BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFF037A04

Length=583
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

gb|AHB86963.1|  elongation factor 1-alpha                               189   3e-86   Sedum alfredii
ref|XP_009421379.1|  PREDICTED: elongation factor 1-alpha-like          188   3e-86   
ref|XP_009380678.1|  PREDICTED: elongation factor 1-alpha-like          188   3e-86   
ref|XP_007015466.1|  GTP binding Elongation factor Tu family prot...    188   3e-86   Theobroma cacao [chocolate]
ref|XP_007015463.1|  GTP binding Elongation factor Tu family protein    188   3e-86   
ref|XP_010032225.1|  PREDICTED: elongation factor 1-alpha-like          188   3e-86   Eucalyptus grandis [rose gum]
ref|XP_009392715.1|  PREDICTED: elongation factor 1-alpha-like          187   4e-86   Musa acuminata subsp. malaccensis [pisang utan]
dbj|BAM13877.1|  elongation factor 1 alpha                              187   4e-86   Arum maculatum [cuckoo-pint]
ref|XP_009420035.1|  PREDICTED: elongation factor 1-alpha               187   4e-86   Musa acuminata subsp. malaccensis [pisang utan]
gb|AAN77897.1|  elongation factor 1 alpha                               188   5e-86   Stevia rebaudiana
ref|XP_004143833.1|  PREDICTED: uncharacterized protein LOC101220517    191   5e-86   
sp|P34823.1|EF1A2_DAUCA  RecName: Full=Elongation factor 1-alpha;...    188   5e-86   Daucus carota [carrots]
gb|AID52924.1|  elongation factor 1-alpha                               188   5e-86   Carthamus tinctorius
gb|ABB72813.1|  elongation factor 1-alpha-like protein                  187   5e-86   Solanum tuberosum [potatoes]
gb|ABV26710.1|  elongation factor 1 alpha                               188   5e-86   Gerbera hybrid cultivar
ref|XP_010535587.1|  PREDICTED: elongation factor 1-alpha               188   6e-86   Tarenaya hassleriana [spider flower]
ref|XP_010542598.1|  PREDICTED: elongation factor 1-alpha-like          188   6e-86   Tarenaya hassleriana [spider flower]
gb|AGC94754.1|  elongation factor 1 alpha                               188   6e-86   Euphorbia lathyris
gb|AHE76183.1|  elongation factor 1-alpha                               188   6e-86   Chrysanthemum indicum
ref|XP_010557310.1|  PREDICTED: elongation factor 1-alpha-like          188   6e-86   Tarenaya hassleriana [spider flower]
gb|AGI15328.1|  elongation factor 1                                     188   6e-86   Aegiceras corniculatum
ref|XP_010521772.1|  PREDICTED: elongation factor 1-alpha-like          188   6e-86   Tarenaya hassleriana [spider flower]
gb|AGY80449.1|  elongation factor 1-alpha                               188   6e-86   Dendrocalamus latiflorus [sweet bamboo]
dbj|BAL14665.1|  elongation factor 1-alpha                              188   6e-86   Chrysanthemum seticuspe f. boreale
ref|XP_010542596.1|  PREDICTED: elongation factor 1-alpha-like          188   6e-86   Tarenaya hassleriana [spider flower]
ref|XP_010541344.1|  PREDICTED: elongation factor 1-alpha               188   6e-86   Tarenaya hassleriana [spider flower]
gb|AGJ50595.1|  EF1alpha                                                188   6e-86   Pericallis cruenta
dbj|BAC23049.1|  Elongation factor 1-alpha                              187   6e-86   Solanum tuberosum [potatoes]
gb|ABB86283.1|  elongation factor-1 alpha-like                          187   6e-86   Solanum tuberosum [potatoes]
gb|KHG28979.1|  Elongation factor 1-alpha                               188   7e-86   Gossypium arboreum [tree cotton]
gb|KHN18669.1|  Elongation factor 1-alpha                               187   7e-86   Glycine soja [wild soybean]
gb|ABA12219.1|  translation elongation factor 1A-3                      188   7e-86   Gossypium hirsutum [American cotton]
ref|XP_009358244.1|  PREDICTED: elongation factor 1-alpha-like          188   7e-86   Pyrus x bretschneideri [bai li]
gb|KHN42761.1|  Elongation factor 1-alpha                               188   7e-86   Glycine soja [wild soybean]
ref|NP_001234035.1|  elongation factor 1-alpha                          187   7e-86   Solanum lycopersicum
ref|XP_011089874.1|  PREDICTED: elongation factor 1-alpha               188   7e-86   Sesamum indicum [beniseed]
ref|XP_011089339.1|  PREDICTED: elongation factor 1-alpha isoform X1    188   7e-86   Sesamum indicum [beniseed]
ref|NP_001274875.1|  elongation factor 1-alpha-like protein             187   7e-86   Solanum tuberosum [potatoes]
gb|AAR82894.1|  elongation factor 1-alpha                               187   7e-86   Cichorium intybus [radicchio]
ref|XP_002518073.1|  elongation factor 1-alpha, putative                187   7e-86   Ricinus communis
ref|XP_010920912.1|  PREDICTED: elongation factor 1-alpha-like          188   7e-86   Elaeis guineensis
gb|KHG26926.1|  Elongation factor 1-alpha                               188   7e-86   Gossypium arboreum [tree cotton]
ref|NP_001237425.1|  elongation factor-1A                               187   7e-86   
gb|KHG01531.1|  Elongation factor 1-alpha                               188   7e-86   Gossypium arboreum [tree cotton]
ref|XP_008789061.1|  PREDICTED: elongation factor 1-alpha-like          188   7e-86   Phoenix dactylifera
gb|ABA12224.1|  translation elongation factor 1A-8                      188   7e-86   Gossypium hirsutum [American cotton]
ref|XP_010916901.1|  PREDICTED: elongation factor 1-alpha               188   7e-86   Elaeis guineensis
ref|XP_008783722.1|  PREDICTED: elongation factor 1-alpha isoform X1    188   7e-86   
gb|ABA12220.1|  translation elongation factor 1A-4                      188   7e-86   Gossypium hirsutum [American cotton]
ref|XP_003547695.1|  PREDICTED: elongation factor 1-alpha isoform 2     188   8e-86   Glycine max [soybeans]
gb|KHG23927.1|  Elongation factor 1-alpha                               188   8e-86   Gossypium arboreum [tree cotton]
gb|ABA12221.1|  translation elongation factor 1A-5                      188   8e-86   Gossypium hirsutum [American cotton]
ref|XP_007151789.1|  hypothetical protein PHAVU_004G075100g             186   8e-86   Phaseolus vulgaris [French bean]
ref|XP_006343452.1|  PREDICTED: elongation factor 1-alpha-like          187   8e-86   Solanum tuberosum [potatoes]
ref|XP_006600131.1|  PREDICTED: elongation factor-1A isoform X1         187   8e-86   
ref|XP_011089340.1|  PREDICTED: elongation factor 1-alpha isoform X2    188   8e-86   
gb|AAX54511.1|  elongation factor 1 alpha                               188   8e-86   Actinidia deliciosa [Chinese gooseberry]
sp|O49169.1|EF1A_MANES  RecName: Full=Elongation factor 1-alpha; ...    188   8e-86   Manihot esculenta [manioc]
gb|ABA12217.1|  translation elongation factor 1A-1                      188   8e-86   Gossypium hirsutum [American cotton]
ref|NP_001290506.1|  elongation factor 1-alpha                          188   8e-86   Elaeis guineensis
gb|EPS66069.1|  elongation factor 1-alpha                               188   8e-86   Genlisea aurea
ref|XP_010244958.1|  PREDICTED: elongation factor 1-alpha-like          188   8e-86   Nelumbo nucifera [Indian lotus]
gb|ABA12223.1|  translation elongation factor 1A-7                      188   8e-86   Gossypium hirsutum [American cotton]
gb|AHA84124.1|  elongation factor 1-alpha                               188   8e-86   Phaseolus vulgaris [French bean]
ref|XP_010067278.1|  PREDICTED: elongation factor 1-alpha-like          188   8e-86   Eucalyptus grandis [rose gum]
ref|XP_009381507.1|  PREDICTED: elongation factor 1-alpha-like          188   8e-86   Musa acuminata subsp. malaccensis [pisang utan]
gb|ABA12225.1|  translation elongation factor 1A-9                      188   9e-86   Gossypium hirsutum [American cotton]
gb|AGV54713.1|  elongation factor 1-alpha                               186   9e-86   Phaseolus vulgaris [French bean]
sp|P25698.2|EF1A_SOYBN  RecName: Full=Elongation factor 1-alpha; ...    186   9e-86   Glycine max [soybeans]
ref|XP_008792062.1|  PREDICTED: elongation factor 1-alpha               188   9e-86   Phoenix dactylifera
ref|XP_008792073.1|  PREDICTED: elongation factor 1-alpha-like          187   9e-86   Phoenix dactylifera
gb|ADR70875.1|  eukaryotic translation elongation factor 1-alpha        188   9e-86   Hevea brasiliensis [jebe]
ref|XP_010937806.1|  PREDICTED: elongation factor 1-alpha-like          188   9e-86   Elaeis guineensis
ref|XP_010937804.1|  PREDICTED: elongation factor 1-alpha-like          188   9e-86   Elaeis guineensis
ref|XP_010032223.1|  PREDICTED: elongation factor 1-alpha isoform X2    187   9e-86   Eucalyptus grandis [rose gum]
ref|XP_004512426.1|  PREDICTED: elongation factor 1-alpha-like          188   9e-86   Cicer arietinum [garbanzo]
ref|XP_007151593.1|  hypothetical protein PHAVU_004G060000g             187   1e-85   Phaseolus vulgaris [French bean]
ref|XP_003604823.1|  Elongation factor 1-alpha                          188   1e-85   
ref|XP_009762748.1|  PREDICTED: elongation factor 1-alpha-like          187   1e-85   Nicotiana sylvestris
ref|XP_009593325.1|  PREDICTED: elongation factor 1-alpha               187   1e-85   Nicotiana tomentosiformis
ref|XP_007027265.1|  GTP binding Elongation factor Tu family protein    187   1e-85   
dbj|BAM13874.1|  elongation factor 1 alpha                              187   1e-85   Symplocarpus renifolius
gb|ADR70874.1|  eukaryotic translation elongation factor 1-alpha        188   1e-85   Hevea brasiliensis [jebe]
gb|KDP29083.1|  hypothetical protein JCGZ_16472                         187   1e-85   Jatropha curcas
ref|XP_010043711.1|  PREDICTED: elongation factor 1-alpha               188   1e-85   Eucalyptus grandis [rose gum]
ref|XP_009403341.1|  PREDICTED: elongation factor 1-alpha-like          187   1e-85   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009388387.1|  PREDICTED: elongation factor 1-alpha-like          187   1e-85   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_006856244.1|  hypothetical protein AMTR_s00059p00216110          187   1e-85   Amborella trichopoda
ref|XP_007009751.1|  GTP binding Elongation factor Tu family prot...    187   1e-85   Theobroma cacao [chocolate]
ref|XP_009613861.1|  PREDICTED: elongation factor 1-alpha-like          187   1e-85   Nicotiana tomentosiformis
dbj|BAA34348.1|  elongation factor-1 alpha                              187   1e-85   Nicotiana paniculata
gb|EPS66340.1|  elongation factor 1-alpha                               187   1e-85   Genlisea aurea
ref|XP_002528028.1|  elongation factor 1-alpha, putative                187   1e-85   
gb|KEH43536.1|  GTP-binding elongation factor Tu family protein         187   1e-85   Medicago truncatula
emb|CDX95108.1|  BnaC05g05630D                                          187   1e-85   
gb|AAD56019.1|AF181491_1  elongation factor-1 alpha 2                   187   1e-85   Lilium longiflorum [Easter lily]
gb|AES62210.2|  GTP-binding elongation factor Tu family protein         187   1e-85   Medicago truncatula
ref|XP_010521578.1|  PREDICTED: elongation factor 1-alpha               187   1e-85   Tarenaya hassleriana [spider flower]
ref|XP_010032227.1|  PREDICTED: elongation factor 1-alpha-like          187   1e-85   Eucalyptus grandis [rose gum]
gb|ABD66517.1|  EF-1 alpha                                              186   1e-85   Gymnadenia conopsea
gb|AFJ04514.1|  elongation factor 1-alpha                               187   1e-85   Vernicia fordii [tung oil tree]
gb|KCW65375.1|  hypothetical protein EUGRSUZ_G02807                     187   1e-85   Eucalyptus grandis [rose gum]
gb|KCW51623.1|  hypothetical protein EUGRSUZ_J01112                     186   1e-85   Eucalyptus grandis [rose gum]
gb|AES74993.2|  GTP-binding elongation factor Tu family protein         187   1e-85   Medicago truncatula
ref|XP_003536362.1|  PREDICTED: elongation factor 1-alpha-like is...    187   1e-85   Glycine max [soybeans]
ref|XP_010032224.1|  PREDICTED: elongation factor 1-alpha isoform X3    187   1e-85   
ref|XP_006340223.1|  PREDICTED: elongation factor 1-alpha-like          187   2e-85   Solanum tuberosum [potatoes]
ref|XP_003604587.1|  Elongation factor 1-alpha                          187   2e-85   Medicago truncatula
ref|XP_004251154.1|  PREDICTED: elongation factor 1-alpha-like          187   2e-85   Solanum lycopersicum
ref|XP_002284964.1|  PREDICTED: elongation factor 1-alpha               187   2e-85   Vitis vinifera
gb|EYU36203.1|  hypothetical protein MIMGU_mgv1a006301mg                187   2e-85   Erythranthe guttata [common monkey flower]
emb|CDO98621.1|  unnamed protein product                                187   2e-85   Coffea canephora [robusta coffee]
ref|XP_010032221.1|  PREDICTED: elongation factor 1-alpha isoform X1    187   2e-85   Eucalyptus grandis [rose gum]
ref|XP_007009760.1|  GTP binding Elongation factor Tu family prot...    187   2e-85   Theobroma cacao [chocolate]
ref|XP_006846237.1|  hypothetical protein AMTR_s00012p00237190          187   2e-85   Amborella trichopoda
ref|XP_002277159.1|  PREDICTED: elongation factor 1-alpha               187   2e-85   Vitis vinifera
ref|XP_011031813.1|  PREDICTED: LOW QUALITY PROTEIN: HBS1-like pr...    188   2e-85   Populus euphratica
ref|XP_011091454.1|  PREDICTED: elongation factor 1-alpha-like          187   2e-85   Sesamum indicum [beniseed]
ref|XP_009403064.1|  PREDICTED: elongation factor 1-alpha-like          187   2e-85   Musa acuminata subsp. malaccensis [pisang utan]
emb|CDP07148.1|  unnamed protein product                                187   2e-85   Coffea canephora [robusta coffee]
dbj|BAA23658.1|  EF-1 alpha                                             188   2e-85   Oryza sativa [red rice]
gb|ADD71925.1|  translation elongation factor 1 alpha                   187   2e-85   Actaea racemosa
ref|XP_004138964.1|  PREDICTED: elongation factor 1-alpha-like          188   2e-85   Cucumis sativus [cucumbers]
ref|XP_009617039.1|  PREDICTED: elongation factor 1-alpha               187   2e-85   Nicotiana tomentosiformis
ref|XP_007143679.1|  hypothetical protein PHAVU_007G092500g             185   2e-85   Phaseolus vulgaris [French bean]
ref|XP_010248287.1|  PREDICTED: elongation factor 1-alpha               187   2e-85   Nelumbo nucifera [Indian lotus]
ref|XP_010937512.1|  PREDICTED: elongation factor 1-alpha               187   2e-85   Elaeis guineensis
ref|XP_006381487.1|  hypothetical protein POPTR_0006s13310g             186   2e-85   Populus trichocarpa [western balsam poplar]
gb|AGV54654.1|  elongation factor 1-alpha                               185   2e-85   Phaseolus vulgaris [French bean]
gb|ABA12218.1|  translation elongation factor 1A-2                      188   2e-85   Gossypium hirsutum [American cotton]
ref|XP_006424629.1|  hypothetical protein CICLE_v10028446mg             188   2e-85   Citrus clementina [clementine]
gb|AIZ68131.1|  translation elongation factor 1-alpha                   188   2e-85   Ornithogalum longebracteatum [sea-onion]
ref|XP_006424633.1|  hypothetical protein CICLE_v10028443mg             188   2e-85   Citrus clementina [clementine]
ref|XP_009342341.1|  PREDICTED: elongation factor 1-alpha               186   2e-85   Pyrus x bretschneideri [bai li]
ref|NP_001049145.1|  Os03g0177400                                       188   2e-85   
gb|KDP29086.1|  hypothetical protein JCGZ_16475                         187   2e-85   Jatropha curcas
gb|KHN14872.1|  Elongation factor 1-alpha                               188   2e-85   Glycine soja [wild soybean]
gb|AGH32502.1|  translation elongation factor-1 alpha                   188   2e-85   Stylosanthes guianensis [stylo]
gb|AAD27590.1|AF121261_1  elongation factor 1-alpha 1                   187   2e-85   Lilium longiflorum [Easter lily]
gb|AAC15413.1|  translation elongation factor-1 alpha                   188   2e-85   Oryza sativa Japonica Group [Japonica rice]
gb|EEE58429.1|  hypothetical protein OsJ_09630                          188   2e-85   Oryza sativa Japonica Group [Japonica rice]
ref|XP_002279598.1|  PREDICTED: elongation factor 1-alpha               187   2e-85   Vitis vinifera
ref|XP_008463920.1|  PREDICTED: elongation factor 1-alpha               188   2e-85   Cucumis melo [Oriental melon]
ref|XP_006646939.1|  PREDICTED: elongation factor 1-alpha-like          188   2e-85   Oryza brachyantha
ref|XP_002460859.1|  hypothetical protein SORBIDRAFT_02g036420          186   2e-85   Sorghum bicolor [broomcorn]
gb|ADI24333.1|  elongation factor 1-alpha                               188   2e-85   Miscanthus sinensis
gb|KJB09231.1|  hypothetical protein B456_001G130700                    188   2e-85   Gossypium raimondii
ref|NP_001151074.1|  elongation factor 1-alpha                          186   2e-85   
ref|NP_001105587.1|  elongation factor 1-alpha                          188   2e-85   Zea mays [maize]
dbj|BAO57272.1|  elongation factor 1-alpha                              188   2e-85   Ipomoea nil [qian niu]
gb|AHZ58493.1|  translation elongation factor alpha                     186   2e-85   Syntrichia caninervis
ref|XP_003553292.1|  PREDICTED: elongation factor 1-alpha isoform 1     187   2e-85   Glycine max [soybeans]
ref|XP_003618775.1|  Elongation factor 1-alpha                          187   2e-85   
gb|EMS52529.1|  Elongation factor 1-alpha                               188   2e-85   Triticum urartu
gb|AFP44110.1|  elongation factor 1-alpha                               188   2e-85   Lycoris longituba
gb|AFC88830.1|  putative elongation factor 1-alpha                      188   2e-85   Miscanthus sinensis
ref|NP_001105933.1|  elongation factor alpha2                           188   2e-85   
gb|ABU63160.1|  elongation factor                                       188   2e-85   Saccharum officinarum [noble cane]
ref|NP_001152668.1|  LOC100286309                                       188   3e-85   Zea mays [maize]
ref|XP_003558459.1|  PREDICTED: elongation factor 1-alpha               188   3e-85   Brachypodium distachyon [annual false brome]
ref|XP_008457229.1|  PREDICTED: elongation factor 1-alpha               187   3e-85   Cucumis melo [Oriental melon]
ref|XP_008358325.1|  PREDICTED: elongation factor 1-alpha               188   3e-85   Malus domestica [apple tree]
gb|KHG27341.1|  Elongation factor 1-alpha                               187   3e-85   Gossypium arboreum [tree cotton]
ref|XP_004163381.1|  PREDICTED: LOW QUALITY PROTEIN: elongation f...    187   3e-85   
gb|ACG31866.1|  elongation factor 1-alpha                               188   3e-85   Zea mays [maize]
sp|Q03033.1|EF1A_WHEAT  RecName: Full=Elongation factor 1-alpha; ...    187   3e-85   Triticum aestivum [Canadian hard winter wheat]
ref|XP_007205199.1|  hypothetical protein PRUPE_ppa005718mg             188   3e-85   Prunus persica
ref|XP_006280459.1|  hypothetical protein CARUB_v10026391mg             188   3e-85   Capsella rubella
ref|XP_004149547.1|  PREDICTED: elongation factor 1-alpha-like          187   3e-85   Cucumis sativus [cucumbers]
ref|NP_001105565.1|  elongation factor alpha5                           188   3e-85   
ref|NP_001288465.1|  elongation factor 1-alpha-like                     188   3e-85   Zea mays [maize]
ref|NP_200847.1|  elongation factor 1-alpha 4                           188   3e-85   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009148045.1|  PREDICTED: elongation factor 1-alpha 1             188   3e-85   Brassica rapa
gb|AAL32631.1|  putative elongation factor 1-a                          188   3e-85   Arabidopsis thaliana [mouse-ear cress]
ref|NP_001105617.1|  elongation factor alpha3                           188   3e-85   Zea mays [maize]
ref|XP_008224543.1|  PREDICTED: elongation factor 1-alpha               188   3e-85   Prunus mume [ume]
gb|KJB76528.1|  hypothetical protein B456_012G093800                    187   3e-85   Gossypium raimondii
gb|AGT16893.1|  elongation factor 1-alpha                               188   3e-85   Saccharum hybrid cultivar R570
gb|ACS68200.1|  elongation factor 1 alpha                               188   3e-85   Brassica napus [oilseed rape]
gb|ABA12222.1|  translation elongation factor 1A-6                      187   3e-85   Gossypium hirsutum [American cotton]
dbj|BAH19898.1|  AT1G07930                                              188   3e-85   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009144204.1|  PREDICTED: elongation factor 1-alpha 1-like        187   3e-85   Brassica rapa
ref|NP_001288407.1|  elongation factor 1-alpha-like                     188   3e-85   Zea mays [maize]
sp|O24534.1|EF1A_VICFA  RecName: Full=Elongation factor 1-alpha; ...    186   3e-85   Vicia faba [broad bean]
ref|XP_002892424.1|  T6D22.2                                            187   3e-85   
ref|XP_008656156.1|  PREDICTED: elongation factor 1-alpha-like is...    188   3e-85   Zea mays [maize]
sp|Q41803.1|EF1A_MAIZE  RecName: Full=Elongation factor 1-alpha; ...    188   3e-85   Zea mays [maize]
ref|XP_009126611.1|  PREDICTED: elongation factor 1-alpha 1-like        187   3e-85   Brassica rapa
ref|XP_008656153.1|  PREDICTED: elongation factor 1-alpha-like          188   3e-85   Zea mays [maize]
ref|XP_008380545.1|  PREDICTED: elongation factor 1-alpha-like          188   3e-85   Malus domestica [apple tree]
ref|XP_001753059.1|  predicted protein                                  186   3e-85   
gb|AAF79822.1|AC026875_2  T6D22.2                                       186   3e-85   Arabidopsis thaliana [mouse-ear cress]
ref|XP_011040946.1|  PREDICTED: elongation factor 1-alpha-like is...    188   3e-85   Populus euphratica
gb|AFW77593.1|  putative translation elongation factor Tu family ...    188   3e-85   
ref|XP_011026991.1|  PREDICTED: elongation factor 1-alpha isoform X1    187   3e-85   Populus euphratica
ref|XP_006417745.1|  hypothetical protein EUTSA_v10007619mg             187   3e-85   Eutrema salsugineum [saltwater cress]
ref|XP_011004182.1|  PREDICTED: elongation factor 1-alpha-like          187   3e-85   Populus euphratica
gb|KHG15275.1|  Elongation factor 1-alpha                               187   3e-85   Gossypium arboreum [tree cotton]
ref|XP_006858667.1|  hypothetical protein AMTR_s00066p00072310          188   3e-85   Amborella trichopoda
gb|AEQ75495.1|  elongation factor 1-alpha                               188   3e-85   Rosa multiflora [Japanese rose]
ref|NP_001105934.1|  elongation factor alpha7                           188   3e-85   
gb|ACR38047.1|  unknown                                                 188   3e-85   Zea mays [maize]
gb|ACI96243.1|  elongation factor 1-alpha                               188   3e-85   Prunus persica
ref|XP_004489551.1|  PREDICTED: elongation factor 1-alpha-like          187   3e-85   Cicer arietinum [garbanzo]
gb|AAN31833.1|  putative translation elongation factor eEF-1 alph...    187   3e-85   Arabidopsis thaliana [mouse-ear cress]
ref|XP_007222129.1|  hypothetical protein PRUPE_ppa005702mg             188   3e-85   Prunus persica
gb|AFW90638.1|  elongation factor 1-alpha-like protein                  186   3e-85   Solanum tuberosum [potatoes]
gb|EYU18863.1|  hypothetical protein MIMGU_mgv1a006280mg                187   4e-85   Erythranthe guttata [common monkey flower]
gb|EMS59091.1|  Elongation factor 1-alpha                               187   4e-85   Triticum urartu
ref|XP_009131916.1|  PREDICTED: elongation factor 1-alpha 1-like        187   4e-85   Brassica rapa
gb|ACG34498.1|  elongation factor 1-alpha                               187   4e-85   Zea mays [maize]
ref|XP_001766482.1|  predicted protein                                  186   4e-85   
ref|XP_004962249.1|  PREDICTED: elongation factor 1-alpha-like          188   4e-85   
ref|XP_009783256.1|  PREDICTED: elongation factor 1-alpha               187   4e-85   Nicotiana sylvestris
ref|XP_009793830.1|  PREDICTED: elongation factor 1-alpha-like          187   4e-85   Nicotiana sylvestris
sp|P43643.1|EF1A_TOBAC  RecName: Full=Elongation factor 1-alpha; ...    187   4e-85   Nicotiana tabacum [American tobacco]
ref|XP_004962277.1|  PREDICTED: elongation factor 1-alpha-like is...    188   4e-85   Setaria italica
dbj|BAC22127.1|  eukaryotic elongation factor 1A                        186   4e-85   Salsola komarovii
gb|KHG20498.1|  Elongation factor 1-alpha                               188   4e-85   Gossypium arboreum [tree cotton]
ref|XP_004984833.1|  PREDICTED: elongation factor 1-alpha-like          188   4e-85   Setaria italica
gb|KDO48480.1|  hypothetical protein CISIN_1g0132372mg                  187   4e-85   Citrus sinensis [apfelsine]
ref|XP_008233357.1|  PREDICTED: elongation factor 1-alpha-like          186   4e-85   Prunus mume [ume]
ref|XP_007009762.1|  GTP binding Elongation factor Tu family prot...    186   4e-85   
ref|XP_006436251.1|  hypothetical protein CICLE_v10033471mg             187   4e-85   Citrus clementina [clementine]
ref|XP_007218005.1|  hypothetical protein PRUPE_ppa005706mg             186   4e-85   Prunus persica
ref|XP_001763194.1|  predicted protein                                  186   4e-85   
ref|XP_010669657.1|  PREDICTED: elongation factor 1-alpha               186   4e-85   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_001753167.1|  predicted protein                                  186   4e-85   
ref|XP_004309880.1|  PREDICTED: elongation factor 1-alpha               188   4e-85   Fragaria vesca subsp. vesca
ref|XP_001763201.1|  predicted protein                                  185   4e-85   
ref|XP_001753181.1|  predicted protein                                  186   4e-85   
gb|EMS65134.1|  Elongation factor 1-alpha                               187   4e-85   Triticum urartu
ref|XP_011031783.1|  PREDICTED: elongation factor 1-alpha-like          187   5e-85   Populus euphratica
ref|XP_010669660.1|  PREDICTED: elongation factor 1-alpha-like          186   5e-85   Beta vulgaris subsp. vulgaris [field beet]
emb|CDP08919.1|  unnamed protein product                                186   5e-85   Coffea canephora [robusta coffee]
gb|ABF94275.1|  Elongation factor 1-alpha, putative, expressed          187   5e-85   Oryza sativa Japonica Group [Japonica rice]
gb|AAY56337.1|  elongation factor-1 alpha                               185   5e-85   Musa acuminata [banana]
gb|ACG70967.1|  translation elongation factor 1                         187   5e-85   Ziziphus jujuba [Chinese jujube]
gb|ABB16977.1|  elongation factor 1-alpha-like protein                  186   5e-85   Solanum tuberosum [potatoes]
ref|XP_004157309.1|  PREDICTED: elongation factor 1-alpha-like          185   5e-85   
gb|AAD56020.1|AF181492_1  elongation factor-1 alpha 3                   185   5e-85   Lilium longiflorum [Easter lily]
gb|EMT12343.1|  Elongation factor 1-alpha                               184   5e-85   
gb|AAL57653.1|  At1g07930/T6D22_3                                       187   6e-85   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002315287.1|  hypothetical protein POPTR_0010s22620g             186   6e-85   
gb|EMS49772.1|  Elongation factor 1-alpha                               184   6e-85   Triticum urartu
gb|AAK32834.1|AF361822_1  At1g07930/T6D22_3                             188   6e-85   Arabidopsis thaliana [mouse-ear cress]
ref|XP_004309883.1|  PREDICTED: elongation factor 1-alpha-like          187   6e-85   Fragaria vesca subsp. vesca
ref|XP_008385284.1|  PREDICTED: elongation factor 1-alpha-like          187   6e-85   
gb|AEE98364.1|  elongation factor 1-alpha                               184   7e-85   Deschampsia antarctica
gb|AEN79476.1|  elongation factor 1-alpha                               188   7e-85   Ziziphus jujuba [Chinese jujube]
emb|CAA34456.1|  elongation factor 1-alpha                              188   7e-85   Arabidopsis thaliana [mouse-ear cress]
gb|AAK25877.1|AF360167_1  putative translation elongation factor ...    186   7e-85   Arabidopsis thaliana [mouse-ear cress]
gb|ABR17675.1|  unknown                                                 186   7e-85   Picea sitchensis
ref|NP_001105935.1|  elongation factor alpha8                           188   7e-85   
gb|ABF00115.1|  elongation factor 1-alpha                               185   7e-85   Litchi chinensis [litchi]
gb|AFQ37423.1|  translation elongation factor-1 alpha 2                 188   7e-85   Larix kaempferi [karamatsu]
ref|XP_009126609.1|  PREDICTED: elongation factor 1-alpha 1-like        187   8e-85   Brassica rapa
gb|AIX10769.1|  elongation factor 1 alpha                               187   8e-85   Panax notoginseng [san-qi]
gb|AEQ94148.1|  elongation factor 1                                     186   8e-85   Elaeis guineensis
ref|XP_010669658.1|  PREDICTED: elongation factor 1-alpha-like          185   8e-85   Beta vulgaris subsp. vulgaris [field beet]
gb|ACN40740.1|  unknown                                                 186   8e-85   Picea sitchensis
gb|AER42621.1|  elongation factor 1 alpha                               184   8e-85   Hordeum brevisubulatum
gb|AGI78242.1|  elongation factor 1 alpha                               187   9e-85   Caragana korshinskii
ref|NP_001077483.1|  elongation factor 1-alpha 2                        187   9e-85   Arabidopsis thaliana [mouse-ear cress]
sp|P29521.1|EF1A1_DAUCA  RecName: Full=Elongation factor 1-alpha;...    184   9e-85   Daucus carota [carrots]
ref|XP_008790814.1|  PREDICTED: elongation factor 1-alpha-like          187   9e-85   Phoenix dactylifera
ref|XP_011026992.1|  PREDICTED: elongation factor 1-alpha isoform X2    187   9e-85   Populus euphratica
ref|XP_002311107.1|  ADR12-2 family protein                             186   1e-84   Populus trichocarpa [western balsam poplar]
gb|AEG78681.1|  elongation factor 1 alpha                               186   1e-84   Erythroxylum coca [coca]
gb|AFQ37422.1|  translation elongation factor-1 alpha 1                 186   1e-84   Larix kaempferi [karamatsu]
ref|XP_006378755.1|  hypothetical protein POPTR_0010s22560g             186   1e-84   
ref|XP_007207457.1|  hypothetical protein PRUPE_ppa005717mg             186   1e-84   Prunus persica
ref|XP_008224492.1|  PREDICTED: elongation factor 1-alpha               186   1e-84   Prunus mume [ume]
ref|XP_002312029.1|  ADR12-2 family protein                             186   1e-84   Populus trichocarpa [western balsam poplar]
ref|XP_002311106.1|  ADR12-2 family protein                             186   1e-84   Populus trichocarpa [western balsam poplar]
ref|XP_010939624.1|  PREDICTED: elongation factor 1-alpha-like          187   1e-84   Elaeis guineensis
ref|XP_006387491.1|  hypothetical protein POPTR_0966s00200g             186   1e-84   Populus trichocarpa [western balsam poplar]
ref|NP_001280807.1|  elongation factor 1-alpha-like                     186   1e-84   Malus domestica [apple tree]
ref|XP_004307410.1|  PREDICTED: elongation factor 1-alpha               186   1e-84   Fragaria vesca subsp. vesca
dbj|BAC66180.1|  elongation factor 1A                                   187   1e-84   
gb|ACN41180.1|  unknown                                                 185   1e-84   
ref|NP_001032107.1|  elongation factor 1-alpha 4                        187   1e-84   
gb|ABK25072.1|  unknown                                                 185   1e-84   
gb|ABK24265.1|  unknown                                                 185   1e-84   
ref|XP_010456376.1|  PREDICTED: elongation factor 1-alpha 1 isofo...    186   1e-84   
gb|AFO67216.1|  putative elongation factor 1-alpha                      187   1e-84   
gb|ABK24843.1|  unknown                                                 185   2e-84   
ref|XP_009342345.1|  PREDICTED: elongation factor 1-alpha-like          186   2e-84   
dbj|BAC22125.1|  eukaryotic elongation factor 1A                        184   2e-84   
ref|XP_008380544.1|  PREDICTED: elongation factor 1-alpha-like          186   2e-84   
dbj|BAC22126.1|  eukaryotic elongation factor 1A                        184   2e-84   
gb|EMT09703.1|  Elongation factor 1-alpha                               187   2e-84   
gb|AIZ74328.1|  translation elongation factor 1-alpha                   185   2e-84   
ref|XP_002968419.1|  hypothetical protein SELMODRAFT_270693             186   2e-84   
dbj|BAF02151.1|  elongation factor 1-alpha                              188   2e-84   
ref|XP_008349743.1|  PREDICTED: elongation factor 1-alpha isoform X2    185   3e-84   
gb|AFW87115.1|  putative translation elongation factor Tu family ...    185   4e-84   
ref|XP_002968422.1|  hypothetical protein SELMODRAFT_169717             185   5e-84   
ref|XP_002970579.1|  hypothetical protein SELMODRAFT_270852             185   5e-84   
gb|EYU18869.1|  hypothetical protein MIMGU_mgv1a010191mg                185   5e-84   
gb|ABF94276.1|  Elongation factor 1-alpha, putative, expressed          188   6e-84   
ref|XP_002970583.1|  hypothetical protein SELMODRAFT_171512             184   9e-84   
gb|AAL69396.1|  elongation factor 1-alpha                               181   9e-84   
sp|Q40034.1|EF1A2_HORVU  RecName: Full=Elongation factor 1-alpha;...    182   1e-83   
gb|AAL79774.1|AF331849_1  elongation factor 1 alpha                     182   1e-83   
gb|AGD99674.1|  eukaryotic elongation factor 1A                         184   1e-83   
sp|P34824.1|EF1A1_HORVU  RecName: Full=Elongation factor 1-alpha;...    179   1e-83   
gb|AAF99703.1|  elongation factor                                       182   2e-83   
gb|AEK98799.1|  translation elongation factor 1 alfa                    182   2e-83   
gb|AAK82537.1|  At1g07930/T6D22_3                                       182   2e-83   
ref|NP_001104939.1|  elongation factor alpha6                           183   3e-83   
gb|ACN40081.1|  unknown                                                 180   3e-83   
dbj|BAK08744.1|  elongation factor 1-alpha                              181   4e-83   
dbj|BAK08818.1|  elongation factor 1-alpha                              181   4e-83   
dbj|BAK08819.1|  elongation factor 1-alpha                              181   5e-83   
gb|AAL79775.1|  elongation factor 1 alpha                               188   2e-82   
dbj|BAG80668.1|  elongation factor 1 alpha                              187   4e-82   
emb|CAC27139.1|  translation elongation factor-1 alpha                  185   9e-82   
gb|KDP29085.1|  hypothetical protein JCGZ_16474                         171   6e-81   
ref|XP_002538495.1|  elongation factor 1-alpha, putative                172   1e-80   
gb|AIM48895.1|  elongation factor 1-alpha                               187   1e-80   
sp|Q41011.1|EF1A_PEA  RecName: Full=Elongation factor 1-alpha; Sh...    179   1e-80   
gb|ABX82323.1|  elongation factor 1 subunit alpha                       181   1e-80   
gb|AGF25313.1|  elongation factor 1-alpha                               186   1e-80   
ref|XP_003591959.1|  Elongation factor 1-alpha                          170   2e-80   
gb|AAQ15281.1|  elongation factor 1 alpha                               186   5e-80   
emb|CAA65798.1|  EF1-alpha                                              186   7e-80   
emb|CAA68246.1|  factor 1-alpha                                         185   8e-80   
gb|EAY88762.1|  hypothetical protein OsI_10238                          171   9e-80   
emb|CDY09214.1|  BnaA02g06400D                                          171   2e-79   
gb|AAR89627.1|  elongation factor 1 alpha                               184   2e-79   
gb|ABC74971.1|  elongation factor 1 alpha                               184   2e-79   
ref|XP_005650451.1|  translation elongation factor                      170   2e-79   
gb|AAQ15280.1|  elongation factor 1 alpha                               184   2e-79   
gb|AES59072.2|  GTP-binding elongation factor Tu family protein         170   2e-79   
ref|NP_001104938.1|  elongation factor 1 alpha                          177   3e-79   
gb|AFW77598.1|  putative translation elongation factor Tu family ...    170   3e-79   
ref|XP_006307727.1|  hypothetical protein CARUB_v100096371mg            169   5e-79   
gb|KJB76560.1|  hypothetical protein B456_012G094600                    170   5e-79   
gb|AAV71174.1|  elongation factor 1-alpha                               182   7e-79   
ref|XP_003588821.1|  Elongation factor 1-alpha                          168   9e-79   
dbj|BAK23239.1|  eukaryotic translation elongation factor 1 alpha       171   1e-78   
ref|NP_001275481.1|  elongation factor 1-alpha-like                     167   2e-78   
gb|KJB73629.1|  hypothetical protein B456_011G2414002                   165   4e-78   
gb|ACN59918.1|  translation elongation factor-1 alpha                   169   6e-78   
gb|AHL28542.1|  elongation factor 1-alpha                               186   2e-77   
gb|ABE01138.1|  elongation factor 1-alpha                               183   2e-76   
gb|ACA24136.1|  eukaryotic elongation factor 1-alpha                    187   2e-76   
gb|AGH32904.1|  translation elongation factor 1-alpha                   157   9e-76   
gb|AAX81595.1|  elongation factor elF1-alpha                            185   1e-75   
gb|AHL28535.1|  elongation factor 1-alpha                               186   3e-75   
gb|ABQ81941.1|  elongation factor 1-alpha                               185   7e-75   
dbj|BAA76426.1|  translation elongation factor                          186   1e-74   
gb|ABW20463.1|  elongation factor 1-alpha                               182   3e-74   
emb|CAD60652.1|  elongation factor                                      171   3e-74   
gb|AFB18314.1|  translation elongation factor-1 alpha                   182   4e-74   
ref|XP_002488910.1|  hypothetical protein SORBIDRAFT_2002s002020        156   6e-74   
gb|ABQ81936.1|  elongation factor 1-alpha                               181   8e-74   
emb|CDX93604.1|  BnaA06g04440D                                          180   6e-73   
gb|KEH43146.1|  elongation factor Tu (EF-Tu) GTP-binding family p...    167   6e-73   
ref|XP_001763198.1|  predicted protein                                  155   7e-73   
gb|KJB73625.1|  hypothetical protein B456_011G2412001                   153   9e-73   
emb|CCJ09439.1|  elongation factor 1 alpha                              155   2e-72   
ref|XP_008329250.1|  PREDICTED: elongation factor 1-alpha-like          155   2e-72   
gb|ACN59909.1|  translation elongation factor-1 alpha                   172   3e-72   
dbj|BAD02195.1|  translation elongation factor 1 alpha                  158   3e-72   
gb|AGN03872.1|  elongation factor 1                                     159   4e-72   
gb|KFO37506.1|  Potassium voltage-gated channel subfamily KQT mem...    152   4e-72   
ref|XP_002604722.1|  hypothetical protein BRAFLDRAFT_122567             155   4e-72   
emb|CDY61938.1|  BnaCnng38780D                                          179   4e-72   
ref|XP_007104009.1|  PREDICTED: elongation factor 1-alpha 2             151   4e-72   
ref|XP_001625311.1|  predicted protein                                  158   4e-72   
dbj|BAD35019.1|  elongation factor 1 alpha                              155   4e-72   
gb|AAL78750.1|  elongation factor-1 alpha                               155   5e-72   
ref|XP_004074126.1|  PREDICTED: elongation factor 1-alpha               153   5e-72   
ref|XP_010834950.1|  PREDICTED: elongation factor 1-alpha 2             152   5e-72   
tpg|DAA05867.1|  TPA: eukaryotic translation elongation factor 1A       154   5e-72   
gb|ADJ18333.1|  elongation factor 1 alpha                               155   5e-72   
gb|ADJ18332.1|  elongation factor 1 alpha                               154   5e-72   
ref|XP_003968867.1|  PREDICTED: elongation factor 1-alpha-like          153   5e-72   
gb|AEE61578.1|  unknown                                                 154   6e-72   
gb|ACO50110.1|  elongation factor 1 alpha                               152   6e-72   
emb|CDX88757.1|  BnaA03g08920D                                          179   6e-72   
ref|XP_008329251.1|  PREDICTED: elongation factor 1-alpha               154   7e-72   
dbj|BAG30769.1|  elongation factor 1 alpha                              154   7e-72   
ref|XP_005302147.1|  PREDICTED: elongation factor 1-alpha 1-like        154   7e-72   
gb|AAV84215.1|  elongation factor 1 alpha                               154   7e-72   
gb|AAT91089.1|  elongation factor 1-alpha                               152   7e-72   
ref|XP_006235797.1|  PREDICTED: elongation factor 1-alpha 2 isofo...    152   7e-72   
gb|ELR44723.1|  Elongation factor 1-alpha 2                             152   8e-72   
dbj|BAM18878.1|  elongation factor 1 alpha                              154   8e-72   
gb|KFQ31255.1|  Elongation factor 1-alpha 2                             152   8e-72   
ref|XP_002117044.1|  elongation factor 1 alpha                          155   8e-72   
gb|AIY54298.1|  elongation factor 1-alpha                               154   8e-72   
gb|ELV11338.1|  Potassium voltage-gated channel subfamily KQT mem...    151   8e-72   
ref|NP_001166227.1|  elongation factor 1-alpha                          154   9e-72   
ref|XP_004572773.1|  PREDICTED: elongation factor 1-alpha-like          153   9e-72   
ref|XP_008182369.1|  PREDICTED: elongation factor 1-alpha               154   1e-71   
ref|XP_011213301.1|  PREDICTED: elongation factor 1-alpha 1             154   1e-71   
ref|XP_011502849.1|  PREDICTED: elongation factor 1-alpha               154   1e-71   
gb|ACL97367.1|  elongation factor-1 alpha                               170   1e-71   
ref|XP_003696535.1|  PREDICTED: elongation factor 1-alpha-like          154   1e-71   
emb|CAF89665.1|  unnamed protein product                                152   1e-71   
ref|NP_001037510.1|  elongation factor 1-alpha                          155   1e-71   
gb|AJN91132.1|  elongation factor 1-alpha                               154   1e-71   
dbj|BAJ15871.1|  elongation factor 1 alpha                              154   1e-71   
gb|AJG43843.1|  translation elongation factor EF-1 alpha subunit        154   1e-71   
ref|NP_571338.1|  elongation factor 1-alpha                             152   1e-71   
gb|AFK49795.1|  elongation factor 1-alpha                               154   1e-71   
ref|XP_004716094.1|  PREDICTED: elongation factor 1-alpha 2 isofo...    154   1e-71   
ref|XP_010351233.1|  PREDICTED: elongation factor 1-alpha               154   1e-71   
emb|CAF89666.1|  unnamed protein product                                154   1e-71   
ref|XP_001948740.2|  PREDICTED: elongation factor 1-alpha-like          153   1e-71   
dbj|BAJ15870.1|  elongation factor 1 alpha                              154   1e-71   
ref|XP_003705350.1|  PREDICTED: elongation factor 1-alpha-like          154   1e-71   
ref|XP_011194365.1|  PREDICTED: elongation factor 1-alpha 1             153   1e-71   
gb|EMP28454.1|  Elongation factor 1-alpha 1                             152   1e-71   
ref|NP_001002371.1|  elongation factor 1-alpha 2                        153   1e-71   
gb|KDR17161.1|  Elongation factor 1-alpha                               154   1e-71   
gb|AAO49408.1|AF485331_1  elongation factor 1-alpha                     152   1e-71   
ref|XP_010736053.1|  PREDICTED: elongation factor 1-alpha-like          154   1e-71   
ref|XP_010736036.1|  PREDICTED: elongation factor 1-alpha               152   1e-71   
ref|NP_001032962.1|  elongation factor 1 alpha                          153   1e-71   
ref|NP_001098132.1|  elongation factor 1-alpha                          153   1e-71   
ref|XP_004716095.1|  PREDICTED: elongation factor 1-alpha 2 isofo...    154   1e-71   
ref|XP_011159441.1|  PREDICTED: elongation factor 1-alpha               154   1e-71   
gb|AEO51761.1|  EF-1a                                                   154   1e-71   
ref|NP_524611.1|  elongation factor 1alpha100E, isoform A               154   1e-71   
ref|XP_002670662.1|  predicted protein                                  153   1e-71   
gb|AFJ44727.1|  elongation factor 1 alpha                               154   1e-71   
dbj|BAB64567.1|  elongation factor-1 alpha                              152   1e-71   
ref|XP_007245773.1|  PREDICTED: elongation factor 1-alpha-like          152   1e-71   
gb|AIL54058.1|  elongation factor 1 alpha                               153   1e-71   
ref|XP_004520688.1|  PREDICTED: elongation factor 1-alpha 1-like        153   1e-71   
ref|XP_006639575.1|  PREDICTED: elongation factor 1-alpha 2-like        152   1e-71   
gb|ADJ18334.1|  elongation factor 1 alpha                               153   1e-71   
ref|XP_003401992.1|  PREDICTED: elongation factor 1-alpha 1             154   1e-71   
ref|XP_007185479.1|  PREDICTED: elongation factor 1-alpha 2             150   2e-71   
ref|XP_011493435.1|  AAEL017096-PA                                      154   2e-71   
dbj|BAO56800.1|  elongation factor 1-alpha                              152   2e-71   
ref|XP_003492701.1|  PREDICTED: elongation factor 1-alpha 1 isofo...    154   2e-71   
ref|XP_006569953.1|  PREDICTED: elongation factor 1-alpha isoform X1    154   2e-71   
ref|NP_001014993.1|  elongation factor 1-alpha                          154   2e-71   
gb|AEB31334.1|  elongation factor 1-alpha                               153   2e-71   
ref|NP_001107835.1|  elongation factor 1-alpha                          154   2e-71   
emb|CBY09087.1|  unnamed protein product                                153   2e-71   
ref|XP_011279138.1|  PREDICTED: elongation factor 1-alpha 2             152   2e-71   
ref|XP_008329252.1|  PREDICTED: elongation factor 1-alpha               151   2e-71   
ref|NP_001266576.1|  elongation factor 1a                               154   2e-71   
ref|XP_011304459.1|  PREDICTED: elongation factor 1-alpha               153   2e-71   
gb|ADN94290.1|  elongation factor 1                                     152   2e-71   
gb|AAR89978.1|  putative elongation factor 1-alpha                      153   2e-71   
ref|XP_011340017.1|  PREDICTED: elongation factor 1-alpha               153   2e-71   
ref|XP_006268032.1|  PREDICTED: elongation factor 1-alpha, oocyte...    152   2e-71   
ref|XP_002070544.1|  GK12116                                            153   2e-71   
emb|CDY06289.1|  BnaA09g49140D                                          178   2e-71   
ref|XP_005739861.1|  PREDICTED: elongation factor 1-alpha-like          153   2e-71   
ref|XP_002053872.1|  GJ23103                                            153   2e-71   
dbj|BAF64485.1|  elongation factor 1 alpha isoform 2                    151   2e-71   
ref|XP_001999327.1|  GI23129                                            153   2e-71   
ref|XP_001358993.1|  GA15055                                            153   2e-71   
ref|XP_007067667.1|  PREDICTED: elongation factor 1-alpha, oocyte...    152   2e-71   
gb|ABV68853.1|  elongation factor 1 alpha                               154   2e-71   
ref|XP_002091158.1|  GE12389                                            153   2e-71   
ref|XP_001964572.1|  GF22982                                            153   2e-71   
ref|XP_002081092.1|  GD10821                                            153   2e-71   
ref|NP_477375.1|  elongation factor 1alpha48D, isoform A                153   2e-71   
ref|XP_006019355.1|  PREDICTED: elongation factor 1-alpha, oocyte...    152   2e-71   
ref|XP_002059330.1|  GJ17887                                            153   2e-71   
ref|XP_002004478.1|  GI19955                                            153   2e-71   
ref|XP_001989696.1|  GH18651                                            153   2e-71   
ref|XP_007245774.1|  PREDICTED: elongation factor 1-alpha-like          152   2e-71   
ref|XP_001959909.1|  GF13105                                            153   2e-71   
ref|XP_855343.2|  PREDICTED: spidroin-2-like                            150   2e-71   
ref|XP_002066234.1|  GK22048                                            153   2e-71   
ref|XP_005739860.1|  PREDICTED: elongation factor 1-alpha-like          152   2e-71   
ref|XP_003482639.1|  PREDICTED: elongation factor 1-alpha, oocyte...    152   2e-71   
ref|XP_001951287.3|  PREDICTED: elongation factor 1-alpha 2-like        153   2e-71   
gb|ACV83782.1|  elongation factor 1 alpha                               153   2e-71   
ref|XP_005802896.1|  PREDICTED: elongation factor 1-alpha-like          150   2e-71   
gb|AAP20169.1|  elongation factor 1-alpha                               152   2e-71   
ref|XP_001361821.2|  GA20951                                            153   3e-71   
ref|XP_001986652.1|  GH21478                                            152   3e-71   
ref|XP_966355.1|  PREDICTED: elongation factor 1-alpha                  154   3e-71   
gb|AAI28792.1|  Zgc:109885 protein                                      152   3e-71   
ref|XP_005185335.1|  PREDICTED: elongation factor 1-alpha 2             152   3e-71   
ref|NP_001035074.1|  eukaryotic translation elongation factor 1 a...    152   3e-71   
ref|XP_011269702.1|  PREDICTED: elongation factor 1-alpha               154   3e-71   
ref|XP_005302149.1|  PREDICTED: elongation factor 1-alpha, somati...    153   3e-71   
ref|XP_010736051.1|  PREDICTED: elongation factor 1-alpha-like          152   3e-71   
emb|CDY67375.1|  BnaC03g71520D                                          177   3e-71   
ref|XP_003421836.1|  PREDICTED: elongation factor 1-alpha 2             151   3e-71   
gb|KFW90563.1|  Elongation factor 1-alpha 2                             152   3e-71   
ref|XP_008319518.1|  PREDICTED: elongation factor 1-alpha, somati...    152   3e-71   
ref|XP_008547400.1|  PREDICTED: elongation factor 1-alpha               154   3e-71   
gb|AAD56406.1|AF184170_1  elongation factor 1-alpha                     152   3e-71   
ref|NP_956303.1|  eukaryotic translation elongation factor 1 alph...    152   3e-71   
gb|AAA41967.1|  statin-related protein                                  152   3e-71   
emb|CEF65912.1|  Elongation factor 1-alpha                              152   3e-71   
ref|XP_005181516.1|  PREDICTED: elongation factor 1-alpha 1             153   3e-71   



>gb|AHB86963.1| elongation factor 1-alpha [Sedum alfredii]
Length=447

 Score =   189 bits (480),  Expect(2) = 3e-86, Method: Compositional matrix adjust.
 Identities = 87/89 (98%), Positives = 88/89 (99%), Gaps = 0/89 (0%)
 Frame = +1

Query  316  LPLWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTR  495
            + LWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTR
Sbjct  75   IALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTR  134

Query  496  EHALLAFTLGVKQMICCCNKIDATTPKYS  582
            EHALLAFTLGVKQMICCCNKIDATTPKYS
Sbjct  135  EHALLAFTLGVKQMICCCNKIDATTPKYS  163


 Score =   156 bits (395),  Expect(2) = 3e-86, Method: Compositional matrix adjust.
 Identities = 76/77 (99%), Positives = 77/77 (100%), Gaps = 0/77 (0%)
 Frame = +3

Query  93   MGKEKVHISIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  272
            MGKEK+HISIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKIHISIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  273  DKLKAERERGITIDIAL  323
            DKLKAERERGITIDIAL
Sbjct  61   DKLKAERERGITIDIAL  77



>ref|XP_009421379.1| PREDICTED: elongation factor 1-alpha-like [Musa acuminata subsp. 
malaccensis]
Length=447

 Score =   188 bits (477),  Expect(2) = 3e-86, Method: Compositional matrix adjust.
 Identities = 86/89 (97%), Positives = 88/89 (99%), Gaps = 0/89 (0%)
 Frame = +1

Query  316  LPLWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTR  495
            + LWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTR
Sbjct  75   IALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTR  134

Query  496  EHALLAFTLGVKQMICCCNKIDATTPKYS  582
            EHALLAFTLGVKQMICCCNK+DATTPKYS
Sbjct  135  EHALLAFTLGVKQMICCCNKMDATTPKYS  163


 Score =   157 bits (398),  Expect(2) = 3e-86, Method: Compositional matrix adjust.
 Identities = 77/77 (100%), Positives = 77/77 (100%), Gaps = 0/77 (0%)
 Frame = +3

Query  93   MGKEKVHISIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  272
            MGKEKVHISIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKVHISIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  273  DKLKAERERGITIDIAL  323
            DKLKAERERGITIDIAL
Sbjct  61   DKLKAERERGITIDIAL  77



>ref|XP_009380678.1| PREDICTED: elongation factor 1-alpha-like [Musa acuminata subsp. 
malaccensis]
 ref|XP_009380679.1| PREDICTED: elongation factor 1-alpha-like [Musa acuminata subsp. 
malaccensis]
 ref|XP_009380680.1| PREDICTED: elongation factor 1-alpha-like [Musa acuminata subsp. 
malaccensis]
Length=447

 Score =   188 bits (477),  Expect(2) = 3e-86, Method: Compositional matrix adjust.
 Identities = 86/89 (97%), Positives = 88/89 (99%), Gaps = 0/89 (0%)
 Frame = +1

Query  316  LPLWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTR  495
            + LWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTR
Sbjct  75   IALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTR  134

Query  496  EHALLAFTLGVKQMICCCNKIDATTPKYS  582
            EHALLAFTLGVKQMICCCNK+DATTPKYS
Sbjct  135  EHALLAFTLGVKQMICCCNKMDATTPKYS  163


 Score =   157 bits (398),  Expect(2) = 3e-86, Method: Compositional matrix adjust.
 Identities = 77/77 (100%), Positives = 77/77 (100%), Gaps = 0/77 (0%)
 Frame = +3

Query  93   MGKEKVHISIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  272
            MGKEKVHISIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKVHISIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  273  DKLKAERERGITIDIAL  323
            DKLKAERERGITIDIAL
Sbjct  61   DKLKAERERGITIDIAL  77



>ref|XP_007015466.1| GTP binding Elongation factor Tu family protein isoform 1 [Theobroma 
cacao]
 gb|EOY33085.1| GTP binding Elongation factor Tu family protein isoform 1 [Theobroma 
cacao]
Length=449

 Score =   188 bits (477),  Expect(2) = 3e-86, Method: Compositional matrix adjust.
 Identities = 86/89 (97%), Positives = 88/89 (99%), Gaps = 0/89 (0%)
 Frame = +1

Query  316  LPLWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTR  495
            + LWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTR
Sbjct  75   IALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTR  134

Query  496  EHALLAFTLGVKQMICCCNKIDATTPKYS  582
            EHALLAFTLGVKQMICCCNK+DATTPKYS
Sbjct  135  EHALLAFTLGVKQMICCCNKMDATTPKYS  163


 Score =   157 bits (397),  Expect(2) = 3e-86, Method: Compositional matrix adjust.
 Identities = 77/77 (100%), Positives = 77/77 (100%), Gaps = 0/77 (0%)
 Frame = +3

Query  93   MGKEKVHISIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  272
            MGKEKVHISIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKVHISIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  273  DKLKAERERGITIDIAL  323
            DKLKAERERGITIDIAL
Sbjct  61   DKLKAERERGITIDIAL  77



>ref|XP_007015463.1| GTP binding Elongation factor Tu family protein [Theobroma cacao]
 gb|EOY33082.1| GTP binding Elongation factor Tu family protein [Theobroma cacao]
Length=449

 Score =   188 bits (477),  Expect(2) = 3e-86, Method: Compositional matrix adjust.
 Identities = 86/89 (97%), Positives = 88/89 (99%), Gaps = 0/89 (0%)
 Frame = +1

Query  316  LPLWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTR  495
            + LWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTR
Sbjct  75   IALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTR  134

Query  496  EHALLAFTLGVKQMICCCNKIDATTPKYS  582
            EHALLAFTLGVKQMICCCNK+DATTPKYS
Sbjct  135  EHALLAFTLGVKQMICCCNKMDATTPKYS  163


 Score =   157 bits (397),  Expect(2) = 3e-86, Method: Compositional matrix adjust.
 Identities = 77/77 (100%), Positives = 77/77 (100%), Gaps = 0/77 (0%)
 Frame = +3

Query  93   MGKEKVHISIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  272
            MGKEKVHISIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKVHISIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  273  DKLKAERERGITIDIAL  323
            DKLKAERERGITIDIAL
Sbjct  61   DKLKAERERGITIDIAL  77



>ref|XP_010032225.1| PREDICTED: elongation factor 1-alpha-like [Eucalyptus grandis]
Length=448

 Score =   188 bits (477),  Expect(2) = 3e-86, Method: Compositional matrix adjust.
 Identities = 86/89 (97%), Positives = 88/89 (99%), Gaps = 0/89 (0%)
 Frame = +1

Query  316  LPLWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTR  495
            + LWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTR
Sbjct  75   IALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTR  134

Query  496  EHALLAFTLGVKQMICCCNKIDATTPKYS  582
            EHALLAFTLGVKQMICCCNK+DATTPKYS
Sbjct  135  EHALLAFTLGVKQMICCCNKMDATTPKYS  163


 Score =   157 bits (397),  Expect(2) = 3e-86, Method: Compositional matrix adjust.
 Identities = 77/77 (100%), Positives = 77/77 (100%), Gaps = 0/77 (0%)
 Frame = +3

Query  93   MGKEKVHISIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  272
            MGKEKVHISIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKVHISIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  273  DKLKAERERGITIDIAL  323
            DKLKAERERGITIDIAL
Sbjct  61   DKLKAERERGITIDIAL  77



>ref|XP_009392715.1| PREDICTED: elongation factor 1-alpha-like [Musa acuminata subsp. 
malaccensis]
 ref|XP_009392716.1| PREDICTED: elongation factor 1-alpha-like [Musa acuminata subsp. 
malaccensis]
Length=447

 Score =   187 bits (476),  Expect(2) = 4e-86, Method: Compositional matrix adjust.
 Identities = 86/89 (97%), Positives = 88/89 (99%), Gaps = 0/89 (0%)
 Frame = +1

Query  316  LPLWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTR  495
            + LWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTR
Sbjct  75   IALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTR  134

Query  496  EHALLAFTLGVKQMICCCNKIDATTPKYS  582
            EHALLAFTLGVKQMICCCNK+DATTPKYS
Sbjct  135  EHALLAFTLGVKQMICCCNKMDATTPKYS  163


 Score =   157 bits (397),  Expect(2) = 4e-86, Method: Compositional matrix adjust.
 Identities = 77/77 (100%), Positives = 77/77 (100%), Gaps = 0/77 (0%)
 Frame = +3

Query  93   MGKEKVHISIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  272
            MGKEKVHISIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKVHISIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  273  DKLKAERERGITIDIAL  323
            DKLKAERERGITIDIAL
Sbjct  61   DKLKAERERGITIDIAL  77



>dbj|BAM13877.1| elongation factor 1 alpha [Arum maculatum]
Length=447

 Score =   187 bits (476),  Expect(2) = 4e-86, Method: Compositional matrix adjust.
 Identities = 86/89 (97%), Positives = 88/89 (99%), Gaps = 0/89 (0%)
 Frame = +1

Query  316  LPLWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTR  495
            + LWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTR
Sbjct  75   IALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTR  134

Query  496  EHALLAFTLGVKQMICCCNKIDATTPKYS  582
            EHALLAFTLGVKQMICCCNK+DATTPKYS
Sbjct  135  EHALLAFTLGVKQMICCCNKMDATTPKYS  163


 Score =   157 bits (397),  Expect(2) = 4e-86, Method: Compositional matrix adjust.
 Identities = 77/77 (100%), Positives = 77/77 (100%), Gaps = 0/77 (0%)
 Frame = +3

Query  93   MGKEKVHISIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  272
            MGKEKVHISIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKVHISIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  273  DKLKAERERGITIDIAL  323
            DKLKAERERGITIDIAL
Sbjct  61   DKLKAERERGITIDIAL  77



>ref|XP_009420035.1| PREDICTED: elongation factor 1-alpha [Musa acuminata subsp. malaccensis]
 ref|XP_009420036.1| PREDICTED: elongation factor 1-alpha [Musa acuminata subsp. malaccensis]
Length=447

 Score =   187 bits (476),  Expect(2) = 4e-86, Method: Compositional matrix adjust.
 Identities = 86/89 (97%), Positives = 88/89 (99%), Gaps = 0/89 (0%)
 Frame = +1

Query  316  LPLWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTR  495
            + LWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTR
Sbjct  75   IALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTR  134

Query  496  EHALLAFTLGVKQMICCCNKIDATTPKYS  582
            EHALLAFTLGVKQMICCCNK+DATTPKYS
Sbjct  135  EHALLAFTLGVKQMICCCNKMDATTPKYS  163


 Score =   157 bits (397),  Expect(2) = 4e-86, Method: Compositional matrix adjust.
 Identities = 77/77 (100%), Positives = 77/77 (100%), Gaps = 0/77 (0%)
 Frame = +3

Query  93   MGKEKVHISIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  272
            MGKEKVHISIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKVHISIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  273  DKLKAERERGITIDIAL  323
            DKLKAERERGITIDIAL
Sbjct  61   DKLKAERERGITIDIAL  77



>gb|AAN77897.1| elongation factor 1 alpha [Stevia rebaudiana]
Length=449

 Score =   188 bits (477),  Expect(2) = 5e-86, Method: Compositional matrix adjust.
 Identities = 86/89 (97%), Positives = 88/89 (99%), Gaps = 0/89 (0%)
 Frame = +1

Query  316  LPLWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTR  495
            + LWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTR
Sbjct  75   IALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTR  134

Query  496  EHALLAFTLGVKQMICCCNKIDATTPKYS  582
            EHALLAFTLGVKQMICCCNK+DATTPKYS
Sbjct  135  EHALLAFTLGVKQMICCCNKMDATTPKYS  163


 Score =   157 bits (396),  Expect(2) = 5e-86, Method: Compositional matrix adjust.
 Identities = 76/77 (99%), Positives = 77/77 (100%), Gaps = 0/77 (0%)
 Frame = +3

Query  93   MGKEKVHISIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  272
            MGKEK+HISIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKIHISIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  273  DKLKAERERGITIDIAL  323
            DKLKAERERGITIDIAL
Sbjct  61   DKLKAERERGITIDIAL  77



>ref|XP_004143833.1| PREDICTED: uncharacterized protein LOC101220517 [Cucumis sativus]
Length=933

 Score =   191 bits (486),  Expect(2) = 5e-86, Method: Compositional matrix adjust.
 Identities = 87/89 (98%), Positives = 89/89 (100%), Gaps = 0/89 (0%)
 Frame = +1

Query  316  LPLWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTR  495
            +PLWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTR
Sbjct  559  IPLWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTR  618

Query  496  EHALLAFTLGVKQMICCCNKIDATTPKYS  582
            EHALLAFTLGVKQMICCCNK+DATTPKYS
Sbjct  619  EHALLAFTLGVKQMICCCNKMDATTPKYS  647


 Score =   153 bits (386),  Expect(2) = 5e-86, Method: Compositional matrix adjust.
 Identities = 79/96 (82%), Positives = 82/96 (85%), Gaps = 5/96 (5%)
 Frame = +3

Query  51   PQPSSE--ESFY*KLR---MGKEKVHISIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIER  215
            P PS +     Y  +R   MGKEK HI+IVVIGHVDSGKSTTTGHLIYKLGGIDKRVIER
Sbjct  466  PAPSHQWTPDVYEGVRYSSMGKEKTHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIER  525

Query  216  FEKEAAEMNKRSFKYAWVLDKLKAERERGITIDIAL  323
            FEKEAAEMNKRSFKYAWVLDKLKAERERGITIDI L
Sbjct  526  FEKEAAEMNKRSFKYAWVLDKLKAERERGITIDIPL  561


 Score =   185 bits (470),  Expect(2) = 6e-85, Method: Compositional matrix adjust.
 Identities = 84/89 (94%), Positives = 87/89 (98%), Gaps = 0/89 (0%)
 Frame = +1

Query  316  LPLWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTR  495
            + LWKFET KYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTR
Sbjct  75   IALWKFETAKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTR  134

Query  496  EHALLAFTLGVKQMICCCNKIDATTPKYS  582
            EHALLAFTLGV+QMICCCNK+DATTPKYS
Sbjct  135  EHALLAFTLGVRQMICCCNKMDATTPKYS  163


 Score =   155 bits (393),  Expect(2) = 6e-85, Method: Compositional matrix adjust.
 Identities = 76/77 (99%), Positives = 77/77 (100%), Gaps = 0/77 (0%)
 Frame = +3

Query  93   MGKEKVHISIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  272
            MGKEKVHI+IVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  273  DKLKAERERGITIDIAL  323
            DKLKAERERGITIDIAL
Sbjct  61   DKLKAERERGITIDIAL  77



>sp|P34823.1|EF1A2_DAUCA RecName: Full=Elongation factor 1-alpha; Short=EF-1-alpha [Daucus 
carota]
 dbj|BAA02205.1| elongation factor 1-alpha [Daucus carota]
Length=447

 Score =   188 bits (477),  Expect(2) = 5e-86, Method: Compositional matrix adjust.
 Identities = 86/89 (97%), Positives = 88/89 (99%), Gaps = 0/89 (0%)
 Frame = +1

Query  316  LPLWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTR  495
            + LWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTR
Sbjct  75   IALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTR  134

Query  496  EHALLAFTLGVKQMICCCNKIDATTPKYS  582
            EHALLAFTLGVKQMICCCNK+DATTPKYS
Sbjct  135  EHALLAFTLGVKQMICCCNKMDATTPKYS  163


 Score =   156 bits (395),  Expect(2) = 5e-86, Method: Compositional matrix adjust.
 Identities = 76/77 (99%), Positives = 77/77 (100%), Gaps = 0/77 (0%)
 Frame = +3

Query  93   MGKEKVHISIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  272
            MGKEK+HISIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKIHISIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  273  DKLKAERERGITIDIAL  323
            DKLKAERERGITIDIAL
Sbjct  61   DKLKAERERGITIDIAL  77



>gb|AID52924.1| elongation factor 1-alpha [Carthamus tinctorius]
Length=449

 Score =   188 bits (477),  Expect(2) = 5e-86, Method: Compositional matrix adjust.
 Identities = 86/89 (97%), Positives = 88/89 (99%), Gaps = 0/89 (0%)
 Frame = +1

Query  316  LPLWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTR  495
            + LWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTR
Sbjct  75   IALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTR  134

Query  496  EHALLAFTLGVKQMICCCNKIDATTPKYS  582
            EHALLAFTLGVKQMICCCNK+DATTPKYS
Sbjct  135  EHALLAFTLGVKQMICCCNKMDATTPKYS  163


 Score =   156 bits (395),  Expect(2) = 5e-86, Method: Compositional matrix adjust.
 Identities = 76/77 (99%), Positives = 77/77 (100%), Gaps = 0/77 (0%)
 Frame = +3

Query  93   MGKEKVHISIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  272
            MGKEK+HISIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKIHISIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  273  DKLKAERERGITIDIAL  323
            DKLKAERERGITIDIAL
Sbjct  61   DKLKAERERGITIDIAL  77



>gb|ABB72813.1| elongation factor 1-alpha-like protein [Solanum tuberosum]
Length=448

 Score =   187 bits (476),  Expect(2) = 5e-86, Method: Compositional matrix adjust.
 Identities = 86/89 (97%), Positives = 88/89 (99%), Gaps = 0/89 (0%)
 Frame = +1

Query  316  LPLWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTR  495
            + LWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTR
Sbjct  75   IALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTR  134

Query  496  EHALLAFTLGVKQMICCCNKIDATTPKYS  582
            EHALLAFTLGVKQMICCCNK+DATTPKYS
Sbjct  135  EHALLAFTLGVKQMICCCNKMDATTPKYS  163


 Score =   157 bits (396),  Expect(2) = 5e-86, Method: Compositional matrix adjust.
 Identities = 76/77 (99%), Positives = 77/77 (100%), Gaps = 0/77 (0%)
 Frame = +3

Query  93   MGKEKVHISIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  272
            MGKEK+HISIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKIHISIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  273  DKLKAERERGITIDIAL  323
            DKLKAERERGITIDIAL
Sbjct  61   DKLKAERERGITIDIAL  77



>gb|ABV26710.1| elongation factor 1 alpha [Gerbera hybrid cultivar]
Length=449

 Score =   188 bits (477),  Expect(2) = 5e-86, Method: Compositional matrix adjust.
 Identities = 86/89 (97%), Positives = 88/89 (99%), Gaps = 0/89 (0%)
 Frame = +1

Query  316  LPLWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTR  495
            + LWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTR
Sbjct  75   IALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTR  134

Query  496  EHALLAFTLGVKQMICCCNKIDATTPKYS  582
            EHALLAFTLGVKQMICCCNK+DATTPKYS
Sbjct  135  EHALLAFTLGVKQMICCCNKMDATTPKYS  163


 Score =   156 bits (395),  Expect(2) = 5e-86, Method: Compositional matrix adjust.
 Identities = 76/77 (99%), Positives = 77/77 (100%), Gaps = 0/77 (0%)
 Frame = +3

Query  93   MGKEKVHISIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  272
            MGKEK+HISIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKIHISIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  273  DKLKAERERGITIDIAL  323
            DKLKAERERGITIDIAL
Sbjct  61   DKLKAERERGITIDIAL  77



>ref|XP_010535587.1| PREDICTED: elongation factor 1-alpha [Tarenaya hassleriana]
Length=449

 Score =   188 bits (477),  Expect(2) = 6e-86, Method: Compositional matrix adjust.
 Identities = 86/89 (97%), Positives = 88/89 (99%), Gaps = 0/89 (0%)
 Frame = +1

Query  316  LPLWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTR  495
            + LWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTR
Sbjct  75   IALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTR  134

Query  496  EHALLAFTLGVKQMICCCNKIDATTPKYS  582
            EHALLAFTLGVKQMICCCNK+DATTPKYS
Sbjct  135  EHALLAFTLGVKQMICCCNKMDATTPKYS  163


 Score =   156 bits (395),  Expect(2) = 6e-86, Method: Compositional matrix adjust.
 Identities = 76/77 (99%), Positives = 77/77 (100%), Gaps = 0/77 (0%)
 Frame = +3

Query  93   MGKEKVHISIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  272
            MGKEKVHI+IVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  273  DKLKAERERGITIDIAL  323
            DKLKAERERGITIDIAL
Sbjct  61   DKLKAERERGITIDIAL  77



>ref|XP_010542598.1| PREDICTED: elongation factor 1-alpha-like [Tarenaya hassleriana]
Length=449

 Score =   188 bits (478),  Expect(2) = 6e-86, Method: Compositional matrix adjust.
 Identities = 86/89 (97%), Positives = 88/89 (99%), Gaps = 0/89 (0%)
 Frame = +1

Query  316  LPLWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTR  495
            + LWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTR
Sbjct  75   IALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTR  134

Query  496  EHALLAFTLGVKQMICCCNKIDATTPKYS  582
            EHALLAFTLGVKQMICCCNK+DATTPKYS
Sbjct  135  EHALLAFTLGVKQMICCCNKMDATTPKYS  163


 Score =   156 bits (394),  Expect(2) = 6e-86, Method: Compositional matrix adjust.
 Identities = 76/77 (99%), Positives = 77/77 (100%), Gaps = 0/77 (0%)
 Frame = +3

Query  93   MGKEKVHISIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  272
            MGKEKVHI+IVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  273  DKLKAERERGITIDIAL  323
            DKLKAERERGITIDIAL
Sbjct  61   DKLKAERERGITIDIAL  77



>gb|AGC94754.1| elongation factor 1 alpha [Euphorbia lathyris]
Length=447

 Score =   188 bits (477),  Expect(2) = 6e-86, Method: Compositional matrix adjust.
 Identities = 86/89 (97%), Positives = 88/89 (99%), Gaps = 0/89 (0%)
 Frame = +1

Query  316  LPLWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTR  495
            + LWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTR
Sbjct  75   IALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTR  134

Query  496  EHALLAFTLGVKQMICCCNKIDATTPKYS  582
            EHALLAFTLGVKQMICCCNK+DATTPKYS
Sbjct  135  EHALLAFTLGVKQMICCCNKMDATTPKYS  163


 Score =   156 bits (395),  Expect(2) = 6e-86, Method: Compositional matrix adjust.
 Identities = 76/77 (99%), Positives = 77/77 (100%), Gaps = 0/77 (0%)
 Frame = +3

Query  93   MGKEKVHISIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  272
            MGKEK+HISIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKIHISIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  273  DKLKAERERGITIDIAL  323
            DKLKAERERGITIDIAL
Sbjct  61   DKLKAERERGITIDIAL  77



>gb|AHE76183.1| elongation factor 1-alpha [Chrysanthemum indicum]
Length=449

 Score =   188 bits (477),  Expect(2) = 6e-86, Method: Compositional matrix adjust.
 Identities = 86/89 (97%), Positives = 88/89 (99%), Gaps = 0/89 (0%)
 Frame = +1

Query  316  LPLWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTR  495
            + LWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTR
Sbjct  75   IALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTR  134

Query  496  EHALLAFTLGVKQMICCCNKIDATTPKYS  582
            EHALLAFTLGVKQMICCCNK+DATTPKYS
Sbjct  135  EHALLAFTLGVKQMICCCNKMDATTPKYS  163


 Score =   156 bits (395),  Expect(2) = 6e-86, Method: Compositional matrix adjust.
 Identities = 76/77 (99%), Positives = 77/77 (100%), Gaps = 0/77 (0%)
 Frame = +3

Query  93   MGKEKVHISIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  272
            MGKEK+HISIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKIHISIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  273  DKLKAERERGITIDIAL  323
            DKLKAERERGITIDIAL
Sbjct  61   DKLKAERERGITIDIAL  77



>ref|XP_010557310.1| PREDICTED: elongation factor 1-alpha-like [Tarenaya hassleriana]
 ref|XP_010557311.1| PREDICTED: elongation factor 1-alpha-like [Tarenaya hassleriana]
Length=449

 Score =   188 bits (477),  Expect(2) = 6e-86, Method: Compositional matrix adjust.
 Identities = 86/89 (97%), Positives = 88/89 (99%), Gaps = 0/89 (0%)
 Frame = +1

Query  316  LPLWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTR  495
            + LWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTR
Sbjct  75   IALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTR  134

Query  496  EHALLAFTLGVKQMICCCNKIDATTPKYS  582
            EHALLAFTLGVKQMICCCNK+DATTPKYS
Sbjct  135  EHALLAFTLGVKQMICCCNKMDATTPKYS  163


 Score =   156 bits (395),  Expect(2) = 6e-86, Method: Compositional matrix adjust.
 Identities = 76/77 (99%), Positives = 77/77 (100%), Gaps = 0/77 (0%)
 Frame = +3

Query  93   MGKEKVHISIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  272
            MGKEKVHI+IVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  273  DKLKAERERGITIDIAL  323
            DKLKAERERGITIDIAL
Sbjct  61   DKLKAERERGITIDIAL  77



>gb|AGI15328.1| elongation factor 1 [Aegiceras corniculatum]
Length=449

 Score =   188 bits (478),  Expect(2) = 6e-86, Method: Compositional matrix adjust.
 Identities = 86/89 (97%), Positives = 88/89 (99%), Gaps = 0/89 (0%)
 Frame = +1

Query  316  LPLWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTR  495
            + LWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTR
Sbjct  75   IALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTR  134

Query  496  EHALLAFTLGVKQMICCCNKIDATTPKYS  582
            EHALLAFTLGVKQMICCCNK+DATTPKYS
Sbjct  135  EHALLAFTLGVKQMICCCNKMDATTPKYS  163


 Score =   156 bits (394),  Expect(2) = 6e-86, Method: Compositional matrix adjust.
 Identities = 76/77 (99%), Positives = 77/77 (100%), Gaps = 0/77 (0%)
 Frame = +3

Query  93   MGKEKVHISIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  272
            MGKEKVHI+IVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  273  DKLKAERERGITIDIAL  323
            DKLKAERERGITIDIAL
Sbjct  61   DKLKAERERGITIDIAL  77



>ref|XP_010521772.1| PREDICTED: elongation factor 1-alpha-like [Tarenaya hassleriana]
Length=449

 Score =   188 bits (477),  Expect(2) = 6e-86, Method: Compositional matrix adjust.
 Identities = 86/89 (97%), Positives = 88/89 (99%), Gaps = 0/89 (0%)
 Frame = +1

Query  316  LPLWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTR  495
            + LWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTR
Sbjct  75   IALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTR  134

Query  496  EHALLAFTLGVKQMICCCNKIDATTPKYS  582
            EHALLAFTLGVKQMICCCNK+DATTPKYS
Sbjct  135  EHALLAFTLGVKQMICCCNKMDATTPKYS  163


 Score =   156 bits (395),  Expect(2) = 6e-86, Method: Compositional matrix adjust.
 Identities = 76/77 (99%), Positives = 77/77 (100%), Gaps = 0/77 (0%)
 Frame = +3

Query  93   MGKEKVHISIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  272
            MGKEKVHI+IVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  273  DKLKAERERGITIDIAL  323
            DKLKAERERGITIDIAL
Sbjct  61   DKLKAERERGITIDIAL  77



>gb|AGY80449.1| elongation factor 1-alpha [Dendrocalamus latiflorus]
Length=447

 Score =   188 bits (477),  Expect(2) = 6e-86, Method: Compositional matrix adjust.
 Identities = 86/89 (97%), Positives = 88/89 (99%), Gaps = 0/89 (0%)
 Frame = +1

Query  316  LPLWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTR  495
            + LWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTR
Sbjct  75   IALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTR  134

Query  496  EHALLAFTLGVKQMICCCNKIDATTPKYS  582
            EHALLAFTLGVKQMICCCNK+DATTPKYS
Sbjct  135  EHALLAFTLGVKQMICCCNKMDATTPKYS  163


 Score =   156 bits (395),  Expect(2) = 6e-86, Method: Compositional matrix adjust.
 Identities = 76/77 (99%), Positives = 77/77 (100%), Gaps = 0/77 (0%)
 Frame = +3

Query  93   MGKEKVHISIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  272
            MGKEKVHI+IVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  273  DKLKAERERGITIDIAL  323
            DKLKAERERGITIDIAL
Sbjct  61   DKLKAERERGITIDIAL  77



>dbj|BAL14665.1| elongation factor 1-alpha [Chrysanthemum seticuspe f. boreale]
Length=449

 Score =   188 bits (477),  Expect(2) = 6e-86, Method: Compositional matrix adjust.
 Identities = 86/89 (97%), Positives = 88/89 (99%), Gaps = 0/89 (0%)
 Frame = +1

Query  316  LPLWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTR  495
            + LWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTR
Sbjct  75   IALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTR  134

Query  496  EHALLAFTLGVKQMICCCNKIDATTPKYS  582
            EHALLAFTLGVKQMICCCNK+DATTPKYS
Sbjct  135  EHALLAFTLGVKQMICCCNKMDATTPKYS  163


 Score =   156 bits (395),  Expect(2) = 6e-86, Method: Compositional matrix adjust.
 Identities = 76/77 (99%), Positives = 77/77 (100%), Gaps = 0/77 (0%)
 Frame = +3

Query  93   MGKEKVHISIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  272
            MGKEK+HISIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKIHISIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  273  DKLKAERERGITIDIAL  323
            DKLKAERERGITIDIAL
Sbjct  61   DKLKAERERGITIDIAL  77



>ref|XP_010542596.1| PREDICTED: elongation factor 1-alpha-like [Tarenaya hassleriana]
Length=449

 Score =   188 bits (477),  Expect(2) = 6e-86, Method: Compositional matrix adjust.
 Identities = 86/89 (97%), Positives = 88/89 (99%), Gaps = 0/89 (0%)
 Frame = +1

Query  316  LPLWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTR  495
            + LWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTR
Sbjct  75   IALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTR  134

Query  496  EHALLAFTLGVKQMICCCNKIDATTPKYS  582
            EHALLAFTLGVKQMICCCNK+DATTPKYS
Sbjct  135  EHALLAFTLGVKQMICCCNKMDATTPKYS  163


 Score =   156 bits (394),  Expect(2) = 6e-86, Method: Compositional matrix adjust.
 Identities = 76/77 (99%), Positives = 77/77 (100%), Gaps = 0/77 (0%)
 Frame = +3

Query  93   MGKEKVHISIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  272
            MGKEKVHI+IVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  273  DKLKAERERGITIDIAL  323
            DKLKAERERGITIDIAL
Sbjct  61   DKLKAERERGITIDIAL  77



>ref|XP_010541344.1| PREDICTED: elongation factor 1-alpha [Tarenaya hassleriana]
Length=449

 Score =   188 bits (477),  Expect(2) = 6e-86, Method: Compositional matrix adjust.
 Identities = 86/89 (97%), Positives = 88/89 (99%), Gaps = 0/89 (0%)
 Frame = +1

Query  316  LPLWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTR  495
            + LWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTR
Sbjct  75   IALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTR  134

Query  496  EHALLAFTLGVKQMICCCNKIDATTPKYS  582
            EHALLAFTLGVKQMICCCNK+DATTPKYS
Sbjct  135  EHALLAFTLGVKQMICCCNKMDATTPKYS  163


 Score =   156 bits (394),  Expect(2) = 6e-86, Method: Compositional matrix adjust.
 Identities = 76/77 (99%), Positives = 77/77 (100%), Gaps = 0/77 (0%)
 Frame = +3

Query  93   MGKEKVHISIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  272
            MGKEKVHI+IVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  273  DKLKAERERGITIDIAL  323
            DKLKAERERGITIDIAL
Sbjct  61   DKLKAERERGITIDIAL  77



>gb|AGJ50595.1| EF1alpha [Pericallis cruenta]
Length=449

 Score =   188 bits (477),  Expect(2) = 6e-86, Method: Compositional matrix adjust.
 Identities = 86/89 (97%), Positives = 88/89 (99%), Gaps = 0/89 (0%)
 Frame = +1

Query  316  LPLWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTR  495
            + LWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTR
Sbjct  75   IALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTR  134

Query  496  EHALLAFTLGVKQMICCCNKIDATTPKYS  582
            EHALLAFTLGVKQMICCCNK+DATTPKYS
Sbjct  135  EHALLAFTLGVKQMICCCNKMDATTPKYS  163


 Score =   156 bits (395),  Expect(2) = 6e-86, Method: Compositional matrix adjust.
 Identities = 76/77 (99%), Positives = 77/77 (100%), Gaps = 0/77 (0%)
 Frame = +3

Query  93   MGKEKVHISIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  272
            MGKEK+HISIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKIHISIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  273  DKLKAERERGITIDIAL  323
            DKLKAERERGITIDIAL
Sbjct  61   DKLKAERERGITIDIAL  77



>dbj|BAC23049.1| Elongation factor 1-alpha [Solanum tuberosum]
 gb|AHL27103.1| eukaryotic elongation factor 1A protein [Solanum chacoense]
Length=448

 Score =   187 bits (476),  Expect(2) = 6e-86, Method: Compositional matrix adjust.
 Identities = 86/89 (97%), Positives = 88/89 (99%), Gaps = 0/89 (0%)
 Frame = +1

Query  316  LPLWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTR  495
            + LWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTR
Sbjct  75   IALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTR  134

Query  496  EHALLAFTLGVKQMICCCNKIDATTPKYS  582
            EHALLAFTLGVKQMICCCNK+DATTPKYS
Sbjct  135  EHALLAFTLGVKQMICCCNKMDATTPKYS  163


 Score =   157 bits (396),  Expect(2) = 6e-86, Method: Compositional matrix adjust.
 Identities = 76/77 (99%), Positives = 77/77 (100%), Gaps = 0/77 (0%)
 Frame = +3

Query  93   MGKEKVHISIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  272
            MGKEK+HISIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKIHISIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  273  DKLKAERERGITIDIAL  323
            DKLKAERERGITIDIAL
Sbjct  61   DKLKAERERGITIDIAL  77



>gb|ABB86283.1| elongation factor-1 alpha-like [Solanum tuberosum]
Length=447

 Score =   187 bits (476),  Expect(2) = 6e-86, Method: Compositional matrix adjust.
 Identities = 86/89 (97%), Positives = 88/89 (99%), Gaps = 0/89 (0%)
 Frame = +1

Query  316  LPLWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTR  495
            + LWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTR
Sbjct  75   IALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTR  134

Query  496  EHALLAFTLGVKQMICCCNKIDATTPKYS  582
            EHALLAFTLGVKQMICCCNK+DATTPKYS
Sbjct  135  EHALLAFTLGVKQMICCCNKMDATTPKYS  163


 Score =   156 bits (395),  Expect(2) = 6e-86, Method: Compositional matrix adjust.
 Identities = 76/77 (99%), Positives = 77/77 (100%), Gaps = 0/77 (0%)
 Frame = +3

Query  93   MGKEKVHISIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  272
            MGKEK+HISIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKIHISIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  273  DKLKAERERGITIDIAL  323
            DKLKAERERGITIDIAL
Sbjct  61   DKLKAERERGITIDIAL  77



>gb|KHG28979.1| Elongation factor 1-alpha [Gossypium arboreum]
Length=447

 Score =   188 bits (478),  Expect(2) = 7e-86, Method: Compositional matrix adjust.
 Identities = 86/89 (97%), Positives = 88/89 (99%), Gaps = 0/89 (0%)
 Frame = +1

Query  316  LPLWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTR  495
            + LWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTR
Sbjct  75   IALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTR  134

Query  496  EHALLAFTLGVKQMICCCNKIDATTPKYS  582
            EHALLAFTLGVKQMICCCNK+DATTPKYS
Sbjct  135  EHALLAFTLGVKQMICCCNKMDATTPKYS  163


 Score =   156 bits (394),  Expect(2) = 7e-86, Method: Compositional matrix adjust.
 Identities = 76/77 (99%), Positives = 77/77 (100%), Gaps = 0/77 (0%)
 Frame = +3

Query  93   MGKEKVHISIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  272
            MGKEKVHI+IVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  273  DKLKAERERGITIDIAL  323
            DKLKAERERGITIDIAL
Sbjct  61   DKLKAERERGITIDIAL  77



>gb|KHN18669.1| Elongation factor 1-alpha [Glycine soja]
Length=447

 Score =   187 bits (474),  Expect(2) = 7e-86, Method: Compositional matrix adjust.
 Identities = 85/89 (96%), Positives = 88/89 (99%), Gaps = 0/89 (0%)
 Frame = +1

Query  316  LPLWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTR  495
            + LWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTR
Sbjct  75   IALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTR  134

Query  496  EHALLAFTLGVKQMICCCNKIDATTPKYS  582
            EHALL+FTLGVKQMICCCNK+DATTPKYS
Sbjct  135  EHALLSFTLGVKQMICCCNKMDATTPKYS  163


 Score =   157 bits (398),  Expect(2) = 7e-86, Method: Compositional matrix adjust.
 Identities = 77/77 (100%), Positives = 77/77 (100%), Gaps = 0/77 (0%)
 Frame = +3

Query  93   MGKEKVHISIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  272
            MGKEKVHISIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKVHISIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  273  DKLKAERERGITIDIAL  323
            DKLKAERERGITIDIAL
Sbjct  61   DKLKAERERGITIDIAL  77



>gb|ABA12219.1| translation elongation factor 1A-3 [Gossypium hirsutum]
Length=448

 Score =   188 bits (477),  Expect(2) = 7e-86, Method: Compositional matrix adjust.
 Identities = 86/89 (97%), Positives = 88/89 (99%), Gaps = 0/89 (0%)
 Frame = +1

Query  316  LPLWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTR  495
            + LWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTR
Sbjct  75   IALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTR  134

Query  496  EHALLAFTLGVKQMICCCNKIDATTPKYS  582
            EHALLAFTLGVKQMICCCNK+DATTPKYS
Sbjct  135  EHALLAFTLGVKQMICCCNKMDATTPKYS  163


 Score =   156 bits (394),  Expect(2) = 7e-86, Method: Compositional matrix adjust.
 Identities = 76/77 (99%), Positives = 77/77 (100%), Gaps = 0/77 (0%)
 Frame = +3

Query  93   MGKEKVHISIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  272
            MGKEKVHI+IVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  273  DKLKAERERGITIDIAL  323
            DKLKAERERGITIDIAL
Sbjct  61   DKLKAERERGITIDIAL  77



>ref|XP_009358244.1| PREDICTED: elongation factor 1-alpha-like [Pyrus x bretschneideri]
 ref|XP_009338285.1| PREDICTED: elongation factor 1-alpha-like [Pyrus x bretschneideri]
Length=447

 Score =   188 bits (477),  Expect(2) = 7e-86, Method: Compositional matrix adjust.
 Identities = 86/89 (97%), Positives = 88/89 (99%), Gaps = 0/89 (0%)
 Frame = +1

Query  316  LPLWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTR  495
            + LWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTR
Sbjct  75   IALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTR  134

Query  496  EHALLAFTLGVKQMICCCNKIDATTPKYS  582
            EHALLAFTLGVKQMICCCNK+DATTPKYS
Sbjct  135  EHALLAFTLGVKQMICCCNKMDATTPKYS  163


 Score =   156 bits (394),  Expect(2) = 7e-86, Method: Compositional matrix adjust.
 Identities = 76/77 (99%), Positives = 77/77 (100%), Gaps = 0/77 (0%)
 Frame = +3

Query  93   MGKEKVHISIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  272
            MGKEKVHI+IVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  273  DKLKAERERGITIDIAL  323
            DKLKAERERGITIDIAL
Sbjct  61   DKLKAERERGITIDIAL  77



>gb|KHN42761.1| Elongation factor 1-alpha [Glycine soja]
Length=447

 Score =   188 bits (477),  Expect(2) = 7e-86, Method: Compositional matrix adjust.
 Identities = 86/89 (97%), Positives = 88/89 (99%), Gaps = 0/89 (0%)
 Frame = +1

Query  316  LPLWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTR  495
            + LWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTR
Sbjct  75   IALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTR  134

Query  496  EHALLAFTLGVKQMICCCNKIDATTPKYS  582
            EHALLAFTLGVKQMICCCNK+DATTPKYS
Sbjct  135  EHALLAFTLGVKQMICCCNKMDATTPKYS  163


 Score =   156 bits (394),  Expect(2) = 7e-86, Method: Compositional matrix adjust.
 Identities = 76/77 (99%), Positives = 77/77 (100%), Gaps = 0/77 (0%)
 Frame = +3

Query  93   MGKEKVHISIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  272
            MGKEKVHI+IVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  273  DKLKAERERGITIDIAL  323
            DKLKAERERGITIDIAL
Sbjct  61   DKLKAERERGITIDIAL  77



>ref|NP_001234035.1| elongation factor 1-alpha [Solanum lycopersicum]
 ref|XP_004240579.1| PREDICTED: elongation factor 1-alpha [Solanum lycopersicum]
 sp|P17786.1|EF1A_SOLLC RecName: Full=Elongation factor 1-alpha; Short=EF-1-alpha [Solanum 
lycopersicum]
 emb|CAA32618.1| unnamed protein product [Solanum lycopersicum]
 emb|CAA37212.1| elongation factor 1-alpha [Solanum lycopersicum]
Length=448

 Score =   187 bits (476),  Expect(2) = 7e-86, Method: Compositional matrix adjust.
 Identities = 86/89 (97%), Positives = 88/89 (99%), Gaps = 0/89 (0%)
 Frame = +1

Query  316  LPLWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTR  495
            + LWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTR
Sbjct  75   IALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTR  134

Query  496  EHALLAFTLGVKQMICCCNKIDATTPKYS  582
            EHALLAFTLGVKQMICCCNK+DATTPKYS
Sbjct  135  EHALLAFTLGVKQMICCCNKMDATTPKYS  163


 Score =   156 bits (395),  Expect(2) = 7e-86, Method: Compositional matrix adjust.
 Identities = 76/77 (99%), Positives = 77/77 (100%), Gaps = 0/77 (0%)
 Frame = +3

Query  93   MGKEKVHISIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  272
            MGKEK+HISIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKIHISIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  273  DKLKAERERGITIDIAL  323
            DKLKAERERGITIDIAL
Sbjct  61   DKLKAERERGITIDIAL  77



>ref|XP_011089874.1| PREDICTED: elongation factor 1-alpha [Sesamum indicum]
Length=449

 Score =   188 bits (477),  Expect(2) = 7e-86, Method: Compositional matrix adjust.
 Identities = 86/89 (97%), Positives = 88/89 (99%), Gaps = 0/89 (0%)
 Frame = +1

Query  316  LPLWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTR  495
            + LWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTR
Sbjct  75   IALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTR  134

Query  496  EHALLAFTLGVKQMICCCNKIDATTPKYS  582
            EHALLAFTLGVKQMICCCNK+DATTPKYS
Sbjct  135  EHALLAFTLGVKQMICCCNKMDATTPKYS  163


 Score =   156 bits (394),  Expect(2) = 7e-86, Method: Compositional matrix adjust.
 Identities = 76/77 (99%), Positives = 77/77 (100%), Gaps = 0/77 (0%)
 Frame = +3

Query  93   MGKEKVHISIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  272
            MGKEKVHI+IVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  273  DKLKAERERGITIDIAL  323
            DKLKAERERGITIDIAL
Sbjct  61   DKLKAERERGITIDIAL  77



>ref|XP_011089339.1| PREDICTED: elongation factor 1-alpha isoform X1 [Sesamum indicum]
 ref|XP_011089346.1| PREDICTED: elongation factor 1-alpha-like [Sesamum indicum]
Length=449

 Score =   188 bits (477),  Expect(2) = 7e-86, Method: Compositional matrix adjust.
 Identities = 86/89 (97%), Positives = 88/89 (99%), Gaps = 0/89 (0%)
 Frame = +1

Query  316  LPLWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTR  495
            + LWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTR
Sbjct  75   IALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTR  134

Query  496  EHALLAFTLGVKQMICCCNKIDATTPKYS  582
            EHALLAFTLGVKQMICCCNK+DATTPKYS
Sbjct  135  EHALLAFTLGVKQMICCCNKMDATTPKYS  163


 Score =   156 bits (394),  Expect(2) = 7e-86, Method: Compositional matrix adjust.
 Identities = 76/77 (99%), Positives = 77/77 (100%), Gaps = 0/77 (0%)
 Frame = +3

Query  93   MGKEKVHISIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  272
            MGKEKVHI+IVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  273  DKLKAERERGITIDIAL  323
            DKLKAERERGITIDIAL
Sbjct  61   DKLKAERERGITIDIAL  77



>ref|NP_001274875.1| elongation factor 1-alpha-like protein [Solanum tuberosum]
 gb|ABC01896.1| elongation factor 1-alpha-like protein [Solanum tuberosum]
Length=448

 Score =   187 bits (476),  Expect(2) = 7e-86, Method: Compositional matrix adjust.
 Identities = 86/89 (97%), Positives = 88/89 (99%), Gaps = 0/89 (0%)
 Frame = +1

Query  316  LPLWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTR  495
            + LWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTR
Sbjct  75   IALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTR  134

Query  496  EHALLAFTLGVKQMICCCNKIDATTPKYS  582
            EHALLAFTLGVKQMICCCNK+DATTPKYS
Sbjct  135  EHALLAFTLGVKQMICCCNKMDATTPKYS  163


 Score =   156 bits (395),  Expect(2) = 7e-86, Method: Compositional matrix adjust.
 Identities = 76/77 (99%), Positives = 77/77 (100%), Gaps = 0/77 (0%)
 Frame = +3

Query  93   MGKEKVHISIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  272
            MGKEK+HISIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKIHISIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  273  DKLKAERERGITIDIAL  323
            DKLKAERERGITIDIAL
Sbjct  61   DKLKAERERGITIDIAL  77



>gb|AAR82894.1| elongation factor 1-alpha [Cichorium intybus]
Length=448

 Score =   187 bits (476),  Expect(2) = 7e-86, Method: Compositional matrix adjust.
 Identities = 86/89 (97%), Positives = 88/89 (99%), Gaps = 0/89 (0%)
 Frame = +1

Query  316  LPLWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTR  495
            + LWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTR
Sbjct  75   IALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTR  134

Query  496  EHALLAFTLGVKQMICCCNKIDATTPKYS  582
            EHALLAFTLGVKQMICCCNK+DATTPKYS
Sbjct  135  EHALLAFTLGVKQMICCCNKMDATTPKYS  163


 Score =   156 bits (395),  Expect(2) = 7e-86, Method: Compositional matrix adjust.
 Identities = 76/77 (99%), Positives = 77/77 (100%), Gaps = 0/77 (0%)
 Frame = +3

Query  93   MGKEKVHISIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  272
            MGKEK+HISIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKIHISIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  273  DKLKAERERGITIDIAL  323
            DKLKAERERGITIDIAL
Sbjct  61   DKLKAERERGITIDIAL  77



>ref|XP_002518073.1| elongation factor 1-alpha, putative [Ricinus communis]
 ref|XP_002518074.1| elongation factor 1-alpha, putative [Ricinus communis]
 gb|EEF44206.1| elongation factor 1-alpha, putative [Ricinus communis]
 gb|EEF44207.1| elongation factor 1-alpha, putative [Ricinus communis]
Length=449

 Score =   187 bits (476),  Expect(2) = 7e-86, Method: Compositional matrix adjust.
 Identities = 86/89 (97%), Positives = 88/89 (99%), Gaps = 0/89 (0%)
 Frame = +1

Query  316  LPLWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTR  495
            + LWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTR
Sbjct  75   IALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTR  134

Query  496  EHALLAFTLGVKQMICCCNKIDATTPKYS  582
            EHALLAFTLGVKQMICCCNK+DATTPKYS
Sbjct  135  EHALLAFTLGVKQMICCCNKMDATTPKYS  163


 Score =   156 bits (395),  Expect(2) = 7e-86, Method: Compositional matrix adjust.
 Identities = 76/77 (99%), Positives = 77/77 (100%), Gaps = 0/77 (0%)
 Frame = +3

Query  93   MGKEKVHISIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  272
            MGKEK+HISIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKIHISIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  273  DKLKAERERGITIDIAL  323
            DKLKAERERGITIDIAL
Sbjct  61   DKLKAERERGITIDIAL  77



>ref|XP_010920912.1| PREDICTED: elongation factor 1-alpha-like [Elaeis guineensis]
Length=447

 Score =   188 bits (477),  Expect(2) = 7e-86, Method: Compositional matrix adjust.
 Identities = 86/89 (97%), Positives = 88/89 (99%), Gaps = 0/89 (0%)
 Frame = +1

Query  316  LPLWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTR  495
            + LWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTR
Sbjct  75   IALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTR  134

Query  496  EHALLAFTLGVKQMICCCNKIDATTPKYS  582
            EHALLAFTLGVKQMICCCNK+DATTPKYS
Sbjct  135  EHALLAFTLGVKQMICCCNKMDATTPKYS  163


 Score =   156 bits (394),  Expect(2) = 7e-86, Method: Compositional matrix adjust.
 Identities = 76/77 (99%), Positives = 77/77 (100%), Gaps = 0/77 (0%)
 Frame = +3

Query  93   MGKEKVHISIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  272
            MGKEKVHI+IVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  273  DKLKAERERGITIDIAL  323
            DKLKAERERGITIDIAL
Sbjct  61   DKLKAERERGITIDIAL  77



>gb|KHG26926.1| Elongation factor 1-alpha [Gossypium arboreum]
Length=448

 Score =   188 bits (477),  Expect(2) = 7e-86, Method: Compositional matrix adjust.
 Identities = 86/89 (97%), Positives = 88/89 (99%), Gaps = 0/89 (0%)
 Frame = +1

Query  316  LPLWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTR  495
            + LWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTR
Sbjct  75   IALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTR  134

Query  496  EHALLAFTLGVKQMICCCNKIDATTPKYS  582
            EHALLAFTLGVKQMICCCNK+DATTPKYS
Sbjct  135  EHALLAFTLGVKQMICCCNKMDATTPKYS  163


 Score =   156 bits (394),  Expect(2) = 7e-86, Method: Compositional matrix adjust.
 Identities = 76/77 (99%), Positives = 77/77 (100%), Gaps = 0/77 (0%)
 Frame = +3

Query  93   MGKEKVHISIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  272
            MGKEKVHI+IVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  273  DKLKAERERGITIDIAL  323
            DKLKAERERGITIDIAL
Sbjct  61   DKLKAERERGITIDIAL  77



>ref|NP_001237425.1| elongation factor-1A [Glycine max]
 gb|ACI42861.1| elongation factor-1A [Glycine max]
Length=447

 Score =   187 bits (474),  Expect(2) = 7e-86, Method: Compositional matrix adjust.
 Identities = 85/89 (96%), Positives = 88/89 (99%), Gaps = 0/89 (0%)
 Frame = +1

Query  316  LPLWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTR  495
            + LWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTR
Sbjct  75   IALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTR  134

Query  496  EHALLAFTLGVKQMICCCNKIDATTPKYS  582
            EHALL+FTLGVKQMICCCNK+DATTPKYS
Sbjct  135  EHALLSFTLGVKQMICCCNKMDATTPKYS  163


 Score =   157 bits (397),  Expect(2) = 7e-86, Method: Compositional matrix adjust.
 Identities = 77/77 (100%), Positives = 77/77 (100%), Gaps = 0/77 (0%)
 Frame = +3

Query  93   MGKEKVHISIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  272
            MGKEKVHISIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKVHISIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  273  DKLKAERERGITIDIAL  323
            DKLKAERERGITIDIAL
Sbjct  61   DKLKAERERGITIDIAL  77



>gb|KHG01531.1| Elongation factor 1-alpha [Gossypium arboreum]
 gb|KJB63252.1| hypothetical protein B456_010G2044001 [Gossypium raimondii]
Length=447

 Score =   188 bits (477),  Expect(2) = 7e-86, Method: Compositional matrix adjust.
 Identities = 86/89 (97%), Positives = 88/89 (99%), Gaps = 0/89 (0%)
 Frame = +1

Query  316  LPLWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTR  495
            + LWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTR
Sbjct  75   IALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTR  134

Query  496  EHALLAFTLGVKQMICCCNKIDATTPKYS  582
            EHALLAFTLGVKQMICCCNK+DATTPKYS
Sbjct  135  EHALLAFTLGVKQMICCCNKMDATTPKYS  163


 Score =   156 bits (394),  Expect(2) = 7e-86, Method: Compositional matrix adjust.
 Identities = 76/77 (99%), Positives = 77/77 (100%), Gaps = 0/77 (0%)
 Frame = +3

Query  93   MGKEKVHISIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  272
            MGKEKVHI+IVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  273  DKLKAERERGITIDIAL  323
            DKLKAERERGITIDIAL
Sbjct  61   DKLKAERERGITIDIAL  77



>ref|XP_008789061.1| PREDICTED: elongation factor 1-alpha-like [Phoenix dactylifera]
 ref|XP_008789062.1| PREDICTED: elongation factor 1-alpha-like [Phoenix dactylifera]
 ref|XP_008789063.1| PREDICTED: elongation factor 1-alpha-like [Phoenix dactylifera]
Length=447

 Score =   188 bits (477),  Expect(2) = 7e-86, Method: Compositional matrix adjust.
 Identities = 86/89 (97%), Positives = 88/89 (99%), Gaps = 0/89 (0%)
 Frame = +1

Query  316  LPLWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTR  495
            + LWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTR
Sbjct  75   IALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTR  134

Query  496  EHALLAFTLGVKQMICCCNKIDATTPKYS  582
            EHALLAFTLGVKQMICCCNK+DATTPKYS
Sbjct  135  EHALLAFTLGVKQMICCCNKMDATTPKYS  163


 Score =   156 bits (394),  Expect(2) = 7e-86, Method: Compositional matrix adjust.
 Identities = 76/77 (99%), Positives = 77/77 (100%), Gaps = 0/77 (0%)
 Frame = +3

Query  93   MGKEKVHISIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  272
            MGKEKVHI+IVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  273  DKLKAERERGITIDIAL  323
            DKLKAERERGITIDIAL
Sbjct  61   DKLKAERERGITIDIAL  77



>gb|ABA12224.1| translation elongation factor 1A-8 [Gossypium hirsutum]
Length=449

 Score =   188 bits (477),  Expect(2) = 7e-86, Method: Compositional matrix adjust.
 Identities = 86/89 (97%), Positives = 88/89 (99%), Gaps = 0/89 (0%)
 Frame = +1

Query  316  LPLWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTR  495
            + LWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTR
Sbjct  75   IALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTR  134

Query  496  EHALLAFTLGVKQMICCCNKIDATTPKYS  582
            EHALLAFTLGVKQMICCCNK+DATTPKYS
Sbjct  135  EHALLAFTLGVKQMICCCNKMDATTPKYS  163


 Score =   156 bits (394),  Expect(2) = 7e-86, Method: Compositional matrix adjust.
 Identities = 76/77 (99%), Positives = 77/77 (100%), Gaps = 0/77 (0%)
 Frame = +3

Query  93   MGKEKVHISIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  272
            MGKEKVHI+IVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  273  DKLKAERERGITIDIAL  323
            DKLKAERERGITIDIAL
Sbjct  61   DKLKAERERGITIDIAL  77



>ref|XP_010916901.1| PREDICTED: elongation factor 1-alpha [Elaeis guineensis]
 ref|XP_010910504.1| PREDICTED: elongation factor 1-alpha [Elaeis guineensis]
Length=447

 Score =   188 bits (477),  Expect(2) = 7e-86, Method: Compositional matrix adjust.
 Identities = 86/89 (97%), Positives = 88/89 (99%), Gaps = 0/89 (0%)
 Frame = +1

Query  316  LPLWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTR  495
            + LWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTR
Sbjct  75   IALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTR  134

Query  496  EHALLAFTLGVKQMICCCNKIDATTPKYS  582
            EHALLAFTLGVKQMICCCNK+DATTPKYS
Sbjct  135  EHALLAFTLGVKQMICCCNKMDATTPKYS  163


 Score =   156 bits (394),  Expect(2) = 7e-86, Method: Compositional matrix adjust.
 Identities = 76/77 (99%), Positives = 77/77 (100%), Gaps = 0/77 (0%)
 Frame = +3

Query  93   MGKEKVHISIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  272
            MGKEKVHI+IVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  273  DKLKAERERGITIDIAL  323
            DKLKAERERGITIDIAL
Sbjct  61   DKLKAERERGITIDIAL  77



>ref|XP_008783722.1| PREDICTED: elongation factor 1-alpha isoform X1 [Phoenix dactylifera]
Length=447

 Score =   188 bits (477),  Expect(2) = 7e-86, Method: Compositional matrix adjust.
 Identities = 86/89 (97%), Positives = 88/89 (99%), Gaps = 0/89 (0%)
 Frame = +1

Query  316  LPLWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTR  495
            + LWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTR
Sbjct  75   IALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTR  134

Query  496  EHALLAFTLGVKQMICCCNKIDATTPKYS  582
            EHALLAFTLGVKQMICCCNK+DATTPKYS
Sbjct  135  EHALLAFTLGVKQMICCCNKMDATTPKYS  163


 Score =   156 bits (394),  Expect(2) = 7e-86, Method: Compositional matrix adjust.
 Identities = 76/77 (99%), Positives = 77/77 (100%), Gaps = 0/77 (0%)
 Frame = +3

Query  93   MGKEKVHISIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  272
            MGKEKVHI+IVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  273  DKLKAERERGITIDIAL  323
            DKLKAERERGITIDIAL
Sbjct  61   DKLKAERERGITIDIAL  77



>gb|ABA12220.1| translation elongation factor 1A-4 [Gossypium hirsutum]
 gb|KJB62497.1| hypothetical protein B456_009G420000 [Gossypium raimondii]
 gb|KJB62498.1| hypothetical protein B456_009G420000 [Gossypium raimondii]
 gb|KJB62499.1| hypothetical protein B456_009G420100 [Gossypium raimondii]
 gb|KJB62500.1| hypothetical protein B456_009G420100 [Gossypium raimondii]
Length=447

 Score =   188 bits (477),  Expect(2) = 7e-86, Method: Compositional matrix adjust.
 Identities = 86/89 (97%), Positives = 88/89 (99%), Gaps = 0/89 (0%)
 Frame = +1

Query  316  LPLWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTR  495
            + LWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTR
Sbjct  75   IALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTR  134

Query  496  EHALLAFTLGVKQMICCCNKIDATTPKYS  582
            EHALLAFTLGVKQMICCCNK+DATTPKYS
Sbjct  135  EHALLAFTLGVKQMICCCNKMDATTPKYS  163


 Score =   156 bits (394),  Expect(2) = 7e-86, Method: Compositional matrix adjust.
 Identities = 76/77 (99%), Positives = 77/77 (100%), Gaps = 0/77 (0%)
 Frame = +3

Query  93   MGKEKVHISIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  272
            MGKEKVHI+IVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  273  DKLKAERERGITIDIAL  323
            DKLKAERERGITIDIAL
Sbjct  61   DKLKAERERGITIDIAL  77



>ref|XP_003547695.1| PREDICTED: elongation factor 1-alpha isoform 2 [Glycine max]
 gb|KHN27573.1| Elongation factor 1-alpha [Glycine soja]
Length=447

 Score =   188 bits (477),  Expect(2) = 8e-86, Method: Compositional matrix adjust.
 Identities = 86/89 (97%), Positives = 88/89 (99%), Gaps = 0/89 (0%)
 Frame = +1

Query  316  LPLWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTR  495
            + LWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTR
Sbjct  75   IALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTR  134

Query  496  EHALLAFTLGVKQMICCCNKIDATTPKYS  582
            EHALLAFTLGVKQMICCCNK+DATTPKYS
Sbjct  135  EHALLAFTLGVKQMICCCNKMDATTPKYS  163


 Score =   156 bits (394),  Expect(2) = 8e-86, Method: Compositional matrix adjust.
 Identities = 76/77 (99%), Positives = 77/77 (100%), Gaps = 0/77 (0%)
 Frame = +3

Query  93   MGKEKVHISIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  272
            MGKEKVHI+IVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  273  DKLKAERERGITIDIAL  323
            DKLKAERERGITIDIAL
Sbjct  61   DKLKAERERGITIDIAL  77



>gb|KHG23927.1| Elongation factor 1-alpha [Gossypium arboreum]
Length=449

 Score =   188 bits (477),  Expect(2) = 8e-86, Method: Compositional matrix adjust.
 Identities = 86/89 (97%), Positives = 88/89 (99%), Gaps = 0/89 (0%)
 Frame = +1

Query  316  LPLWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTR  495
            + LWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTR
Sbjct  75   IALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTR  134

Query  496  EHALLAFTLGVKQMICCCNKIDATTPKYS  582
            EHALLAFTLGVKQMICCCNK+DATTPKYS
Sbjct  135  EHALLAFTLGVKQMICCCNKMDATTPKYS  163


 Score =   156 bits (394),  Expect(2) = 8e-86, Method: Compositional matrix adjust.
 Identities = 76/77 (99%), Positives = 77/77 (100%), Gaps = 0/77 (0%)
 Frame = +3

Query  93   MGKEKVHISIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  272
            MGKEKVHI+IVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  273  DKLKAERERGITIDIAL  323
            DKLKAERERGITIDIAL
Sbjct  61   DKLKAERERGITIDIAL  77



>gb|ABA12221.1| translation elongation factor 1A-5 [Gossypium hirsutum]
Length=448

 Score =   188 bits (477),  Expect(2) = 8e-86, Method: Compositional matrix adjust.
 Identities = 86/89 (97%), Positives = 88/89 (99%), Gaps = 0/89 (0%)
 Frame = +1

Query  316  LPLWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTR  495
            + LWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTR
Sbjct  75   IALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTR  134

Query  496  EHALLAFTLGVKQMICCCNKIDATTPKYS  582
            EHALLAFTLGVKQMICCCNK+DATTPKYS
Sbjct  135  EHALLAFTLGVKQMICCCNKMDATTPKYS  163


 Score =   156 bits (394),  Expect(2) = 8e-86, Method: Compositional matrix adjust.
 Identities = 76/77 (99%), Positives = 77/77 (100%), Gaps = 0/77 (0%)
 Frame = +3

Query  93   MGKEKVHISIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  272
            MGKEKVHI+IVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  273  DKLKAERERGITIDIAL  323
            DKLKAERERGITIDIAL
Sbjct  61   DKLKAERERGITIDIAL  77



>ref|XP_007151789.1| hypothetical protein PHAVU_004G075100g [Phaseolus vulgaris]
 gb|ESW23783.1| hypothetical protein PHAVU_004G075100g [Phaseolus vulgaris]
Length=447

 Score =   186 bits (473),  Expect(2) = 8e-86, Method: Compositional matrix adjust.
 Identities = 85/89 (96%), Positives = 88/89 (99%), Gaps = 0/89 (0%)
 Frame = +1

Query  316  LPLWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTR  495
            + LWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTR
Sbjct  75   IALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTR  134

Query  496  EHALLAFTLGVKQMICCCNKIDATTPKYS  582
            EHALL+FTLGVKQMICCCNK+DATTPKYS
Sbjct  135  EHALLSFTLGVKQMICCCNKMDATTPKYS  163


 Score =   157 bits (398),  Expect(2) = 8e-86, Method: Compositional matrix adjust.
 Identities = 77/77 (100%), Positives = 77/77 (100%), Gaps = 0/77 (0%)
 Frame = +3

Query  93   MGKEKVHISIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  272
            MGKEKVHISIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKVHISIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  273  DKLKAERERGITIDIAL  323
            DKLKAERERGITIDIAL
Sbjct  61   DKLKAERERGITIDIAL  77



>ref|XP_006343452.1| PREDICTED: elongation factor 1-alpha-like [Solanum tuberosum]
 ref|XP_006343454.1| PREDICTED: elongation factor 1-alpha-like isoform X2 [Solanum 
tuberosum]
 ref|XP_006343455.1| PREDICTED: elongation factor 1-alpha-like [Solanum tuberosum]
 gb|ABB55388.1| elongation factor 1-alpha-like [Solanum tuberosum]
Length=448

 Score =   187 bits (476),  Expect(2) = 8e-86, Method: Compositional matrix adjust.
 Identities = 86/89 (97%), Positives = 88/89 (99%), Gaps = 0/89 (0%)
 Frame = +1

Query  316  LPLWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTR  495
            + LWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTR
Sbjct  75   IALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTR  134

Query  496  EHALLAFTLGVKQMICCCNKIDATTPKYS  582
            EHALLAFTLGVKQMICCCNK+DATTPKYS
Sbjct  135  EHALLAFTLGVKQMICCCNKMDATTPKYS  163


 Score =   156 bits (395),  Expect(2) = 8e-86, Method: Compositional matrix adjust.
 Identities = 76/77 (99%), Positives = 77/77 (100%), Gaps = 0/77 (0%)
 Frame = +3

Query  93   MGKEKVHISIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  272
            MGKEK+HISIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKIHISIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  273  DKLKAERERGITIDIAL  323
            DKLKAERERGITIDIAL
Sbjct  61   DKLKAERERGITIDIAL  77



>ref|XP_006600131.1| PREDICTED: elongation factor-1A isoform X1 [Glycine max]
 gb|KHN40184.1| Elongation factor 1-alpha [Glycine soja]
Length=447

 Score =   187 bits (474),  Expect(2) = 8e-86, Method: Compositional matrix adjust.
 Identities = 85/89 (96%), Positives = 88/89 (99%), Gaps = 0/89 (0%)
 Frame = +1

Query  316  LPLWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTR  495
            + LWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTR
Sbjct  75   IALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTR  134

Query  496  EHALLAFTLGVKQMICCCNKIDATTPKYS  582
            EHALL+FTLGVKQMICCCNK+DATTPKYS
Sbjct  135  EHALLSFTLGVKQMICCCNKMDATTPKYS  163


 Score =   157 bits (397),  Expect(2) = 8e-86, Method: Compositional matrix adjust.
 Identities = 77/77 (100%), Positives = 77/77 (100%), Gaps = 0/77 (0%)
 Frame = +3

Query  93   MGKEKVHISIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  272
            MGKEKVHISIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKVHISIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  273  DKLKAERERGITIDIAL  323
            DKLKAERERGITIDIAL
Sbjct  61   DKLKAERERGITIDIAL  77



>ref|XP_011089340.1| PREDICTED: elongation factor 1-alpha isoform X2 [Sesamum indicum]
 ref|XP_011089341.1| PREDICTED: elongation factor 1-alpha isoform X3 [Sesamum indicum]
 ref|XP_011089342.1| PREDICTED: elongation factor 1-alpha isoform X4 [Sesamum indicum]
 ref|XP_011089875.1| PREDICTED: elongation factor 1-alpha [Sesamum indicum]
Length=449

 Score =   188 bits (477),  Expect(2) = 8e-86, Method: Compositional matrix adjust.
 Identities = 86/89 (97%), Positives = 88/89 (99%), Gaps = 0/89 (0%)
 Frame = +1

Query  316  LPLWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTR  495
            + LWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTR
Sbjct  75   IALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTR  134

Query  496  EHALLAFTLGVKQMICCCNKIDATTPKYS  582
            EHALLAFTLGVKQMICCCNK+DATTPKYS
Sbjct  135  EHALLAFTLGVKQMICCCNKMDATTPKYS  163


 Score =   156 bits (394),  Expect(2) = 8e-86, Method: Compositional matrix adjust.
 Identities = 76/77 (99%), Positives = 77/77 (100%), Gaps = 0/77 (0%)
 Frame = +3

Query  93   MGKEKVHISIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  272
            MGKEKVHI+IVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  273  DKLKAERERGITIDIAL  323
            DKLKAERERGITIDIAL
Sbjct  61   DKLKAERERGITIDIAL  77



>gb|AAX54511.1| elongation factor 1 alpha [Actinidia deliciosa]
Length=447

 Score =   188 bits (477),  Expect(2) = 8e-86, Method: Compositional matrix adjust.
 Identities = 86/89 (97%), Positives = 88/89 (99%), Gaps = 0/89 (0%)
 Frame = +1

Query  316  LPLWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTR  495
            + LWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTR
Sbjct  75   IALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTR  134

Query  496  EHALLAFTLGVKQMICCCNKIDATTPKYS  582
            EHALLAFTLGVKQMICCCNK+DATTPKYS
Sbjct  135  EHALLAFTLGVKQMICCCNKMDATTPKYS  163


 Score =   156 bits (394),  Expect(2) = 8e-86, Method: Compositional matrix adjust.
 Identities = 76/77 (99%), Positives = 77/77 (100%), Gaps = 0/77 (0%)
 Frame = +3

Query  93   MGKEKVHISIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  272
            MGKEKVHI+IVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  273  DKLKAERERGITIDIAL  323
            DKLKAERERGITIDIAL
Sbjct  61   DKLKAERERGITIDIAL  77



>sp|O49169.1|EF1A_MANES RecName: Full=Elongation factor 1-alpha; Short=EF-1-alpha [Manihot 
esculenta]
 gb|AAC39447.1| elongation factor 1-alpha [Manihot esculenta]
Length=449

 Score =   188 bits (477),  Expect(2) = 8e-86, Method: Compositional matrix adjust.
 Identities = 86/89 (97%), Positives = 88/89 (99%), Gaps = 0/89 (0%)
 Frame = +1

Query  316  LPLWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTR  495
            + LWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTR
Sbjct  75   IALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTR  134

Query  496  EHALLAFTLGVKQMICCCNKIDATTPKYS  582
            EHALLAFTLGVKQMICCCNK+DATTPKYS
Sbjct  135  EHALLAFTLGVKQMICCCNKMDATTPKYS  163


 Score =   156 bits (394),  Expect(2) = 8e-86, Method: Compositional matrix adjust.
 Identities = 76/77 (99%), Positives = 77/77 (100%), Gaps = 0/77 (0%)
 Frame = +3

Query  93   MGKEKVHISIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  272
            MGKEKVHI+IVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  273  DKLKAERERGITIDIAL  323
            DKLKAERERGITIDIAL
Sbjct  61   DKLKAERERGITIDIAL  77



>gb|ABA12217.1| translation elongation factor 1A-1 [Gossypium hirsutum]
Length=447

 Score =   188 bits (477),  Expect(2) = 8e-86, Method: Compositional matrix adjust.
 Identities = 86/89 (97%), Positives = 88/89 (99%), Gaps = 0/89 (0%)
 Frame = +1

Query  316  LPLWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTR  495
            + LWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTR
Sbjct  75   IALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTR  134

Query  496  EHALLAFTLGVKQMICCCNKIDATTPKYS  582
            EHALLAFTLGVKQMICCCNK+DATTPKYS
Sbjct  135  EHALLAFTLGVKQMICCCNKMDATTPKYS  163


 Score =   156 bits (394),  Expect(2) = 8e-86, Method: Compositional matrix adjust.
 Identities = 76/77 (99%), Positives = 77/77 (100%), Gaps = 0/77 (0%)
 Frame = +3

Query  93   MGKEKVHISIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  272
            MGKEKVHI+IVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  273  DKLKAERERGITIDIAL  323
            DKLKAERERGITIDIAL
Sbjct  61   DKLKAERERGITIDIAL  77



>ref|NP_001290506.1| elongation factor 1-alpha [Elaeis guineensis]
 ref|XP_010922532.1| PREDICTED: elongation factor 1-alpha [Elaeis guineensis]
 gb|AAT45847.1| elongation factor 1-alpha 1 [Elaeis guineensis]
Length=447

 Score =   188 bits (477),  Expect(2) = 8e-86, Method: Compositional matrix adjust.
 Identities = 86/89 (97%), Positives = 88/89 (99%), Gaps = 0/89 (0%)
 Frame = +1

Query  316  LPLWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTR  495
            + LWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTR
Sbjct  75   IALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTR  134

Query  496  EHALLAFTLGVKQMICCCNKIDATTPKYS  582
            EHALLAFTLGVKQMICCCNK+DATTPKYS
Sbjct  135  EHALLAFTLGVKQMICCCNKMDATTPKYS  163


 Score =   156 bits (394),  Expect(2) = 8e-86, Method: Compositional matrix adjust.
 Identities = 76/77 (99%), Positives = 77/77 (100%), Gaps = 0/77 (0%)
 Frame = +3

Query  93   MGKEKVHISIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  272
            MGKEKVHI+IVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  273  DKLKAERERGITIDIAL  323
            DKLKAERERGITIDIAL
Sbjct  61   DKLKAERERGITIDIAL  77



>gb|EPS66069.1| elongation factor 1-alpha, partial [Genlisea aurea]
Length=446

 Score =   188 bits (477),  Expect(2) = 8e-86, Method: Compositional matrix adjust.
 Identities = 86/89 (97%), Positives = 88/89 (99%), Gaps = 0/89 (0%)
 Frame = +1

Query  316  LPLWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTR  495
            + LWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTR
Sbjct  75   IALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTR  134

Query  496  EHALLAFTLGVKQMICCCNKIDATTPKYS  582
            EHALLAFTLGVKQMICCCNK+DATTPKYS
Sbjct  135  EHALLAFTLGVKQMICCCNKMDATTPKYS  163


 Score =   156 bits (394),  Expect(2) = 8e-86, Method: Compositional matrix adjust.
 Identities = 76/77 (99%), Positives = 77/77 (100%), Gaps = 0/77 (0%)
 Frame = +3

Query  93   MGKEKVHISIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  272
            MGKEKVHI+IVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  273  DKLKAERERGITIDIAL  323
            DKLKAERERGITIDIAL
Sbjct  61   DKLKAERERGITIDIAL  77



>ref|XP_010244958.1| PREDICTED: elongation factor 1-alpha-like [Nelumbo nucifera]
 ref|XP_010244959.1| PREDICTED: elongation factor 1-alpha-like [Nelumbo nucifera]
Length=449

 Score =   188 bits (477),  Expect(2) = 8e-86, Method: Compositional matrix adjust.
 Identities = 86/89 (97%), Positives = 88/89 (99%), Gaps = 0/89 (0%)
 Frame = +1

Query  316  LPLWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTR  495
            + LWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTR
Sbjct  75   IALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTR  134

Query  496  EHALLAFTLGVKQMICCCNKIDATTPKYS  582
            EHALLAFTLGVKQMICCCNK+DATTPKYS
Sbjct  135  EHALLAFTLGVKQMICCCNKMDATTPKYS  163


 Score =   156 bits (394),  Expect(2) = 8e-86, Method: Compositional matrix adjust.
 Identities = 76/77 (99%), Positives = 77/77 (100%), Gaps = 0/77 (0%)
 Frame = +3

Query  93   MGKEKVHISIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  272
            MGKEKVHI+IVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  273  DKLKAERERGITIDIAL  323
            DKLKAERERGITIDIAL
Sbjct  61   DKLKAERERGITIDIAL  77



>gb|ABA12223.1| translation elongation factor 1A-7 [Gossypium hirsutum]
Length=448

 Score =   188 bits (477),  Expect(2) = 8e-86, Method: Compositional matrix adjust.
 Identities = 86/89 (97%), Positives = 88/89 (99%), Gaps = 0/89 (0%)
 Frame = +1

Query  316  LPLWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTR  495
            + LWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTR
Sbjct  75   IALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTR  134

Query  496  EHALLAFTLGVKQMICCCNKIDATTPKYS  582
            EHALLAFTLGVKQMICCCNK+DATTPKYS
Sbjct  135  EHALLAFTLGVKQMICCCNKMDATTPKYS  163


 Score =   156 bits (394),  Expect(2) = 8e-86, Method: Compositional matrix adjust.
 Identities = 76/77 (99%), Positives = 77/77 (100%), Gaps = 0/77 (0%)
 Frame = +3

Query  93   MGKEKVHISIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  272
            MGKEKVHI+IVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  273  DKLKAERERGITIDIAL  323
            DKLKAERERGITIDIAL
Sbjct  61   DKLKAERERGITIDIAL  77



>gb|AHA84124.1| elongation factor 1-alpha [Phaseolus vulgaris]
Length=447

 Score =   188 bits (477),  Expect(2) = 8e-86, Method: Compositional matrix adjust.
 Identities = 86/89 (97%), Positives = 88/89 (99%), Gaps = 0/89 (0%)
 Frame = +1

Query  316  LPLWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTR  495
            + LWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTR
Sbjct  75   IALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTR  134

Query  496  EHALLAFTLGVKQMICCCNKIDATTPKYS  582
            EHALLAFTLGVKQMICCCNK+DATTPKYS
Sbjct  135  EHALLAFTLGVKQMICCCNKMDATTPKYS  163


 Score =   156 bits (394),  Expect(2) = 8e-86, Method: Compositional matrix adjust.
 Identities = 76/77 (99%), Positives = 77/77 (100%), Gaps = 0/77 (0%)
 Frame = +3

Query  93   MGKEKVHISIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  272
            MGKEKVHI+IVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  273  DKLKAERERGITIDIAL  323
            DKLKAERERGITIDIAL
Sbjct  61   DKLKAERERGITIDIAL  77



>ref|XP_010067278.1| PREDICTED: elongation factor 1-alpha-like [Eucalyptus grandis]
Length=447

 Score =   188 bits (477),  Expect(2) = 8e-86, Method: Compositional matrix adjust.
 Identities = 86/89 (97%), Positives = 88/89 (99%), Gaps = 0/89 (0%)
 Frame = +1

Query  316  LPLWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTR  495
            + LWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTR
Sbjct  75   IALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTR  134

Query  496  EHALLAFTLGVKQMICCCNKIDATTPKYS  582
            EHALLAFTLGVKQMICCCNK+DATTPKYS
Sbjct  135  EHALLAFTLGVKQMICCCNKMDATTPKYS  163


 Score =   156 bits (394),  Expect(2) = 8e-86, Method: Compositional matrix adjust.
 Identities = 76/77 (99%), Positives = 77/77 (100%), Gaps = 0/77 (0%)
 Frame = +3

Query  93   MGKEKVHISIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  272
            MGKEKVHI+IVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  273  DKLKAERERGITIDIAL  323
            DKLKAERERGITIDIAL
Sbjct  61   DKLKAERERGITIDIAL  77



>ref|XP_009381507.1| PREDICTED: elongation factor 1-alpha-like [Musa acuminata subsp. 
malaccensis]
 ref|XP_009381508.1| PREDICTED: elongation factor 1-alpha-like [Musa acuminata subsp. 
malaccensis]
 ref|XP_009381509.1| PREDICTED: elongation factor 1-alpha-like [Musa acuminata subsp. 
malaccensis]
Length=447

 Score =   188 bits (477),  Expect(2) = 8e-86, Method: Compositional matrix adjust.
 Identities = 86/89 (97%), Positives = 88/89 (99%), Gaps = 0/89 (0%)
 Frame = +1

Query  316  LPLWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTR  495
            + LWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTR
Sbjct  75   IALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTR  134

Query  496  EHALLAFTLGVKQMICCCNKIDATTPKYS  582
            EHALLAFTLGVKQMICCCNK+DATTPKYS
Sbjct  135  EHALLAFTLGVKQMICCCNKMDATTPKYS  163


 Score =   156 bits (394),  Expect(2) = 8e-86, Method: Compositional matrix adjust.
 Identities = 76/77 (99%), Positives = 77/77 (100%), Gaps = 0/77 (0%)
 Frame = +3

Query  93   MGKEKVHISIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  272
            MGKEKVHI+IVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  273  DKLKAERERGITIDIAL  323
            DKLKAERERGITIDIAL
Sbjct  61   DKLKAERERGITIDIAL  77



>gb|ABA12225.1| translation elongation factor 1A-9 [Gossypium hirsutum]
Length=448

 Score =   188 bits (477),  Expect(2) = 9e-86, Method: Compositional matrix adjust.
 Identities = 86/89 (97%), Positives = 88/89 (99%), Gaps = 0/89 (0%)
 Frame = +1

Query  316  LPLWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTR  495
            + LWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTR
Sbjct  75   IALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTR  134

Query  496  EHALLAFTLGVKQMICCCNKIDATTPKYS  582
            EHALLAFTLGVKQMICCCNK+DATTPKYS
Sbjct  135  EHALLAFTLGVKQMICCCNKMDATTPKYS  163


 Score =   156 bits (394),  Expect(2) = 9e-86, Method: Compositional matrix adjust.
 Identities = 76/77 (99%), Positives = 77/77 (100%), Gaps = 0/77 (0%)
 Frame = +3

Query  93   MGKEKVHISIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  272
            MGKEKVHI+IVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  273  DKLKAERERGITIDIAL  323
            DKLKAERERGITIDIAL
Sbjct  61   DKLKAERERGITIDIAL  77



>gb|AGV54713.1| elongation factor 1-alpha [Phaseolus vulgaris]
Length=447

 Score =   186 bits (473),  Expect(2) = 9e-86, Method: Compositional matrix adjust.
 Identities = 85/89 (96%), Positives = 88/89 (99%), Gaps = 0/89 (0%)
 Frame = +1

Query  316  LPLWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTR  495
            + LWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTR
Sbjct  75   IALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTR  134

Query  496  EHALLAFTLGVKQMICCCNKIDATTPKYS  582
            EHALL+FTLGVKQMICCCNK+DATTPKYS
Sbjct  135  EHALLSFTLGVKQMICCCNKMDATTPKYS  163


 Score =   157 bits (398),  Expect(2) = 9e-86, Method: Compositional matrix adjust.
 Identities = 77/77 (100%), Positives = 77/77 (100%), Gaps = 0/77 (0%)
 Frame = +3

Query  93   MGKEKVHISIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  272
            MGKEKVHISIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKVHISIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  273  DKLKAERERGITIDIAL  323
            DKLKAERERGITIDIAL
Sbjct  61   DKLKAERERGITIDIAL  77



>sp|P25698.2|EF1A_SOYBN RecName: Full=Elongation factor 1-alpha; Short=EF-1-alpha [Glycine 
max]
 emb|CAA40182.1| eEF-1a [Glycine max]
Length=447

 Score =   186 bits (473),  Expect(2) = 9e-86, Method: Compositional matrix adjust.
 Identities = 85/89 (96%), Positives = 88/89 (99%), Gaps = 0/89 (0%)
 Frame = +1

Query  316  LPLWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTR  495
            + LWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTR
Sbjct  75   IALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTR  134

Query  496  EHALLAFTLGVKQMICCCNKIDATTPKYS  582
            EHALL+FTLGVKQMICCCNK+DATTPKYS
Sbjct  135  EHALLSFTLGVKQMICCCNKMDATTPKYS  163


 Score =   157 bits (397),  Expect(2) = 9e-86, Method: Compositional matrix adjust.
 Identities = 77/77 (100%), Positives = 77/77 (100%), Gaps = 0/77 (0%)
 Frame = +3

Query  93   MGKEKVHISIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  272
            MGKEKVHISIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKVHISIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  273  DKLKAERERGITIDIAL  323
            DKLKAERERGITIDIAL
Sbjct  61   DKLKAERERGITIDIAL  77



>ref|XP_008792062.1| PREDICTED: elongation factor 1-alpha [Phoenix dactylifera]
Length=447

 Score =   188 bits (477),  Expect(2) = 9e-86, Method: Compositional matrix adjust.
 Identities = 86/89 (97%), Positives = 88/89 (99%), Gaps = 0/89 (0%)
 Frame = +1

Query  316  LPLWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTR  495
            + LWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTR
Sbjct  75   IALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTR  134

Query  496  EHALLAFTLGVKQMICCCNKIDATTPKYS  582
            EHALLAFTLGVKQMICCCNK+DATTPKYS
Sbjct  135  EHALLAFTLGVKQMICCCNKMDATTPKYS  163


 Score =   156 bits (394),  Expect(2) = 9e-86, Method: Compositional matrix adjust.
 Identities = 76/77 (99%), Positives = 77/77 (100%), Gaps = 0/77 (0%)
 Frame = +3

Query  93   MGKEKVHISIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  272
            MGKEKVHI+IVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  273  DKLKAERERGITIDIAL  323
            DKLKAERERGITIDIAL
Sbjct  61   DKLKAERERGITIDIAL  77



>ref|XP_008792073.1| PREDICTED: elongation factor 1-alpha-like [Phoenix dactylifera]
Length=447

 Score =   187 bits (476),  Expect(2) = 9e-86, Method: Compositional matrix adjust.
 Identities = 86/89 (97%), Positives = 88/89 (99%), Gaps = 0/89 (0%)
 Frame = +1

Query  316  LPLWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTR  495
            + LWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTR
Sbjct  75   IALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTR  134

Query  496  EHALLAFTLGVKQMICCCNKIDATTPKYS  582
            EHALLAFTLGVKQMICCCNK+DATTPKYS
Sbjct  135  EHALLAFTLGVKQMICCCNKMDATTPKYS  163


 Score =   156 bits (394),  Expect(2) = 9e-86, Method: Compositional matrix adjust.
 Identities = 76/77 (99%), Positives = 77/77 (100%), Gaps = 0/77 (0%)
 Frame = +3

Query  93   MGKEKVHISIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  272
            MGKEKVHI+IVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  273  DKLKAERERGITIDIAL  323
            DKLKAERERGITIDIAL
Sbjct  61   DKLKAERERGITIDIAL  77



>gb|ADR70875.1| eukaryotic translation elongation factor 1-alpha [Hevea brasiliensis]
Length=449

 Score =   188 bits (477),  Expect(2) = 9e-86, Method: Compositional matrix adjust.
 Identities = 86/89 (97%), Positives = 88/89 (99%), Gaps = 0/89 (0%)
 Frame = +1

Query  316  LPLWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTR  495
            + LWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTR
Sbjct  75   IALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTR  134

Query  496  EHALLAFTLGVKQMICCCNKIDATTPKYS  582
            EHALLAFTLGVKQMICCCNK+DATTPKYS
Sbjct  135  EHALLAFTLGVKQMICCCNKMDATTPKYS  163


 Score =   156 bits (394),  Expect(2) = 9e-86, Method: Compositional matrix adjust.
 Identities = 76/77 (99%), Positives = 77/77 (100%), Gaps = 0/77 (0%)
 Frame = +3

Query  93   MGKEKVHISIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  272
            MGKEKVHI+IVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  273  DKLKAERERGITIDIAL  323
            DKLKAERERGITIDIAL
Sbjct  61   DKLKAERERGITIDIAL  77



>ref|XP_010937806.1| PREDICTED: elongation factor 1-alpha-like [Elaeis guineensis]
Length=447

 Score =   188 bits (477),  Expect(2) = 9e-86, Method: Compositional matrix adjust.
 Identities = 86/89 (97%), Positives = 88/89 (99%), Gaps = 0/89 (0%)
 Frame = +1

Query  316  LPLWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTR  495
            + LWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTR
Sbjct  75   IALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTR  134

Query  496  EHALLAFTLGVKQMICCCNKIDATTPKYS  582
            EHALLAFTLGVKQMICCCNK+DATTPKYS
Sbjct  135  EHALLAFTLGVKQMICCCNKMDATTPKYS  163


 Score =   156 bits (394),  Expect(2) = 9e-86, Method: Compositional matrix adjust.
 Identities = 76/77 (99%), Positives = 77/77 (100%), Gaps = 0/77 (0%)
 Frame = +3

Query  93   MGKEKVHISIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  272
            MGKEKVHI+IVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  273  DKLKAERERGITIDIAL  323
            DKLKAERERGITIDIAL
Sbjct  61   DKLKAERERGITIDIAL  77



>ref|XP_010937804.1| PREDICTED: elongation factor 1-alpha-like [Elaeis guineensis]
 ref|XP_010937805.1| PREDICTED: elongation factor 1-alpha-like [Elaeis guineensis]
Length=447

 Score =   188 bits (477),  Expect(2) = 9e-86, Method: Compositional matrix adjust.
 Identities = 86/89 (97%), Positives = 88/89 (99%), Gaps = 0/89 (0%)
 Frame = +1

Query  316  LPLWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTR  495
            + LWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTR
Sbjct  75   IALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTR  134

Query  496  EHALLAFTLGVKQMICCCNKIDATTPKYS  582
            EHALLAFTLGVKQMICCCNK+DATTPKYS
Sbjct  135  EHALLAFTLGVKQMICCCNKMDATTPKYS  163


 Score =   156 bits (394),  Expect(2) = 9e-86, Method: Compositional matrix adjust.
 Identities = 76/77 (99%), Positives = 77/77 (100%), Gaps = 0/77 (0%)
 Frame = +3

Query  93   MGKEKVHISIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  272
            MGKEKVHI+IVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  273  DKLKAERERGITIDIAL  323
            DKLKAERERGITIDIAL
Sbjct  61   DKLKAERERGITIDIAL  77



>ref|XP_010032223.1| PREDICTED: elongation factor 1-alpha isoform X2 [Eucalyptus grandis]
Length=447

 Score =   187 bits (475),  Expect(2) = 9e-86, Method: Compositional matrix adjust.
 Identities = 85/89 (96%), Positives = 88/89 (99%), Gaps = 0/89 (0%)
 Frame = +1

Query  316  LPLWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTR  495
            + LWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTR
Sbjct  75   IALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTR  134

Query  496  EHALLAFTLGVKQMICCCNKIDATTPKYS  582
            EHALLAFTLGV+QMICCCNK+DATTPKYS
Sbjct  135  EHALLAFTLGVRQMICCCNKMDATTPKYS  163


 Score =   157 bits (396),  Expect(2) = 9e-86, Method: Compositional matrix adjust.
 Identities = 76/77 (99%), Positives = 77/77 (100%), Gaps = 0/77 (0%)
 Frame = +3

Query  93   MGKEKVHISIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  272
            MGKEK+HISIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKIHISIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  273  DKLKAERERGITIDIAL  323
            DKLKAERERGITIDIAL
Sbjct  61   DKLKAERERGITIDIAL  77



>ref|XP_004512426.1| PREDICTED: elongation factor 1-alpha-like [Cicer arietinum]
 ref|XP_004512427.1| PREDICTED: elongation factor 1-alpha-like [Cicer arietinum]
Length=448

 Score =   188 bits (477),  Expect(2) = 9e-86, Method: Compositional matrix adjust.
 Identities = 86/89 (97%), Positives = 88/89 (99%), Gaps = 0/89 (0%)
 Frame = +1

Query  316  LPLWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTR  495
            + LWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTR
Sbjct  75   IALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTR  134

Query  496  EHALLAFTLGVKQMICCCNKIDATTPKYS  582
            EHALLAFTLGVKQMICCCNK+DATTPKYS
Sbjct  135  EHALLAFTLGVKQMICCCNKMDATTPKYS  163


 Score =   155 bits (393),  Expect(2) = 9e-86, Method: Compositional matrix adjust.
 Identities = 76/77 (99%), Positives = 77/77 (100%), Gaps = 0/77 (0%)
 Frame = +3

Query  93   MGKEKVHISIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  272
            MGKEKVHI+IVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  273  DKLKAERERGITIDIAL  323
            DKLKAERERGITIDIAL
Sbjct  61   DKLKAERERGITIDIAL  77



>ref|XP_007151593.1| hypothetical protein PHAVU_004G060000g [Phaseolus vulgaris]
 gb|ESW23587.1| hypothetical protein PHAVU_004G060000g [Phaseolus vulgaris]
Length=447

 Score =   187 bits (476),  Expect(2) = 1e-85, Method: Compositional matrix adjust.
 Identities = 86/89 (97%), Positives = 88/89 (99%), Gaps = 0/89 (0%)
 Frame = +1

Query  316  LPLWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTR  495
            + LWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTR
Sbjct  75   IALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTR  134

Query  496  EHALLAFTLGVKQMICCCNKIDATTPKYS  582
            EHALLAFTLGVKQMICCCNK+DATTPKYS
Sbjct  135  EHALLAFTLGVKQMICCCNKMDATTPKYS  163


 Score =   156 bits (394),  Expect(2) = 1e-85, Method: Compositional matrix adjust.
 Identities = 76/77 (99%), Positives = 77/77 (100%), Gaps = 0/77 (0%)
 Frame = +3

Query  93   MGKEKVHISIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  272
            MGKEKVHI+IVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  273  DKLKAERERGITIDIAL  323
            DKLKAERERGITIDIAL
Sbjct  61   DKLKAERERGITIDIAL  77



>ref|XP_003604823.1| Elongation factor 1-alpha [Medicago truncatula]
Length=448

 Score =   188 bits (477),  Expect(2) = 1e-85, Method: Compositional matrix adjust.
 Identities = 86/89 (97%), Positives = 88/89 (99%), Gaps = 0/89 (0%)
 Frame = +1

Query  316  LPLWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTR  495
            + LWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTR
Sbjct  75   IALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTR  134

Query  496  EHALLAFTLGVKQMICCCNKIDATTPKYS  582
            EHALLAFTLGVKQMICCCNK+DATTPKYS
Sbjct  135  EHALLAFTLGVKQMICCCNKMDATTPKYS  163


 Score =   156 bits (394),  Expect(2) = 1e-85, Method: Compositional matrix adjust.
 Identities = 76/77 (99%), Positives = 77/77 (100%), Gaps = 0/77 (0%)
 Frame = +3

Query  93   MGKEKVHISIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  272
            MGKEKVHI+IVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  273  DKLKAERERGITIDIAL  323
            DKLKAERERGITIDIAL
Sbjct  61   DKLKAERERGITIDIAL  77



>ref|XP_009762748.1| PREDICTED: elongation factor 1-alpha-like [Nicotiana sylvestris]
Length=447

 Score =   187 bits (476),  Expect(2) = 1e-85, Method: Compositional matrix adjust.
 Identities = 86/89 (97%), Positives = 88/89 (99%), Gaps = 0/89 (0%)
 Frame = +1

Query  316  LPLWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTR  495
            + LWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTR
Sbjct  75   IALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTR  134

Query  496  EHALLAFTLGVKQMICCCNKIDATTPKYS  582
            EHALLAFTLGVKQMICCCNK+DATTPKYS
Sbjct  135  EHALLAFTLGVKQMICCCNKMDATTPKYS  163


 Score =   156 bits (394),  Expect(2) = 1e-85, Method: Compositional matrix adjust.
 Identities = 76/77 (99%), Positives = 77/77 (100%), Gaps = 0/77 (0%)
 Frame = +3

Query  93   MGKEKVHISIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  272
            MGKEKVHI+IVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  273  DKLKAERERGITIDIAL  323
            DKLKAERERGITIDIAL
Sbjct  61   DKLKAERERGITIDIAL  77



>ref|XP_009593325.1| PREDICTED: elongation factor 1-alpha [Nicotiana tomentosiformis]
Length=447

 Score =   187 bits (476),  Expect(2) = 1e-85, Method: Compositional matrix adjust.
 Identities = 86/89 (97%), Positives = 88/89 (99%), Gaps = 0/89 (0%)
 Frame = +1

Query  316  LPLWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTR  495
            + LWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTR
Sbjct  75   IALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTR  134

Query  496  EHALLAFTLGVKQMICCCNKIDATTPKYS  582
            EHALLAFTLGVKQMICCCNK+DATTPKYS
Sbjct  135  EHALLAFTLGVKQMICCCNKMDATTPKYS  163


 Score =   156 bits (394),  Expect(2) = 1e-85, Method: Compositional matrix adjust.
 Identities = 76/77 (99%), Positives = 77/77 (100%), Gaps = 0/77 (0%)
 Frame = +3

Query  93   MGKEKVHISIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  272
            MGKEKVHI+IVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  273  DKLKAERERGITIDIAL  323
            DKLKAERERGITIDIAL
Sbjct  61   DKLKAERERGITIDIAL  77



>ref|XP_007027265.1| GTP binding Elongation factor Tu family protein [Theobroma cacao]
 gb|EOY07767.1| GTP binding Elongation factor Tu family protein [Theobroma cacao]
Length=566

 Score =   187 bits (475),  Expect(2) = 1e-85, Method: Compositional matrix adjust.
 Identities = 86/89 (97%), Positives = 88/89 (99%), Gaps = 0/89 (0%)
 Frame = +1

Query  316  LPLWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTR  495
            + LWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTR
Sbjct  75   IALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTR  134

Query  496  EHALLAFTLGVKQMICCCNKIDATTPKYS  582
            EHALLAFTLGVKQMICCCNK+DATTPKYS
Sbjct  135  EHALLAFTLGVKQMICCCNKMDATTPKYS  163


 Score =   156 bits (395),  Expect(2) = 1e-85, Method: Compositional matrix adjust.
 Identities = 76/77 (99%), Positives = 77/77 (100%), Gaps = 0/77 (0%)
 Frame = +3

Query  93   MGKEKVHISIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  272
            MGKEKVHI+IVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  273  DKLKAERERGITIDIAL  323
            DKLKAERERGITIDIAL
Sbjct  61   DKLKAERERGITIDIAL  77



>dbj|BAM13874.1| elongation factor 1 alpha [Symplocarpus renifolius]
Length=447

 Score =   187 bits (475),  Expect(2) = 1e-85, Method: Compositional matrix adjust.
 Identities = 86/89 (97%), Positives = 88/89 (99%), Gaps = 0/89 (0%)
 Frame = +1

Query  316  LPLWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTR  495
            + LWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTR
Sbjct  75   IALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTR  134

Query  496  EHALLAFTLGVKQMICCCNKIDATTPKYS  582
            EHALLAFTLGVKQMICCCNK+DATTPKYS
Sbjct  135  EHALLAFTLGVKQMICCCNKMDATTPKYS  163


 Score =   156 bits (395),  Expect(2) = 1e-85, Method: Compositional matrix adjust.
 Identities = 76/77 (99%), Positives = 77/77 (100%), Gaps = 0/77 (0%)
 Frame = +3

Query  93   MGKEKVHISIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  272
            MGKEK+HISIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKIHISIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  273  DKLKAERERGITIDIAL  323
            DKLKAERERGITIDIAL
Sbjct  61   DKLKAERERGITIDIAL  77



>gb|ADR70874.1| eukaryotic translation elongation factor 1-alpha [Hevea brasiliensis]
Length=449

 Score =   188 bits (477),  Expect(2) = 1e-85, Method: Compositional matrix adjust.
 Identities = 86/89 (97%), Positives = 88/89 (99%), Gaps = 0/89 (0%)
 Frame = +1

Query  316  LPLWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTR  495
            + LWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTR
Sbjct  75   IALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTR  134

Query  496  EHALLAFTLGVKQMICCCNKIDATTPKYS  582
            EHALLAFTLGVKQMICCCNK+DATTPKYS
Sbjct  135  EHALLAFTLGVKQMICCCNKMDATTPKYS  163


 Score =   155 bits (393),  Expect(2) = 1e-85, Method: Compositional matrix adjust.
 Identities = 76/77 (99%), Positives = 77/77 (100%), Gaps = 0/77 (0%)
 Frame = +3

Query  93   MGKEKVHISIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  272
            MGKEKVHI+IVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  273  DKLKAERERGITIDIAL  323
            DKLKAERERGITIDIAL
Sbjct  61   DKLKAERERGITIDIAL  77



>gb|KDP29083.1| hypothetical protein JCGZ_16472 [Jatropha curcas]
Length=447

 Score =   187 bits (476),  Expect(2) = 1e-85, Method: Compositional matrix adjust.
 Identities = 86/89 (97%), Positives = 88/89 (99%), Gaps = 0/89 (0%)
 Frame = +1

Query  316  LPLWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTR  495
            + LWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTR
Sbjct  75   IALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTR  134

Query  496  EHALLAFTLGVKQMICCCNKIDATTPKYS  582
            EHALLAFTLGVKQMICCCNK+DATTPKYS
Sbjct  135  EHALLAFTLGVKQMICCCNKMDATTPKYS  163


 Score =   156 bits (394),  Expect(2) = 1e-85, Method: Compositional matrix adjust.
 Identities = 76/77 (99%), Positives = 77/77 (100%), Gaps = 0/77 (0%)
 Frame = +3

Query  93   MGKEKVHISIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  272
            MGKEKVHI+IVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  273  DKLKAERERGITIDIAL  323
            DKLKAERERGITIDIAL
Sbjct  61   DKLKAERERGITIDIAL  77



>ref|XP_010043711.1| PREDICTED: elongation factor 1-alpha [Eucalyptus grandis]
 gb|KCW85696.1| hypothetical protein EUGRSUZ_B02473 [Eucalyptus grandis]
Length=449

 Score =   188 bits (477),  Expect(2) = 1e-85, Method: Compositional matrix adjust.
 Identities = 86/89 (97%), Positives = 88/89 (99%), Gaps = 0/89 (0%)
 Frame = +1

Query  316  LPLWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTR  495
            + LWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTR
Sbjct  75   IALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTR  134

Query  496  EHALLAFTLGVKQMICCCNKIDATTPKYS  582
            EHALLAFTLGVKQMICCCNK+DATTPKYS
Sbjct  135  EHALLAFTLGVKQMICCCNKMDATTPKYS  163


 Score =   155 bits (393),  Expect(2) = 1e-85, Method: Compositional matrix adjust.
 Identities = 76/77 (99%), Positives = 77/77 (100%), Gaps = 0/77 (0%)
 Frame = +3

Query  93   MGKEKVHISIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  272
            MGKEKVHI+IVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  273  DKLKAERERGITIDIAL  323
            DKLKAERERGITIDIAL
Sbjct  61   DKLKAERERGITIDIAL  77



>ref|XP_009403341.1| PREDICTED: elongation factor 1-alpha-like [Musa acuminata subsp. 
malaccensis]
Length=447

 Score =   187 bits (476),  Expect(2) = 1e-85, Method: Compositional matrix adjust.
 Identities = 86/89 (97%), Positives = 88/89 (99%), Gaps = 0/89 (0%)
 Frame = +1

Query  316  LPLWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTR  495
            + LWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTR
Sbjct  75   IALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTR  134

Query  496  EHALLAFTLGVKQMICCCNKIDATTPKYS  582
            EHALLAFTLGVKQMICCCNK+DATTPKYS
Sbjct  135  EHALLAFTLGVKQMICCCNKMDATTPKYS  163


 Score =   156 bits (394),  Expect(2) = 1e-85, Method: Compositional matrix adjust.
 Identities = 76/77 (99%), Positives = 77/77 (100%), Gaps = 0/77 (0%)
 Frame = +3

Query  93   MGKEKVHISIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  272
            MGKEKVHI+IVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  273  DKLKAERERGITIDIAL  323
            DKLKAERERGITIDIAL
Sbjct  61   DKLKAERERGITIDIAL  77



>ref|XP_009388387.1| PREDICTED: elongation factor 1-alpha-like [Musa acuminata subsp. 
malaccensis]
Length=447

 Score =   187 bits (476),  Expect(2) = 1e-85, Method: Compositional matrix adjust.
 Identities = 86/89 (97%), Positives = 88/89 (99%), Gaps = 0/89 (0%)
 Frame = +1

Query  316  LPLWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTR  495
            + LWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTR
Sbjct  75   IALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTR  134

Query  496  EHALLAFTLGVKQMICCCNKIDATTPKYS  582
            EHALLAFTLGVKQMICCCNK+DATTPKYS
Sbjct  135  EHALLAFTLGVKQMICCCNKMDATTPKYS  163


 Score =   156 bits (394),  Expect(2) = 1e-85, Method: Compositional matrix adjust.
 Identities = 76/77 (99%), Positives = 77/77 (100%), Gaps = 0/77 (0%)
 Frame = +3

Query  93   MGKEKVHISIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  272
            MGKEKVHI+IVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  273  DKLKAERERGITIDIAL  323
            DKLKAERERGITIDIAL
Sbjct  61   DKLKAERERGITIDIAL  77



>ref|XP_006856244.1| hypothetical protein AMTR_s00059p00216110 [Amborella trichopoda]
 gb|ERN17711.1| hypothetical protein AMTR_s00059p00216110 [Amborella trichopoda]
Length=447

 Score =   187 bits (476),  Expect(2) = 1e-85, Method: Compositional matrix adjust.
 Identities = 86/89 (97%), Positives = 88/89 (99%), Gaps = 0/89 (0%)
 Frame = +1

Query  316  LPLWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTR  495
            + LWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTR
Sbjct  75   IALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTR  134

Query  496  EHALLAFTLGVKQMICCCNKIDATTPKYS  582
            EHALLAFTLGVKQMICCCNK+DATTPKYS
Sbjct  135  EHALLAFTLGVKQMICCCNKMDATTPKYS  163


 Score =   156 bits (394),  Expect(2) = 1e-85, Method: Compositional matrix adjust.
 Identities = 76/77 (99%), Positives = 77/77 (100%), Gaps = 0/77 (0%)
 Frame = +3

Query  93   MGKEKVHISIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  272
            MGKEKVHI+IVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  273  DKLKAERERGITIDIAL  323
            DKLKAERERGITIDIAL
Sbjct  61   DKLKAERERGITIDIAL  77



>ref|XP_007009751.1| GTP binding Elongation factor Tu family protein isoform 1 [Theobroma 
cacao]
 ref|XP_007009752.1| GTP binding Elongation factor Tu family protein isoform 1 [Theobroma 
cacao]
 gb|EOY18561.1| GTP binding Elongation factor Tu family protein isoform 1 [Theobroma 
cacao]
 gb|EOY18562.1| GTP binding Elongation factor Tu family protein isoform 1 [Theobroma 
cacao]
Length=449

 Score =   187 bits (476),  Expect(2) = 1e-85, Method: Compositional matrix adjust.
 Identities = 86/89 (97%), Positives = 88/89 (99%), Gaps = 0/89 (0%)
 Frame = +1

Query  316  LPLWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTR  495
            + LWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTR
Sbjct  75   IALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTR  134

Query  496  EHALLAFTLGVKQMICCCNKIDATTPKYS  582
            EHALLAFTLGVKQMICCCNK+DATTPKYS
Sbjct  135  EHALLAFTLGVKQMICCCNKMDATTPKYS  163


 Score =   156 bits (394),  Expect(2) = 1e-85, Method: Compositional matrix adjust.
 Identities = 76/77 (99%), Positives = 77/77 (100%), Gaps = 0/77 (0%)
 Frame = +3

Query  93   MGKEKVHISIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  272
            MGKEKVHI+IVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  273  DKLKAERERGITIDIAL  323
            DKLKAERERGITIDIAL
Sbjct  61   DKLKAERERGITIDIAL  77



>ref|XP_009613861.1| PREDICTED: elongation factor 1-alpha-like [Nicotiana tomentosiformis]
 ref|XP_009626606.1| PREDICTED: elongation factor 1-alpha-like [Nicotiana tomentosiformis]
 ref|XP_009597916.1| PREDICTED: elongation factor 1-alpha-like [Nicotiana tomentosiformis]
Length=447

 Score =   187 bits (476),  Expect(2) = 1e-85, Method: Compositional matrix adjust.
 Identities = 86/89 (97%), Positives = 88/89 (99%), Gaps = 0/89 (0%)
 Frame = +1

Query  316  LPLWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTR  495
            + LWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTR
Sbjct  75   IALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTR  134

Query  496  EHALLAFTLGVKQMICCCNKIDATTPKYS  582
            EHALLAFTLGVKQMICCCNK+DATTPKYS
Sbjct  135  EHALLAFTLGVKQMICCCNKMDATTPKYS  163


 Score =   155 bits (393),  Expect(2) = 1e-85, Method: Compositional matrix adjust.
 Identities = 76/77 (99%), Positives = 77/77 (100%), Gaps = 0/77 (0%)
 Frame = +3

Query  93   MGKEKVHISIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  272
            MGKEKVHI+IVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  273  DKLKAERERGITIDIAL  323
            DKLKAERERGITIDIAL
Sbjct  61   DKLKAERERGITIDIAL  77



>dbj|BAA34348.1| elongation factor-1 alpha [Nicotiana paniculata]
Length=447

 Score =   187 bits (476),  Expect(2) = 1e-85, Method: Compositional matrix adjust.
 Identities = 86/89 (97%), Positives = 88/89 (99%), Gaps = 0/89 (0%)
 Frame = +1

Query  316  LPLWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTR  495
            + LWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTR
Sbjct  75   IALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTR  134

Query  496  EHALLAFTLGVKQMICCCNKIDATTPKYS  582
            EHALLAFTLGVKQMICCCNK+DATTPKYS
Sbjct  135  EHALLAFTLGVKQMICCCNKMDATTPKYS  163


 Score =   156 bits (394),  Expect(2) = 1e-85, Method: Compositional matrix adjust.
 Identities = 76/77 (99%), Positives = 77/77 (100%), Gaps = 0/77 (0%)
 Frame = +3

Query  93   MGKEKVHISIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  272
            MGKEKVHI+IVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  273  DKLKAERERGITIDIAL  323
            DKLKAERERGITIDIAL
Sbjct  61   DKLKAERERGITIDIAL  77



>gb|EPS66340.1| elongation factor 1-alpha, partial [Genlisea aurea]
Length=441

 Score =   187 bits (476),  Expect(2) = 1e-85, Method: Compositional matrix adjust.
 Identities = 86/89 (97%), Positives = 88/89 (99%), Gaps = 0/89 (0%)
 Frame = +1

Query  316  LPLWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTR  495
            + LWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTR
Sbjct  75   IALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTR  134

Query  496  EHALLAFTLGVKQMICCCNKIDATTPKYS  582
            EHALLAFTLGVKQMICCCNK+DATTPKYS
Sbjct  135  EHALLAFTLGVKQMICCCNKMDATTPKYS  163


 Score =   155 bits (393),  Expect(2) = 1e-85, Method: Compositional matrix adjust.
 Identities = 76/77 (99%), Positives = 77/77 (100%), Gaps = 0/77 (0%)
 Frame = +3

Query  93   MGKEKVHISIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  272
            MGKEKVHI+IVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  273  DKLKAERERGITIDIAL  323
            DKLKAERERGITIDIAL
Sbjct  61   DKLKAERERGITIDIAL  77



>ref|XP_002528028.1| elongation factor 1-alpha, putative [Ricinus communis]
 gb|EEF34346.1| elongation factor 1-alpha, putative [Ricinus communis]
Length=449

 Score =   187 bits (476),  Expect(2) = 1e-85, Method: Compositional matrix adjust.
 Identities = 86/89 (97%), Positives = 88/89 (99%), Gaps = 0/89 (0%)
 Frame = +1

Query  316  LPLWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTR  495
            + LWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTR
Sbjct  75   IALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTR  134

Query  496  EHALLAFTLGVKQMICCCNKIDATTPKYS  582
            EHALLAFTLGVKQMICCCNK+DATTPKYS
Sbjct  135  EHALLAFTLGVKQMICCCNKMDATTPKYS  163


 Score =   155 bits (393),  Expect(2) = 1e-85, Method: Compositional matrix adjust.
 Identities = 76/77 (99%), Positives = 77/77 (100%), Gaps = 0/77 (0%)
 Frame = +3

Query  93   MGKEKVHISIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  272
            MGKEKVHI+IVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  273  DKLKAERERGITIDIAL  323
            DKLKAERERGITIDIAL
Sbjct  61   DKLKAERERGITIDIAL  77



>gb|KEH43536.1| GTP-binding elongation factor Tu family protein [Medicago truncatula]
Length=448

 Score =   187 bits (476),  Expect(2) = 1e-85, Method: Compositional matrix adjust.
 Identities = 86/89 (97%), Positives = 88/89 (99%), Gaps = 0/89 (0%)
 Frame = +1

Query  316  LPLWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTR  495
            + LWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTR
Sbjct  75   IALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTR  134

Query  496  EHALLAFTLGVKQMICCCNKIDATTPKYS  582
            EHALLAFTLGVKQMICCCNK+DATTPKYS
Sbjct  135  EHALLAFTLGVKQMICCCNKMDATTPKYS  163


 Score =   155 bits (393),  Expect(2) = 1e-85, Method: Compositional matrix adjust.
 Identities = 76/77 (99%), Positives = 77/77 (100%), Gaps = 0/77 (0%)
 Frame = +3

Query  93   MGKEKVHISIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  272
            MGKEKVHI+IVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  273  DKLKAERERGITIDIAL  323
            DKLKAERERGITIDIAL
Sbjct  61   DKLKAERERGITIDIAL  77



>emb|CDX95108.1| BnaC05g05630D [Brassica napus]
Length=487

 Score =   187 bits (476),  Expect(2) = 1e-85, Method: Compositional matrix adjust.
 Identities = 86/89 (97%), Positives = 88/89 (99%), Gaps = 0/89 (0%)
 Frame = +1

Query  316  LPLWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTR  495
            + LWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTR
Sbjct  96   IALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTR  155

Query  496  EHALLAFTLGVKQMICCCNKIDATTPKYS  582
            EHALLAFTLGVKQMICCCNK+DATTPKYS
Sbjct  156  EHALLAFTLGVKQMICCCNKMDATTPKYS  184


 Score =   155 bits (393),  Expect(2) = 1e-85, Method: Compositional matrix adjust.
 Identities = 81/91 (89%), Positives = 82/91 (90%), Gaps = 3/91 (3%)
 Frame = +3

Query  54   QPSSEES-FY*KLRMGKEKVHISIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEA  230
            QPS   S  Y  L MGKEK HI+IVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEA
Sbjct  10   QPSRYTSKIY--LAMGKEKFHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEA  67

Query  231  AEMNKRSFKYAWVLDKLKAERERGITIDIAL  323
            AEMNKRSFKYAWVLDKLKAERERGITIDIAL
Sbjct  68   AEMNKRSFKYAWVLDKLKAERERGITIDIAL  98



>gb|AAD56019.1|AF181491_1 elongation factor-1 alpha 2 [Lilium longiflorum]
Length=447

 Score =   187 bits (476),  Expect(2) = 1e-85, Method: Compositional matrix adjust.
 Identities = 85/89 (96%), Positives = 88/89 (99%), Gaps = 0/89 (0%)
 Frame = +1

Query  316  LPLWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTR  495
            + LWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCA+LIIDSTTGGFEAGISKDGQTR
Sbjct  75   IALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAILIIDSTTGGFEAGISKDGQTR  134

Query  496  EHALLAFTLGVKQMICCCNKIDATTPKYS  582
            EHALLAFTLGVKQMICCCNK+DATTPKYS
Sbjct  135  EHALLAFTLGVKQMICCCNKMDATTPKYS  163


 Score =   156 bits (394),  Expect(2) = 1e-85, Method: Compositional matrix adjust.
 Identities = 76/77 (99%), Positives = 77/77 (100%), Gaps = 0/77 (0%)
 Frame = +3

Query  93   MGKEKVHISIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  272
            MGKEKVHI+IVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  273  DKLKAERERGITIDIAL  323
            DKLKAERERGITIDIAL
Sbjct  61   DKLKAERERGITIDIAL  77



>gb|AES62210.2| GTP-binding elongation factor Tu family protein [Medicago truncatula]
 gb|KEH43534.1| GTP-binding elongation factor Tu family protein [Medicago truncatula]
Length=448

 Score =   187 bits (476),  Expect(2) = 1e-85, Method: Compositional matrix adjust.
 Identities = 86/89 (97%), Positives = 88/89 (99%), Gaps = 0/89 (0%)
 Frame = +1

Query  316  LPLWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTR  495
            + LWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTR
Sbjct  75   IALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTR  134

Query  496  EHALLAFTLGVKQMICCCNKIDATTPKYS  582
            EHALLAFTLGVKQMICCCNK+DATTPKYS
Sbjct  135  EHALLAFTLGVKQMICCCNKMDATTPKYS  163


 Score =   155 bits (393),  Expect(2) = 1e-85, Method: Compositional matrix adjust.
 Identities = 76/77 (99%), Positives = 77/77 (100%), Gaps = 0/77 (0%)
 Frame = +3

Query  93   MGKEKVHISIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  272
            MGKEKVHI+IVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  273  DKLKAERERGITIDIAL  323
            DKLKAERERGITIDIAL
Sbjct  61   DKLKAERERGITIDIAL  77



>ref|XP_010521578.1| PREDICTED: elongation factor 1-alpha [Tarenaya hassleriana]
Length=449

 Score =   187 bits (476),  Expect(2) = 1e-85, Method: Compositional matrix adjust.
 Identities = 86/89 (97%), Positives = 88/89 (99%), Gaps = 0/89 (0%)
 Frame = +1

Query  316  LPLWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTR  495
            + LWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTR
Sbjct  75   IALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTR  134

Query  496  EHALLAFTLGVKQMICCCNKIDATTPKYS  582
            EHALLAFTLGVKQMICCCNK+DATTPKYS
Sbjct  135  EHALLAFTLGVKQMICCCNKMDATTPKYS  163


 Score =   155 bits (393),  Expect(2) = 1e-85, Method: Compositional matrix adjust.
 Identities = 76/77 (99%), Positives = 77/77 (100%), Gaps = 0/77 (0%)
 Frame = +3

Query  93   MGKEKVHISIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  272
            MGKEKVHI+IVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  273  DKLKAERERGITIDIAL  323
            DKLKAERERGITIDIAL
Sbjct  61   DKLKAERERGITIDIAL  77



>ref|XP_010032227.1| PREDICTED: elongation factor 1-alpha-like [Eucalyptus grandis]
 gb|KCW51630.1| hypothetical protein EUGRSUZ_J01121 [Eucalyptus grandis]
Length=447

 Score =   187 bits (475),  Expect(2) = 1e-85, Method: Compositional matrix adjust.
 Identities = 85/89 (96%), Positives = 88/89 (99%), Gaps = 0/89 (0%)
 Frame = +1

Query  316  LPLWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTR  495
            + LWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCA+LIIDSTTGGFEAGISKDGQTR
Sbjct  75   IALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAILIIDSTTGGFEAGISKDGQTR  134

Query  496  EHALLAFTLGVKQMICCCNKIDATTPKYS  582
            EHALLAFTLGVKQMICCCNK+DATTPKYS
Sbjct  135  EHALLAFTLGVKQMICCCNKMDATTPKYS  163


 Score =   156 bits (394),  Expect(2) = 1e-85, Method: Compositional matrix adjust.
 Identities = 76/77 (99%), Positives = 77/77 (100%), Gaps = 0/77 (0%)
 Frame = +3

Query  93   MGKEKVHISIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  272
            MGKEKVHI+IVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  273  DKLKAERERGITIDIAL  323
            DKLKAERERGITIDIAL
Sbjct  61   DKLKAERERGITIDIAL  77



>gb|ABD66517.1| EF-1 alpha [Gymnadenia conopsea]
Length=447

 Score =   186 bits (473),  Expect(2) = 1e-85, Method: Compositional matrix adjust.
 Identities = 85/89 (96%), Positives = 88/89 (99%), Gaps = 0/89 (0%)
 Frame = +1

Query  316  LPLWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTR  495
            + LWKFETTKYYCTVIDAPGHRDFIKNMITGTS+ADCAVLIIDSTTGGFEAGISKDGQTR
Sbjct  75   IALWKFETTKYYCTVIDAPGHRDFIKNMITGTSRADCAVLIIDSTTGGFEAGISKDGQTR  134

Query  496  EHALLAFTLGVKQMICCCNKIDATTPKYS  582
            EHALLAFTLGVKQMICCCNK+DATTPKYS
Sbjct  135  EHALLAFTLGVKQMICCCNKMDATTPKYS  163


 Score =   157 bits (396),  Expect(2) = 1e-85, Method: Compositional matrix adjust.
 Identities = 77/77 (100%), Positives = 77/77 (100%), Gaps = 0/77 (0%)
 Frame = +3

Query  93   MGKEKVHISIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  272
            MGKEKVHISIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKVHISIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  273  DKLKAERERGITIDIAL  323
            DKLKAERERGITIDIAL
Sbjct  61   DKLKAERERGITIDIAL  77



>gb|AFJ04514.1| elongation factor 1-alpha, partial [Vernicia fordii]
Length=438

 Score =   187 bits (475),  Expect(2) = 1e-85, Method: Compositional matrix adjust.
 Identities = 86/89 (97%), Positives = 88/89 (99%), Gaps = 0/89 (0%)
 Frame = +1

Query  316  LPLWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTR  495
            + LWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTR
Sbjct  75   IALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTR  134

Query  496  EHALLAFTLGVKQMICCCNKIDATTPKYS  582
            EHALLAFTLGVKQMICCCNK+DATTPKYS
Sbjct  135  EHALLAFTLGVKQMICCCNKMDATTPKYS  163


 Score =   156 bits (394),  Expect(2) = 1e-85, Method: Compositional matrix adjust.
 Identities = 76/77 (99%), Positives = 77/77 (100%), Gaps = 0/77 (0%)
 Frame = +3

Query  93   MGKEKVHISIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  272
            MGKEKVHI+IVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  273  DKLKAERERGITIDIAL  323
            DKLKAERERGITIDIAL
Sbjct  61   DKLKAERERGITIDIAL  77



>gb|KCW65375.1| hypothetical protein EUGRSUZ_G02807 [Eucalyptus grandis]
Length=428

 Score =   187 bits (476),  Expect(2) = 1e-85, Method: Compositional matrix adjust.
 Identities = 86/89 (97%), Positives = 88/89 (99%), Gaps = 0/89 (0%)
 Frame = +1

Query  316  LPLWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTR  495
            + LWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTR
Sbjct  75   IALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTR  134

Query  496  EHALLAFTLGVKQMICCCNKIDATTPKYS  582
            EHALLAFTLGVKQMICCCNK+DATTPKYS
Sbjct  135  EHALLAFTLGVKQMICCCNKMDATTPKYS  163


 Score =   155 bits (393),  Expect(2) = 1e-85, Method: Compositional matrix adjust.
 Identities = 76/77 (99%), Positives = 77/77 (100%), Gaps = 0/77 (0%)
 Frame = +3

Query  93   MGKEKVHISIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  272
            MGKEKVHI+IVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  273  DKLKAERERGITIDIAL  323
            DKLKAERERGITIDIAL
Sbjct  61   DKLKAERERGITIDIAL  77



>gb|KCW51623.1| hypothetical protein EUGRSUZ_J01112 [Eucalyptus grandis]
Length=330

 Score =   186 bits (473),  Expect(2) = 1e-85, Method: Compositional matrix adjust.
 Identities = 85/89 (96%), Positives = 88/89 (99%), Gaps = 0/89 (0%)
 Frame = +1

Query  316  LPLWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTR  495
            + LWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTR
Sbjct  75   IALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTR  134

Query  496  EHALLAFTLGVKQMICCCNKIDATTPKYS  582
            EHALLAFTLGV+QMICCCNK+DATTPKYS
Sbjct  135  EHALLAFTLGVRQMICCCNKMDATTPKYS  163


 Score =   157 bits (396),  Expect(2) = 1e-85, Method: Compositional matrix adjust.
 Identities = 77/77 (100%), Positives = 77/77 (100%), Gaps = 0/77 (0%)
 Frame = +3

Query  93   MGKEKVHISIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  272
            MGKEKVHISIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKVHISIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  273  DKLKAERERGITIDIAL  323
            DKLKAERERGITIDIAL
Sbjct  61   DKLKAERERGITIDIAL  77



>gb|AES74993.2| GTP-binding elongation factor Tu family protein [Medicago truncatula]
 gb|KEH25376.1| GTP-binding elongation factor Tu family protein [Medicago truncatula]
Length=447

 Score =   187 bits (476),  Expect(2) = 1e-85, Method: Compositional matrix adjust.
 Identities = 86/89 (97%), Positives = 88/89 (99%), Gaps = 0/89 (0%)
 Frame = +1

Query  316  LPLWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTR  495
            + LWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTR
Sbjct  75   IALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTR  134

Query  496  EHALLAFTLGVKQMICCCNKIDATTPKYS  582
            EHALLAFTLGVKQMICCCNK+DATTPKYS
Sbjct  135  EHALLAFTLGVKQMICCCNKMDATTPKYS  163


 Score =   155 bits (392),  Expect(2) = 1e-85, Method: Compositional matrix adjust.
 Identities = 75/77 (97%), Positives = 77/77 (100%), Gaps = 0/77 (0%)
 Frame = +3

Query  93   MGKEKVHISIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  272
            MGKEK+HI+IVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKIHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  273  DKLKAERERGITIDIAL  323
            DKLKAERERGITIDIAL
Sbjct  61   DKLKAERERGITIDIAL  77



>ref|XP_003536362.1| PREDICTED: elongation factor 1-alpha-like isoformX2 [Glycine 
max]
 ref|XP_006589439.1| PREDICTED: elongation factor 1-alpha-like isoform X3 [Glycine 
max]
 ref|XP_006589440.1| PREDICTED: elongation factor 1-alpha-like isoform X4 [Glycine 
max]
 gb|KHN17117.1| Elongation factor 1-alpha [Glycine soja]
Length=448

 Score =   187 bits (474),  Expect(2) = 1e-85, Method: Compositional matrix adjust.
 Identities = 85/89 (96%), Positives = 88/89 (99%), Gaps = 0/89 (0%)
 Frame = +1

Query  316  LPLWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTR  495
            + LWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTR
Sbjct  75   IALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTR  134

Query  496  EHALLAFTLGVKQMICCCNKIDATTPKYS  582
            EHALLAFTLGV+QMICCCNK+DATTPKYS
Sbjct  135  EHALLAFTLGVRQMICCCNKMDATTPKYS  163


 Score =   156 bits (394),  Expect(2) = 1e-85, Method: Compositional matrix adjust.
 Identities = 76/77 (99%), Positives = 77/77 (100%), Gaps = 0/77 (0%)
 Frame = +3

Query  93   MGKEKVHISIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  272
            MGKEKVHI+IVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  273  DKLKAERERGITIDIAL  323
            DKLKAERERGITIDIAL
Sbjct  61   DKLKAERERGITIDIAL  77



>ref|XP_010032224.1| PREDICTED: elongation factor 1-alpha isoform X3 [Eucalyptus grandis]
Length=447

 Score =   187 bits (475),  Expect(2) = 1e-85, Method: Compositional matrix adjust.
 Identities = 85/89 (96%), Positives = 88/89 (99%), Gaps = 0/89 (0%)
 Frame = +1

Query  316  LPLWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTR  495
            + LWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTR
Sbjct  75   IALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTR  134

Query  496  EHALLAFTLGVKQMICCCNKIDATTPKYS  582
            EHALLAFTLGV+QMICCCNK+DATTPKYS
Sbjct  135  EHALLAFTLGVRQMICCCNKMDATTPKYS  163


 Score =   156 bits (394),  Expect(2) = 1e-85, Method: Compositional matrix adjust.
 Identities = 76/77 (99%), Positives = 77/77 (100%), Gaps = 0/77 (0%)
 Frame = +3

Query  93   MGKEKVHISIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  272
            MGKEKVHI+IVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  273  DKLKAERERGITIDIAL  323
            DKLKAERERGITIDIAL
Sbjct  61   DKLKAERERGITIDIAL  77



>ref|XP_006340223.1| PREDICTED: elongation factor 1-alpha-like [Solanum tuberosum]
Length=447

 Score =   187 bits (474),  Expect(2) = 2e-85, Method: Compositional matrix adjust.
 Identities = 85/89 (96%), Positives = 88/89 (99%), Gaps = 0/89 (0%)
 Frame = +1

Query  316  LPLWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTR  495
            + LWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTR
Sbjct  75   IALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTR  134

Query  496  EHALLAFTLGVKQMICCCNKIDATTPKYS  582
            EHALLAFTLGV+QMICCCNK+DATTPKYS
Sbjct  135  EHALLAFTLGVRQMICCCNKMDATTPKYS  163


 Score =   156 bits (394),  Expect(2) = 2e-85, Method: Compositional matrix adjust.
 Identities = 76/77 (99%), Positives = 77/77 (100%), Gaps = 0/77 (0%)
 Frame = +3

Query  93   MGKEKVHISIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  272
            MGKEKVHI+IVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  273  DKLKAERERGITIDIAL  323
            DKLKAERERGITIDIAL
Sbjct  61   DKLKAERERGITIDIAL  77



>ref|XP_003604587.1| Elongation factor 1-alpha [Medicago truncatula]
 gb|AES86784.1| GTP-binding elongation factor Tu family protein [Medicago truncatula]
Length=447

 Score =   187 bits (475),  Expect(2) = 2e-85, Method: Compositional matrix adjust.
 Identities = 85/89 (96%), Positives = 88/89 (99%), Gaps = 0/89 (0%)
 Frame = +1

Query  316  LPLWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTR  495
            + LWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTR
Sbjct  75   IALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTR  134

Query  496  EHALLAFTLGVKQMICCCNKIDATTPKYS  582
            EHALLAFTLGV+QMICCCNK+DATTPKYS
Sbjct  135  EHALLAFTLGVRQMICCCNKMDATTPKYS  163


 Score =   156 bits (394),  Expect(2) = 2e-85, Method: Compositional matrix adjust.
 Identities = 76/77 (99%), Positives = 77/77 (100%), Gaps = 0/77 (0%)
 Frame = +3

Query  93   MGKEKVHISIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  272
            MGKEKVHI+IVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  273  DKLKAERERGITIDIAL  323
            DKLKAERERGITIDIAL
Sbjct  61   DKLKAERERGITIDIAL  77



>ref|XP_004251154.1| PREDICTED: elongation factor 1-alpha-like [Solanum lycopersicum]
Length=447

 Score =   187 bits (474),  Expect(2) = 2e-85, Method: Compositional matrix adjust.
 Identities = 85/89 (96%), Positives = 88/89 (99%), Gaps = 0/89 (0%)
 Frame = +1

Query  316  LPLWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTR  495
            + LWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTR
Sbjct  75   IALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTR  134

Query  496  EHALLAFTLGVKQMICCCNKIDATTPKYS  582
            EHALLAFTLGV+QMICCCNK+DATTPKYS
Sbjct  135  EHALLAFTLGVRQMICCCNKMDATTPKYS  163


 Score =   156 bits (394),  Expect(2) = 2e-85, Method: Compositional matrix adjust.
 Identities = 76/77 (99%), Positives = 77/77 (100%), Gaps = 0/77 (0%)
 Frame = +3

Query  93   MGKEKVHISIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  272
            MGKEKVHI+IVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  273  DKLKAERERGITIDIAL  323
            DKLKAERERGITIDIAL
Sbjct  61   DKLKAERERGITIDIAL  77



>ref|XP_002284964.1| PREDICTED: elongation factor 1-alpha [Vitis vinifera]
 ref|XP_002284924.1| PREDICTED: elongation factor 1-alpha [Vitis vinifera]
 ref|XP_010651131.1| PREDICTED: elongation factor 1-alpha [Vitis vinifera]
 emb|CAN64511.1| hypothetical protein VITISV_035691 [Vitis vinifera]
Length=447

 Score =   187 bits (474),  Expect(2) = 2e-85, Method: Compositional matrix adjust.
 Identities = 85/89 (96%), Positives = 88/89 (99%), Gaps = 0/89 (0%)
 Frame = +1

Query  316  LPLWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTR  495
            + LWKFETT+YYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTR
Sbjct  75   IALWKFETTRYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTR  134

Query  496  EHALLAFTLGVKQMICCCNKIDATTPKYS  582
            EHALLAFTLGVKQMICCCNK+DATTPKYS
Sbjct  135  EHALLAFTLGVKQMICCCNKMDATTPKYS  163


 Score =   156 bits (394),  Expect(2) = 2e-85, Method: Compositional matrix adjust.
 Identities = 76/77 (99%), Positives = 77/77 (100%), Gaps = 0/77 (0%)
 Frame = +3

Query  93   MGKEKVHISIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  272
            MGKEKVHI+IVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  273  DKLKAERERGITIDIAL  323
            DKLKAERERGITIDIAL
Sbjct  61   DKLKAERERGITIDIAL  77



>gb|EYU36203.1| hypothetical protein MIMGU_mgv1a006301mg [Erythranthe guttata]
Length=449

 Score =   187 bits (475),  Expect(2) = 2e-85, Method: Compositional matrix adjust.
 Identities = 86/89 (97%), Positives = 88/89 (99%), Gaps = 0/89 (0%)
 Frame = +1

Query  316  LPLWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTR  495
            + LWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTR
Sbjct  75   IALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTR  134

Query  496  EHALLAFTLGVKQMICCCNKIDATTPKYS  582
            EHALLAFTLGVKQMICCCNK+DATTPKYS
Sbjct  135  EHALLAFTLGVKQMICCCNKMDATTPKYS  163


 Score =   155 bits (393),  Expect(2) = 2e-85, Method: Compositional matrix adjust.
 Identities = 76/77 (99%), Positives = 77/77 (100%), Gaps = 0/77 (0%)
 Frame = +3

Query  93   MGKEKVHISIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  272
            MGKEKVHI+IVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  273  DKLKAERERGITIDIAL  323
            DKLKAERERGITIDIAL
Sbjct  61   DKLKAERERGITIDIAL  77



>emb|CDO98621.1| unnamed protein product [Coffea canephora]
Length=355

 Score =   187 bits (475),  Expect(2) = 2e-85, Method: Compositional matrix adjust.
 Identities = 86/89 (97%), Positives = 88/89 (99%), Gaps = 0/89 (0%)
 Frame = +1

Query  316  LPLWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTR  495
            + LWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTR
Sbjct  75   IALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTR  134

Query  496  EHALLAFTLGVKQMICCCNKIDATTPKYS  582
            EHALLAFTLGVKQMICCCNK+DATTPKYS
Sbjct  135  EHALLAFTLGVKQMICCCNKMDATTPKYS  163


 Score =   155 bits (393),  Expect(2) = 2e-85, Method: Compositional matrix adjust.
 Identities = 76/77 (99%), Positives = 77/77 (100%), Gaps = 0/77 (0%)
 Frame = +3

Query  93   MGKEKVHISIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  272
            MGKEKVHI+IVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  273  DKLKAERERGITIDIAL  323
            DKLKAERERGITIDIAL
Sbjct  61   DKLKAERERGITIDIAL  77



>ref|XP_010032221.1| PREDICTED: elongation factor 1-alpha isoform X1 [Eucalyptus grandis]
 ref|XP_010032222.1| PREDICTED: elongation factor 1-alpha isoform X1 [Eucalyptus grandis]
Length=449

 Score =   187 bits (474),  Expect(2) = 2e-85, Method: Compositional matrix adjust.
 Identities = 85/89 (96%), Positives = 88/89 (99%), Gaps = 0/89 (0%)
 Frame = +1

Query  316  LPLWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTR  495
            + LWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTR
Sbjct  75   IALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTR  134

Query  496  EHALLAFTLGVKQMICCCNKIDATTPKYS  582
            EHALLAFTLGV+QMICCCNK+DATTPKYS
Sbjct  135  EHALLAFTLGVRQMICCCNKMDATTPKYS  163


 Score =   156 bits (394),  Expect(2) = 2e-85, Method: Compositional matrix adjust.
 Identities = 76/77 (99%), Positives = 77/77 (100%), Gaps = 0/77 (0%)
 Frame = +3

Query  93   MGKEKVHISIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  272
            MGKEKVHI+IVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  273  DKLKAERERGITIDIAL  323
            DKLKAERERGITIDIAL
Sbjct  61   DKLKAERERGITIDIAL  77



>ref|XP_007009760.1| GTP binding Elongation factor Tu family protein isoform 1 [Theobroma 
cacao]
 ref|XP_007009761.1| GTP binding Elongation factor Tu family protein isoform 1 [Theobroma 
cacao]
 gb|EOY18570.1| GTP binding Elongation factor Tu family protein isoform 1 [Theobroma 
cacao]
 gb|EOY18571.1| GTP binding Elongation factor Tu family protein isoform 1 [Theobroma 
cacao]
Length=449

 Score =   187 bits (474),  Expect(2) = 2e-85, Method: Compositional matrix adjust.
 Identities = 85/89 (96%), Positives = 88/89 (99%), Gaps = 0/89 (0%)
 Frame = +1

Query  316  LPLWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTR  495
            + LWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTR
Sbjct  75   IALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTR  134

Query  496  EHALLAFTLGVKQMICCCNKIDATTPKYS  582
            EHALLAFTLGV+QMICCCNK+DATTPKYS
Sbjct  135  EHALLAFTLGVRQMICCCNKMDATTPKYS  163


 Score =   156 bits (394),  Expect(2) = 2e-85, Method: Compositional matrix adjust.
 Identities = 76/77 (99%), Positives = 77/77 (100%), Gaps = 0/77 (0%)
 Frame = +3

Query  93   MGKEKVHISIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  272
            MGKEKVHI+IVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  273  DKLKAERERGITIDIAL  323
            DKLKAERERGITIDIAL
Sbjct  61   DKLKAERERGITIDIAL  77



>ref|XP_006846237.1| hypothetical protein AMTR_s00012p00237190 [Amborella trichopoda]
 gb|ERN07912.1| hypothetical protein AMTR_s00012p00237190 [Amborella trichopoda]
Length=447

 Score =   187 bits (474),  Expect(2) = 2e-85, Method: Compositional matrix adjust.
 Identities = 85/89 (96%), Positives = 88/89 (99%), Gaps = 0/89 (0%)
 Frame = +1

Query  316  LPLWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTR  495
            + LWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTR
Sbjct  75   IALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTR  134

Query  496  EHALLAFTLGVKQMICCCNKIDATTPKYS  582
            EHALLAFTLGV+QMICCCNK+DATTPKYS
Sbjct  135  EHALLAFTLGVRQMICCCNKMDATTPKYS  163


 Score =   156 bits (394),  Expect(2) = 2e-85, Method: Compositional matrix adjust.
 Identities = 76/77 (99%), Positives = 77/77 (100%), Gaps = 0/77 (0%)
 Frame = +3

Query  93   MGKEKVHISIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  272
            MGKEKVHI+IVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  273  DKLKAERERGITIDIAL  323
            DKLKAERERGITIDIAL
Sbjct  61   DKLKAERERGITIDIAL  77



>ref|XP_002277159.1| PREDICTED: elongation factor 1-alpha [Vitis vinifera]
 ref|XP_010658430.1| PREDICTED: elongation factor 1-alpha [Vitis vinifera]
 emb|CAN76417.1| hypothetical protein VITISV_018410 [Vitis vinifera]
 emb|CAN69000.1| hypothetical protein VITISV_022484 [Vitis vinifera]
Length=447

 Score =   187 bits (474),  Expect(2) = 2e-85, Method: Compositional matrix adjust.
 Identities = 85/89 (96%), Positives = 88/89 (99%), Gaps = 0/89 (0%)
 Frame = +1

Query  316  LPLWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTR  495
            + LWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTR
Sbjct  75   IALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTR  134

Query  496  EHALLAFTLGVKQMICCCNKIDATTPKYS  582
            EHALLAFTLGV+QMICCCNK+DATTPKYS
Sbjct  135  EHALLAFTLGVRQMICCCNKMDATTPKYS  163


 Score =   156 bits (394),  Expect(2) = 2e-85, Method: Compositional matrix adjust.
 Identities = 76/77 (99%), Positives = 77/77 (100%), Gaps = 0/77 (0%)
 Frame = +3

Query  93   MGKEKVHISIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  272
            MGKEKVHI+IVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  273  DKLKAERERGITIDIAL  323
            DKLKAERERGITIDIAL
Sbjct  61   DKLKAERERGITIDIAL  77



>ref|XP_011031813.1| PREDICTED: LOW QUALITY PROTEIN: HBS1-like protein [Populus euphratica]
Length=1057

 Score =   188 bits (478),  Expect(2) = 2e-85, Method: Compositional matrix adjust.
 Identities = 86/89 (97%), Positives = 88/89 (99%), Gaps = 0/89 (0%)
 Frame = +1

Query  316  LPLWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTR  495
            + LWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTR
Sbjct  683  IALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTR  742

Query  496  EHALLAFTLGVKQMICCCNKIDATTPKYS  582
            EHALLAFTLGVKQMICCCNK+DATTPKYS
Sbjct  743  EHALLAFTLGVKQMICCCNKMDATTPKYS  771


 Score =   154 bits (390),  Expect(2) = 2e-85, Method: Compositional matrix adjust.
 Identities = 75/77 (97%), Positives = 76/77 (99%), Gaps = 0/77 (0%)
 Frame = +3

Query  93   MGKEKVHISIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  272
            MGKEK HI+IVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  609  MGKEKSHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  668

Query  273  DKLKAERERGITIDIAL  323
            DKLKAERERGITIDIAL
Sbjct  669  DKLKAERERGITIDIAL  685


 Score =   184 bits (466),  Expect(2) = 7e-83, Method: Compositional matrix adjust.
 Identities = 83/89 (93%), Positives = 86/89 (97%), Gaps = 0/89 (0%)
 Frame = +1

Query  316  LPLWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTR  495
            + LWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTR
Sbjct  208  IALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTR  267

Query  496  EHALLAFTLGVKQMICCCNKIDATTPKYS  582
            EHA LAFT GV+QMICCCNK+DATTPKYS
Sbjct  268  EHAFLAFTXGVRQMICCCNKMDATTPKYS  296


 Score =   150 bits (379),  Expect(2) = 7e-83, Method: Compositional matrix adjust.
 Identities = 73/77 (95%), Positives = 74/77 (96%), Gaps = 0/77 (0%)
 Frame = +3

Query  93   MGKEKVHISIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  272
            MGKEK HI+IVVIGH D GKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  134  MGKEKSHINIVVIGHDDPGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  193

Query  273  DKLKAERERGITIDIAL  323
            DKLKAERERGITIDIAL
Sbjct  194  DKLKAERERGITIDIAL  210



>ref|XP_011091454.1| PREDICTED: elongation factor 1-alpha-like [Sesamum indicum]
Length=449

 Score =   187 bits (474),  Expect(2) = 2e-85, Method: Compositional matrix adjust.
 Identities = 85/89 (96%), Positives = 88/89 (99%), Gaps = 0/89 (0%)
 Frame = +1

Query  316  LPLWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTR  495
            + LWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTR
Sbjct  75   IALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTR  134

Query  496  EHALLAFTLGVKQMICCCNKIDATTPKYS  582
            EHALLAFTLGV+QMICCCNK+DATTPKYS
Sbjct  135  EHALLAFTLGVRQMICCCNKMDATTPKYS  163


 Score =   156 bits (394),  Expect(2) = 2e-85, Method: Compositional matrix adjust.
 Identities = 76/77 (99%), Positives = 77/77 (100%), Gaps = 0/77 (0%)
 Frame = +3

Query  93   MGKEKVHISIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  272
            MGKEKVHI+IVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  273  DKLKAERERGITIDIAL  323
            DKLKAERERGITIDIAL
Sbjct  61   DKLKAERERGITIDIAL  77



>ref|XP_009403064.1| PREDICTED: elongation factor 1-alpha-like [Musa acuminata subsp. 
malaccensis]
Length=447

 Score =   187 bits (474),  Expect(2) = 2e-85, Method: Compositional matrix adjust.
 Identities = 85/89 (96%), Positives = 88/89 (99%), Gaps = 0/89 (0%)
 Frame = +1

Query  316  LPLWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTR  495
            + LWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTR
Sbjct  75   IALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTR  134

Query  496  EHALLAFTLGVKQMICCCNKIDATTPKYS  582
            EHALLAFTLGV+QMICCCNK+DATTPKYS
Sbjct  135  EHALLAFTLGVRQMICCCNKMDATTPKYS  163


 Score =   156 bits (394),  Expect(2) = 2e-85, Method: Compositional matrix adjust.
 Identities = 76/77 (99%), Positives = 77/77 (100%), Gaps = 0/77 (0%)
 Frame = +3

Query  93   MGKEKVHISIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  272
            MGKEKVHI+IVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  273  DKLKAERERGITIDIAL  323
            DKLKAERERGITIDIAL
Sbjct  61   DKLKAERERGITIDIAL  77



>emb|CDP07148.1| unnamed protein product [Coffea canephora]
Length=413

 Score =   187 bits (474),  Expect(2) = 2e-85, Method: Compositional matrix adjust.
 Identities = 86/87 (99%), Positives = 87/87 (100%), Gaps = 0/87 (0%)
 Frame = +1

Query  322  LWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTREH  501
            LWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTREH
Sbjct  77   LWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTREH  136

Query  502  ALLAFTLGVKQMICCCNKIDATTPKYS  582
            ALLAFTLGVKQMICCCNK+DATTPKYS
Sbjct  137  ALLAFTLGVKQMICCCNKMDATTPKYS  163


 Score =   155 bits (393),  Expect(2) = 2e-85, Method: Compositional matrix adjust.
 Identities = 76/77 (99%), Positives = 77/77 (100%), Gaps = 0/77 (0%)
 Frame = +3

Query  93   MGKEKVHISIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  272
            MGKEKVHI+IVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  273  DKLKAERERGITIDIAL  323
            DKLKAERERGITIDIAL
Sbjct  61   DKLKAERERGITIDIAL  77



>dbj|BAA23658.1| EF-1 alpha [Oryza sativa]
Length=447

 Score =   188 bits (477),  Expect(2) = 2e-85, Method: Compositional matrix adjust.
 Identities = 86/89 (97%), Positives = 88/89 (99%), Gaps = 0/89 (0%)
 Frame = +1

Query  316  LPLWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTR  495
            + LWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTR
Sbjct  75   IALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTR  134

Query  496  EHALLAFTLGVKQMICCCNKIDATTPKYS  582
            EHALLAFTLGVKQMICCCNK+DATTPKYS
Sbjct  135  EHALLAFTLGVKQMICCCNKMDATTPKYS  163


 Score =   155 bits (391),  Expect(2) = 2e-85, Method: Compositional matrix adjust.
 Identities = 75/77 (97%), Positives = 76/77 (99%), Gaps = 0/77 (0%)
 Frame = +3

Query  93   MGKEKVHISIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  272
            MGKEK HI+IVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKTHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  273  DKLKAERERGITIDIAL  323
            DKLKAERERGITIDIAL
Sbjct  61   DKLKAERERGITIDIAL  77



>gb|ADD71925.1| translation elongation factor 1 alpha [Actaea racemosa]
Length=404

 Score =   187 bits (474),  Expect(2) = 2e-85, Method: Compositional matrix adjust.
 Identities = 86/89 (97%), Positives = 88/89 (99%), Gaps = 0/89 (0%)
 Frame = +1

Query  316  LPLWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTR  495
            + LWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTR
Sbjct  75   IALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTR  134

Query  496  EHALLAFTLGVKQMICCCNKIDATTPKYS  582
            EHALLAFTLGVKQMICCCNK+DATTPKYS
Sbjct  135  EHALLAFTLGVKQMICCCNKMDATTPKYS  163


 Score =   156 bits (394),  Expect(2) = 2e-85, Method: Compositional matrix adjust.
 Identities = 76/77 (99%), Positives = 77/77 (100%), Gaps = 0/77 (0%)
 Frame = +3

Query  93   MGKEKVHISIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  272
            MGKEK+HISIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKIHISIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  273  DKLKAERERGITIDIAL  323
            DKLKAERERGITIDIAL
Sbjct  61   DKLKAERERGITIDIAL  77



>ref|XP_004138964.1| PREDICTED: elongation factor 1-alpha-like [Cucumis sativus]
 ref|XP_004162426.1| PREDICTED: elongation factor 1-alpha-like [Cucumis sativus]
Length=447

 Score =   188 bits (477),  Expect(2) = 2e-85, Method: Compositional matrix adjust.
 Identities = 86/89 (97%), Positives = 88/89 (99%), Gaps = 0/89 (0%)
 Frame = +1

Query  316  LPLWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTR  495
            + LWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTR
Sbjct  75   IALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTR  134

Query  496  EHALLAFTLGVKQMICCCNKIDATTPKYS  582
            EHALLAFTLGVKQMICCCNK+DATTPKYS
Sbjct  135  EHALLAFTLGVKQMICCCNKMDATTPKYS  163


 Score =   155 bits (391),  Expect(2) = 2e-85, Method: Compositional matrix adjust.
 Identities = 75/77 (97%), Positives = 76/77 (99%), Gaps = 0/77 (0%)
 Frame = +3

Query  93   MGKEKVHISIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  272
            MGKEK HI+IVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKTHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  273  DKLKAERERGITIDIAL  323
            DKLKAERERGITIDIAL
Sbjct  61   DKLKAERERGITIDIAL  77



>ref|XP_009617039.1| PREDICTED: elongation factor 1-alpha [Nicotiana tomentosiformis]
Length=447

 Score =   187 bits (474),  Expect(2) = 2e-85, Method: Compositional matrix adjust.
 Identities = 85/89 (96%), Positives = 88/89 (99%), Gaps = 0/89 (0%)
 Frame = +1

Query  316  LPLWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTR  495
            + LWKFETT+YYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTR
Sbjct  75   IALWKFETTRYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTR  134

Query  496  EHALLAFTLGVKQMICCCNKIDATTPKYS  582
            EHALLAFTLGVKQMICCCNK+DATTPKYS
Sbjct  135  EHALLAFTLGVKQMICCCNKMDATTPKYS  163


 Score =   156 bits (394),  Expect(2) = 2e-85, Method: Compositional matrix adjust.
 Identities = 76/77 (99%), Positives = 77/77 (100%), Gaps = 0/77 (0%)
 Frame = +3

Query  93   MGKEKVHISIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  272
            MGKEKVHI+IVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  273  DKLKAERERGITIDIAL  323
            DKLKAERERGITIDIAL
Sbjct  61   DKLKAERERGITIDIAL  77



>ref|XP_007143679.1| hypothetical protein PHAVU_007G092500g [Phaseolus vulgaris]
 gb|ESW15673.1| hypothetical protein PHAVU_007G092500g [Phaseolus vulgaris]
Length=448

 Score =   185 bits (470),  Expect(2) = 2e-85, Method: Compositional matrix adjust.
 Identities = 84/89 (94%), Positives = 87/89 (98%), Gaps = 0/89 (0%)
 Frame = +1

Query  316  LPLWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTR  495
            + LWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTR
Sbjct  75   IALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTR  134

Query  496  EHALLAFTLGVKQMICCCNKIDATTPKYS  582
            EHALLAFTLGV+QMICCCNK+DATTP YS
Sbjct  135  EHALLAFTLGVRQMICCCNKMDATTPNYS  163


 Score =   157 bits (398),  Expect(2) = 2e-85, Method: Compositional matrix adjust.
 Identities = 77/77 (100%), Positives = 77/77 (100%), Gaps = 0/77 (0%)
 Frame = +3

Query  93   MGKEKVHISIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  272
            MGKEKVHISIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKVHISIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  273  DKLKAERERGITIDIAL  323
            DKLKAERERGITIDIAL
Sbjct  61   DKLKAERERGITIDIAL  77



>ref|XP_010248287.1| PREDICTED: elongation factor 1-alpha, partial [Nelumbo nucifera]
Length=382

 Score =   187 bits (475),  Expect(2) = 2e-85, Method: Compositional matrix adjust.
 Identities = 86/89 (97%), Positives = 88/89 (99%), Gaps = 0/89 (0%)
 Frame = +1

Query  316  LPLWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTR  495
            + LWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTR
Sbjct  75   IALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTR  134

Query  496  EHALLAFTLGVKQMICCCNKIDATTPKYS  582
            EHALLAFTLGVKQMICCCNK+DATTPKYS
Sbjct  135  EHALLAFTLGVKQMICCCNKMDATTPKYS  163


 Score =   155 bits (393),  Expect(2) = 2e-85, Method: Compositional matrix adjust.
 Identities = 76/77 (99%), Positives = 77/77 (100%), Gaps = 0/77 (0%)
 Frame = +3

Query  93   MGKEKVHISIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  272
            MGKEKVHI+IVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  273  DKLKAERERGITIDIAL  323
            DKLKAERERGITIDIAL
Sbjct  61   DKLKAERERGITIDIAL  77



>ref|XP_010937512.1| PREDICTED: elongation factor 1-alpha [Elaeis guineensis]
Length=447

 Score =   187 bits (474),  Expect(2) = 2e-85, Method: Compositional matrix adjust.
 Identities = 85/89 (96%), Positives = 88/89 (99%), Gaps = 0/89 (0%)
 Frame = +1

Query  316  LPLWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTR  495
            + LWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTR
Sbjct  75   IALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTR  134

Query  496  EHALLAFTLGVKQMICCCNKIDATTPKYS  582
            EHALLAFTLGV+QMICCCNK+DATTPKYS
Sbjct  135  EHALLAFTLGVRQMICCCNKMDATTPKYS  163


 Score =   155 bits (393),  Expect(2) = 2e-85, Method: Compositional matrix adjust.
 Identities = 76/77 (99%), Positives = 77/77 (100%), Gaps = 0/77 (0%)
 Frame = +3

Query  93   MGKEKVHISIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  272
            MGKEKVHI+IVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  273  DKLKAERERGITIDIAL  323
            DKLKAERERGITIDIAL
Sbjct  61   DKLKAERERGITIDIAL  77



>ref|XP_006381487.1| hypothetical protein POPTR_0006s13310g [Populus trichocarpa]
 gb|ABK95720.1| unknown [Populus trichocarpa]
 gb|ERP59284.1| hypothetical protein POPTR_0006s13310g [Populus trichocarpa]
Length=447

 Score =   186 bits (473),  Expect(2) = 2e-85, Method: Compositional matrix adjust.
 Identities = 85/89 (96%), Positives = 88/89 (99%), Gaps = 0/89 (0%)
 Frame = +1

Query  316  LPLWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTR  495
            + LWKFETT+YYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTR
Sbjct  75   IALWKFETTRYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTR  134

Query  496  EHALLAFTLGVKQMICCCNKIDATTPKYS  582
            EHALLAFTLGVKQMICCCNK+DATTPKYS
Sbjct  135  EHALLAFTLGVKQMICCCNKMDATTPKYS  163


 Score =   156 bits (394),  Expect(2) = 2e-85, Method: Compositional matrix adjust.
 Identities = 76/77 (99%), Positives = 77/77 (100%), Gaps = 0/77 (0%)
 Frame = +3

Query  93   MGKEKVHISIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  272
            MGKEKVHI+IVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  273  DKLKAERERGITIDIAL  323
            DKLKAERERGITIDIAL
Sbjct  61   DKLKAERERGITIDIAL  77



>gb|AGV54654.1| elongation factor 1-alpha [Phaseolus vulgaris]
Length=447

 Score =   185 bits (470),  Expect(2) = 2e-85, Method: Compositional matrix adjust.
 Identities = 85/87 (98%), Positives = 87/87 (100%), Gaps = 0/87 (0%)
 Frame = +1

Query  322  LWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTREH  501
            LWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTREH
Sbjct  77   LWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTREH  136

Query  502  ALLAFTLGVKQMICCCNKIDATTPKYS  582
            ALL+FTLGVKQMICCCNK+DATTPKYS
Sbjct  137  ALLSFTLGVKQMICCCNKMDATTPKYS  163


 Score =   157 bits (397),  Expect(2) = 2e-85, Method: Compositional matrix adjust.
 Identities = 77/77 (100%), Positives = 77/77 (100%), Gaps = 0/77 (0%)
 Frame = +3

Query  93   MGKEKVHISIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  272
            MGKEKVHISIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKVHISIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  273  DKLKAERERGITIDIAL  323
            DKLKAERERGITIDIAL
Sbjct  61   DKLKAERERGITIDIAL  77



>gb|ABA12218.1| translation elongation factor 1A-2 [Gossypium hirsutum]
 gb|KHG05237.1| Elongation factor 1-alpha [Gossypium arboreum]
 gb|KJB14364.1| hypothetical protein B456_002G121500 [Gossypium raimondii]
Length=447

 Score =   188 bits (477),  Expect(2) = 2e-85, Method: Compositional matrix adjust.
 Identities = 86/89 (97%), Positives = 88/89 (99%), Gaps = 0/89 (0%)
 Frame = +1

Query  316  LPLWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTR  495
            + LWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTR
Sbjct  75   IALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTR  134

Query  496  EHALLAFTLGVKQMICCCNKIDATTPKYS  582
            EHALLAFTLGVKQMICCCNK+DATTPKYS
Sbjct  135  EHALLAFTLGVKQMICCCNKMDATTPKYS  163


 Score =   154 bits (390),  Expect(2) = 2e-85, Method: Compositional matrix adjust.
 Identities = 75/77 (97%), Positives = 76/77 (99%), Gaps = 0/77 (0%)
 Frame = +3

Query  93   MGKEKVHISIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  272
            MGKEK HI+IVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKTHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  273  DKLKAERERGITIDIAL  323
            DKLKAERERGITIDIAL
Sbjct  61   DKLKAERERGITIDIAL  77



>ref|XP_006424629.1| hypothetical protein CICLE_v10028446mg [Citrus clementina]
 ref|XP_006424632.1| hypothetical protein CICLE_v10028445mg [Citrus clementina]
 ref|XP_006488147.1| PREDICTED: elongation factor 1-alpha isoform X1 [Citrus sinensis]
 ref|XP_006488148.1| PREDICTED: elongation factor 1-alpha-like [Citrus sinensis]
 gb|ESR37869.1| hypothetical protein CICLE_v10028446mg [Citrus clementina]
 gb|ESR37872.1| hypothetical protein CICLE_v10028445mg [Citrus clementina]
Length=447

 Score =   188 bits (477),  Expect(2) = 2e-85, Method: Compositional matrix adjust.
 Identities = 86/89 (97%), Positives = 88/89 (99%), Gaps = 0/89 (0%)
 Frame = +1

Query  316  LPLWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTR  495
            + LWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTR
Sbjct  75   IALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTR  134

Query  496  EHALLAFTLGVKQMICCCNKIDATTPKYS  582
            EHALLAFTLGVKQMICCCNK+DATTPKYS
Sbjct  135  EHALLAFTLGVKQMICCCNKMDATTPKYS  163


 Score =   154 bits (390),  Expect(2) = 2e-85, Method: Compositional matrix adjust.
 Identities = 75/77 (97%), Positives = 76/77 (99%), Gaps = 0/77 (0%)
 Frame = +3

Query  93   MGKEKVHISIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  272
            MGKEK HI+IVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKTHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  273  DKLKAERERGITIDIAL  323
            DKLKAERERGITIDIAL
Sbjct  61   DKLKAERERGITIDIAL  77



>gb|AIZ68131.1| translation elongation factor 1-alpha [Ornithogalum saundersiae]
Length=447

 Score =   188 bits (477),  Expect(2) = 2e-85, Method: Compositional matrix adjust.
 Identities = 86/89 (97%), Positives = 88/89 (99%), Gaps = 0/89 (0%)
 Frame = +1

Query  316  LPLWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTR  495
            + LWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTR
Sbjct  75   IALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTR  134

Query  496  EHALLAFTLGVKQMICCCNKIDATTPKYS  582
            EHALLAFTLGVKQMICCCNK+DATTPKYS
Sbjct  135  EHALLAFTLGVKQMICCCNKMDATTPKYS  163


 Score =   154 bits (390),  Expect(2) = 2e-85, Method: Compositional matrix adjust.
 Identities = 75/77 (97%), Positives = 76/77 (99%), Gaps = 0/77 (0%)
 Frame = +3

Query  93   MGKEKVHISIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  272
            MGKEK HI+IVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKTHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  273  DKLKAERERGITIDIAL  323
            DKLKAERERGITIDIAL
Sbjct  61   DKLKAERERGITIDIAL  77



>ref|XP_006424633.1| hypothetical protein CICLE_v10028443mg [Citrus clementina]
 ref|XP_006488149.1| PREDICTED: elongation factor 1-alpha-like [Citrus sinensis]
 gb|ESR37873.1| hypothetical protein CICLE_v10028443mg [Citrus clementina]
Length=447

 Score =   188 bits (477),  Expect(2) = 2e-85, Method: Compositional matrix adjust.
 Identities = 86/89 (97%), Positives = 88/89 (99%), Gaps = 0/89 (0%)
 Frame = +1

Query  316  LPLWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTR  495
            + LWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTR
Sbjct  75   IALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTR  134

Query  496  EHALLAFTLGVKQMICCCNKIDATTPKYS  582
            EHALLAFTLGVKQMICCCNK+DATTPKYS
Sbjct  135  EHALLAFTLGVKQMICCCNKMDATTPKYS  163


 Score =   154 bits (390),  Expect(2) = 2e-85, Method: Compositional matrix adjust.
 Identities = 75/77 (97%), Positives = 76/77 (99%), Gaps = 0/77 (0%)
 Frame = +3

Query  93   MGKEKVHISIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  272
            MGKEK HI+IVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKTHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  273  DKLKAERERGITIDIAL  323
            DKLKAERERGITIDIAL
Sbjct  61   DKLKAERERGITIDIAL  77



>ref|XP_009342341.1| PREDICTED: elongation factor 1-alpha [Pyrus x bretschneideri]
Length=447

 Score =   186 bits (473),  Expect(2) = 2e-85, Method: Compositional matrix adjust.
 Identities = 85/89 (96%), Positives = 88/89 (99%), Gaps = 0/89 (0%)
 Frame = +1

Query  316  LPLWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTR  495
            + LWKFETT+YYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTR
Sbjct  75   IALWKFETTRYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTR  134

Query  496  EHALLAFTLGVKQMICCCNKIDATTPKYS  582
            EHALLAFTLGVKQMICCCNK+DATTPKYS
Sbjct  135  EHALLAFTLGVKQMICCCNKMDATTPKYS  163


 Score =   156 bits (394),  Expect(2) = 2e-85, Method: Compositional matrix adjust.
 Identities = 76/77 (99%), Positives = 77/77 (100%), Gaps = 0/77 (0%)
 Frame = +3

Query  93   MGKEKVHISIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  272
            MGKEKVHI+IVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  273  DKLKAERERGITIDIAL  323
            DKLKAERERGITIDIAL
Sbjct  61   DKLKAERERGITIDIAL  77



>ref|NP_001049145.1| Os03g0177400 [Oryza sativa Japonica Group]
 ref|NP_001049146.1| Os03g0177500 [Oryza sativa Japonica Group]
 ref|NP_001049147.1| Os03g0177900 [Oryza sativa Japonica Group]
 ref|NP_001049148.1| Os03g0178000 [Oryza sativa Japonica Group]
 ref|XP_006649493.1| PREDICTED: elongation factor 1-alpha-like [Oryza brachyantha]
 ref|XP_006649494.1| PREDICTED: elongation factor 1-alpha-like [Oryza brachyantha]
 sp|O64937.2|EF1A_ORYSJ RecName: Full=Elongation factor 1-alpha; Short=EF-1-alpha [Oryza 
sativa Japonica Group]
 dbj|BAA23657.1| EF-1 alpha [Oryza sativa]
 dbj|BAA23659.1| EF-1 alpha [Oryza sativa]
 dbj|BAA23660.1| EF-1 alpha [Oryza sativa]
 gb|ABF94269.1| Elongation factor 1-alpha, putative [Oryza sativa Japonica Group]
 gb|ABF94270.1| Elongation factor 1-alpha, putative, expressed [Oryza sativa 
Japonica Group]
 gb|ABF94273.1| Elongation factor 1-alpha, putative, expressed [Oryza sativa 
Japonica Group]
 gb|ABF94274.1| Elongation factor 1-alpha, putative, expressed [Oryza sativa 
Japonica Group]
 dbj|BAF11059.1| Os03g0177400 [Oryza sativa Japonica Group]
 dbj|BAF11060.1| Os03g0177500 [Oryza sativa Japonica Group]
 dbj|BAF11061.1| Os03g0177900 [Oryza sativa Japonica Group]
 dbj|BAF11062.1| Os03g0178000 [Oryza sativa Japonica Group]
 gb|EAZ25788.1| hypothetical protein OsJ_09631 [Oryza sativa Japonica Group]
 gb|EAZ25791.1| hypothetical protein OsJ_09634 [Oryza sativa Japonica Group]
 gb|EAZ25792.1| hypothetical protein OsJ_09635 [Oryza sativa Japonica Group]
 dbj|BAG87945.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG93078.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG97075.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEC74621.1| hypothetical protein OsI_10237 [Oryza sativa Indica Group]
 gb|EEC74622.1| hypothetical protein OsI_10241 [Oryza sativa Indica Group]
 gb|EEC74623.1| hypothetical protein OsI_10242 [Oryza sativa Indica Group]
 gb|ADM86871.1| elongation factor-1 alpha [Oryza sativa Japonica Group]
 gb|ADM86885.1| elongation factor-1 alpha [Oryza sativa Japonica Group]
 gb|ADM86886.1| elongation factor-1 alpha [Oryza sativa Japonica Group]
 gb|ADM86887.1| elongation factor-1 alpha [Oryza sativa Japonica Group]
Length=447

 Score =   188 bits (477),  Expect(2) = 2e-85, Method: Compositional matrix adjust.
 Identities = 86/89 (97%), Positives = 88/89 (99%), Gaps = 0/89 (0%)
 Frame = +1

Query  316  LPLWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTR  495
            + LWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTR
Sbjct  75   IALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTR  134

Query  496  EHALLAFTLGVKQMICCCNKIDATTPKYS  582
            EHALLAFTLGVKQMICCCNK+DATTPKYS
Sbjct  135  EHALLAFTLGVKQMICCCNKMDATTPKYS  163


 Score =   154 bits (390),  Expect(2) = 2e-85, Method: Compositional matrix adjust.
 Identities = 75/77 (97%), Positives = 76/77 (99%), Gaps = 0/77 (0%)
 Frame = +3

Query  93   MGKEKVHISIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  272
            MGKEK HI+IVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKTHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  273  DKLKAERERGITIDIAL  323
            DKLKAERERGITIDIAL
Sbjct  61   DKLKAERERGITIDIAL  77



>gb|KDP29086.1| hypothetical protein JCGZ_16475 [Jatropha curcas]
Length=447

 Score =   187 bits (476),  Expect(2) = 2e-85, Method: Compositional matrix adjust.
 Identities = 86/89 (97%), Positives = 88/89 (99%), Gaps = 0/89 (0%)
 Frame = +1

Query  316  LPLWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTR  495
            + LWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTR
Sbjct  75   IALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTR  134

Query  496  EHALLAFTLGVKQMICCCNKIDATTPKYS  582
            EHALLAFTLGVKQMICCCNK+DATTPKYS
Sbjct  135  EHALLAFTLGVKQMICCCNKMDATTPKYS  163


 Score =   155 bits (391),  Expect(2) = 2e-85, Method: Compositional matrix adjust.
 Identities = 76/77 (99%), Positives = 76/77 (99%), Gaps = 0/77 (0%)
 Frame = +3

Query  93   MGKEKVHISIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  272
            MGKEKVHI IVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKVHIHIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  273  DKLKAERERGITIDIAL  323
            DKLKAERERGITIDIAL
Sbjct  61   DKLKAERERGITIDIAL  77



>gb|KHN14872.1| Elongation factor 1-alpha [Glycine soja]
Length=447

 Score =   188 bits (477),  Expect(2) = 2e-85, Method: Compositional matrix adjust.
 Identities = 86/89 (97%), Positives = 88/89 (99%), Gaps = 0/89 (0%)
 Frame = +1

Query  316  LPLWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTR  495
            + LWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTR
Sbjct  75   IALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTR  134

Query  496  EHALLAFTLGVKQMICCCNKIDATTPKYS  582
            EHALLAFTLGVKQMICCCNK+DATTPKYS
Sbjct  135  EHALLAFTLGVKQMICCCNKMDATTPKYS  163


 Score =   154 bits (390),  Expect(2) = 2e-85, Method: Compositional matrix adjust.
 Identities = 75/77 (97%), Positives = 76/77 (99%), Gaps = 0/77 (0%)
 Frame = +3

Query  93   MGKEKVHISIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  272
            MGKEK HI+IVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKTHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  273  DKLKAERERGITIDIAL  323
            DKLKAERERGITIDIAL
Sbjct  61   DKLKAERERGITIDIAL  77



>gb|AGH32502.1| translation elongation factor-1 alpha [Stylosanthes guianensis]
Length=447

 Score =   188 bits (477),  Expect(2) = 2e-85, Method: Compositional matrix adjust.
 Identities = 86/89 (97%), Positives = 88/89 (99%), Gaps = 0/89 (0%)
 Frame = +1

Query  316  LPLWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTR  495
            + LWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTR
Sbjct  75   IALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTR  134

Query  496  EHALLAFTLGVKQMICCCNKIDATTPKYS  582
            EHALLAFTLGVKQMICCCNK+DATTPKYS
Sbjct  135  EHALLAFTLGVKQMICCCNKMDATTPKYS  163


 Score =   154 bits (390),  Expect(2) = 2e-85, Method: Compositional matrix adjust.
 Identities = 75/77 (97%), Positives = 76/77 (99%), Gaps = 0/77 (0%)
 Frame = +3

Query  93   MGKEKVHISIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  272
            MGKEK HI+IVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKTHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  273  DKLKAERERGITIDIAL  323
            DKLKAERERGITIDIAL
Sbjct  61   DKLKAERERGITIDIAL  77



>gb|AAD27590.1|AF121261_1 elongation factor 1-alpha 1 [Lilium longiflorum]
Length=447

 Score =   187 bits (474),  Expect(2) = 2e-85, Method: Compositional matrix adjust.
 Identities = 85/89 (96%), Positives = 88/89 (99%), Gaps = 0/89 (0%)
 Frame = +1

Query  316  LPLWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTR  495
            + LWKFETT+YYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTR
Sbjct  75   IALWKFETTRYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTR  134

Query  496  EHALLAFTLGVKQMICCCNKIDATTPKYS  582
            EHALLAFTLGVKQMICCCNK+DATTPKYS
Sbjct  135  EHALLAFTLGVKQMICCCNKMDATTPKYS  163


 Score =   155 bits (393),  Expect(2) = 2e-85, Method: Compositional matrix adjust.
 Identities = 76/77 (99%), Positives = 77/77 (100%), Gaps = 0/77 (0%)
 Frame = +3

Query  93   MGKEKVHISIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  272
            MGKEKVHI+IVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  273  DKLKAERERGITIDIAL  323
            DKLKAERERGITIDIAL
Sbjct  61   DKLKAERERGITIDIAL  77



>gb|AAC15413.1| translation elongation factor-1 alpha [Oryza sativa Japonica 
Group]
Length=447

 Score =   188 bits (477),  Expect(2) = 2e-85, Method: Compositional matrix adjust.
 Identities = 86/89 (97%), Positives = 88/89 (99%), Gaps = 0/89 (0%)
 Frame = +1

Query  316  LPLWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTR  495
            + LWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTR
Sbjct  75   IALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTR  134

Query  496  EHALLAFTLGVKQMICCCNKIDATTPKYS  582
            EHALLAFTLGVKQMICCCNK+DATTPKYS
Sbjct  135  EHALLAFTLGVKQMICCCNKMDATTPKYS  163


 Score =   154 bits (390),  Expect(2) = 2e-85, Method: Compositional matrix adjust.
 Identities = 75/77 (97%), Positives = 76/77 (99%), Gaps = 0/77 (0%)
 Frame = +3

Query  93   MGKEKVHISIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  272
            MGKEK HI+IVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKTHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  273  DKLKAERERGITIDIAL  323
            DKLKAERERGITIDIAL
Sbjct  61   DKLKAERERGITIDIAL  77



>gb|EEE58429.1| hypothetical protein OsJ_09630 [Oryza sativa Japonica Group]
Length=427

 Score =   188 bits (477),  Expect(2) = 2e-85, Method: Compositional matrix adjust.
 Identities = 86/89 (97%), Positives = 88/89 (99%), Gaps = 0/89 (0%)
 Frame = +1

Query  316  LPLWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTR  495
            + LWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTR
Sbjct  75   IALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTR  134

Query  496  EHALLAFTLGVKQMICCCNKIDATTPKYS  582
            EHALLAFTLGVKQMICCCNK+DATTPKYS
Sbjct  135  EHALLAFTLGVKQMICCCNKMDATTPKYS  163


 Score =   154 bits (390),  Expect(2) = 2e-85, Method: Compositional matrix adjust.
 Identities = 75/77 (97%), Positives = 76/77 (99%), Gaps = 0/77 (0%)
 Frame = +3

Query  93   MGKEKVHISIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  272
            MGKEK HI+IVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKTHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  273  DKLKAERERGITIDIAL  323
            DKLKAERERGITIDIAL
Sbjct  61   DKLKAERERGITIDIAL  77



>ref|XP_002279598.1| PREDICTED: elongation factor 1-alpha [Vitis vinifera]
 emb|CAN66350.1| hypothetical protein VITISV_044270 [Vitis vinifera]
Length=447

 Score =   187 bits (474),  Expect(2) = 2e-85, Method: Compositional matrix adjust.
 Identities = 85/89 (96%), Positives = 88/89 (99%), Gaps = 0/89 (0%)
 Frame = +1

Query  316  LPLWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTR  495
            + LWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTR
Sbjct  75   IALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTR  134

Query  496  EHALLAFTLGVKQMICCCNKIDATTPKYS  582
            EHALLAFTLGV+QMICCCNK+DATTPKYS
Sbjct  135  EHALLAFTLGVRQMICCCNKMDATTPKYS  163


 Score =   155 bits (393),  Expect(2) = 2e-85, Method: Compositional matrix adjust.
 Identities = 76/77 (99%), Positives = 77/77 (100%), Gaps = 0/77 (0%)
 Frame = +3

Query  93   MGKEKVHISIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  272
            MGKEKVHI+IVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  273  DKLKAERERGITIDIAL  323
            DKLKAERERGITIDIAL
Sbjct  61   DKLKAERERGITIDIAL  77



>ref|XP_008463920.1| PREDICTED: elongation factor 1-alpha [Cucumis melo]
Length=448

 Score =   188 bits (477),  Expect(2) = 2e-85, Method: Compositional matrix adjust.
 Identities = 86/89 (97%), Positives = 88/89 (99%), Gaps = 0/89 (0%)
 Frame = +1

Query  316  LPLWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTR  495
            + LWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTR
Sbjct  75   IALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTR  134

Query  496  EHALLAFTLGVKQMICCCNKIDATTPKYS  582
            EHALLAFTLGVKQMICCCNK+DATTPKYS
Sbjct  135  EHALLAFTLGVKQMICCCNKMDATTPKYS  163


 Score =   154 bits (390),  Expect(2) = 2e-85, Method: Compositional matrix adjust.
 Identities = 75/77 (97%), Positives = 76/77 (99%), Gaps = 0/77 (0%)
 Frame = +3

Query  93   MGKEKVHISIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  272
            MGKEK HI+IVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKAHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  273  DKLKAERERGITIDIAL  323
            DKLKAERERGITIDIAL
Sbjct  61   DKLKAERERGITIDIAL  77



>ref|XP_006646939.1| PREDICTED: elongation factor 1-alpha-like [Oryza brachyantha]
Length=447

 Score =   188 bits (477),  Expect(2) = 2e-85, Method: Compositional matrix adjust.
 Identities = 86/89 (97%), Positives = 88/89 (99%), Gaps = 0/89 (0%)
 Frame = +1

Query  316  LPLWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTR  495
            + LWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTR
Sbjct  75   IALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTR  134

Query  496  EHALLAFTLGVKQMICCCNKIDATTPKYS  582
            EHALLAFTLGVKQMICCCNK+DATTPKYS
Sbjct  135  EHALLAFTLGVKQMICCCNKMDATTPKYS  163


 Score =   154 bits (390),  Expect(2) = 2e-85, Method: Compositional matrix adjust.
 Identities = 75/77 (97%), Positives = 76/77 (99%), Gaps = 0/77 (0%)
 Frame = +3

Query  93   MGKEKVHISIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  272
            MGKEK HI+IVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKTHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  273  DKLKAERERGITIDIAL  323
            DKLKAERERGITIDIAL
Sbjct  61   DKLKAERERGITIDIAL  77



>ref|XP_002460859.1| hypothetical protein SORBIDRAFT_02g036420 [Sorghum bicolor]
 gb|EER97380.1| hypothetical protein SORBIDRAFT_02g036420 [Sorghum bicolor]
Length=447

 Score =   186 bits (473),  Expect(2) = 2e-85, Method: Compositional matrix adjust.
 Identities = 85/89 (96%), Positives = 88/89 (99%), Gaps = 0/89 (0%)
 Frame = +1

Query  316  LPLWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTR  495
            + LWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTR
Sbjct  75   IALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTR  134

Query  496  EHALLAFTLGVKQMICCCNKIDATTPKYS  582
            EHALLAFTLGV+QMICCCNK+DATTPKYS
Sbjct  135  EHALLAFTLGVRQMICCCNKMDATTPKYS  163


 Score =   156 bits (394),  Expect(2) = 2e-85, Method: Compositional matrix adjust.
 Identities = 76/77 (99%), Positives = 77/77 (100%), Gaps = 0/77 (0%)
 Frame = +3

Query  93   MGKEKVHISIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  272
            MGKEKVHI+IVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  273  DKLKAERERGITIDIAL  323
            DKLKAERERGITIDIAL
Sbjct  61   DKLKAERERGITIDIAL  77



>gb|ADI24333.1| elongation factor 1-alpha [Miscanthus sinensis]
Length=447

 Score =   188 bits (477),  Expect(2) = 2e-85, Method: Compositional matrix adjust.
 Identities = 86/89 (97%), Positives = 88/89 (99%), Gaps = 0/89 (0%)
 Frame = +1

Query  316  LPLWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTR  495
            + LWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTR
Sbjct  75   IALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTR  134

Query  496  EHALLAFTLGVKQMICCCNKIDATTPKYS  582
            EHALLAFTLGVKQMICCCNK+DATTPKYS
Sbjct  135  EHALLAFTLGVKQMICCCNKMDATTPKYS  163


 Score =   154 bits (390),  Expect(2) = 2e-85, Method: Compositional matrix adjust.
 Identities = 75/77 (97%), Positives = 76/77 (99%), Gaps = 0/77 (0%)
 Frame = +3

Query  93   MGKEKVHISIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  272
            MGKEK HI+IVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKTHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  273  DKLKAERERGITIDIAL  323
            DKLKAERERGITIDIAL
Sbjct  61   DKLKAERERGITIDIAL  77



>gb|KJB09231.1| hypothetical protein B456_001G130700 [Gossypium raimondii]
 gb|KJB09232.1| hypothetical protein B456_001G130700 [Gossypium raimondii]
Length=447

 Score =   188 bits (477),  Expect(2) = 2e-85, Method: Compositional matrix adjust.
 Identities = 86/89 (97%), Positives = 88/89 (99%), Gaps = 0/89 (0%)
 Frame = +1

Query  316  LPLWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTR  495
            + LWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTR
Sbjct  75   IALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTR  134

Query  496  EHALLAFTLGVKQMICCCNKIDATTPKYS  582
            EHALLAFTLGVKQMICCCNK+DATTPKYS
Sbjct  135  EHALLAFTLGVKQMICCCNKMDATTPKYS  163


 Score =   154 bits (390),  Expect(2) = 2e-85, Method: Compositional matrix adjust.
 Identities = 75/77 (97%), Positives = 76/77 (99%), Gaps = 0/77 (0%)
 Frame = +3

Query  93   MGKEKVHISIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  272
            MGKEK HI+IVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKTHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  273  DKLKAERERGITIDIAL  323
            DKLKAERERGITIDIAL
Sbjct  61   DKLKAERERGITIDIAL  77



>ref|NP_001151074.1| elongation factor 1-alpha [Zea mays]
 gb|ACG41520.1| elongation factor 1-alpha [Zea mays]
 tpg|DAA63136.1| TPA: putative translation elongation factor Tu family protein 
[Zea mays]
Length=447

 Score =   186 bits (473),  Expect(2) = 2e-85, Method: Compositional matrix adjust.
 Identities = 85/89 (96%), Positives = 88/89 (99%), Gaps = 0/89 (0%)
 Frame = +1

Query  316  LPLWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTR  495
            + LWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTR
Sbjct  75   IALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTR  134

Query  496  EHALLAFTLGVKQMICCCNKIDATTPKYS  582
            EHALLAFTLGV+QMICCCNK+DATTPKYS
Sbjct  135  EHALLAFTLGVRQMICCCNKMDATTPKYS  163


 Score =   156 bits (394),  Expect(2) = 2e-85, Method: Compositional matrix adjust.
 Identities = 76/77 (99%), Positives = 77/77 (100%), Gaps = 0/77 (0%)
 Frame = +3

Query  93   MGKEKVHISIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  272
            MGKEKVHI+IVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  273  DKLKAERERGITIDIAL  323
            DKLKAERERGITIDIAL
Sbjct  61   DKLKAERERGITIDIAL  77



>ref|NP_001105587.1| elongation factor 1-alpha [Zea mays]
 gb|AAB64207.1| elongation factor 1-alpha [Zea mays]
 gb|ACG32939.1| elongation factor 1-alpha [Zea mays]
 gb|AFW87114.1| LOW QUALITY PROTEIN: putative translation elongation factor Tu 
family protein [Zea mays]
Length=447

 Score =   188 bits (477),  Expect(2) = 2e-85, Method: Compositional matrix adjust.
 Identities = 86/89 (97%), Positives = 88/89 (99%), Gaps = 0/89 (0%)
 Frame = +1

Query  316  LPLWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTR  495
            + LWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTR
Sbjct  75   IALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTR  134

Query  496  EHALLAFTLGVKQMICCCNKIDATTPKYS  582
            EHALLAFTLGVKQMICCCNK+DATTPKYS
Sbjct  135  EHALLAFTLGVKQMICCCNKMDATTPKYS  163


 Score =   154 bits (390),  Expect(2) = 2e-85, Method: Compositional matrix adjust.
 Identities = 75/77 (97%), Positives = 76/77 (99%), Gaps = 0/77 (0%)
 Frame = +3

Query  93   MGKEKVHISIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  272
            MGKEK HI+IVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKTHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  273  DKLKAERERGITIDIAL  323
            DKLKAERERGITIDIAL
Sbjct  61   DKLKAERERGITIDIAL  77



>dbj|BAO57272.1| elongation factor 1-alpha [Ipomoea nil]
Length=447

 Score =   188 bits (477),  Expect(2) = 2e-85, Method: Compositional matrix adjust.
 Identities = 86/89 (97%), Positives = 88/89 (99%), Gaps = 0/89 (0%)
 Frame = +1

Query  316  LPLWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTR  495
            + LWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTR
Sbjct  75   IALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTR  134

Query  496  EHALLAFTLGVKQMICCCNKIDATTPKYS  582
            EHALLAFTLGVKQMICCCNK+DATTPKYS
Sbjct  135  EHALLAFTLGVKQMICCCNKMDATTPKYS  163


 Score =   154 bits (390),  Expect(2) = 2e-85, Method: Compositional matrix adjust.
 Identities = 75/77 (97%), Positives = 76/77 (99%), Gaps = 0/77 (0%)
 Frame = +3

Query  93   MGKEKVHISIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  272
            MGKEK HI+IVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKTHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  273  DKLKAERERGITIDIAL  323
            DKLKAERERGITIDIAL
Sbjct  61   DKLKAERERGITIDIAL  77



>gb|AHZ58493.1| translation elongation factor alpha [Syntrichia caninervis]
Length=447

 Score =   186 bits (473),  Expect(2) = 2e-85, Method: Compositional matrix adjust.
 Identities = 85/89 (96%), Positives = 88/89 (99%), Gaps = 0/89 (0%)
 Frame = +1

Query  316  LPLWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTR  495
            + LWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTR
Sbjct  75   IALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTR  134

Query  496  EHALLAFTLGVKQMICCCNKIDATTPKYS  582
            EHALLAFTLGV+QMICCCNK+DATTPKYS
Sbjct  135  EHALLAFTLGVRQMICCCNKMDATTPKYS  163


 Score =   156 bits (394),  Expect(2) = 2e-85, Method: Compositional matrix adjust.
 Identities = 76/77 (99%), Positives = 77/77 (100%), Gaps = 0/77 (0%)
 Frame = +3

Query  93   MGKEKVHISIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  272
            MGKEKVHI+IVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  273  DKLKAERERGITIDIAL  323
            DKLKAERERGITIDIAL
Sbjct  61   DKLKAERERGITIDIAL  77



>ref|XP_003553292.1| PREDICTED: elongation factor 1-alpha isoform 1 [Glycine max]
Length=447

 Score =   187 bits (476),  Expect(2) = 2e-85, Method: Compositional matrix adjust.
 Identities = 86/89 (97%), Positives = 88/89 (99%), Gaps = 0/89 (0%)
 Frame = +1

Query  316  LPLWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTR  495
            + LWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTR
Sbjct  75   IALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTR  134

Query  496  EHALLAFTLGVKQMICCCNKIDATTPKYS  582
            EHALLAFTLGVKQMICCCNK+DATTPKYS
Sbjct  135  EHALLAFTLGVKQMICCCNKMDATTPKYS  163


 Score =   154 bits (390),  Expect(2) = 2e-85, Method: Compositional matrix adjust.
 Identities = 75/77 (97%), Positives = 76/77 (99%), Gaps = 0/77 (0%)
 Frame = +3

Query  93   MGKEKVHISIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  272
            MGKEK HI+IVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKTHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  273  DKLKAERERGITIDIAL  323
            DKLKAERERGITIDIAL
Sbjct  61   DKLKAERERGITIDIAL  77



>ref|XP_003618775.1| Elongation factor 1-alpha [Medicago truncatula]
Length=987

 Score =   187 bits (474),  Expect(2) = 2e-85, Method: Compositional matrix adjust.
 Identities = 86/89 (97%), Positives = 88/89 (99%), Gaps = 0/89 (0%)
 Frame = +1

Query  316  LPLWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTR  495
            + LWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTR
Sbjct  75   IALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTR  134

Query  496  EHALLAFTLGVKQMICCCNKIDATTPKYS  582
            EHALLAFTLGVKQMICCCNK+DATTPKYS
Sbjct  135  EHALLAFTLGVKQMICCCNKMDATTPKYS  163


 Score =   187 bits (474),  Expect(2) = 2e-85, Method: Compositional matrix adjust.
 Identities = 86/89 (97%), Positives = 88/89 (99%), Gaps = 0/89 (0%)
 Frame = +1

Query  316  LPLWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTR  495
            + LWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTR
Sbjct  615  IALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTR  674

Query  496  EHALLAFTLGVKQMICCCNKIDATTPKYS  582
            EHALLAFTLGVKQMICCCNK+DATTPKYS
Sbjct  675  EHALLAFTLGVKQMICCCNKMDATTPKYS  703


 Score =   155 bits (392),  Expect(2) = 2e-85, Method: Compositional matrix adjust.
 Identities = 75/77 (97%), Positives = 77/77 (100%), Gaps = 0/77 (0%)
 Frame = +3

Query  93   MGKEKVHISIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  272
            MGKEK+HI+IVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKIHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  273  DKLKAERERGITIDIAL  323
            DKLKAERERGITIDIAL
Sbjct  61   DKLKAERERGITIDIAL  77


 Score =   155 bits (392),  Expect(2) = 2e-85, Method: Compositional matrix adjust.
 Identities = 75/77 (97%), Positives = 77/77 (100%), Gaps = 0/77 (0%)
 Frame = +3

Query  93   MGKEKVHISIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  272
            MGKEK+HI+IVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  541  MGKEKIHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  600

Query  273  DKLKAERERGITIDIAL  323
            DKLKAERERGITIDIAL
Sbjct  601  DKLKAERERGITIDIAL  617



>gb|EMS52529.1| Elongation factor 1-alpha [Triticum urartu]
 gb|EMS55225.1| Elongation factor 1-alpha [Triticum urartu]
Length=447

 Score =   188 bits (477),  Expect(2) = 2e-85, Method: Compositional matrix adjust.
 Identities = 86/89 (97%), Positives = 88/89 (99%), Gaps = 0/89 (0%)
 Frame = +1

Query  316  LPLWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTR  495
            + LWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTR
Sbjct  75   IALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTR  134

Query  496  EHALLAFTLGVKQMICCCNKIDATTPKYS  582
            EHALLAFTLGVKQMICCCNK+DATTPKYS
Sbjct  135  EHALLAFTLGVKQMICCCNKMDATTPKYS  163


 Score =   154 bits (390),  Expect(2) = 2e-85, Method: Compositional matrix adjust.
 Identities = 75/77 (97%), Positives = 76/77 (99%), Gaps = 0/77 (0%)
 Frame = +3

Query  93   MGKEKVHISIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  272
            MGKEK HI+IVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKTHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  273  DKLKAERERGITIDIAL  323
            DKLKAERERGITIDIAL
Sbjct  61   DKLKAERERGITIDIAL  77



>gb|AFP44110.1| elongation factor 1-alpha [Lycoris longituba]
Length=447

 Score =   188 bits (477),  Expect(2) = 2e-85, Method: Compositional matrix adjust.
 Identities = 86/89 (97%), Positives = 88/89 (99%), Gaps = 0/89 (0%)
 Frame = +1

Query  316  LPLWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTR  495
            + LWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTR
Sbjct  75   IALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTR  134

Query  496  EHALLAFTLGVKQMICCCNKIDATTPKYS  582
            EHALLAFTLGVKQMICCCNK+DATTPKYS
Sbjct  135  EHALLAFTLGVKQMICCCNKMDATTPKYS  163


 Score =   154 bits (389),  Expect(2) = 2e-85, Method: Compositional matrix adjust.
 Identities = 75/77 (97%), Positives = 76/77 (99%), Gaps = 0/77 (0%)
 Frame = +3

Query  93   MGKEKVHISIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  272
            MGKEK HI+IVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKFHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  273  DKLKAERERGITIDIAL  323
            DKLKAERERGITIDIAL
Sbjct  61   DKLKAERERGITIDIAL  77



>gb|AFC88830.1| putative elongation factor 1-alpha [Miscanthus sinensis]
Length=447

 Score =   188 bits (477),  Expect(2) = 2e-85, Method: Compositional matrix adjust.
 Identities = 86/89 (97%), Positives = 88/89 (99%), Gaps = 0/89 (0%)
 Frame = +1

Query  316  LPLWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTR  495
            + LWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTR
Sbjct  75   IALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTR  134

Query  496  EHALLAFTLGVKQMICCCNKIDATTPKYS  582
            EHALLAFTLGVKQMICCCNK+DATTPKYS
Sbjct  135  EHALLAFTLGVKQMICCCNKMDATTPKYS  163


 Score =   154 bits (390),  Expect(2) = 2e-85, Method: Compositional matrix adjust.
 Identities = 75/77 (97%), Positives = 76/77 (99%), Gaps = 0/77 (0%)
 Frame = +3

Query  93   MGKEKVHISIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  272
            MGKEK HI+IVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKTHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  273  DKLKAERERGITIDIAL  323
            DKLKAERERGITIDIAL
Sbjct  61   DKLKAERERGITIDIAL  77



>ref|NP_001105933.1| elongation factor alpha2 [Zea mays]
 gb|AAF42976.1| elongation factor 1 alpha [Zea mays]
Length=447

 Score =   188 bits (478),  Expect(2) = 2e-85, Method: Compositional matrix adjust.
 Identities = 86/89 (97%), Positives = 88/89 (99%), Gaps = 0/89 (0%)
 Frame = +1

Query  316  LPLWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTR  495
            + LWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTR
Sbjct  75   IALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTR  134

Query  496  EHALLAFTLGVKQMICCCNKIDATTPKYS  582
            EHALLAFTLGVKQMICCCNK+DATTPKYS
Sbjct  135  EHALLAFTLGVKQMICCCNKMDATTPKYS  163


 Score =   154 bits (389),  Expect(2) = 2e-85, Method: Compositional matrix adjust.
 Identities = 75/77 (97%), Positives = 76/77 (99%), Gaps = 0/77 (0%)
 Frame = +3

Query  93   MGKEKVHISIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  272
            MGKEK HI+IVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKSHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  273  DKLKAERERGITIDIAL  323
            DKLKAERERGITIDIAL
Sbjct  61   DKLKAERERGITIDIAL  77



>gb|ABU63160.1| elongation factor [Saccharum officinarum]
 gb|AGT15989.1| elongation factor 1-alpha [Saccharum hybrid cultivar R570]
 gb|AGT15990.1| elongation factor 1-alpha [Saccharum hybrid cultivar R570]
 gb|AGT16629.1| elongation factor 1 alpha [Saccharum hybrid cultivar R570]
Length=447

 Score =   188 bits (477),  Expect(2) = 2e-85, Method: Compositional matrix adjust.
 Identities = 86/89 (97%), Positives = 88/89 (99%), Gaps = 0/89 (0%)
 Frame = +1

Query  316  LPLWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTR  495
            + LWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTR
Sbjct  75   IALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTR  134

Query  496  EHALLAFTLGVKQMICCCNKIDATTPKYS  582
            EHALLAFTLGVKQMICCCNK+DATTPKYS
Sbjct  135  EHALLAFTLGVKQMICCCNKMDATTPKYS  163


 Score =   154 bits (390),  Expect(2) = 2e-85, Method: Compositional matrix adjust.
 Identities = 75/77 (97%), Positives = 76/77 (99%), Gaps = 0/77 (0%)
 Frame = +3

Query  93   MGKEKVHISIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  272
            MGKEK HI+IVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKTHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  273  DKLKAERERGITIDIAL  323
            DKLKAERERGITIDIAL
Sbjct  61   DKLKAERERGITIDIAL  77



>ref|NP_001152668.1| LOC100286309 [Zea mays]
 ref|XP_008647989.1| PREDICTED: LOC100286309 isoform X1 [Zea mays]
 gb|ACG48827.1| elongation factor 1-alpha [Zea mays]
 gb|AFW76430.1| putative translation elongation factor Tu family protein isoform 
1 [Zea mays]
 gb|AFW76431.1| putative translation elongation factor Tu family protein isoform 
2 [Zea mays]
 gb|AFW76432.1| putative translation elongation factor Tu family protein isoform 
3 [Zea mays]
Length=447

 Score =   188 bits (477),  Expect(2) = 3e-85, Method: Compositional matrix adjust.
 Identities = 86/89 (97%), Positives = 88/89 (99%), Gaps = 0/89 (0%)
 Frame = +1

Query  316  LPLWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTR  495
            + LWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTR
Sbjct  75   IALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTR  134

Query  496  EHALLAFTLGVKQMICCCNKIDATTPKYS  582
            EHALLAFTLGVKQMICCCNK+DATTPKYS
Sbjct  135  EHALLAFTLGVKQMICCCNKMDATTPKYS  163


 Score =   154 bits (390),  Expect(2) = 3e-85, Method: Compositional matrix adjust.
 Identities = 75/77 (97%), Positives = 76/77 (99%), Gaps = 0/77 (0%)
 Frame = +3

Query  93   MGKEKVHISIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  272
            MGKEK HI+IVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKTHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  273  DKLKAERERGITIDIAL  323
            DKLKAERERGITIDIAL
Sbjct  61   DKLKAERERGITIDIAL  77



>ref|XP_003558459.1| PREDICTED: elongation factor 1-alpha [Brachypodium distachyon]
 ref|XP_003577316.1| PREDICTED: elongation factor 1-alpha [Brachypodium distachyon]
 ref|XP_003581689.1| PREDICTED: elongation factor 1-alpha [Brachypodium distachyon]
 ref|XP_010228997.1| PREDICTED: elongation factor 1-alpha [Brachypodium distachyon]
 ref|XP_010228998.1| PREDICTED: elongation factor 1-alpha [Brachypodium distachyon]
Length=447

 Score =   188 bits (477),  Expect(2) = 3e-85, Method: Compositional matrix adjust.
 Identities = 86/89 (97%), Positives = 88/89 (99%), Gaps = 0/89 (0%)
 Frame = +1

Query  316  LPLWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTR  495
            + LWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTR
Sbjct  75   IALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTR  134

Query  496  EHALLAFTLGVKQMICCCNKIDATTPKYS  582
            EHALLAFTLGVKQMICCCNK+DATTPKYS
Sbjct  135  EHALLAFTLGVKQMICCCNKMDATTPKYS  163


 Score =   154 bits (390),  Expect(2) = 3e-85, Method: Compositional matrix adjust.
 Identities = 75/77 (97%), Positives = 76/77 (99%), Gaps = 0/77 (0%)
 Frame = +3

Query  93   MGKEKVHISIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  272
            MGKEK HI+IVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKTHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  273  DKLKAERERGITIDIAL  323
            DKLKAERERGITIDIAL
Sbjct  61   DKLKAERERGITIDIAL  77



>ref|XP_008457229.1| PREDICTED: elongation factor 1-alpha [Cucumis melo]
Length=447

 Score =   187 bits (476),  Expect(2) = 3e-85, Method: Compositional matrix adjust.
 Identities = 86/89 (97%), Positives = 88/89 (99%), Gaps = 0/89 (0%)
 Frame = +1

Query  316  LPLWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTR  495
            + LWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTR
Sbjct  75   IALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTR  134

Query  496  EHALLAFTLGVKQMICCCNKIDATTPKYS  582
            EHALLAFTLGVKQMICCCNK+DATTPKYS
Sbjct  135  EHALLAFTLGVKQMICCCNKMDATTPKYS  163


 Score =   154 bits (390),  Expect(2) = 3e-85, Method: Compositional matrix adjust.
 Identities = 75/77 (97%), Positives = 76/77 (99%), Gaps = 0/77 (0%)
 Frame = +3

Query  93   MGKEKVHISIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  272
            MGKEK HI+IVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKTHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  273  DKLKAERERGITIDIAL  323
            DKLKAERERGITIDIAL
Sbjct  61   DKLKAERERGITIDIAL  77



>ref|XP_008358325.1| PREDICTED: elongation factor 1-alpha [Malus domestica]
 ref|XP_008385282.1| PREDICTED: elongation factor 1-alpha [Malus domestica]
Length=447

 Score =   188 bits (477),  Expect(2) = 3e-85, Method: Compositional matrix adjust.
 Identities = 86/89 (97%), Positives = 88/89 (99%), Gaps = 0/89 (0%)
 Frame = +1

Query  316  LPLWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTR  495
            + LWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTR
Sbjct  75   IALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTR  134

Query  496  EHALLAFTLGVKQMICCCNKIDATTPKYS  582
            EHALLAFTLGVKQMICCCNK+DATTPKYS
Sbjct  135  EHALLAFTLGVKQMICCCNKMDATTPKYS  163


 Score =   154 bits (389),  Expect(2) = 3e-85, Method: Compositional matrix adjust.
 Identities = 75/77 (97%), Positives = 76/77 (99%), Gaps = 0/77 (0%)
 Frame = +3

Query  93   MGKEKVHISIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  272
            MGKEK HI+IVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKFHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  273  DKLKAERERGITIDIAL  323
            DKLKAERERGITIDIAL
Sbjct  61   DKLKAERERGITIDIAL  77



>gb|KHG27341.1| Elongation factor 1-alpha [Gossypium arboreum]
Length=449

 Score =   187 bits (476),  Expect(2) = 3e-85, Method: Compositional matrix adjust.
 Identities = 86/89 (97%), Positives = 88/89 (99%), Gaps = 0/89 (0%)
 Frame = +1

Query  316  LPLWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTR  495
            + LWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTR
Sbjct  75   IALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTR  134

Query  496  EHALLAFTLGVKQMICCCNKIDATTPKYS  582
            EHALLAFTLGVKQMICCCNK+DATTPKYS
Sbjct  135  EHALLAFTLGVKQMICCCNKMDATTPKYS  163


 Score =   154 bits (390),  Expect(2) = 3e-85, Method: Compositional matrix adjust.
 Identities = 75/77 (97%), Positives = 76/77 (99%), Gaps = 0/77 (0%)
 Frame = +3

Query  93   MGKEKVHISIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  272
            MGKEK HI+IVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKTHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  273  DKLKAERERGITIDIAL  323
            DKLKAERERGITIDIAL
Sbjct  61   DKLKAERERGITIDIAL  77



>ref|XP_004163381.1| PREDICTED: LOW QUALITY PROTEIN: elongation factor 1-alpha-like 
[Cucumis sativus]
Length=449

 Score =   187 bits (476),  Expect(2) = 3e-85, Method: Compositional matrix adjust.
 Identities = 86/89 (97%), Positives = 88/89 (99%), Gaps = 0/89 (0%)
 Frame = +1

Query  316  LPLWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTR  495
            + LWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTR
Sbjct  75   IALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTR  134

Query  496  EHALLAFTLGVKQMICCCNKIDATTPKYS  582
            EHALLAFTLGVKQMICCCNK+DATTPKYS
Sbjct  135  EHALLAFTLGVKQMICCCNKMDATTPKYS  163


 Score =   154 bits (390),  Expect(2) = 3e-85, Method: Compositional matrix adjust.
 Identities = 75/77 (97%), Positives = 76/77 (99%), Gaps = 0/77 (0%)
 Frame = +3

Query  93   MGKEKVHISIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  272
            MGKEK HI+IVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKTHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  273  DKLKAERERGITIDIAL  323
            DKLKAERERGITIDIAL
Sbjct  61   DKLKAERERGITIDIAL  77



>gb|ACG31866.1| elongation factor 1-alpha [Zea mays]
Length=447

 Score =   188 bits (477),  Expect(2) = 3e-85, Method: Compositional matrix adjust.
 Identities = 86/89 (97%), Positives = 88/89 (99%), Gaps = 0/89 (0%)
 Frame = +1

Query  316  LPLWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTR  495
            + LWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTR
Sbjct  75   IALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTR  134

Query  496  EHALLAFTLGVKQMICCCNKIDATTPKYS  582
            EHALLAFTLGVKQMICCCNK+DATTPKYS
Sbjct  135  EHALLAFTLGVKQMICCCNKMDATTPKYS  163


 Score =   154 bits (389),  Expect(2) = 3e-85, Method: Compositional matrix adjust.
 Identities = 75/77 (97%), Positives = 76/77 (99%), Gaps = 0/77 (0%)
 Frame = +3

Query  93   MGKEKVHISIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  272
            MGKEK HI+IVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKSHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  273  DKLKAERERGITIDIAL  323
            DKLKAERERGITIDIAL
Sbjct  61   DKLKAERERGITIDIAL  77



>sp|Q03033.1|EF1A_WHEAT RecName: Full=Elongation factor 1-alpha; Short=EF-1-alpha [Triticum 
aestivum]
 gb|AAA34306.1| translation elongation factor 1 alpha-subunit [Triticum aestivum]
 emb|CAA90651.1| elongation factor 1-alpha [Hordeum vulgare subsp. vulgare]
 dbj|BAJ85443.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ87634.1| predicted protein [Hordeum vulgare subsp. vulgare]
 gb|EMT04563.1| Elongation factor 1-alpha [Aegilops tauschii]
 gb|EMT21642.1| Elongation factor 1-alpha [Aegilops tauschii]
 gb|EMT30905.1| Elongation factor 1-alpha [Aegilops tauschii]
Length=447

 Score =   187 bits (476),  Expect(2) = 3e-85, Method: Compositional matrix adjust.
 Identities = 86/89 (97%), Positives = 88/89 (99%), Gaps = 0/89 (0%)
 Frame = +1

Query  316  LPLWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTR  495
            + LWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTR
Sbjct  75   IALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTR  134

Query  496  EHALLAFTLGVKQMICCCNKIDATTPKYS  582
            EHALLAFTLGVKQMICCCNK+DATTPKYS
Sbjct  135  EHALLAFTLGVKQMICCCNKMDATTPKYS  163


 Score =   154 bits (390),  Expect(2) = 3e-85, Method: Compositional matrix adjust.
 Identities = 75/77 (97%), Positives = 76/77 (99%), Gaps = 0/77 (0%)
 Frame = +3

Query  93   MGKEKVHISIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  272
            MGKEK HI+IVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKTHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  273  DKLKAERERGITIDIAL  323
            DKLKAERERGITIDIAL
Sbjct  61   DKLKAERERGITIDIAL  77



>ref|XP_007205199.1| hypothetical protein PRUPE_ppa005718mg [Prunus persica]
 gb|EMJ06398.1| hypothetical protein PRUPE_ppa005718mg [Prunus persica]
Length=447

 Score =   188 bits (477),  Expect(2) = 3e-85, Method: Compositional matrix adjust.
 Identities = 86/89 (97%), Positives = 88/89 (99%), Gaps = 0/89 (0%)
 Frame = +1

Query  316  LPLWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTR  495
            + LWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTR
Sbjct  75   IALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTR  134

Query  496  EHALLAFTLGVKQMICCCNKIDATTPKYS  582
            EHALLAFTLGVKQMICCCNK+DATTPKYS
Sbjct  135  EHALLAFTLGVKQMICCCNKMDATTPKYS  163


 Score =   154 bits (390),  Expect(2) = 3e-85, Method: Compositional matrix adjust.
 Identities = 75/77 (97%), Positives = 76/77 (99%), Gaps = 0/77 (0%)
 Frame = +3

Query  93   MGKEKVHISIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  272
            MGKEK HI+IVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKFHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  273  DKLKAERERGITIDIAL  323
            DKLKAERERGITIDIAL
Sbjct  61   DKLKAERERGITIDIAL  77



>ref|XP_006280459.1| hypothetical protein CARUB_v10026391mg [Capsella rubella]
 ref|XP_006304491.1| hypothetical protein CARUB_v10011249mg [Capsella rubella]
 ref|XP_010456336.1| PREDICTED: elongation factor 1-alpha 1 isoform X1 [Camelina sativa]
 ref|XP_010456344.1| PREDICTED: elongation factor 1-alpha 1 isoform X2 [Camelina sativa]
 ref|XP_010456350.1| PREDICTED: elongation factor 1-alpha 1 isoform X3 [Camelina sativa]
 ref|XP_010456355.1| PREDICTED: elongation factor 1-alpha 1 isoform X4 [Camelina sativa]
 ref|XP_010456361.1| PREDICTED: elongation factor 1-alpha 1 isoform X5 [Camelina sativa]
 ref|XP_010456369.1| PREDICTED: elongation factor 1-alpha 1 isoform X6 [Camelina sativa]
 ref|XP_010488164.1| PREDICTED: elongation factor 1-alpha 1 [Camelina sativa]
 ref|XP_010488173.1| PREDICTED: elongation factor 1-alpha 1 [Camelina sativa]
 ref|XP_010505603.1| PREDICTED: elongation factor 1-alpha 1 isoform X1 [Camelina sativa]
 ref|XP_010505604.1| PREDICTED: elongation factor 1-alpha 1 isoform X2 [Camelina sativa]
 ref|XP_010509026.1| PREDICTED: elongation factor 1-alpha 1 [Camelina sativa]
 ref|XP_010517279.1| PREDICTED: elongation factor 1-alpha 1 [Camelina sativa]
 ref|XP_010443836.1| PREDICTED: elongation factor 1-alpha 1 [Camelina sativa]
 ref|XP_010443839.1| PREDICTED: elongation factor 1-alpha 1 [Camelina sativa]
 ref|XP_010458006.1| PREDICTED: elongation factor 1-alpha 1 [Camelina sativa]
 ref|XP_010458008.1| PREDICTED: elongation factor 1-alpha 1 isoform X1 [Camelina sativa]
 ref|XP_010458009.1| PREDICTED: elongation factor 1-alpha 1 isoform X1 [Camelina sativa]
 ref|XP_010475572.1| PREDICTED: elongation factor 1-alpha 1 [Camelina sativa]
 ref|XP_010475573.1| PREDICTED: elongation factor 1-alpha 1 [Camelina sativa]
 ref|XP_010475574.1| PREDICTED: elongation factor 1-alpha 1 [Camelina sativa]
 ref|XP_010483684.1| PREDICTED: elongation factor 1-alpha 1 [Camelina sativa]
 ref|XP_010483687.1| PREDICTED: elongation factor 1-alpha 1 [Camelina sativa]
 gb|EOA13357.1| hypothetical protein CARUB_v10026391mg [Capsella rubella]
 gb|EOA37389.1| hypothetical protein CARUB_v10011249mg [Capsella rubella]
Length=449

 Score =   188 bits (477),  Expect(2) = 3e-85, Method: Compositional matrix adjust.
 Identities = 86/89 (97%), Positives = 88/89 (99%), Gaps = 0/89 (0%)
 Frame = +1

Query  316  LPLWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTR  495
            + LWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTR
Sbjct  75   IALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTR  134

Query  496  EHALLAFTLGVKQMICCCNKIDATTPKYS  582
            EHALLAFTLGVKQMICCCNK+DATTPKYS
Sbjct  135  EHALLAFTLGVKQMICCCNKMDATTPKYS  163


 Score =   154 bits (389),  Expect(2) = 3e-85, Method: Compositional matrix adjust.
 Identities = 75/77 (97%), Positives = 76/77 (99%), Gaps = 0/77 (0%)
 Frame = +3

Query  93   MGKEKVHISIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  272
            MGKEK HI+IVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKFHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  273  DKLKAERERGITIDIAL  323
            DKLKAERERGITIDIAL
Sbjct  61   DKLKAERERGITIDIAL  77



>ref|XP_004149547.1| PREDICTED: elongation factor 1-alpha-like [Cucumis sativus]
Length=449

 Score =   187 bits (476),  Expect(2) = 3e-85, Method: Compositional matrix adjust.
 Identities = 86/89 (97%), Positives = 88/89 (99%), Gaps = 0/89 (0%)
 Frame = +1

Query  316  LPLWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTR  495
            + LWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTR
Sbjct  75   IALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTR  134

Query  496  EHALLAFTLGVKQMICCCNKIDATTPKYS  582
            EHALLAFTLGVKQMICCCNK+DATTPKYS
Sbjct  135  EHALLAFTLGVKQMICCCNKMDATTPKYS  163


 Score =   154 bits (390),  Expect(2) = 3e-85, Method: Compositional matrix adjust.
 Identities = 75/77 (97%), Positives = 76/77 (99%), Gaps = 0/77 (0%)
 Frame = +3

Query  93   MGKEKVHISIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  272
            MGKEK HI+IVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKTHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  273  DKLKAERERGITIDIAL  323
            DKLKAERERGITIDIAL
Sbjct  61   DKLKAERERGITIDIAL  77



>ref|NP_001105565.1| elongation factor alpha5 [Zea mays]
 gb|AAF42979.1| elongation factor 1 alpha [Zea mays]
Length=447

 Score =   188 bits (478),  Expect(2) = 3e-85, Method: Compositional matrix adjust.
 Identities = 86/89 (97%), Positives = 88/89 (99%), Gaps = 0/89 (0%)
 Frame = +1

Query  316  LPLWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTR  495
            + LWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTR
Sbjct  75   IALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTR  134

Query  496  EHALLAFTLGVKQMICCCNKIDATTPKYS  582
            EHALLAFTLGVKQMICCCNK+DATTPKYS
Sbjct  135  EHALLAFTLGVKQMICCCNKMDATTPKYS  163


 Score =   154 bits (388),  Expect(2) = 3e-85, Method: Compositional matrix adjust.
 Identities = 75/77 (97%), Positives = 76/77 (99%), Gaps = 0/77 (0%)
 Frame = +3

Query  93   MGKEKVHISIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  272
            MGKEK HI+IVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKSHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  273  DKLKAERERGITIDIAL  323
            DKLKAERERGITIDIAL
Sbjct  61   DKLKAERERGITIDIAL  77



>ref|NP_001288465.1| elongation factor 1-alpha-like [Zea mays]
 ref|XP_008647262.1| PREDICTED: elongation factor alpha2 isoform X1 [Zea mays]
 gb|ACG25290.1| elongation factor 1-alpha [Zea mays]
 gb|AFW77596.1| putative translation elongation factor Tu family protein [Zea 
mays]
 gb|AFW77599.1| putative translation elongation factor Tu family protein isoform 
1 [Zea mays]
 gb|AFW77600.1| putative translation elongation factor Tu family protein isoform 
2 [Zea mays]
Length=447

 Score =   188 bits (477),  Expect(2) = 3e-85, Method: Compositional matrix adjust.
 Identities = 86/89 (97%), Positives = 88/89 (99%), Gaps = 0/89 (0%)
 Frame = +1

Query  316  LPLWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTR  495
            + LWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTR
Sbjct  75   IALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTR  134

Query  496  EHALLAFTLGVKQMICCCNKIDATTPKYS  582
            EHALLAFTLGVKQMICCCNK+DATTPKYS
Sbjct  135  EHALLAFTLGVKQMICCCNKMDATTPKYS  163


 Score =   154 bits (389),  Expect(2) = 3e-85, Method: Compositional matrix adjust.
 Identities = 75/77 (97%), Positives = 76/77 (99%), Gaps = 0/77 (0%)
 Frame = +3

Query  93   MGKEKVHISIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  272
            MGKEK HI+IVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKSHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  273  DKLKAERERGITIDIAL  323
            DKLKAERERGITIDIAL
Sbjct  61   DKLKAERERGITIDIAL  77



>ref|NP_200847.1| elongation factor 1-alpha 4 [Arabidopsis thaliana]
 ref|NP_563799.1| elongation factor 1-alpha 3 [Arabidopsis thaliana]
 ref|NP_563800.1| elongation factor 1-alpha 2 [Arabidopsis thaliana]
 ref|NP_563801.1| elongation factor 1-alpha 1 [Arabidopsis thaliana]
 ref|NP_001030993.1| elongation factor 1-alpha 1 [Arabidopsis thaliana]
 ref|NP_001119464.1| elongation factor 1-alpha 4 [Arabidopsis thaliana]
 ref|XP_002864684.1| elongation factor 1-alpha [Arabidopsis lyrata subsp. lyrata]
 ref|XP_002889674.1| elongation factor 1-alpha [Arabidopsis lyrata subsp. lyrata]
 sp|P0DH99.1|EF1A1_ARATH RecName: Full=Elongation factor 1-alpha 1; Short=EF-1-alpha 1; 
AltName: Full=eEF-1A1 [Arabidopsis thaliana]
 sp|Q8W4H7.2|EF1A2_ARATH RecName: Full=Elongation factor 1-alpha 2; Short=EF-1-alpha 2; 
AltName: Full=eEF-1A2 [Arabidopsis thaliana]
 sp|Q0WL56.2|EF1A3_ARATH RecName: Full=Elongation factor 1-alpha 3; Short=EF-1-alpha 3; 
AltName: Full=eEF-1A3 [Arabidopsis thaliana]
 sp|Q8GTY0.2|EF1A4_ARATH RecName: Full=Elongation factor 1-alpha 4; Short=EF-1-alpha 4; 
AltName: Full=eEF-1A4 [Arabidopsis thaliana]
 gb|AAF79847.1|AC026875_27 T6D22.3 [Arabidopsis thaliana]
 gb|AAL31918.1|AF419586_1 AT5g60390/muf9_40 [Arabidopsis thaliana]
 emb|CAA34453.1| elongation factor 1-alpha [Arabidopsis thaliana]
 emb|CAA34454.1| elongation factor 1-alpha [Arabidopsis thaliana]
 emb|CAA34455.1| elongation factor 1-alpha [Arabidopsis thaliana]
 gb|AAB07882.1| EF-1alpha-A1 [Arabidopsis thaliana]
 gb|AAB07883.1| EF-1alpha-A2 [Arabidopsis thaliana]
 gb|AAB07884.1| EF-1alpha-A3 [Arabidopsis thaliana]
 dbj|BAB08224.1| elongation factor 1-alpha (EF-1-alpha) [Arabidopsis thaliana]
 gb|AAK62638.1| At1g07940/T6D22_14 [Arabidopsis thaliana]
 gb|AAL24386.1| elongation factor 1-alpha (EF-1-alpha) [Arabidopsis thaliana]
 gb|AAL31193.1| AT5g60390/muf9_40 [Arabidopsis thaliana]
 gb|AAL86336.1| putative elongation factor 1-alpha [Arabidopsis thaliana]
 gb|AAM65897.1| elongation factor 1-alpha [Arabidopsis thaliana]
 gb|AAM67562.1| putative elongation factor 1-alpha [Arabidopsis thaliana]
 gb|AAM91202.1| elongation factor 1-alpha [Arabidopsis thaliana]
 gb|AAM91362.1| At5g60390/muf9_40 [Arabidopsis thaliana]
 gb|AAM98236.1| unknown protein [Arabidopsis thaliana]
 gb|AAM98240.1| unknown protein [Arabidopsis thaliana]
 gb|AAN18164.1| At1g07940/T6D22_14 [Arabidopsis thaliana]
 gb|AAO00783.1| elongation factor 1-alpha [Arabidopsis thaliana]
 gb|AAO00802.1| elongation factor 1-alpha [Arabidopsis thaliana]
 gb|AAO00870.1| Unknown protein [Arabidopsis thaliana]
 gb|AAO29944.1| Unknown protein [Arabidopsis thaliana]
 gb|AAP21177.1| At5g60390/muf9_40 [Arabidopsis thaliana]
 dbj|BAE99963.1| elongation factor 1-alpha [Arabidopsis thaliana]
 dbj|BAE98497.1| translation elongation factor eEF-1 alpha chain [Arabidopsis 
thaliana]
 dbj|BAE98750.1| translation elongation factor eEF-1 alpha chain [Arabidopsis 
thaliana]
 gb|EFH40943.1| elongation factor 1-alpha [Arabidopsis lyrata subsp. lyrata]
 gb|EFH65933.1| elongation factor 1-alpha [Arabidopsis lyrata subsp. lyrata]
 gb|AED97318.1| elongation factor 1-alpha 4 [Arabidopsis thaliana]
 gb|AED97320.1| elongation factor 1-alpha 4 [Arabidopsis thaliana]
 gb|AEE28212.1| elongation factor 1-alpha [Arabidopsis thaliana]
 gb|AEE28213.1| Elongation factor 1-alpha [Arabidopsis thaliana]
 gb|AEE28215.1| Elongation factor 1-alpha [Arabidopsis thaliana]
 gb|AEE28216.1| Elongation factor 1-alpha [Arabidopsis thaliana]
Length=449

 Score =   188 bits (477),  Expect(2) = 3e-85, Method: Compositional matrix adjust.
 Identities = 86/89 (97%), Positives = 88/89 (99%), Gaps = 0/89 (0%)
 Frame = +1

Query  316  LPLWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTR  495
            + LWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTR
Sbjct  75   IALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTR  134

Query  496  EHALLAFTLGVKQMICCCNKIDATTPKYS  582
            EHALLAFTLGVKQMICCCNK+DATTPKYS
Sbjct  135  EHALLAFTLGVKQMICCCNKMDATTPKYS  163


 Score =   154 bits (389),  Expect(2) = 3e-85, Method: Compositional matrix adjust.
 Identities = 75/77 (97%), Positives = 76/77 (99%), Gaps = 0/77 (0%)
 Frame = +3

Query  93   MGKEKVHISIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  272
            MGKEK HI+IVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKFHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  273  DKLKAERERGITIDIAL  323
            DKLKAERERGITIDIAL
Sbjct  61   DKLKAERERGITIDIAL  77



>ref|XP_009148045.1| PREDICTED: elongation factor 1-alpha 1 [Brassica rapa]
 ref|XP_009110915.1| PREDICTED: elongation factor 1-alpha 1 [Brassica rapa]
 ref|XP_009118409.1| PREDICTED: elongation factor 1-alpha 1 isoform X1 [Brassica rapa]
 ref|XP_009118410.1| PREDICTED: elongation factor 1-alpha 1 isoform X2 [Brassica rapa]
 ref|XP_009118411.1| PREDICTED: elongation factor 1-alpha 1 isoform X3 [Brassica rapa]
 ref|XP_009120571.1| PREDICTED: elongation factor 1-alpha 1 [Brassica rapa]
 gb|ACS68201.1| elongation factor 1 alpha [Brassica napus]
 gb|AGK07381.1| elongation factor 1-alpha protein [Brassica oleracea var. botrytis]
Length=449

 Score =   188 bits (477),  Expect(2) = 3e-85, Method: Compositional matrix adjust.
 Identities = 86/89 (97%), Positives = 88/89 (99%), Gaps = 0/89 (0%)
 Frame = +1

Query  316  LPLWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTR  495
            + LWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTR
Sbjct  75   IALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTR  134

Query  496  EHALLAFTLGVKQMICCCNKIDATTPKYS  582
            EHALLAFTLGVKQMICCCNK+DATTPKYS
Sbjct  135  EHALLAFTLGVKQMICCCNKMDATTPKYS  163


 Score =   154 bits (389),  Expect(2) = 3e-85, Method: Compositional matrix adjust.
 Identities = 75/77 (97%), Positives = 76/77 (99%), Gaps = 0/77 (0%)
 Frame = +3

Query  93   MGKEKVHISIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  272
            MGKEK HI+IVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKFHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  273  DKLKAERERGITIDIAL  323
            DKLKAERERGITIDIAL
Sbjct  61   DKLKAERERGITIDIAL  77



>gb|AAL32631.1| putative elongation factor 1-a [Arabidopsis thaliana]
 gb|AAM47970.1| putative elongation factor 1-a [Arabidopsis thaliana]
Length=449

 Score =   188 bits (477),  Expect(2) = 3e-85, Method: Compositional matrix adjust.
 Identities = 86/89 (97%), Positives = 88/89 (99%), Gaps = 0/89 (0%)
 Frame = +1

Query  316  LPLWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTR  495
            + LWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTR
Sbjct  75   IALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTR  134

Query  496  EHALLAFTLGVKQMICCCNKIDATTPKYS  582
            EHALLAFTLGVKQMICCCNK+DATTPKYS
Sbjct  135  EHALLAFTLGVKQMICCCNKMDATTPKYS  163


 Score =   154 bits (390),  Expect(2) = 3e-85, Method: Compositional matrix adjust.
 Identities = 75/77 (97%), Positives = 76/77 (99%), Gaps = 0/77 (0%)
 Frame = +3

Query  93   MGKEKVHISIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  272
            MGKEK HI+IVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKFHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  273  DKLKAERERGITIDIAL  323
            DKLKAERERGITIDIAL
Sbjct  61   DKLKAERERGITIDIAL  77



>ref|NP_001105617.1| elongation factor alpha3 [Zea mays]
 gb|AAF42977.1| elongation factor 1 alpha [Zea mays]
Length=447

 Score =   188 bits (478),  Expect(2) = 3e-85, Method: Compositional matrix adjust.
 Identities = 86/89 (97%), Positives = 88/89 (99%), Gaps = 0/89 (0%)
 Frame = +1

Query  316  LPLWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTR  495
            + LWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTR
Sbjct  75   IALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTR  134

Query  496  EHALLAFTLGVKQMICCCNKIDATTPKYS  582
            EHALLAFTLGVKQMICCCNK+DATTPKYS
Sbjct  135  EHALLAFTLGVKQMICCCNKMDATTPKYS  163


 Score =   154 bits (388),  Expect(2) = 3e-85, Method: Compositional matrix adjust.
 Identities = 75/77 (97%), Positives = 76/77 (99%), Gaps = 0/77 (0%)
 Frame = +3

Query  93   MGKEKVHISIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  272
            MGKEK HI+IVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKSHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  273  DKLKAERERGITIDIAL  323
            DKLKAERERGITIDIAL
Sbjct  61   DKLKAERERGITIDIAL  77



>ref|XP_008224543.1| PREDICTED: elongation factor 1-alpha [Prunus mume]
Length=447

 Score =   188 bits (477),  Expect(2) = 3e-85, Method: Compositional matrix adjust.
 Identities = 86/89 (97%), Positives = 88/89 (99%), Gaps = 0/89 (0%)
 Frame = +1

Query  316  LPLWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTR  495
            + LWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTR
Sbjct  75   IALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTR  134

Query  496  EHALLAFTLGVKQMICCCNKIDATTPKYS  582
            EHALLAFTLGVKQMICCCNK+DATTPKYS
Sbjct  135  EHALLAFTLGVKQMICCCNKMDATTPKYS  163


 Score =   154 bits (389),  Expect(2) = 3e-85, Method: Compositional matrix adjust.
 Identities = 75/77 (97%), Positives = 76/77 (99%), Gaps = 0/77 (0%)
 Frame = +3

Query  93   MGKEKVHISIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  272
            MGKEK HI+IVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKFHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  273  DKLKAERERGITIDIAL  323
            DKLKAERERGITIDIAL
Sbjct  61   DKLKAERERGITIDIAL  77



>gb|KJB76528.1| hypothetical protein B456_012G093800 [Gossypium raimondii]
Length=449

 Score =   187 bits (476),  Expect(2) = 3e-85, Method: Compositional matrix adjust.
 Identities = 86/89 (97%), Positives = 88/89 (99%), Gaps = 0/89 (0%)
 Frame = +1

Query  316  LPLWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTR  495
            + LWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTR
Sbjct  75   IALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTR  134

Query  496  EHALLAFTLGVKQMICCCNKIDATTPKYS  582
            EHALLAFTLGVKQMICCCNK+DATTPKYS
Sbjct  135  EHALLAFTLGVKQMICCCNKMDATTPKYS  163


 Score =   154 bits (390),  Expect(2) = 3e-85, Method: Compositional matrix adjust.
 Identities = 75/77 (97%), Positives = 76/77 (99%), Gaps = 0/77 (0%)
 Frame = +3

Query  93   MGKEKVHISIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  272
            MGKEK HI+IVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKTHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  273  DKLKAERERGITIDIAL  323
            DKLKAERERGITIDIAL
Sbjct  61   DKLKAERERGITIDIAL  77



>gb|AGT16893.1| elongation factor 1-alpha [Saccharum hybrid cultivar R570]
Length=447

 Score =   188 bits (477),  Expect(2) = 3e-85, Method: Compositional matrix adjust.
 Identities = 86/89 (97%), Positives = 88/89 (99%), Gaps = 0/89 (0%)
 Frame = +1

Query  316  LPLWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTR  495
            + LWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTR
Sbjct  75   IALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTR  134

Query  496  EHALLAFTLGVKQMICCCNKIDATTPKYS  582
            EHALLAFTLGVKQMICCCNK+DATTPKYS
Sbjct  135  EHALLAFTLGVKQMICCCNKMDATTPKYS  163


 Score =   154 bits (389),  Expect(2) = 3e-85, Method: Compositional matrix adjust.
 Identities = 75/77 (97%), Positives = 76/77 (99%), Gaps = 0/77 (0%)
 Frame = +3

Query  93   MGKEKVHISIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  272
            MGKEK HI+IVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKSHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  273  DKLKAERERGITIDIAL  323
            DKLKAERERGITIDIAL
Sbjct  61   DKLKAERERGITIDIAL  77



>gb|ACS68200.1| elongation factor 1 alpha [Brassica napus]
Length=449

 Score =   188 bits (477),  Expect(2) = 3e-85, Method: Compositional matrix adjust.
 Identities = 86/89 (97%), Positives = 88/89 (99%), Gaps = 0/89 (0%)
 Frame = +1

Query  316  LPLWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTR  495
            + LWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTR
Sbjct  75   IALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTR  134

Query  496  EHALLAFTLGVKQMICCCNKIDATTPKYS  582
            EHALLAFTLGVKQMICCCNK+DATTPKYS
Sbjct  135  EHALLAFTLGVKQMICCCNKMDATTPKYS  163


 Score =   154 bits (389),  Expect(2) = 3e-85, Method: Compositional matrix adjust.
 Identities = 75/77 (97%), Positives = 76/77 (99%), Gaps = 0/77 (0%)
 Frame = +3

Query  93   MGKEKVHISIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  272
            MGKEK HI+IVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKFHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  273  DKLKAERERGITIDIAL  323
            DKLKAERERGITIDIAL
Sbjct  61   DKLKAERERGITIDIAL  77



>gb|ABA12222.1| translation elongation factor 1A-6 [Gossypium hirsutum]
 gb|KHG08414.1| Elongation factor 1-alpha [Gossypium arboreum]
 gb|KJB16823.1| hypothetical protein B456_002G249600 [Gossypium raimondii]
 gb|KJB16824.1| hypothetical protein B456_002G249600 [Gossypium raimondii]
 gb|KJB16825.1| hypothetical protein B456_002G249600 [Gossypium raimondii]
Length=447

 Score =   187 bits (474),  Expect(2) = 3e-85, Method: Compositional matrix adjust.
 Identities = 85/89 (96%), Positives = 88/89 (99%), Gaps = 0/89 (0%)
 Frame = +1

Query  316  LPLWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTR  495
            + LWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTR
Sbjct  75   IALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTR  134

Query  496  EHALLAFTLGVKQMICCCNKIDATTPKYS  582
            EHALLAFTLGV+QMICCCNK+DATTPKYS
Sbjct  135  EHALLAFTLGVRQMICCCNKMDATTPKYS  163


 Score =   155 bits (392),  Expect(2) = 3e-85, Method: Compositional matrix adjust.
 Identities = 75/77 (97%), Positives = 77/77 (100%), Gaps = 0/77 (0%)
 Frame = +3

Query  93   MGKEKVHISIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  272
            MGKEKVHI++VVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKVHINLVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  273  DKLKAERERGITIDIAL  323
            DKLKAERERGITIDIAL
Sbjct  61   DKLKAERERGITIDIAL  77



>dbj|BAH19898.1| AT1G07930 [Arabidopsis thaliana]
Length=449

 Score =   188 bits (477),  Expect(2) = 3e-85, Method: Compositional matrix adjust.
 Identities = 86/89 (97%), Positives = 88/89 (99%), Gaps = 0/89 (0%)
 Frame = +1

Query  316  LPLWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTR  495
            + LWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTR
Sbjct  75   IALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTR  134

Query  496  EHALLAFTLGVKQMICCCNKIDATTPKYS  582
            EHALLAFTLGVKQMICCCNK+DATTPKYS
Sbjct  135  EHALLAFTLGVKQMICCCNKMDATTPKYS  163


 Score =   154 bits (389),  Expect(2) = 3e-85, Method: Compositional matrix adjust.
 Identities = 75/77 (97%), Positives = 76/77 (99%), Gaps = 0/77 (0%)
 Frame = +3

Query  93   MGKEKVHISIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  272
            MGKEK HI+IVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKFHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  273  DKLKAERERGITIDIAL  323
            DKLKAERERGITIDIAL
Sbjct  61   DKLKAERERGITIDIAL  77



>ref|XP_009144204.1| PREDICTED: elongation factor 1-alpha 1-like [Brassica rapa]
Length=449

 Score =   187 bits (476),  Expect(2) = 3e-85, Method: Compositional matrix adjust.
 Identities = 86/89 (97%), Positives = 88/89 (99%), Gaps = 0/89 (0%)
 Frame = +1

Query  316  LPLWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTR  495
            + LWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTR
Sbjct  75   IALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTR  134

Query  496  EHALLAFTLGVKQMICCCNKIDATTPKYS  582
            EHALLAFTLGVKQMICCCNK+DATTPKYS
Sbjct  135  EHALLAFTLGVKQMICCCNKMDATTPKYS  163


 Score =   154 bits (389),  Expect(2) = 3e-85, Method: Compositional matrix adjust.
 Identities = 75/77 (97%), Positives = 76/77 (99%), Gaps = 0/77 (0%)
 Frame = +3

Query  93   MGKEKVHISIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  272
            MGKEK HI+IVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKFHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  273  DKLKAERERGITIDIAL  323
            DKLKAERERGITIDIAL
Sbjct  61   DKLKAERERGITIDIAL  77



>ref|NP_001288407.1| elongation factor 1-alpha-like [Zea mays]
 gb|ACF87009.1| unknown [Zea mays]
Length=447

 Score =   188 bits (477),  Expect(2) = 3e-85, Method: Compositional matrix adjust.
 Identities = 86/89 (97%), Positives = 88/89 (99%), Gaps = 0/89 (0%)
 Frame = +1

Query  316  LPLWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTR  495
            + LWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTR
Sbjct  75   IALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTR  134

Query  496  EHALLAFTLGVKQMICCCNKIDATTPKYS  582
            EHALLAFTLGVKQMICCCNK+DATTPKYS
Sbjct  135  EHALLAFTLGVKQMICCCNKMDATTPKYS  163


 Score =   154 bits (389),  Expect(2) = 3e-85, Method: Compositional matrix adjust.
 Identities = 75/77 (97%), Positives = 76/77 (99%), Gaps = 0/77 (0%)
 Frame = +3

Query  93   MGKEKVHISIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  272
            MGKEK HI+IVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKSHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  273  DKLKAERERGITIDIAL  323
            DKLKAERERGITIDIAL
Sbjct  61   DKLKAERERGITIDIAL  77



>sp|O24534.1|EF1A_VICFA RecName: Full=Elongation factor 1-alpha; Short=EF-1-alpha [Vicia 
faba]
 emb|CAA10847.1| elongation factor 1-alpha (EF1-a) [Vicia faba]
Length=447

 Score =   186 bits (472),  Expect(2) = 3e-85, Method: Compositional matrix adjust.
 Identities = 85/89 (96%), Positives = 88/89 (99%), Gaps = 0/89 (0%)
 Frame = +1

Query  316  LPLWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTR  495
            + LWKFET+KYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTR
Sbjct  75   IALWKFETSKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTR  134

Query  496  EHALLAFTLGVKQMICCCNKIDATTPKYS  582
            EHALLAFTLGVKQMICCCNK+DATTPKYS
Sbjct  135  EHALLAFTLGVKQMICCCNKMDATTPKYS  163


 Score =   156 bits (394),  Expect(2) = 3e-85, Method: Compositional matrix adjust.
 Identities = 76/77 (99%), Positives = 77/77 (100%), Gaps = 0/77 (0%)
 Frame = +3

Query  93   MGKEKVHISIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  272
            MGKEKVHI+IVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  273  DKLKAERERGITIDIAL  323
            DKLKAERERGITIDIAL
Sbjct  61   DKLKAERERGITIDIAL  77



>ref|XP_002892424.1| T6D22.2 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH68683.1| T6D22.2 [Arabidopsis lyrata subsp. lyrata]
Length=951

 Score =   187 bits (475),  Expect(2) = 3e-85, Method: Compositional matrix adjust.
 Identities = 86/89 (97%), Positives = 88/89 (99%), Gaps = 0/89 (0%)
 Frame = +1

Query  316  LPLWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTR  495
            + LWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTR
Sbjct  577  IALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTR  636

Query  496  EHALLAFTLGVKQMICCCNKIDATTPKYS  582
            EHALLAFTLGVKQMICCCNK+DATTPKYS
Sbjct  637  EHALLAFTLGVKQMICCCNKMDATTPKYS  665


 Score =   155 bits (391),  Expect(2) = 3e-85, Method: Compositional matrix adjust.
 Identities = 75/80 (94%), Positives = 78/80 (98%), Gaps = 0/80 (0%)
 Frame = +3

Query  84   KLRMGKEKVHISIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYA  263
            ++ MGKEK HI+IVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYA
Sbjct  500  RVTMGKEKFHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYA  559

Query  264  WVLDKLKAERERGITIDIAL  323
            WVLDKLKAERERGITIDIAL
Sbjct  560  WVLDKLKAERERGITIDIAL  579


 Score =   186 bits (473),  Expect(2) = 9e-85, Method: Compositional matrix adjust.
 Identities = 85/89 (96%), Positives = 88/89 (99%), Gaps = 0/89 (0%)
 Frame = +1

Query  316  LPLWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTR  495
            + LWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTR
Sbjct  75   IALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTR  134

Query  496  EHALLAFTLGVKQMICCCNKIDATTPKYS  582
            EHALLAFTLGVKQMICCCNK+DATTP+YS
Sbjct  135  EHALLAFTLGVKQMICCCNKMDATTPRYS  163


 Score =   154 bits (389),  Expect(2) = 9e-85, Method: Compositional matrix adjust.
 Identities = 75/77 (97%), Positives = 76/77 (99%), Gaps = 0/77 (0%)
 Frame = +3

Query  93   MGKEKVHISIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  272
            MGKEK HI+IVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKFHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  273  DKLKAERERGITIDIAL  323
            DKLKAERERGITIDIAL
Sbjct  61   DKLKAERERGITIDIAL  77



>ref|XP_008656156.1| PREDICTED: elongation factor 1-alpha-like isoform X2 [Zea mays]
 gb|AFW81467.1| putative translation elongation factor Tu family protein isoform 
1 [Zea mays]
 gb|AFW81468.1| putative translation elongation factor Tu family protein isoform 
2 [Zea mays]
 gb|AFW81469.1| putative translation elongation factor Tu family protein isoform 
3 [Zea mays]
Length=447

 Score =   188 bits (477),  Expect(2) = 3e-85, Method: Compositional matrix adjust.
 Identities = 86/89 (97%), Positives = 88/89 (99%), Gaps = 0/89 (0%)
 Frame = +1

Query  316  LPLWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTR  495
            + LWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTR
Sbjct  75   IALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTR  134

Query  496  EHALLAFTLGVKQMICCCNKIDATTPKYS  582
            EHALLAFTLGVKQMICCCNK+DATTPKYS
Sbjct  135  EHALLAFTLGVKQMICCCNKMDATTPKYS  163


 Score =   154 bits (389),  Expect(2) = 3e-85, Method: Compositional matrix adjust.
 Identities = 75/77 (97%), Positives = 76/77 (99%), Gaps = 0/77 (0%)
 Frame = +3

Query  93   MGKEKVHISIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  272
            MGKEK HI+IVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKSHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  273  DKLKAERERGITIDIAL  323
            DKLKAERERGITIDIAL
Sbjct  61   DKLKAERERGITIDIAL  77



>sp|Q41803.1|EF1A_MAIZE RecName: Full=Elongation factor 1-alpha; Short=EF-1-alpha [Zea 
mays]
 dbj|BAA08249.1| alpha subunit of tlanslation elongation factor 1 [Zea mays]
Length=447

 Score =   188 bits (477),  Expect(2) = 3e-85, Method: Compositional matrix adjust.
 Identities = 86/89 (97%), Positives = 88/89 (99%), Gaps = 0/89 (0%)
 Frame = +1

Query  316  LPLWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTR  495
            + LWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTR
Sbjct  75   IALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTR  134

Query  496  EHALLAFTLGVKQMICCCNKIDATTPKYS  582
            EHALLAFTLGVKQMICCCNK+DATTPKYS
Sbjct  135  EHALLAFTLGVKQMICCCNKMDATTPKYS  163


 Score =   154 bits (389),  Expect(2) = 3e-85, Method: Compositional matrix adjust.
 Identities = 75/77 (97%), Positives = 76/77 (99%), Gaps = 0/77 (0%)
 Frame = +3

Query  93   MGKEKVHISIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  272
            MGKEK HI+IVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKTHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  273  DKLKAERERGITIDIAL  323
            DKLKAERERGITIDIAL
Sbjct  61   DKLKAERERGITIDIAL  77



>ref|XP_009126611.1| PREDICTED: elongation factor 1-alpha 1-like [Brassica rapa]
 ref|XP_009126612.1| PREDICTED: elongation factor 1-alpha 1-like [Brassica rapa]
Length=449

 Score =   187 bits (476),  Expect(2) = 3e-85, Method: Compositional matrix adjust.
 Identities = 86/89 (97%), Positives = 88/89 (99%), Gaps = 0/89 (0%)
 Frame = +1

Query  316  LPLWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTR  495
            + LWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTR
Sbjct  75   IALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTR  134

Query  496  EHALLAFTLGVKQMICCCNKIDATTPKYS  582
            EHALLAFTLGVKQMICCCNK+DATTPKYS
Sbjct  135  EHALLAFTLGVKQMICCCNKMDATTPKYS  163


 Score =   154 bits (389),  Expect(2) = 3e-85, Method: Compositional matrix adjust.
 Identities = 75/77 (97%), Positives = 76/77 (99%), Gaps = 0/77 (0%)
 Frame = +3

Query  93   MGKEKVHISIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  272
            MGKEK HI+IVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKFHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  273  DKLKAERERGITIDIAL  323
            DKLKAERERGITIDIAL
Sbjct  61   DKLKAERERGITIDIAL  77



>ref|XP_008656153.1| PREDICTED: elongation factor 1-alpha-like [Zea mays]
 ref|XP_008656154.1| PREDICTED: elongation factor 1-alpha-like [Zea mays]
 gb|AFW81463.1| putative translation elongation factor Tu family protein isoform 
1 [Zea mays]
 gb|AFW81464.1| putative translation elongation factor Tu family protein isoform 
2 [Zea mays]
 gb|AFW81465.1| putative translation elongation factor Tu family protein isoform 
3 [Zea mays]
Length=447

 Score =   188 bits (477),  Expect(2) = 3e-85, Method: Compositional matrix adjust.
 Identities = 86/89 (97%), Positives = 88/89 (99%), Gaps = 0/89 (0%)
 Frame = +1

Query  316  LPLWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTR  495
            + LWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTR
Sbjct  75   IALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTR  134

Query  496  EHALLAFTLGVKQMICCCNKIDATTPKYS  582
            EHALLAFTLGVKQMICCCNK+DATTPKYS
Sbjct  135  EHALLAFTLGVKQMICCCNKMDATTPKYS  163


 Score =   154 bits (388),  Expect(2) = 3e-85, Method: Compositional matrix adjust.
 Identities = 75/77 (97%), Positives = 76/77 (99%), Gaps = 0/77 (0%)
 Frame = +3

Query  93   MGKEKVHISIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  272
            MGKEK HI+IVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKSHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  273  DKLKAERERGITIDIAL  323
            DKLKAERERGITIDIAL
Sbjct  61   DKLKAERERGITIDIAL  77



>ref|XP_008380545.1| PREDICTED: elongation factor 1-alpha-like [Malus domestica]
 ref|XP_008365661.1| PREDICTED: elongation factor 1-alpha [Malus domestica]
 ref|XP_009374568.1| PREDICTED: elongation factor 1-alpha-like [Pyrus x bretschneideri]
 ref|XP_009374577.1| PREDICTED: elongation factor 1-alpha-like [Pyrus x bretschneideri]
Length=447

 Score =   188 bits (477),  Expect(2) = 3e-85, Method: Compositional matrix adjust.
 Identities = 86/89 (97%), Positives = 88/89 (99%), Gaps = 0/89 (0%)
 Frame = +1

Query  316  LPLWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTR  495
            + LWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTR
Sbjct  75   IALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTR  134

Query  496  EHALLAFTLGVKQMICCCNKIDATTPKYS  582
            EHALLAFTLGVKQMICCCNK+DATTPKYS
Sbjct  135  EHALLAFTLGVKQMICCCNKMDATTPKYS  163


 Score =   154 bits (389),  Expect(2) = 3e-85, Method: Compositional matrix adjust.
 Identities = 75/77 (97%), Positives = 76/77 (99%), Gaps = 0/77 (0%)
 Frame = +3

Query  93   MGKEKVHISIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  272
            MGKEK HI+IVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKFHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  273  DKLKAERERGITIDIAL  323
            DKLKAERERGITIDIAL
Sbjct  61   DKLKAERERGITIDIAL  77



>ref|XP_001753059.1| predicted protein [Physcomitrella patens]
 gb|EDQ82100.1| predicted protein [Physcomitrella patens]
Length=447

 Score =   186 bits (472),  Expect(2) = 3e-85, Method: Compositional matrix adjust.
 Identities = 85/89 (96%), Positives = 87/89 (98%), Gaps = 0/89 (0%)
 Frame = +1

Query  316  LPLWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTR  495
            + LWKFET KYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTR
Sbjct  75   IALWKFETVKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTR  134

Query  496  EHALLAFTLGVKQMICCCNKIDATTPKYS  582
            EHALLAFTLGVKQMICCCNK+DATTPKYS
Sbjct  135  EHALLAFTLGVKQMICCCNKMDATTPKYS  163


 Score =   156 bits (394),  Expect(2) = 3e-85, Method: Compositional matrix adjust.
 Identities = 76/77 (99%), Positives = 77/77 (100%), Gaps = 0/77 (0%)
 Frame = +3

Query  93   MGKEKVHISIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  272
            MGKEKVHI+IVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  273  DKLKAERERGITIDIAL  323
            DKLKAERERGITIDIAL
Sbjct  61   DKLKAERERGITIDIAL  77



>gb|AAF79822.1|AC026875_2 T6D22.2 [Arabidopsis thaliana]
Length=967

 Score =   186 bits (473),  Expect(2) = 3e-85, Method: Compositional matrix adjust.
 Identities = 86/89 (97%), Positives = 88/89 (99%), Gaps = 0/89 (0%)
 Frame = +1

Query  316  LPLWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTR  495
            + LWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTR
Sbjct  593  IALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTR  652

Query  496  EHALLAFTLGVKQMICCCNKIDATTPKYS  582
            EHALLAFTLGVKQMICCCNK+DATTPKYS
Sbjct  653  EHALLAFTLGVKQMICCCNKMDATTPKYS  681


 Score =   155 bits (392),  Expect(2) = 3e-85, Method: Compositional matrix adjust.
 Identities = 76/79 (96%), Positives = 77/79 (97%), Gaps = 0/79 (0%)
 Frame = +3

Query  87   LRMGKEKVHISIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAW  266
            L MGKEK HI+IVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAW
Sbjct  517  LTMGKEKFHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAW  576

Query  267  VLDKLKAERERGITIDIAL  323
            VLDKLKAERERGITIDIAL
Sbjct  577  VLDKLKAERERGITIDIAL  595


 Score =   186 bits (473),  Expect(2) = 8e-85, Method: Compositional matrix adjust.
 Identities = 86/89 (97%), Positives = 88/89 (99%), Gaps = 0/89 (0%)
 Frame = +1

Query  316  LPLWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTR  495
            + LWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTR
Sbjct  75   IALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTR  134

Query  496  EHALLAFTLGVKQMICCCNKIDATTPKYS  582
            EHALLAFTLGVKQMICCCNK+DATTPKYS
Sbjct  135  EHALLAFTLGVKQMICCCNKMDATTPKYS  163


 Score =   154 bits (389),  Expect(2) = 8e-85, Method: Compositional matrix adjust.
 Identities = 75/77 (97%), Positives = 76/77 (99%), Gaps = 0/77 (0%)
 Frame = +3

Query  93   MGKEKVHISIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  272
            MGKEK HI+IVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKFHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  273  DKLKAERERGITIDIAL  323
            DKLKAERERGITIDIAL
Sbjct  61   DKLKAERERGITIDIAL  77



>ref|XP_011040946.1| PREDICTED: elongation factor 1-alpha-like isoform X2 [Populus 
euphratica]
Length=449

 Score =   188 bits (477),  Expect(2) = 3e-85, Method: Compositional matrix adjust.
 Identities = 86/89 (97%), Positives = 88/89 (99%), Gaps = 0/89 (0%)
 Frame = +1

Query  316  LPLWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTR  495
            + LWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTR
Sbjct  75   IALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTR  134

Query  496  EHALLAFTLGVKQMICCCNKIDATTPKYS  582
            EHALLAFTLGVKQMICCCNK+DATTPKYS
Sbjct  135  EHALLAFTLGVKQMICCCNKMDATTPKYS  163


 Score =   154 bits (388),  Expect(2) = 3e-85, Method: Compositional matrix adjust.
 Identities = 75/77 (97%), Positives = 76/77 (99%), Gaps = 0/77 (0%)
 Frame = +3

Query  93   MGKEKVHISIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  272
            MGKEK HI+IVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKSHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  273  DKLKAERERGITIDIAL  323
            DKLKAERERGITIDIAL
Sbjct  61   DKLKAERERGITIDIAL  77



>gb|AFW77593.1| putative translation elongation factor Tu family protein isoform 
1 [Zea mays]
 gb|AFW77594.1| putative translation elongation factor Tu family protein isoform 
2 [Zea mays]
Length=447

 Score =   188 bits (477),  Expect(2) = 3e-85, Method: Compositional matrix adjust.
 Identities = 86/89 (97%), Positives = 88/89 (99%), Gaps = 0/89 (0%)
 Frame = +1

Query  316  LPLWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTR  495
            + LWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTR
Sbjct  75   IALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTR  134

Query  496  EHALLAFTLGVKQMICCCNKIDATTPKYS  582
            EHALLAFTLGVKQMICCCNK+DATTPKYS
Sbjct  135  EHALLAFTLGVKQMICCCNKMDATTPKYS  163


 Score =   154 bits (389),  Expect(2) = 3e-85, Method: Compositional matrix adjust.
 Identities = 75/77 (97%), Positives = 76/77 (99%), Gaps = 0/77 (0%)
 Frame = +3

Query  93   MGKEKVHISIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  272
            MGKEK HI+IVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKSHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  273  DKLKAERERGITIDIAL  323
            DKLKAERERGITIDIAL
Sbjct  61   DKLKAERERGITIDIAL  77



>ref|XP_011026991.1| PREDICTED: elongation factor 1-alpha isoform X1 [Populus euphratica]
 ref|XP_011026997.1| PREDICTED: elongation factor 1-alpha [Populus euphratica]
 ref|XP_011040951.1| PREDICTED: elongation factor 1-alpha [Populus euphratica]
Length=449

 Score =   187 bits (476),  Expect(2) = 3e-85, Method: Compositional matrix adjust.
 Identities = 86/89 (97%), Positives = 88/89 (99%), Gaps = 0/89 (0%)
 Frame = +1

Query  316  LPLWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTR  495
            + LWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTR
Sbjct  75   IALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTR  134

Query  496  EHALLAFTLGVKQMICCCNKIDATTPKYS  582
            EHALLAFTLGVKQMICCCNK+DATTPKYS
Sbjct  135  EHALLAFTLGVKQMICCCNKMDATTPKYS  163


 Score =   154 bits (390),  Expect(2) = 3e-85, Method: Compositional matrix adjust.
 Identities = 75/77 (97%), Positives = 76/77 (99%), Gaps = 0/77 (0%)
 Frame = +3

Query  93   MGKEKVHISIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  272
            MGKEK HI+IVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKTHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  273  DKLKAERERGITIDIAL  323
            DKLKAERERGITIDIAL
Sbjct  61   DKLKAERERGITIDIAL  77



>ref|XP_006417745.1| hypothetical protein EUTSA_v10007619mg [Eutrema salsugineum]
 ref|XP_006417746.1| hypothetical protein EUTSA_v10007619mg [Eutrema salsugineum]
 ref|XP_006417749.1| hypothetical protein EUTSA_v10007620mg [Eutrema salsugineum]
 ref|XP_006417750.1| hypothetical protein EUTSA_v10007618mg [Eutrema salsugineum]
 ref|XP_006417751.1| hypothetical protein EUTSA_v10007618mg [Eutrema salsugineum]
 ref|XP_006400853.1| hypothetical protein EUTSA_v10013526mg [Eutrema salsugineum]
 dbj|BAJ33644.1| unnamed protein product [Thellungiella halophila]
 gb|ESQ36098.1| hypothetical protein EUTSA_v10007619mg [Eutrema salsugineum]
 gb|ESQ36099.1| hypothetical protein EUTSA_v10007619mg [Eutrema salsugineum]
 gb|ESQ36102.1| hypothetical protein EUTSA_v10007620mg [Eutrema salsugineum]
 gb|ESQ36103.1| hypothetical protein EUTSA_v10007618mg [Eutrema salsugineum]
 gb|ESQ36104.1| hypothetical protein EUTSA_v10007618mg [Eutrema salsugineum]
 gb|ESQ42306.1| hypothetical protein EUTSA_v10013526mg [Eutrema salsugineum]
Length=449

 Score =   187 bits (476),  Expect(2) = 3e-85, Method: Compositional matrix adjust.
 Identities = 86/89 (97%), Positives = 88/89 (99%), Gaps = 0/89 (0%)
 Frame = +1

Query  316  LPLWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTR  495
            + LWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTR
Sbjct  75   IALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTR  134

Query  496  EHALLAFTLGVKQMICCCNKIDATTPKYS  582
            EHALLAFTLGVKQMICCCNK+DATTPKYS
Sbjct  135  EHALLAFTLGVKQMICCCNKMDATTPKYS  163


 Score =   154 bits (389),  Expect(2) = 3e-85, Method: Compositional matrix adjust.
 Identities = 75/77 (97%), Positives = 76/77 (99%), Gaps = 0/77 (0%)
 Frame = +3

Query  93   MGKEKVHISIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  272
            MGKEK HI+IVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKFHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  273  DKLKAERERGITIDIAL  323
            DKLKAERERGITIDIAL
Sbjct  61   DKLKAERERGITIDIAL  77



>ref|XP_011004182.1| PREDICTED: elongation factor 1-alpha-like [Populus euphratica]
 ref|XP_011010862.1| PREDICTED: elongation factor 1-alpha-like [Populus euphratica]
Length=447

 Score =   187 bits (475),  Expect(2) = 3e-85, Method: Compositional matrix adjust.
 Identities = 86/89 (97%), Positives = 88/89 (99%), Gaps = 0/89 (0%)
 Frame = +1

Query  316  LPLWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTR  495
            + LWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTR
Sbjct  75   IALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTR  134

Query  496  EHALLAFTLGVKQMICCCNKIDATTPKYS  582
            EHALLAFTLGVKQMICCCNK+DATTPKYS
Sbjct  135  EHALLAFTLGVKQMICCCNKMDATTPKYS  163


 Score =   154 bits (390),  Expect(2) = 3e-85, Method: Compositional matrix adjust.
 Identities = 75/77 (97%), Positives = 76/77 (99%), Gaps = 0/77 (0%)
 Frame = +3

Query  93   MGKEKVHISIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  272
            MGKEK HI+IVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKTHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  273  DKLKAERERGITIDIAL  323
            DKLKAERERGITIDIAL
Sbjct  61   DKLKAERERGITIDIAL  77



>gb|KHG15275.1| Elongation factor 1-alpha [Gossypium arboreum]
Length=431

 Score =   187 bits (476),  Expect(2) = 3e-85, Method: Compositional matrix adjust.
 Identities = 86/89 (97%), Positives = 88/89 (99%), Gaps = 0/89 (0%)
 Frame = +1

Query  316  LPLWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTR  495
            + LWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTR
Sbjct  75   IALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTR  134

Query  496  EHALLAFTLGVKQMICCCNKIDATTPKYS  582
            EHALLAFTLGVKQMICCCNK+DATTPKYS
Sbjct  135  EHALLAFTLGVKQMICCCNKMDATTPKYS  163


 Score =   154 bits (390),  Expect(2) = 3e-85, Method: Compositional matrix adjust.
 Identities = 75/77 (97%), Positives = 76/77 (99%), Gaps = 0/77 (0%)
 Frame = +3

Query  93   MGKEKVHISIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  272
            MGKEK HI+IVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKTHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  273  DKLKAERERGITIDIAL  323
            DKLKAERERGITIDIAL
Sbjct  61   DKLKAERERGITIDIAL  77



>ref|XP_006858667.1| hypothetical protein AMTR_s00066p00072310 [Amborella trichopoda]
 gb|ERN20134.1| hypothetical protein AMTR_s00066p00072310 [Amborella trichopoda]
Length=447

 Score =   188 bits (477),  Expect(2) = 3e-85, Method: Compositional matrix adjust.
 Identities = 86/89 (97%), Positives = 88/89 (99%), Gaps = 0/89 (0%)
 Frame = +1

Query  316  LPLWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTR  495
            + LWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTR
Sbjct  75   IALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTR  134

Query  496  EHALLAFTLGVKQMICCCNKIDATTPKYS  582
            EHALLAFTLGVKQMICCCNK+DATTPKYS
Sbjct  135  EHALLAFTLGVKQMICCCNKMDATTPKYS  163


 Score =   154 bits (389),  Expect(2) = 3e-85, Method: Compositional matrix adjust.
 Identities = 75/77 (97%), Positives = 76/77 (99%), Gaps = 0/77 (0%)
 Frame = +3

Query  93   MGKEKVHISIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  272
            MGKEK HI+IVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKFHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  273  DKLKAERERGITIDIAL  323
            DKLKAERERGITIDIAL
Sbjct  61   DKLKAERERGITIDIAL  77



>gb|AEQ75495.1| elongation factor 1-alpha [Rosa multiflora]
Length=447

 Score =   188 bits (477),  Expect(2) = 3e-85, Method: Compositional matrix adjust.
 Identities = 86/89 (97%), Positives = 88/89 (99%), Gaps = 0/89 (0%)
 Frame = +1

Query  316  LPLWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTR  495
            + LWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTR
Sbjct  75   IALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTR  134

Query  496  EHALLAFTLGVKQMICCCNKIDATTPKYS  582
            EHALLAFTLGVKQMICCCNK+DATTPKYS
Sbjct  135  EHALLAFTLGVKQMICCCNKMDATTPKYS  163


 Score =   154 bits (389),  Expect(2) = 3e-85, Method: Compositional matrix adjust.
 Identities = 75/77 (97%), Positives = 76/77 (99%), Gaps = 0/77 (0%)
 Frame = +3

Query  93   MGKEKVHISIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  272
            MGKEK HI+IVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKFHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  273  DKLKAERERGITIDIAL  323
            DKLKAERERGITIDIAL
Sbjct  61   DKLKAERERGITIDIAL  77



>ref|NP_001105934.1| elongation factor alpha7 [Zea mays]
 gb|AAF42981.1| elongation factor 1 alpha [Zea mays]
Length=447

 Score =   188 bits (478),  Expect(2) = 3e-85, Method: Compositional matrix adjust.
 Identities = 86/89 (97%), Positives = 88/89 (99%), Gaps = 0/89 (0%)
 Frame = +1

Query  316  LPLWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTR  495
            + LWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTR
Sbjct  75   IALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTR  134

Query  496  EHALLAFTLGVKQMICCCNKIDATTPKYS  582
            EHALLAFTLGVKQMICCCNK+DATTPKYS
Sbjct  135  EHALLAFTLGVKQMICCCNKMDATTPKYS  163


 Score =   154 bits (388),  Expect(2) = 3e-85, Method: Compositional matrix adjust.
 Identities = 75/77 (97%), Positives = 76/77 (99%), Gaps = 0/77 (0%)
 Frame = +3

Query  93   MGKEKVHISIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  272
            MGKEK HI+IVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKSHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  273  DKLKAERERGITIDIAL  323
            DKLKAERERGITIDIAL
Sbjct  61   DKLKAERERGITIDIAL  77



>gb|ACR38047.1| unknown [Zea mays]
 gb|AFW77623.1| elongation factor alpha1 [Zea mays]
Length=447

 Score =   188 bits (477),  Expect(2) = 3e-85, Method: Compositional matrix adjust.
 Identities = 86/89 (97%), Positives = 88/89 (99%), Gaps = 0/89 (0%)
 Frame = +1

Query  316  LPLWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTR  495
            + LWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTR
Sbjct  75   IALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTR  134

Query  496  EHALLAFTLGVKQMICCCNKIDATTPKYS  582
            EHALLAFTLGVKQMICCCNK+DATTPKYS
Sbjct  135  EHALLAFTLGVKQMICCCNKMDATTPKYS  163


 Score =   154 bits (388),  Expect(2) = 3e-85, Method: Compositional matrix adjust.
 Identities = 75/77 (97%), Positives = 76/77 (99%), Gaps = 0/77 (0%)
 Frame = +3

Query  93   MGKEKVHISIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  272
            MGKEK HI+IVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKSHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  273  DKLKAERERGITIDIAL  323
            DKLKAERERGITIDIAL
Sbjct  61   DKLKAERERGITIDIAL  77



>gb|ACI96243.1| elongation factor 1-alpha [Prunus persica]
Length=447

 Score =   188 bits (477),  Expect(2) = 3e-85, Method: Compositional matrix adjust.
 Identities = 86/89 (97%), Positives = 88/89 (99%), Gaps = 0/89 (0%)
 Frame = +1

Query  316  LPLWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTR  495
            + LWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTR
Sbjct  75   IALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTR  134

Query  496  EHALLAFTLGVKQMICCCNKIDATTPKYS  582
            EHALLAFTLGVKQMICCCNK+DATTPKYS
Sbjct  135  EHALLAFTLGVKQMICCCNKMDATTPKYS  163


 Score =   154 bits (389),  Expect(2) = 3e-85, Method: Compositional matrix adjust.
 Identities = 75/77 (97%), Positives = 76/77 (99%), Gaps = 0/77 (0%)
 Frame = +3

Query  93   MGKEKVHISIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  272
            MGKEK HI+IVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKFHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  273  DKLKAERERGITIDIAL  323
            DKLKAERERGITIDIAL
Sbjct  61   DKLKAERERGITIDIAL  77



>ref|XP_004489551.1| PREDICTED: elongation factor 1-alpha-like [Cicer arietinum]
 ref|XP_004489552.1| PREDICTED: elongation factor 1-alpha-like [Cicer arietinum]
Length=447

 Score =   187 bits (476),  Expect(2) = 3e-85, Method: Compositional matrix adjust.
 Identities = 86/89 (97%), Positives = 88/89 (99%), Gaps = 0/89 (0%)
 Frame = +1

Query  316  LPLWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTR  495
            + LWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTR
Sbjct  75   IALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTR  134

Query  496  EHALLAFTLGVKQMICCCNKIDATTPKYS  582
            EHALLAFTLGVKQMICCCNK+DATTPKYS
Sbjct  135  EHALLAFTLGVKQMICCCNKMDATTPKYS  163


 Score =   154 bits (389),  Expect(2) = 3e-85, Method: Compositional matrix adjust.
 Identities = 75/77 (97%), Positives = 76/77 (99%), Gaps = 0/77 (0%)
 Frame = +3

Query  93   MGKEKVHISIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  272
            MGKEK HI+IVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKFHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  273  DKLKAERERGITIDIAL  323
            DKLKAERERGITIDIAL
Sbjct  61   DKLKAERERGITIDIAL  77



>gb|AAN31833.1| putative translation elongation factor eEF-1 alpha chain (gene 
A4) [Arabidopsis thaliana]
Length=449

 Score =   187 bits (476),  Expect(2) = 3e-85, Method: Compositional matrix adjust.
 Identities = 86/89 (97%), Positives = 88/89 (99%), Gaps = 0/89 (0%)
 Frame = +1

Query  316  LPLWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTR  495
            + LWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTR
Sbjct  75   IALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTR  134

Query  496  EHALLAFTLGVKQMICCCNKIDATTPKYS  582
            EHALLAFTLGVKQMICCCNK+DATTPKYS
Sbjct  135  EHALLAFTLGVKQMICCCNKMDATTPKYS  163


 Score =   154 bits (389),  Expect(2) = 3e-85, Method: Compositional matrix adjust.
 Identities = 75/77 (97%), Positives = 76/77 (99%), Gaps = 0/77 (0%)
 Frame = +3

Query  93   MGKEKVHISIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  272
            MGKEK HI+IVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKFHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  273  DKLKAERERGITIDIAL  323
            DKLKAERERGITIDIAL
Sbjct  61   DKLKAERERGITIDIAL  77



>ref|XP_007222129.1| hypothetical protein PRUPE_ppa005702mg [Prunus persica]
 ref|XP_008224523.1| PREDICTED: elongation factor 1-alpha-like [Prunus mume]
 gb|EMJ23328.1| hypothetical protein PRUPE_ppa005702mg [Prunus persica]
Length=447

 Score =   188 bits (477),  Expect(2) = 3e-85, Method: Compositional matrix adjust.
 Identities = 86/89 (97%), Positives = 88/89 (99%), Gaps = 0/89 (0%)
 Frame = +1

Query  316  LPLWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTR  495
            + LWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTR
Sbjct  75   IALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTR  134

Query  496  EHALLAFTLGVKQMICCCNKIDATTPKYS  582
            EHALLAFTLGVKQMICCCNK+DATTPKYS
Sbjct  135  EHALLAFTLGVKQMICCCNKMDATTPKYS  163


 Score =   154 bits (388),  Expect(2) = 3e-85, Method: Compositional matrix adjust.
 Identities = 75/77 (97%), Positives = 76/77 (99%), Gaps = 0/77 (0%)
 Frame = +3

Query  93   MGKEKVHISIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  272
            MGKEK HI+IVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKFHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  273  DKLKAERERGITIDIAL  323
            DKLKAERERGITIDIAL
Sbjct  61   DKLKAERERGITIDIAL  77



>gb|AFW90638.1| elongation factor 1-alpha-like protein [Solanum tuberosum]
Length=309

 Score =   186 bits (471),  Expect(2) = 3e-85, Method: Compositional matrix adjust.
 Identities = 86/89 (97%), Positives = 88/89 (99%), Gaps = 0/89 (0%)
 Frame = +1

Query  316  LPLWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTR  495
            + LWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTR
Sbjct  75   IALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTR  134

Query  496  EHALLAFTLGVKQMICCCNKIDATTPKYS  582
            EHALLAFTLGVKQMICCCNK+DATTPKYS
Sbjct  135  EHALLAFTLGVKQMICCCNKMDATTPKYS  163


 Score =   156 bits (394),  Expect(2) = 3e-85, Method: Compositional matrix adjust.
 Identities = 76/77 (99%), Positives = 77/77 (100%), Gaps = 0/77 (0%)
 Frame = +3

Query  93   MGKEKVHISIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  272
            MGKEK+HISIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKIHISIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  273  DKLKAERERGITIDIAL  323
            DKLKAERERGITIDIAL
Sbjct  61   DKLKAERERGITIDIAL  77



>gb|EYU18863.1| hypothetical protein MIMGU_mgv1a006280mg [Erythranthe guttata]
 gb|EYU18864.1| hypothetical protein MIMGU_mgv1a006280mg [Erythranthe guttata]
 gb|EYU18866.1| hypothetical protein MIMGU_mgv11b005172mg [Erythranthe guttata]
 gb|EYU18867.1| hypothetical protein MIMGU_mgv1a006307mg [Erythranthe guttata]
Length=449

 Score =   187 bits (476),  Expect(2) = 4e-85, Method: Compositional matrix adjust.
 Identities = 86/89 (97%), Positives = 88/89 (99%), Gaps = 0/89 (0%)
 Frame = +1

Query  316  LPLWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTR  495
            + LWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTR
Sbjct  75   IALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTR  134

Query  496  EHALLAFTLGVKQMICCCNKIDATTPKYS  582
            EHALLAFTLGVKQMICCCNK+DATTPKYS
Sbjct  135  EHALLAFTLGVKQMICCCNKMDATTPKYS  163


 Score =   154 bits (389),  Expect(2) = 4e-85, Method: Compositional matrix adjust.
 Identities = 75/77 (97%), Positives = 76/77 (99%), Gaps = 0/77 (0%)
 Frame = +3

Query  93   MGKEKVHISIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  272
            MGKEK HI+IVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKFHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  273  DKLKAERERGITIDIAL  323
            DKLKAERERGITIDIAL
Sbjct  61   DKLKAERERGITIDIAL  77



>gb|EMS59091.1| Elongation factor 1-alpha [Triticum urartu]
Length=496

 Score =   187 bits (476),  Expect(2) = 4e-85, Method: Compositional matrix adjust.
 Identities = 86/89 (97%), Positives = 88/89 (99%), Gaps = 0/89 (0%)
 Frame = +1

Query  316  LPLWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTR  495
            + LWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTR
Sbjct  124  IALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTR  183

Query  496  EHALLAFTLGVKQMICCCNKIDATTPKYS  582
            EHALLAFTLGVKQMICCCNK+DATTPKYS
Sbjct  184  EHALLAFTLGVKQMICCCNKMDATTPKYS  212


 Score =   154 bits (390),  Expect(2) = 4e-85, Method: Compositional matrix adjust.
 Identities = 75/77 (97%), Positives = 76/77 (99%), Gaps = 0/77 (0%)
 Frame = +3

Query  93   MGKEKVHISIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  272
            MGKEK HI+IVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  50   MGKEKTHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  109

Query  273  DKLKAERERGITIDIAL  323
            DKLKAERERGITIDIAL
Sbjct  110  DKLKAERERGITIDIAL  126



>ref|XP_009131916.1| PREDICTED: elongation factor 1-alpha 1-like [Brassica rapa]
Length=449

 Score =   187 bits (476),  Expect(2) = 4e-85, Method: Compositional matrix adjust.
 Identities = 86/89 (97%), Positives = 88/89 (99%), Gaps = 0/89 (0%)
 Frame = +1

Query  316  LPLWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTR  495
            + LWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTR
Sbjct  75   IALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTR  134

Query  496  EHALLAFTLGVKQMICCCNKIDATTPKYS  582
            EHALLAFTLGVKQMICCCNK+DATTPKYS
Sbjct  135  EHALLAFTLGVKQMICCCNKMDATTPKYS  163


 Score =   154 bits (389),  Expect(2) = 4e-85, Method: Compositional matrix adjust.
 Identities = 75/77 (97%), Positives = 76/77 (99%), Gaps = 0/77 (0%)
 Frame = +3

Query  93   MGKEKVHISIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  272
            MGKEK HI+IVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKFHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  273  DKLKAERERGITIDIAL  323
            DKLKAERERGITIDIAL
Sbjct  61   DKLKAERERGITIDIAL  77



>gb|ACG34498.1| elongation factor 1-alpha [Zea mays]
Length=447

 Score =   187 bits (476),  Expect(2) = 4e-85, Method: Compositional matrix adjust.
 Identities = 86/89 (97%), Positives = 88/89 (99%), Gaps = 0/89 (0%)
 Frame = +1

Query  316  LPLWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTR  495
            + LWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTR
Sbjct  75   IALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTR  134

Query  496  EHALLAFTLGVKQMICCCNKIDATTPKYS  582
            EHALLAFTLGVKQMICCCNK+DATTPKYS
Sbjct  135  EHALLAFTLGVKQMICCCNKMDATTPKYS  163


 Score =   154 bits (389),  Expect(2) = 4e-85, Method: Compositional matrix adjust.
 Identities = 75/77 (97%), Positives = 76/77 (99%), Gaps = 0/77 (0%)
 Frame = +3

Query  93   MGKEKVHISIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  272
            MGKEK HI+IVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKSHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  273  DKLKAERERGITIDIAL  323
            DKLKAERERGITIDIAL
Sbjct  61   DKLKAERERGITIDIAL  77



>ref|XP_001766482.1| predicted protein [Physcomitrella patens]
 gb|EDQ68810.1| predicted protein [Physcomitrella patens]
Length=447

 Score =   186 bits (471),  Expect(2) = 4e-85, Method: Compositional matrix adjust.
 Identities = 85/89 (96%), Positives = 87/89 (98%), Gaps = 0/89 (0%)
 Frame = +1

Query  316  LPLWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTR  495
            + LWKFET KYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTR
Sbjct  75   IALWKFETVKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTR  134

Query  496  EHALLAFTLGVKQMICCCNKIDATTPKYS  582
            EHALLAFTLGVKQMICCCNK+DATTPKYS
Sbjct  135  EHALLAFTLGVKQMICCCNKMDATTPKYS  163


 Score =   156 bits (394),  Expect(2) = 4e-85, Method: Compositional matrix adjust.
 Identities = 76/77 (99%), Positives = 77/77 (100%), Gaps = 0/77 (0%)
 Frame = +3

Query  93   MGKEKVHISIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  272
            MGKEKVHI+IVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  273  DKLKAERERGITIDIAL  323
            DKLKAERERGITIDIAL
Sbjct  61   DKLKAERERGITIDIAL  77



>ref|XP_004962249.1| PREDICTED: elongation factor 1-alpha-like [Setaria italica]
 ref|XP_004962250.1| PREDICTED: elongation factor 1-alpha-like [Setaria italica]
 ref|XP_004962268.1| PREDICTED: elongation factor 1-alpha-like [Setaria italica]
 ref|XP_004962269.1| PREDICTED: elongation factor 1-alpha-like [Setaria italica]
 ref|XP_004962270.1| PREDICTED: elongation factor 1-alpha-like isoform X1 [Setaria 
italica]
 ref|XP_004962271.1| PREDICTED: elongation factor 1-alpha-like isoform X2 [Setaria 
italica]
Length=447

 Score =   188 bits (477),  Expect(2) = 4e-85, Method: Compositional matrix adjust.
 Identities = 86/89 (97%), Positives = 88/89 (99%), Gaps = 0/89 (0%)
 Frame = +1

Query  316  LPLWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTR  495
            + LWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTR
Sbjct  75   IALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTR  134

Query  496  EHALLAFTLGVKQMICCCNKIDATTPKYS  582
            EHALLAFTLGVKQMICCCNK+DATTPKYS
Sbjct  135  EHALLAFTLGVKQMICCCNKMDATTPKYS  163


 Score =   154 bits (388),  Expect(2) = 4e-85, Method: Compositional matrix adjust.
 Identities = 75/77 (97%), Positives = 76/77 (99%), Gaps = 0/77 (0%)
 Frame = +3

Query  93   MGKEKVHISIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  272
            MGKEK HI+IVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKSHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  273  DKLKAERERGITIDIAL  323
            DKLKAERERGITIDIAL
Sbjct  61   DKLKAERERGITIDIAL  77



>ref|XP_009783256.1| PREDICTED: elongation factor 1-alpha [Nicotiana sylvestris]
 dbj|BAA09709.1| elongation factor-1 alpha [Nicotiana tabacum]
Length=447

 Score =   187 bits (476),  Expect(2) = 4e-85, Method: Compositional matrix adjust.
 Identities = 86/89 (97%), Positives = 88/89 (99%), Gaps = 0/89 (0%)
 Frame = +1

Query  316  LPLWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTR  495
            + LWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTR
Sbjct  75   IALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTR  134

Query  496  EHALLAFTLGVKQMICCCNKIDATTPKYS  582
            EHALLAFTLGVKQMICCCNK+DATTPKYS
Sbjct  135  EHALLAFTLGVKQMICCCNKMDATTPKYS  163


 Score =   154 bits (389),  Expect(2) = 4e-85, Method: Compositional matrix adjust.
 Identities = 75/77 (97%), Positives = 76/77 (99%), Gaps = 0/77 (0%)
 Frame = +3

Query  93   MGKEKVHISIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  272
            MGKEK HI+IVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKFHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  273  DKLKAERERGITIDIAL  323
            DKLKAERERGITIDIAL
Sbjct  61   DKLKAERERGITIDIAL  77



>ref|XP_009793830.1| PREDICTED: elongation factor 1-alpha-like [Nicotiana sylvestris]
Length=447

 Score =   187 bits (476),  Expect(2) = 4e-85, Method: Compositional matrix adjust.
 Identities = 86/89 (97%), Positives = 88/89 (99%), Gaps = 0/89 (0%)
 Frame = +1

Query  316  LPLWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTR  495
            + LWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTR
Sbjct  75   IALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTR  134

Query  496  EHALLAFTLGVKQMICCCNKIDATTPKYS  582
            EHALLAFTLGVKQMICCCNK+DATTPKYS
Sbjct  135  EHALLAFTLGVKQMICCCNKMDATTPKYS  163


 Score =   154 bits (389),  Expect(2) = 4e-85, Method: Compositional matrix adjust.
 Identities = 75/77 (97%), Positives = 76/77 (99%), Gaps = 0/77 (0%)
 Frame = +3

Query  93   MGKEKVHISIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  272
            MGKEK HI+IVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKFHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  273  DKLKAERERGITIDIAL  323
            DKLKAERERGITIDIAL
Sbjct  61   DKLKAERERGITIDIAL  77



>sp|P43643.1|EF1A_TOBAC RecName: Full=Elongation factor 1-alpha; Short=EF-1-alpha; AltName: 
Full=Vitronectin-like adhesion protein 1; Short=PVN1 
[Nicotiana tabacum]
 gb|AAA20836.1| vitronectin-like adhesion protein [Nicotiana tabacum]
Length=447

 Score =   187 bits (476),  Expect(2) = 4e-85, Method: Compositional matrix adjust.
 Identities = 86/89 (97%), Positives = 88/89 (99%), Gaps = 0/89 (0%)
 Frame = +1

Query  316  LPLWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTR  495
            + LWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTR
Sbjct  75   IALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTR  134

Query  496  EHALLAFTLGVKQMICCCNKIDATTPKYS  582
            EHALLAFTLGVKQMICCCNK+DATTPKYS
Sbjct  135  EHALLAFTLGVKQMICCCNKMDATTPKYS  163


 Score =   154 bits (389),  Expect(2) = 4e-85, Method: Compositional matrix adjust.
 Identities = 75/77 (97%), Positives = 76/77 (99%), Gaps = 0/77 (0%)
 Frame = +3

Query  93   MGKEKVHISIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  272
            MGKEK HI+IVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKFHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  273  DKLKAERERGITIDIAL  323
            DKLKAERERGITIDIAL
Sbjct  61   DKLKAERERGITIDIAL  77



>ref|XP_004962277.1| PREDICTED: elongation factor 1-alpha-like isoform X1 [Setaria 
italica]
 ref|XP_004962278.1| PREDICTED: elongation factor 1-alpha-like isoform X2 [Setaria 
italica]
 ref|XP_004962279.1| PREDICTED: elongation factor 1-alpha-like [Setaria italica]
Length=447

 Score =   188 bits (477),  Expect(2) = 4e-85, Method: Compositional matrix adjust.
 Identities = 86/89 (97%), Positives = 88/89 (99%), Gaps = 0/89 (0%)
 Frame = +1

Query  316  LPLWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTR  495
            + LWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTR
Sbjct  75   IALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTR  134

Query  496  EHALLAFTLGVKQMICCCNKIDATTPKYS  582
            EHALLAFTLGVKQMICCCNK+DATTPKYS
Sbjct  135  EHALLAFTLGVKQMICCCNKMDATTPKYS  163


 Score =   154 bits (388),  Expect(2) = 4e-85, Method: Compositional matrix adjust.
 Identities = 75/77 (97%), Positives = 76/77 (99%), Gaps = 0/77 (0%)
 Frame = +3

Query  93   MGKEKVHISIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  272
            MGKEK HI+IVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKSHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  273  DKLKAERERGITIDIAL  323
            DKLKAERERGITIDIAL
Sbjct  61   DKLKAERERGITIDIAL  77



>dbj|BAC22127.1| eukaryotic elongation factor 1A [Salsola komarovii]
Length=447

 Score =   186 bits (471),  Expect(2) = 4e-85, Method: Compositional matrix adjust.
 Identities = 84/89 (94%), Positives = 87/89 (98%), Gaps = 0/89 (0%)
 Frame = +1

Query  316  LPLWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTR  495
            + LWKFET KYYCTVIDAPGHRDFIKNMITGTSQADCA+LIIDSTTGGFEAGISKDGQTR
Sbjct  75   IALWKFETNKYYCTVIDAPGHRDFIKNMITGTSQADCAILIIDSTTGGFEAGISKDGQTR  134

Query  496  EHALLAFTLGVKQMICCCNKIDATTPKYS  582
            EHALLAFTLGVKQMICCCNK+DATTPKYS
Sbjct  135  EHALLAFTLGVKQMICCCNKMDATTPKYS  163


 Score =   156 bits (394),  Expect(2) = 4e-85, Method: Compositional matrix adjust.
 Identities = 75/77 (97%), Positives = 77/77 (100%), Gaps = 0/77 (0%)
 Frame = +3

Query  93   MGKEKVHISIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  272
            MGKEK+HIS+VVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKIHISLVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  273  DKLKAERERGITIDIAL  323
            DKLKAERERGITIDIAL
Sbjct  61   DKLKAERERGITIDIAL  77



>gb|KHG20498.1| Elongation factor 1-alpha [Gossypium arboreum]
Length=447

 Score =   188 bits (477),  Expect(2) = 4e-85, Method: Compositional matrix adjust.
 Identities = 86/89 (97%), Positives = 88/89 (99%), Gaps = 0/89 (0%)
 Frame = +1

Query  316  LPLWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTR  495
            + LWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTR
Sbjct  75   IALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTR  134

Query  496  EHALLAFTLGVKQMICCCNKIDATTPKYS  582
            EHALLAFTLGVKQMICCCNK+DATTPKYS
Sbjct  135  EHALLAFTLGVKQMICCCNKMDATTPKYS  163


 Score =   154 bits (388),  Expect(2) = 4e-85, Method: Compositional matrix adjust.
 Identities = 75/77 (97%), Positives = 76/77 (99%), Gaps = 0/77 (0%)
 Frame = +3

Query  93   MGKEKVHISIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  272
            MGKEK HI+IVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKSHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  273  DKLKAERERGITIDIAL  323
            DKLKAERERGITIDIAL
Sbjct  61   DKLKAERERGITIDIAL  77



>ref|XP_004984833.1| PREDICTED: elongation factor 1-alpha-like [Setaria italica]
 ref|XP_004984834.1| PREDICTED: elongation factor 1-alpha-like [Setaria italica]
Length=447

 Score =   188 bits (477),  Expect(2) = 4e-85, Method: Compositional matrix adjust.
 Identities = 86/89 (97%), Positives = 88/89 (99%), Gaps = 0/89 (0%)
 Frame = +1

Query  316  LPLWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTR  495
            + LWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTR
Sbjct  75   IALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTR  134

Query  496  EHALLAFTLGVKQMICCCNKIDATTPKYS  582
            EHALLAFTLGVKQMICCCNK+DATTPKYS
Sbjct  135  EHALLAFTLGVKQMICCCNKMDATTPKYS  163


 Score =   154 bits (388),  Expect(2) = 4e-85, Method: Compositional matrix adjust.
 Identities = 75/77 (97%), Positives = 76/77 (99%), Gaps = 0/77 (0%)
 Frame = +3

Query  93   MGKEKVHISIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  272
            MGKEK HI+IVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKSHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  273  DKLKAERERGITIDIAL  323
            DKLKAERERGITIDIAL
Sbjct  61   DKLKAERERGITIDIAL  77



>gb|KDO48480.1| hypothetical protein CISIN_1g0132372mg [Citrus sinensis]
Length=447

 Score =   187 bits (476),  Expect(2) = 4e-85, Method: Compositional matrix adjust.
 Identities = 86/89 (97%), Positives = 88/89 (99%), Gaps = 0/89 (0%)
 Frame = +1

Query  316  LPLWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTR  495
            + LWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTR
Sbjct  75   IALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTR  134

Query  496  EHALLAFTLGVKQMICCCNKIDATTPKYS  582
            EHALLAFTLGVKQMICCCNK+DATTPKYS
Sbjct  135  EHALLAFTLGVKQMICCCNKMDATTPKYS  163


 Score =   154 bits (389),  Expect(2) = 4e-85, Method: Compositional matrix adjust.
 Identities = 75/77 (97%), Positives = 76/77 (99%), Gaps = 0/77 (0%)
 Frame = +3

Query  93   MGKEKVHISIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  272
            MGKEK HI+IVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKFHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  273  DKLKAERERGITIDIAL  323
            DKLKAERERGITIDIAL
Sbjct  61   DKLKAERERGITIDIAL  77



>ref|XP_008233357.1| PREDICTED: elongation factor 1-alpha-like [Prunus mume]
Length=447

 Score =   186 bits (473),  Expect(2) = 4e-85, Method: Compositional matrix adjust.
 Identities = 85/89 (96%), Positives = 87/89 (98%), Gaps = 0/89 (0%)
 Frame = +1

Query  316  LPLWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTR  495
            + LWKFET KYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTR
Sbjct  75   IALWKFETNKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTR  134

Query  496  EHALLAFTLGVKQMICCCNKIDATTPKYS  582
            EHALLAFTLGVKQMICCCNK+DATTPKYS
Sbjct  135  EHALLAFTLGVKQMICCCNKMDATTPKYS  163


 Score =   155 bits (392),  Expect(2) = 4e-85, Method: Compositional matrix adjust.
 Identities = 75/77 (97%), Positives = 77/77 (100%), Gaps = 0/77 (0%)
 Frame = +3

Query  93   MGKEKVHISIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  272
            MGKEK+HI+IVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKIHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  273  DKLKAERERGITIDIAL  323
            DKLKAERERGITIDIAL
Sbjct  61   DKLKAERERGITIDIAL  77



>ref|XP_007009762.1| GTP binding Elongation factor Tu family protein isoform 3, partial 
[Theobroma cacao]
 gb|EOY18572.1| GTP binding Elongation factor Tu family protein isoform 3, partial 
[Theobroma cacao]
Length=367

 Score =   186 bits (472),  Expect(2) = 4e-85, Method: Compositional matrix adjust.
 Identities = 85/89 (96%), Positives = 88/89 (99%), Gaps = 0/89 (0%)
 Frame = +1

Query  316  LPLWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTR  495
            + LWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTR
Sbjct  75   IALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTR  134

Query  496  EHALLAFTLGVKQMICCCNKIDATTPKYS  582
            EHALLAFTLGV+QMICCCNK+DATTPKYS
Sbjct  135  EHALLAFTLGVRQMICCCNKMDATTPKYS  163


 Score =   155 bits (393),  Expect(2) = 4e-85, Method: Compositional matrix adjust.
 Identities = 76/77 (99%), Positives = 77/77 (100%), Gaps = 0/77 (0%)
 Frame = +3

Query  93   MGKEKVHISIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  272
            MGKEKVHI+IVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  273  DKLKAERERGITIDIAL  323
            DKLKAERERGITIDIAL
Sbjct  61   DKLKAERERGITIDIAL  77



>ref|XP_006436251.1| hypothetical protein CICLE_v10033471mg [Citrus clementina]
 ref|XP_006485903.1| PREDICTED: elongation factor 1-alpha 1-like [Citrus sinensis]
 gb|ESR49491.1| hypothetical protein CICLE_v10033471mg [Citrus clementina]
Length=447

 Score =   187 bits (476),  Expect(2) = 4e-85, Method: Compositional matrix adjust.
 Identities = 86/89 (97%), Positives = 88/89 (99%), Gaps = 0/89 (0%)
 Frame = +1

Query  316  LPLWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTR  495
            + LWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTR
Sbjct  75   IALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTR  134

Query  496  EHALLAFTLGVKQMICCCNKIDATTPKYS  582
            EHALLAFTLGVKQMICCCNK+DATTPKYS
Sbjct  135  EHALLAFTLGVKQMICCCNKMDATTPKYS  163


 Score =   154 bits (389),  Expect(2) = 4e-85, Method: Compositional matrix adjust.
 Identities = 75/77 (97%), Positives = 76/77 (99%), Gaps = 0/77 (0%)
 Frame = +3

Query  93   MGKEKVHISIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  272
            MGKEK HI+IVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKFHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  273  DKLKAERERGITIDIAL  323
            DKLKAERERGITIDIAL
Sbjct  61   DKLKAERERGITIDIAL  77



>ref|XP_007218005.1| hypothetical protein PRUPE_ppa005706mg [Prunus persica]
 gb|EMJ19204.1| hypothetical protein PRUPE_ppa005706mg [Prunus persica]
Length=447

 Score =   186 bits (472),  Expect(2) = 4e-85, Method: Compositional matrix adjust.
 Identities = 85/89 (96%), Positives = 87/89 (98%), Gaps = 0/89 (0%)
 Frame = +1

Query  316  LPLWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTR  495
            + LWKFET KYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTR
Sbjct  75   IALWKFETNKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTR  134

Query  496  EHALLAFTLGVKQMICCCNKIDATTPKYS  582
            EHALLAFTLGVKQMICCCNK+DATTPKYS
Sbjct  135  EHALLAFTLGVKQMICCCNKMDATTPKYS  163


 Score =   155 bits (392),  Expect(2) = 4e-85, Method: Compositional matrix adjust.
 Identities = 75/77 (97%), Positives = 77/77 (100%), Gaps = 0/77 (0%)
 Frame = +3

Query  93   MGKEKVHISIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  272
            MGKEK+HI+IVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKIHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  273  DKLKAERERGITIDIAL  323
            DKLKAERERGITIDIAL
Sbjct  61   DKLKAERERGITIDIAL  77



>ref|XP_001763194.1| predicted protein [Physcomitrella patens]
 ref|XP_001763195.1| predicted protein [Physcomitrella patens]
 ref|XP_001763196.1| predicted protein [Physcomitrella patens]
 gb|EDQ72071.1| predicted protein [Physcomitrella patens]
 gb|EDQ72072.1| predicted protein [Physcomitrella patens]
 gb|EDQ72073.1| predicted protein [Physcomitrella patens]
Length=447

 Score =   186 bits (471),  Expect(2) = 4e-85, Method: Compositional matrix adjust.
 Identities = 85/89 (96%), Positives = 87/89 (98%), Gaps = 0/89 (0%)
 Frame = +1

Query  316  LPLWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTR  495
            + LWKFET KYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTR
Sbjct  75   IALWKFETVKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTR  134

Query  496  EHALLAFTLGVKQMICCCNKIDATTPKYS  582
            EHALLAFTLGVKQMICCCNK+DATTPKYS
Sbjct  135  EHALLAFTLGVKQMICCCNKMDATTPKYS  163


 Score =   156 bits (394),  Expect(2) = 4e-85, Method: Compositional matrix adjust.
 Identities = 76/77 (99%), Positives = 77/77 (100%), Gaps = 0/77 (0%)
 Frame = +3

Query  93   MGKEKVHISIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  272
            MGKEKVHI+IVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  273  DKLKAERERGITIDIAL  323
            DKLKAERERGITIDIAL
Sbjct  61   DKLKAERERGITIDIAL  77



>ref|XP_010669657.1| PREDICTED: elongation factor 1-alpha [Beta vulgaris subsp. vulgaris]
 ref|XP_010669662.1| PREDICTED: elongation factor 1-alpha [Beta vulgaris subsp. vulgaris]
Length=447

 Score =   186 bits (471),  Expect(2) = 4e-85, Method: Compositional matrix adjust.
 Identities = 84/89 (94%), Positives = 87/89 (98%), Gaps = 0/89 (0%)
 Frame = +1

Query  316  LPLWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTR  495
            + LWKFET KYYCTVIDAPGHRDFIKNMITGTSQADCA+LIIDSTTGGFEAGISKDGQTR
Sbjct  75   IALWKFETNKYYCTVIDAPGHRDFIKNMITGTSQADCAILIIDSTTGGFEAGISKDGQTR  134

Query  496  EHALLAFTLGVKQMICCCNKIDATTPKYS  582
            EHALLAFTLGVKQMICCCNK+DATTPKYS
Sbjct  135  EHALLAFTLGVKQMICCCNKMDATTPKYS  163


 Score =   155 bits (393),  Expect(2) = 4e-85, Method: Compositional matrix adjust.
 Identities = 75/77 (97%), Positives = 77/77 (100%), Gaps = 0/77 (0%)
 Frame = +3

Query  93   MGKEKVHISIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  272
            MGKEK+HIS+VVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKIHISLVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  273  DKLKAERERGITIDIAL  323
            DKLKAERERGITIDIAL
Sbjct  61   DKLKAERERGITIDIAL  77



>ref|XP_001753167.1| predicted protein [Physcomitrella patens]
 gb|EDQ82208.1| predicted protein [Physcomitrella patens]
Length=447

 Score =   186 bits (471),  Expect(2) = 4e-85, Method: Compositional matrix adjust.
 Identities = 85/89 (96%), Positives = 87/89 (98%), Gaps = 0/89 (0%)
 Frame = +1

Query  316  LPLWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTR  495
            + LWKFET KYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTR
Sbjct  75   IALWKFETVKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTR  134

Query  496  EHALLAFTLGVKQMICCCNKIDATTPKYS  582
            EHALLAFTLGVKQMICCCNK+DATTPKYS
Sbjct  135  EHALLAFTLGVKQMICCCNKMDATTPKYS  163


 Score =   156 bits (394),  Expect(2) = 4e-85, Method: Compositional matrix adjust.
 Identities = 76/77 (99%), Positives = 77/77 (100%), Gaps = 0/77 (0%)
 Frame = +3

Query  93   MGKEKVHISIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  272
            MGKEKVHI+IVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  273  DKLKAERERGITIDIAL  323
            DKLKAERERGITIDIAL
Sbjct  61   DKLKAERERGITIDIAL  77



>ref|XP_004309880.1| PREDICTED: elongation factor 1-alpha [Fragaria vesca subsp. vesca]
Length=447

 Score =   188 bits (477),  Expect(2) = 4e-85, Method: Compositional matrix adjust.
 Identities = 86/89 (97%), Positives = 88/89 (99%), Gaps = 0/89 (0%)
 Frame = +1

Query  316  LPLWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTR  495
            + LWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTR
Sbjct  75   IALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTR  134

Query  496  EHALLAFTLGVKQMICCCNKIDATTPKYS  582
            EHALLAFTLGVKQMICCCNK+DATTPKYS
Sbjct  135  EHALLAFTLGVKQMICCCNKMDATTPKYS  163


 Score =   154 bits (388),  Expect(2) = 4e-85, Method: Compositional matrix adjust.
 Identities = 75/77 (97%), Positives = 76/77 (99%), Gaps = 0/77 (0%)
 Frame = +3

Query  93   MGKEKVHISIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  272
            MGKEK HI+IVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKSHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  273  DKLKAERERGITIDIAL  323
            DKLKAERERGITIDIAL
Sbjct  61   DKLKAERERGITIDIAL  77



>ref|XP_001763201.1| predicted protein [Physcomitrella patens]
 gb|EDQ72078.1| predicted protein [Physcomitrella patens]
Length=447

 Score =   185 bits (470),  Expect(2) = 4e-85, Method: Compositional matrix adjust.
 Identities = 85/89 (96%), Positives = 87/89 (98%), Gaps = 0/89 (0%)
 Frame = +1

Query  316  LPLWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTR  495
            + LWKFET KYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTR
Sbjct  75   IALWKFETMKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTR  134

Query  496  EHALLAFTLGVKQMICCCNKIDATTPKYS  582
            EHALLAFTLGVKQMICCCNK+DATTPKYS
Sbjct  135  EHALLAFTLGVKQMICCCNKMDATTPKYS  163


 Score =   156 bits (394),  Expect(2) = 4e-85, Method: Compositional matrix adjust.
 Identities = 76/77 (99%), Positives = 77/77 (100%), Gaps = 0/77 (0%)
 Frame = +3

Query  93   MGKEKVHISIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  272
            MGKEKVHI+IVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  273  DKLKAERERGITIDIAL  323
            DKLKAERERGITIDIAL
Sbjct  61   DKLKAERERGITIDIAL  77



>ref|XP_001753181.1| predicted protein [Physcomitrella patens]
 ref|XP_001753188.1| predicted protein [Physcomitrella patens]
 gb|EDQ82222.1| predicted protein [Physcomitrella patens]
 gb|EDQ82229.1| predicted protein [Physcomitrella patens]
Length=447

 Score =   186 bits (471),  Expect(2) = 4e-85, Method: Compositional matrix adjust.
 Identities = 85/89 (96%), Positives = 87/89 (98%), Gaps = 0/89 (0%)
 Frame = +1

Query  316  LPLWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTR  495
            + LWKFET KYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTR
Sbjct  75   IALWKFETVKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTR  134

Query  496  EHALLAFTLGVKQMICCCNKIDATTPKYS  582
            EHALLAFTLGVKQMICCCNK+DATTPKYS
Sbjct  135  EHALLAFTLGVKQMICCCNKMDATTPKYS  163


 Score =   156 bits (394),  Expect(2) = 4e-85, Method: Compositional matrix adjust.
 Identities = 76/77 (99%), Positives = 77/77 (100%), Gaps = 0/77 (0%)
 Frame = +3

Query  93   MGKEKVHISIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  272
            MGKEKVHI+IVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  273  DKLKAERERGITIDIAL  323
            DKLKAERERGITIDIAL
Sbjct  61   DKLKAERERGITIDIAL  77



>gb|EMS65134.1| Elongation factor 1-alpha [Triticum urartu]
Length=639

 Score =   187 bits (474),  Expect(2) = 4e-85, Method: Compositional matrix adjust.
 Identities = 86/89 (97%), Positives = 88/89 (99%), Gaps = 0/89 (0%)
 Frame = +1

Query  316  LPLWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTR  495
            + LWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTR
Sbjct  267  IALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTR  326

Query  496  EHALLAFTLGVKQMICCCNKIDATTPKYS  582
            EHALLAFTLGVKQMICCCNK+DATTPKYS
Sbjct  327  EHALLAFTLGVKQMICCCNKMDATTPKYS  355


 Score =   155 bits (391),  Expect(2) = 4e-85, Method: Compositional matrix adjust.
 Identities = 75/77 (97%), Positives = 76/77 (99%), Gaps = 0/77 (0%)
 Frame = +3

Query  93   MGKEKVHISIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  272
            MGKEK HI+IVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  193  MGKEKTHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  252

Query  273  DKLKAERERGITIDIAL  323
            DKLKAERERGITIDIAL
Sbjct  253  DKLKAERERGITIDIAL  269



>ref|XP_011031783.1| PREDICTED: elongation factor 1-alpha-like [Populus euphratica]
 ref|XP_011040944.1| PREDICTED: elongation factor 1-alpha-like isoform X1 [Populus 
euphratica]
 ref|XP_011040945.1| PREDICTED: elongation factor 1-alpha-like isoform X1 [Populus 
euphratica]
Length=449

 Score =   187 bits (476),  Expect(2) = 5e-85, Method: Compositional matrix adjust.
 Identities = 86/89 (97%), Positives = 88/89 (99%), Gaps = 0/89 (0%)
 Frame = +1

Query  316  LPLWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTR  495
            + LWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTR
Sbjct  75   IALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTR  134

Query  496  EHALLAFTLGVKQMICCCNKIDATTPKYS  582
            EHALLAFTLGVKQMICCCNK+DATTPKYS
Sbjct  135  EHALLAFTLGVKQMICCCNKMDATTPKYS  163


 Score =   154 bits (388),  Expect(2) = 5e-85, Method: Compositional matrix adjust.
 Identities = 75/77 (97%), Positives = 76/77 (99%), Gaps = 0/77 (0%)
 Frame = +3

Query  93   MGKEKVHISIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  272
            MGKEK HI+IVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKSHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  273  DKLKAERERGITIDIAL  323
            DKLKAERERGITIDIAL
Sbjct  61   DKLKAERERGITIDIAL  77



>ref|XP_010669660.1| PREDICTED: elongation factor 1-alpha-like [Beta vulgaris subsp. 
vulgaris]
 ref|XP_010669661.1| PREDICTED: elongation factor 1-alpha-like [Beta vulgaris subsp. 
vulgaris]
Length=447

 Score =   186 bits (471),  Expect(2) = 5e-85, Method: Compositional matrix adjust.
 Identities = 84/89 (94%), Positives = 87/89 (98%), Gaps = 0/89 (0%)
 Frame = +1

Query  316  LPLWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTR  495
            + LWKFET KYYCTVIDAPGHRDFIKNMITGTSQADCA+LIIDSTTGGFEAGISKDGQTR
Sbjct  75   IALWKFETNKYYCTVIDAPGHRDFIKNMITGTSQADCAILIIDSTTGGFEAGISKDGQTR  134

Query  496  EHALLAFTLGVKQMICCCNKIDATTPKYS  582
            EHALLAFTLGVKQMICCCNK+DATTPKYS
Sbjct  135  EHALLAFTLGVKQMICCCNKMDATTPKYS  163


 Score =   155 bits (393),  Expect(2) = 5e-85, Method: Compositional matrix adjust.
 Identities = 75/77 (97%), Positives = 77/77 (100%), Gaps = 0/77 (0%)
 Frame = +3

Query  93   MGKEKVHISIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  272
            MGKEK+HIS+VVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKIHISLVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  273  DKLKAERERGITIDIAL  323
            DKLKAERERGITIDIAL
Sbjct  61   DKLKAERERGITIDIAL  77



>emb|CDP08919.1| unnamed protein product [Coffea canephora]
Length=432

 Score =   186 bits (471),  Expect(2) = 5e-85, Method: Compositional matrix adjust.
 Identities = 85/87 (98%), Positives = 87/87 (100%), Gaps = 0/87 (0%)
 Frame = +1

Query  322  LWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTREH  501
            LWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTREH
Sbjct  77   LWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTREH  136

Query  502  ALLAFTLGVKQMICCCNKIDATTPKYS  582
            ALLAFTLGV+QMICCCNK+DATTPKYS
Sbjct  137  ALLAFTLGVRQMICCCNKMDATTPKYS  163


 Score =   155 bits (393),  Expect(2) = 5e-85, Method: Compositional matrix adjust.
 Identities = 76/77 (99%), Positives = 77/77 (100%), Gaps = 0/77 (0%)
 Frame = +3

Query  93   MGKEKVHISIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  272
            MGKEKVHI+IVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  273  DKLKAERERGITIDIAL  323
            DKLKAERERGITIDIAL
Sbjct  61   DKLKAERERGITIDIAL  77



>gb|ABF94275.1| Elongation factor 1-alpha, putative, expressed [Oryza sativa 
Japonica Group]
Length=347

 Score =   187 bits (475),  Expect(2) = 5e-85, Method: Compositional matrix adjust.
 Identities = 86/89 (97%), Positives = 88/89 (99%), Gaps = 0/89 (0%)
 Frame = +1

Query  316  LPLWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTR  495
            + LWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTR
Sbjct  75   IALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTR  134

Query  496  EHALLAFTLGVKQMICCCNKIDATTPKYS  582
            EHALLAFTLGVKQMICCCNK+DATTPKYS
Sbjct  135  EHALLAFTLGVKQMICCCNKMDATTPKYS  163


 Score =   154 bits (389),  Expect(2) = 5e-85, Method: Compositional matrix adjust.
 Identities = 75/77 (97%), Positives = 76/77 (99%), Gaps = 0/77 (0%)
 Frame = +3

Query  93   MGKEKVHISIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  272
            MGKEK HI+IVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKTHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  273  DKLKAERERGITIDIAL  323
            DKLKAERERGITIDIAL
Sbjct  61   DKLKAERERGITIDIAL  77



>gb|AAY56337.1| elongation factor-1 alpha [Musa acuminata]
Length=447

 Score =   185 bits (470),  Expect(2) = 5e-85, Method: Compositional matrix adjust.
 Identities = 84/89 (94%), Positives = 87/89 (98%), Gaps = 0/89 (0%)
 Frame = +1

Query  316  LPLWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTR  495
            + LWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDST GGFEAGISKDGQTR
Sbjct  75   IALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTAGGFEAGISKDGQTR  134

Query  496  EHALLAFTLGVKQMICCCNKIDATTPKYS  582
            EHALLAFTLGV+QMICCCNK+DATTPKYS
Sbjct  135  EHALLAFTLGVRQMICCCNKMDATTPKYS  163


 Score =   156 bits (394),  Expect(2) = 5e-85, Method: Compositional matrix adjust.
 Identities = 76/77 (99%), Positives = 77/77 (100%), Gaps = 0/77 (0%)
 Frame = +3

Query  93   MGKEKVHISIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  272
            MGKEKVHI+IVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  273  DKLKAERERGITIDIAL  323
            DKLKAERERGITIDIAL
Sbjct  61   DKLKAERERGITIDIAL  77



>gb|ACG70967.1| translation elongation factor 1, partial [Ziziphus jujuba]
Length=227

 Score =   187 bits (474),  Expect(2) = 5e-85, Method: Compositional matrix adjust.
 Identities = 86/89 (97%), Positives = 88/89 (99%), Gaps = 0/89 (0%)
 Frame = +1

Query  316  LPLWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTR  495
            + LWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTR
Sbjct  75   IALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTR  134

Query  496  EHALLAFTLGVKQMICCCNKIDATTPKYS  582
            EHALLAFTLGVKQMICCCNK+DATTPKYS
Sbjct  135  EHALLAFTLGVKQMICCCNKMDATTPKYS  163


 Score =   154 bits (390),  Expect(2) = 5e-85, Method: Compositional matrix adjust.
 Identities = 76/77 (99%), Positives = 77/77 (100%), Gaps = 0/77 (0%)
 Frame = +3

Query  93   MGKEKVHISIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  272
            MGKEKVHI+IVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  273  DKLKAERERGITIDIAL  323
            DKLKAERERGITIDIAL
Sbjct  61   DKLKAERERGITIDIAL  77



>gb|ABB16977.1| elongation factor 1-alpha-like protein [Solanum tuberosum]
Length=319

 Score =   186 bits (471),  Expect(2) = 5e-85, Method: Compositional matrix adjust.
 Identities = 86/89 (97%), Positives = 88/89 (99%), Gaps = 0/89 (0%)
 Frame = +1

Query  316  LPLWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTR  495
            + LWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTR
Sbjct  75   IALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTR  134

Query  496  EHALLAFTLGVKQMICCCNKIDATTPKYS  582
            EHALLAFTLGVKQMICCCNK+DATTPKYS
Sbjct  135  EHALLAFTLGVKQMICCCNKMDATTPKYS  163


 Score =   155 bits (392),  Expect(2) = 5e-85, Method: Compositional matrix adjust.
 Identities = 76/77 (99%), Positives = 77/77 (100%), Gaps = 0/77 (0%)
 Frame = +3

Query  93   MGKEKVHISIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  272
            MGKEK+HISIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKIHISIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  273  DKLKAERERGITIDIAL  323
            DKLKAERERGITIDIAL
Sbjct  61   DKLKAERERGITIDIAL  77



>ref|XP_004157309.1| PREDICTED: elongation factor 1-alpha-like [Cucumis sativus]
Length=449

 Score =   185 bits (470),  Expect(2) = 5e-85, Method: Compositional matrix adjust.
 Identities = 84/89 (94%), Positives = 87/89 (98%), Gaps = 0/89 (0%)
 Frame = +1

Query  316  LPLWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTR  495
            + LWKFET KYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTR
Sbjct  75   IALWKFETAKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTR  134

Query  496  EHALLAFTLGVKQMICCCNKIDATTPKYS  582
            EHALLAFTLGV+QMICCCNK+DATTPKYS
Sbjct  135  EHALLAFTLGVRQMICCCNKMDATTPKYS  163


 Score =   156 bits (394),  Expect(2) = 5e-85, Method: Compositional matrix adjust.
 Identities = 76/77 (99%), Positives = 77/77 (100%), Gaps = 0/77 (0%)
 Frame = +3

Query  93   MGKEKVHISIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  272
            MGKEKVHI+IVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  273  DKLKAERERGITIDIAL  323
            DKLKAERERGITIDIAL
Sbjct  61   DKLKAERERGITIDIAL  77



>gb|AAD56020.1|AF181492_1 elongation factor-1 alpha 3 [Lilium longiflorum]
Length=447

 Score =   185 bits (470),  Expect(2) = 5e-85, Method: Compositional matrix adjust.
 Identities = 83/89 (93%), Positives = 88/89 (99%), Gaps = 0/89 (0%)
 Frame = +1

Query  316  LPLWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTR  495
            + LWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCA+LIIDSTTGGFEAGISKDGQTR
Sbjct  75   IALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAILIIDSTTGGFEAGISKDGQTR  134

Query  496  EHALLAFTLGVKQMICCCNKIDATTPKYS  582
            EHALLAFTLGV+QMICCCNK+DATTPKY+
Sbjct  135  EHALLAFTLGVRQMICCCNKMDATTPKYA  163


 Score =   156 bits (394),  Expect(2) = 5e-85, Method: Compositional matrix adjust.
 Identities = 76/77 (99%), Positives = 77/77 (100%), Gaps = 0/77 (0%)
 Frame = +3

Query  93   MGKEKVHISIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  272
            MGKEKVHI+IVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  273  DKLKAERERGITIDIAL  323
            DKLKAERERGITIDIAL
Sbjct  61   DKLKAERERGITIDIAL  77



>gb|EMT12343.1| Elongation factor 1-alpha [Aegilops tauschii]
 gb|EMT14897.1| Elongation factor 1-alpha [Aegilops tauschii]
Length=447

 Score =   184 bits (467),  Expect(2) = 5e-85, Method: Compositional matrix adjust.
 Identities = 85/89 (96%), Positives = 87/89 (98%), Gaps = 0/89 (0%)
 Frame = +1

Query  316  LPLWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTR  495
            + LWKFETTKY CTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTR
Sbjct  75   IALWKFETTKYSCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTR  134

Query  496  EHALLAFTLGVKQMICCCNKIDATTPKYS  582
            EHALLAFTLGVKQMICCCNK+DATTPKYS
Sbjct  135  EHALLAFTLGVKQMICCCNKMDATTPKYS  163


 Score =   157 bits (396),  Expect(2) = 5e-85, Method: Compositional matrix adjust.
 Identities = 76/77 (99%), Positives = 77/77 (100%), Gaps = 0/77 (0%)
 Frame = +3

Query  93   MGKEKVHISIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  272
            MGKEK+HISIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKIHISIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  273  DKLKAERERGITIDIAL  323
            DKLKAERERGITIDIAL
Sbjct  61   DKLKAERERGITIDIAL  77



>gb|AAL57653.1| At1g07930/T6D22_3 [Arabidopsis thaliana]
Length=449

 Score =   187 bits (474),  Expect(2) = 6e-85, Method: Compositional matrix adjust.
 Identities = 86/89 (97%), Positives = 87/89 (98%), Gaps = 0/89 (0%)
 Frame = +1

Query  316  LPLWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTR  495
            + LWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTR
Sbjct  75   IALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTR  134

Query  496  EHALLAFTLGVKQMICCCNKIDATTPKYS  582
            EHALLAFTLGVKQMICCCN IDATTPKYS
Sbjct  135  EHALLAFTLGVKQMICCCNNIDATTPKYS  163


 Score =   154 bits (389),  Expect(2) = 6e-85, Method: Compositional matrix adjust.
 Identities = 75/77 (97%), Positives = 76/77 (99%), Gaps = 0/77 (0%)
 Frame = +3

Query  93   MGKEKVHISIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  272
            MGKEK HI+IVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKFHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  273  DKLKAERERGITIDIAL  323
            DKLKAERERGITIDIAL
Sbjct  61   DKLKAERERGITIDIAL  77



>ref|XP_002315287.1| hypothetical protein POPTR_0010s22620g [Populus trichocarpa]
 ref|XP_002315285.2| hypothetical protein POPTR_0010s22570g [Populus trichocarpa]
 ref|XP_002316351.2| hypothetical protein POPTR_0010s22620g [Populus trichocarpa]
 gb|ABK95341.1| unknown [Populus trichocarpa]
 gb|ABK95876.1| unknown [Populus trichocarpa]
 gb|EEF01458.1| hypothetical protein POPTR_0010s22620g [Populus trichocarpa]
 gb|EEF01456.2| hypothetical protein POPTR_0010s22570g [Populus trichocarpa]
 gb|EEF02522.2| hypothetical protein POPTR_0010s22620g [Populus trichocarpa]
Length=449

 Score =   186 bits (473),  Expect(2) = 6e-85, Method: Compositional matrix adjust.
 Identities = 85/89 (96%), Positives = 88/89 (99%), Gaps = 0/89 (0%)
 Frame = +1

Query  316  LPLWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTR  495
            + LWKFETT+YYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTR
Sbjct  75   IALWKFETTRYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTR  134

Query  496  EHALLAFTLGVKQMICCCNKIDATTPKYS  582
            EHALLAFTLGVKQMICCCNK+DATTPKYS
Sbjct  135  EHALLAFTLGVKQMICCCNKMDATTPKYS  163


 Score =   154 bits (390),  Expect(2) = 6e-85, Method: Compositional matrix adjust.
 Identities = 75/77 (97%), Positives = 76/77 (99%), Gaps = 0/77 (0%)
 Frame = +3

Query  93   MGKEKVHISIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  272
            MGKEK HI+IVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKTHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  273  DKLKAERERGITIDIAL  323
            DKLKAERERGITIDIAL
Sbjct  61   DKLKAERERGITIDIAL  77



>gb|EMS49772.1| Elongation factor 1-alpha [Triticum urartu]
Length=447

 Score =   184 bits (467),  Expect(2) = 6e-85, Method: Compositional matrix adjust.
 Identities = 85/89 (96%), Positives = 87/89 (98%), Gaps = 0/89 (0%)
 Frame = +1

Query  316  LPLWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTR  495
            + LWKFETTKY CTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTR
Sbjct  75   IALWKFETTKYSCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTR  134

Query  496  EHALLAFTLGVKQMICCCNKIDATTPKYS  582
            EHALLAFTLGVKQMICCCNK+DATTPKYS
Sbjct  135  EHALLAFTLGVKQMICCCNKMDATTPKYS  163


 Score =   157 bits (397),  Expect(2) = 6e-85, Method: Compositional matrix adjust.
 Identities = 76/77 (99%), Positives = 77/77 (100%), Gaps = 0/77 (0%)
 Frame = +3

Query  93   MGKEKVHISIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  272
            MGKEK+HISIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKIHISIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  273  DKLKAERERGITIDIAL  323
            DKLKAERERGITIDIAL
Sbjct  61   DKLKAERERGITIDIAL  77



>gb|AAK32834.1|AF361822_1 At1g07930/T6D22_3 [Arabidopsis thaliana]
 gb|AAL15385.1| At1g07930/T6D22_3 [Arabidopsis thaliana]
Length=449

 Score =   188 bits (477),  Expect(2) = 6e-85, Method: Compositional matrix adjust.
 Identities = 86/89 (97%), Positives = 88/89 (99%), Gaps = 0/89 (0%)
 Frame = +1

Query  316  LPLWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTR  495
            + LWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTR
Sbjct  75   IALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTR  134

Query  496  EHALLAFTLGVKQMICCCNKIDATTPKYS  582
            EHALLAFTLGVKQMICCCNK+DATTPKYS
Sbjct  135  EHALLAFTLGVKQMICCCNKMDATTPKYS  163


 Score =   153 bits (386),  Expect(2) = 6e-85, Method: Compositional matrix adjust.
 Identities = 74/77 (96%), Positives = 76/77 (99%), Gaps = 0/77 (0%)
 Frame = +3

Query  93   MGKEKVHISIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  272
            MGKEK HI+IVVIGHVDSGKSTTTGHLIYKLGGIDKR+IERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKFHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRLIERFEKEAAEMNKRSFKYAWVL  60

Query  273  DKLKAERERGITIDIAL  323
            DKLKAERERGITIDIAL
Sbjct  61   DKLKAERERGITIDIAL  77



>ref|XP_004309883.1| PREDICTED: elongation factor 1-alpha-like [Fragaria vesca subsp. 
vesca]
Length=447

 Score =   187 bits (474),  Expect(2) = 6e-85, Method: Compositional matrix adjust.
 Identities = 85/89 (96%), Positives = 88/89 (99%), Gaps = 0/89 (0%)
 Frame = +1

Query  316  LPLWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTR  495
            + LWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTR
Sbjct  75   IALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTR  134

Query  496  EHALLAFTLGVKQMICCCNKIDATTPKYS  582
            EHALLAFTLGV+QMICCCNK+DATTPKYS
Sbjct  135  EHALLAFTLGVRQMICCCNKMDATTPKYS  163


 Score =   154 bits (389),  Expect(2) = 6e-85, Method: Compositional matrix adjust.
 Identities = 75/77 (97%), Positives = 76/77 (99%), Gaps = 0/77 (0%)
 Frame = +3

Query  93   MGKEKVHISIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  272
            MGKEK HI+IVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKFHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  273  DKLKAERERGITIDIAL  323
            DKLKAERERGITIDIAL
Sbjct  61   DKLKAERERGITIDIAL  77



>ref|XP_008385284.1| PREDICTED: elongation factor 1-alpha-like [Malus domestica]
 ref|XP_009338279.1| PREDICTED: elongation factor 1-alpha-like [Pyrus x bretschneideri]
Length=447

 Score =   187 bits (474),  Expect(2) = 6e-85, Method: Compositional matrix adjust.
 Identities = 85/89 (96%), Positives = 88/89 (99%), Gaps = 0/89 (0%)
 Frame = +1

Query  316  LPLWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTR  495
            + LWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCA+LIIDSTTGGFEAGISKDGQTR
Sbjct  75   IALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAILIIDSTTGGFEAGISKDGQTR  134

Query  496  EHALLAFTLGVKQMICCCNKIDATTPKYS  582
            EHALLAFTLGVKQMICCCNK+DATTPKYS
Sbjct  135  EHALLAFTLGVKQMICCCNKMDATTPKYS  163


 Score =   154 bits (389),  Expect(2) = 6e-85, Method: Compositional matrix adjust.
 Identities = 75/77 (97%), Positives = 76/77 (99%), Gaps = 0/77 (0%)
 Frame = +3

Query  93   MGKEKVHISIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  272
            MGKEK HI+IVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKFHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  273  DKLKAERERGITIDIAL  323
            DKLKAERERGITIDIAL
Sbjct  61   DKLKAERERGITIDIAL  77



>gb|AEE98364.1| elongation factor 1-alpha [Deschampsia antarctica]
Length=447

 Score =   184 bits (467),  Expect(2) = 7e-85, Method: Compositional matrix adjust.
 Identities = 85/89 (96%), Positives = 87/89 (98%), Gaps = 0/89 (0%)
 Frame = +1

Query  316  LPLWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTR  495
            + LWKFETTKY CTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTR
Sbjct  75   IALWKFETTKYSCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTR  134

Query  496  EHALLAFTLGVKQMICCCNKIDATTPKYS  582
            EHALLAFTLGVKQMICCCNK+DATTPKYS
Sbjct  135  EHALLAFTLGVKQMICCCNKMDATTPKYS  163


 Score =   157 bits (396),  Expect(2) = 7e-85, Method: Compositional matrix adjust.
 Identities = 76/77 (99%), Positives = 77/77 (100%), Gaps = 0/77 (0%)
 Frame = +3

Query  93   MGKEKVHISIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  272
            MGKEK+HISIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKIHISIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  273  DKLKAERERGITIDIAL  323
            DKLKAERERGITIDIAL
Sbjct  61   DKLKAERERGITIDIAL  77



>gb|AEN79476.1| elongation factor 1-alpha [Ziziphus jujuba]
Length=447

 Score =   188 bits (477),  Expect(2) = 7e-85, Method: Compositional matrix adjust.
 Identities = 86/89 (97%), Positives = 88/89 (99%), Gaps = 0/89 (0%)
 Frame = +1

Query  316  LPLWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTR  495
            + LWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTR
Sbjct  75   IALWKFETTKYYCTVIDAPGHRDFIKNMITGTSQADCAVLIIDSTTGGFEAGISKDGQTR  134

Query  496  EHALLAFTLGVKQMICCCNKIDATTPKYS  582
            EHALLAFTLGVKQMICCCNK+DATTPKYS
Sbjct  135  EHALLAFTLGVKQMICCCNKMDATTPKYS  163


 Score =   152 bits (385),  Expect(2) = 7e-85, Method: Compositional matrix adjust.
 Identities = 75/77 (97%), Positives = 76/77 (99%), Gaps = 0/77 (0%)
 Frame = +3

Query  93   MGKEKVHISIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  272
            MGKEKVHI+IVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL
Sbjct  1    MGKEKVHINIVVIGHVDSGKSTTTGHLIYKLGGIDKRVIERFEKEAAEMNKRSFKYAWVL  60

Query  273  DKLKAERERGITIDIAL  323
            DKLKAERERGITI IAL
Sbjct  61   DKLKAERERGITIGIAL  77



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 723952452455