP_006412160.1|  hypothetical protein EUTSA_v10026007mg             132   3e-34   
emb|CAA17769.1|  putative protein                                       132   3e-34   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009787001.1|  PREDICTED: uncharacterized protein LOC104235...    132   3e-34   Nicotiana sylvestris
ref|XP_009786999.1|  PREDICTED: uncharacterized protein LOC104235...    132   5e-34   Nicotiana sylvestris
ref|XP_004164905.1|  PREDICTED: uncharacterized protein LOC101232700    130   9e-34   
ref|XP_004144846.1|  PREDICTED: uncharacterized protein LOC101208161    130   1e-33   Cucumis sativus [cucumbers]
ref|XP_008447959.1|  PREDICTED: uncharacterized protein LOC103490288    130   1e-33   Cucumis melo [Oriental melon]
ref|XP_006591923.1|  PREDICTED: bZIP transcription factor bZIP122...    129   6e-33   
ref|NP_001235033.1|  bZIP transcription factor bZIP122                  128   6e-33   Glycine max [soybeans]
ref|XP_011046168.1|  PREDICTED: uncharacterized protein LOC105140851    128   7e-33   Populus euphratica
ref|XP_009108690.1|  PREDICTED: uncharacterized protein LOC103834377    128   9e-33   Brassica rapa
ref|XP_009376950.1|  PREDICTED: uncharacterized protein LOC103965600    127   3e-32   Pyrus x bretschneideri [bai li]
ref|XP_009376970.1|  PREDICTED: uncharacterized protein LOC103965622    127   3e-32   Pyrus x bretschneideri [bai li]
ref|XP_002313707.2|  hypothetical protein POPTR_0009s13730g             126   4e-32   
emb|CDY17503.1|  BnaC03g65600D                                          125   6e-32   Brassica napus [oilseed rape]
ref|XP_009112401.1|  PREDICTED: uncharacterized protein LOC103837...    125   8e-32   
ref|XP_009112403.1|  PREDICTED: uncharacterized protein LOC103837...    125   8e-32   Brassica rapa
emb|CDX76308.1|  BnaA08g10920D                                          125   2e-31   
ref|XP_008377738.1|  PREDICTED: uncharacterized protein LOC103440807    124   2e-31   
ref|XP_010548099.1|  PREDICTED: uncharacterized protein LOC104819648    124   4e-31   Tarenaya hassleriana [spider flower]
ref|XP_002884017.1|  DNA binding protein                                123   5e-31   Arabidopsis lyrata subsp. lyrata
ref|XP_009355669.1|  PREDICTED: uncharacterized protein LOC103946638    122   1e-30   Pyrus x bretschneideri [bai li]
ref|XP_009624365.1|  PREDICTED: uncharacterized protein LOC104115438    122   2e-30   Nicotiana tomentosiformis
ref|XP_010467405.1|  PREDICTED: uncharacterized protein LOC104747472    121   3e-30   Camelina sativa [gold-of-pleasure]
ref|XP_006298365.1|  hypothetical protein CARUB_v10014436mg             117   8e-29   Capsella rubella
emb|CDY47478.1|  BnaA09g08870D                                          117   8e-29   Brassica napus [oilseed rape]
ref|XP_011088608.1|  PREDICTED: uncharacterized protein LOC105169791    117   2e-28   Sesamum indicum [beniseed]
ref|XP_010327411.1|  PREDICTED: uncharacterized protein LOC104649609    116   3e-28   Solanum lycopersicum
ref|XP_010516149.1|  PREDICTED: uncharacterized protein LOC104791854    115   7e-28   Camelina sativa [gold-of-pleasure]
ref|XP_010489260.1|  PREDICTED: uncharacterized protein LOC104766980    114   1e-27   Camelina sativa [gold-of-pleasure]
emb|CDY26786.1|  BnaC09g09130D                                          114   1e-27   Brassica napus [oilseed rape]
ref|NP_179268.2|  transcription factor bZIP23                           114   1e-27   Arabidopsis thaliana [mouse-ear cress]
gb|AAD24610.1|  hypothetical protein                                    113   3e-27   Arabidopsis thaliana [mouse-ear cress]
ref|XP_011092972.1|  PREDICTED: uncharacterized protein LOC105173...    111   2e-26   Sesamum indicum [beniseed]
ref|XP_011092974.1|  PREDICTED: uncharacterized protein LOC105173...    111   2e-26   Sesamum indicum [beniseed]
emb|CBI37871.3|  unnamed protein product                                107   3e-26   Vitis vinifera
gb|AFP19452.1|  bZIP transcription factor family protein 1              110   5e-26   Camellia sinensis [black tea]
ref|XP_004289872.1|  PREDICTED: uncharacterized protein LOC101314521    108   5e-25   Fragaria vesca subsp. vesca
gb|EYU37954.1|  hypothetical protein MIMGU_mgv1a011243mg                107   1e-24   Erythranthe guttata [common monkey flower]
emb|CDX89748.1|  BnaC03g46620D                                          106   1e-24   
emb|CDX69107.1|  BnaC01g03460D                                          105   5e-24   
ref|XP_009408222.1|  PREDICTED: uncharacterized protein LOC103990...    101   9e-23   
ref|XP_009408220.1|  PREDICTED: uncharacterized protein LOC103990...    100   2e-22   
ref|XP_009391011.1|  PREDICTED: uncharacterized protein LOC103977271    100   3e-22   Musa acuminata subsp. malaccensis [pisang utan]
gb|ACI90291.1|  putative bZIP transcription factor                    97.4    4e-21   Picrorhiza kurrooa
gb|AAL79736.1|AC091774_27  putative transcription factor              96.3    1e-20   Oryza sativa Japonica Group [Japonica rice]
ref|NP_001058591.1|  Os06g0716800                                     95.9    1e-20   
ref|XP_006656494.1|  PREDICTED: uncharacterized protein LOC102721653  95.5    1e-20   Oryza brachyantha
ref|XP_009401478.1|  PREDICTED: uncharacterized protein LOC103985487  94.0    7e-20   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_003563276.1|  PREDICTED: uncharacterized protein LOC100823660  93.2    1e-19   Brachypodium distachyon [annual false brome]
ref|XP_004966468.1|  PREDICTED: uncharacterized protein LOC101762...  93.2    1e-19   
ref|XP_002439031.1|  hypothetical protein SORBIDRAFT_10g030250        93.2    1e-19   Sorghum bicolor [broomcorn]
ref|NP_001141059.1|  uncharacterized protein LOC100273140             92.4    2e-19   Zea mays [maize]
gb|ACG32751.1|  DNA binding protein                                   92.4    2e-19   Zea mays [maize]
ref|NP_001148839.1|  LOC100282457                                     92.4    2e-19   Zea mays [maize]
ref|XP_008647848.1|  PREDICTED: LOC100282457 isoform X1               92.4    2e-19   Zea mays [maize]
gb|EMT00406.1|  hypothetical protein F775_29696                       91.3    5e-19   
gb|EPS65924.1|  hypothetical protein M569_08855                       90.9    6e-19   Genlisea aurea
gb|AFW69519.1|  putative bZIP transcription factor superfamily pr...  91.3    6e-19   
ref|XP_006846902.1|  hypothetical protein AMTR_s00152p00031760        87.8    1e-17   Amborella trichopoda
ref|XP_009106517.1|  PREDICTED: uncharacterized protein LOC103832273  86.3    3e-17   Brassica rapa
emb|CDY52654.1|  BnaAnng11690D                                        85.9    3e-17   Brassica napus [oilseed rape]
ref|XP_009136335.1|  PREDICTED: uncharacterized protein LOC103860484  85.5    4e-17   Brassica rapa
emb|CDY02237.1|  BnaA03g39300D                                        85.5    5e-17   
ref|XP_010935120.1|  PREDICTED: uncharacterized protein LOC105055101  85.5    5e-17   Elaeis guineensis
ref|XP_001758867.1|  predicted protein                                83.2    1e-16   
gb|KJB76277.1|  hypothetical protein B456_012G081200                  84.0    2e-16   Gossypium raimondii
gb|KJB76278.1|  hypothetical protein B456_012G081200                  84.0    2e-16   Gossypium raimondii
ref|XP_008800178.1|  PREDICTED: uncharacterized protein LOC103714...  80.9    2e-15   Phoenix dactylifera
ref|XP_008800177.1|  PREDICTED: uncharacterized protein LOC103714...  80.9    2e-15   
ref|XP_009418779.1|  PREDICTED: uncharacterized protein LOC103998893  80.5    3e-15   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010920114.1|  PREDICTED: uncharacterized protein LOC105044037  79.7    5e-15   Elaeis guineensis
ref|XP_008813516.1|  PREDICTED: uncharacterized protein LOC103724133  72.4    2e-12   
ref|XP_011091785.1|  PREDICTED: putative transcription factor kapC    72.0    2e-12   
ref|XP_008790182.1|  PREDICTED: uncharacterized protein LOC103707462  72.0    2e-12   Phoenix dactylifera
dbj|BAJ84101.1|  RNA-dependent RNA polymerase                         65.9    1e-10   Bat coronavirus M.ful/Japan/02/2010
ref|XP_008788583.1|  PREDICTED: uncharacterized protein LOC103706294  64.3    1e-09   Phoenix dactylifera
gb|EMS47152.1|  hypothetical protein TRIUR3_12850                     63.5    1e-09   Triticum urartu
gb|EMT32723.1|  hypothetical protein F775_08202                       62.0    5e-09   
ref|XP_007149027.1|  hypothetical protein PHAVU_005G034400g           62.8    5e-09   Phaseolus vulgaris [French bean]
gb|EMS52367.1|  hypothetical protein TRIUR3_01653                     61.2    9e-09   Triticum urartu
gb|EMT32714.1|  hypothetical protein F775_17324                       60.8    1e-08   
emb|CAB41316.1|  putative protein                                     58.5    5e-08   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009354398.1|  PREDICTED: transcription factor TGA3             58.9    9e-08   
emb|CDP21594.1|  unnamed protein product                              58.9    1e-07   Coffea canephora [robusta coffee]
gb|EMT13528.1|  hypothetical protein F775_07298                       58.5    1e-07   
ref|NP_190764.2|  basic leucine zipper 24                             58.2    2e-07   Arabidopsis thaliana [mouse-ear cress]
gb|EMS54685.1|  hypothetical protein TRIUR3_17772                     58.9    2e-07   Triticum urartu
ref|NP_850680.1|  basic leucine zipper 24                             57.4    3e-07   Arabidopsis thaliana [mouse-ear cress]
emb|CDY23178.1|  BnaA04g05810D                                        55.8    6e-07   Brassica napus [oilseed rape]
ref|XP_006291938.1|  hypothetical protein CARUB_v10018125mg           55.1    9e-07   Capsella rubella
ref|XP_010426786.1|  PREDICTED: uncharacterized protein LOC104711...  55.1    1e-06   Camelina sativa [gold-of-pleasure]
ref|XP_010426784.1|  PREDICTED: uncharacterized protein LOC104711...  55.5    2e-06   Camelina sativa [gold-of-pleasure]
ref|XP_006403861.1|  hypothetical protein EUTSA_v10010764mg           54.3    2e-06   
ref|XP_010515641.1|  PREDICTED: uncharacterized protein LOC104791...  54.7    2e-06   Camelina sativa [gold-of-pleasure]
ref|XP_010515638.1|  PREDICTED: uncharacterized protein LOC104791...  54.7    2e-06   Camelina sativa [gold-of-pleasure]
gb|EMS52399.1|  hypothetical protein TRIUR3_11502                     55.5    2e-06   Triticum urartu
ref|XP_002877837.1|  bZIP family transcription factor                 54.7    2e-06   
ref|XP_008344616.1|  PREDICTED: uncharacterized protein LOC103407459  55.1    3e-06   
emb|CDY60641.1|  BnaCnng36700D                                        53.1    7e-06   Brassica napus [oilseed rape]
ref|XP_003566090.1|  PREDICTED: uncharacterized protein LOC100823248  53.5    8e-06   Brachypodium distachyon [annual false brome]
gb|EMT32713.1|  hypothetical protein F775_17323                       52.0    4e-05   
dbj|BAJ84803.1|  predicted protein                                    51.6    5e-05   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|EMS45140.1|  hypothetical protein TRIUR3_21208                     50.8    7e-05   Triticum urartu
ref|XP_010922246.1|  PREDICTED: uncharacterized protein LOC105045595  50.8    8e-05   Elaeis guineensis
ref|XP_010104020.1|  hypothetical protein L484_001603                 50.1    2e-04   
ref|XP_009117143.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...  48.5    2e-04   
gb|EMS67651.1|  hypothetical protein TRIUR3_23486                     48.9    5e-04   Triticum urartu
gb|EMT18405.1|  hypothetical protein F775_16738                       47.8    7e-04   



>ref|XP_009797256.1| PREDICTED: uncharacterized protein LOC104243716 [Nicotiana sylvestris]
 ref|XP_009797257.1| PREDICTED: uncharacterized protein LOC104243716 [Nicotiana sylvestris]
 ref|XP_009797258.1| PREDICTED: uncharacterized protein LOC104243716 [Nicotiana sylvestris]
 ref|XP_009797259.1| PREDICTED: uncharacterized protein LOC104243716 [Nicotiana sylvestris]
 ref|XP_009797260.1| PREDICTED: uncharacterized protein LOC104243716 [Nicotiana sylvestris]
Length=273

 Score =   172 bits (436),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 104/122 (85%), Positives = 107/122 (88%), Gaps = 2/122 (2%)
 Frame = +1

Query  139  MEDGELEFSNQEMLSSSNFCEFPDSNSYMDSFLNEILKDTHACTHAHTCNPPGPDNSHTH  318
            M+DGELEFSNQEMLSSSNF EFPDS S MDSF NEILKDTHACTH HTCNPPGPDN+HTH
Sbjct  1    MDDGELEFSNQEMLSSSNFGEFPDSGS-MDSFFNEILKDTHACTHTHTCNPPGPDNTHTH  59

Query  319  TCYHVHTKIVPAPSEEDKAPSDDTAESVDKKEKKRPLGNreavrkyrekkkaraaLLEDG  498
            TCYHVHTKIVP P  EDK  SDDTAES + K KKRPLGNREAVRKYREKKKARAA LED 
Sbjct  60   TCYHVHTKIVP-PLSEDKTASDDTAESAEGKRKKRPLGNREAVRKYREKKKARAASLEDE  118

Query  499  VV  504
            VV
Sbjct  119  VV  120



>ref|XP_009631591.1| PREDICTED: uncharacterized protein LOC104121329 [Nicotiana tomentosiformis]
 ref|XP_009631599.1| PREDICTED: uncharacterized protein LOC104121329 [Nicotiana tomentosiformis]
Length=273

 Score =   169 bits (427),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 102/122 (84%), Positives = 106/122 (87%), Gaps = 2/122 (2%)
 Frame = +1

Query  139  MEDGELEFSNQEMLSSSNFCEFPDSNSYMDSFLNEILKDTHACTHAHTCNPPGPDNSHTH  318
            M+DGELEFSNQEMLSSSNF EFPDS   MDSF NEILKDTHACTH HTCNPPGPD++HTH
Sbjct  1    MDDGELEFSNQEMLSSSNFGEFPDS-GLMDSFFNEILKDTHACTHTHTCNPPGPDSTHTH  59

Query  319  TCYHVHTKIVPAPSEEDKAPSDDTAESVDKKEKKRPLGNreavrkyrekkkaraaLLEDG  498
            TCYHVHTKIVP P  EDK  SDDTAES + K KKRPLGNREAVRKYREKKKARAA LED 
Sbjct  60   TCYHVHTKIVP-PLSEDKTASDDTAESAEGKRKKRPLGNREAVRKYREKKKARAASLEDE  118

Query  499  VV  504
            VV
Sbjct  119  VV  120



>ref|XP_009626744.1| PREDICTED: uncharacterized protein LOC104117398 [Nicotiana tomentosiformis]
 ref|XP_009626745.1| PREDICTED: uncharacterized protein LOC104117398 [Nicotiana tomentosiformis]
Length=276

 Score =   167 bits (423),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 104/124 (84%), Positives = 109/124 (88%), Gaps = 6/124 (5%)
 Frame = +1

Query  139  MEDGELEFSNQEMLSSSNFCEFPDSNSYMDSFLNEILKDTHACTHAHTCNPPGPDNSHTH  318
            M DGELEFSNQEMLSSSNF EF   +S MDSF NEILKDTHACTHAHTCNPPGPDNSHTH
Sbjct  2    MADGELEFSNQEMLSSSNFGEF---SSSMDSFFNEILKDTHACTHAHTCNPPGPDNSHTH  58

Query  319  TCYHVHTKIVPAPSE--EDKAPSDDTAESVDKKEKKRPLGNreavrkyrekkkaraaLLE  492
            TCYHVHTKIVP PSE  EDK PSDDTAES +KK KKRP+GN+EAVRKYREKKKARAA LE
Sbjct  59   TCYHVHTKIVP-PSEEDEDKNPSDDTAESSEKKGKKRPVGNKEAVRKYREKKKARAASLE  117

Query  493  DGVV  504
            D V+
Sbjct  118  DEVI  121



>ref|XP_009791619.1| PREDICTED: uncharacterized protein LOC104238836 [Nicotiana sylvestris]
 ref|XP_009791625.1| PREDICTED: uncharacterized protein LOC104238836 [Nicotiana sylvestris]
Length=276

 Score =   165 bits (418),  Expect = 7e-47, Method: Compositional matrix adjust.
 Identities = 103/124 (83%), Positives = 108/124 (87%), Gaps = 6/124 (5%)
 Frame = +1

Query  139  MEDGELEFSNQEMLSSSNFCEFPDSNSYMDSFLNEILKDTHACTHAHTCNPPGPDNSHTH  318
            M DGELEFSNQEMLSSSNF EF   +S MDSF NEILKDTHACTHAHTCNPPGPDNSHTH
Sbjct  2    MADGELEFSNQEMLSSSNFGEF---SSSMDSFFNEILKDTHACTHAHTCNPPGPDNSHTH  58

Query  319  TCYHVHTKIVPAPSE--EDKAPSDDTAESVDKKEKKRPLGNreavrkyrekkkaraaLLE  492
            TCYHVHTK VP PSE  EDK PSDDTAES +KK KKRP+GN+EAVRKYREKKKARAA LE
Sbjct  59   TCYHVHTKFVP-PSEEDEDKNPSDDTAESSEKKGKKRPVGNKEAVRKYREKKKARAASLE  117

Query  493  DGVV  504
            D V+
Sbjct  118  DEVI  121



>emb|CDP14558.1| unnamed protein product [Coffea canephora]
Length=273

 Score =   163 bits (413),  Expect = 4e-46, Method: Compositional matrix adjust.
 Identities = 100/122 (82%), Positives = 107/122 (88%), Gaps = 2/122 (2%)
 Frame = +1

Query  139  MEDGELEFSNQEMLSSSNFCEFPDSNSYMDSFLNEILKDTHACTHAHTCNPPGPDNSHTH  318
            M+DGELEFSN EM S+S+F + P S S M SFL+EILKDTHACTH HTCNPPGPDNSHTH
Sbjct  1    MDDGELEFSNHEMFSNSSFGDLPSSCS-MGSFLDEILKDTHACTHTHTCNPPGPDNSHTH  59

Query  319  TCYHVHTKIVPAPSEEDKAPSDDTAESVDKKEKKRPLGNreavrkyrekkkaraaLLEDG  498
            TCYHVHTKIVPAPS EDK P+DDTAES +KK KKRPLGNREAVRKYREKKKARAA LED 
Sbjct  60   TCYHVHTKIVPAPS-EDKTPTDDTAESTEKKSKKRPLGNREAVRKYREKKKARAASLEDE  118

Query  499  VV  504
            VV
Sbjct  119  VV  120



>ref|XP_006359698.1| PREDICTED: uncharacterized protein LOC102599645 [Solanum tuberosum]
Length=272

 Score =   160 bits (404),  Expect = 6e-45, Method: Compositional matrix adjust.
 Identities = 97/122 (80%), Positives = 104/122 (85%), Gaps = 4/122 (3%)
 Frame = +1

Query  139  MEDGELEFSNQEMLSSSNFCEFPDSNSYMDSFLNEILKDTHACTHAHTCNPPGPDNSHTH  318
            M DGEL+ SNQEMLSSSNF EF  S   MDSF NEILKD HACTHAHTCNPPGPDNSHTH
Sbjct  1    MADGELDISNQEMLSSSNFGEFSSS---MDSFFNEILKDAHACTHAHTCNPPGPDNSHTH  57

Query  319  TCYHVHTKIVPAPSEEDKAPSDDTAESVDKKEKKRPLGNreavrkyrekkkaraaLLEDG  498
            TCYHVHTKIVP  +++DK PSDDTAES D K KKRP+GN+EAVRKYREKKKARAA LED 
Sbjct  58   TCYHVHTKIVPT-TDDDKNPSDDTAESADNKGKKRPVGNKEAVRKYREKKKARAASLEDE  116

Query  499  VV  504
            V+
Sbjct  117  VI  118



>ref|XP_004231042.1| PREDICTED: uncharacterized protein LOC101266077 [Solanum lycopersicum]
Length=270

 Score =   157 bits (397),  Expect = 8e-44, Method: Compositional matrix adjust.
 Identities = 96/122 (79%), Positives = 103/122 (84%), Gaps = 4/122 (3%)
 Frame = +1

Query  139  MEDGELEFSNQEMLSSSNFCEFPDSNSYMDSFLNEILKDTHACTHAHTCNPPGPDNSHTH  318
            M DGEL+ S QEMLSSSNF EF  S   MDSF NEILKD HACTHAHTCNPPGPDNSHTH
Sbjct  1    MADGELDISTQEMLSSSNFGEFSSS---MDSFFNEILKDAHACTHAHTCNPPGPDNSHTH  57

Query  319  TCYHVHTKIVPAPSEEDKAPSDDTAESVDKKEKKRPLGNreavrkyrekkkaraaLLEDG  498
            TCYHVHTKIVP  +++DK PSDDTAES + K KKRP+GN+EAVRKYREKKKARAA LED 
Sbjct  58   TCYHVHTKIVPT-TDDDKNPSDDTAESAENKGKKRPVGNKEAVRKYREKKKARAASLEDE  116

Query  499  VV  504
            VV
Sbjct  117  VV  118



>ref|XP_004505820.1| PREDICTED: uncharacterized protein LOC101509009 [Cicer arietinum]
Length=269

 Score =   152 bits (383),  Expect = 8e-42, Method: Compositional matrix adjust.
 Identities = 92/122 (75%), Positives = 104/122 (85%), Gaps = 2/122 (2%)
 Frame = +1

Query  139  MEDGELEFSNQEMLSSSNFCEFPDSNSYMDSFLNEILKDTHACTHAHTCNPPGPDNSHTH  318
            MEDGEL+FSN E+ SS N  EFP S S MDSF +E+LKD+HACTH HTCNPPGPD+SHTH
Sbjct  1    MEDGELDFSNHEVFSSPNMGEFPSSGS-MDSFFDELLKDSHACTHTHTCNPPGPDSSHTH  59

Query  319  TCYHVHTKIVPAPSEEDKAPSDDTAESVDKKEKKRPLGNreavrkyrekkkaraaLLEDG  498
            TCYHVHTKIVPAP EED+  +DDTAES +KK KKRP GN+EAVRKYREKKKARAA LE+ 
Sbjct  60   TCYHVHTKIVPAP-EEDQIGTDDTAESAEKKSKKRPTGNKEAVRKYREKKKARAASLEEE  118

Query  499  VV  504
            V+
Sbjct  119  VM  120



>ref|XP_007131714.1| hypothetical protein PHAVU_011G035700g [Phaseolus vulgaris]
 ref|XP_007131715.1| hypothetical protein PHAVU_011G035700g [Phaseolus vulgaris]
 gb|ESW03708.1| hypothetical protein PHAVU_011G035700g [Phaseolus vulgaris]
 gb|ESW03709.1| hypothetical protein PHAVU_011G035700g [Phaseolus vulgaris]
Length=265

 Score =   151 bits (382),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 92/122 (75%), Positives = 102/122 (84%), Gaps = 2/122 (2%)
 Frame = +1

Query  139  MEDGELEFSNQEMLSSSNFCEFPDSNSYMDSFLNEILKDTHACTHAHTCNPPGPDNSHTH  318
            M+DGEL+FS  E+ SS N  E P S S MDSF +E+LKDTHACTH HTCNPPGPD SHTH
Sbjct  1    MDDGELDFSTHEVFSSPNMGELPSSGS-MDSFFDELLKDTHACTHTHTCNPPGPDFSHTH  59

Query  319  TCYHVHTKIVPAPSEEDKAPSDDTAESVDKKEKKRPLGNreavrkyrekkkaraaLLEDG  498
            TCYHVHTKIVPAP+ ED+  +DDTAES +KK KKRPLGN+EAVRKYREKKKARAA LED 
Sbjct  60   TCYHVHTKIVPAPA-EDQVATDDTAESAEKKSKKRPLGNKEAVRKYREKKKARAASLEDE  118

Query  499  VV  504
            VV
Sbjct  119  VV  120



>ref|XP_004147043.1| PREDICTED: uncharacterized protein LOC101219501 [Cucumis sativus]
 ref|XP_004158374.1| PREDICTED: uncharacterized LOC101219501 [Cucumis sativus]
 gb|KGN61936.1| hypothetical protein Csa_2G270780 [Cucumis sativus]
Length=273

 Score =   151 bits (382),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 97/122 (80%), Positives = 104/122 (85%), Gaps = 2/122 (2%)
 Frame = +1

Query  139  MEDGELEFSNQEMLSSSNFCEFPDSNSYMDSFLNEILKDTHACTHAHTCNPPGPDNSHTH  318
            MEDGELE SN E+ SSSN  E P S S MDSF +EILKDTHACTHAHTCNPPGPD SHTH
Sbjct  1    MEDGELESSNPEVFSSSNAIELPSSCS-MDSFFDEILKDTHACTHAHTCNPPGPDYSHTH  59

Query  319  TCYHVHTKIVPAPSEEDKAPSDDTAESVDKKEKKRPLGNreavrkyrekkkaraaLLEDG  498
            TC+HVHTKIV +P+EE K  +DDTA+SVDKK KKRPLGNREAVRKYREKKKARAA LED 
Sbjct  60   TCFHVHTKIVSSPTEE-KVSTDDTADSVDKKNKKRPLGNREAVRKYREKKKARAASLEDE  118

Query  499  VV  504
            VV
Sbjct  119  VV  120



>ref|XP_002278836.1| PREDICTED: uncharacterized protein LOC100243471 [Vitis vinifera]
Length=273

 Score =   150 bits (380),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 93/122 (76%), Positives = 105/122 (86%), Gaps = 2/122 (2%)
 Frame = +1

Query  139  MEDGELEFSNQEMLSSSNFCEFPDSNSYMDSFLNEILKDTHACTHAHTCNPPGPDNSHTH  318
            M+DGEL+FSNQ++ SS N  + P S S MDSF +EILKDTHACTH HTCNPPGPD SHTH
Sbjct  3    MDDGELDFSNQDVFSSPNMADLPSSCS-MDSFFDEILKDTHACTHTHTCNPPGPDFSHTH  61

Query  319  TCYHVHTKIVPAPSEEDKAPSDDTAESVDKKEKKRPLGNreavrkyrekkkaraaLLEDG  498
            TC+HVHTKIVPAP+E++ A +DDTAES +KK KKRPLGNREAVRKYREKKKARAA LED 
Sbjct  62   TCFHVHTKIVPAPAEDNIA-TDDTAESAEKKSKKRPLGNREAVRKYREKKKARAASLEDE  120

Query  499  VV  504
            VV
Sbjct  121  VV  122



>ref|XP_010265995.1| PREDICTED: uncharacterized protein LOC104603629 [Nelumbo nucifera]
Length=280

 Score =   150 bits (380),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 92/122 (75%), Positives = 103/122 (84%), Gaps = 1/122 (1%)
 Frame = +1

Query  139  MEDGELEFSNQEMLSSSNFCEFPDSNSYMDSFLNEILKDTHACTHAHTCNPPGPDNSHTH  318
            M+DGEL+FSNQEM SS N  + P S+  MDSF +E+L DTHACTH HTCNPPGPD +HTH
Sbjct  1    MDDGELDFSNQEMFSSPNMGDQPPSSCSMDSFFDELLNDTHACTHTHTCNPPGPDFTHTH  60

Query  319  TCYHVHTKIVPAPSEEDKAPSDDTAESVDKKEKKRPLGNreavrkyrekkkaraaLLEDG  498
            TC+HVHTKI+ APS EDK  +DDTAESV+KK KKRPLGNREAVRKYREKKKARAA LED 
Sbjct  61   TCFHVHTKILSAPS-EDKIATDDTAESVEKKAKKRPLGNREAVRKYREKKKARAASLEDE  119

Query  499  VV  504
            VV
Sbjct  120  VV  121



>emb|CAN73631.1| hypothetical protein VITISV_026643 [Vitis vinifera]
Length=264

 Score =   150 bits (379),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 93/122 (76%), Positives = 105/122 (86%), Gaps = 2/122 (2%)
 Frame = +1

Query  139  MEDGELEFSNQEMLSSSNFCEFPDSNSYMDSFLNEILKDTHACTHAHTCNPPGPDNSHTH  318
            M+DGEL+FSNQ++ SS N  + P S S MDSF +EILKDTHACTH HTCNPPGPD SHTH
Sbjct  1    MDDGELDFSNQDVFSSPNMADLPSSCS-MDSFFDEILKDTHACTHTHTCNPPGPDFSHTH  59

Query  319  TCYHVHTKIVPAPSEEDKAPSDDTAESVDKKEKKRPLGNreavrkyrekkkaraaLLEDG  498
            TC+HVHTKIVPAP+E++ A +DDTAES +KK KKRPLGNREAVRKYREKKKARAA LED 
Sbjct  60   TCFHVHTKIVPAPAEDNIA-TDDTAESAEKKSKKRPLGNREAVRKYREKKKARAASLEDE  118

Query  499  VV  504
            VV
Sbjct  119  VV  120



>ref|XP_010107666.1| hypothetical protein L484_008383 [Morus notabilis]
 gb|EXC16577.1| hypothetical protein L484_008383 [Morus notabilis]
Length=262

 Score =   148 bits (373),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 96/123 (78%), Positives = 104/123 (85%), Gaps = 3/123 (2%)
 Frame = +1

Query  139  MEDGELEFSNQEMLSSSNFC-EFPDSNSYMDSFLNEILKDTHACTHAHTCNPPGPDNSHT  315
            M+DGE++FSNQE+ SS N   E P S S MDSF +E+LKDTHACTH HTCNPPGPD SHT
Sbjct  1    MDDGEVDFSNQEVFSSPNIGGELPSSCS-MDSFFDELLKDTHACTHTHTCNPPGPDFSHT  59

Query  316  HTCYHVHTKIVPAPSEEDKAPSDDTAESVDKKEKKRPLGNreavrkyrekkkaraaLLED  495
            HTC+HVHTKIVPA S EDKA SDDTAES +KK KKRPLGNREAVRKYREKKKARAA LED
Sbjct  60   HTCFHVHTKIVPA-SGEDKAASDDTAESTEKKSKKRPLGNREAVRKYREKKKARAASLED  118

Query  496  GVV  504
             VV
Sbjct  119  EVV  121



>ref|XP_008457698.1| PREDICTED: uncharacterized protein LOC103497333 isoform X2 [Cucumis 
melo]
 ref|XP_008457699.1| PREDICTED: uncharacterized protein LOC103497333 isoform X2 [Cucumis 
melo]
Length=272

 Score =   147 bits (372),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 95/122 (78%), Positives = 102/122 (84%), Gaps = 2/122 (2%)
 Frame = +1

Query  139  MEDGELEFSNQEMLSSSNFCEFPDSNSYMDSFLNEILKDTHACTHAHTCNPPGPDNSHTH  318
            MEDGELE SN E+ S SN  E P S S MDSF +EILKDTHACTHAHTCNPPGPD SHTH
Sbjct  1    MEDGELESSNPEVFSGSNAVELPSSCS-MDSFFDEILKDTHACTHAHTCNPPGPDYSHTH  59

Query  319  TCYHVHTKIVPAPSEEDKAPSDDTAESVDKKEKKRPLGNreavrkyrekkkaraaLLEDG  498
            TC+HVHTKIV +P+EE K  +DDT +SVDKK KKRPLGNREAVRKYREKKKARAA LED 
Sbjct  60   TCFHVHTKIVSSPTEE-KLSTDDTEDSVDKKNKKRPLGNREAVRKYREKKKARAASLEDE  118

Query  499  VV  504
            VV
Sbjct  119  VV  120



>ref|XP_008457697.1| PREDICTED: uncharacterized protein LOC103497333 isoform X1 [Cucumis 
melo]
Length=273

 Score =   147 bits (372),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 95/122 (78%), Positives = 102/122 (84%), Gaps = 2/122 (2%)
 Frame = +1

Query  139  MEDGELEFSNQEMLSSSNFCEFPDSNSYMDSFLNEILKDTHACTHAHTCNPPGPDNSHTH  318
            MEDGELE SN E+ S SN  E P S S MDSF +EILKDTHACTHAHTCNPPGPD SHTH
Sbjct  1    MEDGELESSNPEVFSGSNAVELPSSCS-MDSFFDEILKDTHACTHAHTCNPPGPDYSHTH  59

Query  319  TCYHVHTKIVPAPSEEDKAPSDDTAESVDKKEKKRPLGNreavrkyrekkkaraaLLEDG  498
            TC+HVHTKIV +P+EE K  +DDT +SVDKK KKRPLGNREAVRKYREKKKARAA LED 
Sbjct  60   TCFHVHTKIVSSPTEE-KLSTDDTEDSVDKKNKKRPLGNREAVRKYREKKKARAASLEDE  118

Query  499  VV  504
            VV
Sbjct  119  VV  120



>gb|KDO68071.1| hypothetical protein CISIN_1g024365mg [Citrus sinensis]
Length=262

 Score =   147 bits (370),  Expect = 5e-40, Method: Compositional matrix adjust.
 Identities = 91/122 (75%), Positives = 103/122 (84%), Gaps = 4/122 (3%)
 Frame = +1

Query  139  MEDGELEFSNQEMLSSSNFCEFPDSNSYMDSFLNEILKDTHACTHAHTCNPPGPDNSHTH  318
            M+DGE++FSNQEMLS+ N  +FP  +  MDSF  +ILKDTHACTH HTCNPPGPD+SHTH
Sbjct  1    MDDGEVDFSNQEMLSA-NIGDFPSCS--MDSFFEDILKDTHACTHTHTCNPPGPDSSHTH  57

Query  319  TCYHVHTKIVPAPSEEDKAPSDDTAESVDKKEKKRPLGNreavrkyrekkkaraaLLEDG  498
            TC+HVHTKIV AP+ EDK  +DDTAES +KK KKRPLGNREAVRKYREKKKAR A LED 
Sbjct  58   TCFHVHTKIV-APTSEDKVSTDDTAESTEKKTKKRPLGNREAVRKYREKKKARTASLEDE  116

Query  499  VV  504
            VV
Sbjct  117  VV  118



>ref|XP_006422593.1| hypothetical protein CICLE_v10028931mg [Citrus clementina]
 ref|XP_006422594.1| hypothetical protein CICLE_v10028931mg [Citrus clementina]
 ref|XP_006422595.1| hypothetical protein CICLE_v10028931mg [Citrus clementina]
 ref|XP_006422596.1| hypothetical protein CICLE_v10028931mg [Citrus clementina]
 ref|XP_006422597.1| hypothetical protein CICLE_v10028931mg [Citrus clementina]
 ref|XP_006422598.1| hypothetical protein CICLE_v10028931mg [Citrus clementina]
 ref|XP_006422599.1| hypothetical protein CICLE_v10028931mg [Citrus clementina]
 ref|XP_006422600.1| hypothetical protein CICLE_v10028931mg [Citrus clementina]
 ref|XP_006486739.1| PREDICTED: uncharacterized protein LOC102628933 isoform X1 [Citrus 
sinensis]
 ref|XP_006486740.1| PREDICTED: uncharacterized protein LOC102628933 isoform X2 [Citrus 
sinensis]
 ref|XP_006486741.1| PREDICTED: uncharacterized protein LOC102628933 isoform X3 [Citrus 
sinensis]
 gb|ESR35833.1| hypothetical protein CICLE_v10028931mg [Citrus clementina]
 gb|ESR35834.1| hypothetical protein CICLE_v10028931mg [Citrus clementina]
 gb|ESR35835.1| hypothetical protein CICLE_v10028931mg [Citrus clementina]
 gb|ESR35836.1| hypothetical protein CICLE_v10028931mg [Citrus clementina]
 gb|ESR35837.1| hypothetical protein CICLE_v10028931mg [Citrus clementina]
 gb|ESR35838.1| hypothetical protein CICLE_v10028931mg [Citrus clementina]
 gb|ESR35839.1| hypothetical protein CICLE_v10028931mg [Citrus clementina]
 gb|ESR35840.1| hypothetical protein CICLE_v10028931mg [Citrus clementina]
 gb|KDO68066.1| hypothetical protein CISIN_1g024365mg [Citrus sinensis]
 gb|KDO68067.1| hypothetical protein CISIN_1g024365mg [Citrus sinensis]
 gb|KDO68068.1| hypothetical protein CISIN_1g024365mg [Citrus sinensis]
 gb|KDO68069.1| hypothetical protein CISIN_1g024365mg [Citrus sinensis]
 gb|KDO68070.1| hypothetical protein CISIN_1g024365mg [Citrus sinensis]
Length=268

 Score =   147 bits (371),  Expect = 6e-40, Method: Compositional matrix adjust.
 Identities = 91/122 (75%), Positives = 103/122 (84%), Gaps = 4/122 (3%)
 Frame = +1

Query  139  MEDGELEFSNQEMLSSSNFCEFPDSNSYMDSFLNEILKDTHACTHAHTCNPPGPDNSHTH  318
            M+DGE++FSNQEMLS+ N  +FP  +  MDSF  +ILKDTHACTH HTCNPPGPD+SHTH
Sbjct  1    MDDGEVDFSNQEMLSA-NIGDFPSCS--MDSFFEDILKDTHACTHTHTCNPPGPDSSHTH  57

Query  319  TCYHVHTKIVPAPSEEDKAPSDDTAESVDKKEKKRPLGNreavrkyrekkkaraaLLEDG  498
            TC+HVHTKIV AP+ EDK  +DDTAES +KK KKRPLGNREAVRKYREKKKAR A LED 
Sbjct  58   TCFHVHTKIV-APTSEDKVSTDDTAESTEKKTKKRPLGNREAVRKYREKKKARTASLEDE  116

Query  499  VV  504
            VV
Sbjct  117  VV  118



>ref|XP_002534148.1| DNA binding protein, putative [Ricinus communis]
 gb|EEF28231.1| DNA binding protein, putative [Ricinus communis]
Length=284

 Score =   147 bits (371),  Expect = 6e-40, Method: Compositional matrix adjust.
 Identities = 91/122 (75%), Positives = 103/122 (84%), Gaps = 2/122 (2%)
 Frame = +1

Query  139  MEDGELEFSNQEMLSSSNFCEFPDSNSYMDSFLNEILKDTHACTHAHTCNPPGPDNSHTH  318
            M+DGEL+FS+QE+ S +N  E P+ N  MDSF +E+LKDTHACTH HTCNPPGPD SHTH
Sbjct  1    MDDGELDFSHQEVFSGTNMGEMPN-NCSMDSFFDELLKDTHACTHTHTCNPPGPDYSHTH  59

Query  319  TCYHVHTKIVPAPSEEDKAPSDDTAESVDKKEKKRPLGNreavrkyrekkkaraaLLEDG  498
            TC+HVHTKIV APS +DK  +DDTAES +KK KKRPLGNREAVRKYREKKKARAA LED 
Sbjct  60   TCFHVHTKIVSAPS-DDKTGTDDTAESTEKKSKKRPLGNREAVRKYREKKKARAASLEDE  118

Query  499  VV  504
            VV
Sbjct  119  VV  120



>ref|XP_010266832.1| PREDICTED: uncharacterized protein LOC104604256 [Nelumbo nucifera]
Length=273

 Score =   147 bits (370),  Expect = 7e-40, Method: Compositional matrix adjust.
 Identities = 89/122 (73%), Positives = 103/122 (84%), Gaps = 1/122 (1%)
 Frame = +1

Query  139  MEDGELEFSNQEMLSSSNFCEFPDSNSYMDSFLNEILKDTHACTHAHTCNPPGPDNSHTH  318
            M+DGEL+FSNQE+ SS+N  +   S+  MD F +E+LKD  ACTH HTCNPPGPD++HTH
Sbjct  1    MDDGELDFSNQEVFSSANLGDQLPSSCSMDEFFDELLKDAQACTHTHTCNPPGPDSTHTH  60

Query  319  TCYHVHTKIVPAPSEEDKAPSDDTAESVDKKEKKRPLGNreavrkyrekkkaraaLLEDG  498
            TC+HVHTKI+PAPS EDKA +DDT ESV+KK KKRPLGNREAVRKYREKKKARAA LED 
Sbjct  61   TCFHVHTKILPAPS-EDKAATDDTEESVEKKAKKRPLGNREAVRKYREKKKARAASLEDE  119

Query  499  VV  504
            VV
Sbjct  120  VV  121



>ref|XP_007041832.1| Basic-leucine zipper (bZIP) transcription factor family protein 
isoform 7, partial [Theobroma cacao]
 gb|EOX97663.1| Basic-leucine zipper (bZIP) transcription factor family protein 
isoform 7, partial [Theobroma cacao]
Length=202

 Score =   145 bits (365),  Expect = 7e-40, Method: Compositional matrix adjust.
 Identities = 91/122 (75%), Positives = 101/122 (83%), Gaps = 3/122 (2%)
 Frame = +1

Query  139  MEDGELEFSNQEMLSSSNFCEFPDSNSYMDSFLNEILKDTHACTHAHTCNPPGPDNSHTH  318
            M+DGEL+F NQE+ S  N  + P S S MDSF +E+L D+HACTH HTCNPPGPDNSHTH
Sbjct  1    MDDGELDFLNQEVFSG-NMADIPSSCS-MDSFFDELLNDSHACTHTHTCNPPGPDNSHTH  58

Query  319  TCYHVHTKIVPAPSEEDKAPSDDTAESVDKKEKKRPLGNreavrkyrekkkaraaLLEDG  498
            TC+HVHTKIVPAP+ EDKA  DDTAES +KK KKRPLGNREAVRKYREK KARAA LED 
Sbjct  59   TCFHVHTKIVPAPT-EDKAAIDDTAESREKKSKKRPLGNREAVRKYREKVKARAASLEDE  117

Query  499  VV  504
            VV
Sbjct  118  VV  119



>ref|XP_006422601.1| hypothetical protein CICLE_v10028931mg [Citrus clementina]
 gb|ESR35841.1| hypothetical protein CICLE_v10028931mg [Citrus clementina]
Length=302

 Score =   147 bits (371),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 91/122 (75%), Positives = 103/122 (84%), Gaps = 4/122 (3%)
 Frame = +1

Query  139  MEDGELEFSNQEMLSSSNFCEFPDSNSYMDSFLNEILKDTHACTHAHTCNPPGPDNSHTH  318
            M+DGE++FSNQEMLS+ N  +FP  +  MDSF  +ILKDTHACTH HTCNPPGPD+SHTH
Sbjct  1    MDDGEVDFSNQEMLSA-NIGDFPSCS--MDSFFEDILKDTHACTHTHTCNPPGPDSSHTH  57

Query  319  TCYHVHTKIVPAPSEEDKAPSDDTAESVDKKEKKRPLGNreavrkyrekkkaraaLLEDG  498
            TC+HVHTKIV AP+ EDK  +DDTAES +KK KKRPLGNREAVRKYREKKKAR A LED 
Sbjct  58   TCFHVHTKIV-APTSEDKVSTDDTAESTEKKTKKRPLGNREAVRKYREKKKARTASLEDE  116

Query  499  VV  504
            VV
Sbjct  117  VV  118



>ref|XP_007041826.1| Basic-leucine zipper transcription factor family protein isoform 
1 [Theobroma cacao]
 ref|XP_007041829.1| Basic-leucine zipper transcription factor family protein isoform 
1 [Theobroma cacao]
 ref|XP_007041830.1| Basic-leucine zipper transcription factor family protein isoform 
1 [Theobroma cacao]
 ref|XP_007041831.1| Basic-leucine zipper transcription factor family protein isoform 
1 [Theobroma cacao]
 gb|EOX97657.1| Basic-leucine zipper transcription factor family protein isoform 
1 [Theobroma cacao]
 gb|EOX97660.1| Basic-leucine zipper transcription factor family protein isoform 
1 [Theobroma cacao]
 gb|EOX97661.1| Basic-leucine zipper transcription factor family protein isoform 
1 [Theobroma cacao]
 gb|EOX97662.1| Basic-leucine zipper transcription factor family protein isoform 
1 [Theobroma cacao]
Length=266

 Score =   145 bits (367),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 91/122 (75%), Positives = 101/122 (83%), Gaps = 3/122 (2%)
 Frame = +1

Query  139  MEDGELEFSNQEMLSSSNFCEFPDSNSYMDSFLNEILKDTHACTHAHTCNPPGPDNSHTH  318
            M+DGEL+F NQE+ S  N  + P S S MDSF +E+L D+HACTH HTCNPPGPDNSHTH
Sbjct  1    MDDGELDFLNQEVFSG-NMADIPSSCS-MDSFFDELLNDSHACTHTHTCNPPGPDNSHTH  58

Query  319  TCYHVHTKIVPAPSEEDKAPSDDTAESVDKKEKKRPLGNreavrkyrekkkaraaLLEDG  498
            TC+HVHTKIVPAP+ EDKA  DDTAES +KK KKRPLGNREAVRKYREK KARAA LED 
Sbjct  59   TCFHVHTKIVPAPT-EDKAAIDDTAESREKKSKKRPLGNREAVRKYREKVKARAASLEDE  117

Query  499  VV  504
            VV
Sbjct  118  VV  119



>ref|XP_007041828.1| Basic-leucine zipper transcription factor family protein isoform 
3 [Theobroma cacao]
 gb|EOX97659.1| Basic-leucine zipper transcription factor family protein isoform 
3 [Theobroma cacao]
Length=281

 Score =   145 bits (367),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 91/122 (75%), Positives = 101/122 (83%), Gaps = 3/122 (2%)
 Frame = +1

Query  139  MEDGELEFSNQEMLSSSNFCEFPDSNSYMDSFLNEILKDTHACTHAHTCNPPGPDNSHTH  318
            M+DGEL+F NQE+ S  N  + P S S MDSF +E+L D+HACTH HTCNPPGPDNSHTH
Sbjct  1    MDDGELDFLNQEVFSG-NMADIPSSCS-MDSFFDELLNDSHACTHTHTCNPPGPDNSHTH  58

Query  319  TCYHVHTKIVPAPSEEDKAPSDDTAESVDKKEKKRPLGNreavrkyrekkkaraaLLEDG  498
            TC+HVHTKIVPAP+ EDKA  DDTAES +KK KKRPLGNREAVRKYREK KARAA LED 
Sbjct  59   TCFHVHTKIVPAPT-EDKAAIDDTAESREKKSKKRPLGNREAVRKYREKVKARAASLEDE  117

Query  499  VV  504
            VV
Sbjct  118  VV  119



>ref|XP_010028728.1| PREDICTED: uncharacterized protein LOC104418944 [Eucalyptus grandis]
 gb|KCW55527.1| hypothetical protein EUGRSUZ_I01416 [Eucalyptus grandis]
 gb|KCW55528.1| hypothetical protein EUGRSUZ_I01416 [Eucalyptus grandis]
Length=269

 Score =   144 bits (364),  Expect = 6e-39, Method: Compositional matrix adjust.
 Identities = 93/127 (73%), Positives = 102/127 (80%), Gaps = 8/127 (6%)
 Frame = +1

Query  139  MEDGELEFSNQEML------SSSNFCEFPDSNSYMDSFLNEILKDTHACTHAHTCNPPGP  300
            M+DGEL+FSNQE+       S S   E P S S MDSFL EI +DTHACTH HTCNPPGP
Sbjct  1    MDDGELDFSNQEVFANHDVFSGSTLGEVPGSRS-MDSFLEEIFRDTHACTHTHTCNPPGP  59

Query  301  DNSHTHTCYHVHTKIVPAPSEEDKAPSDDTAESVDKKEKKRPLGNreavrkyrekkkara  480
            D+SHTHTC+HVHTKIVPA SEE K  +DDTAES++KK KKRPLGNREAVRKYREKKKARA
Sbjct  60   DSSHTHTCFHVHTKIVPATSEE-KVSTDDTAESMEKKSKKRPLGNREAVRKYREKKKARA  118

Query  481  aLLEDGV  501
            A LED V
Sbjct  119  ASLEDEV  125



>ref|XP_007041827.1| Basic-leucine zipper transcription factor family protein isoform 
2 [Theobroma cacao]
 gb|EOX97658.1| Basic-leucine zipper transcription factor family protein isoform 
2 [Theobroma cacao]
Length=310

 Score =   145 bits (366),  Expect = 6e-39, Method: Compositional matrix adjust.
 Identities = 91/122 (75%), Positives = 101/122 (83%), Gaps = 3/122 (2%)
 Frame = +1

Query  139  MEDGELEFSNQEMLSSSNFCEFPDSNSYMDSFLNEILKDTHACTHAHTCNPPGPDNSHTH  318
            M+DGEL+F NQE+ S  N  + P S S MDSF +E+L D+HACTH HTCNPPGPDNSHTH
Sbjct  1    MDDGELDFLNQEVFSG-NMADIPSSCS-MDSFFDELLNDSHACTHTHTCNPPGPDNSHTH  58

Query  319  TCYHVHTKIVPAPSEEDKAPSDDTAESVDKKEKKRPLGNreavrkyrekkkaraaLLEDG  498
            TC+HVHTKIVPAP+ EDKA  DDTAES +KK KKRPLGNREAVRKYREK KARAA LED 
Sbjct  59   TCFHVHTKIVPAPT-EDKAAIDDTAESREKKSKKRPLGNREAVRKYREKVKARAASLEDE  117

Query  499  VV  504
            VV
Sbjct  118  VV  119



>ref|XP_003607180.1| hypothetical protein MTR_4g073100 [Medicago truncatula]
 gb|ACJ84596.1| unknown [Medicago truncatula]
 gb|AES89377.1| BZIP transcription factor [Medicago truncatula]
Length=267

 Score =   144 bits (363),  Expect = 8e-39, Method: Compositional matrix adjust.
 Identities = 91/123 (74%), Positives = 103/123 (84%), Gaps = 4/123 (3%)
 Frame = +1

Query  139  MEDGELEFSNQEMLSSSNFCEFPDSNSYMDSFLNEILKDTHACTHAHTCNPPGPDNSHTH  318
            MEDGEL+FSNQ++ SS N  EF  S S MDSF +E+LKDTHACTH HTCNPPGPD SHTH
Sbjct  1    MEDGELDFSNQDVFSSPNMGEFQTSGS-MDSFFDELLKDTHACTHTHTCNPPGPDFSHTH  59

Query  319  TCYHVHTKIVPAPSEEDKAPSDDTAESVDKK-EKKRPLGNreavrkyrekkkaraaLLED  495
            TCYHVHTKIVPA  E+D+  +DDTAES +KK  KKRP+GN+EAVRKYREKKKARAA LED
Sbjct  60   TCYHVHTKIVPA--EDDQVGTDDTAESAEKKSSKKRPVGNKEAVRKYREKKKARAASLED  117

Query  496  GVV  504
             V+
Sbjct  118  EVM  120



>ref|XP_008236021.1| PREDICTED: uncharacterized protein LOC103334826 isoform X2 [Prunus 
mume]
Length=265

 Score =   144 bits (363),  Expect = 8e-39, Method: Compositional matrix adjust.
 Identities = 91/123 (74%), Positives = 99/123 (80%), Gaps = 1/123 (1%)
 Frame = +1

Query  139  MEDGELEFSNQEMLSSSNFCEFPDSNSYMDSFLNEILKDTHACTHAHTCNPPGPDNSHTH  318
            MEDGEL+FSNQEM S  N      S+  MDSF +++LKDTHACTH HTCNPPGPD SHTH
Sbjct  1    MEDGELDFSNQEMFSGPNMGGEHPSSCSMDSFFDDLLKDTHACTHTHTCNPPGPDYSHTH  60

Query  319  TCYHVHTKIV-PAPSEEDKAPSDDTAESVDKKEKKRPLGNreavrkyrekkkaraaLLED  495
            TC+HVHTKIV  A   EDKA +DDTAES +KK KKRPLGNREAVRKYREKKKARAA LED
Sbjct  61   TCFHVHTKIVSSATGSEDKAGTDDTAESGEKKSKKRPLGNREAVRKYREKKKARAASLED  120

Query  496  GVV  504
             VV
Sbjct  121  EVV  123



>ref|XP_008236016.1| PREDICTED: uncharacterized protein LOC103334826 isoform X1 [Prunus 
mume]
 ref|XP_008236017.1| PREDICTED: uncharacterized protein LOC103334826 isoform X1 [Prunus 
mume]
 ref|XP_008236018.1| PREDICTED: uncharacterized protein LOC103334826 isoform X1 [Prunus 
mume]
 ref|XP_008236020.1| PREDICTED: uncharacterized protein LOC103334826 isoform X1 [Prunus 
mume]
Length=272

 Score =   144 bits (362),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 91/123 (74%), Positives = 99/123 (80%), Gaps = 1/123 (1%)
 Frame = +1

Query  139  MEDGELEFSNQEMLSSSNFCEFPDSNSYMDSFLNEILKDTHACTHAHTCNPPGPDNSHTH  318
            MEDGEL+FSNQEM S  N      S+  MDSF +++LKDTHACTH HTCNPPGPD SHTH
Sbjct  1    MEDGELDFSNQEMFSGPNMGGEHPSSCSMDSFFDDLLKDTHACTHTHTCNPPGPDYSHTH  60

Query  319  TCYHVHTKIV-PAPSEEDKAPSDDTAESVDKKEKKRPLGNreavrkyrekkkaraaLLED  495
            TC+HVHTKIV  A   EDKA +DDTAES +KK KKRPLGNREAVRKYREKKKARAA LED
Sbjct  61   TCFHVHTKIVSSATGSEDKAGTDDTAESGEKKSKKRPLGNREAVRKYREKKKARAASLED  120

Query  496  GVV  504
             VV
Sbjct  121  EVV  123



>ref|XP_007201303.1| hypothetical protein PRUPE_ppa009913mg [Prunus persica]
 gb|EMJ02502.1| hypothetical protein PRUPE_ppa009913mg [Prunus persica]
Length=272

 Score =   144 bits (362),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 91/123 (74%), Positives = 99/123 (80%), Gaps = 1/123 (1%)
 Frame = +1

Query  139  MEDGELEFSNQEMLSSSNFCEFPDSNSYMDSFLNEILKDTHACTHAHTCNPPGPDNSHTH  318
            MEDGEL+FSNQEM S  N      S+  MDSF +++LKDTHACTH HTCNPPGPD SHTH
Sbjct  1    MEDGELDFSNQEMFSGPNMGGEHPSSCSMDSFFDDLLKDTHACTHTHTCNPPGPDYSHTH  60

Query  319  TCYHVHTKIV-PAPSEEDKAPSDDTAESVDKKEKKRPLGNreavrkyrekkkaraaLLED  495
            TC+HVHTKIV  A   EDKA +DDTAES +KK KKRPLGNREAVRKYREKKKARAA LED
Sbjct  61   TCFHVHTKIVSSATGSEDKAGTDDTAESGEKKSKKRPLGNREAVRKYREKKKARAASLED  120

Query  496  GVV  504
             VV
Sbjct  121  EVV  123



>gb|KHG28517.1| Protein FD -like protein [Gossypium arboreum]
Length=261

 Score =   143 bits (360),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 89/122 (73%), Positives = 99/122 (81%), Gaps = 2/122 (2%)
 Frame = +1

Query  139  MEDGELEFSNQEMLSSSNFCEFPDSNSYMDSFLNEILKDTHACTHAHTCNPPGPDNSHTH  318
            M+DGEL+FSNQE+ S +N  + P S S MDSF +E+L D+HACTH HTCNPPGPDNSHTH
Sbjct  1    MDDGELDFSNQEVFSGNNMGDIPSSCS-MDSFFDELLNDSHACTHTHTCNPPGPDNSHTH  59

Query  319  TCYHVHTKIVPAPSEEDKAPSDDTAESVDKKEKKRPLGNreavrkyrekkkaraaLLEDG  498
            TC+H HTKIVPA S EDKA  DDTA S + K KKRPLGNREAVRKYREK KARAA LED 
Sbjct  60   TCFHFHTKIVPA-SSEDKAAIDDTAVSGENKSKKRPLGNREAVRKYREKVKARAASLEDE  118

Query  499  VV  504
            VV
Sbjct  119  VV  120



>ref|XP_002305521.2| bZIP transcription factor family protein [Populus trichocarpa]
 gb|EEE86032.2| bZIP transcription factor family protein [Populus trichocarpa]
Length=265

 Score =   140 bits (352),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 88/121 (73%), Positives = 98/121 (81%), Gaps = 4/121 (3%)
 Frame = +1

Query  139  MEDGELEFSNQEMLSSSNFCEFPDSNSYMDSFLNEILKDTHACTHAHTCNPPGPDNSHTH  318
            M+DGEL+FSNQ++LSS N  E P S S+   FL+E+LKDTHACTH HTCNPPGPD SHTH
Sbjct  1    MDDGELDFSNQDLLSSPNIGEIPSSCSF--DFLDELLKDTHACTHTHTCNPPGPDYSHTH  58

Query  319  TCYHVHTKIVPAPSEEDKAPSDDTAESVDKKEKKRPLGNreavrkyrekkkaraaLLEDG  498
            TCYHVHTKI+P    EDK  SDDTAES DKK KKR  GNREAVRKYRE+KKA+AA LED 
Sbjct  59   TCYHVHTKILPPA--EDKVVSDDTAESTDKKSKKRSSGNREAVRKYRERKKAKAASLEDE  116

Query  499  V  501
            V
Sbjct  117  V  117



>ref|XP_006384577.1| hypothetical protein POPTR_0004s18120g [Populus trichocarpa]
 gb|ERP62374.1| hypothetical protein POPTR_0004s18120g [Populus trichocarpa]
Length=266

 Score =   140 bits (352),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 88/121 (73%), Positives = 98/121 (81%), Gaps = 4/121 (3%)
 Frame = +1

Query  139  MEDGELEFSNQEMLSSSNFCEFPDSNSYMDSFLNEILKDTHACTHAHTCNPPGPDNSHTH  318
            M+DGEL+FSNQ++LSS N  E P S S+   FL+E+LKDTHACTH HTCNPPGPD SHTH
Sbjct  1    MDDGELDFSNQDLLSSPNIGEIPSSCSF--DFLDELLKDTHACTHTHTCNPPGPDYSHTH  58

Query  319  TCYHVHTKIVPAPSEEDKAPSDDTAESVDKKEKKRPLGNreavrkyrekkkaraaLLEDG  498
            TCYHVHTKI+P    EDK  SDDTAES DKK KKR  GNREAVRKYRE+KKA+AA LED 
Sbjct  59   TCYHVHTKILPPA--EDKVVSDDTAESTDKKSKKRSSGNREAVRKYRERKKAKAASLEDE  116

Query  499  V  501
            V
Sbjct  117  V  117



>gb|KJB32659.1| hypothetical protein B456_005G254200 [Gossypium raimondii]
 gb|KJB32660.1| hypothetical protein B456_005G254200 [Gossypium raimondii]
Length=266

 Score =   139 bits (350),  Expect = 6e-37, Method: Compositional matrix adjust.
 Identities = 89/122 (73%), Positives = 100/122 (82%), Gaps = 3/122 (2%)
 Frame = +1

Query  139  MEDGELEFSNQEMLSSSNFCEFPDSNSYMDSFLNEILKDTHACTHAHTCNPPGPDNSHTH  318
            M+DGEL+FSNQE+ S +N  + P S S MDSF +E+L D+HACTH HTCNPPGPDNSHTH
Sbjct  1    MDDGELDFSNQEVFSGNNMGDIPSSCS-MDSFFDELLNDSHACTHTHTCNPPGPDNSHTH  59

Query  319  TCYHVHTKIVPAPSEEDKAPSDDTAESVDKKEKKRPLGNreavrkyrekkkaraaLLEDG  498
            TC+HVHTKIVPA S EDKA  DDTA S + K KKRPLGNREAVRKYREK KARAA LED 
Sbjct  60   TCFHVHTKIVPA-STEDKASIDDTAGSRE-KSKKRPLGNREAVRKYREKVKARAASLEDE  117

Query  499  VV  504
            V+
Sbjct  118  VM  119



>gb|KJB15817.1| hypothetical protein B456_002G197800 [Gossypium raimondii]
 gb|KJB15818.1| hypothetical protein B456_002G197800 [Gossypium raimondii]
 gb|KJB15819.1| hypothetical protein B456_002G197800 [Gossypium raimondii]
Length=257

 Score =   139 bits (349),  Expect = 7e-37, Method: Compositional matrix adjust.
 Identities = 87/122 (71%), Positives = 98/122 (80%), Gaps = 2/122 (2%)
 Frame = +1

Query  139  MEDGELEFSNQEMLSSSNFCEFPDSNSYMDSFLNEILKDTHACTHAHTCNPPGPDNSHTH  318
            M+DGEL++SNQE+ S +N  + P S S MDSF +E+L D+HACTH HTCNPPGPDNSHTH
Sbjct  1    MDDGELDYSNQEVFSVNNMGDIPSSCS-MDSFFDELLNDSHACTHTHTCNPPGPDNSHTH  59

Query  319  TCYHVHTKIVPAPSEEDKAPSDDTAESVDKKEKKRPLGNreavrkyrekkkaraaLLEDG  498
            TC+H HTKIVPA S EDKA  D TA S + K KKRPLGNREAVRKYREK KARAA LED 
Sbjct  60   TCFHFHTKIVPA-SSEDKAAIDGTAVSGENKSKKRPLGNREAVRKYREKVKARAASLEDE  118

Query  499  VV  504
            VV
Sbjct  119  VV  120



>ref|XP_010530900.1| PREDICTED: uncharacterized protein LOC104807371 [Tarenaya hassleriana]
 ref|XP_010530901.1| PREDICTED: uncharacterized protein LOC104807371 [Tarenaya hassleriana]
 ref|XP_010530902.1| PREDICTED: uncharacterized protein LOC104807371 [Tarenaya hassleriana]
 ref|XP_010530904.1| PREDICTED: uncharacterized protein LOC104807371 [Tarenaya hassleriana]
 ref|XP_010530905.1| PREDICTED: uncharacterized protein LOC104807371 [Tarenaya hassleriana]
 ref|XP_010530906.1| PREDICTED: uncharacterized protein LOC104807371 [Tarenaya hassleriana]
 ref|XP_010530907.1| PREDICTED: uncharacterized protein LOC104807371 [Tarenaya hassleriana]
 ref|XP_010530908.1| PREDICTED: uncharacterized protein LOC104807371 [Tarenaya hassleriana]
 ref|XP_010530909.1| PREDICTED: uncharacterized protein LOC104807371 [Tarenaya hassleriana]
 ref|XP_010530910.1| PREDICTED: uncharacterized protein LOC104807371 [Tarenaya hassleriana]
 ref|XP_010530911.1| PREDICTED: uncharacterized protein LOC104807371 [Tarenaya hassleriana]
 ref|XP_010530912.1| PREDICTED: uncharacterized protein LOC104807371 [Tarenaya hassleriana]
Length=270

 Score =   137 bits (344),  Expect = 5e-36, Method: Compositional matrix adjust.
 Identities = 83/122 (68%), Positives = 102/122 (84%), Gaps = 1/122 (1%)
 Frame = +1

Query  139  MEDGELEFSNQEMLSSSNFCEFPDSNSYMDSFLNEILKDTHACTHAHTCNPPGPDNSHTH  318
            M+DGEL+FSNQE+ S+SN  +   S+  MD+F +E+L+D+HACTH HTCNPPGP+++HTH
Sbjct  1    MDDGELDFSNQEVFSNSNMDDIQPSSCSMDTFFDELLRDSHACTHTHTCNPPGPESTHTH  60

Query  319  TCYHVHTKIVPAPSEEDKAPSDDTAESVDKKEKKRPLGNreavrkyrekkkaraaLLEDG  498
            TC+HVHTKI+PA SEE K  +DDTAE  +KK KKRP GNREAVRKYREKKKARAA LED 
Sbjct  61   TCFHVHTKILPAQSEE-KVSTDDTAEFSEKKNKKRPSGNREAVRKYREKKKARAASLEDE  119

Query  499  VV  504
            V+
Sbjct  120  VI  121



>ref|XP_011046685.1| PREDICTED: uncharacterized protein LOC105141220 isoform X1 [Populus 
euphratica]
 ref|XP_011046686.1| PREDICTED: uncharacterized protein LOC105141220 isoform X1 [Populus 
euphratica]
 ref|XP_011046687.1| PREDICTED: uncharacterized protein LOC105141220 isoform X1 [Populus 
euphratica]
Length=266

 Score =   137 bits (344),  Expect = 5e-36, Method: Compositional matrix adjust.
 Identities = 86/121 (71%), Positives = 98/121 (81%), Gaps = 4/121 (3%)
 Frame = +1

Query  139  MEDGELEFSNQEMLSSSNFCEFPDSNSYMDSFLNEILKDTHACTHAHTCNPPGPDNSHTH  318
            M+DGEL+FSNQ++LSS N  E P S S+   FL+E+LKD+HACTH HTCNPPGPD SHTH
Sbjct  1    MDDGELDFSNQDLLSSPNIGEIPSSCSF--DFLDELLKDSHACTHTHTCNPPGPDYSHTH  58

Query  319  TCYHVHTKIVPAPSEEDKAPSDDTAESVDKKEKKRPLGNreavrkyrekkkaraaLLEDG  498
            TCYHVHTKI+P    EDK  SDDTAES DKK KK+  GNREAVRKYRE+KKA+AA LED 
Sbjct  59   TCYHVHTKILPPA--EDKVVSDDTAESTDKKSKKQSSGNREAVRKYRERKKAKAASLEDE  116

Query  499  V  501
            V
Sbjct  117  V  117



>ref|XP_011046689.1| PREDICTED: uncharacterized protein LOC105141220 isoform X3 [Populus 
euphratica]
Length=265

 Score =   137 bits (344),  Expect = 5e-36, Method: Compositional matrix adjust.
 Identities = 86/121 (71%), Positives = 98/121 (81%), Gaps = 4/121 (3%)
 Frame = +1

Query  139  MEDGELEFSNQEMLSSSNFCEFPDSNSYMDSFLNEILKDTHACTHAHTCNPPGPDNSHTH  318
            M+DGEL+FSNQ++LSS N  E P S S+   FL+E+LKD+HACTH HTCNPPGPD SHTH
Sbjct  1    MDDGELDFSNQDLLSSPNIGEIPSSCSF--DFLDELLKDSHACTHTHTCNPPGPDYSHTH  58

Query  319  TCYHVHTKIVPAPSEEDKAPSDDTAESVDKKEKKRPLGNreavrkyrekkkaraaLLEDG  498
            TCYHVHTKI+P    EDK  SDDTAES DKK KK+  GNREAVRKYRE+KKA+AA LED 
Sbjct  59   TCYHVHTKILPPA--EDKVVSDDTAESTDKKSKKQSSGNREAVRKYRERKKAKAASLEDE  116

Query  499  V  501
            V
Sbjct  117  V  117



>ref|XP_011046688.1| PREDICTED: uncharacterized protein LOC105141220 isoform X2 [Populus 
euphratica]
 ref|XP_011046690.1| PREDICTED: uncharacterized protein LOC105141220 isoform X2 [Populus 
euphratica]
Length=265

 Score =   136 bits (343),  Expect = 6e-36, Method: Compositional matrix adjust.
 Identities = 86/121 (71%), Positives = 98/121 (81%), Gaps = 4/121 (3%)
 Frame = +1

Query  139  MEDGELEFSNQEMLSSSNFCEFPDSNSYMDSFLNEILKDTHACTHAHTCNPPGPDNSHTH  318
            M+DGEL+FSNQ++LSS N  E P S S+   FL+E+LKD+HACTH HTCNPPGPD SHTH
Sbjct  1    MDDGELDFSNQDLLSSPNIGEIPSSCSF--DFLDELLKDSHACTHTHTCNPPGPDYSHTH  58

Query  319  TCYHVHTKIVPAPSEEDKAPSDDTAESVDKKEKKRPLGNreavrkyrekkkaraaLLEDG  498
            TCYHVHTKI+P    EDK  SDDTAES DKK KK+  GNREAVRKYRE+KKA+AA LED 
Sbjct  59   TCYHVHTKILPPA--EDKVVSDDTAESTDKKSKKQSSGNREAVRKYRERKKAKAASLEDE  116

Query  499  V  501
            V
Sbjct  117  V  117



>gb|KDP29660.1| hypothetical protein JCGZ_18822 [Jatropha curcas]
Length=284

 Score =   137 bits (344),  Expect = 6e-36, Method: Compositional matrix adjust.
 Identities = 85/122 (70%), Positives = 99/122 (81%), Gaps = 2/122 (2%)
 Frame = +1

Query  139  MEDGELEFSNQEMLSSSNFCEFPDSNSYMDSFLNEILKDTHACTHAHTCNPPGPDNSHTH  318
            M+DGE++FS QE+ S++N  +    N  MD+F  E+ KD+HACTH HTCNPPGPD SHTH
Sbjct  1    MDDGEVDFSQQEVFSNTNIGDI-QPNCSMDNFFEELFKDSHACTHTHTCNPPGPDFSHTH  59

Query  319  TCYHVHTKIVPAPSEEDKAPSDDTAESVDKKEKKRPLGNreavrkyrekkkaraaLLEDG  498
            TC+HVHTKIV APS +DK  +DDTAES +KK KKRPLGNREAVRKYREKKKARAA LED 
Sbjct  60   TCFHVHTKIVSAPS-DDKTATDDTAESTEKKSKKRPLGNREAVRKYREKKKARAASLEDE  118

Query  499  VV  504
            VV
Sbjct  119  VV  120



>gb|KJB12146.1| hypothetical protein B456_002G003000 [Gossypium raimondii]
 gb|KJB12147.1| hypothetical protein B456_002G003000 [Gossypium raimondii]
Length=265

 Score =   135 bits (341),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 87/123 (71%), Positives = 98/123 (80%), Gaps = 3/123 (2%)
 Frame = +1

Query  139  MEDGELEFSNQEMLSSSN-FCEFPDSNSYMDSFLNEILKDTHACTHAHTCNPPGPDNSHT  315
            M++GEL+FSN E+ S  N   + P S S MDSF NEIL D+HACTH HTCNPPGPDNSHT
Sbjct  1    MDEGELDFSNHEVFSGGNSMGDIPSSCS-MDSFFNEILNDSHACTHTHTCNPPGPDNSHT  59

Query  316  HTCYHVHTKIVPAPSEEDKAPSDDTAESVDKKEKKRPLGNreavrkyrekkkaraaLLED  495
            HTC+HVHTKIVPA S ED+A +DDT  S +KK KKR LGNREAVRKYR+K KARAA LED
Sbjct  60   HTCFHVHTKIVPA-STEDEAAADDTEGSREKKPKKRSLGNREAVRKYRQKVKARAASLED  118

Query  496  GVV  504
             VV
Sbjct  119  EVV  121



>gb|KJB12148.1| hypothetical protein B456_002G003000 [Gossypium raimondii]
Length=269

 Score =   135 bits (341),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 87/123 (71%), Positives = 98/123 (80%), Gaps = 3/123 (2%)
 Frame = +1

Query  139  MEDGELEFSNQEMLSSSN-FCEFPDSNSYMDSFLNEILKDTHACTHAHTCNPPGPDNSHT  315
            M++GEL+FSN E+ S  N   + P S S MDSF NEIL D+HACTH HTCNPPGPDNSHT
Sbjct  1    MDEGELDFSNHEVFSGGNSMGDIPSSCS-MDSFFNEILNDSHACTHTHTCNPPGPDNSHT  59

Query  316  HTCYHVHTKIVPAPSEEDKAPSDDTAESVDKKEKKRPLGNreavrkyrekkkaraaLLED  495
            HTC+HVHTKIVPA S ED+A +DDT  S +KK KKR LGNREAVRKYR+K KARAA LED
Sbjct  60   HTCFHVHTKIVPA-STEDEAAADDTEGSREKKPKKRSLGNREAVRKYRQKVKARAASLED  118

Query  496  GVV  504
             VV
Sbjct  119  EVV  121



>ref|XP_010690366.1| PREDICTED: uncharacterized protein LOC104903923 [Beta vulgaris 
subsp. vulgaris]
Length=290

 Score =   136 bits (342),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 67/96 (70%), Positives = 80/96 (83%), Gaps = 2/96 (2%)
 Frame = +1

Query  139  MEDGELEFSNQEMLSSSNFCEFPDSNSYMDSFLNEILKDTHACTHAHTCNPPGPDNSHTH  318
            M+DGELEFSNQE+LSS+N  + P S S MDSF +E+LKDTHACTH HTCNPPGPD  HTH
Sbjct  23   MDDGELEFSNQELLSSANIGDVPSSGS-MDSFFDELLKDTHACTHTHTCNPPGPDLHHTH  81

Query  319  TCYHVHTKIVPAPSEEDKAP-SDDTAESVDKKEKKR  423
            TC+HVHTKI+P PSEE+K+  +DD+AES + K KKR
Sbjct  82   TCFHVHTKILPPPSEEEKSGNNDDSAESEELKSKKR  117



>ref|XP_006409392.1| hypothetical protein EUTSA_v10022810mg [Eutrema salsugineum]
 gb|ESQ50845.1| hypothetical protein EUTSA_v10022810mg [Eutrema salsugineum]
Length=263

 Score =   135 bits (340),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 89/122 (73%), Positives = 102/122 (84%), Gaps = 1/122 (1%)
 Frame = +1

Query  139  MEDGELEFSNQEMLSSSNFCEFPDSNSYMDSFLNEILKDTHACTHAHTCNPPGPDNSHTH  318
            M+DGELEFSNQE LS+    EFP SN  MDSF +E+L D+HACTH HTCNPPGP+N+HTH
Sbjct  1    MDDGELEFSNQEALSNPKMPEFPPSNCSMDSFFDELLNDSHACTHTHTCNPPGPENTHTH  60

Query  319  TCYHVHTKIVPAPSEEDKAPSDDTAESVDKKEKKRPLGNreavrkyrekkkaraaLLEDG  498
            TC HVHTKI+PA S +DKA +DDT+ES  KK KKRPLGNREAVRKYREKKKA+AA LED 
Sbjct  61   TCLHVHTKILPAQS-DDKASTDDTSESSGKKSKKRPLGNREAVRKYREKKKAKAASLEDE  119

Query  499  VV  504
            V+
Sbjct  120  VI  121



>gb|AFP19453.1| bZIP transcription factor family protein 2 [Camellia sinensis]
Length=270

 Score =   135 bits (339),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 88/122 (72%), Positives = 99/122 (81%), Gaps = 4/122 (3%)
 Frame = +1

Query  139  MEDGELEFSNQEMLSSSNFCEFPDSNSYMDSFLNEILKDTHACTHAHTCNPPGPDNSHTH  318
            M+DGE++FSNQ++ SS N  E P S S MDSF +E+LKDT  CTH HTCNPPGPD SHTH
Sbjct  1    MDDGEIDFSNQDVFSSPNMGELPSSCS-MDSFFDELLKDT--CTHTHTCNPPGPDFSHTH  57

Query  319  TCYHVHTKIVPAPSEEDKAPSDDTAESVDKKEKKRPLGNreavrkyrekkkaraaLLEDG  498
            TC+HVHTKIVPAP+ EDK  +DDTAES +KK KK P GNREAVRKYREKKKAR A LED 
Sbjct  58   TCFHVHTKIVPAPT-EDKVSTDDTAESSEKKSKKCPTGNREAVRKYREKKKARTASLEDE  116

Query  499  VV  504
            VV
Sbjct  117  VV  118



>ref|XP_006409393.1| hypothetical protein EUTSA_v10022810mg [Eutrema salsugineum]
 gb|ESQ50846.1| hypothetical protein EUTSA_v10022810mg [Eutrema salsugineum]
Length=265

 Score =   135 bits (339),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 89/122 (73%), Positives = 102/122 (84%), Gaps = 1/122 (1%)
 Frame = +1

Query  139  MEDGELEFSNQEMLSSSNFCEFPDSNSYMDSFLNEILKDTHACTHAHTCNPPGPDNSHTH  318
            M+DGELEFSNQE LS+    EFP SN  MDSF +E+L D+HACTH HTCNPPGP+N+HTH
Sbjct  1    MDDGELEFSNQEALSNPKMPEFPPSNCSMDSFFDELLNDSHACTHTHTCNPPGPENTHTH  60

Query  319  TCYHVHTKIVPAPSEEDKAPSDDTAESVDKKEKKRPLGNreavrkyrekkkaraaLLEDG  498
            TC HVHTKI+PA S +DKA +DDT+ES  KK KKRPLGNREAVRKYREKKKA+AA LED 
Sbjct  61   TCLHVHTKILPAQS-DDKASTDDTSESSGKKSKKRPLGNREAVRKYREKKKAKAASLEDE  119

Query  499  VV  504
            V+
Sbjct  120  VI  121



>ref|XP_010526894.1| PREDICTED: uncharacterized protein LOC104804328 [Tarenaya hassleriana]
Length=273

 Score =   134 bits (338),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 87/123 (71%), Positives = 105/123 (85%), Gaps = 2/123 (2%)
 Frame = +1

Query  139  MEDGELEFSNQEMLSSSNFCEFPDSNSYMDSFLNEILKDTHACTHAHTCNPPGPDNSHTH  318
            M+DGE++FSNQE+ S+SN  E P S+  MD+F +E+L+D+HACTH HTCNPPGP+N+HTH
Sbjct  1    MDDGEVDFSNQEVFSNSNMEEIPPSSCSMDTFFDELLRDSHACTHTHTCNPPGPENTHTH  60

Query  319  TCYHVHTKIVPAPSEEDKAPSDDTAESVD-KKEKKRPLGNreavrkyrekkkaraaLLED  495
            TC+HVHTKI+PA SEE K  +DDTAES + KK KKRPLGNREAVRKYREKKKARAA LED
Sbjct  61   TCFHVHTKILPAQSEE-KVSADDTAESSEKKKNKKRPLGNREAVRKYREKKKARAASLED  119

Query  496  GVV  504
             V+
Sbjct  120  EVI  122



>gb|KFK30142.1| hypothetical protein AALP_AA7G222200 [Arabis alpina]
Length=263

 Score =   134 bits (337),  Expect = 5e-35, Method: Compositional matrix adjust.
 Identities = 85/124 (69%), Positives = 99/124 (80%), Gaps = 3/124 (2%)
 Frame = +1

Query  139  MEDGELEFSNQEMLSSSNFCEFPDSNSYMDSFLNEILKDTH--ACTHAHTCNPPGPDNSH  312
            MEDGEL+FSNQE+ SSS+  E P SN  MDSF + +L D+H  ACTH HTCNP GP+N+H
Sbjct  1    MEDGELDFSNQEVFSSSDMGELPPSNCSMDSFFDGLLMDSHQAACTHTHTCNPTGPENTH  60

Query  313  THTCYHVHTKIVPAPSEEDKAPSDDTAESVDKKEKKRPLGNreavrkyrekkkaraaLLE  492
            THTC+HVHTKI+P  S+E K  +DDTAES  KK +KRPLGNREAVRKYREKKKA+AA LE
Sbjct  61   THTCFHVHTKILPDESDE-KVSTDDTAESCGKKGEKRPLGNREAVRKYREKKKAKAASLE  119

Query  493  DGVV  504
            D V 
Sbjct  120  DEVA  123



>ref|XP_006284366.1| hypothetical protein CARUB_v10005538mg [Capsella rubella]
 gb|EOA17264.1| hypothetical protein CARUB_v10005538mg [Capsella rubella]
Length=258

 Score =   134 bits (336),  Expect = 5e-35, Method: Compositional matrix adjust.
 Identities = 86/122 (70%), Positives = 98/122 (80%), Gaps = 2/122 (2%)
 Frame = +1

Query  139  MEDGELEFSNQEMLSSSNFCEFPDSNSYMDSFLNEILKDTHA-CTHAHTCNPPGPDNSHT  315
            MEDGELEFSNQE+ SSS   E P SN  MDSF + +L DT+A CTH HTCNP GP+N+HT
Sbjct  1    MEDGELEFSNQEVFSSSEMGELPPSNCSMDSFFDGLLMDTNAACTHTHTCNPTGPENTHT  60

Query  316  HTCYHVHTKIVPAPSEEDKAPSDDTAESVDKKEKKRPLGNreavrkyrekkkaraaLLED  495
            HTC+HVHTKI+P  S+E K  +DDTAES  KK +KRPLGNREAVRKYREKKKA+AA LED
Sbjct  61   HTCFHVHTKILPDDSDE-KVSTDDTAESCGKKGEKRPLGNREAVRKYREKKKAKAASLED  119

Query  496  GV  501
             V
Sbjct  120  EV  121



>ref|XP_006590380.1| PREDICTED: bZIP transcription factor bZIP121 isoform X1 [Glycine 
max]
 ref|XP_006590381.1| PREDICTED: bZIP transcription factor bZIP121 isoform X2 [Glycine 
max]
 ref|XP_006590382.1| PREDICTED: bZIP transcription factor bZIP121 isoform X3 [Glycine 
max]
Length=270

 Score =   134 bits (336),  Expect = 8e-35, Method: Compositional matrix adjust.
 Identities = 89/124 (72%), Positives = 98/124 (79%), Gaps = 4/124 (3%)
 Frame = +1

Query  139  MEDGELEFSNQEMLSSSNFCEFPDSNSYMDSFLNEILKDTHACTHAHTCNPPGPDNSHTH  318
            M+DGEL+FSN E+ SS N  E P S S MDSF +E+LKDTHACTH HTCNPPGPD SHTH
Sbjct  1    MDDGELDFSNHEVFSSPNMGELPSSGS-MDSFFDELLKDTHACTHTHTCNPPGPDFSHTH  59

Query  319  TCYHVHTKIVPAPSEEDKAPSDDT--AESVDKKEKKRPLGNreavrkyrekkkaraaLLE  492
            TCYHVHTKIVPAP EED+  +DDT  +       KKRPLGN+EAVRKYREKKKARAA LE
Sbjct  60   TCYHVHTKIVPAP-EEDQVATDDTAESAEKKSSSKKRPLGNKEAVRKYREKKKARAASLE  118

Query  493  DGVV  504
            D VV
Sbjct  119  DEVV  122



>ref|XP_010432347.1| PREDICTED: uncharacterized protein LOC104716633 [Camelina sativa]
 ref|XP_010432348.1| PREDICTED: uncharacterized protein LOC104716633 [Camelina sativa]
Length=264

 Score =   133 bits (334),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 86/126 (68%), Positives = 98/126 (78%), Gaps = 5/126 (4%)
 Frame = +1

Query  139  MEDGELEFSNQEMLSSSNFCEFPDSNSYMDSFLNEILKDT----HACTHAHTCNPPGPDN  306
            MEDGELEFSNQE+ SSS+  E P SN  MDSF + +L DT     ACTH HTCNP GP+N
Sbjct  1    MEDGELEFSNQEVFSSSDMGELPPSNCSMDSFFDGLLMDTTNANAACTHTHTCNPTGPEN  60

Query  307  SHTHTCYHVHTKIVPAPSEEDKAPSDDTAESVDKKEKKRPLGNreavrkyrekkkaraaL  486
            +HTHTC+HVHTKI+P  S+E K  +DDTAES  KK +KRPLGNREAVRKYREKKKA+AA 
Sbjct  61   THTHTCFHVHTKILPDESDE-KVSTDDTAESCGKKGEKRPLGNREAVRKYREKKKAKAAS  119

Query  487  LEDGVV  504
            LED V 
Sbjct  120  LEDEVA  125



>ref|XP_010437531.1| PREDICTED: uncharacterized protein LOC104721282 [Camelina sativa]
 ref|XP_010437532.1| PREDICTED: uncharacterized protein LOC104721282 [Camelina sativa]
Length=264

 Score =   133 bits (334),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 86/126 (68%), Positives = 98/126 (78%), Gaps = 5/126 (4%)
 Frame = +1

Query  139  MEDGELEFSNQEMLSSSNFCEFPDSNSYMDSFLNEILKDT----HACTHAHTCNPPGPDN  306
            MEDGELEFSNQE+ SSS+  E P SN  MDSF + +L DT     ACTH HTCNP GP+N
Sbjct  1    MEDGELEFSNQEVFSSSDMGELPPSNCSMDSFFDGLLMDTTNANAACTHTHTCNPTGPEN  60

Query  307  SHTHTCYHVHTKIVPAPSEEDKAPSDDTAESVDKKEKKRPLGNreavrkyrekkkaraaL  486
            +HTHTC+HVHTKI+P  S+E K  +DDTAES  KK +KRPLGNREAVRKYREKKKA+AA 
Sbjct  61   THTHTCFHVHTKILPDESDE-KVSTDDTAESCGKKGEKRPLGNREAVRKYREKKKAKAAS  119

Query  487  LEDGVV  504
            LED V 
Sbjct  120  LEDEVA  125



>gb|KHN39873.1| hypothetical protein glysoja_020613 [Glycine soja]
Length=268

 Score =   133 bits (334),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 89/124 (72%), Positives = 98/124 (79%), Gaps = 4/124 (3%)
 Frame = +1

Query  139  MEDGELEFSNQEMLSSSNFCEFPDSNSYMDSFLNEILKDTHACTHAHTCNPPGPDNSHTH  318
            M+DGEL+FSN E+ SS N  E P S S MDSF +E+LKDTHACTH HTCNPPGPD SHTH
Sbjct  1    MDDGELDFSNHEVFSSPNMGELPSSGS-MDSFFDELLKDTHACTHTHTCNPPGPDFSHTH  59

Query  319  TCYHVHTKIVPAPSEEDKAPSDDT--AESVDKKEKKRPLGNreavrkyrekkkaraaLLE  492
            TCYHVHTKIVPAP EED+  +DDT  +       KKRPLGN+EAVRKYREKKKARAA LE
Sbjct  60   TCYHVHTKIVPAP-EEDQVATDDTAESAEKKSSSKKRPLGNKEAVRKYREKKKARAASLE  118

Query  493  DGVV  504
            D VV
Sbjct  119  DEVV  122



>ref|XP_002869111.1| bZIP transcription factor family protein [Arabidopsis lyrata 
subsp. lyrata]
 gb|EFH45370.1| bZIP transcription factor family protein [Arabidopsis lyrata 
subsp. lyrata]
Length=261

 Score =   132 bits (333),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 85/123 (69%), Positives = 98/123 (80%), Gaps = 2/123 (2%)
 Frame = +1

Query  139  MEDGELEFSNQEMLSSSNFCEFPDSNSYMDSFLNEILKDTHA-CTHAHTCNPPGPDNSHT  315
            MEDGEL+FSNQE+ SSS   E P SN  MDSF + +L DT+A CTH HTCNP GP+N+HT
Sbjct  1    MEDGELDFSNQEVFSSSEMGELPPSNCSMDSFFDGLLMDTNAACTHTHTCNPTGPENTHT  60

Query  316  HTCYHVHTKIVPAPSEEDKAPSDDTAESVDKKEKKRPLGNreavrkyrekkkaraaLLED  495
            HTC+HVHTKI+P  S+E K  +DDTAES  KK +KRPLGNREAVRKYREKKKA+AA LED
Sbjct  61   HTCFHVHTKILPDESDE-KVSTDDTAESCGKKGEKRPLGNREAVRKYREKKKAKAASLED  119

Query  496  GVV  504
             V 
Sbjct  120  EVA  122



>ref|XP_010447005.1| PREDICTED: uncharacterized protein LOC104729711 [Camelina sativa]
Length=261

 Score =   132 bits (333),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 86/126 (68%), Positives = 98/126 (78%), Gaps = 5/126 (4%)
 Frame = +1

Query  139  MEDGELEFSNQEMLSSSNFCEFPDSNSYMDSFLNEILKDT----HACTHAHTCNPPGPDN  306
            MEDGELEFSNQE+ SSS+  E P SN  MDSF + +L DT     ACTH HTCNP GP+N
Sbjct  1    MEDGELEFSNQEVFSSSDMGELPPSNCSMDSFFDGLLMDTTTTNAACTHTHTCNPTGPEN  60

Query  307  SHTHTCYHVHTKIVPAPSEEDKAPSDDTAESVDKKEKKRPLGNreavrkyrekkkaraaL  486
            +HTHTC+HVHTKI+P  S+E K  +DDTAES  KK +KRPLGNREAVRKYREKKKA+AA 
Sbjct  61   THTHTCFHVHTKILPDESDE-KVSTDDTAESCGKKGEKRPLGNREAVRKYREKKKAKAAS  119

Query  487  LEDGVV  504
            LED V 
Sbjct  120  LEDEVA  125



>ref|NP_567974.1| transcription factor bZIP19 [Arabidopsis thaliana]
 gb|AAL62378.1| putative protein [Arabidopsis thaliana]
 gb|AAN15479.1| putative protein [Arabidopsis thaliana]
 gb|AEE86454.1| transcription factor bZIP19 [Arabidopsis thaliana]
Length=261

 Score =   132 bits (333),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 85/123 (69%), Positives = 98/123 (80%), Gaps = 2/123 (2%)
 Frame = +1

Query  139  MEDGELEFSNQEMLSSSNFCEFPDSNSYMDSFLNEILKDTHA-CTHAHTCNPPGPDNSHT  315
            MEDGEL+FSNQE+ SSS   E P SN  MDSF + +L DT+A CTH HTCNP GP+N+HT
Sbjct  1    MEDGELDFSNQEVFSSSEMGELPPSNCSMDSFFDGLLMDTNAACTHTHTCNPTGPENTHT  60

Query  316  HTCYHVHTKIVPAPSEEDKAPSDDTAESVDKKEKKRPLGNreavrkyrekkkaraaLLED  495
            HTC+HVHTKI+P  S+E K  +DDTAES  KK +KRPLGNREAVRKYREKKKA+AA LED
Sbjct  61   HTCFHVHTKILPDESDE-KVSTDDTAESCGKKGEKRPLGNREAVRKYREKKKAKAASLED  119

Query  496  GVV  504
             V 
Sbjct  120  EVA  122



>gb|AAM63358.1| putative transcription factor [Arabidopsis thaliana]
Length=261

 Score =   132 bits (333),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 85/123 (69%), Positives = 98/123 (80%), Gaps = 2/123 (2%)
 Frame = +1

Query  139  MEDGELEFSNQEMLSSSNFCEFPDSNSYMDSFLNEILKDTHA-CTHAHTCNPPGPDNSHT  315
            MEDGEL+FSNQE+ SSS   E P SN  MDSF + +L DT+A CTH HTCNP GP+N+HT
Sbjct  1    MEDGELDFSNQEVFSSSEMGELPPSNCSMDSFFDGLLMDTNAACTHTHTCNPTGPENTHT  60

Query  316  HTCYHVHTKIVPAPSEEDKAPSDDTAESVDKKEKKRPLGNreavrkyrekkkaraaLLED  495
            HTC+HVHTKI+P  S+E K  +DDTAES  KK +KRPLGNREAVRKYREKKKA+AA LED
Sbjct  61   HTCFHVHTKILPDESDE-KVSTDDTAESCGKKGEKRPLGNREAVRKYREKKKAKAASLED  119

Query  496  GVV  504
             V 
Sbjct  120  EVA  122



>ref|NP_001237296.1| bZIP transcription factor bZIP121 [Glycine max]
 gb|ABI34680.1| bZIP transcription factor bZIP121 [Glycine max]
Length=270

 Score =   132 bits (332),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 89/124 (72%), Positives = 97/124 (78%), Gaps = 4/124 (3%)
 Frame = +1

Query  139  MEDGELEFSNQEMLSSSNFCEFPDSNSYMDSFLNEILKDTHACTHAHTCNPPGPDNSHTH  318
            M+DGEL+FSN E+ SS N  E P S S MDSF +E+LKDTHACTH HTCNPPGPD SHTH
Sbjct  1    MDDGELDFSNHEVFSSPNMGELPSSGS-MDSFFDELLKDTHACTHTHTCNPPGPDFSHTH  59

Query  319  TCYHVHTKIVPAPSEEDKAPSDDT--AESVDKKEKKRPLGNreavrkyrekkkaraaLLE  492
            TCYHVHTKIVPAP EED   +DDT  +       KKRPLGN+EAVRKYREKKKARAA LE
Sbjct  60   TCYHVHTKIVPAP-EEDHVATDDTAESAEKKSSSKKRPLGNKEAVRKYREKKKARAASLE  118

Query  493  DGVV  504
            D VV
Sbjct  119  DEVV  122



>ref|XP_006412160.1| hypothetical protein EUTSA_v10026007mg [Eutrema salsugineum]
 gb|ESQ53613.1| hypothetical protein EUTSA_v10026007mg [Eutrema salsugineum]
Length=262

 Score =   132 bits (331),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 84/123 (68%), Positives = 98/123 (80%), Gaps = 3/123 (2%)
 Frame = +1

Query  139  MEDGELEFSNQEMLSSSNFCEFPDSNSYMDSFLNEILKDTH--ACTHAHTCNPPGPDNSH  312
            MEDGEL+FSNQE+ SSS+  E P SN  +DSF   +L D+H  ACTH HTCNP GP+N+H
Sbjct  1    MEDGELDFSNQEVFSSSDMGELPPSNCSIDSFFEGLLMDSHQAACTHTHTCNPTGPENTH  60

Query  313  THTCYHVHTKIVPAPSEEDKAPSDDTAESVDKKEKKRPLGNreavrkyrekkkaraaLLE  492
            THTC+HVHTKI+P  S+E K  +DDTAES  KK +KRPLGNREAVRKYREKKKA+AA LE
Sbjct  61   THTCFHVHTKILPEDSDE-KVSTDDTAESCGKKGEKRPLGNREAVRKYREKKKAKAASLE  119

Query  493  DGV  501
            D V
Sbjct  120  DEV  122



>emb|CAA17769.1| putative protein [Arabidopsis thaliana]
 emb|CAB80221.1| putative protein [Arabidopsis thaliana]
Length=278

 Score =   132 bits (332),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 85/123 (69%), Positives = 98/123 (80%), Gaps = 2/123 (2%)
 Frame = +1

Query  139  MEDGELEFSNQEMLSSSNFCEFPDSNSYMDSFLNEILKDTHA-CTHAHTCNPPGPDNSHT  315
            MEDGEL+FSNQE+ SSS   E P SN  MDSF + +L DT+A CTH HTCNP GP+N+HT
Sbjct  1    MEDGELDFSNQEVFSSSEMGELPPSNCSMDSFFDGLLMDTNAACTHTHTCNPTGPENTHT  60

Query  316  HTCYHVHTKIVPAPSEEDKAPSDDTAESVDKKEKKRPLGNreavrkyrekkkaraaLLED  495
            HTC+HVHTKI+P  S+E K  +DDTAES  KK +KRPLGNREAVRKYREKKKA+AA LED
Sbjct  61   HTCFHVHTKILPDESDE-KVSTDDTAESCGKKGEKRPLGNREAVRKYREKKKAKAASLED  119

Query  496  GVV  504
             V 
Sbjct  120  EVA  122



>ref|XP_009787001.1| PREDICTED: uncharacterized protein LOC104235029 isoform X2 [Nicotiana 
sylvestris]
Length=269

 Score =   132 bits (332),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 86/123 (70%), Positives = 93/123 (76%), Gaps = 3/123 (2%)
 Frame = +1

Query  139  MEDGELEFSNQEMLSSSNFCEFPDSNSYMDSFLNEILKDTHACTHAHTCNPPGPDNSHTH  318
            M +GELE SNQE +SSSNF E P+ +S    F NEIL D HAC H HTCNPPGPDNSHTH
Sbjct  1    MHNGELELSNQETVSSSNFGEIPECSSTKRLF-NEILSDMHACIHTHTCNPPGPDNSHTH  59

Query  319  TCYHVHTKIVPAPSEEDKAPSDDTAESVDKK-EKKRPLGNreavrkyrekkkaraaLLED  495
            +CYHVHTK+VP P  EDK  SDDTAES + K  KKRPL N EAVRKYREK KAR A LED
Sbjct  60   SCYHVHTKVVPPPI-EDKILSDDTAESAENKIGKKRPLSNNEAVRKYREKNKARVASLED  118

Query  496  GVV  504
             VV
Sbjct  119  EVV  121



>ref|XP_009786999.1| PREDICTED: uncharacterized protein LOC104235029 isoform X1 [Nicotiana 
sylvestris]
 ref|XP_009787000.1| PREDICTED: uncharacterized protein LOC104235029 isoform X1 [Nicotiana 
sylvestris]
Length=274

 Score =   132 bits (331),  Expect = 5e-34, Method: Compositional matrix adjust.
 Identities = 86/123 (70%), Positives = 93/123 (76%), Gaps = 3/123 (2%)
 Frame = +1

Query  139  MEDGELEFSNQEMLSSSNFCEFPDSNSYMDSFLNEILKDTHACTHAHTCNPPGPDNSHTH  318
            M +GELE SNQE +SSSNF E P+ +S    F NEIL D HAC H HTCNPPGPDNSHTH
Sbjct  1    MHNGELELSNQETVSSSNFGEIPECSSTKRLF-NEILSDMHACIHTHTCNPPGPDNSHTH  59

Query  319  TCYHVHTKIVPAPSEEDKAPSDDTAESVDKK-EKKRPLGNreavrkyrekkkaraaLLED  495
            +CYHVHTK+VP P  EDK  SDDTAES + K  KKRPL N EAVRKYREK KAR A LED
Sbjct  60   SCYHVHTKVVPPPI-EDKILSDDTAESAENKIGKKRPLSNNEAVRKYREKNKARVASLED  118

Query  496  GVV  504
             VV
Sbjct  119  EVV  121



>ref|XP_004164905.1| PREDICTED: uncharacterized protein LOC101232700 [Cucumis sativus]
Length=262

 Score =   130 bits (328),  Expect = 9e-34, Method: Compositional matrix adjust.
 Identities = 95/122 (78%), Positives = 104/122 (85%), Gaps = 2/122 (2%)
 Frame = +1

Query  139  MEDGELEFSNQEMLSSSNFCEFPDSNSYMDSFLNEILKDTHACTHAHTCNPPGPDNSHTH  318
            M+DGEL+FSNQ++ SS N  E P S S MDSF +E+LKDTH CTH HTCNPPGPD SHTH
Sbjct  1    MDDGELDFSNQDVFSSPNM-EIPSSCS-MDSFFDELLKDTHTCTHTHTCNPPGPDYSHTH  58

Query  319  TCYHVHTKIVPAPSEEDKAPSDDTAESVDKKEKKRPLGNreavrkyrekkkaraaLLEDG  498
            TC+HVHTKIVPAPSEEDK  +DDTAES +KK KKRPLGNREAVRKYREKKKARAA LED 
Sbjct  59   TCFHVHTKIVPAPSEEDKVVTDDTAESTEKKSKKRPLGNREAVRKYREKKKARAASLEDE  118

Query  499  VV  504
            VV
Sbjct  119  VV  120



>ref|XP_004144846.1| PREDICTED: uncharacterized protein LOC101208161 [Cucumis sativus]
 gb|KGN43249.1| DNA binding protein [Cucumis sativus]
Length=270

 Score =   130 bits (328),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 95/122 (78%), Positives = 104/122 (85%), Gaps = 2/122 (2%)
 Frame = +1

Query  139  MEDGELEFSNQEMLSSSNFCEFPDSNSYMDSFLNEILKDTHACTHAHTCNPPGPDNSHTH  318
            M+DGEL+FSNQ++ SS N  E P S S MDSF +E+LKDTH CTH HTCNPPGPD SHTH
Sbjct  1    MDDGELDFSNQDVFSSPNM-EIPSSCS-MDSFFDELLKDTHTCTHTHTCNPPGPDYSHTH  58

Query  319  TCYHVHTKIVPAPSEEDKAPSDDTAESVDKKEKKRPLGNreavrkyrekkkaraaLLEDG  498
            TC+HVHTKIVPAPSEEDK  +DDTAES +KK KKRPLGNREAVRKYREKKKARAA LED 
Sbjct  59   TCFHVHTKIVPAPSEEDKVVTDDTAESTEKKSKKRPLGNREAVRKYREKKKARAASLEDE  118

Query  499  VV  504
            VV
Sbjct  119  VV  120



>ref|XP_008447959.1| PREDICTED: uncharacterized protein LOC103490288 [Cucumis melo]
Length=270

 Score =   130 bits (328),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 95/122 (78%), Positives = 104/122 (85%), Gaps = 2/122 (2%)
 Frame = +1

Query  139  MEDGELEFSNQEMLSSSNFCEFPDSNSYMDSFLNEILKDTHACTHAHTCNPPGPDNSHTH  318
            M+DGEL+FSNQ++ SS N  E P S S MDSF +E+LKDTH CTH HTCNPPGPD SHTH
Sbjct  1    MDDGELDFSNQDVFSSPNI-EIPSSCS-MDSFFDELLKDTHTCTHTHTCNPPGPDYSHTH  58

Query  319  TCYHVHTKIVPAPSEEDKAPSDDTAESVDKKEKKRPLGNreavrkyrekkkaraaLLEDG  498
            TC+HVHTKIVPAPSEEDK  +DDTAES +KK KKRPLGNREAVRKYREKKKARAA LED 
Sbjct  59   TCFHVHTKIVPAPSEEDKVVTDDTAESTEKKSKKRPLGNREAVRKYREKKKARAASLEDE  118

Query  499  VV  504
            VV
Sbjct  119  VV  120



>ref|XP_006591923.1| PREDICTED: bZIP transcription factor bZIP122 isoform X1 [Glycine 
max]
 ref|XP_006591924.1| PREDICTED: bZIP transcription factor bZIP122 isoform X2 [Glycine 
max]
 ref|XP_006591925.1| PREDICTED: bZIP transcription factor bZIP122 isoform X3 [Glycine 
max]
 ref|XP_006591926.1| PREDICTED: bZIP transcription factor bZIP122 isoform X4 [Glycine 
max]
 ref|XP_006591927.1| PREDICTED: bZIP transcription factor bZIP122 isoform X5 [Glycine 
max]
 ref|XP_006591928.1| PREDICTED: bZIP transcription factor bZIP122 isoform X6 [Glycine 
max]
 ref|XP_006591929.1| PREDICTED: bZIP transcription factor bZIP122 isoform X7 [Glycine 
max]
Length=271

 Score =   129 bits (323),  Expect = 6e-33, Method: Compositional matrix adjust.
 Identities = 90/125 (72%), Positives = 97/125 (78%), Gaps = 5/125 (4%)
 Frame = +1

Query  139  MEDGELEFSNQEMLSSSNFCEFPDSNSYMDSFLNEILKDTHACTHAHTCNPPGPDNSHTH  318
            M+DGEL+FSN E+ SS N  E P S S MDSF +E+LKDTHACTH HTCNPPGPD SHTH
Sbjct  1    MDDGELDFSNHEVFSSPNMGELPSSGS-MDSFFDELLKDTHACTHTHTCNPPGPDFSHTH  59

Query  319  TCYHVHTKIVPAPSEEDKAPSDDT---AESVDKKEKKRPLGNreavrkyrekkkaraaLL  489
            TCYHVHTKIVPAP EED   +DDT   AE      KKR LGN+EAVRKYREKKKARAA L
Sbjct  60   TCYHVHTKIVPAP-EEDHVATDDTAESAEKKSSSSKKRSLGNKEAVRKYREKKKARAASL  118

Query  490  EDGVV  504
            ED VV
Sbjct  119  EDEVV  123



>ref|NP_001235033.1| bZIP transcription factor bZIP122 [Glycine max]
 ref|XP_006591930.1| PREDICTED: bZIP transcription factor bZIP122 isoform X8 [Glycine 
max]
 ref|XP_006591931.1| PREDICTED: bZIP transcription factor bZIP122 isoform X9 [Glycine 
max]
 gb|ABI34664.1| bZIP transcription factor bZIP122 [Glycine max]
Length=265

 Score =   128 bits (322),  Expect = 6e-33, Method: Compositional matrix adjust.
 Identities = 90/125 (72%), Positives = 97/125 (78%), Gaps = 5/125 (4%)
 Frame = +1

Query  139  MEDGELEFSNQEMLSSSNFCEFPDSNSYMDSFLNEILKDTHACTHAHTCNPPGPDNSHTH  318
            M+DGEL+FSN E+ SS N  E P S S MDSF +E+LKDTHACTH HTCNPPGPD SHTH
Sbjct  1    MDDGELDFSNHEVFSSPNMGELPSSGS-MDSFFDELLKDTHACTHTHTCNPPGPDFSHTH  59

Query  319  TCYHVHTKIVPAPSEEDKAPSDDT---AESVDKKEKKRPLGNreavrkyrekkkaraaLL  489
            TCYHVHTKIVPAP EED   +DDT   AE      KKR LGN+EAVRKYREKKKARAA L
Sbjct  60   TCYHVHTKIVPAP-EEDHVATDDTAESAEKKSSSSKKRSLGNKEAVRKYREKKKARAASL  118

Query  490  EDGVV  504
            ED VV
Sbjct  119  EDEVV  123



>ref|XP_011046168.1| PREDICTED: uncharacterized protein LOC105140851 [Populus euphratica]
 ref|XP_011046178.1| PREDICTED: uncharacterized protein LOC105140851 [Populus euphratica]
 ref|XP_011046187.1| PREDICTED: uncharacterized protein LOC105140851 [Populus euphratica]
 ref|XP_011046199.1| PREDICTED: uncharacterized protein LOC105140851 [Populus euphratica]
Length=267

 Score =   128 bits (322),  Expect = 7e-33, Method: Compositional matrix adjust.
 Identities = 83/122 (68%), Positives = 97/122 (80%), Gaps = 5/122 (4%)
 Frame = +1

Query  139  MEDGELEFSNQEMLSSSNFCEFPDSNSYMDSFLNEILKDT-HACTHAHTCNPPGPDNSHT  315
            M+DGEL++SNQE+  S N  + P S SY   FL+E+LKDT HACTH HTCNPPGPDN HT
Sbjct  1    MDDGELDYSNQELFLSPNMDDLPSSCSY--GFLDELLKDTPHACTHTHTCNPPGPDNPHT  58

Query  316  HTCYHVHTKIVPAPSEEDKAPSDDTAESVDKKEKKRPLGNreavrkyrekkkaraaLLED  495
            H C+H HTK++   S EDK  S+DTAES++KK KKRPLGNREAVRKYREKKKA+AA LED
Sbjct  59   HVCFHAHTKLL--SSSEDKVDSEDTAESIEKKSKKRPLGNREAVRKYREKKKAKAASLED  116

Query  496  GV  501
             V
Sbjct  117  EV  118



>ref|XP_009108690.1| PREDICTED: uncharacterized protein LOC103834377 [Brassica rapa]
Length=255

 Score =   128 bits (321),  Expect = 9e-33, Method: Compositional matrix adjust.
 Identities = 83/124 (67%), Positives = 100/124 (81%), Gaps = 3/124 (2%)
 Frame = +1

Query  139  MEDGELEFSNQEMLSSSNFCEFPDSNSYMDSFLNEILKDTHA-CTHAHTCNPPGPDNSHT  315
            MEDGELEFSNQE+ S+S+    P +N  MD+F +E+LKD++A CTH HTCNP GP+N+HT
Sbjct  1    MEDGELEFSNQEVFSTSDMNGLPLTNCSMDTFFDELLKDSNAACTHTHTCNPTGPENAHT  60

Query  316  HTCYHVHTKIVPAPSEEDKAPSDDTAESVDKK-EKKRPLGNreavrkyrekkkaraaLLE  492
            HTC+HVHTKI+P  S+E K  +DDTAES  KK + KRPLGNREAVRKYREKKKA+AA LE
Sbjct  61   HTCFHVHTKILPEDSDE-KVSTDDTAESCGKKGDNKRPLGNREAVRKYREKKKAKAASLE  119

Query  493  DGVV  504
            D V 
Sbjct  120  DEVA  123



>ref|XP_009376950.1| PREDICTED: uncharacterized protein LOC103965600 [Pyrus x bretschneideri]
 ref|XP_009376951.1| PREDICTED: uncharacterized protein LOC103965600 [Pyrus x bretschneideri]
Length=268

 Score =   127 bits (318),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 80/122 (66%), Positives = 95/122 (78%), Gaps = 3/122 (2%)
 Frame = +1

Query  139  MEDGELEFSNQEMLSSSNFCEFPDSNSYMDSFLNEILKDTHACTHAHTCNPPGPDNSHTH  318
            M+D E++FSNQE+ SS+N      S+  MD+F +++LKDTHACTH HTCNPPGPD SHTH
Sbjct  1    MDDHEVDFSNQEVFSSANMGGELASSCSMDTFFDDLLKDTHACTHTHTCNPPGPDYSHTH  60

Query  319  TCYHVHTKIVPAPSEEDKAPSDDTAESVDKKEKKRPLGNreavrkyrekkkaraaLLEDG  498
            TC+HVHTKIV + S EDKA  DDT ES +KK KK+PLGN+ AVRKYRE KKAR  LLE  
Sbjct  61   TCFHVHTKIVSSAS-EDKA--DDTCESGEKKSKKQPLGNKVAVRKYRENKKARVKLLEAE  117

Query  499  VV  504
            VV
Sbjct  118  VV  119



>ref|XP_009376970.1| PREDICTED: uncharacterized protein LOC103965622 [Pyrus x bretschneideri]
Length=268

 Score =   127 bits (318),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 80/122 (66%), Positives = 95/122 (78%), Gaps = 3/122 (2%)
 Frame = +1

Query  139  MEDGELEFSNQEMLSSSNFCEFPDSNSYMDSFLNEILKDTHACTHAHTCNPPGPDNSHTH  318
            M+D E++FSNQE+ SS+N      S+  MD+F +++LKDTHACTH HTCNPPGPD SHTH
Sbjct  1    MDDHEVDFSNQEVFSSANMGGELASSCSMDTFFDDLLKDTHACTHTHTCNPPGPDYSHTH  60

Query  319  TCYHVHTKIVPAPSEEDKAPSDDTAESVDKKEKKRPLGNreavrkyrekkkaraaLLEDG  498
            TC+HVHTKIV + S EDKA  DDT ES +KK KK+PLGN+ AVRKYRE KKAR  LLE  
Sbjct  61   TCFHVHTKIVSSAS-EDKA--DDTCESGEKKSKKQPLGNKVAVRKYRENKKARVKLLEAE  117

Query  499  VV  504
            VV
Sbjct  118  VV  119



>ref|XP_002313707.2| hypothetical protein POPTR_0009s13730g [Populus trichocarpa]
 gb|EEE87662.2| hypothetical protein POPTR_0009s13730g [Populus trichocarpa]
Length=267

 Score =   126 bits (317),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 82/122 (67%), Positives = 96/122 (79%), Gaps = 5/122 (4%)
 Frame = +1

Query  139  MEDGELEFSNQEMLSSSNFCEFPDSNSYMDSFLNEILKDT-HACTHAHTCNPPGPDNSHT  315
            M+DGEL++SNQE+  S N  + P S SY   FL+E+L DT HACTH HTCNPPGPDN HT
Sbjct  1    MDDGELDYSNQELFLSPNMDDLPSSCSY--GFLDELLMDTPHACTHTHTCNPPGPDNPHT  58

Query  316  HTCYHVHTKIVPAPSEEDKAPSDDTAESVDKKEKKRPLGNreavrkyrekkkaraaLLED  495
            H C+H HTK++   S EDK  S+DTAES++KK KKRPLGNREAVRKYREKKKA+AA LED
Sbjct  59   HVCFHAHTKLL--SSSEDKVESEDTAESIEKKSKKRPLGNREAVRKYREKKKAKAASLED  116

Query  496  GV  501
             V
Sbjct  117  EV  118



>emb|CDY17503.1| BnaC03g65600D [Brassica napus]
Length=255

 Score =   125 bits (315),  Expect = 6e-32, Method: Compositional matrix adjust.
 Identities = 82/124 (66%), Positives = 99/124 (80%), Gaps = 3/124 (2%)
 Frame = +1

Query  139  MEDGELEFSNQEMLSSSNFCEFPDSNSYMDSFLNEILKDTHA-CTHAHTCNPPGPDNSHT  315
            MEDGELEFSNQE+ S+S+    P +N  MD+F +E+L D++A CTH HTCNP GP+N+HT
Sbjct  1    MEDGELEFSNQEVFSTSDMNGLPLTNCSMDTFFDELLMDSNAACTHTHTCNPTGPENAHT  60

Query  316  HTCYHVHTKIVPAPSEEDKAPSDDTAESVDKK-EKKRPLGNreavrkyrekkkaraaLLE  492
            HTC+HVHTKI+P  S+E K  +DDTAES  KK + KRPLGNREAVRKYREKKKA+AA LE
Sbjct  61   HTCFHVHTKILPEDSDE-KVSTDDTAESCGKKGDNKRPLGNREAVRKYREKKKAKAASLE  119

Query  493  DGVV  504
            D V 
Sbjct  120  DEVA  123



>ref|XP_009112401.1| PREDICTED: uncharacterized protein LOC103837781 isoform X1 [Brassica 
rapa]
 ref|XP_009112402.1| PREDICTED: uncharacterized protein LOC103837781 isoform X1 [Brassica 
rapa]
Length=242

 Score =   125 bits (314),  Expect = 8e-32, Method: Compositional matrix adjust.
 Identities = 79/122 (65%), Positives = 92/122 (75%), Gaps = 14/122 (11%)
 Frame = +1

Query  139  MEDGELEFSNQEMLSSSNFCEFPDSNSYMDSFLNEILKDTHACTHAHTCNPPGPDNSHTH  318
            M+DGELEF              P S+S MDSFL E+LKD+HACTH HTCNPPGP+N+HTH
Sbjct  2    MDDGELEF--------------PPSSSSMDSFLEELLKDSHACTHTHTCNPPGPENTHTH  47

Query  319  TCYHVHTKIVPAPSEEDKAPSDDTAESVDKKEKKRPLGNreavrkyrekkkaraaLLEDG  498
            TC HVHTKI+PA   +DK  +DDT+ES  K+ KKRP GNREAVRKYREKKKA+AA LED 
Sbjct  48   TCLHVHTKILPAAQSDDKETTDDTSESSGKRSKKRPSGNREAVRKYREKKKAKAASLEDE  107

Query  499  VV  504
            V+
Sbjct  108  VL  109



>ref|XP_009112403.1| PREDICTED: uncharacterized protein LOC103837781 isoform X2 [Brassica 
rapa]
Length=239

 Score =   125 bits (313),  Expect = 8e-32, Method: Compositional matrix adjust.
 Identities = 79/122 (65%), Positives = 92/122 (75%), Gaps = 14/122 (11%)
 Frame = +1

Query  139  MEDGELEFSNQEMLSSSNFCEFPDSNSYMDSFLNEILKDTHACTHAHTCNPPGPDNSHTH  318
            M+DGELEF              P S+S MDSFL E+LKD+HACTH HTCNPPGP+N+HTH
Sbjct  2    MDDGELEF--------------PPSSSSMDSFLEELLKDSHACTHTHTCNPPGPENTHTH  47

Query  319  TCYHVHTKIVPAPSEEDKAPSDDTAESVDKKEKKRPLGNreavrkyrekkkaraaLLEDG  498
            TC HVHTKI+PA   +DK  +DDT+ES  K+ KKRP GNREAVRKYREKKKA+AA LED 
Sbjct  48   TCLHVHTKILPAAQSDDKETTDDTSESSGKRSKKRPSGNREAVRKYREKKKAKAASLEDE  107

Query  499  VV  504
            V+
Sbjct  108  VL  109



>emb|CDX76308.1| BnaA08g10920D [Brassica napus]
Length=273

 Score =   125 bits (314),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 82/124 (66%), Positives = 99/124 (80%), Gaps = 3/124 (2%)
 Frame = +1

Query  139  MEDGELEFSNQEMLSSSNFCEFPDSNSYMDSFLNEILKDTHA-CTHAHTCNPPGPDNSHT  315
            MEDGELEFSNQE+ S+S+    P +N  MD+F +E+L D++A CTH HTCNP GP+N+HT
Sbjct  1    MEDGELEFSNQEVFSTSDMNGLPLTNCSMDTFFDELLMDSNAACTHTHTCNPTGPENAHT  60

Query  316  HTCYHVHTKIVPAPSEEDKAPSDDTAESVDKK-EKKRPLGNreavrkyrekkkaraaLLE  492
            HTC+HVHTKI+P  S+E K  +DDTAES  KK + KRPLGNREAVRKYREKKKA+AA LE
Sbjct  61   HTCFHVHTKILPEDSDE-KVSTDDTAESCGKKGDNKRPLGNREAVRKYREKKKAKAASLE  119

Query  493  DGVV  504
            D V 
Sbjct  120  DEVA  123



>ref|XP_008377738.1| PREDICTED: uncharacterized protein LOC103440807 [Malus domestica]
 ref|XP_008377739.1| PREDICTED: uncharacterized protein LOC103440807 [Malus domestica]
Length=263

 Score =   124 bits (312),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 75/113 (66%), Positives = 90/113 (80%), Gaps = 1/113 (1%)
 Frame = +1

Query  166  NQEMLSSSNFCEFPDSNSYMDSFLNEILKDTHACTHAHTCNPPGPDNSHTHTCYHVHTKI  345
            +QE+   +N      S+  MDSF +++LKDTHACTHAHTCNPPGPD SHTHTC+HVHTKI
Sbjct  3    DQEVFPGANMGGELASSCSMDSFFDDLLKDTHACTHAHTCNPPGPDYSHTHTCFHVHTKI  62

Query  346  VPAPSEEDKAPSDDTAESVDKKEKKRPLGNreavrkyrekkkaraaLLEDGVV  504
            + + S EDKA +DDTAES +KK KK+PLGN+ AVRKYREK+KAR  LLED VV
Sbjct  63   LSSAS-EDKAGTDDTAESGEKKSKKQPLGNKVAVRKYREKEKARVKLLEDEVV  114



>ref|XP_010548099.1| PREDICTED: uncharacterized protein LOC104819648 [Tarenaya hassleriana]
Length=260

 Score =   124 bits (310),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 77/124 (62%), Positives = 95/124 (77%), Gaps = 3/124 (2%)
 Frame = +1

Query  139  MEDGELEFSNQEMLSSSNF--CEFPDSNSYMDSFLNEILKDTHACTHAHTCNPPGPDNSH  312
            M++GEL+FSNQE+ SS N      P S+  MDSF +E+LKD   CTH HTCNPPGP+N+H
Sbjct  1    MDEGELDFSNQELFSSPNMEGIRIPLSSCSMDSFFDELLKDPQTCTHTHTCNPPGPENTH  60

Query  313  THTCYHVHTKIVPAPSEEDKAPSDDTAESVDKKEKKRPLGNreavrkyrekkkaraaLLE  492
            +HTC+HVHTK +P  S E K  +DDTAES +K+ + RP GNREAVRKYREKK+ARAA LE
Sbjct  61   SHTCFHVHTKFLPLQSGE-KVSTDDTAESSEKRNRNRPSGNREAVRKYREKKRARAASLE  119

Query  493  DGVV  504
            D V+
Sbjct  120  DEVI  123



>ref|XP_002884017.1| DNA binding protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH60276.1| DNA binding protein [Arabidopsis lyrata subsp. lyrata]
Length=255

 Score =   123 bits (309),  Expect = 5e-31, Method: Compositional matrix adjust.
 Identities = 81/122 (66%), Positives = 95/122 (78%), Gaps = 9/122 (7%)
 Frame = +1

Query  139  MEDGELEFSNQEMLSSSNFCEFPDSNSYMDSFLNEILKDTHACTHAHTCNPPGPDNSHTH  318
            M+DGELEFSN  M       E P S+  MDSF +E+L+D+HACTH HTCNPPGP+N+HTH
Sbjct  1    MDDGELEFSNSNMGG-----ELPPSSCSMDSFFDELLRDSHACTHTHTCNPPGPENTHTH  55

Query  319  TCYHVHTKIVPAPSEEDKAPSDDTAESVDKKEKKRPLGNreavrkyrekkkaraaLLEDG  498
            TC HVHTKI+P+ S EDK  +DDT+ES     KKRPLGNREAVRKYREKKKA+AA LED 
Sbjct  56   TCLHVHTKILPSQS-EDKVSTDDTSES---SGKKRPLGNREAVRKYREKKKAKAASLEDE  111

Query  499  VV  504
            V+
Sbjct  112  VM  113



>ref|XP_009355669.1| PREDICTED: uncharacterized protein LOC103946638 [Pyrus x bretschneideri]
Length=263

 Score =   122 bits (307),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 74/113 (65%), Positives = 90/113 (80%), Gaps = 1/113 (1%)
 Frame = +1

Query  166  NQEMLSSSNFCEFPDSNSYMDSFLNEILKDTHACTHAHTCNPPGPDNSHTHTCYHVHTKI  345
            +QE+   +N      S+  MDSF +++LKDTHACTHAHTCNPPGPD SHTHTC+HVHTKI
Sbjct  3    DQEVFPGANMGGELASSCSMDSFFDDLLKDTHACTHAHTCNPPGPDYSHTHTCFHVHTKI  62

Query  346  VPAPSEEDKAPSDDTAESVDKKEKKRPLGNreavrkyrekkkaraaLLEDGVV  504
            + + S EDKA +DDTAES +KK KK+PLGN+ AVRKYREK+KAR  LLED V+
Sbjct  63   LSSAS-EDKAGTDDTAESGEKKSKKQPLGNKVAVRKYREKEKARVKLLEDEVL  114



>ref|XP_009624365.1| PREDICTED: uncharacterized protein LOC104115438 [Nicotiana tomentosiformis]
 ref|XP_009624366.1| PREDICTED: uncharacterized protein LOC104115438 [Nicotiana tomentosiformis]
 ref|XP_009624367.1| PREDICTED: uncharacterized protein LOC104115438 [Nicotiana tomentosiformis]
 ref|XP_009624368.1| PREDICTED: uncharacterized protein LOC104115438 [Nicotiana tomentosiformis]
Length=263

 Score =   122 bits (305),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 83/123 (67%), Positives = 89/123 (72%), Gaps = 9/123 (7%)
 Frame = +1

Query  139  MEDGELEFSNQEMLSSSNFCEFPDSNSYMDSFLNEILKDTHACTHAHTCNPPGPDNSHTH  318
            M + EL FSNQEM SSSNF E P+ +S    F NEIL D HAC H HTCNPPGPDNSHTH
Sbjct  1    MHNRELHFSNQEMGSSSNFGEIPECSSTKRLF-NEILSDMHACIHTHTCNPPGPDNSHTH  59

Query  319  TCYHVHTKIVPAPSEEDKAPSDDTAESVDKK-EKKRPLGNreavrkyrekkkaraaLLED  495
            TCYHVHTK+VP         SDDTAES + K  KKRPL N+EAVRKYREK KAR A LED
Sbjct  60   TCYHVHTKVVP-------PLSDDTAESAENKIGKKRPLSNKEAVRKYREKNKARVASLED  112

Query  496  GVV  504
             VV
Sbjct  113  EVV  115



>ref|XP_010467405.1| PREDICTED: uncharacterized protein LOC104747472 [Camelina sativa]
 ref|XP_010467406.1| PREDICTED: uncharacterized protein LOC104747472 [Camelina sativa]
Length=259

 Score =   121 bits (304),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 80/123 (65%), Positives = 94/123 (76%), Gaps = 7/123 (6%)
 Frame = +1

Query  139  MEDGELEFSNQEMLSSSNFCEFPDSNSYMDSFLNEILKDTHACTHAHTCNPPGP-DNSHT  315
            M+DGELEFSN  M+      E   S+  MDSF +E+L+D+HACTH HTCNP GP +N+HT
Sbjct  1    MDDGELEFSNSNMVG-----ELLPSSCSMDSFFDELLRDSHACTHTHTCNPSGPENNTHT  55

Query  316  HTCYHVHTKIVPAPSEEDKAPSDDTAESVDKKEKKRPLGNreavrkyrekkkaraaLLED  495
            HTC HVHTKI+P+ S EDK  +DDT+ES  K  KKRPLGNREAVRKYREKKKA+AA LED
Sbjct  56   HTCLHVHTKILPSQS-EDKVSTDDTSESSGKNSKKRPLGNREAVRKYREKKKAKAASLED  114

Query  496  GVV  504
             V 
Sbjct  115  EVT  117



>ref|XP_006298365.1| hypothetical protein CARUB_v10014436mg [Capsella rubella]
 ref|XP_006298366.1| hypothetical protein CARUB_v10014436mg [Capsella rubella]
 gb|EOA31263.1| hypothetical protein CARUB_v10014436mg [Capsella rubella]
 gb|EOA31264.1| hypothetical protein CARUB_v10014436mg [Capsella rubella]
Length=258

 Score =   117 bits (294),  Expect = 8e-29, Method: Compositional matrix adjust.
 Identities = 82/122 (67%), Positives = 96/122 (79%), Gaps = 6/122 (5%)
 Frame = +1

Query  139  MEDGELEFSNQEMLSSSNFCEFPDSNSYMDSFLNEILKDTHACTHAHTCNPPGPDNSHTH  318
            M+DGELEFSN  M       E P ++  MDSF +E+L+D+HACTH HTCNP GP+N+HTH
Sbjct  1    MDDGELEFSNSNMGG-----ELPLTSCSMDSFFDELLRDSHACTHTHTCNPSGPENTHTH  55

Query  319  TCYHVHTKIVPAPSEEDKAPSDDTAESVDKKEKKRPLGNreavrkyrekkkaraaLLEDG  498
            TC HVHTKI+PA S EDK  +DDT+ES  KK KKRPLGNREAVRKYREKKKA+AA LED 
Sbjct  56   TCLHVHTKILPAQS-EDKVSTDDTSESSGKKSKKRPLGNREAVRKYREKKKAKAASLEDE  114

Query  499  VV  504
            V+
Sbjct  115  VM  116



>emb|CDY47478.1| BnaA09g08870D [Brassica napus]
Length=241

 Score =   117 bits (293),  Expect = 8e-29, Method: Compositional matrix adjust.
 Identities = 82/122 (67%), Positives = 93/122 (76%), Gaps = 14/122 (11%)
 Frame = +1

Query  139  MEDGELEFSNQEMLSSSNFCEFPDSNSYMDSFLNEILKDTHACTHAHTCNPPGPDNSHTH  318
            MEDGELEF              P S+S MDSFL E+LKD+HACTH HTCNPPGP+N+HTH
Sbjct  1    MEDGELEF--------------PPSSSSMDSFLEELLKDSHACTHTHTCNPPGPENTHTH  46

Query  319  TCYHVHTKIVPAPSEEDKAPSDDTAESVDKKEKKRPLGNreavrkyrekkkaraaLLEDG  498
            TC HVHTKI+PAP  +DK  +DDT+ES  KK KKRP GNREAVRKYREKKKA+AA LED 
Sbjct  47   TCLHVHTKILPAPQSDDKETTDDTSESSGKKSKKRPSGNREAVRKYREKKKAKAASLEDE  106

Query  499  VV  504
            V+
Sbjct  107  VL  108



>ref|XP_011088608.1| PREDICTED: uncharacterized protein LOC105169791 [Sesamum indicum]
 ref|XP_011088609.1| PREDICTED: uncharacterized protein LOC105169791 [Sesamum indicum]
Length=287

 Score =   117 bits (293),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 81/139 (58%), Positives = 96/139 (69%), Gaps = 18/139 (13%)
 Frame = +1

Query  139  MEDGELEFSNQEMLSSSNFCEFPDSNSY-MDSFLN----------------EILKDTHAC  267
            M+DGEL+F + +MLS  +      S S+ +D FL                 ++L  T AC
Sbjct  1    MDDGELDFPSDQMLSCLDMTNAQSSCSFDIDEFLGRTQACNDALGRTEAYTDVLGRTQAC  60

Query  268  THAHTCNPPGPDNSHTHTCYHVHTKIVPAPSEEDKAPSDDTAESVDKKEKKRPLGNreav  447
            THAH CNP GPD SHTHTC HVHT+I+P+PSE  +APSDDTAESV+KK KKRPLGNREAV
Sbjct  61   THAHACNPSGPDKSHTHTCIHVHTQIMPSPSEP-QAPSDDTAESVEKKGKKRPLGNREAV  119

Query  448  rkyrekkkaraaLLEDGVV  504
            RKYREKKKAR A LED V+
Sbjct  120  RKYREKKKARTASLEDEVI  138



>ref|XP_010327411.1| PREDICTED: uncharacterized protein LOC104649609 [Solanum lycopersicum]
 ref|XP_010327412.1| PREDICTED: uncharacterized protein LOC104649609 [Solanum lycopersicum]
Length=262

 Score =   116 bits (291),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 78/122 (64%), Positives = 90/122 (74%), Gaps = 6/122 (5%)
 Frame = +1

Query  139  MEDGELEFSNQEMLSSSNFCEFPDSNSYMDSFLNEILKDTHACTHAHTCNPPGPDNSHTH  318
            M+D ELEFS+Q++LSSS F E P+S S M+   NEIL D HAC HAHTCNPPGPDNSHTH
Sbjct  1    MDDMELEFSSQQVLSSSTFGEIPES-SPMNKRFNEILTDVHACIHAHTCNPPGPDNSHTH  59

Query  319  TCYHVHTKIVPAPSEEDKAPSDDTAESVDKKEKKRPLGNreavrkyrekkkaraaLLEDG  498
            TCYHVHTK+V  P   D   ++ TA +V    KKR L N+EAVRKY EKKKAR A LE+ 
Sbjct  60   TCYHVHTKVVTPP--RDDTTAESTAANVG---KKRSLSNKEAVRKYCEKKKARVASLEEE  114

Query  499  VV  504
            VV
Sbjct  115  VV  116



>ref|XP_010516149.1| PREDICTED: uncharacterized protein LOC104791854 [Camelina sativa]
 ref|XP_010516157.1| PREDICTED: uncharacterized protein LOC104791854 [Camelina sativa]
Length=256

 Score =   115 bits (287),  Expect = 7e-28, Method: Compositional matrix adjust.
 Identities = 79/122 (65%), Positives = 93/122 (76%), Gaps = 10/122 (8%)
 Frame = +1

Query  139  MEDGELEFSNQEMLSSSNFCEFPDSNSYMDSFLNEILKDTHACTHAHTCNPPGPD-NSHT  315
            M+DGELEFSN  M+      E   S+  MDSF +E+L+D+HACTH HTCNP GP+ N+HT
Sbjct  1    MDDGELEFSNSNMVG-----ELLPSSCSMDSFFDELLRDSHACTHTHTCNPSGPENNTHT  55

Query  316  HTCYHVHTKIVPAPSEEDKAPSDDTAESVDKKEKKRPLGNreavrkyrekkkaraaLLED  495
            HTC HVHTKI+P+ S EDK  +DDT+ES     KKRPLGNREAVRKYREKKKA+AA LED
Sbjct  56   HTCLHVHTKILPSQS-EDKVSTDDTSESSG---KKRPLGNREAVRKYREKKKAKAASLED  111

Query  496  GV  501
             V
Sbjct  112  EV  113



>ref|XP_010489260.1| PREDICTED: uncharacterized protein LOC104766980 [Camelina sativa]
 ref|XP_010489261.1| PREDICTED: uncharacterized protein LOC104766980 [Camelina sativa]
 ref|XP_010489262.1| PREDICTED: uncharacterized protein LOC104766980 [Camelina sativa]
 ref|XP_010489264.1| PREDICTED: uncharacterized protein LOC104766980 [Camelina sativa]
Length=256

 Score =   114 bits (286),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 79/122 (65%), Positives = 93/122 (76%), Gaps = 10/122 (8%)
 Frame = +1

Query  139  MEDGELEFSNQEMLSSSNFCEFPDSNSYMDSFLNEILKDTHACTHAHTCNPPGP-DNSHT  315
            M+DGELEFSN  M+      E   S+  MDSF +E+L+D+HACTH HTCNP GP +N+HT
Sbjct  1    MDDGELEFSNSNMVG-----ELLPSSCSMDSFFDELLRDSHACTHTHTCNPSGPENNTHT  55

Query  316  HTCYHVHTKIVPAPSEEDKAPSDDTAESVDKKEKKRPLGNreavrkyrekkkaraaLLED  495
            HTC HVHTKI+P+ S EDK  +DDT+ES     KKRPLGNREAVRKYREKKKA+AA LED
Sbjct  56   HTCLHVHTKILPSQS-EDKVSTDDTSES---SGKKRPLGNREAVRKYREKKKAKAASLED  111

Query  496  GV  501
             V
Sbjct  112  EV  113



>emb|CDY26786.1| BnaC09g09130D [Brassica napus]
Length=239

 Score =   114 bits (285),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 81/122 (66%), Positives = 92/122 (75%), Gaps = 14/122 (11%)
 Frame = +1

Query  139  MEDGELEFSNQEMLSSSNFCEFPDSNSYMDSFLNEILKDTHACTHAHTCNPPGPDNSHTH  318
            M+DGELEF              P S+S MDSFL E+LKD+HACTH HTCNPPGP+N+HTH
Sbjct  1    MDDGELEF--------------PPSSSSMDSFLEELLKDSHACTHTHTCNPPGPENTHTH  46

Query  319  TCYHVHTKIVPAPSEEDKAPSDDTAESVDKKEKKRPLGNreavrkyrekkkaraaLLEDG  498
            TC HVHTKI+PA   +DK  +DDT+ES  KK KKRP GNREAVRKYREKKKA+AA LED 
Sbjct  47   TCLHVHTKILPAAQSDDKETTDDTSESSGKKSKKRPSGNREAVRKYREKKKAKAASLEDE  106

Query  499  VV  504
            VV
Sbjct  107  VV  108



>ref|NP_179268.2| transcription factor bZIP23 [Arabidopsis thaliana]
 dbj|BAC42143.1| putative bzip transcription factor atbzip23 [Arabidopsis thaliana]
 gb|ABI93931.1| At2g16770 [Arabidopsis thaliana]
 gb|AEC06536.1| Basic-leucine zipper (bZIP) transcription factor family protein 
[Arabidopsis thaliana]
Length=249

 Score =   114 bits (285),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 78/122 (64%), Positives = 91/122 (75%), Gaps = 15/122 (12%)
 Frame = +1

Query  139  MEDGELEFSNQEMLSSSNFCEFPDSNSYMDSFLNEILKDTHACTHAHTCNPPGPDNSHTH  318
            M+DGELEFSN  M       E P  +  MDSF +E+L+D+HACTH HTCNPPGP+N+HTH
Sbjct  1    MDDGELEFSNSNMGG-----ELPSCS--MDSFFDELLRDSHACTHTHTCNPPGPENTHTH  53

Query  319  TCYHVHTKIVPAPSEEDKAPSDDTAESVDKKEKKRPLGNreavrkyrekkkaraaLLEDG  498
            TC HVHTKI+P     DK  +DDT+ES     KKRPLGNREAVRKYREKKKA+AA LED 
Sbjct  54   TCLHVHTKILP-----DKVSTDDTSES---SGKKRPLGNREAVRKYREKKKAKAASLEDE  105

Query  499  VV  504
            V+
Sbjct  106  VM  107



>gb|AAD24610.1| hypothetical protein [Arabidopsis thaliana]
Length=255

 Score =   113 bits (283),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 78/122 (64%), Positives = 91/122 (75%), Gaps = 15/122 (12%)
 Frame = +1

Query  139  MEDGELEFSNQEMLSSSNFCEFPDSNSYMDSFLNEILKDTHACTHAHTCNPPGPDNSHTH  318
            M+DGELEFSN  M       E P  +  MDSF +E+L+D+HACTH HTCNPPGP+N+HTH
Sbjct  1    MDDGELEFSNSNMGG-----ELPSCS--MDSFFDELLRDSHACTHTHTCNPPGPENTHTH  53

Query  319  TCYHVHTKIVPAPSEEDKAPSDDTAESVDKKEKKRPLGNreavrkyrekkkaraaLLEDG  498
            TC HVHTKI+P     DK  +DDT+ES     KKRPLGNREAVRKYREKKKA+AA LED 
Sbjct  54   TCLHVHTKILP-----DKVSTDDTSES---SGKKRPLGNREAVRKYREKKKAKAASLEDE  105

Query  499  VV  504
            V+
Sbjct  106  VM  107



>ref|XP_011092972.1| PREDICTED: uncharacterized protein LOC105173033 isoform X1 [Sesamum 
indicum]
 ref|XP_011092973.1| PREDICTED: uncharacterized protein LOC105173033 isoform X1 [Sesamum 
indicum]
Length=288

 Score =   111 bits (278),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 81/139 (58%), Positives = 91/139 (65%), Gaps = 18/139 (13%)
 Frame = +1

Query  139  MEDGELEFSNQEMLSSSNFCEFPDSNSY-MDSFLN----------------EILKDTHAC  267
            M D ELEF ++E+LS  +      S S+ +D FL                 ++L  THAC
Sbjct  1    MYDTELEFPSEELLSCLDMANAQSSCSFDIDEFLVRTQACNDALGGTEACPDLLGRTHAC  60

Query  268  THAHTCNPPGPDNSHTHTCYHVHTKIVPAPSEEDKAPSDDTAESVDKKEKKRPLGNreav  447
            THAH CNPPGPD SHTHTC HVHT+I+P P E   AP DDTAESV KK KKRP GN EAV
Sbjct  61   THAHACNPPGPDKSHTHTCIHVHTQIMPTPGEL-HAPGDDTAESVGKKAKKRPSGNNEAV  119

Query  448  rkyrekkkaraaLLEDGVV  504
            RKYREKKKARAA LED VV
Sbjct  120  RKYREKKKARAASLEDEVV  138



>ref|XP_011092974.1| PREDICTED: uncharacterized protein LOC105173033 isoform X2 [Sesamum 
indicum]
Length=287

 Score =   111 bits (278),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 81/139 (58%), Positives = 91/139 (65%), Gaps = 18/139 (13%)
 Frame = +1

Query  139  MEDGELEFSNQEMLSSSNFCEFPDSNSY-MDSFLN----------------EILKDTHAC  267
            M D ELEF ++E+LS  +      S S+ +D FL                 ++L  THAC
Sbjct  1    MYDTELEFPSEELLSCLDMANAQSSCSFDIDEFLVRTQACNDALGGTEACPDLLGRTHAC  60

Query  268  THAHTCNPPGPDNSHTHTCYHVHTKIVPAPSEEDKAPSDDTAESVDKKEKKRPLGNreav  447
            THAH CNPPGPD SHTHTC HVHT+I+P P E   AP DDTAESV KK KKRP GN EAV
Sbjct  61   THAHACNPPGPDKSHTHTCIHVHTQIMPTPGEL-HAPGDDTAESVGKKAKKRPSGNNEAV  119

Query  448  rkyrekkkaraaLLEDGVV  504
            RKYREKKKARAA LED VV
Sbjct  120  RKYREKKKARAASLEDEVV  138



>emb|CBI37871.3| unnamed protein product [Vitis vinifera]
Length=127

 Score =   107 bits (267),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 51/69 (74%), Positives = 58/69 (84%), Gaps = 1/69 (1%)
 Frame = +1

Query  139  MEDGELEFSNQEMLSSSNFCEFPDSNSYMDSFLNEILKDTHACTHAHTCNPPGPDNSHTH  318
            M+DGEL+FSNQ++ SS N  + P S S MDSF +EILKDTHACTH HTCNPPGPD SHTH
Sbjct  1    MDDGELDFSNQDVFSSPNMADLPSSCS-MDSFFDEILKDTHACTHTHTCNPPGPDFSHTH  59

Query  319  TCYHVHTKI  345
            TC+HVHTKI
Sbjct  60   TCFHVHTKI  68



>gb|AFP19452.1| bZIP transcription factor family protein 1 [Camellia sinensis]
Length=270

 Score =   110 bits (275),  Expect = 5e-26, Method: Compositional matrix adjust.
 Identities = 74/122 (61%), Positives = 92/122 (75%), Gaps = 4/122 (3%)
 Frame = +1

Query  139  MEDGELEFSNQEMLSSSNFCEFPDSNSYMDSFLNEILKDTHACTHAHTCNPPGPDNSHTH  318
            MEDGE++FSNQE+ SS N  E P ++S+ +SFLN+  ++T  CTH H CNPP  D+SH+H
Sbjct  1    MEDGEIDFSNQEVCSSPNIGELPKTSSW-ESFLNDFQRET--CTHTHICNPPRLDSSHSH  57

Query  319  TCYHVHTKIVPAPSEEDKAPSDDTAESVDKKEKKRPLGNreavrkyrekkkaraaLLEDG  498
            TC HVHTKIVPA + +DK  + D AE ++KK  + P GNREAVRKYREKKKAR A LED 
Sbjct  58   TCRHVHTKIVPAAT-QDKVSTGDIAECLEKKSNRCPTGNREAVRKYREKKKARTASLEDE  116

Query  499  VV  504
            VV
Sbjct  117  VV  118



>ref|XP_004289872.1| PREDICTED: uncharacterized protein LOC101314521 [Fragaria vesca 
subsp. vesca]
Length=276

 Score =   108 bits (269),  Expect = 5e-25, Method: Compositional matrix adjust.
 Identities = 79/126 (63%), Positives = 94/126 (75%), Gaps = 5/126 (4%)
 Frame = +1

Query  139  MEDGELEFSNQEM-LSSSNFC-EFPDSNSYMDSFLNEILKDTH-ACTHAHTCNPP-GPDN  306
            M+DGEL+FSNQE+  S  N   E P S S M++   +  K+T  ACTH H CNPP GPD+
Sbjct  1    MDDGELDFSNQELDFSIPNMTGELPSSCS-MENIFGDFFKETDTACTHNHICNPPSGPDS  59

Query  307  SHTHTCYHVHTKIVPAPSEEDKAPSDDTAESVDKKEKKRPLGNreavrkyrekkkaraaL  486
            +H HTC HVHTKI+ + + EDKA +DDTAES +K  KKRPLGNREAVRKYREKKKARAA 
Sbjct  60   AHRHTCIHVHTKILSSGASEDKAGTDDTAESGEKNSKKRPLGNREAVRKYREKKKARAAS  119

Query  487  LEDGVV  504
            LED V+
Sbjct  120  LEDEVI  125



>gb|EYU37954.1| hypothetical protein MIMGU_mgv1a011243mg [Erythranthe guttata]
Length=288

 Score =   107 bits (266),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 78/139 (56%), Positives = 94/139 (68%), Gaps = 18/139 (13%)
 Frame = +1

Query  139  MEDGELEFSNQEMLSSSNFCEFPDSNSY-MDSFLN----------------EILKDTHAC  267
            M+DGEL+F + +M+S  +      S S+ +D FL                 ++L  T AC
Sbjct  1    MDDGELDFPSDQMMSCLDLPNAQSSCSFDIDEFLGRTQSCNDALGRTEAYTDVLGRTQAC  60

Query  268  THAHTCNPPGPDNSHTHTCYHVHTKIVPAPSEEDKAPSDDTAESVDKKEKKRPLGNreav  447
            THAH CNP GPD SHTHTC HVHT+I+ +PS E + PSDDTAESV+KK KKRP GNREAV
Sbjct  61   THAHACNPSGPDKSHTHTCIHVHTQIMHSPS-EGQDPSDDTAESVEKKGKKRPTGNREAV  119

Query  448  rkyrekkkaraaLLEDGVV  504
            RKYREKKKARAA LED V+
Sbjct  120  RKYREKKKARAASLEDEVI  138



>emb|CDX89748.1| BnaC03g46620D [Brassica napus]
Length=248

 Score =   106 bits (264),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 74/102 (73%), Positives = 87/102 (85%), Gaps = 1/102 (1%)
 Frame = +1

Query  199  EFPDSNSYMDSFLNEILKDTHACTHAHTCNPPGPDNSHTHTCYHVHTKIVPAPSEEDKAP  378
            EFP S+S MDSF +E+L+D+HACTH HTCNPPGP+N+HTHTC HVHTKI+PA + EDK  
Sbjct  7    EFPLSSSSMDSFFDELLRDSHACTHTHTCNPPGPENTHTHTCLHVHTKILPAQA-EDKEA  65

Query  379  SDDTAESVDKKEKKRPLGNreavrkyrekkkaraaLLEDGVV  504
            +DDT+ES   K KKRPLGNREAVRKYREKKKA+AA LED V+
Sbjct  66   TDDTSESSGNKSKKRPLGNREAVRKYREKKKAKAASLEDEVM  107



>emb|CDX69107.1| BnaC01g03460D [Brassica napus]
Length=271

 Score =   105 bits (261),  Expect = 5e-24, Method: Compositional matrix adjust.
 Identities = 78/132 (59%), Positives = 93/132 (70%), Gaps = 14/132 (11%)
 Frame = +1

Query  139  MEDGELEFSNQEMLSSSNFCE-FPDSNSYMDSFLNEILKDTH----------ACTHAHTC  285
            MEDGELEFSNQE+ SSS+     P SN  +DSF + +L D+H          ACTH HTC
Sbjct  1    MEDGELEFSNQEVFSSSDVVGGLPPSNGSIDSFFDGLLMDSHHQHQHQHQQGACTHTHTC  60

Query  286  N--PPGPDNSHTHTCYHVHTKIVPAPSEEDKAPSDDTAESVDKKEKKRPLGNreavrkyr  459
            N      DN+H+HTC+HVHTK++P  S+E K  +DDTAES  K  +KRPLGNREAVRKYR
Sbjct  61   NNSTGTADNTHSHTCFHVHTKVLPEDSDE-KVSTDDTAESCGKNGEKRPLGNREAVRKYR  119

Query  460  ekkkaraaLLED  495
            EKKKA+AA LED
Sbjct  120  EKKKAKAASLED  131



>ref|XP_009408222.1| PREDICTED: uncharacterized protein LOC103990705 isoform X2 [Musa 
acuminata subsp. malaccensis]
Length=239

 Score =   101 bits (251),  Expect = 9e-23, Method: Compositional matrix adjust.
 Identities = 54/101 (53%), Positives = 68/101 (67%), Gaps = 9/101 (9%)
 Frame = +1

Query  139  MEDGELEFSNQEMLSSSNFCEFPDSNSYMDSFLNEILKDTHACTHAHTCNPPGPDNSHTH  318
            M+DGE + SN E+ S+    E   S+  MDSF ++IL D H CTH HTCNPPGP+ SHTH
Sbjct  1    MDDGEPDLSNPEVFSTPGAGEDLPSSCSMDSFFDKILNDGHTCTHTHTCNPPGPNLSHTH  60

Query  319  TCYHVHTKIVPAPSEEDKAPSDDTAESVDKKE--KKRPLGN  435
            TC+HVHTKI+        +P D+TAESV+K +  KKRP  N
Sbjct  61   TCFHVHTKIL-------SSPPDETAESVEKSDSSKKRPCNN  94



>ref|XP_009408220.1| PREDICTED: uncharacterized protein LOC103990705 isoform X1 [Musa 
acuminata subsp. malaccensis]
 ref|XP_009408221.1| PREDICTED: uncharacterized protein LOC103990705 isoform X1 [Musa 
acuminata subsp. malaccensis]
Length=273

 Score =   100 bits (249),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 54/101 (53%), Positives = 68/101 (67%), Gaps = 9/101 (9%)
 Frame = +1

Query  139  MEDGELEFSNQEMLSSSNFCEFPDSNSYMDSFLNEILKDTHACTHAHTCNPPGPDNSHTH  318
            M+DGE + SN E+ S+    E   S+  MDSF ++IL D H CTH HTCNPPGP+ SHTH
Sbjct  1    MDDGEPDLSNPEVFSTPGAGEDLPSSCSMDSFFDKILNDGHTCTHTHTCNPPGPNLSHTH  60

Query  319  TCYHVHTKIVPAPSEEDKAPSDDTAESVDKKE--KKRPLGN  435
            TC+HVHTKI+        +P D+TAESV+K +  KKRP  N
Sbjct  61   TCFHVHTKIL-------SSPPDETAESVEKSDSSKKRPCNN  94



>ref|XP_009391011.1| PREDICTED: uncharacterized protein LOC103977271 [Musa acuminata 
subsp. malaccensis]
 ref|XP_009391012.1| PREDICTED: uncharacterized protein LOC103977271 [Musa acuminata 
subsp. malaccensis]
Length=275

 Score =   100 bits (248),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 55/103 (53%), Positives = 66/103 (64%), Gaps = 12/103 (12%)
 Frame = +1

Query  139  MEDGELEFSNQEMLSSSNFCEFPDSNSYMDSFLNEILKDT--HACTHAHTCNPPGPDNSH  312
            ME+G+L+FSN E+ S  N  + P S   MDS  + I  D+  H CTH HTCNPPGPD SH
Sbjct  1    MEEGDLDFSNPEVFSGPNAGDLP-SGCSMDSVFDNIFNDSQQHTCTHTHTCNPPGPDLSH  59

Query  313  THTCYHVHTKIVPAPSEEDKAPSDDTAESVDKKE--KKRPLGN  435
            THTC+HVHTKI+        AP+D+TAES  K    KKR  GN
Sbjct  60   THTCFHVHTKIL-------SAPADETAESAGKSSPTKKRSCGN  95



>gb|ACI90291.1| putative bZIP transcription factor [Picrorhiza kurrooa]
Length=289

 Score = 97.4 bits (241),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 74/140 (53%), Positives = 93/140 (66%), Gaps = 20/140 (14%)
 Frame = +1

Query  139  MEDGELEFSNQEMLS------SSNFCEF------------PDSNSYMDSFLNEILKDTHA  264
            M+ GEL+F ++++LS      + + C F             D+    ++F  ++L  T A
Sbjct  1    MDHGELDFPSEQLLSCLDVPNAQSSCSFDIEEYLGRPQTFSDTLGRTEAF-TDVLGRTQA  59

Query  265  CTHAHTCNPPGPDNSHTHTCYHVHTKIVPAPSEEDKAPSDDTAESVDKKEKKRPLGNrea  444
            CTHAH CNP GPD SHTHTC HVHT+I+P  S+  + PSDDTAESV+KK KKR  GNREA
Sbjct  60   CTHAHACNPSGPDKSHTHTCIHVHTQIMPTSSDGHE-PSDDTAESVEKKGKKRTSGNREA  118

Query  445  vrkyrekkkaraaLLEDGVV  504
            VRKYREKKKARAA LED V+
Sbjct  119  VRKYREKKKARAASLEDEVI  138



>gb|AAL79736.1|AC091774_27 putative transcription factor [Oryza sativa Japonica Group]
Length=297

 Score = 96.3 bits (238),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 76/129 (59%), Positives = 89/129 (69%), Gaps = 10/129 (8%)
 Frame = +1

Query  139  MEDGELEFSNQE-MLSSSNFCEFPDSNSYMDSFLNEILKDT--HACTHAHTCNPPGPDNS  309
            M+DG+L+FSN +  L  +     PD +  MDS+ ++ILKDT  HACTH HTCNPP  D S
Sbjct  1    MDDGDLDFSNPDTFLCPAVGGADPDGSCSMDSYFDDILKDTEHHACTHTHTCNPPVHDLS  60

Query  310  HTHTCYHVHTKIVPAPSEEDKAPSD--DTAES--VDKKEKKRPLGNreavrkyrekkkar  477
            HTHTC HVHTKIV APS+    PSD  +TAES   +   KKRP GNR AVRKYREKKKA 
Sbjct  61   HTHTCVHVHTKIVSAPSD---TPSDAAETAESPTENNASKKRPSGNRAAVRKYREKKKAH  117

Query  478  aaLLEDGVV  504
             A LE+ VV
Sbjct  118  TASLEEEVV  126



>ref|NP_001058591.1| Os06g0716800 [Oryza sativa Japonica Group]
 dbj|BAD53586.1| transcription factor-like [Oryza sativa Japonica Group]
 dbj|BAD61716.1| transcription factor-like [Oryza sativa Japonica Group]
 dbj|BAF20505.1| Os06g0716800 [Oryza sativa Japonica Group]
 gb|EAZ02370.1| hypothetical protein OsI_24474 [Oryza sativa Indica Group]
 dbj|BAG96347.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG92598.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEE66367.1| hypothetical protein OsJ_22672 [Oryza sativa Japonica Group]
Length=272

 Score = 95.9 bits (237),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 76/129 (59%), Positives = 89/129 (69%), Gaps = 10/129 (8%)
 Frame = +1

Query  139  MEDGELEFSNQE-MLSSSNFCEFPDSNSYMDSFLNEILKDT--HACTHAHTCNPPGPDNS  309
            M+DG+L+FSN +  L  +     PD +  MDS+ ++ILKDT  HACTH HTCNPP  D S
Sbjct  1    MDDGDLDFSNPDTFLCPAVGGADPDGSCSMDSYFDDILKDTEHHACTHTHTCNPPVHDLS  60

Query  310  HTHTCYHVHTKIVPAPSEEDKAPSD--DTAES--VDKKEKKRPLGNreavrkyrekkkar  477
            HTHTC HVHTKIV APS+    PSD  +TAES   +   KKRP GNR AVRKYREKKKA 
Sbjct  61   HTHTCVHVHTKIVSAPSD---TPSDAAETAESPTENNASKKRPSGNRAAVRKYREKKKAH  117

Query  478  aaLLEDGVV  504
             A LE+ VV
Sbjct  118  TASLEEEVV  126



>ref|XP_006656494.1| PREDICTED: uncharacterized protein LOC102721653 [Oryza brachyantha]
Length=269

 Score = 95.5 bits (236),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 70/126 (56%), Positives = 89/126 (71%), Gaps = 8/126 (6%)
 Frame = +1

Query  139  MEDGELEFSNQE--MLSSSNFCEFPDSNSYMDSFLNEILKDT--HACTHAHTCNPPGPDN  306
            M+DG+++FSN +  +  ++     PD +  MDS+ ++ILKDT  HACTH HTCNPP  D 
Sbjct  1    MDDGDIDFSNPDTFLCPAAGAGADPDGSCSMDSYFDDILKDTEHHACTHTHTCNPPVHDL  60

Query  307  SHTHTCYHVHTKIVPAPSEEDKAPSDDTAESVDKKEKKRPLGNreavrkyrekkkaraaL  486
            SHTHTC HVHTKIV APS++  +P+  TA+  +   KKRP GNR AVRKYREKKKA  A 
Sbjct  61   SHTHTCVHVHTKIVSAPSDDADSPT--TAD--NNASKKRPSGNRAAVRKYREKKKAHTAS  116

Query  487  LEDGVV  504
            LE+ VV
Sbjct  117  LEEEVV  122



>ref|XP_009401478.1| PREDICTED: uncharacterized protein LOC103985487 [Musa acuminata 
subsp. malaccensis]
Length=275

 Score = 94.0 bits (232),  Expect = 7e-20, Method: Compositional matrix adjust.
 Identities = 52/103 (50%), Positives = 68/103 (66%), Gaps = 11/103 (11%)
 Frame = +1

Query  139  MEDGELEFSNQEMLSSSNFCEFPDSNSYMDSFLNEILKDT--HACTHAHTCNPPGPDNSH  312
            M++G+++FSN E+ S  +  E   S+  MDSF + I  ++  H+CTH HTCNPPGPD SH
Sbjct  1    MDEGDVDFSNPEVFSGPSAGEDLPSSCSMDSFFDNIFNESQQHSCTHTHTCNPPGPDLSH  60

Query  313  THTCYHVHTKIVPAPSEEDKAPSDDTAESVDKKE--KKRPLGN  435
            THTC HVHTKI+        A +D+TAESV+K    KKR  GN
Sbjct  61   THTCLHVHTKILT-------AAADETAESVEKNSSTKKRSCGN  96



>ref|XP_003563276.1| PREDICTED: uncharacterized protein LOC100823660 [Brachypodium 
distachyon]
Length=269

 Score = 93.2 bits (230),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 71/127 (56%), Positives = 87/127 (69%), Gaps = 8/127 (6%)
 Frame = +1

Query  139  MEDGELEFSNQEMLSS---SNFCEFPDSNSYMDSFLNEILKDTH--ACTHAHTCNPPGPD  303
            M+DG+L+F+    L S   +   E P + S MDS+ +EILKDT   ACTH HTCNPP  D
Sbjct  1    MDDGDLDFNPDTYLCSGAAAGGTETPGACS-MDSYFDEILKDTEHLACTHTHTCNPPVHD  59

Query  304  NSHTHTCYHVHTKIVPAPSEEDKAPSDDTAESVDKKEKKRPLGNreavrkyrekkkaraa  483
             SHTHTC HVHTKIV A S+  ++P+++T     K  K+RP GNR AVRKYREKKKA  A
Sbjct  60   LSHTHTCVHVHTKIVSASSDGAESPAENTTSGTSK--KRRPSGNRAAVRKYREKKKAHTA  117

Query  484  LLEDGVV  504
            LLE+ VV
Sbjct  118  LLEEEVV  124



>ref|XP_004966468.1| PREDICTED: uncharacterized protein LOC101762708 isoform X1 [Setaria 
italica]
 ref|XP_004966469.1| PREDICTED: uncharacterized protein LOC101762708 isoform X2 [Setaria 
italica]
Length=261

 Score = 93.2 bits (230),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 70/127 (55%), Positives = 85/127 (67%), Gaps = 11/127 (9%)
 Frame = +1

Query  139  MEDGELEFSNQEMLSSSNFCEFPDSNSYMDSFLNEILKDT--HACTHAHTCNPPGPDNSH  312
            M+DG+L+FSN +          P S+  MDS+ ++ILKDT  HACTH HTCNPP  D+SH
Sbjct  1    MDDGDLDFSNPDTFLCPAIGNDPPSSCSMDSYFDDILKDTEHHACTHTHTCNPPVHDHSH  60

Query  313  THTCYHVHTKIV---PAPSEEDKAPSDDTAESVDKKEKKRPLGNreavrkyrekkkaraa  483
            THTC HVHTKIV   P  +E  ++PS++ A       KKRP GNR AVRKYREKKKA  A
Sbjct  61   THTCVHVHTKIVAASPDAAETAESPSENNA------SKKRPSGNRAAVRKYREKKKAHTA  114

Query  484  LLEDGVV  504
             LE+ VV
Sbjct  115  SLEEEVV  121



>ref|XP_002439031.1| hypothetical protein SORBIDRAFT_10g030250 [Sorghum bicolor]
 gb|EER90398.1| hypothetical protein SORBIDRAFT_10g030250 [Sorghum bicolor]
Length=273

 Score = 93.2 bits (230),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 73/135 (54%), Positives = 83/135 (61%), Gaps = 19/135 (14%)
 Frame = +1

Query  139  MEDGELEFSNQEMLSSSNFCEFPDSNSYMDSFLNEILKDT--HACTHAHTCNPPGPDNSH  312
            M+DG+L+FSN +          P S+  MDS+ +EILKDT  HACTH HTCNPP  D SH
Sbjct  1    MDDGDLDFSNPDTYLCPALGTDPPSSCSMDSYFDEILKDTEHHACTHTHTCNPPVHDLSH  60

Query  313  THTCYHVHTKIVPAPSEEDKAPSDDTAES-----------VDKKEKKRPLGNreavrkyr  459
            THTC HVHTKIV A      +P DD AES            +   KKRP GNR AVRKYR
Sbjct  61   THTCVHVHTKIVAA------SPGDDAAESPSENNTNTTGNSNAASKKRPSGNRAAVRKYR  114

Query  460  ekkkaraaLLEDGVV  504
            EKKKA  A LE+ VV
Sbjct  115  EKKKAHTASLEEEVV  129



>ref|NP_001141059.1| uncharacterized protein LOC100273140 [Zea mays]
 ref|XP_008681415.1| PREDICTED: uncharacterized protein LOC100273140 isoform X1 [Zea 
mays]
 gb|ACF85309.1| unknown [Zea mays]
 gb|ADX60074.1| bZIP transcription factor [Zea mays]
 gb|AFW69520.1| putative bZIP transcription factor superfamily protein isoform 
1 [Zea mays]
 gb|AFW69521.1| putative bZIP transcription factor superfamily protein isoform 
2 [Zea mays]
 gb|AFW69522.1| putative bZIP transcription factor superfamily protein isoform 
3 [Zea mays]
 gb|AFW69523.1| putative bZIP transcription factor superfamily protein isoform 
4 [Zea mays]
 gb|AIB04274.1| bZIP transcription factor, partial [Zea mays]
Length=276

 Score = 92.4 bits (228),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 73/137 (53%), Positives = 84/137 (61%), Gaps = 21/137 (15%)
 Frame = +1

Query  139  MEDGELEFSNQEMLSSSNFCEFPDSNSYMDSFLNEILKDT--HACTHAHTCNPPGPDNSH  312
            M+DG+L+FSN +          P S+  MDS+ +EILKDT  HACTH HTCNPP  D SH
Sbjct  1    MDDGDLDFSNPDTYLCPALGTDPPSSCSMDSYFDEILKDTEHHACTHTHTCNPPVHDLSH  60

Query  313  THTCYHVHTKIVPAPSEEDKAPSDDTAES-------------VDKKEKKRPLGNreavrk  453
            THTC HVHTKIV A      +P DDTA+S              +   KKRP GNR AVRK
Sbjct  61   THTCVHVHTKIVAA------SPGDDTADSPSENNTNGSGGNGSNAASKKRPSGNRAAVRK  114

Query  454  yrekkkaraaLLEDGVV  504
            YREKKKA  A LE+ VV
Sbjct  115  YREKKKAHTASLEEEVV  131



>gb|ACG32751.1| DNA binding protein [Zea mays]
Length=276

 Score = 92.4 bits (228),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 73/137 (53%), Positives = 84/137 (61%), Gaps = 21/137 (15%)
 Frame = +1

Query  139  MEDGELEFSNQEMLSSSNFCEFPDSNSYMDSFLNEILKDT--HACTHAHTCNPPGPDNSH  312
            M+DG+L+FSN +          P S+  MDS+ +EILKDT  HACTH HTCNPP  D SH
Sbjct  1    MDDGDLDFSNPDTYLCPALGTDPPSSCSMDSYFDEILKDTEHHACTHTHTCNPPVHDLSH  60

Query  313  THTCYHVHTKIVPAPSEEDKAPSDDTAES-------------VDKKEKKRPLGNreavrk  453
            THTC HVHTKIV A      +P DDTA+S              +   KKRP GNR AVRK
Sbjct  61   THTCVHVHTKIVAA------SPGDDTADSPSENNTNGSGGNGSNAASKKRPSGNRAAVRK  114

Query  454  yrekkkaraaLLEDGVV  504
            YREKKKA  A LE+ VV
Sbjct  115  YREKKKAHTASLEEEVV  131



>ref|NP_001148839.1| LOC100282457 [Zea mays]
 gb|ACG33099.1| DNA binding protein [Zea mays]
Length=267

 Score = 92.4 bits (228),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 68/124 (55%), Positives = 83/124 (67%), Gaps = 3/124 (2%)
 Frame = +1

Query  139  MEDGELEFSNQEMLSSSNFCEFPDSNSYMDSFLNEILKDTH--ACTHAHTCNPPGPDNSH  312
            M+DG+L+FSN +          P S+  MDS+ +EILKDT   ACTH HTCNPP  D SH
Sbjct  1    MDDGDLDFSNPDTYLCPALGTDPPSSCSMDSYFDEILKDTEHLACTHTHTCNPPVHDLSH  60

Query  313  THTCYHVHTKIVPAPSEEDKAPSDDTAESVDKKEKKRPLGNreavrkyrekkkaraaLLE  492
            THTC HVHTKIV A   + ++PS++ +   +   KKRP GNR AVRKYREKKKA  A LE
Sbjct  61   THTCVHVHTKIVAASPGDAESPSENNSNG-NAASKKRPSGNRAAVRKYREKKKAHTASLE  119

Query  493  DGVV  504
            + VV
Sbjct  120  EEVV  123



>ref|XP_008647848.1| PREDICTED: LOC100282457 isoform X1 [Zea mays]
 ref|XP_008647849.1| PREDICTED: LOC100282457 isoform X1 [Zea mays]
 ref|XP_008647850.1| PREDICTED: LOC100282457 isoform X1 [Zea mays]
 ref|XP_008647851.1| PREDICTED: LOC100282457 isoform X1 [Zea mays]
 ref|XP_008647852.1| PREDICTED: LOC100282457 isoform X1 [Zea mays]
 ref|XP_008647853.1| PREDICTED: LOC100282457 isoform X1 [Zea mays]
 gb|ACF83160.1| unknown [Zea mays]
 gb|ACN29059.1| unknown [Zea mays]
 gb|ACR33895.1| unknown [Zea mays]
 gb|AFU81623.1| bZIP-type transcription factor, partial [Zea mays subsp. mays]
 gb|AFW75759.1| putative bZIP transcription factor superfamily protein isoform 
1 [Zea mays]
 gb|AFW75760.1| putative bZIP transcription factor superfamily protein isoform 
2 [Zea mays]
 gb|AFW75761.1| putative bZIP transcription factor superfamily protein isoform 
3 [Zea mays]
 gb|AFW75762.1| putative bZIP transcription factor superfamily protein isoform 
4 [Zea mays]
 gb|AFW75763.1| putative bZIP transcription factor superfamily protein isoform 
5 [Zea mays]
 gb|AFW75764.1| putative bZIP transcription factor superfamily protein isoform 
6 [Zea mays]
 gb|AFW75765.1| putative bZIP transcription factor superfamily protein isoform 
7 [Zea mays]
Length=267

 Score = 92.4 bits (228),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 68/124 (55%), Positives = 83/124 (67%), Gaps = 3/124 (2%)
 Frame = +1

Query  139  MEDGELEFSNQEMLSSSNFCEFPDSNSYMDSFLNEILKDTH--ACTHAHTCNPPGPDNSH  312
            M+DG+L+FSN +          P S+  MDS+ +EILKDT   ACTH HTCNPP  D SH
Sbjct  1    MDDGDLDFSNPDTYLCPALGTDPPSSCSMDSYFDEILKDTEHLACTHTHTCNPPVHDLSH  60

Query  313  THTCYHVHTKIVPAPSEEDKAPSDDTAESVDKKEKKRPLGNreavrkyrekkkaraaLLE  492
            THTC HVHTKIV A   + ++PS++ +   +   KKRP GNR AVRKYREKKKA  A LE
Sbjct  61   THTCVHVHTKIVAASPGDAESPSENNSNG-NAASKKRPSGNRAAVRKYREKKKAHTASLE  119

Query  493  DGVV  504
            + VV
Sbjct  120  EEVV  123



>gb|EMT00406.1| hypothetical protein F775_29696 [Aegilops tauschii]
Length=266

 Score = 91.3 bits (225),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 68/125 (54%), Positives = 83/125 (66%), Gaps = 9/125 (7%)
 Frame = +1

Query  139  MEDGELEFSNQEMLSSSNFCEFPDSNSYMDSFLNEILKDTH--ACTHAHTCNPPGPDNSH  312
            M+DG+L+FSN E    +   + P     MDS+ +E L DT   ACTH HTCNPP  D+SH
Sbjct  1    MDDGDLDFSNPEAYLDTG-ADLPGGGCSMDSYFDEFLNDTEHLACTHTHTCNPPVDDSSH  59

Query  313  THTCYHVHTKIVPAPSEEDK-APSDDTAESVDKKEKKRPLGNreavrkyrekkkaraaLL  489
            THTC HVHTKIV A S+    +P++++  S     KKRP GNR AVRKYREKKKA  ALL
Sbjct  60   THTCVHVHTKIVSASSDGGADSPAENSGAS-----KKRPSGNRAAVRKYREKKKAHTALL  114

Query  490  EDGVV  504
            E+ VV
Sbjct  115  EEEVV  119



>gb|EPS65924.1| hypothetical protein M569_08855 [Genlisea aurea]
Length=246

 Score = 90.9 bits (224),  Expect = 6e-19, Method: Compositional matrix adjust.
 Identities = 63/89 (71%), Positives = 70/89 (79%), Gaps = 8/89 (9%)
 Frame = +1

Query  241  EILKDTHACTHAHTCNPPGPDNSHTHTCYHVHTKIVPAPSEEDKAPSDDTAESVDK-KEK  417
            ++L  T ACTHAH CNP GPD SHTHTC HVHT+I+        +PSDDTAES+DK K K
Sbjct  50   DVLGRTQACTHAHACNPSGPDKSHTHTCIHVHTQIMA-------SPSDDTAESIDKNKSK  102

Query  418  KRPLGNreavrkyrekkkaraaLLEDGVV  504
            KRPLGNREAVRKYREKKKARAA LED V+
Sbjct  103  KRPLGNREAVRKYREKKKARAASLEDEVI  131



>gb|AFW69519.1| putative bZIP transcription factor superfamily protein [Zea mays]
Length=332

 Score = 91.3 bits (225),  Expect = 6e-19, Method: Compositional matrix adjust.
 Identities = 73/137 (53%), Positives = 84/137 (61%), Gaps = 21/137 (15%)
 Frame = +1

Query  139  MEDGELEFSNQEMLSSSNFCEFPDSNSYMDSFLNEILKDT--HACTHAHTCNPPGPDNSH  312
            M+DG+L+FSN +          P S+  MDS+ +EILKDT  HACTH HTCNPP  D SH
Sbjct  1    MDDGDLDFSNPDTYLCPALGTDPPSSCSMDSYFDEILKDTEHHACTHTHTCNPPVHDLSH  60

Query  313  THTCYHVHTKIVPAPSEEDKAPSDDTAES-------------VDKKEKKRPLGNreavrk  453
            THTC HVHTKIV A      +P DDTA+S              +   KKRP GNR AVRK
Sbjct  61   THTCVHVHTKIVAA------SPGDDTADSPSENNTNGSGGNGSNAASKKRPSGNRAAVRK  114

Query  454  yrekkkaraaLLEDGVV  504
            YREKKKA  A LE+ VV
Sbjct  115  YREKKKAHTASLEEEVV  131



>ref|XP_006846902.1| hypothetical protein AMTR_s00152p00031760 [Amborella trichopoda]
 gb|ERN08483.1| hypothetical protein AMTR_s00152p00031760 [Amborella trichopoda]
Length=293

 Score = 87.8 bits (216),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 71/138 (51%), Positives = 96/138 (70%), Gaps = 19/138 (14%)
 Frame = +1

Query  139  MEDGELEFSNQEMLSSSNF------CEFPDSNSYMDSFLNEI-LKDTHA--CTHAHTCNP  291
            MEDGE++FSNQ++ S  +       C   D    M SF  ++ +KD H+  CTH HTCNP
Sbjct  1    MEDGEIDFSNQDVFSRPSMEMGLGDC---DDGCSMGSFFEDLFVKDIHSQSCTHTHTCNP  57

Query  292  P-GPDNSHTHTCYHVHTKIVPA--PSEEDKAPS----DDTAESVDKKEKKRPLGNreavr  450
            P GPD +HTHTC+HVHTKI+ +  P+ +D A +    ++++   ++++KKRPLGN+EAVR
Sbjct  58   PAGPDLAHTHTCFHVHTKILSSADPNNDDDAAATTGEEESSSINEQQKKKRPLGNKEAVR  117

Query  451  kyrekkkaraaLLEDGVV  504
            KYREKKKARAA LED VV
Sbjct  118  KYREKKKARAASLEDEVV  135



>ref|XP_009106517.1| PREDICTED: uncharacterized protein LOC103832273 [Brassica rapa]
Length=237

 Score = 86.3 bits (212),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 70/125 (56%), Positives = 80/125 (64%), Gaps = 22/125 (18%)
 Frame = +1

Query  139  MEDGELE-FSNQEMLSSSNFCEFPDSNSYMDSFLNEILKDTH-----ACTHAHTCNPPGP  300
            MEDGELE FS               SN  +DSF + +L D+H     ACTH HTCN    
Sbjct  1    MEDGELEVFS---------------SNGSIDSFFDGLLMDSHHHQQGACTHTHTCNNSTG  45

Query  301  DNSHTHTCYHVHTKIVPAPSEEDKAPSDDTAESVDKKEKKRPLGNreavrkyrekkkara  480
               H HTC+HVHTKI+P  S+E K  +DDTAES  K  +KRPLGNREAVRKYREKKKA+A
Sbjct  46   TEPHAHTCFHVHTKILPEDSDE-KVSTDDTAESCGKNGEKRPLGNREAVRKYREKKKAKA  104

Query  481  aLLED  495
            A LED
Sbjct  105  ASLED  109



>emb|CDY52654.1| BnaAnng11690D [Brassica napus]
Length=238

 Score = 85.9 bits (211),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 70/126 (56%), Positives = 80/126 (63%), Gaps = 23/126 (18%)
 Frame = +1

Query  139  MEDGELE-FSNQEMLSSSNFCEFPDSNSYMDSFLNEILKDTH------ACTHAHTCNPPG  297
            MEDGELE FS               SN  +DSF + +L D+H      ACTH HTCN   
Sbjct  1    MEDGELEVFS---------------SNGSIDSFFDGLLMDSHHQHQQGACTHTHTCNNST  45

Query  298  PDNSHTHTCYHVHTKIVPAPSEEDKAPSDDTAESVDKKEKKRPLGNreavrkyrekkkar  477
                H HTC+HVHTKI+P  S+E K  +DDTAES  K  +KRPLGNREAVRKYREKKKA+
Sbjct  46   GTEPHAHTCFHVHTKILPEDSDE-KVSTDDTAESCGKNGEKRPLGNREAVRKYREKKKAK  104

Query  478  aaLLED  495
            AA LED
Sbjct  105  AASLED  110



>ref|XP_009136335.1| PREDICTED: uncharacterized protein LOC103860484 [Brassica rapa]
 ref|XP_009136337.1| PREDICTED: uncharacterized protein LOC103860484 [Brassica rapa]
Length=239

 Score = 85.5 bits (210),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 70/102 (69%), Positives = 82/102 (80%), Gaps = 7/102 (7%)
 Frame = +1

Query  199  EFPDSNSYMDSFLNEILKDTHACTHAHTCNPPGPDNSHTHTCYHVHTKIVPAPSEEDKAP  378
            EFP S+S MDSF +E+L+D+HACTH HTCNPPGP+N+HTHTC HVHTKI+P       A 
Sbjct  7    EFPLSSSSMDSFFDELLRDSHACTHTHTCNPPGPENTHTHTCLHVHTKILP-------AQ  59

Query  379  SDDTAESVDKKEKKRPLGNreavrkyrekkkaraaLLEDGVV  504
            +DDT+ES   K KK PLGNREAVRKYREKKKA+AA LED V+
Sbjct  60   ADDTSESSGSKSKKTPLGNREAVRKYREKKKAKAASLEDEVI  101



>emb|CDY02237.1| BnaA03g39300D [Brassica napus]
Length=239

 Score = 85.5 bits (210),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 70/102 (69%), Positives = 82/102 (80%), Gaps = 7/102 (7%)
 Frame = +1

Query  199  EFPDSNSYMDSFLNEILKDTHACTHAHTCNPPGPDNSHTHTCYHVHTKIVPAPSEEDKAP  378
            EFP S+S MDSF +E+L+D+HACTH HTCNPPGP+N+HTHTC HVHTKI+P       A 
Sbjct  7    EFPLSSSSMDSFFDELLRDSHACTHTHTCNPPGPENTHTHTCLHVHTKILP-------AK  59

Query  379  SDDTAESVDKKEKKRPLGNreavrkyrekkkaraaLLEDGVV  504
            +DDT+ES   K KK PLGNREAVRKYREKKKA+AA LED V+
Sbjct  60   ADDTSESSGSKSKKTPLGNREAVRKYREKKKAKAASLEDEVI  101



>ref|XP_010935120.1| PREDICTED: uncharacterized protein LOC105055101 [Elaeis guineensis]
Length=273

 Score = 85.5 bits (210),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 75/125 (60%), Positives = 89/125 (71%), Gaps = 10/125 (8%)
 Frame = +1

Query  139  MEDGELEFSNQEMLSSSNFCEFPDSNSYMDSFLNEILKDTHACTHAHT--CNPPGPDNSH  312
            M++G+L+ SN E  S  +  E   S+  MDSF +EILKDTH  +  HT  CNPPGPD SH
Sbjct  1    MDEGDLDLSNPEAFSGPSMGEDLPSSCSMDSFFDEILKDTHHHSCTHTHTCNPPGPDLSH  60

Query  313  THTCYHVHTKIVPAPSEEDKAPSDDTAESVDK-KEKKRPLGNreavrkyrekkkaraaLL  489
            THTC+HVHTKI+        AP+D+TAES +K   KKRP GNREAVRKYREKKKARAA L
Sbjct  61   THTCFHVHTKIL-------SAPADETAESAEKSSSKKRPSGNREAVRKYREKKKARAASL  113

Query  490  EDGVV  504
            ED V+
Sbjct  114  EDEVI  118



>ref|XP_001758867.1| predicted protein [Physcomitrella patens]
 gb|EDQ76373.1| predicted protein, partial [Physcomitrella patens]
Length=171

 Score = 83.2 bits (204),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 69/124 (56%), Positives = 86/124 (69%), Gaps = 4/124 (3%)
 Frame = +1

Query  139  MEDGELEFSNQEMLSSSNFCEFPDSNSYMDS---FLNEILKDTHACTHAHTCNPPGPDNS  309
            M+DGELEF++ ++ +  + C+ P + + M S   FL E+L+ THACTH HTCNPPGPDN+
Sbjct  1    MDDGELEFTDHDVFAGCSLCDLPSTPTTMGSMENFLEEVLRSTHACTHTHTCNPPGPDNT  60

Query  310  HTHTCYHVHTKIVPAPSEEDKAPSDDTAESVDKKEKKRPLGNreavrkyrekkkaraaLL  489
            HTHTCYH HT +  A  E+  A   +T  S     KKRPLGNREAVRKYREKKKA  A L
Sbjct  61   HTHTCYHTHTHLFAAGEEDTSADKSETPTS-SHNSKKRPLGNREAVRKYREKKKAHTAYL  119

Query  490  EDGV  501
            E+ V
Sbjct  120  EEQV  123



>gb|KJB76277.1| hypothetical protein B456_012G081200 [Gossypium raimondii]
Length=257

 Score = 84.0 bits (206),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 45/100 (45%), Positives = 67/100 (67%), Gaps = 5/100 (5%)
 Frame = +1

Query  139  MEDGELEFSNQEMLSSSN-FCEFPDSNSYMDSFLNEILKDTHACTHAHTCNPPGPDNSHT  315
            MEDGE+E S+  +LS++     F DS S +D  ++E LK+T  C+H HTCNPPGPD +H+
Sbjct  13   MEDGEIELSDHVLLSNTAPSTNFQDSTS-VDLIIDEYLKNTRTCSHTHTCNPPGPDVAHS  71

Query  316  HTCYHVHTKIVPAPSEEDKAPSDDTAESVDKKEKKRPLGN  435
            HTCYH HT+++   SE+D   ++  +  ++ K  +R LGN
Sbjct  72   HTCYHTHTQLL--TSEDDDYHNNKASSGLNLK-PRRSLGN  108



>gb|KJB76278.1| hypothetical protein B456_012G081200 [Gossypium raimondii]
 gb|KJB76279.1| hypothetical protein B456_012G081200 [Gossypium raimondii]
Length=249

 Score = 84.0 bits (206),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 45/100 (45%), Positives = 65/100 (65%), Gaps = 5/100 (5%)
 Frame = +1

Query  139  MEDGELEFSNQEMLSSSN-FCEFPDSNSYMDSFLNEILKDTHACTHAHTCNPPGPDNSHT  315
            MEDGE+E S+  +LS++     F DS S +D  ++E LK+T  C+H HTCNPPGPD +H+
Sbjct  5    MEDGEIELSDHVLLSNTAPSTNFQDSTS-VDLIIDEYLKNTRTCSHTHTCNPPGPDVAHS  63

Query  316  HTCYHVHTKIVPAPSEEDKAPSDDTAESVDKKEKKRPLGN  435
            HTCYH HT+++   + ED    ++ A S    + +R LGN
Sbjct  64   HTCYHTHTQLL---TSEDDDYHNNKASSGLNLKPRRSLGN  100



>ref|XP_008800178.1| PREDICTED: uncharacterized protein LOC103714633 isoform X2 [Phoenix 
dactylifera]
Length=266

 Score = 80.9 bits (198),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 45/81 (56%), Positives = 54/81 (67%), Gaps = 9/81 (11%)
 Frame = +1

Query  199  EFPDSNSYMDSFLNEILKDT--HACTHAHTCNPPGPDNSHTHTCYHVHTKIVPAPSEEDK  372
            + P S S  D F +E LKD   H+CTH HTCN PGP+ SHTHTC+HVHTKIV A +EE  
Sbjct  22   QMPGSCSIND-FFDESLKDVPHHSCTHTHTCNHPGPNLSHTHTCFHVHTKIVSASAEE--  78

Query  373  APSDDTAESVDKKEKKRPLGN  435
              + D+AE      KKRP+GN
Sbjct  79   --TSDSAEK--SSSKKRPMGN  95



>ref|XP_008800177.1| PREDICTED: uncharacterized protein LOC103714633 isoform X1 [Phoenix 
dactylifera]
Length=271

 Score = 80.9 bits (198),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 45/81 (56%), Positives = 54/81 (67%), Gaps = 9/81 (11%)
 Frame = +1

Query  199  EFPDSNSYMDSFLNEILKDT--HACTHAHTCNPPGPDNSHTHTCYHVHTKIVPAPSEEDK  372
            + P S S  D F +E LKD   H+CTH HTCN PGP+ SHTHTC+HVHTKIV A +EE  
Sbjct  22   QMPGSCSIND-FFDESLKDVPHHSCTHTHTCNHPGPNLSHTHTCFHVHTKIVSASAEE--  78

Query  373  APSDDTAESVDKKEKKRPLGN  435
              + D+AE      KKRP+GN
Sbjct  79   --TSDSAEK--SSSKKRPMGN  95



>ref|XP_009418779.1| PREDICTED: uncharacterized protein LOC103998893 [Musa acuminata 
subsp. malaccensis]
Length=272

 Score = 80.5 bits (197),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 50/104 (48%), Positives = 64/104 (62%), Gaps = 17/104 (16%)
 Frame = +1

Query  139  MEDGELEFSNQEMLSSSNFCE-FPDSNSYMDSFLNEILKD--THACTHAHTCNPPGPDNS  309
            M+DG+++FSN ++ S  N  +  P S S +DSF ++I  D   H CTH HTCNP     S
Sbjct  1    MDDGDIDFSNPDVFSGPNAGDDLPGSRS-IDSFFDDIFNDGQQHTCTHTHTCNPL----S  55

Query  310  HTHTCYHVHTKIVPAPSEEDKAPSDDTAESVDKKE--KKRPLGN  435
            HTHTC+HVHTKIV        AP D+ AES++K    KKR  GN
Sbjct  56   HTHTCFHVHTKIV-------SAPPDEAAESMEKSSSTKKRSCGN  92



>ref|XP_010920114.1| PREDICTED: uncharacterized protein LOC105044037 [Elaeis guineensis]
 ref|XP_010920115.1| PREDICTED: uncharacterized protein LOC105044037 [Elaeis guineensis]
 ref|XP_010920117.1| PREDICTED: uncharacterized protein LOC105044037 [Elaeis guineensis]
Length=262

 Score = 79.7 bits (195),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 41/77 (53%), Positives = 52/77 (68%), Gaps = 10/77 (13%)
 Frame = +1

Query  214  NSYMDSFLNEILKDT--HACTHAHTCNPPGPDNSHTHTCYHVHTKIVPAPSEEDKAPSDD  387
            N  ++ F +E +KD   H+CTH HTCNPPGPD SH+HTC+H HTKI+ AP+ E       
Sbjct  22   NCSINGFFDESVKDMPRHSCTHTHTCNPPGPDLSHSHTCFHAHTKILSAPAME-------  74

Query  388  TAESVDKKE-KKRPLGN  435
            T ES +K   KKRP+GN
Sbjct  75   TFESAEKSLPKKRPIGN  91



>ref|XP_008813516.1| PREDICTED: uncharacterized protein LOC103724133, partial [Phoenix 
dactylifera]
Length=277

 Score = 72.4 bits (176),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 61/120 (51%), Positives = 79/120 (66%), Gaps = 7/120 (6%)
 Frame = +1

Query  151  ELEFSNQEMLSSSNFCEFPDSNSYMDSFLNEILKDT--HACTHAHTCNPPGPDNSHTHTC  324
            +L+F N E+    +  +    N ++D F +E +KD   H+CTH HTCNPPG D SHTHTC
Sbjct  2    DLDFPNPEVFPGPDVGDQMPGNCWIDGFFDESVKDMPRHSCTHTHTCNPPGGDLSHTHTC  61

Query  325  YHVHTKIVPAPSEEDKAPSDDTAESVDKKEKKRPLGNreavrkyrekkkaraaLLEDGVV  504
            +H HT+I+ APSEE       +  +     KKRP+GNREAVRKYREKKKA+ A LED +V
Sbjct  62   FHAHTRILSAPSEETS-----SESAEKSSSKKRPIGNREAVRKYREKKKAQTASLEDEIV  116



>ref|XP_011091785.1| PREDICTED: putative transcription factor kapC [Sesamum indicum]
Length=256

 Score = 72.0 bits (175),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 48/99 (48%), Positives = 69/99 (70%), Gaps = 5/99 (5%)
 Frame = +1

Query  139  MEDGELEFSNQEMLSSSNFCEFPDSNSYMDSFLNEILKDTHACTHAHTCNPPGPDNSHTH  318
            M+DGE+E S++ +L +S+      ++   DSFL+++L++   CTH HTCNPPGPD +HTH
Sbjct  5    MDDGEVELSDRLLLPNSDSSSNIQASLSADSFLDDLLRNAQTCTHTHTCNPPGPDTAHTH  64

Query  319  TCYHVHTKIVPAPSEEDKAPSDDTAESVDKKEKKRPLGN  435
            TCYH HT ++  PSEED  P D+ +  V K++  RPLGN
Sbjct  65   TCYHTHTHVI--PSEEDNDPCDEKS-PVSKRQ--RPLGN  98



>ref|XP_008790182.1| PREDICTED: uncharacterized protein LOC103707462 [Phoenix dactylifera]
Length=268

 Score = 72.0 bits (175),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 61/120 (51%), Positives = 79/120 (66%), Gaps = 7/120 (6%)
 Frame = +1

Query  151  ELEFSNQEMLSSSNFCEFPDSNSYMDSFLNEILKDT--HACTHAHTCNPPGPDNSHTHTC  324
            +L+F N E+    +  +    N ++D F +E +KD   H+CTH HTCNPPG D SHTHTC
Sbjct  4    DLDFPNPEVFPGPDVGDQMPGNCWIDGFFDESVKDMPRHSCTHTHTCNPPGGDLSHTHTC  63

Query  325  YHVHTKIVPAPSEEDKAPSDDTAESVDKKEKKRPLGNreavrkyrekkkaraaLLEDGVV  504
            +H HT+I+ APSEE       +  +     KKRP+GNREAVRKYREKKKA+ A LED +V
Sbjct  64   FHAHTRILSAPSEETS-----SESAEKSSSKKRPIGNREAVRKYREKKKAQTASLEDEIV  118



>dbj|BAJ84101.1| RNA-dependent RNA polymerase, partial [Bat coronavirus M.ful/Japan/02/2010]
Length=108

 Score = 65.9 bits (159),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 50/99 (51%), Positives = 59/99 (60%), Gaps = 2/99 (2%)
 Frame = +2

Query  170  RRCYPVRISANFQTVTPIWIAF*MKSSRILMHALMLTPATRLALITPTPTLVTMCTPK*Y  349
            +RC  V+I    Q V  +WIAF MK SRI M AL+ TPAT  ALI    TLV MCTPK Y
Sbjct  11   KRCSRVQIWVISQVVA-LWIAFSMKFSRIHMPALIPTPATHPALIYRIRTLVFMCTPKLY  69

Query  350  LLPVK-KIRPPVMILQNLWIRKKRNGLSAIGKLSASTGR  463
            L  ++  IR P+M L +L  R +RN    I K  AST R
Sbjct  70   LAQLRTTIRLPLMTLPSLPKRNQRNAHRVIVKQFASTER  108



>ref|XP_008788583.1| PREDICTED: uncharacterized protein LOC103706294 [Phoenix dactylifera]
Length=225

 Score = 64.3 bits (155),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 53/122 (43%), Positives = 76/122 (62%), Gaps = 18/122 (15%)
 Frame = +1

Query  139  MEDGELEFSNQEMLSSSNFCEFPDSNSYMDSFLNEILKDTHACTHAHTCNPPGPDNS-HT  315
            M+DGE++ S+  +L           N  M +  +E L+++  CTH HTCNPPGP  + HT
Sbjct  1    MDDGEVDLSSHLLLP----------NPEMTNSFDEYLRNSRTCTHTHTCNPPGPAAAMHT  50

Query  316  HTCYHVHTKIVPAPSEEDKAPSDDTAESVDKKEKKRPLGNreavrkyrekkkaraaLLED  495
            HTCYH H ++  A ++ ++   ++       K  ++PLGNREAVRKYREKKKA+AA LE+
Sbjct  51   HTCYHTHMQVF-ATTDGERGGEEEL------KTSRKPLGNREAVRKYREKKKAQAAYLEE  103

Query  496  GV  501
             V
Sbjct  104  EV  105



>gb|EMS47152.1| hypothetical protein TRIUR3_12850 [Triticum urartu]
Length=195

 Score = 63.5 bits (153),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 37/102 (36%), Positives = 53/102 (52%), Gaps = 15/102 (15%)
 Frame = +1

Query  139  MEDGELEFSNQEMLSSSNFCEFPDSNSYMDSFLNEILKDTHACTHAHTCNPPGPDNSHTH  318
            M+DG+L+FS+  M             SY D  L    +    CTH HTCNPP  D  HTH
Sbjct  1    MDDGDLDFSSMSM------------GSYFDDLLGGTAEHLACCTHTHTCNPPAHDLPHTH  48

Query  319  TCYHVHTKI--VPAPSEEDKAPSD-DTAESVDKKEKKRPLGN  435
            TC+HVH+K     +      +P++ + A +  + +K+RP GN
Sbjct  49   TCHHVHSKFAASASSDAAADSPTEPEDAHATSRSKKRRPSGN  90



>gb|EMT32723.1| hypothetical protein F775_08202 [Aegilops tauschii]
Length=176

 Score = 62.0 bits (149),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 36/102 (35%), Positives = 53/102 (52%), Gaps = 15/102 (15%)
 Frame = +1

Query  139  MEDGELEFSNQEMLSSSNFCEFPDSNSYMDSFLNEILKDTHACTHAHTCNPPGPDNSHTH  318
            M+DG+L+FS+  M             SY D  L    +    CTH HTCNPP  D  H+H
Sbjct  1    MDDGDLDFSSMSM------------GSYFDDVLGGAAEHLACCTHTHTCNPPAHDLPHSH  48

Query  319  TCYHVHTKI--VPAPSEEDKAPSD-DTAESVDKKEKKRPLGN  435
            TC+HVH+K     +      +P++ + A +  + +K+RP GN
Sbjct  49   TCHHVHSKFAASASSDAAADSPTEPEDAHATSRSKKRRPSGN  90



>ref|XP_007149027.1| hypothetical protein PHAVU_005G034400g [Phaseolus vulgaris]
 ref|XP_007149028.1| hypothetical protein PHAVU_005G034400g [Phaseolus vulgaris]
 gb|ESW21021.1| hypothetical protein PHAVU_005G034400g [Phaseolus vulgaris]
 gb|ESW21022.1| hypothetical protein PHAVU_005G034400g [Phaseolus vulgaris]
Length=260

 Score = 62.8 bits (151),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 30/60 (50%), Positives = 35/60 (58%), Gaps = 8/60 (13%)
 Frame = +1

Query  256  THACTHAHTCNPPGPDNSHTHTCYHVHTKIVPAPSEEDKAPSDDTAESVDKKEKKRPLGN  435
            +  CTH HTCNPPGPD +HTHTCYH HT+I          P DD  +     + KRP GN
Sbjct  44   SRTCTHTHTCNPPGPDAAHTHTCYHSHTQIF--------GPEDDDDKEHTNSKPKRPSGN  95



>gb|EMS52367.1| hypothetical protein TRIUR3_01653 [Triticum urartu]
Length=182

 Score = 61.2 bits (147),  Expect = 9e-09, Method: Compositional matrix adjust.
 Identities = 34/78 (44%), Positives = 47/78 (60%), Gaps = 5/78 (6%)
 Frame = +1

Query  217  SYMDSFLNEILKDTH--ACTHAHTCNPPGPDNSHTHTCYHVHTKI--VPAPSEEDKAPSD  384
            S M S+ ++IL DT   ACTH HTCNPP     HTHTC HVH+K     +     + P++
Sbjct  9    SSMGSYFDDILMDTEQVACTHTHTCNPPAHHLPHTHTCLHVHSKFAASASSDAGAETPAE  68

Query  385  -DTAESVDKKEKKRPLGN  435
             + A +  + +K+RPLGN
Sbjct  69   FEDAHATSRSKKRRPLGN  86



>gb|EMT32714.1| hypothetical protein F775_17324 [Aegilops tauschii]
Length=188

 Score = 60.8 bits (146),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 50/99 (51%), Positives = 62/99 (63%), Gaps = 7/99 (7%)
 Frame = +1

Query  217  SYMDSFLNEILKDTH--ACTHAHTCNPPGPDNSHTHTCYHVHTKI----VPAPSEEDKAP  378
            S M S+ ++IL DT   ACTH HTCNPP     HTHTC HVH+KI          E  A 
Sbjct  9    SSMGSYFDDILMDTEQVACTHTHTCNPPAHHLPHTHTCLHVHSKIAASASSDAGAETPAG  68

Query  379  SDDTAESVDKKEKKRPLGNreavrkyrekkkaraaLLED  495
             +D A +  + +++RP GN+ AVRKYREKKKA  ALLE+
Sbjct  69   FED-AHATSRSKRRRPSGNQAAVRKYREKKKAHTALLEE  106



>emb|CAB41316.1| putative protein [Arabidopsis thaliana]
Length=157

 Score = 58.5 bits (140),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 45/84 (54%), Positives = 57/84 (68%), Gaps = 8/84 (10%)
 Frame = +1

Query  256  THACTHAHTCNPPGP-DNSHTHTCYHVHTKIVPAPSEEDKAPSDDTAESVDKKEKKRPLG  432
            T  C+H H+CNPPGP D SH+HTC+H HT ++ +  +++   SD +        KKR  G
Sbjct  13   TRGCSHTHSCNPPGPEDASHSHTCFHAHTHLIISQDQQENDHSDSS-------NKKRLCG  65

Query  433  NreavrkyrekkkaraaLLEDGVV  504
            NREAVRKYREKKKAR A LED V+
Sbjct  66   NREAVRKYREKKKARTAYLEDEVM  89



>ref|XP_009354398.1| PREDICTED: transcription factor TGA3 [Pyrus x bretschneideri]
 ref|XP_009354399.1| PREDICTED: transcription factor TGA3 [Pyrus x bretschneideri]
Length=245

 Score = 58.9 bits (141),  Expect = 9e-08, Method: Compositional matrix adjust.
 Identities = 61/125 (49%), Positives = 81/125 (65%), Gaps = 11/125 (9%)
 Frame = +1

Query  139  MEDGELEFSNQEML----SSSNFCEFPDSNSYMDSFLNEILKDTHACTHAHTCNPPGPDN  306
            M+DGE+  S+  +L    SSSNF      ++Y D+F +E LK    CTH HTCNPPGP+ 
Sbjct  1    MDDGEVVTSDHALLPNPNSSSNF----HGSTYEDTFFDEFLKTARTCTHTHTCNPPGPEA  56

Query  307  SHTHTCYHVHTKIVPAPSEEDKAPSDDTAESVDKKEKKRPLGNreavrkyrekkkaraaL  486
            +HTHTCYH HT+++P+   ED   + +   S  +  ++R  GN+EAVRKYREKKKA  A 
Sbjct  57   AHTHTCYHTHTQVLPS---EDDDGTKNKEHSNLRPRRRRSSGNKEAVRKYREKKKAHTAY  113

Query  487  LEDGV  501
            LED V
Sbjct  114  LEDEV  118



>emb|CDP21594.1| unnamed protein product [Coffea canephora]
Length=265

 Score = 58.9 bits (141),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 39/87 (45%), Positives = 59/87 (68%), Gaps = 5/87 (6%)
 Frame = +1

Query  139  MEDGELEFSNQEMLSSSNFCEFPDSNSYMDSFLNEILKDTHACTHAHTCNPPGPDNSHTH  318
            M+D E+E S+  ++ +S+      ++  +DSFL+E+L++   CTH HTCNPPGPD +HTH
Sbjct  1    MDDREVELSHPVLVPNSDSSSSVQASISVDSFLDELLRNAQTCTHTHTCNPPGPDAAHTH  60

Query  319  TCYHVHTKIVPA-----PSEEDKAPSD  384
            TCYH HT+++P+     PSE+   P D
Sbjct  61   TCYHTHTQVIPSERVENPSEKVDGPCD  87



>gb|EMT13528.1| hypothetical protein F775_07298 [Aegilops tauschii]
Length=238

 Score = 58.5 bits (140),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 58/129 (45%), Positives = 76/129 (59%), Gaps = 29/129 (22%)
 Frame = +1

Query  139  MEDGELEFSNQEMLSSSNFCEFPDSNSYMDSFLNEILKDT-HACTHAHTCNPPGPDNSH-  312
            M+D +++F+N E         +P     MDS+ +++LKDT HAC     CNP   D +H 
Sbjct  1    MDDADIDFTNPET--------YP--RPAMDSYFDDVLKDTQHAC-----CNPHVEDLAHH  45

Query  313  THTCYHVHTKIVPAPSEEDKAPSDDTAESVDKKE-----KKRPLGNreavrkyrekkkar  477
             HTC HVHTKI P       A SDD AE+ +  +     KKRP GNR AVR+YR+K+KAR
Sbjct  46   AHTCVHVHTKIHP-------AESDDVAETSESPQQNSGAKKRPSGNRAAVRRYRDKRKAR  98

Query  478  aaLLEDGVV  504
             ALLE+ V 
Sbjct  99   TALLEEEVA  107



>ref|NP_190764.2| basic leucine zipper 24 [Arabidopsis thaliana]
 gb|AEE78868.1| basic leucine zipper 24 [Arabidopsis thaliana]
Length=228

 Score = 58.2 bits (139),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 45/84 (54%), Positives = 57/84 (68%), Gaps = 8/84 (10%)
 Frame = +1

Query  256  THACTHAHTCNPPGP-DNSHTHTCYHVHTKIVPAPSEEDKAPSDDTAESVDKKEKKRPLG  432
            T  C+H H+CNPPGP D SH+HTC+H HT ++ +  +++   SD +        KKR  G
Sbjct  52   TRGCSHTHSCNPPGPEDASHSHTCFHAHTHLIISQDQQENDHSDSS-------NKKRLCG  104

Query  433  NreavrkyrekkkaraaLLEDGVV  504
            NREAVRKYREKKKAR A LED V+
Sbjct  105  NREAVRKYREKKKARTAYLEDEVM  128



>gb|EMS54685.1| hypothetical protein TRIUR3_17772 [Triticum urartu]
Length=337

 Score = 58.9 bits (141),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 56/138 (41%), Positives = 76/138 (55%), Gaps = 27/138 (20%)
 Frame = +1

Query  121  GIYISKMEDGELEFSNQEMLSSSNFCEFPDSNSYMDSFLNEILKDTH--ACTHAHTC---  285
            G+++  M+DG+++F+N E             +  MDS+ ++ILKD    ACTH H C   
Sbjct  97   GLFLRTMDDGDIDFTNPETYL----------HPAMDSYFDDILKDPEHLACTHTHACCNL  146

Query  286  NPPGPDNSHTHTCYHVHTKIVPAPSEEDKAPSDDTAESVDKKE-----KKRPLGNreavr  450
            +       HT TC HVHTKI+       +  SDD A++ +  +     KKRP GNR AVR
Sbjct  147  HVRHDLAHHTQTCVHVHTKIL-------REESDDVAQTSESPQENNGPKKRPPGNRAAVR  199

Query  451  kyrekkkaraaLLEDGVV  504
            KYREKKKA   LLE+ V 
Sbjct  200  KYREKKKAHTTLLEEEVA  217



>ref|NP_850680.1| basic leucine zipper 24 [Arabidopsis thaliana]
 dbj|BAC42285.1| putative bZip transcription factor Atbzip24 [Arabidopsis thaliana]
 gb|AAO63842.1| putative bZIP family transcription factor [Arabidopsis thaliana]
 gb|AEE78869.1| basic leucine zipper 24 [Arabidopsis thaliana]
Length=227

 Score = 57.4 bits (137),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 45/84 (54%), Positives = 56/84 (67%), Gaps = 9/84 (11%)
 Frame = +1

Query  256  THACTHAHTCNPPGP-DNSHTHTCYHVHTKIVPAPSEEDKAPSDDTAESVDKKEKKRPLG  432
            T  C+H H+CNPPGP D SH+HTC+H HT ++ +  +E+        +  D   KKR  G
Sbjct  52   TRGCSHTHSCNPPGPEDASHSHTCFHAHTHLIISDQQEN--------DHSDSSNKKRLCG  103

Query  433  NreavrkyrekkkaraaLLEDGVV  504
            NREAVRKYREKKKAR A LED V+
Sbjct  104  NREAVRKYREKKKARTAYLEDEVM  127



>emb|CDY23178.1| BnaA04g05810D [Brassica napus]
Length=188

 Score = 55.8 bits (133),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 45/85 (53%), Positives = 57/85 (67%), Gaps = 9/85 (11%)
 Frame = +1

Query  250  KDTHACTHAHTCNPPGP-DNSHTHTCYHVHTKIVPAPSEEDKAPSDDTAESVDKKEKKRP  426
            + +  C+H H+CNPPGP D SH+HTC+H HT ++   S+E+        +  D   K+RP
Sbjct  11   RASGGCSHTHSCNPPGPEDASHSHTCFHTHTHLIIPDSQEN--------DHSDSSNKRRP  62

Query  427  LGNreavrkyrekkkaraaLLEDGV  501
             GNREAVRKYREKKKAR A LED V
Sbjct  63   CGNREAVRKYREKKKARTAYLEDEV  87



>ref|XP_006291938.1| hypothetical protein CARUB_v10018125mg [Capsella rubella]
 gb|EOA24836.1| hypothetical protein CARUB_v10018125mg [Capsella rubella]
Length=171

 Score = 55.1 bits (131),  Expect = 9e-07, Method: Compositional matrix adjust.
 Identities = 47/84 (56%), Positives = 56/84 (67%), Gaps = 11/84 (13%)
 Frame = +1

Query  256  THACTHAHTCNPPGPDN-SHTHTCYHVHTK-IVPAPSEEDKAPSDDTAESVDKKEKKRPL  429
            +  C+H H+CNPPGPD+ SH+HTC+H HT  I+P   E D + S +         KKR  
Sbjct  15   SRGCSHTHSCNPPGPDDASHSHTCFHTHTHLIIPDQQENDHSDSSN---------KKRSC  65

Query  430  GNreavrkyrekkkaraaLLEDGV  501
            GNREAVRKYREKKKAR A LED V
Sbjct  66   GNREAVRKYREKKKARTAYLEDEV  89



>ref|XP_010426786.1| PREDICTED: uncharacterized protein LOC104711744 isoform X2 [Camelina 
sativa]
 ref|XP_010426787.1| PREDICTED: uncharacterized protein LOC104711744 isoform X2 [Camelina 
sativa]
 ref|XP_010426788.1| PREDICTED: uncharacterized protein LOC104711744 isoform X2 [Camelina 
sativa]
 ref|XP_010426789.1| PREDICTED: uncharacterized protein LOC104711744 isoform X2 [Camelina 
sativa]
 ref|XP_010426790.1| PREDICTED: uncharacterized protein LOC104711744 isoform X2 [Camelina 
sativa]
Length=190

 Score = 55.1 bits (131),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 47/84 (56%), Positives = 55/84 (65%), Gaps = 11/84 (13%)
 Frame = +1

Query  256  THACTHAHTCNPPGPDN-SHTHTCYHVHTK-IVPAPSEEDKAPSDDTAESVDKKEKKRPL  429
            +  C+H H+CNPPGPD+ SH+HTC+H HT  I+P   E D +         D   KKR  
Sbjct  13   SRGCSHTHSCNPPGPDDASHSHTCFHTHTHLIIPDQQENDHS---------DSSNKKRSC  63

Query  430  GNreavrkyrekkkaraaLLEDGV  501
            GNREAVRKYREKKKAR A LED V
Sbjct  64   GNREAVRKYREKKKARTAYLEDEV  87



>ref|XP_010426784.1| PREDICTED: uncharacterized protein LOC104711744 isoform X1 [Camelina 
sativa]
Length=231

 Score = 55.5 bits (132),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 51/99 (52%), Positives = 62/99 (63%), Gaps = 12/99 (12%)
 Frame = +1

Query  214  NSYMDSFLNEILKD-THACTHAHTCNPPGPDN-SHTHTCYHVHTK-IVPAPSEEDKAPSD  384
            N+ MD    E+    +  C+H H+CNPPGPD+ SH+HTC+H HT  I+P   E D + S 
Sbjct  39   NTTMDEEEVEVWGGASRGCSHTHSCNPPGPDDASHSHTCFHTHTHLIIPDQQENDHSDSS  98

Query  385  DTAESVDKKEKKRPLGNreavrkyrekkkaraaLLEDGV  501
            +         KKR  GNREAVRKYREKKKAR A LED V
Sbjct  99   N---------KKRSCGNREAVRKYREKKKARTAYLEDEV  128



>ref|XP_006403861.1| hypothetical protein EUTSA_v10010764mg [Eutrema salsugineum]
 gb|ESQ45314.1| hypothetical protein EUTSA_v10010764mg [Eutrema salsugineum]
Length=176

 Score = 54.3 bits (129),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 47/86 (55%), Positives = 54/86 (63%), Gaps = 11/86 (13%)
 Frame = +1

Query  250  KDTHACTHAHTCNPPGP-DNSHTHTCYHVHT-KIVPAPSEEDKAPSDDTAESVDKKEKKR  423
            + +  C+H H+CNPPGP D SH+HTC+H HT  I+P   E D           D   KKR
Sbjct  11   RASRGCSHTHSCNPPGPEDASHSHTCFHAHTHLIIPDSGENDHC---------DGSNKKR  61

Query  424  PLGNreavrkyrekkkaraaLLEDGV  501
              GNREAVRKYREKKKAR A LED V
Sbjct  62   SCGNREAVRKYREKKKARTAYLEDEV  87



>ref|XP_010515641.1| PREDICTED: uncharacterized protein LOC104791444 isoform X2 [Camelina 
sativa]
Length=194

 Score = 54.7 bits (130),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 47/84 (56%), Positives = 56/84 (67%), Gaps = 11/84 (13%)
 Frame = +1

Query  256  THACTHAHTCNPPGP-DNSHTHTCYHVHTK-IVPAPSEEDKAPSDDTAESVDKKEKKRPL  429
            +  C+H H+CNPPGP D SH+HTC+H HT  I+P   E D + S++         KKR  
Sbjct  15   SRGCSHTHSCNPPGPEDASHSHTCFHTHTHLIIPDQQENDHSDSNN---------KKRSC  65

Query  430  GNreavrkyrekkkaraaLLEDGV  501
            GNREAVRKYREKKKAR A LED V
Sbjct  66   GNREAVRKYREKKKARTAYLEDEV  89



>ref|XP_010515638.1| PREDICTED: uncharacterized protein LOC104791444 isoform X1 [Camelina 
sativa]
 ref|XP_010515639.1| PREDICTED: uncharacterized protein LOC104791444 isoform X1 [Camelina 
sativa]
 ref|XP_010515640.1| PREDICTED: uncharacterized protein LOC104791444 isoform X1 [Camelina 
sativa]
Length=207

 Score = 54.7 bits (130),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 47/84 (56%), Positives = 56/84 (67%), Gaps = 11/84 (13%)
 Frame = +1

Query  256  THACTHAHTCNPPGP-DNSHTHTCYHVHTK-IVPAPSEEDKAPSDDTAESVDKKEKKRPL  429
            +  C+H H+CNPPGP D SH+HTC+H HT  I+P   E D + S++         KKR  
Sbjct  15   SRGCSHTHSCNPPGPEDASHSHTCFHTHTHLIIPDQQENDHSDSNN---------KKRSC  65

Query  430  GNreavrkyrekkkaraaLLEDGV  501
            GNREAVRKYREKKKAR A LED V
Sbjct  66   GNREAVRKYREKKKARTAYLEDEV  89



>gb|EMS52399.1| hypothetical protein TRIUR3_11502 [Triticum urartu]
Length=259

 Score = 55.5 bits (132),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 29/66 (44%), Positives = 38/66 (58%), Gaps = 3/66 (5%)
 Frame = +1

Query  130  ISKMEDGELEFSNQE-MLSSSNFCEFPDSNSYMDSFLNEILKDTH--ACTHAHTCNPPGP  300
            ++ M+DG+L+FSN E  L S    + P     MDS+ + IL DT   ACTH HTCNPP  
Sbjct  23   VAAMDDGDLDFSNPEAYLCSDTGADLPGGGCSMDSYFDGILNDTEHLACTHTHTCNPPVD  82

Query  301  DNSHTH  318
            D    +
Sbjct  83   DTVRKY  88



>ref|XP_002877837.1| bZIP family transcription factor [Arabidopsis lyrata subsp. lyrata]
 gb|EFH54096.1| bZIP family transcription factor [Arabidopsis lyrata subsp. lyrata]
Length=211

 Score = 54.7 bits (130),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 46/84 (55%), Positives = 55/84 (65%), Gaps = 11/84 (13%)
 Frame = +1

Query  256  THACTHAHTCNPPGPDNS-HTHTCYHVHTK-IVPAPSEEDKAPSDDTAESVDKKEKKRPL  429
            T  C+H H+CNPPGP+++ H+HTC+H HT  I+P   E D +         D   KKR  
Sbjct  36   TRGCSHTHSCNPPGPEDAFHSHTCFHAHTHLIIPDQQENDHS---------DSSNKKRSC  86

Query  430  GNreavrkyrekkkaraaLLEDGV  501
            GNREAVRKYREKKKAR A LED V
Sbjct  87   GNREAVRKYREKKKARTAYLEDEV  110



>ref|XP_008344616.1| PREDICTED: uncharacterized protein LOC103407459 [Malus domestica]
 ref|XP_008344617.1| PREDICTED: uncharacterized protein LOC103407459 [Malus domestica]
 ref|XP_008363297.1| PREDICTED: uncharacterized protein LOC103426998 [Malus domestica]
 ref|XP_008363299.1| PREDICTED: uncharacterized protein LOC103426998 [Malus domestica]
Length=245

 Score = 55.1 bits (131),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 25/55 (45%), Positives = 34/55 (62%), Gaps = 0/55 (0%)
 Frame = +1

Query  139  MEDGELEFSNQEMLSSSNFCEFPDSNSYMDSFLNEILKDTHACTHAHTCNPPGPD  303
            M+DGE+  S+  +L + N       ++Y D+F +E LK    CTH HTCNPPGPD
Sbjct  1    MDDGEVVTSDHALLPNPNSSSTFHGSTYEDTFFDEFLKTARTCTHTHTCNPPGPD  55



>emb|CDY60641.1| BnaCnng36700D [Brassica napus]
Length=188

 Score = 53.1 bits (126),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 44/85 (52%), Positives = 55/85 (65%), Gaps = 9/85 (11%)
 Frame = +1

Query  250  KDTHACTHAHTCNPPGP-DNSHTHTCYHVHTKIVPAPSEEDKAPSDDTAESVDKKEKKRP  426
            + +  C+H H+CNPPGP D SH+HTC+H HT ++   S+E+           D   K+R 
Sbjct  11   RASGGCSHTHSCNPPGPEDASHSHTCFHTHTHLIIPDSQENGHS--------DSSNKRRS  62

Query  427  LGNreavrkyrekkkaraaLLEDGV  501
             GNREAVRKYREKKKAR A LED V
Sbjct  63   CGNREAVRKYREKKKARTAYLEDEV  87



>ref|XP_003566090.1| PREDICTED: uncharacterized protein LOC100823248 [Brachypodium 
distachyon]
Length=233

 Score = 53.5 bits (127),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 47/84 (56%), Positives = 56/84 (67%), Gaps = 11/84 (13%)
 Frame = +1

Query  256  THACTHAHTCNPPGPDNS-HTHTCYHVHTKIVPAPSEEDKA-PSDDTAESVDKKEKKRPL  429
            T +C+H HTCN PGP  + H+HTC H HTK+    SE+D   P+  T         +RPL
Sbjct  34   TSSCSHTHTCNAPGPSAAMHSHTCQHTHTKVFATGSEDDDGNPAAKT---------RRPL  84

Query  430  GNreavrkyrekkkaraaLLEDGV  501
            GNREAVRKYREKKKARAA LE+ V
Sbjct  85   GNREAVRKYREKKKARAAFLEEEV  108



>gb|EMT32713.1| hypothetical protein F775_17323 [Aegilops tauschii]
Length=318

 Score = 52.0 bits (123),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 50/125 (40%), Positives = 73/125 (58%), Gaps = 7/125 (6%)
 Frame = +1

Query  139  MEDGELEFSNQEMLSSSNFCEFPDSNSYMDSFLNEILK---DTHACTHAHTCNPPGPDNS  309
            M+DG+++FSN E          P ++  M ++ ++IL    D  ACTH HTCNPP  D +
Sbjct  1    MDDGDIDFSNPETFLCEAMGNDPPASCSMGTYFDDILNGDTDHLACTHTHTCNPPVHDLA  60

Query  310  HTHTCYHVHTKIVPAPSEEDKAPSDDTAESVDKKEKKRPLGNreavrkyrekkkaraaLL  489
            H           + + S++    + +T+ES+ + +K+RP GNR AVRKYREKKKA  ALL
Sbjct  61   HHTHTCVHVHTKILSASDD----AAETSESLPESKKQRPSGNRAAVRKYREKKKAHTALL  116

Query  490  EDGVV  504
            E+ V 
Sbjct  117  EEEVA  121



>dbj|BAJ84803.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=251

 Score = 51.6 bits (122),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 51/125 (41%), Positives = 72/125 (58%), Gaps = 7/125 (6%)
 Frame = +1

Query  139  MEDGELEFSNQEMLSSSNFCEFPDSNSYMDSFLNEIL---KDTHACTHAHTCNPPGPDNS  309
            M+DG+++FSN E          P ++  M S+ ++IL    D  ACTH HTCNPP  D +
Sbjct  1    MDDGDIDFSNPETYLCEAMGNDPPASCSMGSYFDDILNSDADHLACTHTHTCNPPVHDLA  60

Query  310  HTHTCYHVHTKIVPAPSEEDKAPSDDTAESVDKKEKKRPLGNreavrkyrekkkaraaLL  489
            H           + + S++    + +T+ES+   +K+RP GNR AVRKYREKKKA  ALL
Sbjct  61   HHTHTCVHVHTKILSASDD----AAETSESLPDAKKQRPSGNRAAVRKYREKKKAHTALL  116

Query  490  EDGVV  504
            E+ V 
Sbjct  117  EEEVA  121



>gb|EMS45140.1| hypothetical protein TRIUR3_21208 [Triticum urartu]
Length=214

 Score = 50.8 bits (120),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 46/98 (47%), Positives = 59/98 (60%), Gaps = 17/98 (17%)
 Frame = +1

Query  211  SNSYMDSFLNEILKDTHACTHAHTCN-PPGPDNSHTHTCYHVHTKIVPAPSEEDKAPSDD  387
            S+ + D FL        ACTH HTCN P  P  +H+HTC H HT+++        A  +D
Sbjct  21   SHGFDDEFL--------ACTHTHTCNVPSWPAAAHSHTCLHAHTQVI--------ASGED  64

Query  388  TAESVDKKEKKRPLGNreavrkyrekkkaraaLLEDGV  501
             AE    +  ++PLGNREAVRKYR+KKKA AA LE+ V
Sbjct  65   HAEHDQLRNLRKPLGNREAVRKYRQKKKAHAAFLEEEV  102



>ref|XP_010922246.1| PREDICTED: uncharacterized protein LOC105045595 [Elaeis guineensis]
Length=230

 Score = 50.8 bits (120),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 29/100 (29%), Positives = 51/100 (51%), Gaps = 16/100 (16%)
 Frame = +1

Query  136  KMEDGELEFSNQEMLSSSNFCEFPDSNSYMDSFLNEILKDTHACTHAHTCNPPGPDNSHT  315
            +M+DGE++ S+  +L           NS M S   E  +++  CTH HTCNPPGP ++  
Sbjct  5    RMDDGEVDLSSHLLLP----------NSEMTSSFEEYFRNSRKCTHTHTCNPPGPADAMH  54

Query  316  HTCYHVHTKIVPAPSEEDKAPSDDTAESVDKKEKKRPLGN  435
                +     V A ++ ++   +      ++K+ ++PLGN
Sbjct  55   THTCYHTHTQVFATADGEREGEE------EQKKSRKPLGN  88



>ref|XP_010104020.1| hypothetical protein L484_001603 [Morus notabilis]
 gb|EXB97908.1| hypothetical protein L484_001603 [Morus notabilis]
Length=232

 Score = 50.1 bits (118),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 34/71 (48%), Positives = 50/71 (70%), Gaps = 5/71 (7%)
 Frame = +1

Query  223  MDSFLNEILKDTHACTHAHTCNPPGPDNSHTHTCYHVHTKIVPAPSEEDKAPSDDTAESV  402
            +DSF++++LK+   CTH HTCNPPGPD++HTHTCYH HT+++ A  ++D   S   + S 
Sbjct  3    LDSFIDDLLKNARTCTHTHTCNPPGPDSTHTHTCYHTHTQVL-ASEDDDHTTSKQNSTS-  60

Query  403  DKKEKKRPLGN  435
               + +RP GN
Sbjct  61   ---KSRRPSGN  68



>ref|XP_009117143.1| PREDICTED: LOW QUALITY PROTEIN: uncharacterized protein LOC103842271 
[Brassica rapa]
Length=163

 Score = 48.5 bits (114),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 43/80 (54%), Positives = 51/80 (64%), Gaps = 14/80 (18%)
 Frame = +1

Query  268  THAHTCNPPGPDN-SHTHTCYHVHTK-IVPAPSEEDKAPSDDTAESVDKKEKKRPLGNre  441
            +H H+CNPPG D+ SH+HTC+H HT  I+P P E D +            + KR  GNRE
Sbjct  17   SHTHSCNPPGRDDASHSHTCFHTHTHLIIPDPQENDNS------------DXKRSCGNRE  64

Query  442  avrkyrekkkaraaLLEDGV  501
            A RKYREKKKAR A LED V
Sbjct  65   AARKYREKKKARTAYLEDEV  84



>gb|EMS67651.1| hypothetical protein TRIUR3_23486 [Triticum urartu]
Length=253

 Score = 48.9 bits (115),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 50/125 (40%), Positives = 69/125 (55%), Gaps = 4/125 (3%)
 Frame = +1

Query  139  MEDGELEFSNQEMLSSSNFCEFPDSNSYMDSFLNEIL---KDTHACTHAHTCNPPGPDNS  309
            M+DG+++FSN E          P ++  M S+ ++IL    D  ACTH HTCNPP  D +
Sbjct  1    MDDGDIDFSNPETFLCEAMGNDPPASCSMGSYFDDILNSDADHLACTHTHTCNPPVHDLA  60

Query  310  HTHTCYHVHTKIVPAPSEEDKAPSDDTAESVDKKEKKRPLGNreavrkyrekkkaraaLL  489
            H           + + S +D A + ++       +K+RP GNR AVRKYREKKKA  ALL
Sbjct  61   HHTHTCVHVHTKILSAS-DDAAETSESLPEGGATKKQRPSGNRAAVRKYREKKKAHTALL  119

Query  490  EDGVV  504
            E+ V 
Sbjct  120  EEEVA  124



>gb|EMT18405.1| hypothetical protein F775_16738 [Aegilops tauschii]
Length=195

 Score = 47.8 bits (112),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 46/103 (45%), Positives = 60/103 (58%), Gaps = 19/103 (18%)
 Frame = +1

Query  202  FPD-SNSYMDSFLNEILKDTHACTHAHTC--NPPGPDNSHTHTCYHVHTKIVPAPSEEDK  372
            +P+ S+ + D FL        ACTH HTC   P  P  +H HTC H HT+++        
Sbjct  17   YPEISHGFDDEFL--------ACTHTHTCCNVPSWPAAAHAHTCLHAHTQVI--------  60

Query  373  APSDDTAESVDKKEKKRPLGNreavrkyrekkkaraaLLEDGV  501
            A  +D AE    +  ++PLGNREAVRKYR+KKKA AA LE+ V
Sbjct  61   ASGEDHAEHDQLRNLRKPLGNREAVRKYRQKKKAHAAFLEEEV  103



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 562345909905