BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFF036O12

Length=530
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009762378.1|  PREDICTED: probable nucleoredoxin 1                238   3e-72   Nicotiana sylvestris
gb|KDP26595.1|  hypothetical protein JCGZ_17753                         239   4e-72   Jatropha curcas
ref|XP_009626674.1|  PREDICTED: probable nucleoredoxin 1                236   2e-71   Nicotiana tomentosiformis
emb|CDP00158.1|  unnamed protein product                                231   4e-69   Coffea canephora [robusta coffee]
ref|XP_002525369.1|  nucleoredoxin, putative                            231   5e-69   
gb|KJB31217.1|  hypothetical protein B456_005G181700                    227   2e-68   Gossypium raimondii
gb|AGV54528.1|  nucleoredoxin 1-like protein                            228   5e-68   Phaseolus vulgaris [French bean]
ref|XP_007153741.1|  hypothetical protein PHAVU_003G061100g             228   7e-68   Phaseolus vulgaris [French bean]
gb|KJB31218.1|  hypothetical protein B456_005G181700                    227   1e-67   Gossypium raimondii
ref|XP_006365240.1|  PREDICTED: probable nucleoredoxin 1-like           228   2e-67   Solanum tuberosum [potatoes]
gb|KCW59853.1|  hypothetical protein EUGRSUZ_H025921                    215   3e-67   Eucalyptus grandis [rose gum]
ref|XP_007044667.1|  DC1 domain-containing protein                      225   9e-67   
ref|XP_007225633.1|  hypothetical protein PRUPE_ppa003374mg             225   1e-66   Prunus persica
ref|XP_004238662.1|  PREDICTED: probable nucleoredoxin 1                225   1e-66   Solanum lycopersicum
ref|XP_010553606.1|  PREDICTED: probable nucleoredoxin 1                224   1e-66   Tarenaya hassleriana [spider flower]
gb|KHG25736.1|  hypothetical protein F383_04337                         224   1e-66   Gossypium arboreum [tree cotton]
ref|XP_010023550.1|  PREDICTED: probable nucleoredoxin 1 isoform X3     222   3e-66   
gb|KDO82404.1|  hypothetical protein CISIN_1g008336mg                   216   8e-66   Citrus sinensis [apfelsine]
ref|XP_010651773.1|  PREDICTED: probable nucleoredoxin 1                213   1e-65   Vitis vinifera
ref|XP_006483868.1|  PREDICTED: probable nucleoredoxin 1-like           221   3e-65   Citrus sinensis [apfelsine]
ref|XP_006438373.1|  hypothetical protein CICLE_v10031097mg             220   4e-65   Citrus clementina [clementine]
ref|XP_004509957.1|  PREDICTED: probable nucleoredoxin 1-like           220   6e-65   
ref|XP_007222066.1|  hypothetical protein PRUPE_ppa003234mg             220   7e-65   
gb|KFK40790.1|  hypothetical protein AALP_AA2G041400                    219   9e-65   Arabis alpina [alpine rockcress]
gb|KEH20025.1|  protein disulfide isomerase (PDI)-like protein          219   1e-64   Medicago truncatula
ref|XP_010023549.1|  PREDICTED: probable nucleoredoxin 1 isoform X2     218   2e-64   Eucalyptus grandis [rose gum]
ref|XP_003532006.1|  PREDICTED: probable nucleoredoxin 1-like iso...    218   3e-64   Glycine max [soybeans]
gb|KHN26883.1|  Putative nucleoredoxin 1                                218   3e-64   Glycine soja [wild soybean]
ref|XP_011071086.1|  PREDICTED: probable nucleoredoxin 1                218   4e-64   Sesamum indicum [beniseed]
ref|XP_010023554.1|  PREDICTED: probable nucleoredoxin 1 isoform X6     215   9e-64   Eucalyptus grandis [rose gum]
ref|XP_010023552.1|  PREDICTED: probable nucleoredoxin 1 isoform X5     214   2e-63   
gb|ACJ85567.1|  unknown                                                 215   3e-63   Medicago truncatula
ref|XP_010243057.1|  PREDICTED: probable nucleoredoxin 1                215   3e-63   Nelumbo nucifera [Indian lotus]
emb|CBI28541.3|  unnamed protein product                                213   4e-63   Vitis vinifera
ref|XP_008221827.1|  PREDICTED: probable nucleoredoxin 1                214   9e-63   Prunus mume [ume]
ref|XP_008340047.1|  PREDICTED: probable nucleoredoxin 1                214   1e-62   Malus domestica [apple tree]
gb|KDO82401.1|  hypothetical protein CISIN_1g008336mg                   214   1e-62   Citrus sinensis [apfelsine]
ref|XP_010023548.1|  PREDICTED: probable nucleoredoxin 1 isoform X1     213   3e-62   Eucalyptus grandis [rose gum]
ref|XP_010023551.1|  PREDICTED: probable nucleoredoxin 1 isoform X4     210   6e-62   
gb|KEH20030.1|  protein disulfide isomerase (PDI)-like protein          211   6e-62   Medicago truncatula
emb|CAN77321.1|  hypothetical protein VITISV_008818                     212   6e-62   Vitis vinifera
ref|XP_010651402.1|  PREDICTED: probable nucleoredoxin 1                212   6e-62   Vitis vinifera
ref|XP_010023556.1|  PREDICTED: probable nucleoredoxin 1                213   7e-62   Eucalyptus grandis [rose gum]
ref|XP_006302027.1|  hypothetical protein CARUB_v10020010mg             212   9e-62   
emb|CBI28542.3|  unnamed protein product                                214   2e-61   Vitis vinifera
ref|XP_008221828.1|  PREDICTED: probable nucleoredoxin 1 isoform X1     209   6e-61   Prunus mume [ume]
emb|CDY60573.1|  BnaC01g43180D                                          209   7e-61   Brassica napus [oilseed rape]
ref|XP_006392168.1|  hypothetical protein EUTSA_v10023374mg             209   7e-61   Eutrema salsugineum [saltwater cress]
gb|KCW59854.1|  hypothetical protein EUGRSUZ_H02593                     209   1e-60   Eucalyptus grandis [rose gum]
gb|AAM64945.1|  PDI-like protein                                        209   1e-60   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009103743.1|  PREDICTED: probable nucleoredoxin 1                209   1e-60   Brassica rapa
emb|CDY24527.1|  BnaA01g22310D                                          208   2e-60   Brassica napus [oilseed rape]
ref|NP_564756.1|  protein reduce transmission through pollen            208   2e-60   Arabidopsis thaliana [mouse-ear cress]
emb|CBI28535.3|  unnamed protein product                                208   4e-60   Vitis vinifera
emb|CCD74518.1|  putative nucleoredoxin 1                               207   5e-60   Arabidopsis halleri subsp. halleri
ref|XP_010417977.1|  PREDICTED: probable nucleoredoxin 1                206   1e-59   Camelina sativa [gold-of-pleasure]
ref|XP_008389658.1|  PREDICTED: probable nucleoredoxin 1                206   1e-59   Malus domestica [apple tree]
ref|XP_008459530.1|  PREDICTED: probable nucleoredoxin 1                206   1e-59   Cucumis melo [Oriental melon]
ref|XP_002888143.1|  DC1 domain-containing protein                      206   1e-59   Arabidopsis lyrata subsp. lyrata
emb|CAN59927.1|  hypothetical protein VITISV_043885                     206   2e-59   Vitis vinifera
ref|XP_010243058.1|  PREDICTED: probable nucleoredoxin 1                204   2e-59   Nelumbo nucifera [Indian lotus]
ref|XP_010473222.1|  PREDICTED: probable nucleoredoxin 1 isoform X1     205   3e-59   Camelina sativa [gold-of-pleasure]
gb|EYU22493.1|  hypothetical protein MIMGU_mgv1a003730mg                204   4e-59   Erythranthe guttata [common monkey flower]
ref|XP_010510950.1|  PREDICTED: probable nucleoredoxin 1                204   6e-59   Camelina sativa [gold-of-pleasure]
ref|XP_010682547.1|  PREDICTED: probable nucleoredoxin 1 isoform X2     199   8e-59   
ref|XP_008792848.1|  PREDICTED: LOW QUALITY PROTEIN: probable nuc...    204   1e-58   Phoenix dactylifera
ref|XP_004141532.1|  PREDICTED: probable nucleoredoxin 1-like           202   2e-58   
ref|XP_004156196.1|  PREDICTED: probable nucleoredoxin 1-like           203   2e-58   
emb|CDP13168.1|  unnamed protein product                                201   2e-58   Coffea canephora [robusta coffee]
ref|XP_008353016.1|  PREDICTED: LOW QUALITY PROTEIN: probable nuc...    202   2e-58   
emb|CAC87937.1|  PDI-like protein                                       201   4e-58   Quercus suber [cork oak]
gb|AAS02080.1|  protein disulfide isomerase                             201   4e-58   Quercus suber [cork oak]
gb|AAU04766.1|  protein disulfide isomerase (PDI)-like protein 2        202   4e-58   Cucumis melo [Oriental melon]
ref|XP_008459528.1|  PREDICTED: probable nucleoredoxin 1                202   4e-58   Cucumis melo [Oriental melon]
ref|XP_004297483.1|  PREDICTED: probable nucleoredoxin 1                202   5e-58   Fragaria vesca subsp. vesca
ref|XP_003631262.2|  PREDICTED: uncharacterized protein LOC100852797    206   6e-58   
emb|CBI28536.3|  unnamed protein product                                200   1e-57   Vitis vinifera
ref|XP_010917444.1|  PREDICTED: LOW QUALITY PROTEIN: probable nuc...    200   3e-57   
ref|XP_004297482.1|  PREDICTED: probable nucleoredoxin 1                199   3e-57   Fragaria vesca subsp. vesca
ref|XP_010100450.1|  putative nucleoredoxin 1                           199   6e-57   Morus notabilis
ref|XP_008389657.1|  PREDICTED: probable nucleoredoxin 1                198   1e-56   Malus domestica [apple tree]
ref|XP_008221826.1|  PREDICTED: probable nucleoredoxin 1                198   1e-56   
ref|XP_010682546.1|  PREDICTED: probable nucleoredoxin 1 isoform X1     197   2e-56   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_004141529.1|  PREDICTED: probable nucleoredoxin 1-like           197   2e-56   Cucumis sativus [cucumbers]
ref|XP_008340046.1|  PREDICTED: probable nucleoredoxin 1 isoform X2     197   4e-56   
ref|XP_008340045.1|  PREDICTED: probable nucleoredoxin 1 isoform X1     197   4e-56   
ref|XP_009391725.1|  PREDICTED: probable nucleoredoxin 1                196   6e-56   Musa acuminata subsp. malaccensis [pisang utan]
emb|CBI28543.3|  unnamed protein product                                194   1e-55   Vitis vinifera
gb|EYU22494.1|  hypothetical protein MIMGU_mgv1a005241mg                193   2e-55   Erythranthe guttata [common monkey flower]
ref|XP_010651414.1|  PREDICTED: probable nucleoredoxin 1 isoform X2     194   2e-55   
gb|ABK25230.1|  unknown                                                 190   2e-55   Picea sitchensis
emb|CAN63033.1|  hypothetical protein VITISV_044051                     194   3e-55   Vitis vinifera
ref|XP_008353015.1|  PREDICTED: probable nucleoredoxin 1                191   3e-55   Malus domestica [apple tree]
ref|XP_010651408.1|  PREDICTED: probable nucleoredoxin 1 isoform X1     194   3e-55   Vitis vinifera
ref|XP_008221830.1|  PREDICTED: probable nucleoredoxin 1                192   1e-54   
ref|XP_011014070.1|  PREDICTED: probable nucleoredoxin 1                192   1e-54   Populus euphratica
ref|XP_008782777.1|  PREDICTED: probable nucleoredoxin 1-1              192   2e-54   Phoenix dactylifera
ref|XP_010682544.1|  PREDICTED: probable nucleoredoxin 1                191   2e-54   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_007222607.1|  hypothetical protein PRUPE_ppa003530mg             191   4e-54   Prunus persica
ref|XP_010937313.1|  PREDICTED: probable nucleoredoxin 1-2              189   8e-54   
ref|XP_010937315.1|  PREDICTED: probable nucleoredoxin 1-2              189   8e-54   
ref|XP_011014064.1|  PREDICTED: probable nucleoredoxin 1                179   4e-53   Populus euphratica
gb|ABK25413.1|  unknown                                                 189   4e-53   Picea sitchensis
ref|XP_010937316.1|  PREDICTED: probable nucleoredoxin 1-1              189   6e-53   Elaeis guineensis
ref|XP_008448920.1|  PREDICTED: probable nucleoredoxin 1                187   2e-52   Cucumis melo [Oriental melon]
ref|XP_008459538.1|  PREDICTED: probable nucleoredoxin 1                181   2e-52   Cucumis melo [Oriental melon]
ref|XP_010682545.1|  PREDICTED: probable nucleoredoxin 1                186   4e-52   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_006836611.1|  hypothetical protein AMTR_s00131p00113720          186   4e-52   
ref|XP_011041504.1|  PREDICTED: probable nucleoredoxin 1 isoform X3     184   6e-52   Populus euphratica
ref|NP_001105407.1|  nucleoredoxin1                                     185   7e-52   
ref|XP_006365237.1|  PREDICTED: probable nucleoredoxin 1-like           185   7e-52   Solanum tuberosum [potatoes]
tpg|DAA45727.1|  TPA: PDI-like protein                                  185   7e-52   
gb|ACF82903.1|  unknown                                                 185   8e-52   Zea mays [maize]
ref|XP_004147954.1|  PREDICTED: probable nucleoredoxin 1-like           184   1e-51   Cucumis sativus [cucumbers]
ref|XP_004984067.1|  PREDICTED: probable nucleoredoxin 1-1-like         184   3e-51   Setaria italica
ref|XP_011041503.1|  PREDICTED: probable nucleoredoxin 1 isoform X2     183   3e-51   Populus euphratica
ref|XP_006378294.1|  hypothetical protein POPTR_0010s06990g             183   3e-51   
ref|XP_011041502.1|  PREDICTED: probable nucleoredoxin 1 isoform X1     183   3e-51   Populus euphratica
ref|XP_006378293.1|  disulfide isomerase family protein                 182   5e-51   
gb|KDO82402.1|  hypothetical protein CISIN_1g008336mg                   182   5e-51   Citrus sinensis [apfelsine]
ref|XP_009762379.1|  PREDICTED: probable nucleoredoxin 1                182   6e-51   Nicotiana sylvestris
gb|ABK25089.1|  unknown                                                 179   7e-51   Picea sitchensis
gb|EPS71977.1|  hypothetical protein M569_02774                         182   7e-51   Genlisea aurea
ref|XP_002467709.1|  hypothetical protein SORBIDRAFT_01g032910          182   7e-51   Sorghum bicolor [broomcorn]
ref|XP_002314537.2|  hypothetical protein POPTR_0010s06940g             182   7e-51   
gb|ABR16144.1|  unknown                                                 182   1e-50   Picea sitchensis
ref|NP_001050329.1|  Os03g0405500                                       182   1e-50   
ref|XP_009626672.1|  PREDICTED: probable nucleoredoxin 1                181   2e-50   Nicotiana tomentosiformis
ref|XP_002314533.2|  hypothetical protein POPTR_0010s06960g             181   2e-50   Populus trichocarpa [western balsam poplar]
ref|XP_002314536.2|  hypothetical protein POPTR_0010s06970g             179   2e-50   
ref|XP_002314534.2|  hypothetical protein POPTR_0010s07000g             181   3e-50   Populus trichocarpa [western balsam poplar]
ref|XP_003562828.1|  PREDICTED: probable nucleoredoxin 1-2              180   5e-50   Brachypodium distachyon [annual false brome]
ref|XP_003557743.1|  PREDICTED: probable nucleoredoxin 1-2              180   5e-50   Brachypodium distachyon [annual false brome]
ref|XP_006378292.1|  hypothetical protein POPTR_0010s06950g             180   5e-50   
ref|XP_011041505.1|  PREDICTED: probable nucleoredoxin 1                179   8e-50   Populus euphratica
gb|AHL29285.1|  nucleoredoxin                                           178   2e-49   Triticum aestivum [Canadian hard winter wheat]
gb|EMT12941.1|  Nucleoredoxin                                           178   3e-49   
gb|KGN52628.1|  hypothetical protein Csa_5G647500                       173   3e-49   Cucumis sativus [cucumbers]
ref|XP_008459536.1|  PREDICTED: probable nucleoredoxin 1 isoform X6     174   3e-49   
ref|XP_010937371.1|  PREDICTED: probable nucleoredoxin 1-1              177   4e-49   Elaeis guineensis
ref|XP_006378291.1|  hypothetical protein POPTR_0010s06930g             177   4e-49   
ref|XP_002314535.2|  hypothetical protein POPTR_0010s06980g             177   5e-49   
emb|CCP27784.1|  unnamed protein product                                178   6e-49   Arabidopsis halleri subsp. halleri
ref|XP_011014068.1|  PREDICTED: probable nucleoredoxin 1 isoform X3     177   6e-49   Populus euphratica
ref|XP_011014069.1|  PREDICTED: probable nucleoredoxin 1 isoform X4     177   6e-49   Populus euphratica
ref|XP_011014066.1|  PREDICTED: probable nucleoredoxin 1 isoform X1     177   7e-49   Populus euphratica
ref|XP_011014067.1|  PREDICTED: probable nucleoredoxin 1 isoform X2     177   8e-49   Populus euphratica
ref|XP_008459535.1|  PREDICTED: probable nucleoredoxin 1-1 isofor...    174   9e-49   
ref|XP_004239348.2|  PREDICTED: probable nucleoredoxin 1                176   1e-48   
ref|XP_008459534.1|  PREDICTED: probable nucleoredoxin 1-1 isofor...    174   1e-48   
ref|XP_008459533.1|  PREDICTED: probable nucleoredoxin 1 isoform X3     174   1e-48   
ref|XP_002965590.1|  hypothetical protein SELMODRAFT_143457             175   2e-48   
ref|XP_008459531.1|  PREDICTED: probable nucleoredoxin 1 isoform X1     174   2e-48   Cucumis melo [Oriental melon]
ref|XP_008459532.1|  PREDICTED: probable nucleoredoxin 1 isoform X2     173   2e-48   
ref|XP_002968070.1|  hypothetical protein SELMODRAFT_440252             176   3e-48   Selaginella moellendorffii
ref|XP_006836608.1|  hypothetical protein AMTR_s00131p00112160          174   9e-48   
gb|KGN52627.1|  hypothetical protein Csa_5G647490                       172   1e-47   Cucumis sativus [cucumbers]
ref|XP_004141531.1|  PREDICTED: probable nucleoredoxin 1-like           173   9e-47   
gb|EEC75442.1|  hypothetical protein OsI_11975                          171   1e-46   Oryza sativa Indica Group [Indian rice]
sp|Q7Y0F2.1|NRX12_ORYSJ  RecName: Full=Probable nucleoredoxin 1-2...    171   1e-46   Oryza sativa Japonica Group [Japonica rice]
gb|EAY90397.1|  hypothetical protein OsI_11974                          170   2e-46   Oryza sativa Indica Group [Indian rice]
gb|AAU89249.1|  C1-like domain containing protein                       171   2e-46   Oryza sativa Japonica Group [Japonica rice]
gb|AGH33853.1|  PDI4                                                    169   3e-46   Cucumis melo [Oriental melon]
ref|XP_002525368.1|  nucleoredoxin, putative                            169   6e-46   
dbj|BAJ87919.1|  predicted protein                                      169   7e-46   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|KDP26596.1|  hypothetical protein JCGZ_17754                         167   4e-45   Jatropha curcas
gb|AAU04768.1|  protein disulfide isomerase (PDI)-like protein 4        165   6e-45   Cucumis melo [Oriental melon]
ref|XP_010256393.1|  PREDICTED: uncharacterized protein LOC104596799    169   1e-44   Nelumbo nucifera [Indian lotus]
gb|ABR18079.1|  unknown                                                 160   6e-43   Picea sitchensis
ref|XP_010431903.1|  PREDICTED: probable nucleoredoxin 1                150   3e-42   Camelina sativa [gold-of-pleasure]
ref|XP_010470488.1|  PREDICTED: probable nucleoredoxin 1 isoform X2     150   5e-42   Camelina sativa [gold-of-pleasure]
ref|XP_010470487.1|  PREDICTED: probable nucleoredoxin 1 isoform X1     150   2e-41   Camelina sativa [gold-of-pleasure]
ref|NP_001130856.1|  hypothetical protein                               150   3e-39   Zea mays [maize]
ref|XP_006855862.1|  hypothetical protein AMTR_s00037p00109800          147   8e-39   Amborella trichopoda
ref|XP_010266892.1|  PREDICTED: probable nucleoredoxin 2                147   2e-38   Nelumbo nucifera [Indian lotus]
ref|XP_011083440.1|  PREDICTED: probable nucleoredoxin 2                146   4e-38   Sesamum indicum [beniseed]
ref|XP_002306954.1|  hypothetical protein POPTR_0005s26610g             143   4e-37   Populus trichocarpa [western balsam poplar]
ref|XP_011003080.1|  PREDICTED: probable nucleoredoxin 2                143   5e-37   Populus euphratica
ref|XP_009620045.1|  PREDICTED: probable nucleoredoxin 2 isoform X1     141   2e-36   Nicotiana tomentosiformis
gb|KDP36878.1|  hypothetical protein JCGZ_08169                         140   4e-36   Jatropha curcas
ref|XP_007222806.1|  hypothetical protein PRUPE_ppa005061mg             140   8e-36   
ref|XP_006292691.1|  hypothetical protein CARUB_v10018937mg             140   8e-36   
gb|KHG29175.1|  hypothetical protein F383_13074                         139   1e-35   Gossypium arboreum [tree cotton]
ref|XP_008653605.1|  PREDICTED: probable nucleoredoxin 3                135   3e-35   Zea mays [maize]
gb|KJB14360.1|  hypothetical protein B456_002G121200                    137   3e-35   Gossypium raimondii
ref|XP_008221829.1|  PREDICTED: probable nucleoredoxin 1 isoform X2     138   5e-35   Prunus mume [ume]
gb|KJB14359.1|  hypothetical protein B456_002G121200                    137   5e-35   Gossypium raimondii
ref|XP_009798867.1|  PREDICTED: probable nucleoredoxin 2                137   5e-35   Nicotiana sylvestris
ref|XP_006652793.1|  PREDICTED: probable nucleoredoxin 3-like           136   7e-35   
gb|KJB14358.1|  hypothetical protein B456_002G121200                    137   7e-35   Gossypium raimondii
gb|KJB14361.1|  hypothetical protein B456_002G121200                    137   8e-35   Gossypium raimondii
ref|XP_008221212.1|  PREDICTED: probable nucleoredoxin 2                136   1e-34   Prunus mume [ume]
gb|KCW59852.1|  hypothetical protein EUGRSUZ_H025922                    135   1e-34   Eucalyptus grandis [rose gum]
emb|CDP07350.1|  unnamed protein product                                136   1e-34   Coffea canephora [robusta coffee]
ref|XP_002285895.1|  PREDICTED: probable nucleoredoxin 2 isoform X1     136   2e-34   Vitis vinifera
gb|KHN45956.1|  Putative nucleoredoxin 2                                136   2e-34   Glycine soja [wild soybean]
ref|XP_007221797.1|  hypothetical protein PRUPE_ppa006064mg             136   2e-34   Prunus persica
ref|NP_001276271.1|  probable nucleoredoxin 2-like                      135   2e-34   
ref|XP_006577959.1|  PREDICTED: probable nucleoredoxin 2-like iso...    135   2e-34   
ref|XP_010266051.1|  PREDICTED: probable nucleoredoxin 2                135   3e-34   Nelumbo nucifera [Indian lotus]
ref|XP_011034968.1|  PREDICTED: probable nucleoredoxin 2                135   3e-34   Populus euphratica
ref|XP_006435251.1|  hypothetical protein CICLE_v10001187mg             135   4e-34   
ref|XP_008466458.1|  PREDICTED: probable nucleoredoxin 2 isoform X1     134   4e-34   Cucumis melo [Oriental melon]
ref|XP_010263377.1|  PREDICTED: probable nucleoredoxin 3                134   5e-34   Nelumbo nucifera [Indian lotus]
ref|XP_006435250.1|  hypothetical protein CICLE_v10001187mg             134   5e-34   Citrus clementina [clementine]
ref|XP_007017890.1|  DC1 domain-containing protein isoform 1            134   8e-34   
ref|XP_007017892.1|  DC1 domain-containing protein isoform 3            134   8e-34   Theobroma cacao [chocolate]
sp|Q7XPE8.2|NRX3_ORYSJ  RecName: Full=Probable nucleoredoxin 3; S...    134   8e-34   Oryza sativa Japonica Group [Japonica rice]
ref|XP_007136118.1|  hypothetical protein PHAVU_009G019400g             134   9e-34   Phaseolus vulgaris [French bean]
gb|EEC77960.1|  hypothetical protein OsI_17320                          134   1e-33   Oryza sativa Indica Group [Indian rice]
ref|XP_006386162.1|  hypothetical protein POPTR_0002s01870g             134   1e-33   Populus trichocarpa [western balsam poplar]
ref|XP_004238384.1|  PREDICTED: probable nucleoredoxin 2                134   1e-33   Solanum lycopersicum
ref|XP_003603818.1|  Nucleoredoxin                                      134   1e-33   Medicago truncatula
ref|XP_004976749.1|  PREDICTED: probable nucleoredoxin 3-like           133   1e-33   Setaria italica
ref|XP_004167003.1|  PREDICTED: probable nucleoredoxin 2-like           133   2e-33   
ref|XP_010100128.1|  hypothetical protein L484_014319                   133   2e-33   
ref|XP_010913793.1|  PREDICTED: probable nucleoredoxin 3                132   2e-33   Elaeis guineensis
gb|AFW59396.1|  hypothetical protein ZEAMMB73_974140                    132   4e-33   
ref|XP_008377128.1|  PREDICTED: probable nucleoredoxin 2                132   4e-33   Malus domestica [apple tree]
ref|XP_004291331.1|  PREDICTED: probable nucleoredoxin 2                132   4e-33   Fragaria vesca subsp. vesca
ref|XP_008387909.1|  PREDICTED: probable nucleoredoxin 2                132   4e-33   Malus domestica [apple tree]
gb|KHN09060.1|  Putative nucleoredoxin 2                                132   5e-33   Glycine soja [wild soybean]
ref|XP_008663577.1|  PREDICTED: probable nucleoredoxin 3                132   5e-33   
ref|XP_002504076.1|  thioredoxin                                        132   5e-33   Micromonas commoda
ref|XP_003527520.1|  PREDICTED: probable nucleoredoxin 2-like iso...    131   7e-33   Glycine max [soybeans]
gb|KDO82403.1|  hypothetical protein CISIN_1g008336mg                   132   7e-33   Citrus sinensis [apfelsine]
ref|XP_010648454.1|  PREDICTED: probable nucleoredoxin 3                131   9e-33   Vitis vinifera
ref|XP_003527521.1|  PREDICTED: probable nucleoredoxin 2-like iso...    131   9e-33   Glycine max [soybeans]
ref|XP_006342078.1|  PREDICTED: probable nucleoredoxin 2-like           131   9e-33   Solanum tuberosum [potatoes]
ref|XP_009334668.1|  PREDICTED: probable nucleoredoxin 2                131   9e-33   Pyrus x bretschneideri [bai li]
ref|XP_004136369.1|  PREDICTED: probable nucleoredoxin 2-like           130   2e-32   Cucumis sativus [cucumbers]
ref|XP_002448495.1|  hypothetical protein SORBIDRAFT_06g027950          130   2e-32   Sorghum bicolor [broomcorn]
ref|XP_010061105.1|  PREDICTED: probable nucleoredoxin 2 isoform X2     130   2e-32   Eucalyptus grandis [rose gum]
ref|XP_008350516.1|  PREDICTED: probable nucleoredoxin 2                129   3e-32   
gb|KCW68002.1|  hypothetical protein EUGRSUZ_F01693                     130   3e-32   Eucalyptus grandis [rose gum]
ref|NP_001050331.2|  Os03g0405900                                       129   5e-32   
ref|XP_006438372.1|  hypothetical protein CICLE_v10031097mg             129   7e-32   
ref|XP_009417222.1|  PREDICTED: probable nucleoredoxin 2 isoform X1     128   7e-32   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_004986914.1|  PREDICTED: LOW QUALITY PROTEIN: probable nuc...    129   8e-32   
ref|XP_008054249.1|  PREDICTED: nucleoredoxin                           127   1e-31   
ref|NP_001053815.2|  Os04g0608600                                       124   1e-31   
ref|XP_008806406.1|  PREDICTED: probable nucleoredoxin 2                127   2e-31   Phoenix dactylifera
emb|CBI20806.3|  unnamed protein product                                131   2e-31   Vitis vinifera
gb|KJB58048.1|  hypothetical protein B456_009G191800                    127   2e-31   Gossypium raimondii
gb|KJB58049.1|  hypothetical protein B456_009G191800                    127   2e-31   Gossypium raimondii
gb|KJB58046.1|  hypothetical protein B456_009G191800                    127   2e-31   Gossypium raimondii
gb|KJB58047.1|  hypothetical protein B456_009G191800                    127   2e-31   Gossypium raimondii
ref|XP_008781716.1|  PREDICTED: probable nucleoredoxin 3                127   3e-31   Phoenix dactylifera
gb|KHG03676.1|  hypothetical protein F383_28340                         126   4e-31   Gossypium arboreum [tree cotton]
ref|XP_004500916.1|  PREDICTED: probable nucleoredoxin 2-like iso...    126   5e-31   
gb|KDP33411.1|  hypothetical protein JCGZ_06982                         126   5e-31   Jatropha curcas
gb|KDO32836.1|  hypothetical protein SPRG_02529                         126   5e-31   Saprolegnia parasitica CBS 223.65
gb|KDO32827.1|  hypothetical protein SPRG_02520                         127   5e-31   Saprolegnia parasitica CBS 223.65
gb|AFK11103.1|  nucleoredoxin-like protein                              124   6e-31   Callorhinchus milii [Australian ghost shark]
ref|XP_010692758.1|  PREDICTED: probable nucleoredoxin 2                126   6e-31   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_004901065.1|  PREDICTED: nucleoredoxin                           125   6e-31   
ref|XP_004376324.1|  PREDICTED: nucleoredoxin                           126   8e-31   Trichechus manatus latirostris
ref|XP_010923905.1|  PREDICTED: probable nucleoredoxin 2                125   9e-31   Elaeis guineensis
ref|XP_005402699.1|  PREDICTED: nucleoredoxin                           124   1e-30   
ref|XP_004594003.1|  PREDICTED: nucleoredoxin                           124   1e-30   Ochotona princeps [southern American pika]
ref|XP_006378295.1|  hypothetical protein POPTR_0010s07010g             125   1e-30   
ref|XP_010640711.1|  PREDICTED: nucleoredoxin                           124   1e-30   Fukomys damarensis [Damara mole rat]
gb|KDO67158.1|  hypothetical protein CISIN_1g016384mg                   123   1e-30   Citrus sinensis [apfelsine]
ref|XP_004707373.1|  PREDICTED: nucleoredoxin                           124   1e-30   
ref|XP_011041579.1|  PREDICTED: probable nucleoredoxin 1                123   1e-30   Populus euphratica
ref|XP_003469738.1|  PREDICTED: nucleoredoxin isoform 2                 124   2e-30   
ref|XP_009924330.1|  PREDICTED: nucleoredoxin                           120   2e-30   Haliaeetus albicilla
gb|EHB13353.1|  Nucleoredoxin                                           124   2e-30   Heterocephalus glaber [naked mole rat]
ref|XP_004857156.1|  PREDICTED: nucleoredoxin isoform X1                125   2e-30   Heterocephalus glaber [naked mole rat]
ref|XP_004857157.1|  PREDICTED: nucleoredoxin isoform X2                125   2e-30   
ref|XP_003469737.1|  PREDICTED: nucleoredoxin isoform 1                 124   2e-30   Cavia porcellus [guinea pig]
gb|KFP95148.1|  Nucleoredoxin                                           120   2e-30   Haliaeetus albicilla
ref|XP_007898874.1|  PREDICTED: nucleoredoxin                           123   2e-30   Callorhinchus milii [Australian ghost shark]
gb|KFZ53194.1|  Nucleoredoxin                                           121   2e-30   Podiceps cristatus
ref|XP_010664141.1|  PREDICTED: probable nucleoredoxin 2 isoform X2     124   3e-30   Vitis vinifera
ref|XP_009574641.1|  PREDICTED: nucleoredoxin                           120   3e-30   Fulmarus glacialis
ref|XP_002510593.1|  nucleoredoxin, putative                            124   3e-30   Ricinus communis
ref|XP_006891069.1|  PREDICTED: nucleoredoxin isoform X4                124   3e-30   Elephantulus edwardii [Cape long-eared elephant shrew]
gb|KFW03638.1|  Nucleoredoxin                                           120   3e-30   Fulmarus glacialis
gb|KFV57197.1|  Nucleoredoxin                                           121   3e-30   
ref|XP_006033187.1|  PREDICTED: nucleoredoxin                           123   3e-30   
ref|XP_006435249.1|  hypothetical protein CICLE_v10001187mg             122   3e-30   
ref|XP_005654033.1|  PREDICTED: nucleoredoxin                           122   3e-30   
ref|XP_009814648.1|  PREDICTED: nucleoredoxin                           121   4e-30   
ref|XP_006277726.1|  PREDICTED: nucleoredoxin                           123   4e-30   
ref|XP_004635420.1|  PREDICTED: nucleoredoxin isoform X3                123   4e-30   
gb|KJB18918.1|  hypothetical protein B456_003G074700                    124   4e-30   
ref|XP_009971007.1|  PREDICTED: nucleoredoxin                           120   4e-30   
ref|XP_008827049.1|  PREDICTED: nucleoredoxin                           124   4e-30   
gb|KFV58459.1|  Nucleoredoxin                                           120   4e-30   
ref|NP_001135672.1|  nucleoredoxin                                      124   4e-30   
gb|KFQ89891.1|  Nucleoredoxin                                           120   4e-30   
ref|XP_006891068.1|  PREDICTED: nucleoredoxin isoform X3                124   4e-30   
gb|KDO67148.1|  hypothetical protein CISIN_1g016384mg                   123   5e-30   
ref|XP_010720373.1|  PREDICTED: nucleoredoxin isoform X3                122   5e-30   
gb|KFW07294.1|  Nucleoredoxin                                           121   5e-30   
emb|CDM84533.1|  unnamed protein product                                123   5e-30   
ref|XP_006891067.1|  PREDICTED: nucleoredoxin isoform X2                124   5e-30   
gb|KFP31328.1|  Nucleoredoxin                                           121   5e-30   
tpg|DAA59507.1|  TPA: hypothetical protein ZEAMMB73_323265              122   5e-30   
ref|NP_001086161.1|  nucleoredoxin                                      123   6e-30   
ref|XP_006891066.1|  PREDICTED: nucleoredoxin isoform X1                123   6e-30   
ref|XP_006435252.1|  hypothetical protein CICLE_v10001187mg             123   6e-30   
ref|XP_004635418.1|  PREDICTED: nucleoredoxin isoform X1                123   6e-30   
gb|KDO67152.1|  hypothetical protein CISIN_1g016384mg                   123   6e-30   
ref|XP_006483643.1|  PREDICTED: probable nucleoredoxin 3-like iso...    123   6e-30   
ref|XP_010720372.1|  PREDICTED: nucleoredoxin isoform X2                122   6e-30   
ref|XP_004635419.1|  PREDICTED: nucleoredoxin isoform X2                123   6e-30   
gb|KDO84955.1|  hypothetical protein CISIN_1g013684mg                   123   7e-30   
ref|XP_010720371.1|  PREDICTED: nucleoredoxin isoform X1                122   7e-30   
gb|KFO08069.1|  Nucleoredoxin                                           120   7e-30   
ref|XP_009503264.1|  PREDICTED: nucleoredoxin                           120   7e-30   
ref|XP_009484678.1|  PREDICTED: nucleoredoxin                           120   8e-30   
gb|KFZ62045.1|  Nucleoredoxin                                           120   8e-30   
ref|XP_010170099.1|  PREDICTED: nucleoredoxin                           120   8e-30   
gb|KFP38132.1|  Nucleoredoxin                                           120   9e-30   
gb|KFV69446.1|  Nucleoredoxin                                           121   1e-29   
emb|CDJ68127.1|  nucleoredoxin, putative                                122   1e-29   
ref|XP_010199267.1|  PREDICTED: nucleoredoxin                           121   1e-29   
ref|XP_009978109.1|  PREDICTED: LOW QUALITY PROTEIN: nucleoredoxin      121   1e-29   
gb|EOB06969.1|  Nucleoredoxin                                           121   1e-29   
ref|XP_010119022.1|  PREDICTED: nucleoredoxin                           120   1e-29   
gb|AAH73845.1|  NXN protein                                             120   1e-29   
gb|KFP11930.1|  Nucleoredoxin                                           121   1e-29   
gb|KFM06813.1|  Nucleoredoxin                                           121   1e-29   
ref|XP_003642481.2|  PREDICTED: nucleoredoxin                           120   1e-29   
ref|XP_010007431.1|  PREDICTED: nucleoredoxin                           121   1e-29   
gb|KFU86270.1|  Nucleoredoxin                                           121   2e-29   
ref|XP_009276611.1|  PREDICTED: nucleoredoxin                           121   2e-29   
gb|KFQ34957.1|  Nucleoredoxin                                           120   2e-29   
gb|KFR05500.1|  Nucleoredoxin                                           121   2e-29   
ref|XP_005424535.1|  PREDICTED: nucleoredoxin                           121   2e-29   
ref|XP_009901657.1|  PREDICTED: nucleoredoxin                           121   2e-29   
emb|CDJ39906.1|  nucleoredoxin, putative                                122   2e-29   
ref|XP_010079547.1|  PREDICTED: nucleoredoxin                           120   2e-29   
ref|XP_008944115.1|  PREDICTED: nucleoredoxin                           120   2e-29   
gb|KFV13409.1|  Nucleoredoxin                                           120   2e-29   
ref|XP_009671237.1|  PREDICTED: nucleoredoxin                           120   2e-29   
ref|XP_005011914.1|  PREDICTED: nucleoredoxin                           121   2e-29   
gb|ACG38694.1|  protein disulfide isomerase                             122   2e-29   
ref|XP_009957883.1|  PREDICTED: nucleoredoxin                           121   2e-29   
ref|NP_001131397.1|  protein disulfide isomerase                        122   2e-29   
ref|XP_009093217.1|  PREDICTED: nucleoredoxin                           120   2e-29   
ref|XP_005512023.1|  PREDICTED: nucleoredoxin                           121   2e-29   
gb|EMC80597.1|  Nucleoredoxin                                           120   2e-29   
ref|XP_004605049.1|  PREDICTED: nucleoredoxin                           120   2e-29   
ref|XP_008654313.1|  PREDICTED: protein disulfide isomerase isofo...    122   2e-29   
gb|KFV80184.1|  Nucleoredoxin                                           120   2e-29   
ref|XP_009468450.1|  PREDICTED: nucleoredoxin                           121   2e-29   
ref|XP_005493616.1|  PREDICTED: nucleoredoxin                           120   2e-29   
ref|XP_009318514.1|  PREDICTED: nucleoredoxin                           120   2e-29   
ref|NP_001169000.1|  uncharacterized protein LOC100382831               121   2e-29   
ref|XP_009632193.1|  PREDICTED: nucleoredoxin                           120   3e-29   
ref|XP_008629409.1|  PREDICTED: nucleoredoxin                           120   3e-29   
gb|KFO57186.1|  Nucleoredoxin                                           120   3e-29   
ref|XP_002456473.1|  hypothetical protein SORBIDRAFT_03g036980          121   3e-29   
ref|XP_010400666.1|  PREDICTED: nucleoredoxin isoform X3                120   3e-29   
ref|XP_010400664.1|  PREDICTED: nucleoredoxin isoform X1                120   3e-29   
gb|KFP89121.1|  Nucleoredoxin                                           120   3e-29   
ref|XP_010400665.1|  PREDICTED: nucleoredoxin isoform X2                120   3e-29   
gb|KFW86506.1|  Nucleoredoxin                                           120   3e-29   
gb|EMP37752.1|  Nucleoredoxin                                           121   3e-29   
ref|XP_009868051.1|  PREDICTED: nucleoredoxin                           120   3e-29   
ref|XP_002191661.1|  PREDICTED: nucleoredoxin-like                      119   3e-29   
ref|XP_005233760.1|  PREDICTED: nucleoredoxin                           120   3e-29   
ref|XP_001701995.1|  nucleoredoxin 2                                    121   3e-29   
ref|XP_010572043.1|  PREDICTED: nucleoredoxin                           121   3e-29   
ref|XP_005056720.1|  PREDICTED: nucleoredoxin                           120   4e-29   
ref|XP_005837333.1|  hypothetical protein GUITHDRAFT_151288             116   4e-29   
gb|AGT16827.1|  disulfide isomerase                                     120   4e-29   
ref|XP_008928855.1|  PREDICTED: nucleoredoxin                           120   5e-29   
gb|EEC71628.1|  hypothetical protein OsI_04055                          120   5e-29   
ref|XP_008968177.1|  PREDICTED: nucleoredoxin                           119   5e-29   
ref|NP_001044503.1|  Os01g0794400                                       120   5e-29   
ref|XP_005256815.1|  PREDICTED: nucleoredoxin isoform X3                119   5e-29   
ref|XP_005298217.1|  PREDICTED: nucleoredoxin                           120   5e-29   
ref|NP_001192248.1|  nucleoredoxin isoform 2                            119   5e-29   
ref|XP_005256814.1|  PREDICTED: nucleoredoxin isoform X2                119   5e-29   
gb|KGL77160.1|  Nucleoredoxin                                           119   6e-29   
gb|AAH09327.2|  NXN protein                                             119   6e-29   
ref|XP_007017891.1|  DC1 domain-containing protein isoform 2            120   6e-29   
ref|XP_005439924.1|  PREDICTED: nucleoredoxin                           120   6e-29   
ref|XP_009074337.1|  PREDICTED: nucleoredoxin                           118   6e-29   
gb|KGL91395.1|  Nucleoredoxin                                           119   6e-29   
ref|XP_008864269.1|  hypothetical protein H310_02512                    120   6e-29   
gb|KFP81403.1|  Nucleoredoxin                                           118   6e-29   
ref|XP_006450083.1|  hypothetical protein CICLE_v10010213mg             124   6e-29   
ref|XP_010136252.1|  PREDICTED: nucleoredoxin                           117   7e-29   
ref|XP_009839261.1|  hypothetical protein H257_13449                    120   7e-29   
ref|XP_008219971.1|  PREDICTED: probable nucleoredoxin 3 isoform X2     120   8e-29   
ref|XP_009944129.1|  PREDICTED: nucleoredoxin                           121   9e-29   
gb|ELU09340.1|  hypothetical protein CAPTEDRAFT_174065                  120   9e-29   
ref|XP_010188235.1|  PREDICTED: nucleoredoxin                           119   9e-29   
ref|XP_009839259.1|  hypothetical protein H257_13447                    120   1e-28   
gb|KFQ39372.1|  Nucleoredoxin                                           119   1e-28   
gb|KDO67150.1|  hypothetical protein CISIN_1g016384mg                   119   1e-28   
gb|EAW90639.1|  nucleoredoxin, isoform CRA_a                            119   1e-28   
ref|XP_009429794.1|  PREDICTED: nucleoredoxin isoform X1                119   1e-28   
gb|KFP64510.1|  Nucleoredoxin                                           117   1e-28   
ref|XP_003800168.1|  PREDICTED: nucleoredoxin                           119   1e-28   
ref|XP_010212818.1|  PREDICTED: nucleoredoxin                           120   1e-28   
ref|XP_009697403.1|  PREDICTED: nucleoredoxin                           117   1e-28   
ref|XP_006646403.1|  PREDICTED: probable nucleoredoxin 2-like           119   1e-28   
ref|XP_010863626.1|  PREDICTED: nucleoredoxin                           119   1e-28   
ref|XP_005525777.1|  PREDICTED: nucleoredoxin                           119   1e-28   
ref|NP_071908.2|  nucleoredoxin isoform 1                               119   1e-28   
ref|XP_004970236.1|  PREDICTED: probable nucleoredoxin 2-like           119   2e-28   
ref|XP_009127152.1|  PREDICTED: probable nucleoredoxin 3                119   2e-28   
ref|XP_007440160.1|  PREDICTED: nucleoredoxin                           118   2e-28   
ref|NP_001167329.1|  Tryparedoxin                                       119   2e-28   
ref|XP_009187555.1|  PREDICTED: nucleoredoxin isoform X3                118   2e-28   
ref|XP_004291281.1|  PREDICTED: probable nucleoredoxin 3                119   2e-28   
dbj|BAK03911.1|  predicted protein                                      119   2e-28   
ref|XP_007567435.1|  PREDICTED: nucleoredoxin                           119   2e-28   
ref|XP_009417224.1|  PREDICTED: probable nucleoredoxin 2 isoform X3     118   2e-28   
ref|XP_009417223.1|  PREDICTED: probable nucleoredoxin 2 isoform X2     118   2e-28   
gb|EHH57553.1|  Nucleoredoxin                                           118   2e-28   
ref|XP_009881039.1|  PREDICTED: nucleoredoxin                           119   2e-28   
ref|XP_004075375.1|  PREDICTED: nucleoredoxin                           119   2e-28   
emb|CDX68729.1|  BnaC01g07240D                                          119   2e-28   
ref|XP_005582477.1|  PREDICTED: nucleoredoxin isoform X3                117   2e-28   
ref|XP_005582476.1|  PREDICTED: nucleoredoxin isoform X2                117   2e-28   
ref|XP_006382207.1|  hypothetical protein POPTR_0006s29370g             118   3e-28   
ref|XP_009556788.1|  PREDICTED: nucleoredoxin                           119   3e-28   
gb|KFQ52683.1|  Nucleoredoxin                                           117   3e-28   
ref|XP_010016215.1|  PREDICTED: nucleoredoxin                           117   3e-28   
ref|XP_003417015.1|  PREDICTED: nucleoredoxin                           117   3e-28   
ref|XP_008423154.1|  PREDICTED: nucleoredoxin                           118   3e-28   
ref|XP_004685199.1|  PREDICTED: nucleoredoxin                           118   3e-28   
ref|XP_006977476.1|  PREDICTED: nucleoredoxin                           117   3e-28   
ref|XP_005804144.1|  PREDICTED: nucleoredoxin-like                      118   3e-28   
ref|XP_001634149.1|  predicted protein                                  118   3e-28   
ref|XP_005474805.1|  PREDICTED: nucleoredoxin-like isoform X2           117   3e-28   
ref|XP_010371830.1|  PREDICTED: nucleoredoxin                           118   4e-28   
ref|XP_010669505.1|  PREDICTED: probable nucleoredoxin 3                118   4e-28   
ref|XP_005932097.1|  PREDICTED: nucleoredoxin-like isoform X3           117   4e-28   
ref|XP_005932096.1|  PREDICTED: nucleoredoxin-like isoform X2           117   4e-28   
emb|CDQ77743.1|  unnamed protein product                                118   4e-28   
ref|XP_008824756.1|  PREDICTED: nucleoredoxin                           116   4e-28   
ref|XP_007011460.1|  Kinase C-like zinc finger protein                  118   4e-28   
ref|XP_003968580.1|  PREDICTED: nucleoredoxin-like                      118   4e-28   
ref|XP_003912092.1|  PREDICTED: nucleoredoxin isoform X1                118   4e-28   
ref|XP_005582475.1|  PREDICTED: nucleoredoxin isoform X1                118   4e-28   
ref|XP_006452948.1|  hypothetical protein CICLE_v10010235mg             118   4e-28   
ref|XP_001701807.1|  nucleoredoxin 1                                    117   4e-28   
ref|XP_005328005.1|  PREDICTED: nucleoredoxin                           117   5e-28   
ref|NP_567869.1|  putative nucleoredoxin 3                              117   5e-28   
dbj|BAD88798.1|  nucleoredoxin                                          118   5e-28   
ref|XP_006863275.1|  PREDICTED: nucleoredoxin isoform X2                117   5e-28   
ref|XP_008007939.1|  PREDICTED: nucleoredoxin                           118   5e-28   
ref|XP_002718941.1|  PREDICTED: nucleoredoxin                           118   5e-28   
ref|XP_005349576.1|  PREDICTED: nucleoredoxin isoform X2                117   6e-28   
ref|XP_004483855.1|  PREDICTED: nucleoredoxin isoform 2                 117   6e-28   
ref|NP_001101755.1|  nucleoredoxin                                      117   6e-28   
ref|XP_004483854.1|  PREDICTED: nucleoredoxin isoform 1                 118   6e-28   
ref|XP_006246969.1|  PREDICTED: nucleoredoxin isoform X1                117   6e-28   
ref|XP_008287281.1|  PREDICTED: nucleoredoxin                           117   6e-28   
ref|XP_006863274.1|  PREDICTED: nucleoredoxin isoform X1                117   6e-28   
gb|ELV11126.1|  Nucleoredoxin                                           116   6e-28   
ref|XP_001701806.1|  nucleoredoxin 1                                    117   7e-28   
ref|XP_007623197.1|  PREDICTED: nucleoredoxin isoform X2                116   7e-28   
gb|AAH04688.1|  Nxn protein                                             117   7e-28   
ref|XP_005349575.1|  PREDICTED: nucleoredoxin isoform X1                117   7e-28   
ref|NP_032776.1|  nucleoredoxin                                         117   7e-28   
ref|XP_007123660.1|  PREDICTED: nucleoredoxin                           116   7e-28   
ref|XP_004318054.1|  PREDICTED: nucleoredoxin                           116   7e-28   
gb|EDL12859.1|  nucleoredoxin                                           117   7e-28   
ref|XP_008613953.1|  hypothetical protein SDRG_09779                    119   7e-28   
ref|XP_005143023.1|  PREDICTED: nucleoredoxin                           117   8e-28   
ref|XP_003440171.1|  PREDICTED: nucleoredoxin-like isoform X1           117   8e-28   
ref|XP_010447596.1|  PREDICTED: probable nucleoredoxin 3                117   8e-28   
ref|XP_003506776.1|  PREDICTED: nucleoredoxin isoform X1                117   8e-28   
ref|XP_008591306.1|  PREDICTED: nucleoredoxin                           116   8e-28   
ref|XP_009353319.1|  PREDICTED: probable nucleoredoxin 3                117   9e-28   
ref|XP_010956525.1|  PREDICTED: nucleoredoxin                           116   9e-28   
ref|XP_003564391.1|  PREDICTED: probable nucleoredoxin 2                117   9e-28   
ref|XP_002425676.1|  nucleoredoxin, putative                            117   9e-28   
ref|XP_008219969.1|  PREDICTED: probable nucleoredoxin 3 isoform X1     117   9e-28   
ref|XP_004433510.1|  PREDICTED: nucleoredoxin                           117   1e-27   
ref|XP_007137135.1|  hypothetical protein PHAVU_009G102600g             117   1e-27   
ref|XP_009015788.1|  hypothetical protein HELRODRAFT_155703             112   1e-27   
ref|XP_006940095.1|  PREDICTED: nucleoredoxin                           116   1e-27   
ref|XP_007223217.1|  hypothetical protein PRUPE_ppa007157mg             117   1e-27   
ref|XP_006474525.1|  PREDICTED: probable nucleoredoxin 1-like           117   1e-27   
ref|XP_006641152.1|  PREDICTED: nucleoredoxin-like                      117   1e-27   
ref|XP_004747434.1|  PREDICTED: nucleoredoxin                           116   1e-27   
gb|EPQ02770.1|  Nucleoredoxin                                           116   1e-27   
ref|XP_004807669.1|  PREDICTED: nucleoredoxin                           116   1e-27   
ref|XP_008357428.1|  PREDICTED: probable nucleoredoxin 3                116   1e-27   
ref|XP_008307694.1|  PREDICTED: nucleoredoxin                           117   1e-27   
ref|XP_006099271.1|  PREDICTED: nucleoredoxin                           116   1e-27   
gb|ELK26967.1|  Nucleoredoxin                                           115   1e-27   
ref|XP_008122185.1|  PREDICTED: nucleoredoxin                           115   1e-27   
ref|XP_004267131.1|  PREDICTED: nucleoredoxin isoform 1                 117   1e-27   
ref|XP_005067434.1|  PREDICTED: nucleoredoxin isoform X2                116   1e-27   
ref|XP_010432885.1|  PREDICTED: probable nucleoredoxin 3                116   2e-27   
ref|XP_005858409.1|  PREDICTED: nucleoredoxin                           116   2e-27   
ref|XP_004267132.1|  PREDICTED: nucleoredoxin isoform 2                 116   2e-27   
ref|XP_006167578.1|  PREDICTED: nucleoredoxin isoform X1                117   2e-27   
ref|XP_005067433.1|  PREDICTED: nucleoredoxin isoform X1                116   2e-27   



>ref|XP_009762378.1| PREDICTED: probable nucleoredoxin 1 [Nicotiana sylvestris]
Length=520

 Score =   238 bits (606),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 108/144 (75%), Positives = 126/144 (88%), Gaps = 0/144 (0%)
 Frame = +3

Query  99   DAHDLRSILCSSDRDFLIRNSGHQVKVDDLKGKKIGIYFSASWCGPCHRFTPNLATVYNE  278
            D+HDL  +L SSDRDFLIRN+G QVK+D LK KK+G+YFSASWCGPC  FTPNL   YNE
Sbjct  5    DSHDLMKLLGSSDRDFLIRNNGDQVKLDALKEKKVGLYFSASWCGPCQHFTPNLVEAYNE  64

Query  279  LLPKGNFEVVFVSADEDEESFKEYFGKMPWTAVPFSDSVTRERLDALFTVRGIPHLVILD  458
            LLPKG+FEVVF++ADED++SFKEYF KMPW AVPFSDS TR+RLD LF V+GIPHLVILD
Sbjct  65   LLPKGDFEVVFLTADEDDKSFKEYFSKMPWLAVPFSDSETRKRLDELFAVKGIPHLVILD  124

Query  459  ESGKVTTEDGVDIVLEHGVEAYPF  530
            +SGKV T++GV+I+LEHGVE YPF
Sbjct  125  DSGKVVTDNGVEIILEHGVEGYPF  148


 Score =   139 bits (350),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 67/145 (46%), Positives = 88/145 (61%), Gaps = 2/145 (1%)
 Frame = +3

Query  99   DAHDLRSILCSSDRDFLIRNSGHQVKVDDLKGKKIGIYFSASWCGPCHRFTPNLATVYNE  278
            +A  L SIL + D DF+I   G ++ V DL GK I +YFSA WC PC  FTP L   Y  
Sbjct  327  EAQTLESILVTGDHDFVIGKDGEKILVSDLVGKNILLYFSAHWCPPCRAFTPKLKEAYEN  386

Query  279  LLPK-GNFEVVFVSADEDEESFKEYFGKMPWTAVPFSDSVTRERLDALFTVRGIPHLVIL  455
            +  K G  EV+F+S+D+D+ SF +YF  MPW A+PF D   +  L  LF V+GIP LV +
Sbjct  387  IKAKSGPLEVIFISSDQDQASFDDYFATMPWLALPFGDE-RKASLSRLFKVQGIPTLVAI  445

Query  456  DESGKVTTEDGVDIVLEHGVEAYPF  530
              SGK  T     +++ HG EA+PF
Sbjct  446  GPSGKTITTGARSMIMRHGAEAFPF  470


 Score =   103 bits (256),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 60/162 (37%), Positives = 92/162 (57%), Gaps = 7/162 (4%)
 Frame = +3

Query  63   ERKASSMAEQNGDA---HDLRSILCSSDRDFLIRNSGHQVKVDDLKGKKIGIYFSASWCG  233
            + + + + EQ   A     L+SIL S  R++++   G +V V +L+GK +G+YFS S   
Sbjct  150  QERLNELKEQEETAKREQSLKSILESQSRNYVVAADGRKVPVAELEGKIVGLYFSISSFE  209

Query  234  PCHRFTPNLATVYNELLPKG-NFEVVFVSAD--EDEESFKEYFGKMPWTAVPFSDSVTRE  404
             C  FT  L  +Y++L  +G NFEVV +  D  + +ESFK+ F  MPW ++P  D  T E
Sbjct  210  ECESFTRMLIDMYDKLKAQGENFEVVMIPLDGEDGDESFKKEFASMPWYSLPLKDR-TCE  268

Query  405  RLDALFTVRGIPHLVILDESGKVTTEDGVDIVLEHGVEAYPF  530
            +L   F +  +P LVI+   GK    +  + + EHG+ AYPF
Sbjct  269  KLARYFELSTLPTLVIIGTDGKTLHSNVAEAIEEHGILAYPF  310



>gb|KDP26595.1| hypothetical protein JCGZ_17753 [Jatropha curcas]
Length=572

 Score =   239 bits (610),  Expect = 4e-72, Method: Compositional matrix adjust.
 Identities = 109/151 (72%), Positives = 131/151 (87%), Gaps = 1/151 (1%)
 Frame = +3

Query  81   MAEQ-NGDAHDLRSILCSSDRDFLIRNSGHQVKVDDLKGKKIGIYFSASWCGPCHRFTPN  257
            MAE  NGD+HD RS+L SSD D+LIRN+G QVK+D LKGKKIG+YFSASWCGPC RFTP 
Sbjct  1    MAEMANGDSHDFRSLLSSSDCDYLIRNNGDQVKIDSLKGKKIGLYFSASWCGPCQRFTPV  60

Query  258  LATVYNELLPKGNFEVVFVSADEDEESFKEYFGKMPWTAVPFSDSVTRERLDALFTVRGI  437
            L   YNEL PKGNFE+VF+SADED+ESFK+YF KMPW A+PFS+S TR+RLD LF ++GI
Sbjct  61   LVEAYNELAPKGNFEIVFISADEDDESFKKYFSKMPWLAIPFSESETRDRLDQLFKIQGI  120

Query  438  PHLVILDESGKVTTEDGVDIVLEHGVEAYPF  530
            PHLVI+DE+GKV++E GV+I+ E+GVEAYPF
Sbjct  121  PHLVIIDENGKVSSESGVEIIREYGVEAYPF  151


 Score =   134 bits (336),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 65/144 (45%), Positives = 89/144 (62%), Gaps = 2/144 (1%)
 Frame = +3

Query  102  AHDLRSILCSSDRDFLIRNSGHQVKVDDLKGKKIGIYFSASWCGPCHRFTPNLATVYNEL  281
            +  L S+L S DRDF+I   G +V V DL GK I +YFSA WC PC  F P L   Y+E+
Sbjct  329  SQTLESVLVSGDRDFVIGKDGAKVLVSDLIGKNILLYFSAHWCPPCRAFLPKLIEAYHEI  388

Query  282  LPKGN-FEVVFVSADEDEESFKEYFGKMPWTAVPFSDSVTRERLDALFTVRGIPHLVILD  458
              K N FEV+F+S+D D+ S+ ++F  MPW A+PF D   +  L   F V+GIP LV L 
Sbjct  389  KAKDNAFEVIFISSDSDQASYDDFFSTMPWLALPFGDE-RKASLSRKFKVQGIPMLVALG  447

Query  459  ESGKVTTEDGVDIVLEHGVEAYPF  530
             +G+  T++   ++  HG +AYPF
Sbjct  448  PTGRTITKEARSLITIHGADAYPF  471


 Score =   119 bits (298),  Expect = 6e-28, Method: Compositional matrix adjust.
 Identities = 63/158 (40%), Positives = 93/158 (59%), Gaps = 5/158 (3%)
 Frame = +3

Query  69   KASSMAEQNGDA---HDLRSILCSSDRDFLIRNSGHQVKVDDLKGKKIGIYFSASWCGPC  239
            K   + EQ  +A     LRSIL    RD++I + G +  + +L+GK +G++FS +    C
Sbjct  155  KIKQLKEQEEEARRNQSLRSILVVHSRDYVISSDGKKFPISELEGKTVGLFFSLASYKSC  214

Query  240  HRFTPNLATVYNELLPKG-NFEVVFVSADEDEESFKEYFGKMPWTAVPFSDSVTRERLDA  416
              FT  L  VY +L  KG NFEVVF+S D+DEE+F++  G MPW ++PF D    E+L  
Sbjct  215  VDFTQKLVEVYGKLKEKGENFEVVFISLDDDEETFQQSLGGMPWLSLPFKDKCC-EKLVR  273

Query  417  LFTVRGIPHLVILDESGKVTTEDGVDIVLEHGVEAYPF  530
             F +  +P LV++   GK    +  + + EHGV+AYPF
Sbjct  274  YFELSTVPTLVVIGPDGKTLHSNVAEAIEEHGVQAYPF  311



>ref|XP_009626674.1| PREDICTED: probable nucleoredoxin 1 [Nicotiana tomentosiformis]
Length=520

 Score =   236 bits (601),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 107/144 (74%), Positives = 125/144 (87%), Gaps = 0/144 (0%)
 Frame = +3

Query  99   DAHDLRSILCSSDRDFLIRNSGHQVKVDDLKGKKIGIYFSASWCGPCHRFTPNLATVYNE  278
            D+HDL  +L SSDRDFLIRN+G QVK+D LK KK+G+YFSASWCGPC  FTPNL   YNE
Sbjct  5    DSHDLMKLLGSSDRDFLIRNNGDQVKLDALKEKKVGLYFSASWCGPCQHFTPNLVEAYNE  64

Query  279  LLPKGNFEVVFVSADEDEESFKEYFGKMPWTAVPFSDSVTRERLDALFTVRGIPHLVILD  458
            LLPKG+FEVVF++ADED+ESFKEYF KMPW AVPFSDS TR+RL+ LF V+GIPHLVILD
Sbjct  65   LLPKGDFEVVFLTADEDDESFKEYFSKMPWLAVPFSDSETRKRLNELFAVKGIPHLVILD  124

Query  459  ESGKVTTEDGVDIVLEHGVEAYPF  530
            + GKV T++GV+I+LEHGVE YPF
Sbjct  125  DCGKVVTDNGVEIILEHGVEGYPF  148


 Score =   137 bits (345),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 66/145 (46%), Positives = 89/145 (61%), Gaps = 2/145 (1%)
 Frame = +3

Query  99   DAHDLRSILCSSDRDFLIRNSGHQVKVDDLKGKKIGIYFSASWCGPCHRFTPNLATVYNE  278
            +A  L SIL + D DF+I   G ++ V DL GK I +YFSA WC PC  FTP L   Y +
Sbjct  327  EAQTLESILVTGDHDFVIGKDGEKILVSDLVGKNILLYFSAHWCPPCRAFTPKLKDAYEK  386

Query  279  LLPK-GNFEVVFVSADEDEESFKEYFGKMPWTAVPFSDSVTRERLDALFTVRGIPHLVIL  455
            +  K G  EV+F+S+D+D+ SF +YF  MPW A+PF D   +  L  LF V+GIP LV +
Sbjct  387  IKTKNGPLEVIFISSDQDQASFDDYFATMPWLALPFGDE-RKASLSRLFKVQGIPTLVAI  445

Query  456  DESGKVTTEDGVDIVLEHGVEAYPF  530
               GK  T    ++++ HG EA+PF
Sbjct  446  GPLGKTITTGARNMIMRHGAEAFPF  470


 Score =   104 bits (260),  Expect = 6e-23, Method: Compositional matrix adjust.
 Identities = 61/168 (36%), Positives = 95/168 (57%), Gaps = 6/168 (4%)
 Frame = +3

Query  36   FQFSKRKGEERKASSMAEQNGDAHDLRSILCSSDRDFLIRNSGHQVKVDDLKGKKIGIYF  215
            + F++ +  E K    A +      L+SIL S  R++++   G +V V +L+GK +G+YF
Sbjct  146  YPFTQERLNELKEQEEAAKR--EQSLKSILESQSRNYVVAVDGRKVPVAELEGKIVGLYF  203

Query  216  SASWCGPCHRFTPNLATVYNELLPKG-NFEVVFVSAD--EDEESFKEYFGKMPWTAVPFS  386
            S +    C  FT  L  +Y++L  +G NFEVV +  D  +D+ESFK+ F  MPW ++P  
Sbjct  204  SMTSFEECESFTRMLIDMYDKLKAQGENFEVVMIPLDGEDDDESFKKEFASMPWYSLPLK  263

Query  387  DSVTRERLDALFTVRGIPHLVILDESGKVTTEDGVDIVLEHGVEAYPF  530
            D  T E+L   F +  +P LVI+   GK    +  + + EHG+ AYPF
Sbjct  264  DR-TCEKLARYFELSTLPTLVIIGTDGKTLHSNVAEAIEEHGILAYPF  310



>emb|CDP00158.1| unnamed protein product [Coffea canephora]
Length=549

 Score =   231 bits (588),  Expect = 4e-69, Method: Compositional matrix adjust.
 Identities = 108/151 (72%), Positives = 126/151 (83%), Gaps = 1/151 (1%)
 Frame = +3

Query  81   MAE-QNGDAHDLRSILCSSDRDFLIRNSGHQVKVDDLKGKKIGIYFSASWCGPCHRFTPN  257
            MAE  NG  HDL ++L SSDRDFLIRN+G QVKV+ LKGKK+G+YFSASWCGPC RFTP 
Sbjct  1    MAEGANGRVHDLNTMLSSSDRDFLIRNNGQQVKVESLKGKKVGLYFSASWCGPCRRFTPK  60

Query  258  LATVYNELLPKGNFEVVFVSADEDEESFKEYFGKMPWTAVPFSDSVTRERLDALFTVRGI  437
            L  VYNELLPK +FE+VFVSADED+ESF  YF KMPW A+PFSDS TR+RLD LF+VRGI
Sbjct  61   LVEVYNELLPKDDFEIVFVSADEDDESFAAYFSKMPWLAIPFSDSETRDRLDELFSVRGI  120

Query  438  PHLVILDESGKVTTEDGVDIVLEHGVEAYPF  530
            PHLVI+ E+GKV+T+DGV++V   G E YPF
Sbjct  121  PHLVIIGENGKVSTDDGVEVVQGCGAEGYPF  151


 Score =   139 bits (349),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 70/145 (48%), Positives = 89/145 (61%), Gaps = 2/145 (1%)
 Frame = +3

Query  99   DAHDLRSILCSSDRDFLIRNSGHQVKVDDLKGKKIGIYFSASWCGPCHRFTPNLATVYNE  278
            +A  L SIL S D +F+I   G +V V DL GK I +YFSA WC PC  F P L   Y+ 
Sbjct  328  EAQTLESILVSGDHNFVIGKDGVKVPVSDLVGKTILLYFSAHWCPPCRAFLPKLIEAYHG  387

Query  279  LLPK-GNFEVVFVSADEDEESFKEYFGKMPWTAVPFSDSVTRERLDALFTVRGIPHLVIL  455
            +  K G FEVVF+S+D D+ SF E+F KMPW A+PF D   +E L  +F V GIP LV +
Sbjct  388  IKAKNGAFEVVFISSDRDQNSFDEFFSKMPWLALPFGDG-RKESLSRVFKVLGIPMLVAI  446

Query  456  DESGKVTTEDGVDIVLEHGVEAYPF  530
              +GK  T +  D++  HG  AYPF
Sbjct  447  GPTGKTVTTEARDLITYHGANAYPF  471


 Score =   107 bits (267),  Expect = 8e-24, Method: Compositional matrix adjust.
 Identities = 59/158 (37%), Positives = 93/158 (59%), Gaps = 5/158 (3%)
 Frame = +3

Query  60   EERKASSMAEQNGDAHDLRSILCSSDRDFLIRNSGHQVKVDDLKGKKIGIYFSASWCGPC  239
            E ++   +A +N     L++IL S  RD+++ + G +V V +L+GK +G+YF  S  G  
Sbjct  158  EIKEQEEVARRN---QTLKTILVSRSRDYVVASDGKKVSVAELEGKTVGLYFFLSTFGGR  214

Query  240  HRFTPNLATVYNELLPKG-NFEVVFVSADEDEESFKEYFGKMPWTAVPFSDSVTRERLDA  416
            + FT  L  +Y +L  KG NFE+V +  D+DEES+K +F  MPW ++P  D    E+L  
Sbjct  215  NAFTSKLLELYEKLKAKGENFEIVMIPLDDDEESYKLWFKNMPWLSLPVKDKGC-EKLVR  273

Query  417  LFTVRGIPHLVILDESGKVTTEDGVDIVLEHGVEAYPF  530
             F +  +P +VI+   GK    +  + + EHGV+AYPF
Sbjct  274  YFELFTLPTVVIIGPDGKTLHSNVAEAIEEHGVQAYPF  311



>ref|XP_002525369.1| nucleoredoxin, putative [Ricinus communis]
 gb|EEF37007.1| nucleoredoxin, putative [Ricinus communis]
Length=575

 Score =   231 bits (588),  Expect = 5e-69, Method: Compositional matrix adjust.
 Identities = 104/151 (69%), Positives = 128/151 (85%), Gaps = 1/151 (1%)
 Frame = +3

Query  81   MAEQ-NGDAHDLRSILCSSDRDFLIRNSGHQVKVDDLKGKKIGIYFSASWCGPCHRFTPN  257
            MAE  NGD HD  S+L SSDRD+LIRN+G QV++D LKGKK+G+YFSASWCGPC RFTP 
Sbjct  1    MAEMVNGDYHDFVSLLSSSDRDYLIRNNGDQVEIDSLKGKKLGLYFSASWCGPCQRFTPT  60

Query  258  LATVYNELLPKGNFEVVFVSADEDEESFKEYFGKMPWTAVPFSDSVTRERLDALFTVRGI  437
            L  VYNEL PKG+FE+VF++ADED+ESF+EYF KMPW A+PFSDS  R+RLD +F V+GI
Sbjct  61   LVEVYNELAPKGDFEIVFITADEDDESFEEYFSKMPWLAIPFSDSDKRDRLDEIFKVQGI  120

Query  438  PHLVILDESGKVTTEDGVDIVLEHGVEAYPF  530
            PH VILDE+GKV++E GV+I+ E+GV+ YPF
Sbjct  121  PHFVILDENGKVSSESGVEIIQEYGVQCYPF  151


 Score =   130 bits (328),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 65/153 (42%), Positives = 92/153 (60%), Gaps = 2/153 (1%)
 Frame = +3

Query  75   SSMAEQNGDAHDLRSILCSSDRDFLIRNSGHQVKVDDLKGKKIGIYFSASWCGPCHRFTP  254
            + M +    A  L S+L S D++F+I   G ++ V DL GK I +YFSA WC PC  F P
Sbjct  320  AEMEKAREAAQTLESVLVSGDQNFVIGRDGAKIPVTDLVGKNILLYFSAHWCPPCRAFLP  379

Query  255  NLATVYNELLPKGN-FEVVFVSADEDEESFKEYFGKMPWTAVPFSDSVTRERLDALFTVR  431
             L   Y+E+  K + FEV+F+S+D D+ SF E+F  MPW A+PF D V +  L   F V+
Sbjct  380  KLVEAYHEIKTKDDAFEVIFISSDRDQASFDEFFSGMPWLALPFGD-VRKASLSRKFKVQ  438

Query  432  GIPHLVILDESGKVTTEDGVDIVLEHGVEAYPF  530
            GIP L+ L  +G+  T++   +V  HG +AY F
Sbjct  439  GIPMLIALGPTGRTITKEARSLVTLHGADAYLF  471


 Score =   120 bits (301),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 66/160 (41%), Positives = 94/160 (59%), Gaps = 9/160 (6%)
 Frame = +3

Query  54   KGEERKASSMAEQNGDAHDLRSILCSSDRDFLIRNSGHQVKVDDLKGKKIGIYFSASWCG  233
            KG+E +A            LRSIL    RD++I + G +V V +L+GK +G+YFS S   
Sbjct  160  KGQEEEARR-------NQSLRSILVFGSRDYVIASDGKKVSVSELEGKTVGLYFSLSSYT  212

Query  234  PCHRFTPNLATVYNELLPKG-NFEVVFVSADEDEESFKEYFGKMPWTAVPFSDSVTRERL  410
             C  FT  LA VY +L  KG NFE+VF+S D++EE+F++    MPW A PF+D    E+L
Sbjct  213  SCVDFTSTLAEVYEKLKAKGENFEIVFISLDDEEETFQQSLANMPWLAFPFNDKGC-EKL  271

Query  411  DALFTVRGIPHLVILDESGKVTTEDGVDIVLEHGVEAYPF  530
               F +  +P LV++   GK    +  + + EHGV+AYPF
Sbjct  272  VRYFELSTVPTLVVIGPDGKTLHSNVAEAIEEHGVQAYPF  311



>gb|KJB31217.1| hypothetical protein B456_005G181700 [Gossypium raimondii]
Length=490

 Score =   227 bits (579),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 103/146 (71%), Positives = 122/146 (84%), Gaps = 0/146 (0%)
 Frame = +3

Query  93   NGDAHDLRSILCSSDRDFLIRNSGHQVKVDDLKGKKIGIYFSASWCGPCHRFTPNLATVY  272
            N D HD +S+L SSDRDFL+RN+G QVK+D LKGKK+G+YFSASWCGPC RFTPNL  VY
Sbjct  13   NRDCHDFKSLLSSSDRDFLVRNNGDQVKIDSLKGKKLGLYFSASWCGPCRRFTPNLIEVY  72

Query  273  NELLPKGNFEVVFVSADEDEESFKEYFGKMPWTAVPFSDSVTRERLDALFTVRGIPHLVI  452
             EL  KG+FEV+FVSADEDEESF  YF KMPW A+PFSDS  R+RLD  F+V+GIPHLV+
Sbjct  73   TELSTKGDFEVIFVSADEDEESFNGYFSKMPWLAIPFSDSEARKRLDEPFSVKGIPHLVL  132

Query  453  LDESGKVTTEDGVDIVLEHGVEAYPF  530
            LDE+GKV TE+GV+I+ E+G E YPF
Sbjct  133  LDENGKVLTEEGVEIIREYGEEGYPF  158


 Score =   119 bits (298),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 63/151 (42%), Positives = 90/151 (60%), Gaps = 4/151 (3%)
 Frame = +3

Query  36   FQFSKRKGEERKASSMAEQNGDAHDLRSILCSSDRDFLIRNSGHQVKVDDLKGKKIGIYF  215
            + F+  K  E K    A +      L S+L S   DF++   G +VKV DL GK I +YF
Sbjct  315  YPFTPEKFAELKEIEKASEA--TQTLESVLVSGGLDFVLGKDGAKVKVADLVGKTILLYF  372

Query  216  SASWCGPCHRFTPNLATVYNELLPKGN-FEVVFVSADEDEESFKEYFGKMPWTAVPFSDS  392
            SA WC PC  FTP+L  VY ++  K + FEV+F+S+D D+ SF +Y+  MPW A+PF+D+
Sbjct  373  SAHWCPPCRAFTPSLVEVYKKIKEKDDAFEVIFISSDRDQSSFDDYYSGMPWLALPFNDA  432

Query  393  VTRERLDALFTVRGIPHLVILDESGKVTTED  485
              +  L   F V+GIP L+ L  +GK  T++
Sbjct  433  -RKSSLSRKFKVQGIPMLIALGPTGKTITKE  462


 Score =   117 bits (292),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 67/166 (40%), Positives = 98/166 (59%), Gaps = 5/166 (3%)
 Frame = +3

Query  36   FQFSKRKGEERKASSMAEQNGDAHDLRSILCSSDRDFLIRNSGHQVKVDDLKGKKIGIYF  215
            + F+  K +E K   + E+      +++IL S  RDF++ + G +V V +L+GK +GIYF
Sbjct  156  YPFTPEKIQELK--DLEEKAKKEQSIKTILVSRSRDFVVTSDGSKVPVSELEGKTVGIYF  213

Query  216  SASWCGPCHRFTPNLATVYNELLPKG-NFEVVFVSADEDEESFKEYFGKMPWTAVPFSDS  392
            SAS   P   FT  LA VY++L   G  FEVV +S D+D+ESFK+ FG  PW A+P  D 
Sbjct  214  SASSFKPSADFTQKLAEVYSKLKENGEKFEVVMISLDDDDESFKQSFG-APWLALPSKDK  272

Query  393  VTRERLDALFTVRGIPHLVILDESGKVTTEDGVDIVLEHGVEAYPF  530
             + E+L   F +  +P +VI+   GK    +  D + EHG+ AYPF
Sbjct  273  -SCEKLARYFELSTLPTVVIIGPDGKTLHPNAADAIDEHGIVAYPF  317



>gb|AGV54528.1| nucleoredoxin 1-like protein [Phaseolus vulgaris]
Length=571

 Score =   228 bits (581),  Expect = 5e-68, Method: Compositional matrix adjust.
 Identities = 105/150 (70%), Positives = 123/150 (82%), Gaps = 0/150 (0%)
 Frame = +3

Query  81   MAEQNGDAHDLRSILCSSDRDFLIRNSGHQVKVDDLKGKKIGIYFSASWCGPCHRFTPNL  260
            MA    + HD+ S+L S  RDFL+RN+G QVK++ LKGKK+G+YFSASWCGPC +FTP L
Sbjct  1    MAASEDNTHDVVSLLSSPQRDFLLRNNGDQVKIESLKGKKLGVYFSASWCGPCRKFTPTL  60

Query  261  ATVYNELLPKGNFEVVFVSADEDEESFKEYFGKMPWTAVPFSDSVTRERLDALFTVRGIP  440
               YNE++ KG+FEVVF SADEDEESFK YF KMPW A+PFSDS TR RLD LF VRGIP
Sbjct  61   VEAYNEVVSKGDFEVVFASADEDEESFKGYFSKMPWLAIPFSDSETRSRLDELFHVRGIP  120

Query  441  HLVILDESGKVTTEDGVDIVLEHGVEAYPF  530
            HLVIL+E+GKV TEDGVDIV E+GV+AYPF
Sbjct  121  HLVILEETGKVVTEDGVDIVREYGVDAYPF  150


 Score =   145 bits (365),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 71/144 (49%), Positives = 93/144 (65%), Gaps = 2/144 (1%)
 Frame = +3

Query  102  AHDLRSILCSSDRDFLIRNSGHQVKVDDLKGKKIGIYFSASWCGPCHRFTPNLATVYNEL  281
            A  L S+L S DR F+I   G Q+ V +LKGK + +YFSA WC PC  F P L   Y E+
Sbjct  328  AQTLESVLVSEDRGFVIGKDGVQIPVSELKGKVVLLYFSAHWCPPCRAFLPKLVDAYQEI  387

Query  282  LPKGN-FEVVFVSADEDEESFKEYFGKMPWTAVPFSDSVTRERLDALFTVRGIPHLVILD  458
              KGN  EVVF+S+D+D+ SF E+FG MPW A+PF DS  ++ L   F V GIP LV + 
Sbjct  388  KAKGNALEVVFISSDKDQASFDEFFGGMPWLALPFGDS-RKKFLSRKFKVTGIPKLVAIG  446

Query  459  ESGKVTTEDGVDIVLEHGVEAYPF  530
             SG+ +T +  D+VL++G  AYPF
Sbjct  447  SSGQTSTTEARDLVLQYGARAYPF  470


 Score = 55.1 bits (131),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 34/91 (37%), Positives = 49/91 (54%), Gaps = 4/91 (4%)
 Frame = +3

Query  45   SKRKGEERKASSMAEQNGDAHDLRSILCSSDRDFLIRNSGHQVKVDDLKGKKIGIYFSAS  224
            S R  E R     A +N     +RS+L S  RDF+I + G+ + V +L+GK +G+ FS +
Sbjct  152  SARIQELRAQEEEARRN---QSVRSLLISPSRDFVISSDGNNILVSELEGKTVGLEFSRN  208

Query  225  WCGPCHRFTPNLATVYNELLPKG-NFEVVFV  314
                   FTP    VY +L  +G NFEVV +
Sbjct  209  SFHRNSEFTPRPGEVYEKLKAQGENFEVVLI  239



>ref|XP_007153741.1| hypothetical protein PHAVU_003G061100g [Phaseolus vulgaris]
 gb|ESW25735.1| hypothetical protein PHAVU_003G061100g [Phaseolus vulgaris]
Length=571

 Score =   228 bits (580),  Expect = 7e-68, Method: Compositional matrix adjust.
 Identities = 105/150 (70%), Positives = 123/150 (82%), Gaps = 0/150 (0%)
 Frame = +3

Query  81   MAEQNGDAHDLRSILCSSDRDFLIRNSGHQVKVDDLKGKKIGIYFSASWCGPCHRFTPNL  260
            MA    + HD+ S+L S  RDFL+RN+G QVK++ LKGKK+G+YFSASWCGPC +FTP L
Sbjct  1    MAASADNTHDVVSLLSSPQRDFLLRNNGDQVKIESLKGKKLGVYFSASWCGPCRKFTPTL  60

Query  261  ATVYNELLPKGNFEVVFVSADEDEESFKEYFGKMPWTAVPFSDSVTRERLDALFTVRGIP  440
               YNE++ KG+FEVVF SADEDEESFK YF +MPW A+PFSDS TR RLD LF VRGIP
Sbjct  61   VEAYNEVVSKGDFEVVFASADEDEESFKGYFSEMPWLAIPFSDSETRSRLDELFHVRGIP  120

Query  441  HLVILDESGKVTTEDGVDIVLEHGVEAYPF  530
            HLVIL+E+GKV TEDGVDIV E+GVEAYPF
Sbjct  121  HLVILEETGKVVTEDGVDIVREYGVEAYPF  150


 Score =   145 bits (365),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 71/144 (49%), Positives = 93/144 (65%), Gaps = 2/144 (1%)
 Frame = +3

Query  102  AHDLRSILCSSDRDFLIRNSGHQVKVDDLKGKKIGIYFSASWCGPCHRFTPNLATVYNEL  281
            A  L S+L S DR F+I   G Q+ V +LKGK + +YFSA WC PC  F P L   Y E+
Sbjct  328  AQTLESVLVSEDRGFVIGKDGVQIPVSELKGKVVLLYFSAHWCPPCRAFLPKLVDAYQEI  387

Query  282  LPKGN-FEVVFVSADEDEESFKEYFGKMPWTAVPFSDSVTRERLDALFTVRGIPHLVILD  458
              KGN  EVVF+S+D+D+ SF E+FG MPW A+PF DS  ++ L   F V GIP LV + 
Sbjct  388  KEKGNALEVVFISSDKDQASFDEFFGGMPWLALPFGDS-RKKFLSRKFKVTGIPKLVAIG  446

Query  459  ESGKVTTEDGVDIVLEHGVEAYPF  530
             SG+ +T +  D+VL++G  AYPF
Sbjct  447  SSGQTSTTEARDLVLQYGARAYPF  470


 Score =   119 bits (297),  Expect = 8e-28, Method: Compositional matrix adjust.
 Identities = 66/163 (40%), Positives = 94/163 (58%), Gaps = 5/163 (3%)
 Frame = +3

Query  45   SKRKGEERKASSMAEQNGDAHDLRSILCSSDRDFLIRNSGHQVKVDDLKGKKIGIYFSAS  224
            S R  E R     A +N     +RS+L S  RDF+I + G+++ V +L+GK +G+YFS +
Sbjct  152  SARIQELRAQEEEARRN---QSVRSLLISPSRDFVISSDGNKILVSELEGKTVGLYFSLN  208

Query  225  WCGPCHRFTPNLATVYNELLPKG-NFEVVFVSADEDEESFKEYFGKMPWTAVPFSDSVTR  401
                   FTP L  VY +L  KG NFEVV +  DEDEESFK+  G +PW ++PF D    
Sbjct  209  SFQRSSEFTPKLVDVYEKLKAKGENFEVVLIPLDEDEESFKKVLGSVPWLSLPFKDKFCG  268

Query  402  ERLDALFTVRGIPHLVILDESGKVTTEDGVDIVLEHGVEAYPF  530
             +L   F +  +P LVI+   GK    +  + + +HGV+AYPF
Sbjct  269  -KLAQYFELSTLPTLVIIGPDGKTLNPNVAEAIEDHGVDAYPF  310



>gb|KJB31218.1| hypothetical protein B456_005G181700 [Gossypium raimondii]
Length=570

 Score =   227 bits (579),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 103/146 (71%), Positives = 122/146 (84%), Gaps = 0/146 (0%)
 Frame = +3

Query  93   NGDAHDLRSILCSSDRDFLIRNSGHQVKVDDLKGKKIGIYFSASWCGPCHRFTPNLATVY  272
            N D HD +S+L SSDRDFL+RN+G QVK+D LKGKK+G+YFSASWCGPC RFTPNL  VY
Sbjct  13   NRDCHDFKSLLSSSDRDFLVRNNGDQVKIDSLKGKKLGLYFSASWCGPCRRFTPNLIEVY  72

Query  273  NELLPKGNFEVVFVSADEDEESFKEYFGKMPWTAVPFSDSVTRERLDALFTVRGIPHLVI  452
             EL  KG+FEV+FVSADEDEESF  YF KMPW A+PFSDS  R+RLD  F+V+GIPHLV+
Sbjct  73   TELSTKGDFEVIFVSADEDEESFNGYFSKMPWLAIPFSDSEARKRLDEPFSVKGIPHLVL  132

Query  453  LDESGKVTTEDGVDIVLEHGVEAYPF  530
            LDE+GKV TE+GV+I+ E+G E YPF
Sbjct  133  LDENGKVLTEEGVEIIREYGEEGYPF  158


 Score =   135 bits (341),  Expect = 5e-34, Method: Compositional matrix adjust.
 Identities = 70/166 (42%), Positives = 100/166 (60%), Gaps = 4/166 (2%)
 Frame = +3

Query  36   FQFSKRKGEERKASSMAEQNGDAHDLRSILCSSDRDFLIRNSGHQVKVDDLKGKKIGIYF  215
            + F+  K  E K    A +      L S+L S   DF++   G +VKV DL GK I +YF
Sbjct  315  YPFTPEKFAELKEIEKASEA--TQTLESVLVSGGLDFVLGKDGAKVKVADLVGKTILLYF  372

Query  216  SASWCGPCHRFTPNLATVYNELLPKGN-FEVVFVSADEDEESFKEYFGKMPWTAVPFSDS  392
            SA WC PC  FTP+L  VY ++  K + FEV+F+S+D D+ SF +Y+  MPW A+PF+D+
Sbjct  373  SAHWCPPCRAFTPSLVEVYKKIKEKDDAFEVIFISSDRDQSSFDDYYSGMPWLALPFNDA  432

Query  393  VTRERLDALFTVRGIPHLVILDESGKVTTEDGVDIVLEHGVEAYPF  530
              +  L   F V+GIP L+ L  +GK  T++   +V+ HG +AYPF
Sbjct  433  -RKSSLSRKFKVQGIPMLIALGPTGKTITKEARSLVMAHGADAYPF  477


 Score =   116 bits (291),  Expect = 5e-27, Method: Compositional matrix adjust.
 Identities = 67/166 (40%), Positives = 98/166 (59%), Gaps = 5/166 (3%)
 Frame = +3

Query  36   FQFSKRKGEERKASSMAEQNGDAHDLRSILCSSDRDFLIRNSGHQVKVDDLKGKKIGIYF  215
            + F+  K +E K   + E+      +++IL S  RDF++ + G +V V +L+GK +GIYF
Sbjct  156  YPFTPEKIQELK--DLEEKAKKEQSIKTILVSRSRDFVVTSDGSKVPVSELEGKTVGIYF  213

Query  216  SASWCGPCHRFTPNLATVYNELLPKG-NFEVVFVSADEDEESFKEYFGKMPWTAVPFSDS  392
            SAS   P   FT  LA VY++L   G  FEVV +S D+D+ESFK+ FG  PW A+P  D 
Sbjct  214  SASSFKPSADFTQKLAEVYSKLKENGEKFEVVMISLDDDDESFKQSFG-APWLALPSKDK  272

Query  393  VTRERLDALFTVRGIPHLVILDESGKVTTEDGVDIVLEHGVEAYPF  530
             + E+L   F +  +P +VI+   GK    +  D + EHG+ AYPF
Sbjct  273  -SCEKLARYFELSTLPTVVIIGPDGKTLHPNAADAIDEHGIVAYPF  317



>ref|XP_006365240.1| PREDICTED: probable nucleoredoxin 1-like [Solanum tuberosum]
Length=607

 Score =   228 bits (580),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 108/157 (69%), Positives = 127/157 (81%), Gaps = 2/157 (1%)
 Frame = +3

Query  60   EERKASSMAEQNGDAHDLRSILCSSDRDFLIRNSGHQVKVDDLKGKKIGIYFSASWCGPC  239
            ++R   SMA +N   HD+  +L SSDRDFLIRN+G +VK+D LK KKIG+YFSASWCGPC
Sbjct  24   KKRLNRSMAGEN--CHDVIKLLGSSDRDFLIRNNGDKVKLDTLKEKKIGLYFSASWCGPC  81

Query  240  HRFTPNLATVYNELLPKGNFEVVFVSADEDEESFKEYFGKMPWTAVPFSDSVTRERLDAL  419
              FTPNL   YN LLP G+FEVVF++AD+D+ESFKEYF KMPW AVPFSDS TR+RL+ L
Sbjct  82   KHFTPNLVEAYNGLLPNGDFEVVFLTADKDDESFKEYFSKMPWLAVPFSDSETRKRLNEL  141

Query  420  FTVRGIPHLVILDESGKVTTEDGVDIVLEHGVEAYPF  530
            F VRGIPHLVILD SGKV T  GV+I++EHGVE YPF
Sbjct  142  FAVRGIPHLVILDASGKVVTNSGVEIIVEHGVEGYPF  178


 Score =   139 bits (351),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 67/145 (46%), Positives = 88/145 (61%), Gaps = 2/145 (1%)
 Frame = +3

Query  99   DAHDLRSILCSSDRDFLIRNSGHQVKVDDLKGKKIGIYFSASWCGPCHRFTPNLATVYNE  278
            +A  L SIL + D DF+I   G ++ V DL GK I +YFSA WC PC  FTP L   Y  
Sbjct  357  EAQTLESILVTGDHDFVIGKDGEKILVSDLVGKNILLYFSAHWCPPCRAFTPQLKEAYET  416

Query  279  LLPK-GNFEVVFVSADEDEESFKEYFGKMPWTAVPFSDSVTRERLDALFTVRGIPHLVIL  455
            +  K G  EV+F+S+D D+ SF +YF  MPW A+PF D   +  L  LF VRGIP LV +
Sbjct  417  IKAKNGPLEVIFISSDRDQASFDDYFASMPWLALPFGDE-RKTYLSRLFKVRGIPTLVAV  475

Query  456  DESGKVTTEDGVDIVLEHGVEAYPF  530
              SGK  T    ++++ HG +A+PF
Sbjct  476  GPSGKTVTTGARNLIMSHGAKAFPF  500


 Score =   109 bits (272),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 66/162 (41%), Positives = 94/162 (58%), Gaps = 7/162 (4%)
 Frame = +3

Query  63   ERKASSMAEQNGDA---HDLRSILCSSDRDFLIRNSGHQVKVDDLKGKKIGIYFSASWCG  233
            + + S + EQ   A     L+SIL S  R+++I   G +V V DL+GK IG+YFS +   
Sbjct  180  QERLSELKEQEETAKREQSLKSILESQSRNYVIAADGRKVPVADLEGKIIGLYFSMTSFK  239

Query  234  PCHRFTPNLATVYNELLPK-GNFEVVFVSA-DEDE-ESFKEYFGKMPWTAVPFSDSVTRE  404
             C  FT  L  +Y++L  + GNFE+V +   DEDE ESFK+ F +MPW ++P  D  T E
Sbjct  240  GCESFTRKLIEMYDKLKAQEGNFEIVMIPLDDEDEDESFKKEFSRMPWFSLPLKDK-TCE  298

Query  405  RLDALFTVRGIPHLVILDESGKVTTEDGVDIVLEHGVEAYPF  530
            +L   F +  +P LVI+   GK    +  + V EHG+ AYPF
Sbjct  299  KLARYFELSTLPTLVIIGTDGKTLHSNVAEAVEEHGILAYPF  340



>gb|KCW59853.1| hypothetical protein EUGRSUZ_H025921, partial [Eucalyptus grandis]
Length=192

 Score =   215 bits (547),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 100/152 (66%), Positives = 119/152 (78%), Gaps = 0/152 (0%)
 Frame = +3

Query  75   SSMAEQNGDAHDLRSILCSSDRDFLIRNSGHQVKVDDLKGKKIGIYFSASWCGPCHRFTP  254
            + + E    +HD++S+L S DRDFLIRN+G QVKVD LKGKKIG+YFSASWCGPCHRFTP
Sbjct  2    ADVVEGGASSHDVQSLLSSPDRDFLIRNNGDQVKVDSLKGKKIGLYFSASWCGPCHRFTP  61

Query  255  NLATVYNELLPKGNFEVVFVSADEDEESFKEYFGKMPWTAVPFSDSVTRERLDALFTVRG  434
             LA VY+EL PKG+ E++F+SAD+DE SF  YF KMPW A+PFSD   R  LD LF VRG
Sbjct  62   ILAEVYDELSPKGDLEIIFISADKDEGSFSGYFSKMPWLAIPFSDLDKRNSLDELFKVRG  121

Query  435  IPHLVILDESGKVTTEDGVDIVLEHGVEAYPF  530
            IPHLVILD +G V T+ GV IV E+GVE +PF
Sbjct  122  IPHLVILDGTGTVLTDSGVAIVREYGVEGHPF  153



>ref|XP_007044667.1| DC1 domain-containing protein [Theobroma cacao]
 gb|EOY00499.1| DC1 domain-containing protein [Theobroma cacao]
Length=577

 Score =   225 bits (573),  Expect = 9e-67, Method: Compositional matrix adjust.
 Identities = 100/146 (68%), Positives = 120/146 (82%), Gaps = 0/146 (0%)
 Frame = +3

Query  93   NGDAHDLRSILCSSDRDFLIRNSGHQVKVDDLKGKKIGIYFSASWCGPCHRFTPNLATVY  272
            NGD HD +S+L SS+RDFL+RN+G +VK+D L G K+G+YFSASWCGPC RFTPNL  VY
Sbjct  13   NGDCHDFQSLLSSSNRDFLVRNNGDRVKIDSLNGTKLGLYFSASWCGPCRRFTPNLMEVY  72

Query  273  NELLPKGNFEVVFVSADEDEESFKEYFGKMPWTAVPFSDSVTRERLDALFTVRGIPHLVI  452
            +EL PKG+FE++FVS D+DEESF  YF KMPW A+PFSDS TR RLD LF V GIPHLV+
Sbjct  73   SELSPKGDFEIIFVSGDQDEESFNGYFSKMPWLAIPFSDSETRSRLDELFKVMGIPHLVL  132

Query  453  LDESGKVTTEDGVDIVLEHGVEAYPF  530
            L E+GKV T+DGV I+ E+GVE YPF
Sbjct  133  LGENGKVLTDDGVGIIQEYGVEGYPF  158


 Score =   140 bits (353),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 68/144 (47%), Positives = 93/144 (65%), Gaps = 2/144 (1%)
 Frame = +3

Query  102  AHDLRSILCSSDRDFLIRNSGHQVKVDDLKGKKIGIYFSASWCGPCHRFTPNLATVYNEL  281
            A  L SIL S D DF+I   G +V+V +L GK + +YFSA WC PC  FTP L   Y ++
Sbjct  336  AQTLESILISGDLDFVIGKDGAKVQVTELVGKTVLLYFSAHWCPPCRGFTPKLVEAYKKI  395

Query  282  LPKGN-FEVVFVSADEDEESFKEYFGKMPWTAVPFSDSVTRERLDALFTVRGIPHLVILD  458
              K   FEVVFVS+D D+ SF+EY+ +MPW A+PF D+  +  L   F VRGIP LV + 
Sbjct  396  KAKNEAFEVVFVSSDRDQASFEEYYSEMPWLALPFGDA-RKPLLSRKFKVRGIPMLVAIG  454

Query  459  ESGKVTTEDGVDIVLEHGVEAYPF  530
             +GK  T++  ++++ HG +AYPF
Sbjct  455  PTGKTVTKETRNLIMAHGADAYPF  478


 Score = 97.1 bits (240),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 58/166 (35%), Positives = 94/166 (57%), Gaps = 4/166 (2%)
 Frame = +3

Query  36   FQFSKRKGEERKASSMAEQNGDAHDLRSILCSSDRDFLIRNSGHQVKVDDLKGKKIGIYF  215
            + F+  K +E +   + E+      +++IL S  RDF++ + G++V V +L+GK +G+YF
Sbjct  156  YPFNPEKIQELR--DLEEKARTEQSIKTILVSRSRDFVVTSDGNKVPVSELEGKTVGLYF  213

Query  216  SASWCGPCHRFTPNLATVYNELLPKG-NFEVVFVSADEDEESFKEYFGKMPWTAVPFSDS  392
            S S       FTP LA VY +L  KG NFE+V +S D++EE   +     PW A+PF D 
Sbjct  214  SVSSYKASADFTPKLAEVYKKLKEKGENFEIVVISLDDEEEESFKESFVAPWLALPFKDK  273

Query  393  VTRERLDALFTVRGIPHLVILDESGKVTTEDGVDIVLEHGVEAYPF  530
              + +L   F +  +P +VI+   GK    +  + +  HG++AYPF
Sbjct  274  SCK-KLARYFELSTLPTVVIIGPDGKTLHSNVAEAIEGHGIQAYPF  318



>ref|XP_007225633.1| hypothetical protein PRUPE_ppa003374mg [Prunus persica]
 gb|EMJ26832.1| hypothetical protein PRUPE_ppa003374mg [Prunus persica]
Length=580

 Score =   225 bits (573),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 101/146 (69%), Positives = 122/146 (84%), Gaps = 0/146 (0%)
 Frame = +3

Query  93   NGDAHDLRSILCSSDRDFLIRNSGHQVKVDDLKGKKIGIYFSASWCGPCHRFTPNLATVY  272
            N + HD RS+L SS+RDFL+ N+G Q+KV+ LKGKK+G+YFSASWCGPC RFTP+L  VY
Sbjct  13   NSEPHDFRSLLSSSERDFLVGNNGDQIKVESLKGKKLGLYFSASWCGPCRRFTPSLVEVY  72

Query  273  NELLPKGNFEVVFVSADEDEESFKEYFGKMPWTAVPFSDSVTRERLDALFTVRGIPHLVI  452
            NEL PKG+FEVVF+SADED+ESF  YF KMPW A+PFSDS  R+R+D LF VRGIPHLVI
Sbjct  73   NELSPKGDFEVVFISADEDDESFNGYFSKMPWLAIPFSDSEARDRVDKLFKVRGIPHLVI  132

Query  453  LDESGKVTTEDGVDIVLEHGVEAYPF  530
            LDE GKV ++ GV+I+ EHGV+ YPF
Sbjct  133  LDEDGKVLSDSGVEIIQEHGVDGYPF  158


 Score =   135 bits (340),  Expect = 6e-34, Method: Compositional matrix adjust.
 Identities = 69/166 (42%), Positives = 101/166 (61%), Gaps = 4/166 (2%)
 Frame = +3

Query  36   FQFSKRKGEERKASSMAEQNGDAHDLRSILCSSDRDFLIRNSGHQVKVDDLKGKKIGIYF  215
            + F+  K EE      A++   A  L SIL S DR+F+I   G ++ V DL GK I +YF
Sbjct  316  YPFTPEKFEELIEIEKAKEK--AQTLESILISGDRNFVIGKGGTEIPVSDLVGKNILLYF  373

Query  216  SASWCGPCHRFTPNLATVYNELLPKGN-FEVVFVSADEDEESFKEYFGKMPWTAVPFSDS  392
            SA WC PC  F P L   Y+++  K + FEV+F+S+D D+++F E+F  MPW A+PF DS
Sbjct  374  SAHWCPPCRAFLPKLLEAYHKIKAKDDAFEVIFISSDRDQDAFDEFFSGMPWLALPFGDS  433

Query  393  VTRERLDALFTVRGIPHLVILDESGKVTTEDGVDIVLEHGVEAYPF  530
              +  L   F V+GIP L+ +  +G+  T++   +V++HG  AYPF
Sbjct  434  -RKACLSRRFKVQGIPMLIAIGPTGQTVTKEARHLVMQHGANAYPF  478


 Score =   117 bits (293),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 63/143 (44%), Positives = 86/143 (60%), Gaps = 2/143 (1%)
 Frame = +3

Query  105  HDLRSILCSSDRDFLIRNSGHQVKVDDLKGKKIGIYFSASWCGPCHRFTPNLATVYNELL  284
              L++IL S  RDF+I N G  V V +L+GK +G+YFS S   PC  FTP L  VY +L 
Sbjct  177  QSLKTILVSRLRDFVISNDGKNVPVSELEGKIVGLYFSLSAYSPCVDFTPKLLEVYEKLK  236

Query  285  PKG-NFEVVFVSADEDEESFKEYFGKMPWTAVPFSDSVTRERLDALFTVRGIPHLVILDE  461
              G +FEVV +  D+DEESFK+ F  MPW ++P  D     +L   F +  +P LVI+  
Sbjct  237  ANGESFEVVVIPLDDDEESFKQDFKNMPWFSLPIGDKNVG-KLARYFELSTLPTLVIIGA  295

Query  462  SGKVTTEDGVDIVLEHGVEAYPF  530
             GK  +++  + + EHGV AYPF
Sbjct  296  DGKTVSKNVAEAIEEHGVLAYPF  318



>ref|XP_004238662.1| PREDICTED: probable nucleoredoxin 1 [Solanum lycopersicum]
Length=601

 Score =   225 bits (574),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 107/150 (71%), Positives = 123/150 (82%), Gaps = 2/150 (1%)
 Frame = +3

Query  81   MAEQNGDAHDLRSILCSSDRDFLIRNSGHQVKVDDLKGKKIGIYFSASWCGPCHRFTPNL  260
            MA +N   HD+ ++L SSDRDFLIRN+G +VK+D LK KKIG YFSASWCGPC  FTPNL
Sbjct  1    MAGEN--CHDVINLLGSSDRDFLIRNNGDKVKLDTLKEKKIGFYFSASWCGPCKHFTPNL  58

Query  261  ATVYNELLPKGNFEVVFVSADEDEESFKEYFGKMPWTAVPFSDSVTRERLDALFTVRGIP  440
               YN LLPKG+FEVVF++AD D+ESFKEYF KMPW AVPFSDS TR+RL+ LF VRGIP
Sbjct  59   VEAYNALLPKGDFEVVFLTADMDDESFKEYFSKMPWLAVPFSDSETRKRLNELFAVRGIP  118

Query  441  HLVILDESGKVTTEDGVDIVLEHGVEAYPF  530
            HLVILD SGKV T  GV+I++EHGVE YPF
Sbjct  119  HLVILDASGKVVTNSGVEIIVEHGVEGYPF  148


 Score =   143 bits (360),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 70/145 (48%), Positives = 90/145 (62%), Gaps = 2/145 (1%)
 Frame = +3

Query  99   DAHDLRSILCSSDRDFLIRNSGHQVKVDDLKGKKIGIYFSASWCGPCHRFTPNLATVYNE  278
            +A  L SIL + DRDF+I   G ++ V DL GK I +YFSA WC PC  FTP L   Y  
Sbjct  327  EAQTLESILVTRDRDFVIGKDGEKILVSDLVGKTILLYFSAHWCPPCRAFTPQLKEAYET  386

Query  279  LLPK-GNFEVVFVSADEDEESFKEYFGKMPWTAVPFSDSVTRERLDALFTVRGIPHLVIL  455
            +  K G  EV+F+S+D+D+ SF EYF  MPW A+PF D   +  L  LF VRGIP LV +
Sbjct  387  IKSKNGPLEVIFLSSDQDQASFDEYFATMPWLALPFGDE-RKTYLSRLFKVRGIPTLVAV  445

Query  456  DESGKVTTEDGVDIVLEHGVEAYPF  530
              SGK  T D   +++ HG +A+PF
Sbjct  446  GPSGKTVTTDARSLIMCHGAKAFPF  470


 Score =   103 bits (258),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 59/162 (36%), Positives = 92/162 (57%), Gaps = 7/162 (4%)
 Frame = +3

Query  63   ERKASSMAEQNGDA---HDLRSILCSSDRDFLIRNSGHQVKVDDLKGKKIGIYFSASWCG  233
            + + + + EQ   A     L+SIL S  R+++I   G +V V +L+GK IG+Y S +   
Sbjct  150  QERLNELKEQEETAKREQSLKSILESQSRNYVIAADGRKVPVAELEGKIIGLYMSMASFE  209

Query  234  PCHRFTPNLATVYNELLPKG-NFEVVFVSAD--EDEESFKEYFGKMPWTAVPFSDSVTRE  404
             C  FT  L  +Y++L  +G NFE+V +  D  +D+ESFK+ F +MPW ++P  D   + 
Sbjct  210  ECESFTGKLIEMYDKLKSQGENFEIVMIPLDDEDDDESFKKEFSRMPWFSLPLKDKTCK-  268

Query  405  RLDALFTVRGIPHLVILDESGKVTTEDGVDIVLEHGVEAYPF  530
            +L   F +  +P LVI+   GK    +  + V EHG+ AYPF
Sbjct  269  KLARYFELSTLPTLVIIGTDGKTLHSNVAEAVEEHGILAYPF  310



>ref|XP_010553606.1| PREDICTED: probable nucleoredoxin 1 [Tarenaya hassleriana]
Length=580

 Score =   224 bits (572),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 106/154 (69%), Positives = 126/154 (82%), Gaps = 1/154 (1%)
 Frame = +3

Query  72   ASSMAEQN-GDAHDLRSILCSSDRDFLIRNSGHQVKVDDLKGKKIGIYFSASWCGPCHRF  248
            A+S +E N GD+HDLR++L S  RDFL+RN G QVK+D LKGKK+G+YFSA+WCGPC  F
Sbjct  2    ANSPSEVNAGDSHDLRTLLSSPARDFLLRNDGEQVKLDSLKGKKLGLYFSAAWCGPCQHF  61

Query  249  TPNLATVYNELLPKGNFEVVFVSADEDEESFKEYFGKMPWTAVPFSDSVTRERLDALFTV  428
            TP L  VYNEL PKG+FE+VFVS DEDEESFKEYF KMPW A+PF+DS TR+RLD LF V
Sbjct  62   TPQLTEVYNELSPKGDFEIVFVSGDEDEESFKEYFSKMPWLAIPFTDSETRDRLDELFKV  121

Query  429  RGIPHLVILDESGKVTTEDGVDIVLEHGVEAYPF  530
            RGIP+LVILDE+ KV   +GV +V  +GVEAYPF
Sbjct  122  RGIPNLVILDENVKVVNTNGVGMVRGYGVEAYPF  155


 Score =   138 bits (347),  Expect = 9e-35, Method: Compositional matrix adjust.
 Identities = 70/166 (42%), Positives = 100/166 (60%), Gaps = 4/166 (2%)
 Frame = +3

Query  36   FQFSKRKGEERKASSMAEQNGDAHDLRSILCSSDRDFLIRNSGHQVKVDDLKGKKIGIYF  215
            + F+  K EE +A  +A    +A  L S+L   D D+++   G +V+V DL GK I +YF
Sbjct  313  YPFTPEKFEELEA--IARAKAEAQTLESLLVWDDLDYVLGKDGLKVRVSDLVGKHILLYF  370

Query  216  SASWCGPCHRFTPNLATVYNELLPKGN-FEVVFVSADEDEESFKEYFGKMPWTAVPFSDS  392
            SA WC PC  FTP L  VY ++  +   FE++F+S+D D+ SF EY+ +MPW A+PF D 
Sbjct  371  SAHWCPPCRGFTPKLVEVYKQIKARDEAFELIFISSDRDQASFDEYYSEMPWLALPFGDP  430

Query  393  VTRERLDALFTVRGIPHLVILDESGKVTTEDGVDIVLEHGVEAYPF  530
              ++ L   F V GIP LV L  +G+  T +  D+V  HG +AYPF
Sbjct  431  -RKQSLARTFKVSGIPMLVALGPTGRTITTEARDLVGAHGADAYPF  475


 Score =   123 bits (308),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 66/141 (47%), Positives = 90/141 (64%), Gaps = 2/141 (1%)
 Frame = +3

Query  111  LRSILCSSDRDFLIRNSGHQVKVDDLKGKKIGIYFSASWCGPCHRFTPNLATVYNELLPK  290
            L+S+L +  RDF+I   G+ V V +L+GK IG+YFS +   PC  FT  L  VYN+L   
Sbjct  176  LKSVLVTGSRDFVISRDGNTVPVSELEGKIIGLYFSVASYKPCTEFTGKLVEVYNKLKEM  235

Query  291  G-NFEVVFVSADEDEESFKEYFGKMPWTAVPFSDSVTRERLDALFTVRGIPHLVILDESG  467
            G NFEVV +S ++DEESFK+ F  MPW ++PF+D  +  +L   F + G+P LVIL   G
Sbjct  236  GENFEVVMISLEDDEESFKQDFETMPWLSLPFNDK-SSSKLARHFMLSGLPMLVILGPDG  294

Query  468  KVTTEDGVDIVLEHGVEAYPF  530
            K    + V+ V E+GV AYPF
Sbjct  295  KTRHPNVVEAVEEYGVVAYPF  315



>gb|KHG25736.1| hypothetical protein F383_04337 [Gossypium arboreum]
Length=570

 Score =   224 bits (572),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 102/146 (70%), Positives = 120/146 (82%), Gaps = 0/146 (0%)
 Frame = +3

Query  93   NGDAHDLRSILCSSDRDFLIRNSGHQVKVDDLKGKKIGIYFSASWCGPCHRFTPNLATVY  272
            NGD HD +S+L S DRDFL+RN+G QVK+D LKGKK+G+Y SASWCGPC RFTPNL  VY
Sbjct  13   NGDCHDFKSLLSSLDRDFLVRNNGDQVKIDSLKGKKLGLYISASWCGPCRRFTPNLIEVY  72

Query  273  NELLPKGNFEVVFVSADEDEESFKEYFGKMPWTAVPFSDSVTRERLDALFTVRGIPHLVI  452
             EL  KG+FEV+FVSADEDEESF  YF KMPW A+PFSDS  R+RLD  F+V GIPHLV+
Sbjct  73   TELSTKGDFEVIFVSADEDEESFNGYFSKMPWLAIPFSDSEARKRLDEPFSVMGIPHLVL  132

Query  453  LDESGKVTTEDGVDIVLEHGVEAYPF  530
            LDE+GKV TE+GV+I+ E+G E YPF
Sbjct  133  LDENGKVLTEEGVEIIREYGEEGYPF  158


 Score =   138 bits (347),  Expect = 7e-35, Method: Compositional matrix adjust.
 Identities = 72/166 (43%), Positives = 100/166 (60%), Gaps = 4/166 (2%)
 Frame = +3

Query  36   FQFSKRKGEERKASSMAEQNGDAHDLRSILCSSDRDFLIRNSGHQVKVDDLKGKKIGIYF  215
            + F+  K  E K    A +   A  L S+L S   DF++   G +VKV DL GK I +YF
Sbjct  315  YPFTPEKFAELKEIEKASEA--AQTLESVLVSGGLDFVLGKDGAKVKVADLVGKTILLYF  372

Query  216  SASWCGPCHRFTPNLATVYNELLPKGN-FEVVFVSADEDEESFKEYFGKMPWTAVPFSDS  392
            SA WC PC  FTP+L  VY ++  K + FEV+F+S+D D  SF EY+  MPW A+PF+D+
Sbjct  373  SAHWCPPCRAFTPSLVEVYKKIKEKDDAFEVIFISSDRDRASFDEYYSGMPWLALPFNDA  432

Query  393  VTRERLDALFTVRGIPHLVILDESGKVTTEDGVDIVLEHGVEAYPF  530
              +  L   F V+GIP L+ L  +GK  T++   +V+ HG +AYPF
Sbjct  433  -RKSSLSRKFKVQGIPMLIALGPTGKTITKEARSLVMAHGADAYPF  477


 Score =   118 bits (296),  Expect = 9e-28, Method: Compositional matrix adjust.
 Identities = 67/166 (40%), Positives = 98/166 (59%), Gaps = 5/166 (3%)
 Frame = +3

Query  36   FQFSKRKGEERKASSMAEQNGDAHDLRSILCSSDRDFLIRNSGHQVKVDDLKGKKIGIYF  215
            + F+  K +E K   + E+      +++IL S  RDF++ + G +V V +L+GK +GIYF
Sbjct  156  YPFTPEKIQELK--DLEEKAKKEQSIKTILVSRSRDFVVTSDGSKVPVSELEGKTVGIYF  213

Query  216  SASWCGPCHRFTPNLATVYNELLPKG-NFEVVFVSADEDEESFKEYFGKMPWTAVPFSDS  392
            SAS   P   FT  LA VY++L   G  FEVV +S D+DEESF++ FG  PW A+P  D 
Sbjct  214  SASSFKPSADFTQKLAEVYSKLKENGEKFEVVMISLDDDEESFRQSFG-APWLALPLKDK  272

Query  393  VTRERLDALFTVRGIPHLVILDESGKVTTEDGVDIVLEHGVEAYPF  530
             + E+L   F +  +P +VI+   GK    +  D + EHG+ AYPF
Sbjct  273  -SCEKLARYFELSTLPTVVIIGPDGKTLHPNAADAIDEHGIVAYPF  317



>ref|XP_010023550.1| PREDICTED: probable nucleoredoxin 1 isoform X3 [Eucalyptus grandis]
Length=525

 Score =   222 bits (566),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 102/152 (67%), Positives = 121/152 (80%), Gaps = 0/152 (0%)
 Frame = +3

Query  75   SSMAEQNGDAHDLRSILCSSDRDFLIRNSGHQVKVDDLKGKKIGIYFSASWCGPCHRFTP  254
            + + E    +HD++S+L S DRDFLIRN+G QVKVD LKGKKIG+YFSASWCGPC RFTP
Sbjct  2    ADVVEGGASSHDVQSLLSSPDRDFLIRNNGDQVKVDSLKGKKIGLYFSASWCGPCQRFTP  61

Query  255  NLATVYNELLPKGNFEVVFVSADEDEESFKEYFGKMPWTAVPFSDSVTRERLDALFTVRG  434
             LA VYNEL PKG+ E++F+SADEDEESF  YF KMPW A+PFSDS  R+ LD LF VRG
Sbjct  62   TLAEVYNELSPKGDLEIIFISADEDEESFSGYFSKMPWLAIPFSDSEKRDSLDELFEVRG  121

Query  435  IPHLVILDESGKVTTEDGVDIVLEHGVEAYPF  530
            IPHLV LD +G V T+ GV+IV E+GVE +PF
Sbjct  122  IPHLVFLDGTGTVLTDSGVEIVREYGVEGHPF  153


 Score =   134 bits (337),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 61/153 (40%), Positives = 96/153 (63%), Gaps = 2/153 (1%)
 Frame = +3

Query  75   SSMAEQNGDAHDLRSILCSSDRDFLIRNSGHQVKVDDLKGKKIGIYFSASWCGPCHRFTP  254
            + +  +  ++  L SIL S DRDF+I   G ++ V DL GK + +YFSA WC PC  F P
Sbjct  322  AEIQRKKEESQTLESILVSGDRDFVIGKEGTKIPVLDLVGKTVLLYFSAHWCPPCRDFLP  381

Query  255  NLATVYNELLPKGN-FEVVFVSADEDEESFKEYFGKMPWTAVPFSDSVTRERLDALFTVR  431
             L   Y ++  K N FE++F+S+D+D+ +F  Y+ +MPW A+PF D   ++ L+  F V 
Sbjct  382  VLTEAYEKIKAKNNAFELIFISSDKDQAAFDNYYAQMPWLALPFGDE-RKKSLNRKFKVD  440

Query  432  GIPHLVILDESGKVTTEDGVDIVLEHGVEAYPF  530
            GIP L+ +  +G+  T++  +++ EHG +AYPF
Sbjct  441  GIPTLIAIGPTGRTLTKEARNLISEHGADAYPF  473


 Score =   114 bits (284),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 65/163 (40%), Positives = 93/163 (57%), Gaps = 5/163 (3%)
 Frame = +3

Query  45   SKRKGEERKASSMAEQNGDAHDLRSILCSSDRDFLIRNSGHQVKVDDLKGKKIGIYFSAS  224
            ++R  E +     A++N     + SIL    RDF++ + G +V V +L+GK +G+YFS S
Sbjct  155  AERIKELKDQEEAAKRN---QSVTSILVDGSRDFVVSSDGKKVPVAELEGKTVGLYFSLS  211

Query  225  WCGPCHRFTPNLATVYNELLPKG-NFEVVFVSADEDEESFKEYFGKMPWTAVPFSDSVTR  401
                C  FTP L  V+ +L  KG  FE+V +  D+DEESF + FG MPW ++P  D    
Sbjct  212  IYKSCIDFTPILLDVHEKLKAKGERFEIVQIPLDDDEESFNQAFGSMPWLSLPLKDKKC-  270

Query  402  ERLDALFTVRGIPHLVILDESGKVTTEDGVDIVLEHGVEAYPF  530
            E+L   F +  +P LVI+   GK    +  + V EHGVEAYPF
Sbjct  271  EKLVRYFELSTLPTLVIIGPDGKTLHSNVAETVEEHGVEAYPF  313



>gb|KDO82404.1| hypothetical protein CISIN_1g008336mg [Citrus sinensis]
Length=350

 Score =   216 bits (551),  Expect = 8e-66, Method: Compositional matrix adjust.
 Identities = 101/150 (67%), Positives = 123/150 (82%), Gaps = 1/150 (1%)
 Frame = +3

Query  81   MAEQNGDAHDLRSILCSSDRDFLIRNSGHQVKVDDLKGKKIGIYFSASWCGPCHRFTPNL  260
            M     ++HD++S+L SS RDFLIR++G QVK+D LKGK IG+YFSASWCGPC RFTP L
Sbjct  1    MNMNGANSHDIQSLLSSSARDFLIRSNGDQVKLDSLKGK-IGLYFSASWCGPCQRFTPIL  59

Query  261  ATVYNELLPKGNFEVVFVSADEDEESFKEYFGKMPWTAVPFSDSVTRERLDALFTVRGIP  440
            A VYNEL  +G+FEV+FVS DED+E+FK YF KMPW AVPFSDS TR++LD LF V GIP
Sbjct  60   AEVYNELSRQGDFEVIFVSGDEDDEAFKGYFSKMPWLAVPFSDSETRDKLDELFKVMGIP  119

Query  441  HLVILDESGKVTTEDGVDIVLEHGVEAYPF  530
            HLVILDE+GKV ++ GV+I+ E+GVE YPF
Sbjct  120  HLVILDENGKVLSDGGVEIIREYGVEGYPF  149


 Score =   127 bits (320),  Expect = 8e-32, Method: Compositional matrix adjust.
 Identities = 69/158 (44%), Positives = 93/158 (59%), Gaps = 5/158 (3%)
 Frame = +3

Query  69   KASSMAEQNGDA---HDLRSILCSSDRDFLIRNSGHQVKVDDLKGKKIGIYFSASWCGPC  239
            +   M EQ   A     LRS+L S  RDF+I + G ++ V DL+GK IG+YFS S     
Sbjct  153  RIKEMKEQEERAKREQSLRSVLTSHSRDFVISSDGRKISVSDLEGKTIGLYFSMSSYKAS  212

Query  240  HRFTPNLATVYNELLPKG-NFEVVFVSADEDEESFKEYFGKMPWTAVPFSDSVTRERLDA  416
              FTP L  VY +L  KG +FE+V +S D++EESFK   G MPW A+PF D  +RE+L  
Sbjct  213  AEFTPRLVEVYEKLKGKGESFEIVLISLDDEEESFKRDLGSMPWLALPFKDK-SREKLAR  271

Query  417  LFTVRGIPHLVILDESGKVTTEDGVDIVLEHGVEAYPF  530
             F +  +P LVI+   GK    +  + + EHGV A+PF
Sbjct  272  YFELSTLPTLVIIGPDGKTLHSNVAEAIEEHGVGAFPF  309



>ref|XP_010651773.1| PREDICTED: probable nucleoredoxin 1 [Vitis vinifera]
Length=258

 Score =   213 bits (543),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 98/146 (67%), Positives = 117/146 (80%), Gaps = 0/146 (0%)
 Frame = +3

Query  93   NGDAHDLRSILCSSDRDFLIRNSGHQVKVDDLKGKKIGIYFSASWCGPCHRFTPNLATVY  272
            +G AHDL S+L   DRDFL+RN+GHQVKV+ LKGKKI +YFSASWCGPC RFTP L   Y
Sbjct  7    DGVAHDLVSLLTREDRDFLVRNNGHQVKVESLKGKKIWLYFSASWCGPCRRFTPKLVEAY  66

Query  273  NELLPKGNFEVVFVSADEDEESFKEYFGKMPWTAVPFSDSVTRERLDALFTVRGIPHLVI  452
            NEL    +FE++FVS D D+ESF  YF KMPW A+PFSDS  R++L+ LF V GIP+LV+
Sbjct  67   NELSSNDDFEIIFVSGDNDDESFHGYFSKMPWLAIPFSDSDARDQLNELFKVMGIPNLVM  126

Query  453  LDESGKVTTEDGVDIVLEHGVEAYPF  530
            LDESGKV +EDGVDI+ E+GVEAYPF
Sbjct  127  LDESGKVLSEDGVDIIQEYGVEAYPF  152


 Score = 69.3 bits (168),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 35/77 (45%), Positives = 49/77 (64%), Gaps = 1/77 (1%)
 Frame = +3

Query  105  HDLRSILCSSDRDFLIRNSGHQVKVDDLKGKKIGIYFSASWCGPCHRFTPNLATVYNELL  284
              LRSIL S  RD++I   G +V V +L+GK +G++FS S    C  FTP L  VY +L 
Sbjct  171  QSLRSILVSQSRDYVISTDGKKVPVSELEGKFVGLFFSLSSYKACLEFTPTLVDVYEKLR  230

Query  285  PKG-NFEVVFVSADEDE  332
             KG +FE+V +S D++E
Sbjct  231  AKGESFEIVMISLDDEE  247



>ref|XP_006483868.1| PREDICTED: probable nucleoredoxin 1-like [Citrus sinensis]
Length=570

 Score =   221 bits (562),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 102/150 (68%), Positives = 124/150 (83%), Gaps = 0/150 (0%)
 Frame = +3

Query  81   MAEQNGDAHDLRSILCSSDRDFLIRNSGHQVKVDDLKGKKIGIYFSASWCGPCHRFTPNL  260
            M     ++HD++S+L SS RDFLIR++G QVK+D LKGKKIG+YFSASWCGPC RFTP L
Sbjct  1    MNMNGANSHDIQSLLSSSARDFLIRSNGDQVKIDSLKGKKIGLYFSASWCGPCQRFTPIL  60

Query  261  ATVYNELLPKGNFEVVFVSADEDEESFKEYFGKMPWTAVPFSDSVTRERLDALFTVRGIP  440
            A VYNEL  +G+FEV+FVS DED+E+FK YF KMPW AVPFSDS TR++LD LF V GIP
Sbjct  61   AEVYNELSRQGDFEVIFVSGDEDDEAFKGYFSKMPWLAVPFSDSETRDKLDELFKVMGIP  120

Query  441  HLVILDESGKVTTEDGVDIVLEHGVEAYPF  530
            HLVILDE+GKV ++ GV+I+ E+GVE YPF
Sbjct  121  HLVILDENGKVLSDGGVEIIREYGVEGYPF  150


 Score =   129 bits (323),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 68/166 (41%), Positives = 96/166 (58%), Gaps = 4/166 (2%)
 Frame = +3

Query  36   FQFSKRKGEERKASSMAEQNGDAHDLRSILCSSDRDFLIRNSGHQVKVDDLKGKKIGIYF  215
            F F+  K  E      A++  ++  L  +L S D DF++  +G +V V DL GK I +YF
Sbjct  308  FPFTPEKFAELAEIQRAKE--ESQTLELVLVSGDLDFVVGKNGGKVPVSDLVGKTILLYF  365

Query  216  SASWCGPCHRFTPNLATVYNELLPKG-NFEVVFVSADEDEESFKEYFGKMPWTAVPFSDS  392
            SA WC PC  F P L   Y ++  +  + EVVF+S+D D+ SF E+F  MPW A+PF D+
Sbjct  366  SAHWCPPCRAFLPKLIEAYKKIKERNESLEVVFISSDRDQTSFDEFFKGMPWLALPFGDA  425

Query  393  VTRERLDALFTVRGIPHLVILDESGKVTTEDGVDIVLEHGVEAYPF  530
              +  L   F V GIP LV +  SG+  T++  D++  HG EAYPF
Sbjct  426  -RKASLSRKFKVSGIPMLVAIGPSGRTITKEARDMIAVHGAEAYPF  470


 Score =   125 bits (315),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 69/158 (44%), Positives = 93/158 (59%), Gaps = 5/158 (3%)
 Frame = +3

Query  69   KASSMAEQNGDA---HDLRSILCSSDRDFLIRNSGHQVKVDDLKGKKIGIYFSASWCGPC  239
            +   M EQ   A     LRS+L S  RDF+I + G ++ V DL+GK IG+YFS S     
Sbjct  154  RIKEMKEQEERAKREQSLRSVLTSHSRDFVISSDGRKISVSDLEGKTIGLYFSMSSYKAS  213

Query  240  HRFTPNLATVYNELLPKG-NFEVVFVSADEDEESFKEYFGKMPWTAVPFSDSVTRERLDA  416
              FTP L  VY +L  KG +FE+V +S D++EESFK   G MPW A+PF D  +RE+L  
Sbjct  214  AEFTPRLVEVYEKLKGKGESFEIVLISLDDEEESFKRDLGSMPWLALPFKDK-SREKLAR  272

Query  417  LFTVRGIPHLVILDESGKVTTEDGVDIVLEHGVEAYPF  530
             F +  +P LVI+   GK    +  + + EHGV A+PF
Sbjct  273  YFELSTLPTLVIIGPDGKTLHSNVAEAIEEHGVGAFPF  310



>ref|XP_006438373.1| hypothetical protein CICLE_v10031097mg [Citrus clementina]
 gb|ESR51613.1| hypothetical protein CICLE_v10031097mg [Citrus clementina]
Length=570

 Score =   220 bits (561),  Expect = 4e-65, Method: Compositional matrix adjust.
 Identities = 102/150 (68%), Positives = 124/150 (83%), Gaps = 0/150 (0%)
 Frame = +3

Query  81   MAEQNGDAHDLRSILCSSDRDFLIRNSGHQVKVDDLKGKKIGIYFSASWCGPCHRFTPNL  260
            M     ++HD++S+L SS RDFLIR++G QVK+D LKGKKIG+YFSASWCGPC RFTP L
Sbjct  1    MNMNGANSHDIQSLLSSSARDFLIRSNGDQVKIDSLKGKKIGLYFSASWCGPCQRFTPIL  60

Query  261  ATVYNELLPKGNFEVVFVSADEDEESFKEYFGKMPWTAVPFSDSVTRERLDALFTVRGIP  440
            A VYNEL  +G+FEV+FVS DED+E+FK YF KMPW AVPFSDS TR++LD LF V GIP
Sbjct  61   AEVYNELSCQGDFEVIFVSGDEDDEAFKGYFSKMPWLAVPFSDSETRDKLDELFKVMGIP  120

Query  441  HLVILDESGKVTTEDGVDIVLEHGVEAYPF  530
            HLVILDE+GKV ++ GV+I+ E+GVE YPF
Sbjct  121  HLVILDENGKVLSDGGVEIIREYGVEGYPF  150


 Score =   129 bits (323),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 68/166 (41%), Positives = 96/166 (58%), Gaps = 4/166 (2%)
 Frame = +3

Query  36   FQFSKRKGEERKASSMAEQNGDAHDLRSILCSSDRDFLIRNSGHQVKVDDLKGKKIGIYF  215
            F F+  K  E      A++  ++  L  +L S D DF++  +G +V V DL GK I +YF
Sbjct  308  FPFTPEKFAELAEIQRAKE--ESQTLELVLVSGDLDFVVGKNGGKVPVSDLVGKTILLYF  365

Query  216  SASWCGPCHRFTPNLATVYNELLPKG-NFEVVFVSADEDEESFKEYFGKMPWTAVPFSDS  392
            SA WC PC  F P L   Y ++  +  + EVVF+S+D D+ SF E+F  MPW A+PF D+
Sbjct  366  SAHWCPPCRAFLPKLIEAYKKIKERNESLEVVFISSDRDQTSFDEFFKGMPWLALPFGDA  425

Query  393  VTRERLDALFTVRGIPHLVILDESGKVTTEDGVDIVLEHGVEAYPF  530
              +  L   F V GIP LV +  SG+  T++  D++  HG EAYPF
Sbjct  426  -RKASLSRKFKVSGIPMLVAIGPSGRTITKEAKDMIAVHGAEAYPF  470


 Score =   125 bits (315),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 69/158 (44%), Positives = 93/158 (59%), Gaps = 5/158 (3%)
 Frame = +3

Query  69   KASSMAEQNGDA---HDLRSILCSSDRDFLIRNSGHQVKVDDLKGKKIGIYFSASWCGPC  239
            +   M EQ   A     LRS+L S  RDF+I + G ++ V DL+GK IG+YFS S     
Sbjct  154  RIKEMKEQEERAKREQSLRSVLTSHSRDFVISSDGRKISVSDLEGKTIGLYFSMSSYKAS  213

Query  240  HRFTPNLATVYNELLPKG-NFEVVFVSADEDEESFKEYFGKMPWTAVPFSDSVTRERLDA  416
              FTP L  VY +L  KG +FE+V +S D++EESFK   G MPW A+PF D  +RE+L  
Sbjct  214  AEFTPRLVEVYEKLKGKGESFEIVLISLDDEEESFKRDLGSMPWLALPFKDK-SREKLAR  272

Query  417  LFTVRGIPHLVILDESGKVTTEDGVDIVLEHGVEAYPF  530
             F +  +P LVI+   GK    +  + + EHGV A+PF
Sbjct  273  YFELSTLPTLVIIGPDGKTLHSNVAEAIEEHGVGAFPF  310



>ref|XP_004509957.1| PREDICTED: probable nucleoredoxin 1-like [Cicer arietinum]
Length=569

 Score =   220 bits (560),  Expect = 6e-65, Method: Compositional matrix adjust.
 Identities = 101/150 (67%), Positives = 118/150 (79%), Gaps = 0/150 (0%)
 Frame = +3

Query  81   MAEQNGDAHDLRSILCSSDRDFLIRNSGHQVKVDDLKGKKIGIYFSASWCGPCHRFTPNL  260
            MA+     HDL S+L S DRDFL+RN+G QVK+D LKGKK+G+YFSASWCGPC  FTP L
Sbjct  1    MADSVDVTHDLHSLLSSPDRDFLLRNNGDQVKIDSLKGKKLGLYFSASWCGPCRGFTPTL  60

Query  261  ATVYNELLPKGNFEVVFVSADEDEESFKEYFGKMPWTAVPFSDSVTRERLDALFTVRGIP  440
               YNEL P G FEVVF++ADED+E+FK YF KMPW A+PFSDS TR RLD LF V GIP
Sbjct  61   VEAYNELSPNGEFEVVFITADEDDEAFKSYFSKMPWLAIPFSDSDTRNRLDELFHVNGIP  120

Query  441  HLVILDESGKVTTEDGVDIVLEHGVEAYPF  530
            HL +LDE+GKV  EDGVDI+ E+G EA+PF
Sbjct  121  HLALLDETGKVVAEDGVDIIREYGPEAFPF  150


 Score =   126 bits (317),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 61/140 (44%), Positives = 86/140 (61%), Gaps = 3/140 (2%)
 Frame = +3

Query  117  SILCSSDRDFLIRNSGHQVKVDDLKGKKIGIYFSASWCGPCHRFTPNLATVYNELLPKGN  296
            S+L S DRDF+I   G ++ V  L+GK + +YFSA WC PC  F P L   Y+++  + N
Sbjct  333  SVLVSGDRDFVIEKDGEKIPVSKLEGKTVLLYFSAHWCPPCRAFLPKLIDAYHKIKAQDN  392

Query  297  --FEVVFVSADEDEESFKEYFGKMPWTAVPFSDSVTRERLDALFTVRGIPHLVILDESGK  470
               EV+F+S   D+ SF E+F  MPW A+PF DS  +E L   F V GIP LV +  +G+
Sbjct  393  DALEVIFISRYRDQASFDEFFAXMPWLALPFGDS-RKEFLSRKFKVSGIPKLVAIGSNGR  451

Query  471  VTTEDGVDIVLEHGVEAYPF  530
              T++  D+V  +G +AYPF
Sbjct  452  TVTKEARDLVALYGADAYPF  471


 Score = 96.3 bits (238),  Expect = 9e-20, Method: Compositional matrix adjust.
 Identities = 59/166 (36%), Positives = 92/166 (55%), Gaps = 4/166 (2%)
 Frame = +3

Query  36   FQFSKRKGEERKASSMAEQNGDAHDLRSILCSSDRDFLIRNSGHQVKVDDLKGKKIGIYF  215
            F F+  + +E K     E+      LRSIL S  RDF+I + G  + + +L+GK +G+YF
Sbjct  148  FPFTSERIQELK--DQEEEAKRNQSLRSILGSRSRDFVISSDGKNIPISELEGKTVGLYF  205

Query  216  SASWCGPCHRFTPNLATVYNELLPKG-NFEVVFVSADEDEESFKEYFGKMPWTAVPFSDS  392
             A+    C  FT  L  VY +L  +G NFEVV +  D++EES ++    + W ++P  D 
Sbjct  206  CANSYRSCTTFTSQLKDVYKKLKAEGENFEVVVIPLDDEEESLEKELESVHWLSLPIKDK  265

Query  393  VTRERLDALFTVRGIPHLVILDESGKVTTEDGVDIVLEHGVEAYPF  530
             T  +L   F +  +P LVI+  +GK    +  +I+ +HG+ AYPF
Sbjct  266  -TCAKLVQYFELSALPTLVIIGPNGKTLHPNAAEIIEDHGITAYPF  310



>ref|XP_007222066.1| hypothetical protein PRUPE_ppa003234mg [Prunus persica]
 gb|EMJ23265.1| hypothetical protein PRUPE_ppa003234mg [Prunus persica]
Length=590

 Score =   220 bits (561),  Expect = 7e-65, Method: Compositional matrix adjust.
 Identities = 98/146 (67%), Positives = 119/146 (82%), Gaps = 0/146 (0%)
 Frame = +3

Query  93   NGDAHDLRSILCSSDRDFLIRNSGHQVKVDDLKGKKIGIYFSASWCGPCHRFTPNLATVY  272
            N + HD  S+L SS+RDFL+RN+G Q+KV+ LKGKK+G+YFSASWCGPC RFTP+L   Y
Sbjct  13   NSEPHDFCSLLSSSERDFLVRNNGDQIKVESLKGKKLGLYFSASWCGPCQRFTPSLVEAY  72

Query  273  NELLPKGNFEVVFVSADEDEESFKEYFGKMPWTAVPFSDSVTRERLDALFTVRGIPHLVI  452
            NEL PKG+FEVVF+SADED+ESF  YF KMPW A+PFSD   R+R+D LF VRGIPHLVI
Sbjct  73   NELSPKGDFEVVFISADEDDESFNGYFSKMPWLAIPFSDKEARDRVDKLFKVRGIPHLVI  132

Query  453  LDESGKVTTEDGVDIVLEHGVEAYPF  530
            L E GKV ++ GV+I+ EHGV+ YPF
Sbjct  133  LGEDGKVLSDSGVEIIKEHGVDGYPF  158


 Score =   136 bits (342),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 64/144 (44%), Positives = 91/144 (63%), Gaps = 2/144 (1%)
 Frame = +3

Query  102  AHDLRSILCSSDRDFLIRNSGHQVKVDDLKGKKIGIYFSASWCGPCHRFTPNLATVYNEL  281
            A  L SIL S DR+F+I   G ++ V DL GK I +YFSA WC PC  F P L   Y+++
Sbjct  336  AQTLESILVSGDRNFVIGKGGTEIPVSDLVGKNILLYFSAHWCPPCRAFLPKLVEAYHKI  395

Query  282  LPKGN-FEVVFVSADEDEESFKEYFGKMPWTAVPFSDSVTRERLDALFTVRGIPHLVILD  458
              K + FEV+F+S+D D+  F E+F  MPW A+PF D + +  L   F V+GIP LV + 
Sbjct  396  KAKDDAFEVIFISSDRDQGDFDEFFSGMPWLALPFGD-LRKASLSRKFKVKGIPMLVAIG  454

Query  459  ESGKVTTEDGVDIVLEHGVEAYPF  530
             +G+  T++  ++V++HG  AYPF
Sbjct  455  PTGQTVTKEARNLVMQHGANAYPF  478


 Score =   118 bits (295),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 63/143 (44%), Positives = 86/143 (60%), Gaps = 2/143 (1%)
 Frame = +3

Query  105  HDLRSILCSSDRDFLIRNSGHQVKVDDLKGKKIGIYFSASWCGPCHRFTPNLATVYNELL  284
              L++IL S  RDF+I N G  V V +L+GK +G+YFS S   PC  FTP L  VY +L 
Sbjct  177  QSLKTILVSRLRDFVISNDGKNVPVSELEGKIVGLYFSLSVYSPCVDFTPKLLEVYEKLK  236

Query  285  PKG-NFEVVFVSADEDEESFKEYFGKMPWTAVPFSDSVTRERLDALFTVRGIPHLVILDE  461
              G +FEVV +  D+DEESFK+ F  MPW ++P  D     +L   F +  +P LVI+  
Sbjct  237  ANGESFEVVVIPLDDDEESFKQDFKNMPWFSLPIGDK-NIGKLARYFELSTLPTLVIIGA  295

Query  462  SGKVTTEDGVDIVLEHGVEAYPF  530
             GK  +++  + + EHGV AYPF
Sbjct  296  DGKTVSKNVAEAIEEHGVLAYPF  318



>gb|KFK40790.1| hypothetical protein AALP_AA2G041400 [Arabis alpina]
Length=572

 Score =   219 bits (559),  Expect = 9e-65, Method: Compositional matrix adjust.
 Identities = 103/150 (69%), Positives = 118/150 (79%), Gaps = 1/150 (1%)
 Frame = +3

Query  81   MAEQNGDAHDLRSILCSSDRDFLIRNSGHQVKVDDLKGKKIGIYFSASWCGPCHRFTPNL  260
            MAE  GDA DL S+L S  RDFL+RN G QVK+D LKGKKIG+YFSASWCGPC RFTP L
Sbjct  1    MAE-GGDARDLHSLLSSPSRDFLLRNDGQQVKIDSLKGKKIGLYFSASWCGPCQRFTPQL  59

Query  261  ATVYNELLPKGNFEVVFVSADEDEESFKEYFGKMPWTAVPFSDSVTRERLDALFTVRGIP  440
              VYNEL PK  FEVVFVS DEDEESF +YF KMPW AVPF+DS TR+RLD +F VRGIP
Sbjct  60   VQVYNELAPKAGFEVVFVSGDEDEESFTDYFSKMPWLAVPFTDSETRDRLDEVFKVRGIP  119

Query  441  HLVILDESGKVTTEDGVDIVLEHGVEAYPF  530
            +LVI+D+ GK+  E+GV  +  +G EAYPF
Sbjct  120  NLVIIDDQGKLENENGVGNIRSYGAEAYPF  149


 Score =   137 bits (344),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 69/166 (42%), Positives = 100/166 (60%), Gaps = 4/166 (2%)
 Frame = +3

Query  36   FQFSKRKGEERKASSMAEQNGDAHDLRSILCSSDRDFLIRNSGHQVKVDDLKGKKIGIYF  215
            + F+  K EE KA   A+   +A  L S+L S D ++++   G +V V +L GK I +YF
Sbjct  307  YPFTPEKFEELKAIEKAK--AEAQTLESLLVSGDLNYVLGKDGAKVLVSELVGKNILMYF  364

Query  216  SASWCGPCHRFTPNLATVYNELLPKGN-FEVVFVSADEDEESFKEYFGKMPWTAVPFSDS  392
            SA WC PC  FTP L  VY ++  +   FE++F+S+D D E+F EY+ +MPW A+P+ D 
Sbjct  365  SAHWCPPCRAFTPKLVEVYKQIKERDEAFELIFISSDRDPEAFSEYYSQMPWLALPYGDP  424

Query  393  VTRERLDALFTVRGIPHLVILDESGKVTTEDGVDIVLEHGVEAYPF  530
              +  L   F V GIP L  L  +G+  T++  D+VL HG +AYPF
Sbjct  425  -RKSTLSQTFKVGGIPMLAALGPTGRTVTKEARDLVLAHGADAYPF  469


 Score =   114 bits (284),  Expect = 5e-26, Method: Compositional matrix adjust.
 Identities = 60/141 (43%), Positives = 85/141 (60%), Gaps = 2/141 (1%)
 Frame = +3

Query  111  LRSILCSSDRDFLIRNSGHQVKVDDLKGKKIGIYFSASWCGPCHRFTPNLATVYNELLPK  290
            L S+L S  RDF+I   G++V V +L+GK IG+ FS      C  F+P L  VYN+L   
Sbjct  170  LTSVLVSPSRDFVISRDGNKVPVSELEGKTIGLLFSVGTYKKCTEFSPKLVEVYNKLKEN  229

Query  291  -GNFEVVFVSADEDEESFKEYFGKMPWTAVPFSDSVTRERLDALFTVRGIPHLVILDESG  467
             G+FE+V +S ++DEESFK+ F   PW A+PF+D  +  +L   F +  +P LVIL   G
Sbjct  230  GGDFEIVLISLEDDEESFKQDFETKPWLALPFNDK-SSSKLARHFMLSTLPTLVILGPDG  288

Query  468  KVTTEDGVDIVLEHGVEAYPF  530
            K    +  + + EHG+ AYPF
Sbjct  289  KTRHSNVAEAIEEHGIVAYPF  309



>gb|KEH20025.1| protein disulfide isomerase (PDI)-like protein [Medicago truncatula]
Length=570

 Score =   219 bits (558),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 104/151 (69%), Positives = 120/151 (79%), Gaps = 1/151 (1%)
 Frame = +3

Query  81   MAEQNGD-AHDLRSILCSSDRDFLIRNSGHQVKVDDLKGKKIGIYFSASWCGPCHRFTPN  257
            MA+   D  H++ SIL SSDRDFL+RN+G QVK+D LKGKK+G YFSASWCGPC  FTP 
Sbjct  1    MADSVADVTHNVHSILSSSDRDFLLRNTGDQVKIDSLKGKKLGFYFSASWCGPCRGFTPK  60

Query  258  LATVYNELLPKGNFEVVFVSADEDEESFKEYFGKMPWTAVPFSDSVTRERLDALFTVRGI  437
            L  VY+EL P G FEVVFVSAD+D+E+FK YF KMPW A+PFSDS TR RLD LF V GI
Sbjct  61   LVEVYDELSPNGEFEVVFVSADKDDEAFKSYFSKMPWLAIPFSDSETRGRLDELFHVNGI  120

Query  438  PHLVILDESGKVTTEDGVDIVLEHGVEAYPF  530
            PHL +LDE+GKV TEDGVDI+  +G EAYPF
Sbjct  121  PHLALLDEAGKVITEDGVDIIRVYGAEAYPF  151


 Score =   130 bits (326),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 64/152 (42%), Positives = 93/152 (61%), Gaps = 3/152 (2%)
 Frame = +3

Query  81   MAEQNGDAHDLRSILCSSDRDFLIRNSGHQVKVDDLKGKKIGIYFSASWCGPCHRFTPNL  260
            +A+    +  L S+L S D+DF+I   G ++ V +L GK + +YFSA WC PC  F P L
Sbjct  322  IAKAKEASQTLESVLVSGDQDFVIDKDGKKIPVSELVGKTVLLYFSAHWCPPCRAFLPKL  381

Query  261  ATVYNELLPKGN--FEVVFVSADEDEESFKEYFGKMPWTAVPFSDSVTRERLDALFTVRG  434
               Y+++  + N   EVVF+S+D D+ESF E+F  MPW A+PF D+  +E L   F V G
Sbjct  382  IEAYHKIKAQNNDALEVVFISSDRDQESFNEFFAGMPWLALPFGDT-RKEFLSRKFKVSG  440

Query  435  IPHLVILDESGKVTTEDGVDIVLEHGVEAYPF  530
            IP LV +  SG+  T++   +V  +G +AYPF
Sbjct  441  IPKLVAIGPSGQTVTKEARGLVGLYGADAYPF  472


 Score =   112 bits (279),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 62/163 (38%), Positives = 94/163 (58%), Gaps = 5/163 (3%)
 Frame = +3

Query  45   SKRKGEERKASSMAEQNGDAHDLRSILCSSDRDFLIRNSGHQVKVDDLKGKKIGIYFSAS  224
            SKR  E +     A++N     LRSIL S  RDFLI + G+++ + +L+GK +G++F A+
Sbjct  153  SKRVQELKDIEEEAKRN---QSLRSILASRSRDFLISSDGNEIPISELEGKTVGLHFCAT  209

Query  225  WCGPCHRFTPNLATVYNELLPKG-NFEVVFVSADEDEESFKEYFGKMPWTAVPFSDSVTR  401
                C  FT  L  VY +L   G NFEVVF+  D++E++FK+     PW ++P  D  T 
Sbjct  210  SYRACTLFTQKLKEVYKKLKENGENFEVVFIPLDDEEDAFKKELESAPWLSLPLKDK-TC  268

Query  402  ERLDALFTVRGIPHLVILDESGKVTTEDGVDIVLEHGVEAYPF  530
             +L   F +  +P LVI+   GK    +  + + +HGV+AYPF
Sbjct  269  AKLIQYFELSELPTLVIIGPDGKTLHPNAAEAIEDHGVDAYPF  311



>ref|XP_010023549.1| PREDICTED: probable nucleoredoxin 1 isoform X2 [Eucalyptus grandis]
 gb|KCW59849.1| hypothetical protein EUGRSUZ_H02589 [Eucalyptus grandis]
Length=526

 Score =   218 bits (555),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 99/143 (69%), Positives = 118/143 (83%), Gaps = 0/143 (0%)
 Frame = +3

Query  102  AHDLRSILCSSDRDFLIRNSGHQVKVDDLKGKKIGIYFSASWCGPCHRFTPNLATVYNEL  281
            +HD++S+L S DRDFL+RN+G +VKVD LKGKKIG+YFSASWCGPC RFTP LA VYNEL
Sbjct  12   SHDVQSLLSSPDRDFLVRNNGDRVKVDSLKGKKIGLYFSASWCGPCQRFTPTLAEVYNEL  71

Query  282  LPKGNFEVVFVSADEDEESFKEYFGKMPWTAVPFSDSVTRERLDALFTVRGIPHLVILDE  461
             PKG+ E++F+SADEDEESF  YF KMPW A+PFSDS  R+ LD LF VRGIPHLV LD 
Sbjct  72   SPKGDLEIIFISADEDEESFSGYFSKMPWLAIPFSDSEKRDSLDELFEVRGIPHLVFLDG  131

Query  462  SGKVTTEDGVDIVLEHGVEAYPF  530
            +G V T+ GV+IV E+GVE +PF
Sbjct  132  TGTVLTDSGVEIVREYGVEGHPF  154


 Score =   134 bits (336),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 61/153 (40%), Positives = 96/153 (63%), Gaps = 2/153 (1%)
 Frame = +3

Query  75   SSMAEQNGDAHDLRSILCSSDRDFLIRNSGHQVKVDDLKGKKIGIYFSASWCGPCHRFTP  254
            + +  +  ++  L SIL S DRDF+I   G ++ V DL GK + +YFSA WC PC  F P
Sbjct  323  AEIQRKKEESQTLESILVSGDRDFVIGKEGTKIPVLDLVGKTVLLYFSAHWCPPCRDFLP  382

Query  255  NLATVYNELLPKGN-FEVVFVSADEDEESFKEYFGKMPWTAVPFSDSVTRERLDALFTVR  431
             L   Y ++  K N FE++F+S+D+D+ +F  Y+ +MPW A+PF D   ++ L+  F V 
Sbjct  383  VLTEAYEKIKAKNNAFELIFISSDKDQAAFDNYYAQMPWLALPFGDE-RKKSLNRKFKVD  441

Query  432  GIPHLVILDESGKVTTEDGVDIVLEHGVEAYPF  530
            GIP L+ +  +G+  T++  +++ EHG +AYPF
Sbjct  442  GIPTLIAIGPTGRTLTKEARNLISEHGADAYPF  474


 Score =   114 bits (284),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 65/163 (40%), Positives = 93/163 (57%), Gaps = 5/163 (3%)
 Frame = +3

Query  45   SKRKGEERKASSMAEQNGDAHDLRSILCSSDRDFLIRNSGHQVKVDDLKGKKIGIYFSAS  224
            ++R  E +     A++N     + SIL    RDF++ + G +V V +L+GK +G+YFS S
Sbjct  156  AERIKELKDQEEAAKRN---QSVTSILVDGSRDFVVSSDGKKVPVAELEGKTVGLYFSLS  212

Query  225  WCGPCHRFTPNLATVYNELLPKG-NFEVVFVSADEDEESFKEYFGKMPWTAVPFSDSVTR  401
                C  FTP L  V+ +L  KG  FE+V +  D+DEESF + FG MPW ++P  D    
Sbjct  213  IYKSCIDFTPILLDVHEKLKAKGERFEIVQIPLDDDEESFNQAFGSMPWLSLPLKDKKC-  271

Query  402  ERLDALFTVRGIPHLVILDESGKVTTEDGVDIVLEHGVEAYPF  530
            E+L   F +  +P LVI+   GK    +  + V EHGVEAYPF
Sbjct  272  EKLVRYFELSTLPTLVIIGPDGKTLHSNVAETVEEHGVEAYPF  314



>ref|XP_003532006.1| PREDICTED: probable nucleoredoxin 1-like isoform X1 [Glycine 
max]
Length=570

 Score =   218 bits (555),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 98/150 (65%), Positives = 119/150 (79%), Gaps = 0/150 (0%)
 Frame = +3

Query  81   MAEQNGDAHDLRSILCSSDRDFLIRNSGHQVKVDDLKGKKIGIYFSASWCGPCHRFTPNL  260
            MA+     HD+ S+L S  RDFL+RN+G QVK+D LKGKK+G+YFSASWCGPC  FTP L
Sbjct  1    MADSADVTHDVVSLLSSPQRDFLLRNNGDQVKIDSLKGKKLGLYFSASWCGPCQTFTPTL  60

Query  261  ATVYNELLPKGNFEVVFVSADEDEESFKEYFGKMPWTAVPFSDSVTRERLDALFTVRGIP  440
              VYNE+  KG+F++VF++ADED+ESF  YF KMPW A+PFSDS TR RLD LF VRGIP
Sbjct  61   VDVYNEVAKKGDFQIVFITADEDDESFNGYFSKMPWLAIPFSDSDTRSRLDELFHVRGIP  120

Query  441  HLVILDESGKVTTEDGVDIVLEHGVEAYPF  530
            HL +LDE+G V TEDGVD++ E+GVE YPF
Sbjct  121  HLALLDEAGNVVTEDGVDVIREYGVEGYPF  150


 Score =   135 bits (341),  Expect = 5e-34, Method: Compositional matrix adjust.
 Identities = 69/144 (48%), Positives = 90/144 (63%), Gaps = 2/144 (1%)
 Frame = +3

Query  102  AHDLRSILCSSDRDFLIRNSGHQVKVDDLKGKKIGIYFSASWCGPCHRFTPNLATVYNEL  281
            A  L SIL S D+DF+I   G ++ V +LKGK + +YFSA WC PC  F P L   YN++
Sbjct  328  AQTLESILVSDDQDFVIGKDGVKIPVSELKGKVVLLYFSAHWCPPCRAFLPKLIDAYNKI  387

Query  282  LPKGN-FEVVFVSADEDEESFKEYFGKMPWTAVPFSDSVTRERLDALFTVRGIPHLVILD  458
              KGN  EVVF+S+D D+ SF E+F  MPW A+PF DS  ++ L   F V GIP LV + 
Sbjct  388  KEKGNALEVVFISSDRDQTSFDEFFAGMPWLALPFGDS-RKKFLSRKFRVSGIPMLVAIA  446

Query  459  ESGKVTTEDGVDIVLEHGVEAYPF  530
             SG+  T    D+V  +G +AYPF
Sbjct  447  SSGQTLTTKARDLVSLYGADAYPF  470


 Score =   118 bits (295),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 65/163 (40%), Positives = 91/163 (56%), Gaps = 5/163 (3%)
 Frame = +3

Query  45   SKRKGEERKASSMAEQNGDAHDLRSILCSSDRDFLIRNSGHQVKVDDLKGKKIGIYFSAS  224
            S R  E R     A +N     +RS+L S  RDF+I + G +  V +L+GK +G+YF   
Sbjct  152  SARIQELRDQEEEARRN---QSVRSLLVSPSRDFVISSDGKKTLVSELEGKTVGLYFCVK  208

Query  225  WCGPCHRFTPNLATVYNELLPKG-NFEVVFVSADEDEESFKEYFGKMPWTAVPFSDSVTR  401
              G C  FTP L  VY +L  +G NFEVV +  D+DEESFKE    +PW ++PF D +  
Sbjct  209  SFGSCSDFTPKLVEVYEKLKAQGENFEVVLIPLDDDEESFKELLESVPWLSLPFKDKICG  268

Query  402  ERLDALFTVRGIPHLVILDESGKVTTEDGVDIVLEHGVEAYPF  530
             +L   F +  +P LVI+   GK    +  + + +HGV AYPF
Sbjct  269  -KLARYFELSTLPTLVIIGPDGKTLHSNVAEAIEDHGVAAYPF  310



>gb|KHN26883.1| Putative nucleoredoxin 1 [Glycine soja]
Length=570

 Score =   218 bits (555),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 98/150 (65%), Positives = 119/150 (79%), Gaps = 0/150 (0%)
 Frame = +3

Query  81   MAEQNGDAHDLRSILCSSDRDFLIRNSGHQVKVDDLKGKKIGIYFSASWCGPCHRFTPNL  260
            MA+     HD+ S+L S  RDFL+RN+G QVK+D LKGKK+G+YFSASWCGPC  FTP L
Sbjct  1    MADSADVTHDVVSLLSSPQRDFLLRNNGDQVKIDSLKGKKLGLYFSASWCGPCQTFTPTL  60

Query  261  ATVYNELLPKGNFEVVFVSADEDEESFKEYFGKMPWTAVPFSDSVTRERLDALFTVRGIP  440
              VYNE+  KG+F++VF++ADED+ESF  YF KMPW A+PFSDS TR RLD LF VRGIP
Sbjct  61   VDVYNEVAKKGDFQIVFITADEDDESFNGYFSKMPWLAIPFSDSDTRSRLDELFHVRGIP  120

Query  441  HLVILDESGKVTTEDGVDIVLEHGVEAYPF  530
            HL +LDE+G V TEDGVD++ E+GVE YPF
Sbjct  121  HLALLDEAGNVVTEDGVDVIREYGVEGYPF  150


 Score =   135 bits (341),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 69/144 (48%), Positives = 90/144 (63%), Gaps = 2/144 (1%)
 Frame = +3

Query  102  AHDLRSILCSSDRDFLIRNSGHQVKVDDLKGKKIGIYFSASWCGPCHRFTPNLATVYNEL  281
            A  L SIL S D+DF+I   G ++ V +LKGK + +YFSA WC PC  F P L   YN++
Sbjct  328  AQTLESILVSDDQDFVIGKDGVKIPVSELKGKVVLLYFSAHWCPPCRAFLPKLIDAYNKI  387

Query  282  LPKGN-FEVVFVSADEDEESFKEYFGKMPWTAVPFSDSVTRERLDALFTVRGIPHLVILD  458
              KGN  EVVF+S+D D+ SF E+F  MPW A+PF DS  ++ L   F V GIP LV + 
Sbjct  388  KEKGNALEVVFISSDRDQTSFDEFFAGMPWLALPFGDS-RKKFLSRKFKVSGIPMLVAIA  446

Query  459  ESGKVTTEDGVDIVLEHGVEAYPF  530
             SG+  T    D+V  +G +AYPF
Sbjct  447  SSGQTLTTKARDLVSLYGADAYPF  470


 Score =   118 bits (295),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 65/163 (40%), Positives = 91/163 (56%), Gaps = 5/163 (3%)
 Frame = +3

Query  45   SKRKGEERKASSMAEQNGDAHDLRSILCSSDRDFLIRNSGHQVKVDDLKGKKIGIYFSAS  224
            S R  E R     A +N     +RS+L S  RDF+I + G +  V +L+GK +G+YF   
Sbjct  152  SARIQELRDQEEEARRN---QSVRSLLVSPSRDFVISSDGKKTLVSELEGKTVGLYFCVK  208

Query  225  WCGPCHRFTPNLATVYNELLPKG-NFEVVFVSADEDEESFKEYFGKMPWTAVPFSDSVTR  401
              G C  FTP L  VY +L  +G NFEVV +  D+DEESFKE    +PW ++PF D +  
Sbjct  209  SFGSCSDFTPKLVEVYEKLKAQGENFEVVLIPLDDDEESFKELLESVPWLSLPFKDKICG  268

Query  402  ERLDALFTVRGIPHLVILDESGKVTTEDGVDIVLEHGVEAYPF  530
             +L   F +  +P LVI+   GK    +  + + +HGV AYPF
Sbjct  269  -KLARYFELSTLPTLVIIGPDGKTLHSNVAEAIEDHGVAAYPF  310



>ref|XP_011071086.1| PREDICTED: probable nucleoredoxin 1 [Sesamum indicum]
Length=585

 Score =   218 bits (555),  Expect = 4e-64, Method: Compositional matrix adjust.
 Identities = 100/142 (70%), Positives = 116/142 (82%), Gaps = 0/142 (0%)
 Frame = +3

Query  105  HDLRSILCSSDRDFLIRNSGHQVKVDDLKGKKIGIYFSASWCGPCHRFTPNLATVYNELL  284
            +DL SILC  +RDFL+RN+G QV+VD L+GK +G+YFSASWCGPC RFTPNL  VYNELL
Sbjct  18   YDLASILCVPNRDFLVRNNGDQVRVDSLRGKIVGLYFSASWCGPCQRFTPNLVEVYNELL  77

Query  285  PKGNFEVVFVSADEDEESFKEYFGKMPWTAVPFSDSVTRERLDALFTVRGIPHLVILDES  464
               NFE+VFVS+DED+ESF  YF KMPW A+PFSDS TR +LD LF V GIPHL ILDE+
Sbjct  78   QVNNFEIVFVSSDEDDESFNAYFSKMPWLAIPFSDSETRGQLDELFAVSGIPHLEILDEN  137

Query  465  GKVTTEDGVDIVLEHGVEAYPF  530
            GKV T DGV+I+ EHGVE YPF
Sbjct  138  GKVLTSDGVEIIQEHGVEGYPF  159


 Score =   136 bits (343),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 67/145 (46%), Positives = 91/145 (63%), Gaps = 2/145 (1%)
 Frame = +3

Query  99   DAHDLRSILCSSDRDFLIRNSGHQVKVDDLKGKKIGIYFSASWCGPCHRFTPNLATVYNE  278
            +A  L SIL + D DF+I   G ++ V DL GK I +YFSA WC PC  F P L   Y E
Sbjct  336  EAQTLESILVAKDCDFVIGKDGIKIPVSDLVGKNILLYFSAHWCPPCRAFLPALIKAYEE  395

Query  279  LLPKGN-FEVVFVSADEDEESFKEYFGKMPWTAVPFSDSVTRERLDALFTVRGIPHLVIL  455
            +   GN  EVVF+S+D DE SF E+F KMPW A+PF D   +E L  LF VRGIP ++ +
Sbjct  396  INKNGNVLEVVFISSDRDETSFDEFFSKMPWLALPFGDE-RKEFLGRLFKVRGIPMVIAI  454

Query  456  DESGKVTTEDGVDIVLEHGVEAYPF  530
              +G+  + +  ++++ HG EA+PF
Sbjct  455  GPNGRTVSTEVRELIMYHGAEAFPF  479


 Score =   100 bits (250),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 57/155 (37%), Positives = 88/155 (57%), Gaps = 7/155 (5%)
 Frame = +3

Query  81   MAEQNGDA---HDLRSILCSSDRDFLIRNSGHQVKVDDLKGKKIGIY-FSASWCGPCHRF  248
            + EQ  +A     L+++L +  RD++I   G +V V +L+GK +G+Y F A++ G C  F
Sbjct  167  LVEQEEEAKRNQSLKTLLVTKSRDYVITADGKKVPVSELEGKTVGLYIFLATYNG-CLAF  225

Query  249  TPNLATVYNELLPKG-NFEVVFVSADEDEESFKEYFGKMPWTAVPFSDSVTRERLDALFT  425
               L  VY  L  +G NFE+V +  D+DE+SFKE F  +PW ++P  D     +L   F 
Sbjct  226  NAKLVEVYKSLKEQGENFEIVMIPLDDDEQSFKEAFEHLPWFSLPVKDKCCA-KLLRYFE  284

Query  426  VRGIPHLVILDESGKVTTEDGVDIVLEHGVEAYPF  530
            +  +P +V++   GK    +  D V EHG +AYPF
Sbjct  285  LESLPTVVVIGPDGKTLHSNVADAVDEHGTKAYPF  319



>ref|XP_010023554.1| PREDICTED: probable nucleoredoxin 1 isoform X6 [Eucalyptus grandis]
 gb|KCW59848.1| hypothetical protein EUGRSUZ_H02588 [Eucalyptus grandis]
Length=485

 Score =   215 bits (547),  Expect = 9e-64, Method: Compositional matrix adjust.
 Identities = 101/152 (66%), Positives = 119/152 (78%), Gaps = 0/152 (0%)
 Frame = +3

Query  75   SSMAEQNGDAHDLRSILCSSDRDFLIRNSGHQVKVDDLKGKKIGIYFSASWCGPCHRFTP  254
            + + E    +HD++S+L S DRDFLIRN+G QVKVD LKGKKIG+YFSASWCGPCHRFT 
Sbjct  2    ADVVEGGASSHDVQSLLSSPDRDFLIRNNGDQVKVDSLKGKKIGLYFSASWCGPCHRFTL  61

Query  255  NLATVYNELLPKGNFEVVFVSADEDEESFKEYFGKMPWTAVPFSDSVTRERLDALFTVRG  434
             LA VYNEL PKG+ E++F+SAD+DE SF  YF KMPW A+PFSDS  R  LD LF VRG
Sbjct  62   ILAEVYNELSPKGDLEIIFISADKDEGSFSGYFSKMPWLAIPFSDSDKRNGLDELFKVRG  121

Query  435  IPHLVILDESGKVTTEDGVDIVLEHGVEAYPF  530
            IPHLVILD +G V T++G  IV E+GVE YPF
Sbjct  122  IPHLVILDGNGTVLTDEGDKIVREYGVEGYPF  153


 Score =   132 bits (332),  Expect = 5e-33, Method: Compositional matrix adjust.
 Identities = 61/153 (40%), Positives = 95/153 (62%), Gaps = 2/153 (1%)
 Frame = +3

Query  75   SSMAEQNGDAHDLRSILCSSDRDFLIRNSGHQVKVDDLKGKKIGIYFSASWCGPCHRFTP  254
            + + ++  ++  L S+L S D DF+I   G ++ V DL GK + +YFSA WC PC  F P
Sbjct  322  AEIEKKREESQTLESLLVSGDLDFVIGKEGAKIPVSDLVGKTVLLYFSAHWCPPCRAFLP  381

Query  255  NLATVYNELLPKGN-FEVVFVSADEDEESFKEYFGKMPWTAVPFSDSVTRERLDALFTVR  431
             L   Y ++  K N FEV+F+S+D+D+ +F  YF +MPW A+PF D   ++ L   F VR
Sbjct  382  VLIESYEKIKAKDNAFEVIFLSSDKDQTAFDNYFAEMPWLALPFGDE-RKKSLSRKFKVR  440

Query  432  GIPHLVILDESGKVTTEDGVDIVLEHGVEAYPF  530
            GIP L+ +  +G+  T    ++++EHG +A+PF
Sbjct  441  GIPTLIAIGPTGRTLTNKARNLIMEHGADAHPF  473


 Score =   105 bits (263),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 60/166 (36%), Positives = 92/166 (55%), Gaps = 4/166 (2%)
 Frame = +3

Query  36   FQFSKRKGEERKASSMAEQNGDAHDLRSILCSSDRDFLIRNSGHQVKVDDLKGKKIGIYF  215
            + F+  + +E K    A +   +  L S+L    RDF++ ++G++V V +L+GK +G+YF
Sbjct  151  YPFTPERIKELKDQDEAARKNQS--LTSLLVHGSRDFVVSSAGNKVPVAELEGKTVGLYF  208

Query  216  SASWCGPCHRFTPNLATVYNELLPKG-NFEVVFVSADEDEESFKEYFGKMPWTAVPFSDS  392
            S S    C  F P L  VY +L  KG +FE+V +   +DE SF + F  +PW ++P  D 
Sbjct  209  SLSKNKSCVDFMPKLLEVYEKLKAKGESFEIVQIPLGDDEASFNQTFESLPWLSLPLKDK  268

Query  393  VTRERLDALFTVRGIPHLVILDESGKVTTEDGVDIVLEHGVEAYPF  530
               E+L   F +  +P LVI+   GK    +  + V EHGV AYPF
Sbjct  269  KC-EKLVTYFELLTVPTLVIIGPDGKTMHSNVAETVEEHGVAAYPF  313



>ref|XP_010023552.1| PREDICTED: probable nucleoredoxin 1 isoform X5 [Eucalyptus grandis]
Length=485

 Score =   214 bits (545),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 99/152 (65%), Positives = 119/152 (78%), Gaps = 0/152 (0%)
 Frame = +3

Query  75   SSMAEQNGDAHDLRSILCSSDRDFLIRNSGHQVKVDDLKGKKIGIYFSASWCGPCHRFTP  254
            + + E    +HD++S+L S DRDFLIRN+G QVKVD LKGKK+G+YFSASWCGPCHRFTP
Sbjct  2    ADVVEGGASSHDVQSLLSSPDRDFLIRNNGDQVKVDSLKGKKLGLYFSASWCGPCHRFTP  61

Query  255  NLATVYNELLPKGNFEVVFVSADEDEESFKEYFGKMPWTAVPFSDSVTRERLDALFTVRG  434
             LA VY+EL PKG+ E++F+SAD+DE SF  YF KMPW A+PFSD   R  LD LF VRG
Sbjct  62   ILAEVYDELSPKGDLEIIFISADKDEGSFSGYFSKMPWLAIPFSDLDKRNSLDELFKVRG  121

Query  435  IPHLVILDESGKVTTEDGVDIVLEHGVEAYPF  530
            IPHLVILD +G V T+ GV IV E+GVE +PF
Sbjct  122  IPHLVILDGTGTVLTDSGVAIVREYGVEGHPF  153


 Score =   133 bits (335),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 62/153 (41%), Positives = 95/153 (62%), Gaps = 2/153 (1%)
 Frame = +3

Query  75   SSMAEQNGDAHDLRSILCSSDRDFLIRNSGHQVKVDDLKGKKIGIYFSASWCGPCHRFTP  254
            + + ++  ++  L SIL S D DF+I   G ++ V DL GK + +YFSA WC PC  F P
Sbjct  322  AEIEKKREESQTLESILVSGDLDFVIGKDGTKIPVSDLVGKTVLLYFSAHWCPPCRAFLP  381

Query  255  NLATVYNELLPKGN-FEVVFVSADEDEESFKEYFGKMPWTAVPFSDSVTRERLDALFTVR  431
             L   Y ++  K N FEV+F+S+D+D+ +F  YF +MPW A+PF D   ++ L   F VR
Sbjct  382  VLIESYEKIKAKDNAFEVIFLSSDKDQTAFDNYFAEMPWLALPFGDE-RKKSLSRKFKVR  440

Query  432  GIPHLVILDESGKVTTEDGVDIVLEHGVEAYPF  530
            GIP L+ +  +G+  T    ++++EHG +A+PF
Sbjct  441  GIPTLIAIGPTGRTLTNKARNLIMEHGADAHPF  473


 Score =   112 bits (281),  Expect = 5e-26, Method: Compositional matrix adjust.
 Identities = 58/143 (41%), Positives = 86/143 (60%), Gaps = 2/143 (1%)
 Frame = +3

Query  105  HDLRSILCSSDRDFLIRNSGHQVKVDDLKGKKIGIYFSASWCGPCHRFTPNLATVYNELL  284
              L S+L    R+F++ ++ +QV V +L+GK +G+YFS S    C  FTP L  VY +L 
Sbjct  172  QSLTSLLVHGSRNFVVSSNRNQVPVTELEGKTVGLYFSLSVHRACVDFTPKLLEVYEKLK  231

Query  285  PKG-NFEVVFVSADEDEESFKEYFGKMPWTAVPFSDSVTRERLDALFTVRGIPHLVILDE  461
             +G +FE+V +  D+DE SF + FG MPW ++PF D    E+L   F +  +P LVI+ +
Sbjct  232  ARGESFEIVQIPLDDDEASFNQSFGSMPWLSLPFKDKKC-EKLVRYFKLSTLPTLVIIGQ  290

Query  462  SGKVTTEDGVDIVLEHGVEAYPF  530
             GK    +  + V EHG+ AYPF
Sbjct  291  DGKTVHANVAETVEEHGITAYPF  313



>gb|ACJ85567.1| unknown [Medicago truncatula]
 gb|AFK46193.1| unknown [Medicago truncatula]
Length=570

 Score =   215 bits (548),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 103/151 (68%), Positives = 119/151 (79%), Gaps = 1/151 (1%)
 Frame = +3

Query  81   MAEQNGD-AHDLRSILCSSDRDFLIRNSGHQVKVDDLKGKKIGIYFSASWCGPCHRFTPN  257
            MA+   D  H++ SIL SSDRDFL+RN+G QVK+D LKGKK+G YFSASWCGPC  FTP 
Sbjct  1    MADSVADVTHNVHSILSSSDRDFLLRNTGDQVKIDSLKGKKLGFYFSASWCGPCRGFTPK  60

Query  258  LATVYNELLPKGNFEVVFVSADEDEESFKEYFGKMPWTAVPFSDSVTRERLDALFTVRGI  437
            L  V +EL P G FEVVFVSAD+D+E+FK YF KMPW A+PFSDS TR RLD LF V GI
Sbjct  61   LVEVCDELSPNGGFEVVFVSADKDDEAFKSYFSKMPWLAIPFSDSETRGRLDELFHVNGI  120

Query  438  PHLVILDESGKVTTEDGVDIVLEHGVEAYPF  530
            PHL +LDE+GKV TEDGVDI+  +G EAYPF
Sbjct  121  PHLALLDEAGKVITEDGVDIIRVYGAEAYPF  151


 Score =   130 bits (327),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 64/152 (42%), Positives = 93/152 (61%), Gaps = 3/152 (2%)
 Frame = +3

Query  81   MAEQNGDAHDLRSILCSSDRDFLIRNSGHQVKVDDLKGKKIGIYFSASWCGPCHRFTPNL  260
            +A+    +  L S+L S D+DF+I   G ++ V +L GK + +YFSA WC PC  F P L
Sbjct  322  IAKAKEASQTLESVLVSGDQDFVIDKDGKKIPVSELVGKTVLLYFSAHWCPPCRAFLPKL  381

Query  261  ATVYNELLPKGN--FEVVFVSADEDEESFKEYFGKMPWTAVPFSDSVTRERLDALFTVRG  434
               Y+++  + N   EVVF+S+D D+ESF E+F  MPW A+PF D+  +E L   F V G
Sbjct  382  IEAYHKIKARNNDALEVVFISSDRDQESFNEFFAGMPWLALPFGDT-RKEFLSRKFKVSG  440

Query  435  IPHLVILDESGKVTTEDGVDIVLEHGVEAYPF  530
            IP LV +  SG+  T++   +V  +G +AYPF
Sbjct  441  IPELVAIGPSGQTVTKEARGLVGLYGADAYPF  472


 Score =   111 bits (278),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 62/163 (38%), Positives = 94/163 (58%), Gaps = 5/163 (3%)
 Frame = +3

Query  45   SKRKGEERKASSMAEQNGDAHDLRSILCSSDRDFLIRNSGHQVKVDDLKGKKIGIYFSAS  224
            SKR  E +     A++N     LRSIL S  RDFLI + G+++ + +L+GK +G++F A+
Sbjct  153  SKRVQELKDIEEEAKRN---QSLRSILASRSRDFLISSDGNEIPIPELEGKTVGLHFCAT  209

Query  225  WCGPCHRFTPNLATVYNELLPKG-NFEVVFVSADEDEESFKEYFGKMPWTAVPFSDSVTR  401
                C  FT  L  VY +L   G NFEVVF+  D++E++FK+     PW ++P  D  T 
Sbjct  210  SYRACTLFTQKLKEVYKKLKENGENFEVVFIPLDDEEDAFKKELESAPWLSLPLKDK-TC  268

Query  402  ERLDALFTVRGIPHLVILDESGKVTTEDGVDIVLEHGVEAYPF  530
             +L   F +  +P LVI+   GK    +  + + +HGV+AYPF
Sbjct  269  AKLIQYFELSELPTLVIIGPDGKTLHPNAAEAIEDHGVDAYPF  311



>ref|XP_010243057.1| PREDICTED: probable nucleoredoxin 1 [Nelumbo nucifera]
Length=570

 Score =   215 bits (548),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 100/147 (68%), Positives = 120/147 (82%), Gaps = 1/147 (1%)
 Frame = +3

Query  93   NGDA-HDLRSILCSSDRDFLIRNSGHQVKVDDLKGKKIGIYFSASWCGPCHRFTPNLATV  269
            +GD+ HDL+ IL S +RDFL+RN+G QVK+ DL GK  G+YFSASWCGPC RFTP L  V
Sbjct  3    DGDSQHDLKFILSSGERDFLVRNNGDQVKISDLSGKTTGLYFSASWCGPCRRFTPELIDV  62

Query  270  YNELLPKGNFEVVFVSADEDEESFKEYFGKMPWTAVPFSDSVTRERLDALFTVRGIPHLV  449
            YN+L  KG FE+VFVSAD+DEE F  YF KMPW A+PFSDS TR+RLD +F V GIPHLV
Sbjct  63   YNDLSAKGGFEIVFVSADQDEEEFNGYFSKMPWLAIPFSDSDTRDRLDGIFQVNGIPHLV  122

Query  450  ILDESGKVTTEDGVDIVLEHGVEAYPF  530
            ILD +GKV+TE+GV+I+ E+GVEAYPF
Sbjct  123  ILDANGKVSTEEGVEIIGEYGVEAYPF  149


 Score =   134 bits (337),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 64/145 (44%), Positives = 90/145 (62%), Gaps = 2/145 (1%)
 Frame = +3

Query  99   DAHDLRSILCSSDRDFLIRNSGHQVKVDDLKGKKIGIYFSASWCGPCHRFTPNLATVYNE  278
            +A  L SIL S DRDF+I   G ++ V  L GK I +YFSA WC PC  F P L   Y+E
Sbjct  326  EAQTLESILVSGDRDFVIGKDGAKIPVSKLLGKNILLYFSAEWCPPCRAFLPKLIKAYHE  385

Query  279  LLPKGN-FEVVFVSADEDEESFKEYFGKMPWTAVPFSDSVTRERLDALFTVRGIPHLVIL  455
            +  K + FEV+F+S+D ++ SF E++  MPW A+PF D   ++ L+  F V GIP  V +
Sbjct  386  IKAKDDGFEVIFISSDSNQSSFDEFYSGMPWLALPFGDE-RKKSLNRRFKVTGIPTAVAI  444

Query  456  DESGKVTTEDGVDIVLEHGVEAYPF  530
              SG+  T D  ++++ HG +AYPF
Sbjct  445  GSSGRTVTTDARNLLMAHGADAYPF  469


 Score =   129 bits (324),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 66/143 (46%), Positives = 91/143 (64%), Gaps = 2/143 (1%)
 Frame = +3

Query  105  HDLRSILCSSDRDFLIRNSGHQVKVDDLKGKKIGIYFSASWCGPCHRFTPNLATVYNELL  284
              LRSIL SS RDFLI N G++V V +L+GK +G+YF +S+ G C  FT     +YNEL 
Sbjct  168  QSLRSILVSSSRDFLISNDGNKVPVSELEGKVVGLYFCSSFYGSCVEFTKEFVGIYNELK  227

Query  285  PKG-NFEVVFVSADEDEESFKEYFGKMPWTAVPFSDSVTRERLDALFTVRGIPHLVILDE  461
             K  +FEVV +S D+DEES+K+ F  +PW A+PF D  +  +L   F +  +P LVI+  
Sbjct  228  EKAESFEVVLISLDDDEESYKKSFEIVPWLALPFKDK-SISKLVRYFELSTVPTLVIIGT  286

Query  462  SGKVTTEDGVDIVLEHGVEAYPF  530
             GK    + V I+ EHG++ YPF
Sbjct  287  DGKTLHSNAVKIIEEHGIQGYPF  309



>emb|CBI28541.3| unnamed protein product [Vitis vinifera]
Length=490

 Score =   213 bits (543),  Expect = 4e-63, Method: Compositional matrix adjust.
 Identities = 98/146 (67%), Positives = 117/146 (80%), Gaps = 0/146 (0%)
 Frame = +3

Query  93   NGDAHDLRSILCSSDRDFLIRNSGHQVKVDDLKGKKIGIYFSASWCGPCHRFTPNLATVY  272
            +G AHDL S+L   DRDFL+RN+GHQVKV+ LKGKKI +YFSASWCGPC RFTP L   Y
Sbjct  7    DGVAHDLVSLLTREDRDFLVRNNGHQVKVESLKGKKIWLYFSASWCGPCRRFTPKLVEAY  66

Query  273  NELLPKGNFEVVFVSADEDEESFKEYFGKMPWTAVPFSDSVTRERLDALFTVRGIPHLVI  452
            NEL    +FE++FVS D D+ESF  YF KMPW A+PFSDS  R++L+ LF V GIP+LV+
Sbjct  67   NELSSNDDFEIIFVSGDNDDESFNGYFSKMPWLAIPFSDSDARDQLNELFKVMGIPNLVM  126

Query  453  LDESGKVTTEDGVDIVLEHGVEAYPF  530
            LDESGKV +EDGVDI+ E+GVEAYPF
Sbjct  127  LDESGKVLSEDGVDIIQEYGVEAYPF  152


 Score =   135 bits (340),  Expect = 5e-34, Method: Compositional matrix adjust.
 Identities = 65/145 (45%), Positives = 89/145 (61%), Gaps = 2/145 (1%)
 Frame = +3

Query  99   DAHDLRSILCSSDRDFLIRNSGHQVKVDDLKGKKIGIYFSASWCGPCHRFTPNLATVYNE  278
            +A  L SIL S DRDF+I   G ++ V DL GK I +YFSA WC PC  F P L   Y +
Sbjct  329  EAQTLESILVSGDRDFVIGKDGVKIPVSDLVGKNILLYFSAHWCPPCRAFLPKLIEAYQK  388

Query  279  LLPKGN-FEVVFVSADEDEESFKEYFGKMPWTAVPFSDSVTRERLDALFTVRGIPHLVIL  455
            +  K   FEV+F+S+D+D+ SF E+F  MPW A+PF D   +  L   F V GIP L+ +
Sbjct  389  IKTKDEAFEVIFISSDKDQTSFDEFFSGMPWLALPFGDK-RKASLSRTFKVHGIPSLIAI  447

Query  456  DESGKVTTEDGVDIVLEHGVEAYPF  530
              +G+  T +  ++V+ HG +AYPF
Sbjct  448  GPTGRTVTTEARNLVMIHGADAYPF  472


 Score =   130 bits (326),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 64/143 (45%), Positives = 91/143 (64%), Gaps = 2/143 (1%)
 Frame = +3

Query  105  HDLRSILCSSDRDFLIRNSGHQVKVDDLKGKKIGIYFSASWCGPCHRFTPNLATVYNELL  284
              LRSIL S  RD++I   G +V V +L+GK +G++FS S    C  FTP L  VY +L 
Sbjct  171  QSLRSILVSQSRDYVISTDGKKVPVSELEGKFVGLFFSLSSYKACLEFTPTLVDVYEKLR  230

Query  285  PKG-NFEVVFVSADEDEESFKEYFGKMPWTAVPFSDSVTRERLDALFTVRGIPHLVILDE  461
             KG +FE+V +S D++EESFK+YFG MPW A+PF D  + E+L   F +  +P LV++  
Sbjct  231  AKGESFEIVMISLDDEEESFKKYFGSMPWLALPFRDK-SCEKLARYFELSALPTLVVIGP  289

Query  462  SGKVTTEDGVDIVLEHGVEAYPF  530
             GK    +  + + EHG++AYPF
Sbjct  290  DGKTLHSNVAEAIQEHGIQAYPF  312



>ref|XP_008221827.1| PREDICTED: probable nucleoredoxin 1 [Prunus mume]
Length=580

 Score =   214 bits (546),  Expect = 9e-63, Method: Compositional matrix adjust.
 Identities = 96/146 (66%), Positives = 116/146 (79%), Gaps = 0/146 (0%)
 Frame = +3

Query  93   NGDAHDLRSILCSSDRDFLIRNSGHQVKVDDLKGKKIGIYFSASWCGPCHRFTPNLATVY  272
            N + HD RS+L SS RDF++RN+G Q KV+ L+GKK+G+YFSASWCGPC RFTP     Y
Sbjct  13   NSEPHDFRSLLSSSQRDFVVRNNGDQTKVESLEGKKLGLYFSASWCGPCQRFTPAFVEAY  72

Query  273  NELLPKGNFEVVFVSADEDEESFKEYFGKMPWTAVPFSDSVTRERLDALFTVRGIPHLVI  452
            NEL  KG+FEVVF+SADED+ESF  YF KMPW A+PFSDS  R+R+D LF VRGIPHLVI
Sbjct  73   NELSSKGDFEVVFISADEDDESFNGYFSKMPWLAIPFSDSEARDRMDELFKVRGIPHLVI  132

Query  453  LDESGKVTTEDGVDIVLEHGVEAYPF  530
            L E GKV +E GV+I+ E+GV+ YPF
Sbjct  133  LGEDGKVLSESGVEIIQEYGVDGYPF  158


 Score =   135 bits (340),  Expect = 6e-34, Method: Compositional matrix adjust.
 Identities = 64/144 (44%), Positives = 91/144 (63%), Gaps = 2/144 (1%)
 Frame = +3

Query  102  AHDLRSILCSSDRDFLIRNSGHQVKVDDLKGKKIGIYFSASWCGPCHRFTPNLATVYNEL  281
            A  L SIL S DR+F+I   G ++ V D+ GK I +YFSA WC PC  F P L   Y+++
Sbjct  336  AQTLESILVSGDRNFVIGKGGTEIPVSDMVGKNILLYFSAHWCPPCRAFLPKLVEAYHKI  395

Query  282  LPKGN-FEVVFVSADEDEESFKEYFGKMPWTAVPFSDSVTRERLDALFTVRGIPHLVILD  458
              K + FEV+F+S+D+D+  F E+F  MPW A+PF D + +  L   F V GIP LV + 
Sbjct  396  KAKDDAFEVIFISSDKDQGDFDEFFSGMPWLALPFGD-LRKASLSRRFKVNGIPMLVAIG  454

Query  459  ESGKVTTEDGVDIVLEHGVEAYPF  530
             +G+  T++  D+V++HG  AYPF
Sbjct  455  PTGQTITKEARDLVMQHGANAYPF  478


 Score =   117 bits (292),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 63/143 (44%), Positives = 86/143 (60%), Gaps = 2/143 (1%)
 Frame = +3

Query  105  HDLRSILCSSDRDFLIRNSGHQVKVDDLKGKKIGIYFSASWCGPCHRFTPNLATVYNELL  284
              L +IL S  R+F+I N G  V V +LKGK +G+YFS S   PC  FTP L  VY +L 
Sbjct  177  QSLNTILVSGLRNFVISNDGKNVPVSELKGKIVGLYFSLSAYSPCVDFTPKLLEVYEKLK  236

Query  285  PKG-NFEVVFVSADEDEESFKEYFGKMPWTAVPFSDSVTRERLDALFTVRGIPHLVILDE  461
              G +FEVV +  D+DEESFK+ F  MPW ++P  D   R +L   F +  +P LVI+  
Sbjct  237  ASGESFEVVVIPLDDDEESFKQDFKSMPWFSLPIGDKNVR-KLARYFELSTLPTLVIIGA  295

Query  462  SGKVTTEDGVDIVLEHGVEAYPF  530
             GK  +++  + + E+GV AYPF
Sbjct  296  DGKTISKNVAEAIEENGVLAYPF  318



>ref|XP_008340047.1| PREDICTED: probable nucleoredoxin 1 [Malus domestica]
Length=579

 Score =   214 bits (545),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 96/146 (66%), Positives = 118/146 (81%), Gaps = 0/146 (0%)
 Frame = +3

Query  93   NGDAHDLRSILCSSDRDFLIRNSGHQVKVDDLKGKKIGIYFSASWCGPCHRFTPNLATVY  272
              + HD  S+L SS+RDFL+RN+G Q+KV+ LKGKK+G+YFSASWCGPC RFTP L   Y
Sbjct  13   GAEPHDFVSLLSSSERDFLVRNNGDQIKVESLKGKKLGLYFSASWCGPCKRFTPALVEAY  72

Query  273  NELLPKGNFEVVFVSADEDEESFKEYFGKMPWTAVPFSDSVTRERLDALFTVRGIPHLVI  452
            NEL PKG+FE+VF+SADED+ESF+ YF KMPW A PFSDS  R+R+D LF VRGIPHLVI
Sbjct  73   NELSPKGDFEIVFISADEDDESFEGYFAKMPWLAFPFSDSEARDRVDELFKVRGIPHLVI  132

Query  453  LDESGKVTTEDGVDIVLEHGVEAYPF  530
            L E GKV ++ GV+I+ E+G +AYPF
Sbjct  133  LGEDGKVLSDSGVEIIQEYGADAYPF  158


 Score =   135 bits (340),  Expect = 8e-34, Method: Compositional matrix adjust.
 Identities = 65/144 (45%), Positives = 90/144 (63%), Gaps = 2/144 (1%)
 Frame = +3

Query  102  AHDLRSILCSSDRDFLIRNSGHQVKVDDLKGKKIGIYFSASWCGPCHRFTPNLATVYNEL  281
            A  L SIL S DR+F+I   G Q+ V DL GK I +YFSA WC PC  F P L   Y+ +
Sbjct  336  AQTLESILISGDRNFVIGKDGTQIPVTDLVGKNILLYFSAHWCPPCRAFLPKLVEAYHGI  395

Query  282  LPKGN-FEVVFVSADEDEESFKEYFGKMPWTAVPFSDSVTRERLDALFTVRGIPHLVILD  458
              K + FEV+F+S+D D+ SF E+F  MPW A+PF DS  +  L   F V+GIP L+ + 
Sbjct  396  KAKDDAFEVIFISSDRDQGSFDEFFATMPWLALPFGDS-RKAFLSRKFKVQGIPMLIAIG  454

Query  459  ESGKVTTEDGVDIVLEHGVEAYPF  530
             +G+  T++  ++++ HG  AYPF
Sbjct  455  PTGQTVTKEARNLIMRHGANAYPF  478


 Score =   127 bits (319),  Expect = 6e-31, Method: Compositional matrix adjust.
 Identities = 69/166 (42%), Positives = 100/166 (60%), Gaps = 4/166 (2%)
 Frame = +3

Query  36   FQFSKRKGEERKASSMAEQNGDAHDLRSILCSSDRDFLIRNSGHQVKVDDLKGKKIGIYF  215
            + F+  K +E K    A +   +  L++IL +  RDF+I N G +V V +L+GK +G+YF
Sbjct  156  YPFTLEKLKELKDEEEAARRDQS--LKTILVTRSRDFVISNDGEKVPVSELEGKIVGLYF  213

Query  216  SASWCGPCHRFTPNLATVYNELLPKG-NFEVVFVSADEDEESFKEYFGKMPWTAVPFSDS  392
            S S  GPC  FTP L   +++L   G NFE+V V  D+DEESFK+YF KMPW ++P  D 
Sbjct  214  SLSLYGPCVEFTPKLVEAHDKLKANGENFEIVLVPLDDDEESFKQYFEKMPWFSLPIGDK  273

Query  393  VTRERLDALFTVRGIPHLVILDESGKVTTEDGVDIVLEHGVEAYPF  530
             + ++L   F +  +P +VI+   GK   E+  D + EHG  AYPF
Sbjct  274  -SVQKLARYFELSTLPTVVIIGADGKTLGENVADAIDEHGSLAYPF  318



>gb|KDO82401.1| hypothetical protein CISIN_1g008336mg [Citrus sinensis]
Length=569

 Score =   214 bits (544),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 101/150 (67%), Positives = 123/150 (82%), Gaps = 1/150 (1%)
 Frame = +3

Query  81   MAEQNGDAHDLRSILCSSDRDFLIRNSGHQVKVDDLKGKKIGIYFSASWCGPCHRFTPNL  260
            M     ++HD++S+L SS RDFLIR++G QVK+D LKGK IG+YFSASWCGPC RFTP L
Sbjct  1    MNMNGANSHDIQSLLSSSARDFLIRSNGDQVKLDSLKGK-IGLYFSASWCGPCQRFTPIL  59

Query  261  ATVYNELLPKGNFEVVFVSADEDEESFKEYFGKMPWTAVPFSDSVTRERLDALFTVRGIP  440
            A VYNEL  +G+FEV+FVS DED+E+FK YF KMPW AVPFSDS TR++LD LF V GIP
Sbjct  60   AEVYNELSRQGDFEVIFVSGDEDDEAFKGYFSKMPWLAVPFSDSETRDKLDELFKVMGIP  119

Query  441  HLVILDESGKVTTEDGVDIVLEHGVEAYPF  530
            HLVILDE+GKV ++ GV+I+ E+GVE YPF
Sbjct  120  HLVILDENGKVLSDGGVEIIREYGVEGYPF  149


 Score =   131 bits (330),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 69/166 (42%), Positives = 97/166 (58%), Gaps = 4/166 (2%)
 Frame = +3

Query  36   FQFSKRKGEERKASSMAEQNGDAHDLRSILCSSDRDFLIRNSGHQVKVDDLKGKKIGIYF  215
            F F+  K  E      A++  ++  L S+L S D DF++  +G +V V DL GK I +YF
Sbjct  307  FPFTPEKFAELAEIQRAKE--ESQTLESVLVSGDLDFVVGKNGGKVPVSDLAGKTILLYF  364

Query  216  SASWCGPCHRFTPNLATVYNELLPKG-NFEVVFVSADEDEESFKEYFGKMPWTAVPFSDS  392
            SA WC PC  F P L   Y ++  +  + EVVF+S+D D+ SF E+F  MPW A+PF D+
Sbjct  365  SAHWCPPCRAFLPKLIDAYKKIKERNESLEVVFISSDRDQTSFDEFFKGMPWLALPFGDA  424

Query  393  VTRERLDALFTVRGIPHLVILDESGKVTTEDGVDIVLEHGVEAYPF  530
              +  L   F V GIP LV +  SG+  T++  D++  HG EAYPF
Sbjct  425  -RKASLSRKFKVSGIPMLVAIGPSGRTITKEARDMIAVHGAEAYPF  469


 Score =   125 bits (315),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 69/158 (44%), Positives = 93/158 (59%), Gaps = 5/158 (3%)
 Frame = +3

Query  69   KASSMAEQNGDA---HDLRSILCSSDRDFLIRNSGHQVKVDDLKGKKIGIYFSASWCGPC  239
            +   M EQ   A     LRS+L S  RDF+I + G ++ V DL+GK IG+YFS S     
Sbjct  153  RIKEMKEQEERAKREQSLRSVLTSHSRDFVISSDGRKISVSDLEGKTIGLYFSMSSYKAS  212

Query  240  HRFTPNLATVYNELLPKG-NFEVVFVSADEDEESFKEYFGKMPWTAVPFSDSVTRERLDA  416
              FTP L  VY +L  KG +FE+V +S D++EESFK   G MPW A+PF D  +RE+L  
Sbjct  213  AEFTPRLVEVYEKLKGKGESFEIVLISLDDEEESFKRDLGSMPWLALPFKDK-SREKLAR  271

Query  417  LFTVRGIPHLVILDESGKVTTEDGVDIVLEHGVEAYPF  530
             F +  +P LVI+   GK    +  + + EHGV A+PF
Sbjct  272  YFELSTLPTLVIIGPDGKTLHSNVAEAIEEHGVGAFPF  309



>ref|XP_010023548.1| PREDICTED: probable nucleoredoxin 1 isoform X1 [Eucalyptus grandis]
 gb|KCW59850.1| hypothetical protein EUGRSUZ_H02590 [Eucalyptus grandis]
Length=573

 Score =   213 bits (542),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 99/152 (65%), Positives = 119/152 (78%), Gaps = 0/152 (0%)
 Frame = +3

Query  75   SSMAEQNGDAHDLRSILCSSDRDFLIRNSGHQVKVDDLKGKKIGIYFSASWCGPCHRFTP  254
            + + E    +HD++S+L S DRDFLIRN+G QVKVD LKGKK+G+YFSASWCGPCHRFTP
Sbjct  2    ADVVEGGASSHDVQSLLSSPDRDFLIRNNGDQVKVDSLKGKKLGLYFSASWCGPCHRFTP  61

Query  255  NLATVYNELLPKGNFEVVFVSADEDEESFKEYFGKMPWTAVPFSDSVTRERLDALFTVRG  434
             LA VY+EL PKG+ E++F+SAD+DE SF  YF KMPW A+PFSD   R  LD LF VRG
Sbjct  62   ILAEVYDELSPKGDLEIIFISADKDEGSFSGYFSKMPWLAIPFSDLDKRNSLDELFKVRG  121

Query  435  IPHLVILDESGKVTTEDGVDIVLEHGVEAYPF  530
            IPHLVILD +G V T+ GV IV E+GVE +PF
Sbjct  122  IPHLVILDGTGTVLTDSGVAIVREYGVEGHPF  153


 Score =   132 bits (332),  Expect = 7e-33, Method: Compositional matrix adjust.
 Identities = 61/153 (40%), Positives = 97/153 (63%), Gaps = 2/153 (1%)
 Frame = +3

Query  75   SSMAEQNGDAHDLRSILCSSDRDFLIRNSGHQVKVDDLKGKKIGIYFSASWCGPCHRFTP  254
            + + ++  ++  L SIL S D DF+I   G ++ V DL GK I +YFSA WC PC  F P
Sbjct  322  AEIEKKREESQTLESILVSGDLDFVIGKDGTKIPVSDLVGKTILLYFSAHWCPPCRAFLP  381

Query  255  NLATVYNELLPKGN-FEVVFVSADEDEESFKEYFGKMPWTAVPFSDSVTRERLDALFTVR  431
             L+  Y ++    + FEV+F+S+D+D+ +F +YF +MPW A+PF D   ++ L   F V+
Sbjct  382  VLSEAYEKIKATDDAFEVIFISSDKDQTAFDDYFAQMPWLALPFGDE-RKKFLSRRFKVK  440

Query  432  GIPHLVILDESGKVTTEDGVDIVLEHGVEAYPF  530
            GIP LV +  +G+  ++   D++++HG +AYPF
Sbjct  441  GIPMLVAIGPTGRTVSKKARDLIMDHGADAYPF  473


 Score =   112 bits (279),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 58/143 (41%), Positives = 86/143 (60%), Gaps = 2/143 (1%)
 Frame = +3

Query  105  HDLRSILCSSDRDFLIRNSGHQVKVDDLKGKKIGIYFSASWCGPCHRFTPNLATVYNELL  284
              L S+L    R+F++ ++ +QV V +L+GK +G+YFS S    C  FTP L  VY +L 
Sbjct  172  QSLTSLLVHGSRNFVVSSNRNQVPVTELEGKTVGLYFSLSVHRACVDFTPKLLEVYEKLK  231

Query  285  PKG-NFEVVFVSADEDEESFKEYFGKMPWTAVPFSDSVTRERLDALFTVRGIPHLVILDE  461
             +G +FE+V +  D+DE SF + FG MPW ++PF D    E+L   F +  +P LVI+ +
Sbjct  232  ARGESFEIVQIPLDDDEASFNQSFGSMPWLSLPFKDKKC-EKLVRYFKLSTLPTLVIIGQ  290

Query  462  SGKVTTEDGVDIVLEHGVEAYPF  530
             GK    +  + V EHG+ AYPF
Sbjct  291  DGKTVHANVAETVEEHGITAYPF  313



>ref|XP_010023551.1| PREDICTED: probable nucleoredoxin 1 isoform X4 [Eucalyptus grandis]
Length=486

 Score =   210 bits (535),  Expect = 6e-62, Method: Compositional matrix adjust.
 Identities = 98/143 (69%), Positives = 116/143 (81%), Gaps = 0/143 (0%)
 Frame = +3

Query  102  AHDLRSILCSSDRDFLIRNSGHQVKVDDLKGKKIGIYFSASWCGPCHRFTPNLATVYNEL  281
            +HD++S+L S DRDFL+RN+G +VKVD LKGKKIG+YFSASWCGPCHRFT  LA VYNEL
Sbjct  12   SHDVQSLLSSPDRDFLVRNNGDRVKVDSLKGKKIGLYFSASWCGPCHRFTLILAEVYNEL  71

Query  282  LPKGNFEVVFVSADEDEESFKEYFGKMPWTAVPFSDSVTRERLDALFTVRGIPHLVILDE  461
             PKG+ E++F+SAD+DE SF  YF KMPW A+PFSDS  R  LD LF VRGIPHLVILD 
Sbjct  72   SPKGDLEIIFISADKDEGSFSGYFSKMPWLAIPFSDSDKRNGLDELFKVRGIPHLVILDG  131

Query  462  SGKVTTEDGVDIVLEHGVEAYPF  530
            +G V T++G  IV E+GVE YPF
Sbjct  132  NGTVLTDEGDKIVREYGVEGYPF  154


 Score =   132 bits (332),  Expect = 5e-33, Method: Compositional matrix adjust.
 Identities = 61/153 (40%), Positives = 95/153 (62%), Gaps = 2/153 (1%)
 Frame = +3

Query  75   SSMAEQNGDAHDLRSILCSSDRDFLIRNSGHQVKVDDLKGKKIGIYFSASWCGPCHRFTP  254
            + + ++  ++  L S+L S D DF+I   G ++ V DL GK + +YFSA WC PC  F P
Sbjct  323  AEIEKKREESQTLESLLVSGDLDFVIGKEGAKIPVSDLVGKTVLLYFSAHWCPPCRAFLP  382

Query  255  NLATVYNELLPKGN-FEVVFVSADEDEESFKEYFGKMPWTAVPFSDSVTRERLDALFTVR  431
             L   Y ++  K N FEV+F+S+D+D+ +F  YF +MPW A+PF D   ++ L   F VR
Sbjct  383  VLIESYEKIKAKDNAFEVIFLSSDKDQTAFDNYFAEMPWLALPFGDE-RKKSLSRKFKVR  441

Query  432  GIPHLVILDESGKVTTEDGVDIVLEHGVEAYPF  530
            GIP L+ +  +G+  T    ++++EHG +A+PF
Sbjct  442  GIPTLIAIGPTGRTLTNKARNLIMEHGADAHPF  474


 Score =   105 bits (263),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 60/166 (36%), Positives = 92/166 (55%), Gaps = 4/166 (2%)
 Frame = +3

Query  36   FQFSKRKGEERKASSMAEQNGDAHDLRSILCSSDRDFLIRNSGHQVKVDDLKGKKIGIYF  215
            + F+  + +E K    A +   +  L S+L    RDF++ ++G++V V +L+GK +G+YF
Sbjct  152  YPFTPERIKELKDQDEAARKNQS--LTSLLVHGSRDFVVSSAGNKVPVAELEGKTVGLYF  209

Query  216  SASWCGPCHRFTPNLATVYNELLPKG-NFEVVFVSADEDEESFKEYFGKMPWTAVPFSDS  392
            S S    C  F P L  VY +L  KG +FE+V +   +DE SF + F  +PW ++P  D 
Sbjct  210  SLSKNKSCVDFMPKLLEVYEKLKAKGESFEIVQIPLGDDEASFNQTFESLPWLSLPLKDK  269

Query  393  VTRERLDALFTVRGIPHLVILDESGKVTTEDGVDIVLEHGVEAYPF  530
               E+L   F +  +P LVI+   GK    +  + V EHGV AYPF
Sbjct  270  KC-EKLVTYFELLTVPTLVIIGPDGKTMHSNVAETVEEHGVAAYPF  314



>gb|KEH20030.1| protein disulfide isomerase (PDI)-like protein [Medicago truncatula]
Length=506

 Score =   211 bits (536),  Expect = 6e-62, Method: Compositional matrix adjust.
 Identities = 95/143 (66%), Positives = 113/143 (79%), Gaps = 0/143 (0%)
 Frame = +3

Query  102  AHDLRSILCSSDRDFLIRNSGHQVKVDDLKGKKIGIYFSASWCGPCHRFTPNLATVYNEL  281
             HD+ S+L S DRDFL+RN+G QVK+D LKGKK+G YFSASWCGPC  FTP L  VYNEL
Sbjct  9    THDVHSLLSSPDRDFLLRNTGDQVKIDSLKGKKLGFYFSASWCGPCRSFTPTLVEVYNEL  68

Query  282  LPKGNFEVVFVSADEDEESFKEYFGKMPWTAVPFSDSVTRERLDALFTVRGIPHLVILDE  461
             PKG+FEVV+VS D+D+E+F  YF KMPW A+PFSDS  R RL  LF V+GIPHL +LD+
Sbjct  69   SPKGDFEVVYVSRDKDDETFNNYFSKMPWLAIPFSDSEIRIRLKELFHVKGIPHLALLDD  128

Query  462  SGKVTTEDGVDIVLEHGVEAYPF  530
            +GKV TEDGV I+ E+G E YPF
Sbjct  129  TGKVVTEDGVHIIREYGTEGYPF  151


 Score =   134 bits (338),  Expect = 9e-34, Method: Compositional matrix adjust.
 Identities = 66/152 (43%), Positives = 95/152 (63%), Gaps = 3/152 (2%)
 Frame = +3

Query  81   MAEQNGDAHDLRSILCSSDRDFLIRNSGHQVKVDDLKGKKIGIYFSASWCGPCHRFTPNL  260
            +A+    +  L S+L S D+DF+I   G ++ V +LKGK + +YFSA WC PC  F P L
Sbjct  322  IAKAKEASQTLESVLVSGDQDFVIEKDGKKIPVSELKGKTVLLYFSAHWCPPCREFLPKL  381

Query  261  ATVYNELLPKGN--FEVVFVSADEDEESFKEYFGKMPWTAVPFSDSVTRERLDALFTVRG  434
               Y ++  + N   EVVF+S+D D++SF E+F +MPW A+PF DS  +E L   F V G
Sbjct  382  IDAYLKIKTEDNDALEVVFISSDRDQDSFDEFFAEMPWVALPFGDS-RKEFLSRKFKVAG  440

Query  435  IPHLVILDESGKVTTEDGVDIVLEHGVEAYPF  530
            IP LV +  SG+  T++  D+V  +G +AYPF
Sbjct  441  IPKLVAIGPSGQTVTKEARDLVGIYGADAYPF  472


 Score =   108 bits (270),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 58/166 (35%), Positives = 94/166 (57%), Gaps = 4/166 (2%)
 Frame = +3

Query  36   FQFSKRKGEERKASSMAEQNGDAHDLRSILCSSDRDFLIRNSGHQVKVDDLKGKKIGIYF  215
            + F+ +K +E K   + E+      LRS L SS RDF+I +  +++ + +++GK +G++F
Sbjct  149  YPFTSKKVQELK--DIEEEAMRNQSLRSTLVSSYRDFVISSDRNEIPISEIEGKTVGLHF  206

Query  216  SASWCGPCHRFTPNLATVYNELLPKG-NFEVVFVSADEDEESFKEYFGKMPWTAVPFSDS  392
              +   PC  F   L  VYN L   G NFEVVF+  D++EESFK+    +PW ++P  D 
Sbjct  207  FTTSYKPCVLFNQKLKEVYNNLKENGENFEVVFIPLDDEEESFKKELESVPWLSLPLKDK  266

Query  393  VTRERLDALFTVRGIPHLVILDESGKVTTEDGVDIVLEHGVEAYPF  530
             T  +L   F +  +P  V++   GK    +  D + +HG++AYPF
Sbjct  267  -TCLKLVKYFELSTLPSFVVIGPDGKTLHPNAADAIEDHGIDAYPF  311



>emb|CAN77321.1| hypothetical protein VITISV_008818 [Vitis vinifera]
Length=572

 Score =   212 bits (540),  Expect = 6e-62, Method: Compositional matrix adjust.
 Identities = 98/146 (67%), Positives = 117/146 (80%), Gaps = 0/146 (0%)
 Frame = +3

Query  93   NGDAHDLRSILCSSDRDFLIRNSGHQVKVDDLKGKKIGIYFSASWCGPCHRFTPNLATVY  272
            +G AHDL S+L   DRDFL+RN+GHQVKV+ LKGKKI +YFSASWCGPC RFTP L   Y
Sbjct  7    DGVAHDLVSLLTREDRDFLVRNNGHQVKVESLKGKKIWLYFSASWCGPCRRFTPKLVEAY  66

Query  273  NELLPKGNFEVVFVSADEDEESFKEYFGKMPWTAVPFSDSVTRERLDALFTVRGIPHLVI  452
            NEL    +FE++FVS D D+ESF  YF KMPW A+PFSDS  R++L+ LF V GIP+LV+
Sbjct  67   NELSSNDDFEIIFVSGDNDDESFNGYFSKMPWLAIPFSDSDARDQLNELFKVMGIPNLVM  126

Query  453  LDESGKVTTEDGVDIVLEHGVEAYPF  530
            LDESGKV +EDGVDI+ E+GVEAYPF
Sbjct  127  LDESGKVLSEDGVDIIQEYGVEAYPF  152


 Score =   134 bits (337),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 65/145 (45%), Positives = 89/145 (61%), Gaps = 2/145 (1%)
 Frame = +3

Query  99   DAHDLRSILCSSDRDFLIRNSGHQVKVDDLKGKKIGIYFSASWCGPCHRFTPNLATVYNE  278
            +A  L SIL S DRDF+I   G ++ V DL GK I +YFSA WC PC  F P L   Y +
Sbjct  329  EAQTLESILVSGDRDFVIGKDGVKIPVSDLVGKNILLYFSAHWCPPCRAFLPKLIEAYQK  388

Query  279  LLPKGN-FEVVFVSADEDEESFKEYFGKMPWTAVPFSDSVTRERLDALFTVRGIPHLVIL  455
            +  K   FEV+F+S+D+D+ SF E+F  MPW A+PF D   +  L   F V GIP L+ +
Sbjct  389  IKTKDEAFEVIFISSDKDQTSFDEFFSGMPWLALPFGDK-RKASLSRTFKVHGIPSLIAI  447

Query  456  DESGKVTTEDGVDIVLEHGVEAYPF  530
              +G+  T +  ++V+ HG +AYPF
Sbjct  448  GPTGRTVTTEARNLVMIHGADAYPF  472


 Score =   129 bits (324),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 64/143 (45%), Positives = 91/143 (64%), Gaps = 2/143 (1%)
 Frame = +3

Query  105  HDLRSILCSSDRDFLIRNSGHQVKVDDLKGKKIGIYFSASWCGPCHRFTPNLATVYNELL  284
              LRSIL S  RD++I   G +V V +L+GK +G++FS S    C  FTP L  VY +L 
Sbjct  171  QSLRSILVSQSRDYVISTDGKKVPVSELEGKFVGLFFSLSSYKACLEFTPTLVDVYEKLR  230

Query  285  PKG-NFEVVFVSADEDEESFKEYFGKMPWTAVPFSDSVTRERLDALFTVRGIPHLVILDE  461
             KG +FE+V +S D++EESFK+YFG MPW A+PF D  + E+L   F +  +P LV++  
Sbjct  231  AKGESFEIVMISLDDEEESFKKYFGSMPWLALPFRDK-SCEKLARYFELSALPTLVVIGP  289

Query  462  SGKVTTEDGVDIVLEHGVEAYPF  530
             GK    +  + + EHG++AYPF
Sbjct  290  DGKTLHSNVAEAIQEHGIQAYPF  312



>ref|XP_010651402.1| PREDICTED: probable nucleoredoxin 1 [Vitis vinifera]
Length=572

 Score =   212 bits (540),  Expect = 6e-62, Method: Compositional matrix adjust.
 Identities = 98/146 (67%), Positives = 117/146 (80%), Gaps = 0/146 (0%)
 Frame = +3

Query  93   NGDAHDLRSILCSSDRDFLIRNSGHQVKVDDLKGKKIGIYFSASWCGPCHRFTPNLATVY  272
            +G AHDL S+L   DRDFL+RN+GHQVKV+ LKGKKI +YFSASWCGPC RFTP L   Y
Sbjct  7    DGVAHDLVSLLTREDRDFLVRNNGHQVKVESLKGKKIWLYFSASWCGPCRRFTPKLVEAY  66

Query  273  NELLPKGNFEVVFVSADEDEESFKEYFGKMPWTAVPFSDSVTRERLDALFTVRGIPHLVI  452
            NEL    +FE++FVS D D+ESF  YF KMPW A+PFSDS  R++L+ LF V GIP+LV+
Sbjct  67   NELSSNDDFEIIFVSGDNDDESFNGYFSKMPWLAIPFSDSDARDQLNELFKVMGIPNLVM  126

Query  453  LDESGKVTTEDGVDIVLEHGVEAYPF  530
            LDESGKV +EDGVDI+ E+GVEAYPF
Sbjct  127  LDESGKVLSEDGVDIIQEYGVEAYPF  152


 Score =   134 bits (337),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 65/145 (45%), Positives = 89/145 (61%), Gaps = 2/145 (1%)
 Frame = +3

Query  99   DAHDLRSILCSSDRDFLIRNSGHQVKVDDLKGKKIGIYFSASWCGPCHRFTPNLATVYNE  278
            +A  L SIL S DRDF+I   G ++ V DL GK I +YFSA WC PC  F P L   Y +
Sbjct  329  EAQTLESILVSGDRDFVIGKDGVKIPVSDLVGKNILLYFSAHWCPPCRAFLPKLIEAYQK  388

Query  279  LLPKGN-FEVVFVSADEDEESFKEYFGKMPWTAVPFSDSVTRERLDALFTVRGIPHLVIL  455
            +  K   FEV+F+S+D+D+ SF E+F  MPW A+PF D   +  L   F V GIP L+ +
Sbjct  389  IKTKDEAFEVIFISSDKDQTSFDEFFSGMPWLALPFGDK-RKASLSRTFKVHGIPSLIAI  447

Query  456  DESGKVTTEDGVDIVLEHGVEAYPF  530
              +G+  T +  ++V+ HG +AYPF
Sbjct  448  GPTGRTVTTEARNLVMIHGADAYPF  472


 Score =   129 bits (324),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 64/143 (45%), Positives = 91/143 (64%), Gaps = 2/143 (1%)
 Frame = +3

Query  105  HDLRSILCSSDRDFLIRNSGHQVKVDDLKGKKIGIYFSASWCGPCHRFTPNLATVYNELL  284
              LRSIL S  RD++I   G +V V +L+GK +G++FS S    C  FTP L  VY +L 
Sbjct  171  QSLRSILVSQSRDYVISTDGKKVPVSELEGKFVGLFFSLSSYKACLEFTPTLVDVYEKLR  230

Query  285  PKG-NFEVVFVSADEDEESFKEYFGKMPWTAVPFSDSVTRERLDALFTVRGIPHLVILDE  461
             KG +FE+V +S D++EESFK+YFG MPW A+PF D  + E+L   F +  +P LV++  
Sbjct  231  AKGESFEIVMISLDDEEESFKKYFGSMPWLALPFRDK-SCEKLARYFELSALPTLVVIGP  289

Query  462  SGKVTTEDGVDIVLEHGVEAYPF  530
             GK    +  + + EHG++AYPF
Sbjct  290  DGKTLHSNVAEAIQEHGIQAYPF  312



>ref|XP_010023556.1| PREDICTED: probable nucleoredoxin 1 [Eucalyptus grandis]
Length=599

 Score =   213 bits (541),  Expect = 7e-62, Method: Compositional matrix adjust.
 Identities = 100/162 (62%), Positives = 123/162 (76%), Gaps = 3/162 (2%)
 Frame = +3

Query  54   KGEERKASSMA---EQNGDAHDLRSILCSSDRDFLIRNSGHQVKVDDLKGKKIGIYFSAS  224
            K    KA+ MA   E    +HD++S+L S DRDFLIRN+G QVKV+ LKGK IG+YFSAS
Sbjct  7    KNTPAKATRMADDVEGGASSHDVQSLLSSPDRDFLIRNNGDQVKVNSLKGKNIGLYFSAS  66

Query  225  WCGPCHRFTPNLATVYNELLPKGNFEVVFVSADEDEESFKEYFGKMPWTAVPFSDSVTRE  404
            WCGPC +FTP L  VYNEL P+G+ E++F+S+DEDEESF  YF KMPW A+PFSDS  R+
Sbjct  67   WCGPCQQFTPILLEVYNELAPRGDLEIIFISSDEDEESFSGYFSKMPWLAIPFSDSEKRD  126

Query  405  RLDALFTVRGIPHLVILDESGKVTTEDGVDIVLEHGVEAYPF  530
             LD LF VRGIPHLV+LD +G V T+ GV+IV E+G E +PF
Sbjct  127  SLDELFNVRGIPHLVLLDGTGTVLTDSGVEIVREYGEEGHPF  168


 Score =   136 bits (343),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 62/153 (41%), Positives = 94/153 (61%), Gaps = 2/153 (1%)
 Frame = +3

Query  75   SSMAEQNGDAHDLRSILCSSDRDFLIRNSGHQVKVDDLKGKKIGIYFSASWCGPCHRFTP  254
            + + ++  ++  L SIL S D DF+I   G ++ V DL GK + +YFSA WC PC  F P
Sbjct  337  AEIEKKKEESQTLESILVSGDLDFIIGKEGTKIPVSDLIGKTVLLYFSAHWCRPCRAFLP  396

Query  255  NLATVYNELLPKGN-FEVVFVSADEDEESFKEYFGKMPWTAVPFSDSVTRERLDALFTVR  431
             L   Y ++   GN  EV+F+S+D ++ +F +YF +MPW A+PF D   ++ L   F VR
Sbjct  397  VLMEAYEKIKAAGNALEVIFISSDRNQTAFDDYFAQMPWLALPFGDE-RKKSLSGKFKVR  455

Query  432  GIPHLVILDESGKVTTEDGVDIVLEHGVEAYPF  530
            GIP LV +  +G+  T    D++++HG +AYPF
Sbjct  456  GIPMLVAIGPTGRTVTNKARDLIMDHGADAYPF  488


 Score =   110 bits (276),  Expect = 7e-25, Method: Compositional matrix adjust.
 Identities = 59/143 (41%), Positives = 82/143 (57%), Gaps = 2/143 (1%)
 Frame = +3

Query  105  HDLRSILCSSDRDFLIRNSGHQVKVDDLKGKKIGIYFSASWCGPCHRFTPNLATVYNELL  284
              L S+L    RDF++ + G +V V +L+GK +G+YFS S    C  FTP L  VY  L 
Sbjct  187  QSLTSLLVIKTRDFVVSSDGKKVSVSELEGKTVGLYFSLSMSKSCVDFTPKLLEVYKTLK  246

Query  285  PK-GNFEVVFVSADEDEESFKEYFGKMPWTAVPFSDSVTRERLDALFTVRGIPHLVILDE  461
             K  +FE+V +  D+DE SF + FG MPW ++PF D    E+L   F +  +P LVI+ +
Sbjct  247  AKEESFEIVQIPLDDDEASFNQSFGSMPWLSLPFKDK-KWEKLVRYFELSTLPTLVIIGQ  305

Query  462  SGKVTTEDGVDIVLEHGVEAYPF  530
             GK    +    V +HGV AYPF
Sbjct  306  DGKTVHPNVAGTVEKHGVAAYPF  328



>ref|XP_006302027.1| hypothetical protein CARUB_v10020010mg, partial [Capsella rubella]
 gb|EOA34925.1| hypothetical protein CARUB_v10020010mg, partial [Capsella rubella]
Length=602

 Score =   212 bits (540),  Expect = 9e-62, Method: Compositional matrix adjust.
 Identities = 99/156 (63%), Positives = 119/156 (76%), Gaps = 5/156 (3%)
 Frame = +3

Query  78   SMAE-----QNGDAHDLRSILCSSDRDFLIRNSGHQVKVDDLKGKKIGIYFSASWCGPCH  242
            SMAE       GDA DL+S+L S  RDFL+RN G QVK+D L GKKIG+YFSA+WCGPC 
Sbjct  24   SMAEIAKEVNGGDAQDLQSLLSSPARDFLVRNDGEQVKIDSLIGKKIGLYFSAAWCGPCQ  83

Query  243  RFTPNLATVYNELLPKGNFEVVFVSADEDEESFKEYFGKMPWTAVPFSDSVTRERLDALF  422
            RFTP L  VYNEL  K  FE+VFVS DEDEESF +YF KMPW AVPF+DSVTR+RLD  F
Sbjct  84   RFTPQLVEVYNELASKVGFEIVFVSGDEDEESFSDYFSKMPWLAVPFADSVTRDRLDGFF  143

Query  423  TVRGIPHLVILDESGKVTTEDGVDIVLEHGVEAYPF  530
             VRGIP+LV++D+ GK+  E+GV ++  +G +AYPF
Sbjct  144  KVRGIPNLVMVDDHGKLLNENGVGVIRSYGADAYPF  179


 Score =   142 bits (357),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 73/166 (44%), Positives = 102/166 (61%), Gaps = 4/166 (2%)
 Frame = +3

Query  36   FQFSKRKGEERKASSMAEQNGDAHDLRSILCSSDRDFLIRNSGHQVKVDDLKGKKIGIYF  215
            + F+  K EE K    A+   +A  L SIL S D ++++   G +V V DL GK I +YF
Sbjct  337  YPFTPEKFEELKEIEKAKI--EAQTLESILVSGDLNYVLGKDGAKVLVSDLVGKNILMYF  394

Query  216  SASWCGPCHRFTPNLATVYNELLPKGN-FEVVFVSADEDEESFKEYFGKMPWTAVPFSDS  392
            SA WC PC  FTP L  VY ++  +   FE++F+S+D D+ESF EY+ +MPW A+PF D 
Sbjct  395  SAHWCPPCRAFTPKLVEVYKQIKERDEAFELIFISSDRDQESFDEYYSQMPWLALPFGDP  454

Query  393  VTRERLDALFTVRGIPHLVILDESGKVTTEDGVDIVLEHGVEAYPF  530
              +E L   F V GIP L  L ++GK  T++  D+V+ HG +AYPF
Sbjct  455  -RKESLARTFKVGGIPMLAALGQTGKTVTKEARDLVVAHGADAYPF  499


 Score =   101 bits (252),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 53/141 (38%), Positives = 83/141 (59%), Gaps = 2/141 (1%)
 Frame = +3

Query  111  LRSILCSSDRDFLIRNSGHQVKVDDLKGKKIGIYFSASWCGPCHRFTPNLATVYNELLPK  290
            L S+L +  RDF+I   G++V V +L+G+ IG+ FS +    C  FTP L  VY +L  +
Sbjct  200  LSSLLVTPSRDFVISPDGNKVPVSELEGRTIGLLFSVASYSKCREFTPKLVEVYTKLKER  259

Query  291  G-NFEVVFVSADEDEESFKEYFGKMPWTAVPFSDSVTRERLDALFTVRGIPHLVILDESG  467
              +FE+V +S ++DEESF + F   PW A+PF+D  +  +L   F +  +P LVIL   G
Sbjct  260  TEDFEIVLISLEDDEESFNQDFKTKPWLALPFNDK-SSSKLARHFMLSTLPTLVILGPDG  318

Query  468  KVTTEDGVDIVLEHGVEAYPF  530
            K    +  + + ++G+  YPF
Sbjct  319  KTRHMNVAEAIDDYGILPYPF  339



>emb|CBI28542.3| unnamed protein product [Vitis vinifera]
Length=807

 Score =   214 bits (544),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 98/146 (67%), Positives = 117/146 (80%), Gaps = 0/146 (0%)
 Frame = +3

Query  93   NGDAHDLRSILCSSDRDFLIRNSGHQVKVDDLKGKKIGIYFSASWCGPCHRFTPNLATVY  272
            +G AHDL S+L   DRDFL+RN+GHQVKV+ LKGKKI +YFSASWCGPC RFTP L   Y
Sbjct  7    DGVAHDLVSLLTREDRDFLVRNNGHQVKVESLKGKKIWLYFSASWCGPCRRFTPKLVEAY  66

Query  273  NELLPKGNFEVVFVSADEDEESFKEYFGKMPWTAVPFSDSVTRERLDALFTVRGIPHLVI  452
            NEL    +FE++FVS D D+ESF  YF KMPW A+PFSDS  R++L+ LF V GIP+LV+
Sbjct  67   NELSSNDDFEIIFVSGDNDDESFHGYFSKMPWLAIPFSDSDARDQLNELFKVMGIPNLVM  126

Query  453  LDESGKVTTEDGVDIVLEHGVEAYPF  530
            LDESGKV +EDGVDI+ E+GVEAYPF
Sbjct  127  LDESGKVLSEDGVDIIQEYGVEAYPF  152


 Score = 67.8 bits (164),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 34/76 (45%), Positives = 48/76 (63%), Gaps = 1/76 (1%)
 Frame = +3

Query  105  HDLRSILCSSDRDFLIRNSGHQVKVDDLKGKKIGIYFSASWCGPCHRFTPNLATVYNELL  284
              LRSIL S  RD++I   G +V V +L+GK +G++FS S    C  FTP L  VY +L 
Sbjct  171  QSLRSILVSQSRDYVISTDGKKVPVSELEGKFVGLFFSLSSYKACLEFTPTLVDVYEKLR  230

Query  285  PKG-NFEVVFVSADED  329
             KG +FE+V +S D++
Sbjct  231  AKGESFEIVMISLDDE  246



>ref|XP_008221828.1| PREDICTED: probable nucleoredoxin 1 isoform X1 [Prunus mume]
Length=580

 Score =   209 bits (533),  Expect = 6e-61, Method: Compositional matrix adjust.
 Identities = 94/146 (64%), Positives = 117/146 (80%), Gaps = 0/146 (0%)
 Frame = +3

Query  93   NGDAHDLRSILCSSDRDFLIRNSGHQVKVDDLKGKKIGIYFSASWCGPCHRFTPNLATVY  272
            N + HD RS+L SS+RDFL+RN+G Q+KV+ LKGKK+G+YFSASWCGPC +FTP+L   Y
Sbjct  13   NSEPHDFRSLLSSSERDFLVRNNGDQIKVESLKGKKLGLYFSASWCGPCQQFTPSLVEAY  72

Query  273  NELLPKGNFEVVFVSADEDEESFKEYFGKMPWTAVPFSDSVTRERLDALFTVRGIPHLVI  452
            NEL PKG+FEVVF+SADED+ESF  YF KMPW A+PF D   R+R+D LF V GIP LVI
Sbjct  73   NELSPKGDFEVVFISADEDDESFNGYFSKMPWLAIPFFDKKARDRVDKLFKVIGIPCLVI  132

Query  453  LDESGKVTTEDGVDIVLEHGVEAYPF  530
            L E GKV ++ GV+I+ E+GV+ YPF
Sbjct  133  LGEDGKVLSDSGVEIIKEYGVDGYPF  158


 Score =   138 bits (348),  Expect = 6e-35, Method: Compositional matrix adjust.
 Identities = 66/144 (46%), Positives = 92/144 (64%), Gaps = 2/144 (1%)
 Frame = +3

Query  102  AHDLRSILCSSDRDFLIRNSGHQVKVDDLKGKKIGIYFSASWCGPCHRFTPNLATVYNEL  281
            A  L SIL S DR+F+I   G ++ V DL GK I +YFSA WC PC  F P L   Y+++
Sbjct  336  AQTLESILVSGDRNFVIGKGGTEIPVSDLVGKNILLYFSAHWCPPCRAFLPKLVEAYHKI  395

Query  282  LPKGN-FEVVFVSADEDEESFKEYFGKMPWTAVPFSDSVTRERLDALFTVRGIPHLVILD  458
              K + FEV+F+S+D+D+  F E+F  MPW A+PF D + +  L   F VRGIP LV + 
Sbjct  396  KAKDDAFEVIFISSDKDQGDFDEFFSGMPWFALPFGD-LRKASLSRRFKVRGIPMLVAIG  454

Query  459  ESGKVTTEDGVDIVLEHGVEAYPF  530
             +G+  T++  D+V++HG  AYPF
Sbjct  455  PTGQTVTKEARDLVMQHGANAYPF  478


 Score =   117 bits (293),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 67/166 (40%), Positives = 96/166 (58%), Gaps = 4/166 (2%)
 Frame = +3

Query  36   FQFSKRKGEERKASSMAEQNGDAHDLRSILCSSDRDFLIRNSGHQVKVDDLKGKKIGIYF  215
            + F+  K +E K    A +   +  L++IL S  RDF+I N G  V V +L+GK +G+YF
Sbjct  156  YPFTPEKVKELKDQEEAARRNQS--LKTILVSRSRDFVISNDGKNVPVSELEGKIVGLYF  213

Query  216  SASWCGPCHRFTPNLATVYNELLPKG-NFEVVFVSADEDEESFKEYFGKMPWTAVPFSDS  392
            S S    C  FTP L  VY +L   G +F+VV +  D+DEESFK+ F  MPW ++P  D 
Sbjct  214  SLSVYNRCVDFTPKLLEVYEKLKANGESFQVVVIPLDDDEESFKQDFKSMPWFSLPIGDK  273

Query  393  VTRERLDALFTVRGIPHLVILDESGKVTTEDGVDIVLEHGVEAYPF  530
               E+L   F +  +P LVI+   GK  +++  + + EHGV AYPF
Sbjct  274  -NVEKLARYFELSTLPTLVIIGADGKTISKNVAEAIEEHGVLAYPF  318



>emb|CDY60573.1| BnaC01g43180D [Brassica napus]
Length=578

 Score =   209 bits (533),  Expect = 7e-61, Method: Compositional matrix adjust.
 Identities = 95/145 (66%), Positives = 116/145 (80%), Gaps = 0/145 (0%)
 Frame = +3

Query  96   GDAHDLRSILCSSDRDFLIRNSGHQVKVDDLKGKKIGIYFSASWCGPCHRFTPNLATVYN  275
            GDA DL S+L S  RDFLIR +G QVK+D LKGKKIG+YFSA+WCGPC RFTP L  +YN
Sbjct  11   GDARDLHSLLFSPARDFLIRKNGEQVKIDSLKGKKIGLYFSAAWCGPCQRFTPQLVEIYN  70

Query  276  ELLPKGNFEVVFVSADEDEESFKEYFGKMPWTAVPFSDSVTRERLDALFTVRGIPHLVIL  455
            EL  K  FEVVFVS DEDE+SFK+YF KMPW AVPF+DS TR+RLD +F VRGIP+LV++
Sbjct  71   ELSSKVGFEVVFVSGDEDEDSFKDYFSKMPWLAVPFTDSETRDRLDEVFKVRGIPNLVMI  130

Query  456  DESGKVTTEDGVDIVLEHGVEAYPF  530
            D+ GK+  E+GV ++  +G +AYPF
Sbjct  131  DDEGKLVNENGVGVIRSYGADAYPF  155


 Score =   137 bits (345),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 72/166 (43%), Positives = 100/166 (60%), Gaps = 4/166 (2%)
 Frame = +3

Query  36   FQFSKRKGEERKASSMAEQNGDAHDLRSILCSSDRDFLIRNSGHQVKVDDLKGKKIGIYF  215
            + F+  K EE KA   A+   +A  L S+L S D ++++   G +V V +L GK I +YF
Sbjct  313  YPFTPEKFEELKAIEKAKL--EAQTLESLLVSGDLNYVLGKDGAKVLVSELVGKNILLYF  370

Query  216  SASWCGPCHRFTPNLATVYNELLPKGN-FEVVFVSADEDEESFKEYFGKMPWTAVPFSDS  392
            SA WC PC  FTP L  VY ++  K   FE++F+S+D D+ESF EY+ +MPW A+PF D 
Sbjct  371  SAHWCPPCRAFTPKLVEVYKQIKEKDEAFELIFISSDRDQESFDEYYSQMPWLALPFGDP  430

Query  393  VTRERLDALFTVRGIPHLVILDESGKVTTEDGVDIVLEHGVEAYPF  530
              +  L   F V GIP L  L  +GK  T++  D+V  HG +AYPF
Sbjct  431  -RKTSLARTFKVGGIPMLAALGPTGKTVTKEARDLVGAHGADAYPF  475


 Score =   102 bits (253),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 54/141 (38%), Positives = 84/141 (60%), Gaps = 2/141 (1%)
 Frame = +3

Query  111  LRSILCSSDRDFLIRNSGHQVKVDDLKGKKIGIYFSASWCGPCHRFTPNLATVYNELLPK  290
            L+S+L +  RDF+I   G++V V +L+GK IG+ FS +    C  FT  L  VY +L   
Sbjct  176  LKSVLVTPSRDFVITRDGNKVPVSELEGKTIGLLFSVASYRQCKEFTSKLEEVYKKLKEN  235

Query  291  G-NFEVVFVSADEDEESFKEYFGKMPWTAVPFSDSVTRERLDALFTVRGIPHLVILDESG  467
              +FE+V +S ++DE++FK+ F   PW A+PF+D  +  +L   F +  +P LVIL   G
Sbjct  236  NEDFEIVLISLEDDEDAFKQDFDTNPWLALPFNDK-SSSKLTRHFMLSTLPTLVILGPDG  294

Query  468  KVTTEDGVDIVLEHGVEAYPF  530
            K    +  + + ++GV AYPF
Sbjct  295  KTRHSNVAEAIDDYGVVAYPF  315



>ref|XP_006392168.1| hypothetical protein EUTSA_v10023374mg [Eutrema salsugineum]
 gb|ESQ29454.1| hypothetical protein EUTSA_v10023374mg [Eutrema salsugineum]
Length=579

 Score =   209 bits (533),  Expect = 7e-61, Method: Compositional matrix adjust.
 Identities = 96/154 (62%), Positives = 119/154 (77%), Gaps = 1/154 (1%)
 Frame = +3

Query  72   ASSMAEQNG-DAHDLRSILCSSDRDFLIRNSGHQVKVDDLKGKKIGIYFSASWCGPCHRF  248
            A    E NG DA +L S+L S  RDFL+RN G QVK+D LKGKKIG+YFSA+WCGPC RF
Sbjct  2    AEFAKEVNGSDAQNLHSLLSSPARDFLVRNDGEQVKIDSLKGKKIGLYFSAAWCGPCQRF  61

Query  249  TPNLATVYNELLPKGNFEVVFVSADEDEESFKEYFGKMPWTAVPFSDSVTRERLDALFTV  428
            TP L  VYNEL PK  FEV+FVS DEDEESF++YF KMPW AVPF+DS TR+RLD LF V
Sbjct  62   TPQLMEVYNELSPKVGFEVIFVSGDEDEESFRDYFTKMPWLAVPFTDSETRDRLDQLFKV  121

Query  429  RGIPHLVILDESGKVTTEDGVDIVLEHGVEAYPF  530
            +GIP+LV++D+ G +  E+G+ ++  +G +AYPF
Sbjct  122  KGIPYLVMVDDHGNLLNENGIGVIRSYGADAYPF  155


 Score =   139 bits (351),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 73/166 (44%), Positives = 100/166 (60%), Gaps = 4/166 (2%)
 Frame = +3

Query  36   FQFSKRKGEERKASSMAEQNGDAHDLRSILCSSDRDFLIRNSGHQVKVDDLKGKKIGIYF  215
            + F+  K EE KA   A+   DA  L S+L S D ++++   G +V V DL GK I +YF
Sbjct  313  YPFAPEKFEELKAIEKAKT--DAQTLESLLVSGDLNYVLGKDGAKVLVSDLVGKNILLYF  370

Query  216  SASWCGPCHRFTPNLATVYNELLPKGN-FEVVFVSADEDEESFKEYFGKMPWTAVPFSDS  392
            SA WC PC  FTP L  VY ++  +   FE++F+S+D D+ESF EY+ +MPW A+PF D 
Sbjct  371  SAHWCPPCRAFTPKLVEVYKQIKERDEAFELIFISSDRDQESFDEYYSQMPWLALPFGDP  430

Query  393  VTRERLDALFTVRGIPHLVILDESGKVTTEDGVDIVLEHGVEAYPF  530
              +  L   F V GIP L  +  SGK  T++  D+V  HG +AYPF
Sbjct  431  -RKTSLARTFKVGGIPMLAAVGPSGKTVTKEARDLVGAHGADAYPF  475


 Score =   112 bits (281),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 59/141 (42%), Positives = 88/141 (62%), Gaps = 2/141 (1%)
 Frame = +3

Query  111  LRSILCSSDRDFLIRNSGHQVKVDDLKGKKIGIYFSASWCGPCHRFTPNLATVYNELLPK  290
            L+S+L +  RDF+I   G++V V +L+GK IG+ FS +    C  FTP L  VYN+L   
Sbjct  176  LKSVLVTPSRDFVISRDGNKVPVSELEGKTIGLLFSVATYRRCMEFTPKLIEVYNKLKEN  235

Query  291  G-NFEVVFVSADEDEESFKEYFGKMPWTAVPFSDSVTRERLDALFTVRGIPHLVILDESG  467
            G +FE+V +S ++DEESFK+ F   PW A+PF+D  +  +L   F +  +P LVIL   G
Sbjct  236  GEDFEIVLISLEDDEESFKQDFETKPWLALPFNDK-SSSKLARHFMLSTLPTLVILGPDG  294

Query  468  KVTTEDGVDIVLEHGVEAYPF  530
            K+   +  + + ++GV AYPF
Sbjct  295  KIRHSNVAEAIDDYGVLAYPF  315



>gb|KCW59854.1| hypothetical protein EUGRSUZ_H02593 [Eucalyptus grandis]
Length=584

 Score =   209 bits (532),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 95/148 (64%), Positives = 117/148 (79%), Gaps = 0/148 (0%)
 Frame = +3

Query  87   EQNGDAHDLRSILCSSDRDFLIRNSGHQVKVDDLKGKKIGIYFSASWCGPCHRFTPNLAT  266
            E    +HD++S+L S DRDFLIRN+G QVKV+ LKGK IG+YFSASWCGPC +FTP L  
Sbjct  6    EGGASSHDVQSLLSSPDRDFLIRNNGDQVKVNSLKGKNIGLYFSASWCGPCQQFTPILLE  65

Query  267  VYNELLPKGNFEVVFVSADEDEESFKEYFGKMPWTAVPFSDSVTRERLDALFTVRGIPHL  446
            VYNEL P+G+ E++F+S+DEDEESF  YF KMPW A+PFSDS  R+ LD LF VRGIPHL
Sbjct  66   VYNELAPRGDLEIIFISSDEDEESFSGYFSKMPWLAIPFSDSEKRDSLDELFNVRGIPHL  125

Query  447  VILDESGKVTTEDGVDIVLEHGVEAYPF  530
            V+LD +G V T+ GV+IV E+G E +PF
Sbjct  126  VLLDGTGTVLTDSGVEIVREYGEEGHPF  153


 Score =   135 bits (341),  Expect = 5e-34, Method: Compositional matrix adjust.
 Identities = 62/153 (41%), Positives = 94/153 (61%), Gaps = 2/153 (1%)
 Frame = +3

Query  75   SSMAEQNGDAHDLRSILCSSDRDFLIRNSGHQVKVDDLKGKKIGIYFSASWCGPCHRFTP  254
            + + ++  ++  L SIL S D DF+I   G ++ V DL GK + +YFSA WC PC  F P
Sbjct  322  AEIEKKKEESQTLESILVSGDLDFIIGKEGTKIPVSDLIGKTVLLYFSAHWCRPCRAFLP  381

Query  255  NLATVYNELLPKGN-FEVVFVSADEDEESFKEYFGKMPWTAVPFSDSVTRERLDALFTVR  431
             L   Y ++   GN  EV+F+S+D ++ +F +YF +MPW A+PF D   ++ L   F VR
Sbjct  382  VLMEAYEKIKAAGNALEVIFISSDRNQTAFDDYFAQMPWLALPFGDE-RKKSLSGKFKVR  440

Query  432  GIPHLVILDESGKVTTEDGVDIVLEHGVEAYPF  530
            GIP LV +  +G+  T    D++++HG +AYPF
Sbjct  441  GIPMLVAIGPTGRTVTNKARDLIMDHGADAYPF  473


 Score =   110 bits (275),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 59/143 (41%), Positives = 82/143 (57%), Gaps = 2/143 (1%)
 Frame = +3

Query  105  HDLRSILCSSDRDFLIRNSGHQVKVDDLKGKKIGIYFSASWCGPCHRFTPNLATVYNELL  284
              L S+L    RDF++ + G +V V +L+GK +G+YFS S    C  FTP L  VY  L 
Sbjct  172  QSLTSLLVIKTRDFVVSSDGKKVSVSELEGKTVGLYFSLSMSKSCVDFTPKLLEVYKTLK  231

Query  285  PK-GNFEVVFVSADEDEESFKEYFGKMPWTAVPFSDSVTRERLDALFTVRGIPHLVILDE  461
             K  +FE+V +  D+DE SF + FG MPW ++PF D    E+L   F +  +P LVI+ +
Sbjct  232  AKEESFEIVQIPLDDDEASFNQSFGSMPWLSLPFKDK-KWEKLVRYFELSTLPTLVIIGQ  290

Query  462  SGKVTTEDGVDIVLEHGVEAYPF  530
             GK    +    V +HGV AYPF
Sbjct  291  DGKTVHPNVAGTVEKHGVAAYPF  313



>gb|AAM64945.1| PDI-like protein [Arabidopsis thaliana]
Length=578

 Score =   209 bits (531),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 98/154 (64%), Positives = 118/154 (77%), Gaps = 1/154 (1%)
 Frame = +3

Query  72   ASSMAEQNGD-AHDLRSILCSSDRDFLIRNSGHQVKVDDLKGKKIGIYFSASWCGPCHRF  248
            A +  + NGD A DL S+L S  RDFL+RN G QVKVD L GKKIG+YFSA+WCGPC RF
Sbjct  2    AETSKQVNGDDAQDLHSLLSSPARDFLVRNDGEQVKVDSLLGKKIGLYFSAAWCGPCQRF  61

Query  249  TPNLATVYNELLPKGNFEVVFVSADEDEESFKEYFGKMPWTAVPFSDSVTRERLDALFTV  428
            TP L  VYNEL  K  FE+VFVS DEDEESF +YF KMPW AVPF+DS TR+RLD LF V
Sbjct  62   TPQLVEVYNELSSKVGFEIVFVSGDEDEESFGDYFSKMPWLAVPFTDSETRDRLDELFKV  121

Query  429  RGIPHLVILDESGKVTTEDGVDIVLEHGVEAYPF  530
            RGIP+LV++D+ GK+  E+GV ++  +G +AYPF
Sbjct  122  RGIPNLVMVDDHGKLVNENGVGVIRSYGADAYPF  155


 Score =   136 bits (342),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 68/166 (41%), Positives = 100/166 (60%), Gaps = 4/166 (2%)
 Frame = +3

Query  36   FQFSKRKGEERKASSMAEQNGDAHDLRSILCSSDRDFLIRNSGHQVKVDDLKGKKIGIYF  215
            + F+  K +E K   + +   +A  L S+L S D ++++   G +V V DL GK I +YF
Sbjct  313  YPFTPEKFQELK--ELEKAKVEAQTLESLLVSGDLNYVLGKDGAKVLVSDLVGKTILMYF  370

Query  216  SASWCGPCHRFTPNLATVYNELLPKGN-FEVVFVSADEDEESFKEYFGKMPWTAVPFSDS  392
            SA WC PC  FTP L  VY ++  +   FE++F+S+D D+ESF EY+ +MPW A+PF D 
Sbjct  371  SAHWCPPCRAFTPKLVEVYKQIKERNEAFELIFISSDRDQESFDEYYSQMPWLALPFGDP  430

Query  393  VTRERLDALFTVRGIPHLVILDESGKVTTEDGVDIVLEHGVEAYPF  530
              +  L   F V GIP L  L  +G+  T++  D+V+ HG +AYPF
Sbjct  431  -RKASLAKTFKVGGIPMLAALGPTGQTVTKEARDLVVAHGADAYPF  475


 Score =   104 bits (259),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 56/141 (40%), Positives = 84/141 (60%), Gaps = 2/141 (1%)
 Frame = +3

Query  111  LRSILCSSDRDFLIRNSGHQVKVDDLKGKKIGIYFSASWCGPCHRFTPNLATVYNELLP-  287
            LRS+L +  RDF+I   G++V V +L+GK IG+ FS +    C   TP L   Y +L   
Sbjct  176  LRSVLVTPSRDFVISPDGNKVPVSELEGKTIGLLFSVASYRKCTELTPKLVEFYTKLKEN  235

Query  288  KGNFEVVFVSADEDEESFKEYFGKMPWTAVPFSDSVTRERLDALFTVRGIPHLVILDESG  467
            K +FE+V +S ++DEESF + F   PW A+PF+D  +  +L   F +  +P LVIL   G
Sbjct  236  KEDFEIVLISLEDDEESFNQDFKTKPWLALPFNDK-SGSKLARHFMLSTLPTLVILGPDG  294

Query  468  KVTTEDGVDIVLEHGVEAYPF  530
            K+   +  + + ++GV AYPF
Sbjct  295  KIRHSNVAEAIDDYGVLAYPF  315



>ref|XP_009103743.1| PREDICTED: probable nucleoredoxin 1 [Brassica rapa]
Length=578

 Score =   209 bits (531),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 94/145 (65%), Positives = 116/145 (80%), Gaps = 0/145 (0%)
 Frame = +3

Query  96   GDAHDLRSILCSSDRDFLIRNSGHQVKVDDLKGKKIGIYFSASWCGPCHRFTPNLATVYN  275
            GDA DL S+L S  RDFLIRN+G QVK++ LKGKKIG+YFSA+WCGPC RFTP L  +YN
Sbjct  11   GDARDLHSLLSSPARDFLIRNNGEQVKIESLKGKKIGLYFSAAWCGPCQRFTPQLVDIYN  70

Query  276  ELLPKGNFEVVFVSADEDEESFKEYFGKMPWTAVPFSDSVTRERLDALFTVRGIPHLVIL  455
            EL     FEVVFVS DEDE+SFK+YF KMPW AVPF+DS TR+RLD +F VRGIP+LV++
Sbjct  71   ELSSNVGFEVVFVSGDEDEDSFKDYFSKMPWLAVPFTDSETRDRLDEVFKVRGIPNLVMI  130

Query  456  DESGKVTTEDGVDIVLEHGVEAYPF  530
            D+ GK+  E+GV ++  +G +AYPF
Sbjct  131  DDEGKLVNENGVGVIRSYGADAYPF  155


 Score =   136 bits (343),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 72/166 (43%), Positives = 100/166 (60%), Gaps = 4/166 (2%)
 Frame = +3

Query  36   FQFSKRKGEERKASSMAEQNGDAHDLRSILCSSDRDFLIRNSGHQVKVDDLKGKKIGIYF  215
            + F+  K EE KA   A+   +A  L S+L S D ++++   G +V V +L GK I +YF
Sbjct  313  YPFTPEKFEELKAIEKAKL--EAQTLESLLVSGDLNYVLGKDGAKVLVSELVGKNILLYF  370

Query  216  SASWCGPCHRFTPNLATVYNELLPKGN-FEVVFVSADEDEESFKEYFGKMPWTAVPFSDS  392
            SA WC PC  FTP L  VY ++  K   FE++F+S+D D+ESF EY+ +MPW A+PF D 
Sbjct  371  SAHWCPPCRGFTPKLVEVYKQIKEKDEAFELIFISSDRDQESFDEYYSQMPWLALPFGDP  430

Query  393  VTRERLDALFTVRGIPHLVILDESGKVTTEDGVDIVLEHGVEAYPF  530
              +  L   F V GIP L  L  +GK  T++  D+V  HG +AYPF
Sbjct  431  -RKTSLARTFKVGGIPMLAALGPTGKTVTKEARDLVGAHGADAYPF  475


 Score =   103 bits (257),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 56/141 (40%), Positives = 83/141 (59%), Gaps = 2/141 (1%)
 Frame = +3

Query  111  LRSILCSSDRDFLIRNSGHQVKVDDLKGKKIGIYFSASWCGPCHRFTPNLATVYNELLPK  290
            LRS+L +  RDF+I   G++V V  L+GK IG+ FS +    C  FT  L  VY +L   
Sbjct  176  LRSVLVTPSRDFVITRDGNKVPVSQLEGKTIGLLFSVASYRQCKEFTSKLEEVYKKLKEN  235

Query  291  G-NFEVVFVSADEDEESFKEYFGKMPWTAVPFSDSVTRERLDALFTVRGIPHLVILDESG  467
              +FE+V +S ++DEE+FK+ F   PW A+PF+D  +  +L   F +  +P LVIL   G
Sbjct  236  NEDFEIVLISLEDDEEAFKQDFETNPWLALPFNDK-SSSKLTRHFMLSTLPTLVILGPDG  294

Query  468  KVTTEDGVDIVLEHGVEAYPF  530
            K    +  + + ++GV AYPF
Sbjct  295  KTRHSNVAEAIDDYGVVAYPF  315



>emb|CDY24527.1| BnaA01g22310D [Brassica napus]
Length=578

 Score =   208 bits (530),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 94/145 (65%), Positives = 116/145 (80%), Gaps = 0/145 (0%)
 Frame = +3

Query  96   GDAHDLRSILCSSDRDFLIRNSGHQVKVDDLKGKKIGIYFSASWCGPCHRFTPNLATVYN  275
            GDA DL S+L S  RDFLIRN+G QVK++ LKGKKIG+YFSA+WCGPC RFTP L  +YN
Sbjct  11   GDARDLHSLLSSPARDFLIRNNGEQVKIESLKGKKIGLYFSAAWCGPCQRFTPQLVDIYN  70

Query  276  ELLPKGNFEVVFVSADEDEESFKEYFGKMPWTAVPFSDSVTRERLDALFTVRGIPHLVIL  455
            EL     FEVVFVS DEDE+SFK+YF KMPW AVPF+DS TR+RLD +F VRGIP+LV++
Sbjct  71   ELSSNVGFEVVFVSGDEDEDSFKDYFSKMPWLAVPFTDSETRDRLDEVFKVRGIPNLVMI  130

Query  456  DESGKVTTEDGVDIVLEHGVEAYPF  530
            D+ GK+  E+GV ++  +G +AYPF
Sbjct  131  DDEGKLVNENGVGVIRSYGADAYPF  155


 Score =   135 bits (340),  Expect = 7e-34, Method: Compositional matrix adjust.
 Identities = 71/166 (43%), Positives = 100/166 (60%), Gaps = 4/166 (2%)
 Frame = +3

Query  36   FQFSKRKGEERKASSMAEQNGDAHDLRSILCSSDRDFLIRNSGHQVKVDDLKGKKIGIYF  215
            + F+  K EE KA  + +   +A  L S+L S D ++++   G +V V +L GK I +YF
Sbjct  313  YPFTPEKFEELKA--IEKGKLEAQTLESLLVSGDLNYVLGKDGAKVLVSELVGKNILLYF  370

Query  216  SASWCGPCHRFTPNLATVYNELLPKGN-FEVVFVSADEDEESFKEYFGKMPWTAVPFSDS  392
            SA WC PC  FTP L  VY ++  K   FE++F+S+D D+ESF EY+ +MPW A+PF D 
Sbjct  371  SAHWCPPCRGFTPKLVEVYKQIKEKDEAFELIFISSDRDQESFDEYYSQMPWLALPFGDP  430

Query  393  VTRERLDALFTVRGIPHLVILDESGKVTTEDGVDIVLEHGVEAYPF  530
              +  L   F V GIP L  L  +GK  T++  D+V  HG +AYPF
Sbjct  431  -RKTSLARTFKVGGIPMLAALGPTGKTVTKEARDLVGAHGADAYPF  475


 Score =   103 bits (258),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 56/141 (40%), Positives = 83/141 (59%), Gaps = 2/141 (1%)
 Frame = +3

Query  111  LRSILCSSDRDFLIRNSGHQVKVDDLKGKKIGIYFSASWCGPCHRFTPNLATVYNELLPK  290
            LRS+L +  RDF+I   G++V V  L+GK IG+ FS +    C  FT  L  VY +L   
Sbjct  176  LRSVLVTPSRDFVITRDGNKVPVSQLEGKTIGLLFSVASYRQCKEFTSKLEEVYQKLKEN  235

Query  291  G-NFEVVFVSADEDEESFKEYFGKMPWTAVPFSDSVTRERLDALFTVRGIPHLVILDESG  467
              +FE+V +S ++DEE+FK+ F   PW A+PF+D  +  +L   F +  +P LVIL   G
Sbjct  236  NEDFEIVLISLEDDEEAFKQDFETNPWLALPFNDK-SSSKLTRHFMLSTLPTLVILGPDG  294

Query  468  KVTTEDGVDIVLEHGVEAYPF  530
            K    +  + + ++GV AYPF
Sbjct  295  KTRHSNVAEAIDDYGVVAYPF  315



>ref|NP_564756.1| protein reduce transmission through pollen [Arabidopsis thaliana]
 sp|O80763.1|NRX1_ARATH RecName: Full=Probable nucleoredoxin 1; Short=AtNrx1 [Arabidopsis 
thaliana]
 gb|AAC24068.1| Similar to red-1 (related to thioredoxin) gene gb|X92750 from 
Mus musculus. ESTs gb|AA712687 and gb|Z37223 come from this 
gene [Arabidopsis thaliana]
 gb|AAL38874.1| unknown protein [Arabidopsis thaliana]
 gb|AAM51306.1| unknown protein [Arabidopsis thaliana]
 gb|AEE33684.1| protein reduce transmission through pollen [Arabidopsis thaliana]
Length=578

 Score =   208 bits (529),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 98/154 (64%), Positives = 118/154 (77%), Gaps = 1/154 (1%)
 Frame = +3

Query  72   ASSMAEQNGD-AHDLRSILCSSDRDFLIRNSGHQVKVDDLKGKKIGIYFSASWCGPCHRF  248
            A +  + NGD A DL S+L S  RDFL+RN G QVKVD L GKKIG+YFSA+WCGPC RF
Sbjct  2    AETSKQVNGDDAQDLHSLLSSPARDFLVRNDGEQVKVDSLLGKKIGLYFSAAWCGPCQRF  61

Query  249  TPNLATVYNELLPKGNFEVVFVSADEDEESFKEYFGKMPWTAVPFSDSVTRERLDALFTV  428
            TP L  VYNEL  K  FE+VFVS DEDEESF +YF KMPW AVPF+DS TR+RLD LF V
Sbjct  62   TPQLVEVYNELSSKVGFEIVFVSGDEDEESFGDYFRKMPWLAVPFTDSETRDRLDELFKV  121

Query  429  RGIPHLVILDESGKVTTEDGVDIVLEHGVEAYPF  530
            RGIP+LV++D+ GK+  E+GV ++  +G +AYPF
Sbjct  122  RGIPNLVMVDDHGKLVNENGVGVIRSYGADAYPF  155


 Score =   135 bits (341),  Expect = 5e-34, Method: Compositional matrix adjust.
 Identities = 68/166 (41%), Positives = 100/166 (60%), Gaps = 4/166 (2%)
 Frame = +3

Query  36   FQFSKRKGEERKASSMAEQNGDAHDLRSILCSSDRDFLIRNSGHQVKVDDLKGKKIGIYF  215
            + F+  K +E K   + +   +A  L S+L S D ++++   G +V V DL GK I +YF
Sbjct  313  YPFTPEKFQELK--ELEKAKVEAQTLESLLVSGDLNYVLGKDGAKVLVSDLVGKTILMYF  370

Query  216  SASWCGPCHRFTPNLATVYNELLPKGN-FEVVFVSADEDEESFKEYFGKMPWTAVPFSDS  392
            SA WC PC  FTP L  VY ++  +   FE++F+S+D D+ESF EY+ +MPW A+PF D 
Sbjct  371  SAHWCPPCRAFTPKLVEVYKQIKERNEAFELIFISSDRDQESFDEYYSQMPWLALPFGDP  430

Query  393  VTRERLDALFTVRGIPHLVILDESGKVTTEDGVDIVLEHGVEAYPF  530
              +  L   F V GIP L  L  +G+  T++  D+V+ HG +AYPF
Sbjct  431  -RKASLAKTFKVGGIPMLAALGPTGQTVTKEARDLVVAHGADAYPF  475


 Score =   104 bits (259),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 61/166 (37%), Positives = 92/166 (55%), Gaps = 4/166 (2%)
 Frame = +3

Query  36   FQFSKRKGEERKASSMAEQNGDAHDLRSILCSSDRDFLIRNSGHQVKVDDLKGKKIGIYF  215
            + F+  K +E K      + G    LRS+L +  RDF+I   G++V V +L+GK IG+ F
Sbjct  153  YPFTPEKMKEIKEDEDRARRGQT--LRSVLVTPSRDFVISPDGNKVPVSELEGKTIGLLF  210

Query  216  SASWCGPCHRFTPNLATVYNELLP-KGNFEVVFVSADEDEESFKEYFGKMPWTAVPFSDS  392
            S +    C   TP L   Y +L   K +FE+V +S ++DEESF + F   PW A+PF+D 
Sbjct  211  SVASYRKCTELTPKLVEFYTKLKENKEDFEIVLISLEDDEESFNQDFKTKPWLALPFNDK  270

Query  393  VTRERLDALFTVRGIPHLVILDESGKVTTEDGVDIVLEHGVEAYPF  530
             +  +L   F +  +P LVIL   GK    +  + + ++GV AYPF
Sbjct  271  -SGSKLARHFMLSTLPTLVILGPDGKTRHSNVAEAIDDYGVLAYPF  315



>emb|CBI28535.3| unnamed protein product [Vitis vinifera]
Length=617

 Score =   208 bits (530),  Expect = 4e-60, Method: Compositional matrix adjust.
 Identities = 95/148 (64%), Positives = 117/148 (79%), Gaps = 0/148 (0%)
 Frame = +3

Query  87   EQNGDAHDLRSILCSSDRDFLIRNSGHQVKVDDLKGKKIGIYFSASWCGPCHRFTPNLAT  266
            E     HD+ S+L S +RD+LIRN+G+QVK+  L+GKKIG+YFSASWCGPC RFTP L  
Sbjct  82   EDGSAVHDVVSVLSSPNRDYLIRNNGNQVKITSLRGKKIGLYFSASWCGPCRRFTPELVE  141

Query  267  VYNELLPKGNFEVVFVSADEDEESFKEYFGKMPWTAVPFSDSVTRERLDALFTVRGIPHL  446
            VYN L  KG+FE+ FVSADED+E FKEYF +MPW A+PFSDS TR+ LD LF V GIPHL
Sbjct  142  VYNGLSLKGDFEITFVSADEDDEMFKEYFSEMPWLAIPFSDSDTRDHLDELFRVSGIPHL  201

Query  447  VILDESGKVTTEDGVDIVLEHGVEAYPF  530
            VI+ E+GKV T+ GV+I+ E+GVE +PF
Sbjct  202  VIIGENGKVLTDSGVEIIREYGVEGFPF  229


 Score =   140 bits (354),  Expect = 9e-36, Method: Compositional matrix adjust.
 Identities = 71/166 (43%), Positives = 101/166 (61%), Gaps = 4/166 (2%)
 Frame = +3

Query  36   FQFSKRKGEERKASSMAEQNGDAHDLRSILCSSDRDFLIRNSGHQVKVDDLKGKKIGIYF  215
            + F+  K  E +    A+Q  +A  L SIL S +RD+LI   G +V V DL GK I +YF
Sbjct  387  YPFTPAKFAELEEIEKAKQ--EAQTLESILVSGNRDYLIGKHGVKVPVSDLVGKNILLYF  444

Query  216  SASWCGPCHRFTPNLATVYNELLPK-GNFEVVFVSADEDEESFKEYFGKMPWTAVPFSDS  392
            SA WC PC  F P L   Y+++  K   FEV+F+S+D D+ SF ++F +MPW A+PF D 
Sbjct  445  SAHWCSPCRAFLPKLTDAYHKIKAKDSGFEVIFISSDRDQTSFDDFFSEMPWLALPFGDE  504

Query  393  VTRERLDALFTVRGIPHLVILDESGKVTTEDGVDIVLEHGVEAYPF  530
              +E L  +F V+GIP +V +  +G+  T    D+V +HG +AYPF
Sbjct  505  -RKESLSKMFKVQGIPKVVAIGPTGRTITTQARDLVADHGADAYPF  549


 Score =   112 bits (279),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 64/163 (39%), Positives = 96/163 (59%), Gaps = 5/163 (3%)
 Frame = +3

Query  45   SKRKGEERKASSMAEQNGDAHDLRSILCSSDRDFLIRNSGHQVKVDDLKGKKIGIYFSAS  224
            S+R  E ++   +A++      LRSIL S  RDF+I  +G +V +  L+G+ +G+YFS S
Sbjct  231  SERIKELKEQEEVAKRE---QSLRSILVSDSRDFVISANGMKVPISKLEGRLVGLYFSLS  287

Query  225  WCGPCHRFTPNLATVYNELLPKG-NFEVVFVSADEDEESFKEYFGKMPWTAVPFSDSVTR  401
                C  FT  L  VY ++   G +FE+V +S D+DEESF E FG MP  A+PF D   R
Sbjct  288  SYKLCVDFTSKLVDVYAKVKAMGESFEIVLISFDDDEESFNEGFGSMPCFALPFKDESCR  347

Query  402  ERLDALFTVRGIPHLVILDESGKVTTEDGVDIVLEHGVEAYPF  530
             +L   F +  +P LV++   GK    + V+ + E+G++AYPF
Sbjct  348  -KLARYFELSTVPTLVMIGPDGKTLHSNVVEAIEEYGIQAYPF  389



>emb|CCD74518.1| putative nucleoredoxin 1 [Arabidopsis halleri subsp. halleri]
Length=578

 Score =   207 bits (527),  Expect = 5e-60, Method: Compositional matrix adjust.
 Identities = 94/152 (62%), Positives = 116/152 (76%), Gaps = 0/152 (0%)
 Frame = +3

Query  75   SSMAEQNGDAHDLRSILCSSDRDFLIRNSGHQVKVDDLKGKKIGIYFSASWCGPCHRFTP  254
            +S     GD+ DL S+L S  RDFL+RN G QVK+D L GKKIG+YFSA+WCGPC RFTP
Sbjct  4    TSKVVNGGDSQDLHSLLSSPARDFLVRNDGEQVKIDSLIGKKIGLYFSAAWCGPCQRFTP  63

Query  255  NLATVYNELLPKGNFEVVFVSADEDEESFKEYFGKMPWTAVPFSDSVTRERLDALFTVRG  434
             L  VYNEL  K  FE+VFVS DEDEESF +YF KMPW AVPF+DS +R+RLD LF VRG
Sbjct  64   QLVEVYNELSSKVGFEIVFVSGDEDEESFGDYFSKMPWLAVPFTDSESRDRLDELFKVRG  123

Query  435  IPHLVILDESGKVTTEDGVDIVLEHGVEAYPF  530
            IP+LV++D+ GK+  E+GV ++  +G +AYPF
Sbjct  124  IPNLVMVDDHGKLVNENGVGVIRSYGADAYPF  155


 Score =   140 bits (354),  Expect = 8e-36, Method: Compositional matrix adjust.
 Identities = 73/166 (44%), Positives = 100/166 (60%), Gaps = 4/166 (2%)
 Frame = +3

Query  36   FQFSKRKGEERKASSMAEQNGDAHDLRSILCSSDRDFLIRNSGHQVKVDDLKGKKIGIYF  215
            + F+  K EE K    A+   +A  L S+L S D ++++   G +V + DL GK I IYF
Sbjct  313  YPFTPEKFEELKEIEKAKV--EAQTLESLLVSGDLNYVLGKDGAKVLISDLVGKNILIYF  370

Query  216  SASWCGPCHRFTPNLATVYNELLPKGN-FEVVFVSADEDEESFKEYFGKMPWTAVPFSDS  392
            SA WC PC  FTP L  VY ++  +   FE++F+S D D+ESF EY+ +MPW A+PF DS
Sbjct  371  SAHWCPPCRTFTPKLVEVYKQIKERDEAFELIFISNDRDQESFDEYYSQMPWLALPFGDS  430

Query  393  VTRERLDALFTVRGIPHLVILDESGKVTTEDGVDIVLEHGVEAYPF  530
              +  L   F V GIP L  L  +GK  T++  D+V+ HG EAYPF
Sbjct  431  -RKTSLARTFKVGGIPMLAALGPTGKTVTKEARDLVVAHGAEAYPF  475


 Score =   102 bits (255),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 56/141 (40%), Positives = 83/141 (59%), Gaps = 2/141 (1%)
 Frame = +3

Query  111  LRSILCSSDRDFLIRNSGHQVKVDDLKGKKIGIYFSASWCGPCHRFTPNLATVYNELLP-  287
            LRS+L +  RDF+I   G++V V +L+GK IG+ FS +    C  FTP L   Y +L   
Sbjct  176  LRSVLVTPSRDFVISPDGNKVPVSELEGKTIGLLFSVASYRKCTEFTPKLVEFYTKLKEN  235

Query  288  KGNFEVVFVSADEDEESFKEYFGKMPWTAVPFSDSVTRERLDALFTVRGIPHLVILDESG  467
            K +FE+V +S D+DEESF + F   PW ++ F+D  +  +L   F +  +P LVIL   G
Sbjct  236  KEDFEIVLISLDDDEESFNQEFKTKPWLSLLFNDK-SASKLARHFMLATVPTLVILGPDG  294

Query  468  KVTTEDGVDIVLEHGVEAYPF  530
            K    +  + + ++GV AYPF
Sbjct  295  KTRHSNVAEAIDDYGVLAYPF  315



>ref|XP_010417977.1| PREDICTED: probable nucleoredoxin 1 [Camelina sativa]
Length=578

 Score =   206 bits (525),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 99/154 (64%), Positives = 115/154 (75%), Gaps = 1/154 (1%)
 Frame = +3

Query  72   ASSMAEQNG-DAHDLRSILCSSDRDFLIRNSGHQVKVDDLKGKKIGIYFSASWCGPCHRF  248
            A +  E NG DA DL S+L S  RDFL+RN G QVK+D L GKKIG YFSA+WCGPC RF
Sbjct  2    AETAKEINGGDAQDLLSLLSSPARDFLVRNDGEQVKIDSLIGKKIGFYFSAAWCGPCQRF  61

Query  249  TPNLATVYNELLPKGNFEVVFVSADEDEESFKEYFGKMPWTAVPFSDSVTRERLDALFTV  428
            TP L  VYNEL PK  FEVVFVS DEDEESF +YF KMPW AVPF+DS TR+RLD LF V
Sbjct  62   TPQLVEVYNELAPKVGFEVVFVSGDEDEESFGDYFSKMPWLAVPFADSETRDRLDGLFKV  121

Query  429  RGIPHLVILDESGKVTTEDGVDIVLEHGVEAYPF  530
             GIP+LVI+D+ GK+   +GV ++  +G  AYPF
Sbjct  122  TGIPNLVIVDDHGKLVNNNGVGVIRSYGAGAYPF  155


 Score =   132 bits (333),  Expect = 6e-33, Method: Compositional matrix adjust.
 Identities = 64/145 (44%), Positives = 90/145 (62%), Gaps = 2/145 (1%)
 Frame = +3

Query  99   DAHDLRSILCSSDRDFLIRNSGHQVKVDDLKGKKIGIYFSASWCGPCHRFTPNLATVYNE  278
            +A    S+L S D ++++   G +V V DL GK I +YFSA WC PC  FTP L  +Y +
Sbjct  332  EAQTTESLLVSGDLNYVLGKDGAKVLVSDLVGKNILMYFSAHWCPPCRAFTPELVEIYKQ  391

Query  279  LLPKGN-FEVVFVSADEDEESFKEYFGKMPWTAVPFSDSVTRERLDALFTVRGIPHLVIL  455
            +  +   FE++F+S+D D+ESF EY+ +MPW A+PF D   +E L   F V GIP L  L
Sbjct  392  IKERDEAFELIFISSDRDQESFDEYYSQMPWLALPFGDP-RKESLARTFKVGGIPMLAAL  450

Query  456  DESGKVTTEDGVDIVLEHGVEAYPF  530
              +GK  T++  D+V  HG +AYPF
Sbjct  451  GPTGKTVTKEARDLVAIHGADAYPF  475


 Score =   101 bits (251),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 54/141 (38%), Positives = 84/141 (60%), Gaps = 2/141 (1%)
 Frame = +3

Query  111  LRSILCSSDRDFLIRNSGHQVKVDDLKGKKIGIYFSASWCGPCHRFTPNLATVYNELLP-  287
            L S+L +  RDF+I   G++V V +L+G+ IG+ FS +    C  FTP L   Y++L   
Sbjct  176  LSSVLVTPSRDFVISPDGNKVPVSELEGRTIGLLFSVASYSKCKEFTPTLVEFYSKLKEN  235

Query  288  KGNFEVVFVSADEDEESFKEYFGKMPWTAVPFSDSVTRERLDALFTVRGIPHLVILDESG  467
            K +FE+V +S ++DEESF + F   PW A+PF+D  +  +L   F +  +P LVIL   G
Sbjct  236  KEDFEIVLISLEDDEESFNQDFKSKPWLALPFNDK-SSSKLARHFMLSTLPTLVILGPDG  294

Query  468  KVTTEDGVDIVLEHGVEAYPF  530
            K    +  + + ++G+ AYPF
Sbjct  295  KTRHLNVAEAIDDYGLLAYPF  315



>ref|XP_008389658.1| PREDICTED: probable nucleoredoxin 1 [Malus domestica]
Length=579

 Score =   206 bits (525),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 89/144 (62%), Positives = 118/144 (82%), Gaps = 0/144 (0%)
 Frame = +3

Query  99   DAHDLRSILCSSDRDFLIRNSGHQVKVDDLKGKKIGIYFSASWCGPCHRFTPNLATVYNE  278
            + HD+ S+L S++RD+L+RN+G Q+KV+ LKGKK+G+YFSASWC PC +FTP L   YNE
Sbjct  15   EPHDVVSLLSSAERDYLVRNNGDQIKVESLKGKKLGLYFSASWCSPCQQFTPALVEAYNE  74

Query  279  LLPKGNFEVVFVSADEDEESFKEYFGKMPWTAVPFSDSVTRERLDALFTVRGIPHLVILD  458
            + P G+FE++F+SADED+ESF  YF KMPW A+PFSDS  R+ +D LF VRGIPHLVIL 
Sbjct  75   ISPNGDFEIIFISADEDDESFNGYFSKMPWLAIPFSDSDARDSVDGLFKVRGIPHLVILG  134

Query  459  ESGKVTTEDGVDIVLEHGVEAYPF  530
            E GKV ++DGV+I+ E+GV++YPF
Sbjct  135  EDGKVLSDDGVEILQEYGVDSYPF  158


 Score =   131 bits (330),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 66/144 (46%), Positives = 88/144 (61%), Gaps = 2/144 (1%)
 Frame = +3

Query  102  AHDLRSILCSSDRDFLIRNSGHQVKVDDLKGKKIGIYFSASWCGPCHRFTPNLATVYNEL  281
            A  L S+L S DR+F+I     +V V DL GK I +YFSA WC PC  F P L   Y+E+
Sbjct  336  AQTLESLLISGDRNFVIGKDETEVPVTDLVGKNILLYFSAHWCPPCRAFLPKLVEAYHEI  395

Query  282  LPKGN-FEVVFVSADEDEESFKEYFGKMPWTAVPFSDSVTRERLDALFTVRGIPHLVILD  458
              K + FE +F+S+D D+ SF ++F KMPW A+PF D   +  L   F V+GIP LV L 
Sbjct  396  KAKDDAFETIFISSDRDQTSFDDFFAKMPWLALPFGDE-RKVPLSRRFRVQGIPMLVALG  454

Query  459  ESGKVTTEDGVDIVLEHGVEAYPF  530
             +GK  T++  ++V  HG  AYPF
Sbjct  455  PTGKTVTKEARNLVTLHGANAYPF  478


 Score =   124 bits (311),  Expect = 8e-30, Method: Compositional matrix adjust.
 Identities = 67/166 (40%), Positives = 99/166 (60%), Gaps = 4/166 (2%)
 Frame = +3

Query  36   FQFSKRKGEERKASSMAEQNGDAHDLRSILCSSDRDFLIRNSGHQVKVDDLKGKKIGIYF  215
            + F++ K +E K    A +      L+ IL S  RDF+I N+G +V + +L+GK +G+YF
Sbjct  156  YPFTQEKIKELKDQEEAARR--EQSLKKILVSRSRDFVISNNGEKVPISELEGKIVGLYF  213

Query  216  SASWCGPCHRFTPNLATVYNELLPKG-NFEVVFVSADEDEESFKEYFGKMPWTAVPFSDS  392
            S S   PC  +TP L  VY +L   G NFE+V +  D+DE+SFK++F KMPW ++P  D 
Sbjct  214  SLSSYSPCAEYTPKLVDVYEKLKGNGENFEIVLLPLDDDEKSFKKHFEKMPWFSLPNGDK  273

Query  393  VTRERLDALFTVRGIPHLVILDESGKVTTEDGVDIVLEHGVEAYPF  530
               E+L   F +  +P LVI+   GK  +++  D + EHG  AYPF
Sbjct  274  -NVEKLARYFELSTLPTLVIIGADGKTLSKNVTDAIDEHGSLAYPF  318



>ref|XP_008459530.1| PREDICTED: probable nucleoredoxin 1 [Cucumis melo]
 gb|AAU04767.1| protein disulfide isomerase (PDI)-like protein 3 [Cucumis melo]
Length=561

 Score =   206 bits (523),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 95/142 (67%), Positives = 113/142 (80%), Gaps = 0/142 (0%)
 Frame = +3

Query  105  HDLRSILCSSDRDFLIRNSGHQVKVDDLKGKKIGIYFSASWCGPCHRFTPNLATVYNELL  284
            HD+ S+  S  RDFLIRN+G QVK+  L GK +G+YFSASWC PCHRFTP  A VY EL+
Sbjct  7    HDINSLFSSDGRDFLIRNNGDQVKISSLIGKIVGLYFSASWCPPCHRFTPIFAGVYEELV  66

Query  285  PKGNFEVVFVSADEDEESFKEYFGKMPWTAVPFSDSVTRERLDALFTVRGIPHLVILDES  464
             KG+FEVVFVS+D DEESFK+YF KMPW ++PFSDS T +RL+ LF VRGIPHLV+LD +
Sbjct  67   SKGDFEVVFVSSDNDEESFKDYFSKMPWLSIPFSDSETNQRLNELFKVRGIPHLVVLDAN  126

Query  465  GKVTTEDGVDIVLEHGVEAYPF  530
            GKV T DGV +V E+GV AYPF
Sbjct  127  GKVLTNDGVRLVSEYGVNAYPF  148


 Score =   135 bits (339),  Expect = 9e-34, Method: Compositional matrix adjust.
 Identities = 62/145 (43%), Positives = 93/145 (64%), Gaps = 2/145 (1%)
 Frame = +3

Query  99   DAHDLRSILCSSDRDFLIRNSGHQVKVDDLKGKKIGIYFSASWCGPCHRFTPNLATVYNE  278
            ++  L S+L S ++D++I  +G ++ V +L GK I +YFSA WC PC  F P L   YNE
Sbjct  325  ESQTLESLLVSGNQDYVIGKNGKKIPVSELVGKNILLYFSAHWCPPCRAFLPKLIEAYNE  384

Query  279  LLPK-GNFEVVFVSADEDEESFKEYFGKMPWTAVPFSDSVTRERLDALFTVRGIPHLVIL  455
            +  K   FEV+F+S+D D++SF+E+F  MPW A+PF D   ++ L+  F + GIP LV L
Sbjct  385  IKQKDKEFEVIFISSDSDQDSFEEFFSGMPWLALPFGDE-RKKFLNRRFKIEGIPTLVAL  443

Query  456  DESGKVTTEDGVDIVLEHGVEAYPF  530
            + SG+  + D   ++  HG +AYPF
Sbjct  444  NRSGRTVSTDARKLITSHGADAYPF  468


 Score =   109 bits (272),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 58/149 (39%), Positives = 86/149 (58%), Gaps = 2/149 (1%)
 Frame = +3

Query  87   EQNGDAHDLRSILCSSDRDFLIRNSGHQVKVDDLKGKKIGIYFSASWCGPCHRFTPNLAT  266
            E+      + SIL S+ R+++I N G Q+ V +L+GK IG+YFS     PC  FT  L  
Sbjct  161  EEAKRNQTISSILVSNSRNYVISNDGTQIPVSELEGKVIGLYFSVYGHEPCDDFTSILVD  220

Query  267  VYNELLPKG-NFEVVFVSADEDEESFKEYFGKMPWTAVPFSDSVTRERLDALFTVRGIPH  443
             Y +L  KG NFE+V +S D++ + F E    MP  A+PF D   + +L   F +  IP 
Sbjct  221  AYKKLKEKGNNFEIVLISLDDEADDFNEALKAMPCLALPFQDEKCK-KLIRYFELSDIPT  279

Query  444  LVILDESGKVTTEDGVDIVLEHGVEAYPF  530
            L+I+ + GK    + V+++ EHG +AYPF
Sbjct  280  LIIIGQDGKTLHPNAVELIEEHGSDAYPF  308



>ref|XP_002888143.1| DC1 domain-containing protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH64402.1| DC1 domain-containing protein [Arabidopsis lyrata subsp. lyrata]
Length=578

 Score =   206 bits (524),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 95/152 (63%), Positives = 115/152 (76%), Gaps = 0/152 (0%)
 Frame = +3

Query  75   SSMAEQNGDAHDLRSILCSSDRDFLIRNSGHQVKVDDLKGKKIGIYFSASWCGPCHRFTP  254
            +S      DA DL S+L S  RDFL+RN G QVK+D L GKKIG+YFSA+WCGPC RFTP
Sbjct  4    TSKVVNGSDALDLHSLLSSPARDFLVRNDGEQVKIDSLIGKKIGLYFSAAWCGPCQRFTP  63

Query  255  NLATVYNELLPKGNFEVVFVSADEDEESFKEYFGKMPWTAVPFSDSVTRERLDALFTVRG  434
             L  VYNEL  K  FE+VFVS DEDEESF +YF KMPW AVPF+DS TR+RLD LF VRG
Sbjct  64   QLVEVYNELSSKVGFEIVFVSGDEDEESFGDYFSKMPWLAVPFTDSETRDRLDELFKVRG  123

Query  435  IPHLVILDESGKVTTEDGVDIVLEHGVEAYPF  530
            IP+LV++D+ GK+  E+GV ++  +G +AYPF
Sbjct  124  IPNLVMVDDHGKLVNENGVGVIRSYGADAYPF  155


 Score =   140 bits (352),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 72/166 (43%), Positives = 100/166 (60%), Gaps = 4/166 (2%)
 Frame = +3

Query  36   FQFSKRKGEERKASSMAEQNGDAHDLRSILCSSDRDFLIRNSGHQVKVDDLKGKKIGIYF  215
            + F+  K EE K    A+   +A  L S+L S D ++++   G +V + DL GK I IYF
Sbjct  313  YPFTPEKFEELKEIEKAKV--EAQTLESLLVSGDLNYVLGKDGAKVLISDLVGKNILIYF  370

Query  216  SASWCGPCHRFTPNLATVYNELLPKGN-FEVVFVSADEDEESFKEYFGKMPWTAVPFSDS  392
            SA WC PC  FTP L  VY ++  +   FE++F+S+D D+ESF EY+ +MPW A+PF D 
Sbjct  371  SAHWCPPCRAFTPKLVEVYKQIKERDEAFELIFISSDRDQESFDEYYSQMPWLALPFGDP  430

Query  393  VTRERLDALFTVRGIPHLVILDESGKVTTEDGVDIVLEHGVEAYPF  530
              +  L   F V GIP L  L  +GK  T++  D+V+ HG EAYPF
Sbjct  431  -RKTSLARTFKVGGIPMLAALGPTGKTVTKEARDLVVAHGAEAYPF  475


 Score =   105 bits (261),  Expect = 8e-23, Method: Compositional matrix adjust.
 Identities = 56/141 (40%), Positives = 84/141 (60%), Gaps = 2/141 (1%)
 Frame = +3

Query  111  LRSILCSSDRDFLIRNSGHQVKVDDLKGKKIGIYFSASWCGPCHRFTPNLATVYNELLP-  287
            LRS+L +  RDF+I   G++V V +L+GK IG+ FS +    C  FTP L   Y +L   
Sbjct  176  LRSVLVTPSRDFVISPDGNKVPVSELEGKTIGLLFSVASYRKCTEFTPKLVEFYTKLKEN  235

Query  288  KGNFEVVFVSADEDEESFKEYFGKMPWTAVPFSDSVTRERLDALFTVRGIPHLVILDESG  467
            K +FE+V +S ++DEESF + F   PW ++PF+D  +  +L   F +  +P LVIL   G
Sbjct  236  KEDFEIVLISLEDDEESFNQEFKTKPWLSLPFNDK-SASKLARHFMLATLPTLVILGPDG  294

Query  468  KVTTEDGVDIVLEHGVEAYPF  530
            K    +  + + ++GV AYPF
Sbjct  295  KTRHSNVAEAIDDYGVLAYPF  315



>emb|CAN59927.1| hypothetical protein VITISV_043885 [Vitis vinifera]
Length=570

 Score =   206 bits (523),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 94/149 (63%), Positives = 117/149 (79%), Gaps = 0/149 (0%)
 Frame = +3

Query  84   AEQNGDAHDLRSILCSSDRDFLIRNSGHQVKVDDLKGKKIGIYFSASWCGPCHRFTPNLA  263
             E     HD+ S+L S +RD+LIRN+G+QVK+  L+GKKIG+YFSASWCGPC RFTP L 
Sbjct  3    CEDGSAVHDVVSVLSSPNRDYLIRNNGNQVKITSLRGKKIGLYFSASWCGPCRRFTPELV  62

Query  264  TVYNELLPKGNFEVVFVSADEDEESFKEYFGKMPWTAVPFSDSVTRERLDALFTVRGIPH  443
             VYN L  KG+FE+ FVSADED+E FKEYF +MPW A+PFSDS TR+ LD LF V GIPH
Sbjct  63   EVYNGLSLKGDFEITFVSADEDDEMFKEYFSEMPWLAIPFSDSDTRDHLDELFRVSGIPH  122

Query  444  LVILDESGKVTTEDGVDIVLEHGVEAYPF  530
            +VI+ E+GKV T+ GV+I+ E+GVE +PF
Sbjct  123  IVIIGENGKVLTDSGVEIIREYGVEGFPF  151


 Score =   140 bits (353),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 71/166 (43%), Positives = 101/166 (61%), Gaps = 4/166 (2%)
 Frame = +3

Query  36   FQFSKRKGEERKASSMAEQNGDAHDLRSILCSSDRDFLIRNSGHQVKVDDLKGKKIGIYF  215
            + F+  K  E +    A+Q  +A  L SIL S +RD+LI   G +V V DL GK I +YF
Sbjct  309  YPFTPAKFAELEEIEKAKQ--EAQTLESILVSGNRDYLIGKHGVKVPVSDLVGKNILLYF  366

Query  216  SASWCGPCHRFTPNLATVYNELLPK-GNFEVVFVSADEDEESFKEYFGKMPWTAVPFSDS  392
            SA WC PC  F P L   Y+++  K   FEV+F+S+D D+ SF ++F +MPW A+PF D 
Sbjct  367  SAXWCSPCRAFLPKLTDAYHKIKAKDSGFEVIFISSDRDQTSFDDFFSEMPWLALPFGDE  426

Query  393  VTRERLDALFTVRGIPHLVILDESGKVTTEDGVDIVLEHGVEAYPF  530
              +E L  +F V+GIP +V +  +G+  T    D+V +HG +AYPF
Sbjct  427  -RKESLSKMFKVQGIPKVVAIGPTGRTITTQARDLVADHGADAYPF  471


 Score =   113 bits (283),  Expect = 5e-26, Method: Compositional matrix adjust.
 Identities = 64/163 (39%), Positives = 96/163 (59%), Gaps = 5/163 (3%)
 Frame = +3

Query  45   SKRKGEERKASSMAEQNGDAHDLRSILCSSDRDFLIRNSGHQVKVDDLKGKKIGIYFSAS  224
            S+R  E ++   +A++      LRSIL S  RDF+I  +G +V +  L+G+ +G+YFS S
Sbjct  153  SERIKELKEQEEVAKRE---QSLRSILVSDSRDFVISANGMKVPISKLEGRLVGLYFSLS  209

Query  225  WCGPCHRFTPNLATVYNELLPKG-NFEVVFVSADEDEESFKEYFGKMPWTAVPFSDSVTR  401
                C  FT  L  VY ++   G +FE+V +S D+DEESF E  G MPW A+PF D   R
Sbjct  210  SYKLCVDFTSKLVDVYAKVKAMGESFEIVLISFDDDEESFNEGXGSMPWFALPFKDESCR  269

Query  402  ERLDALFTVRGIPHLVILDESGKVTTEDGVDIVLEHGVEAYPF  530
             +L   F +  +P LV++   GK    + V+ + E+G++AYPF
Sbjct  270  -KLARYFELSTVPTLVMIGPDGKTLHSNVVEAIEEYGIQAYPF  311



>ref|XP_010243058.1| PREDICTED: probable nucleoredoxin 1 [Nelumbo nucifera]
Length=498

 Score =   204 bits (518),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 90/146 (62%), Positives = 115/146 (79%), Gaps = 0/146 (0%)
 Frame = +3

Query  93   NGDAHDLRSILCSSDRDFLIRNSGHQVKVDDLKGKKIGIYFSASWCGPCHRFTPNLATVY  272
             GD+HDL S+L + +RDFL+ N+GHQ+K+D L GK +G+YFS SWCGPC RFTP LA VY
Sbjct  3    KGDSHDLSSLLSTGERDFLVHNNGHQIKIDSLTGKTVGLYFSGSWCGPCRRFTPILAEVY  62

Query  273  NELLPKGNFEVVFVSADEDEESFKEYFGKMPWTAVPFSDSVTRERLDALFTVRGIPHLVI  452
             EL  KG+FEVVFVS+D D++SF +YF +MPW A+PF+DS  R+RL  LF VRGIP+LV+
Sbjct  63   QELSSKGDFEVVFVSSDRDDDSFGKYFSEMPWLAIPFADSGARQRLKELFQVRGIPNLVV  122

Query  453  LDESGKVTTEDGVDIVLEHGVEAYPF  530
            LD +GKV +E  V IV ++G EAYPF
Sbjct  123  LDGTGKVLSERAVQIVRDYGAEAYPF  148


 Score =   132 bits (333),  Expect = 5e-33, Method: Compositional matrix adjust.
 Identities = 67/166 (40%), Positives = 98/166 (59%), Gaps = 4/166 (2%)
 Frame = +3

Query  36   FQFSKRKGEERKASSMAEQNGDAHDLRSILCSSDRDFLIRNSGHQVKVDDLKGKKIGIYF  215
            + FS  K EE      A++  +A  L SIL S DRDF+I     +V+V  L GK I +YF
Sbjct  306  YPFSPEKLEELAEIERAKR--EAQTLESILVSGDRDFVIGKGDAKVQVSQLVGKNILLYF  363

Query  216  SASWCGPCHRFTPNLATVYNELLPKGN-FEVVFVSADEDEESFKEYFGKMPWTAVPFSDS  392
            SA WC PC  F P L   Y+E+  K + FEV+F+S+D D++SF +++  MPW A+P+ D 
Sbjct  364  SAHWCPPCRAFLPKLIEAYHEIKAKDDAFEVIFISSDRDQKSFDDFYSGMPWLALPYGDE  423

Query  393  VTRERLDALFTVRGIPHLVILDESGKVTTEDGVDIVLEHGVEAYPF  530
              ++ L   F + GIP ++ +  SG+  T D   +++ HG  AYPF
Sbjct  424  -RKQSLSRWFKIEGIPTVIAIGPSGRTVTMDARALLMTHGAAAYPF  468


 Score =   121 bits (304),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 65/156 (42%), Positives = 92/156 (59%), Gaps = 5/156 (3%)
 Frame = +3

Query  66   RKASSMAEQNGDAHDLRSILCSSDRDFLIRNSGHQVKVDDLKGKKIGIYFSASWCGPCHR  245
            ++    A+QN     LRSIL SS RDF+I N G++  + +L+GK +G+YFS      C  
Sbjct  157  KEEEEAAKQN---QTLRSILASSSRDFVISNDGNKTPISELEGKMVGLYFSVGSHPACLE  213

Query  246  FTPNLATVYNELLPKGN-FEVVFVSADEDEESFKEYFGKMPWTAVPFSDSVTRERLDALF  422
            FT  L  +Y EL   G  FEVV +S   +EESF++ F  MPW A+PF D +  E+L   F
Sbjct  214  FTAKLVQIYRELKENGEAFEVVLISLGYEEESFRQDFESMPWFALPFKDKLC-EKLIRYF  272

Query  423  TVRGIPHLVILDESGKVTTEDGVDIVLEHGVEAYPF  530
             +R +P LVI+   GK    +  ++V +HG+ AYPF
Sbjct  273  ELRALPTLVIVGPDGKTINSNVAELVEDHGILAYPF  308



>ref|XP_010473222.1| PREDICTED: probable nucleoredoxin 1 isoform X1 [Camelina sativa]
 ref|XP_010473223.1| PREDICTED: probable nucleoredoxin 1 isoform X2 [Camelina sativa]
Length=578

 Score =   205 bits (521),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 97/154 (63%), Positives = 116/154 (75%), Gaps = 1/154 (1%)
 Frame = +3

Query  72   ASSMAEQNG-DAHDLRSILCSSDRDFLIRNSGHQVKVDDLKGKKIGIYFSASWCGPCHRF  248
            A +  E NG DA DL S+L S  RDFL+RN G QVK+D L GKKIG+YFSA+WCGPC RF
Sbjct  2    AETAKEINGGDAQDLLSLLSSPARDFLVRNDGEQVKIDSLIGKKIGLYFSAAWCGPCQRF  61

Query  249  TPNLATVYNELLPKGNFEVVFVSADEDEESFKEYFGKMPWTAVPFSDSVTRERLDALFTV  428
            TP L  VYNEL PK  FEVVFVS DED+ESF +YF KMPW AVPF+DS TR+RLD LF V
Sbjct  62   TPQLVEVYNELAPKVGFEVVFVSGDEDQESFADYFSKMPWLAVPFADSETRDRLDGLFKV  121

Query  429  RGIPHLVILDESGKVTTEDGVDIVLEHGVEAYPF  530
             GIP+LV++D+ GK+   +GV ++  +G  AYPF
Sbjct  122  TGIPNLVMVDDHGKLVNGNGVGVIRSYGAGAYPF  155


 Score =   133 bits (334),  Expect = 5e-33, Method: Compositional matrix adjust.
 Identities = 64/145 (44%), Positives = 90/145 (62%), Gaps = 2/145 (1%)
 Frame = +3

Query  99   DAHDLRSILCSSDRDFLIRNSGHQVKVDDLKGKKIGIYFSASWCGPCHRFTPNLATVYNE  278
            +A    S+L S D ++++   G +V V DL GK I +YFSA WC PC  FTP L  +Y +
Sbjct  332  EAQTTESLLVSGDLNYVLGKDGAKVLVSDLVGKNILMYFSAHWCPPCRAFTPELVEIYKQ  391

Query  279  LLPKGN-FEVVFVSADEDEESFKEYFGKMPWTAVPFSDSVTRERLDALFTVRGIPHLVIL  455
            +  +   FE++F+S+D D+ESF EY+ +MPW A+PF D   +E L   F V GIP L  L
Sbjct  392  IKERDEAFELIFISSDRDQESFDEYYSQMPWLALPFGDP-RKESLARTFKVGGIPMLAAL  450

Query  456  DESGKVTTEDGVDIVLEHGVEAYPF  530
              +GK  T++  D+V  HG +AYPF
Sbjct  451  GPTGKTVTKEARDLVAIHGADAYPF  475


 Score =   101 bits (252),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 54/141 (38%), Positives = 83/141 (59%), Gaps = 2/141 (1%)
 Frame = +3

Query  111  LRSILCSSDRDFLIRNSGHQVKVDDLKGKKIGIYFSASWCGPCHRFTPNLATVYNELLP-  287
            L S+L +  RDF++   G++V V +L+GK IG+ FS +    C  FTP L   Y +L   
Sbjct  176  LSSVLVTPSRDFVVSPDGNKVPVSELEGKTIGLLFSVASYSKCSEFTPTLVEFYTKLKEN  235

Query  288  KGNFEVVFVSADEDEESFKEYFGKMPWTAVPFSDSVTRERLDALFTVRGIPHLVILDESG  467
            K +FE+V +S ++DEESF + F   PW A+PF+D  +  +L   F +  +P LVIL   G
Sbjct  236  KEDFEIVLISLEDDEESFNQDFKSKPWLALPFNDK-SSSKLARHFMLSTLPTLVILGPDG  294

Query  468  KVTTEDGVDIVLEHGVEAYPF  530
            K    +  + + ++G+ AYPF
Sbjct  295  KTRHLNVAEAIDDYGLLAYPF  315



>gb|EYU22493.1| hypothetical protein MIMGU_mgv1a003730mg [Erythranthe guttata]
Length=567

 Score =   204 bits (520),  Expect = 4e-59, Method: Compositional matrix adjust.
 Identities = 94/153 (61%), Positives = 115/153 (75%), Gaps = 1/153 (1%)
 Frame = +3

Query  75   SSMAEQNGDA-HDLRSILCSSDRDFLIRNSGHQVKVDDLKGKKIGIYFSASWCGPCHRFT  251
            S +   NGDA +DL SIL S +RD+L+RN+G QVK D  KGK  G+YFSASWCGPC RFT
Sbjct  3    SELEIANGDATYDLSSILSSPNRDYLVRNNGDQVKFDSFKGKVTGLYFSASWCGPCQRFT  62

Query  252  PNLATVYNELLPKGNFEVVFVSADEDEESFKEYFGKMPWTAVPFSDSVTRERLDALFTVR  431
            P L   YNEL    NFE+VF+S DED+ESF  YF KMPW A+PFSDS TRE+L+ LF V 
Sbjct  63   PKLVEAYNELAQSNNFEIVFISGDEDDESFDAYFSKMPWLAIPFSDSDTREKLNELFGVS  122

Query  432  GIPHLVILDESGKVTTEDGVDIVLEHGVEAYPF  530
            GIPHLVIL+E GK+ T +GV +++E+G + YPF
Sbjct  123  GIPHLVILNEDGKILTSEGVQVIVENGSDGYPF  155


 Score =   136 bits (342),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 66/146 (45%), Positives = 92/146 (63%), Gaps = 4/146 (3%)
 Frame = +3

Query  99   DAHDLRSILCSSDRDFLIRNSGHQVKVDDLKGKKIGIYFSASWCGPCHRFTPNLATVYNE  278
            +A  L S+L + D D++I  +G +V V DL GK I +YFSA WC PC  F P L   Y E
Sbjct  332  EAQTLESLLVNQDSDYVIGEAGVKVPVSDLNGKDILLYFSAHWCRPCRAFLPTLTKAYEE  391

Query  279  LLPKGN--FEVVFVSADEDEESFKEYFGKMPWTAVPFSDSVTRERLDALFTVRGIPHLVI  452
             + K N   EV+F+S+D D+++F++YF +MPW A+PF D   +E L + F V GIP LV 
Sbjct  392  -INKNNKRLEVIFISSDRDQKAFEDYFSEMPWLALPFGDK-RKESLSSWFKVDGIPTLVA  449

Query  453  LDESGKVTTEDGVDIVLEHGVEAYPF  530
            L  +GK  + D   +++ HG EAYPF
Sbjct  450  LGPTGKTVSTDARGLIMAHGAEAYPF  475


 Score =   108 bits (269),  Expect = 6e-24, Method: Compositional matrix adjust.
 Identities = 63/157 (40%), Positives = 93/157 (59%), Gaps = 7/157 (4%)
 Frame = +3

Query  66   RKASSMAEQNGDAHDLRSILCSSDRDFLIRNSGHQVKVDDLKGKKIGIYFS-ASWCGPCH  242
            RK    A+ N     L+S+L +  RD++I + G +V V +L+GK +G+YF  AS+ G C 
Sbjct  164  RKQEEEAKMN---QSLKSLLVTESRDYVITSDGKKVPVAELEGKTVGLYFVLASYYG-CL  219

Query  243  RFTPNLATVYNELLPKG-NFEVVFVSADEDEESFKEYFGKMPWTAVPFSDSVTRERLDAL  419
             F   L  VYN L   G +FE+V V  DEDEESF E F K+PW ++P +D     +L   
Sbjct  220  DFNSKLIEVYNSLREGGESFEIVMVPLDEDEESFGEEFEKLPWLSLPINDKCCL-KLVRY  278

Query  420  FTVRGIPHLVILDESGKVTTEDGVDIVLEHGVEAYPF  530
            F +  +P +VI+  +GK    + V+ + EHG++AYPF
Sbjct  279  FELGALPTVVIIGPNGKTLQSNVVEAIEEHGMKAYPF  315



>ref|XP_010510950.1| PREDICTED: probable nucleoredoxin 1 [Camelina sativa]
Length=578

 Score =   204 bits (519),  Expect = 6e-59, Method: Compositional matrix adjust.
 Identities = 93/145 (64%), Positives = 112/145 (77%), Gaps = 0/145 (0%)
 Frame = +3

Query  96   GDAHDLRSILCSSDRDFLIRNSGHQVKVDDLKGKKIGIYFSASWCGPCHRFTPNLATVYN  275
            GDA DL S+L S  RDF +RN G QVK++ L GKKIG+YFSA+WCGPC RFTP L  VYN
Sbjct  11   GDAQDLLSLLSSPARDFFVRNDGEQVKIESLMGKKIGLYFSAAWCGPCQRFTPQLVEVYN  70

Query  276  ELLPKGNFEVVFVSADEDEESFKEYFGKMPWTAVPFSDSVTRERLDALFTVRGIPHLVIL  455
            EL PK  FEVVFVS DEDEESF +YF KMPW AVPF+DS TR+RLD LF V GIP+LV++
Sbjct  71   ELAPKVGFEVVFVSGDEDEESFGDYFSKMPWLAVPFADSETRDRLDGLFKVTGIPNLVMV  130

Query  456  DESGKVTTEDGVDIVLEHGVEAYPF  530
            D+ GK+   +GV ++  +G +AYPF
Sbjct  131  DDHGKLVNGNGVGVIRSYGADAYPF  155


 Score =   133 bits (334),  Expect = 5e-33, Method: Compositional matrix adjust.
 Identities = 64/145 (44%), Positives = 90/145 (62%), Gaps = 2/145 (1%)
 Frame = +3

Query  99   DAHDLRSILCSSDRDFLIRNSGHQVKVDDLKGKKIGIYFSASWCGPCHRFTPNLATVYNE  278
            +A    S+L S D ++++   G +V V DL GK I +YFSA WC PC  FTP L  +Y +
Sbjct  332  EAQTTESLLVSGDLNYVLGKDGAKVLVSDLVGKNILMYFSAHWCPPCRAFTPELVEIYKQ  391

Query  279  LLPKGN-FEVVFVSADEDEESFKEYFGKMPWTAVPFSDSVTRERLDALFTVRGIPHLVIL  455
            +  +   FE++F+S+D D+ESF EY+ +MPW A+PF D   +E L   F V GIP L  L
Sbjct  392  IKERDEAFELIFISSDRDQESFDEYYSQMPWLALPFGDP-RKESLARTFKVGGIPMLAAL  450

Query  456  DESGKVTTEDGVDIVLEHGVEAYPF  530
              +GK  T++  D+V  HG +AYPF
Sbjct  451  GPTGKTVTKEARDLVAIHGADAYPF  475


 Score = 97.8 bits (242),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 52/141 (37%), Positives = 82/141 (58%), Gaps = 2/141 (1%)
 Frame = +3

Query  111  LRSILCSSDRDFLIRNSGHQVKVDDLKGKKIGIYFSASWCGPCHRFTPNLATVYNELLP-  287
            L S+L +  RDF++   G++V V +L G+ IG+ FS +    C  FTP L   Y++L   
Sbjct  176  LSSVLVTPTRDFVVSPDGNKVPVSELVGRTIGLLFSVASYSKCTEFTPTLVKFYSKLKEN  235

Query  288  KGNFEVVFVSADEDEESFKEYFGKMPWTAVPFSDSVTRERLDALFTVRGIPHLVILDESG  467
            K +FE+V +S ++DEESF + F   PW  +PF+D  +  +L   F +  +P LVIL   G
Sbjct  236  KEDFEIVLISLEDDEESFNQDFKSKPWLGLPFNDK-SSSKLARHFMLSTLPTLVILGPDG  294

Query  468  KVTTEDGVDIVLEHGVEAYPF  530
            K    +  + + ++G+ AYPF
Sbjct  295  KTRHLNVAEAIDDYGLLAYPF  315



>ref|XP_010682547.1| PREDICTED: probable nucleoredoxin 1 isoform X2 [Beta vulgaris 
subsp. vulgaris]
Length=356

 Score =   199 bits (505),  Expect = 8e-59, Method: Compositional matrix adjust.
 Identities = 92/143 (64%), Positives = 114/143 (80%), Gaps = 1/143 (1%)
 Frame = +3

Query  105  HDLRSILCSSDRDFLIRNSGHQVKVDDLKGKKIGIYFSASWCGPCHRFTPNLATVYNELL  284
            HDL SILCSS+R+FL RN+GHQV VD LKGK + +YFSASWCG C RFTP L  VYNEL 
Sbjct  6    HDLGSILCSSNRNFLCRNNGHQVSVDTLKGKIVALYFSASWCGLCCRFTPILIEVYNELT  65

Query  285  PKG-NFEVVFVSADEDEESFKEYFGKMPWTAVPFSDSVTRERLDALFTVRGIPHLVILDE  461
             +G +FEVVF++AD+D+ESF  YF KMPW A+PFSDS TR++LD +F V G+PH VILDE
Sbjct  66   SQGKDFEVVFITADDDDESFDNYFSKMPWLAIPFSDSETRDKLDDMFKVDGLPHFVILDE  125

Query  462  SGKVTTEDGVDIVLEHGVEAYPF  530
            +GKV T+DGV I+ ++  + YPF
Sbjct  126  TGKVLTDDGVAIIQDYEAQGYPF  148


 Score =   116 bits (290),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 61/151 (40%), Positives = 89/151 (59%), Gaps = 2/151 (1%)
 Frame = +3

Query  81   MAEQNGDAHDLRSILCSSDRDFLIRNSGHQVKVDDLKGKKIGIYFSASWCGPCHRFTPNL  260
            + +Q      L+SIL S  R+F++  +G +V V +L+G+ IG+YFS S    C +F P L
Sbjct  156  LKKQEETTRTLKSILASDSRNFVLSANGKKVLVSELEGRTIGLYFSLSTYRSCMQFNPVL  215

Query  261  ATVYNELLPKG-NFEVVFVSADEDEESFKEYFGKMPWTAVPFSDSVTRERLDALFTVRGI  437
               Y EL  KG NFE+V +  DEDEE FK+ F  MPW ++P  D  +  +L   F +  +
Sbjct  216  IDFYEELKAKGENFEIVLIPLDEDEELFKQGFASMPWYSLPVKDK-SCVKLARYFDLSTL  274

Query  438  PHLVILDESGKVTTEDGVDIVLEHGVEAYPF  530
            P LVI+   G+    +G + + +HGVEAYPF
Sbjct  275  PTLVIVGPDGRTLHYNGREAIEDHGVEAYPF  305



>ref|XP_008792848.1| PREDICTED: LOW QUALITY PROTEIN: probable nucleoredoxin 1 [Phoenix 
dactylifera]
Length=589

 Score =   204 bits (518),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 92/150 (61%), Positives = 116/150 (77%), Gaps = 1/150 (1%)
 Frame = +3

Query  84   AEQNGDAHDLRSILCSSDRDFLIRNSGHQVKVDDLKGKKIGIYFSASWCGPCHRFTPNLA  263
            A   G+AHDL+S+L +  RDFL+RN+G QVK+ +L GK  G+YFSASWCGPCHRFTP L 
Sbjct  7    AANGGNAHDLKSLLSAEGRDFLVRNNGDQVKISNLDGKVTGLYFSASWCGPCHRFTPKLV  66

Query  264  TVYNELLPK-GNFEVVFVSADEDEESFKEYFGKMPWTAVPFSDSVTRERLDALFTVRGIP  440
              YNE+  + G+FEV+F+S DEDEESF  YF +MPW A+PFSDS TR+RL+ LF V GIP
Sbjct  67   EAYNEISSRVGDFEVIFISGDEDEESFNNYFSEMPWLAIPFSDSETRDRLNELFDVSGIP  126

Query  441  HLVILDESGKVTTEDGVDIVLEHGVEAYPF  530
            HLV+LD+SGKV T++ V  V ++G E YPF
Sbjct  127  HLVVLDKSGKVLTDEAVRAVRDYGSEGYPF  156


 Score =   130 bits (328),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 66/166 (40%), Positives = 100/166 (60%), Gaps = 4/166 (2%)
 Frame = +3

Query  36   FQFSKRKGEERKASSMAEQNGDAHDLRSILCSSDRDFLIRNSGHQVKVDDLKGKKIGIYF  215
            + FS  K +E      A+   +A  L S+L S +RD++I     +V + +L GK I +YF
Sbjct  314  YPFSPEKLQELAEKEKAKM--EAQTLESLLVSGERDYVIGKGNVKVPISELVGKNILLYF  371

Query  216  SASWCGPCHRFTPNLATVYNELLPKGN-FEVVFVSADEDEESFKEYFGKMPWTAVPFSDS  392
            SA WC PC  F P L   Y+++  K + FEV+FVS+D+D+ SF ++F  MPW A+PF D 
Sbjct  372  SAHWCPPCRAFLPKLIDAYHKIKEKDSAFEVIFVSSDQDQSSFDDFFSSMPWLALPFGDE  431

Query  393  VTRERLDALFTVRGIPHLVILDESGKVTTEDGVDIVLEHGVEAYPF  530
              ++ L   F + GIP LV +  +GK  T++  ++V+ HG +AYPF
Sbjct  432  -RKKXLSRTFKIYGIPSLVAIGPTGKTITKEARELVMVHGADAYPF  476


 Score =   127 bits (318),  Expect = 9e-31, Method: Compositional matrix adjust.
 Identities = 67/162 (41%), Positives = 103/162 (64%), Gaps = 5/162 (3%)
 Frame = +3

Query  48   KRKGEERKASSMAEQNGDAHDLRSILCSSDRDFLIRNSGHQVKVDDLKGKKIGIYFSASW  227
            +R  + ++    A++N     LRS+L SS RDF+I NSG++V V +L+GK +G+YF+ S 
Sbjct  159  ERIAKMKEEEEAAKKN---QTLRSVLVSSSRDFVISNSGNKVPVAELEGKIVGLYFALSS  215

Query  228  CGPCHRFTPNLATVYNELLPKG-NFEVVFVSADEDEESFKEYFGKMPWTAVPFSDSVTRE  404
              PC  FT  L+ +Y +L  KG +FEVV VS D+++ SF++ F  MPW A+P +D  + E
Sbjct  216  FAPCIEFTRVLSDMYGKLKEKGESFEVVLVSLDDEDSSFEQSFASMPWLAIPINDK-SSE  274

Query  405  RLDALFTVRGIPHLVILDESGKVTTEDGVDIVLEHGVEAYPF  530
            +L   F +  IP LV++   GK    +  ++V ++GVEAYPF
Sbjct  275  KLARYFELETIPTLVVIGSDGKTLNANAAELVEDYGVEAYPF  316



>ref|XP_004141532.1| PREDICTED: probable nucleoredoxin 1-like [Cucumis sativus]
Length=557

 Score =   202 bits (515),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 95/142 (67%), Positives = 111/142 (78%), Gaps = 0/142 (0%)
 Frame = +3

Query  105  HDLRSILCSSDRDFLIRNSGHQVKVDDLKGKKIGIYFSASWCGPCHRFTPNLATVYNELL  284
            HD+ S+  S   DFLIRN+G QVK+  L GK +G+YFSASWC PCHRFTP  A VY EL 
Sbjct  7    HDINSLFSSDGTDFLIRNNGDQVKISSLIGKIVGLYFSASWCPPCHRFTPIFAGVYEELA  66

Query  285  PKGNFEVVFVSADEDEESFKEYFGKMPWTAVPFSDSVTRERLDALFTVRGIPHLVILDES  464
             KG+FEVVFVS+D DEESFK+YF KMPW A+PFSDS T +RL+ LF VRGIPHLV+LD +
Sbjct  67   SKGDFEVVFVSSDNDEESFKDYFSKMPWLAIPFSDSDTNQRLNELFKVRGIPHLVVLDAN  126

Query  465  GKVTTEDGVDIVLEHGVEAYPF  530
            GKV T DGV +V E+GV AYPF
Sbjct  127  GKVLTNDGVRLVSEYGVNAYPF  148


 Score =   132 bits (331),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 61/145 (42%), Positives = 93/145 (64%), Gaps = 2/145 (1%)
 Frame = +3

Query  99   DAHDLRSILCSSDRDFLIRNSGHQVKVDDLKGKKIGIYFSASWCGPCHRFTPNLATVYNE  278
            ++  L S+L S ++D++I  +G ++ V +L GK I +YFSA WC PC  F P L   Y+E
Sbjct  321  ESQTLESLLISGNKDYVIGKNGKKIPVSELVGKNILLYFSAHWCPPCRAFLPKLIQAYDE  380

Query  279  LLPKGN-FEVVFVSADEDEESFKEYFGKMPWTAVPFSDSVTRERLDALFTVRGIPHLVIL  455
            +  K   FEV+F+S+D D++SF+E+F  MPW A+PF D   ++ L+  F ++GIP LV L
Sbjct  381  IKQKDKEFEVIFISSDSDQDSFEEFFSGMPWLALPFGDE-RKKFLNRRFKIQGIPTLVAL  439

Query  456  DESGKVTTEDGVDIVLEHGVEAYPF  530
            + SG   + D   ++  HG +AYPF
Sbjct  440  NRSGCTVSTDARKLIQSHGADAYPF  464


 Score = 90.5 bits (223),  Expect = 9e-18, Method: Compositional matrix adjust.
 Identities = 51/141 (36%), Positives = 79/141 (56%), Gaps = 6/141 (4%)
 Frame = +3

Query  111  LRSILCSSDRDFLIRNSGHQVKVDDLKGKKIGIYFSASWCGPCHRFTPNLATVYNELLPK  290
            + SIL S+ R++        + V +L+GK +G+YFS     PC  FT  L   Y +L  K
Sbjct  169  ISSILVSNSRNYFF----FFIPVSELEGKVVGLYFSVYGHEPCDDFTSILVDAYKKLKEK  224

Query  291  G-NFEVVFVSADEDEESFKEYFGKMPWTAVPFSDSVTRERLDALFTVRGIPHLVILDESG  467
            G NFE+V +S D++ + F E    +P  A+PF D   + +L   F +  IP L+I+ + G
Sbjct  225  GNNFEIVLLSLDDEADDFNEALETLPCLALPFQDEKCK-KLIRYFELSDIPTLIIIGQDG  283

Query  468  KVTTEDGVDIVLEHGVEAYPF  530
            K    + V+++ EHG +AYPF
Sbjct  284  KTLHPNAVELIEEHGPDAYPF  304



>ref|XP_004156196.1| PREDICTED: probable nucleoredoxin 1-like [Cucumis sativus]
 gb|KGN52626.1| hypothetical protein Csa_5G647480 [Cucumis sativus]
Length=561

 Score =   203 bits (516),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 95/142 (67%), Positives = 111/142 (78%), Gaps = 0/142 (0%)
 Frame = +3

Query  105  HDLRSILCSSDRDFLIRNSGHQVKVDDLKGKKIGIYFSASWCGPCHRFTPNLATVYNELL  284
            HD+ S+  S   DFLIRN+G QVK+  L GK +G+YFSASWC PCHRFTP  A VY EL 
Sbjct  7    HDINSLFSSDGTDFLIRNNGDQVKISSLIGKIVGLYFSASWCPPCHRFTPIFAGVYEELA  66

Query  285  PKGNFEVVFVSADEDEESFKEYFGKMPWTAVPFSDSVTRERLDALFTVRGIPHLVILDES  464
             KG+FEVVFVS+D DEESFK+YF KMPW A+PFSDS T +RL+ LF VRGIPHLV+LD +
Sbjct  67   SKGDFEVVFVSSDNDEESFKDYFSKMPWLAIPFSDSDTNQRLNELFKVRGIPHLVVLDAN  126

Query  465  GKVTTEDGVDIVLEHGVEAYPF  530
            GKV T DGV +V E+GV AYPF
Sbjct  127  GKVLTNDGVRLVSEYGVNAYPF  148


 Score =   132 bits (331),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 61/145 (42%), Positives = 93/145 (64%), Gaps = 2/145 (1%)
 Frame = +3

Query  99   DAHDLRSILCSSDRDFLIRNSGHQVKVDDLKGKKIGIYFSASWCGPCHRFTPNLATVYNE  278
            ++  L S+L S ++D++I  +G ++ V +L GK I +YFSA WC PC  F P L   Y+E
Sbjct  325  ESQTLESLLISGNKDYVIGKNGKKIPVSELVGKNILLYFSAHWCPPCRAFLPKLIQAYDE  384

Query  279  LLPK-GNFEVVFVSADEDEESFKEYFGKMPWTAVPFSDSVTRERLDALFTVRGIPHLVIL  455
            +  K   FEV+F+S+D D++SF+E+F  MPW A+PF D   ++ L+  F ++GIP LV L
Sbjct  385  IKQKDKEFEVIFISSDSDQDSFEEFFSGMPWLALPFGDE-RKKFLNRRFKIQGIPTLVAL  443

Query  456  DESGKVTTEDGVDIVLEHGVEAYPF  530
            + SG   + D   ++  HG +AYPF
Sbjct  444  NRSGCTVSTDARKLIQSHGADAYPF  468


 Score =   105 bits (263),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 55/141 (39%), Positives = 84/141 (60%), Gaps = 2/141 (1%)
 Frame = +3

Query  111  LRSILCSSDRDFLIRNSGHQVKVDDLKGKKIGIYFSASWCGPCHRFTPNLATVYNELLPK  290
            + SIL S+ R+++I N G Q+ V +L+GK +G+YFS     PC  FT  L   Y +L  K
Sbjct  169  ISSILVSNSRNYVISNDGTQIPVSELEGKVVGLYFSVYGHEPCDDFTSILVDAYKKLKEK  228

Query  291  G-NFEVVFVSADEDEESFKEYFGKMPWTAVPFSDSVTRERLDALFTVRGIPHLVILDESG  467
            G NFE+V +S D++ + F E    +P  A+PF D   + +L   F +  IP L+I+ + G
Sbjct  229  GNNFEIVLLSLDDEADDFNEALETLPCLALPFQDEKCK-KLIRYFELSDIPTLIIIGQDG  287

Query  468  KVTTEDGVDIVLEHGVEAYPF  530
            K    + V+++ EHG +AYPF
Sbjct  288  KTLHPNAVELIEEHGPDAYPF  308



>emb|CDP13168.1| unnamed protein product [Coffea canephora]
Length=491

 Score =   201 bits (512),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 90/143 (63%), Positives = 112/143 (78%), Gaps = 0/143 (0%)
 Frame = +3

Query  102  AHDLRSILCSSDRDFLIRNSGHQVKVDDLKGKKIGIYFSASWCGPCHRFTPNLATVYNEL  281
            +HD+ S+L S +RDFL+RN+G QVK++ L GK +G+YFS SWCGPC RFTPNL  VYNEL
Sbjct  11   SHDITSLLSSPERDFLVRNNGDQVKIESLIGKAVGLYFSGSWCGPCLRFTPNLVQVYNEL  70

Query  282  LPKGNFEVVFVSADEDEESFKEYFGKMPWTAVPFSDSVTRERLDALFTVRGIPHLVILDE  461
                +FEVVFVS+D DEESF  YF KMPW A PF++S TR+ L  LF VRGIPHLVILD 
Sbjct  71   SSNADFEVVFVSSDRDEESFNAYFKKMPWLAFPFAESETRQSLKELFKVRGIPHLVILDG  130

Query  462  SGKVTTEDGVDIVLEHGVEAYPF  530
            SG+V+TE+GV I+ +HG + YP+
Sbjct  131  SGRVSTEEGVRIIYDHGADGYPY  153


 Score =   129 bits (323),  Expect = 9e-32, Method: Compositional matrix adjust.
 Identities = 60/155 (39%), Positives = 92/155 (59%), Gaps = 2/155 (1%)
 Frame = +3

Query  69   KASSMAEQNGDAHDLRSILCSSDRDFLIRNSGHQVKVDDLKGKKIGIYFSASWCGPCHRF  248
            K + + +   +A  L SIL S+D+DF+I   G +V V +L GK + +YFSA WC PC  F
Sbjct  320  KLAEIEKAKLEAQTLESILISADKDFVISKDGSKVPVSELVGKNVLLYFSAHWCPPCRHF  379

Query  249  TPNLATVYNELLPKGN-FEVVFVSADEDEESFKEYFGKMPWTAVPFSDSVTRERLDALFT  425
             P    VY E+  K + FEV+F+S+D ++ SF ++F  MPW A+PF D   +  L   F 
Sbjct  380  LPRFIAVYEEIKAKDDAFEVIFISSDHNQSSFDDFFSGMPWLALPFGDE-RKALLQRRFK  438

Query  426  VRGIPHLVILDESGKVTTEDGVDIVLEHGVEAYPF  530
            ++GIP +V +  +G+  +     ++  HG +AYPF
Sbjct  439  IKGIPAVVAIGPNGRTVSTQARQLIQAHGADAYPF  473


 Score =   108 bits (271),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 61/143 (43%), Positives = 84/143 (59%), Gaps = 2/143 (1%)
 Frame = +3

Query  105  HDLRSILCSSDRDFLIRNSGHQVKVDDLKGKKIGIYFSASWCGPCHRFTPNLATVYNELL  284
              L SIL    RD+LI N G+++ V +L+GK +G+YFS S    C  FT  L  VY +L 
Sbjct  172  QSLMSILTHDSRDYLISNDGNKIPVSELEGKTVGLYFSVSSHRGCLHFTDRLLEVYKKLR  231

Query  285  PKGN-FEVVFVSADEDEESFKEYFGKMPWTAVPFSDSVTRERLDALFTVRGIPHLVILDE  461
             KG  FE+V VS D+DE+ FK  +  M W A+PF D  T ++L   F +  +P LV++  
Sbjct  232  EKGEAFELVLVSLDDDEQEFKNCYEPMTWLALPFKDK-TCDKLVRHFELGTLPTLVVIGP  290

Query  462  SGKVTTEDGVDIVLEHGVEAYPF  530
             GK    + V+ + EHG EAYPF
Sbjct  291  DGKTLHSNVVESIEEHGDEAYPF  313



>ref|XP_008353016.1| PREDICTED: LOW QUALITY PROTEIN: probable nucleoredoxin 1 [Malus 
domestica]
Length=571

 Score =   202 bits (515),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 90/146 (62%), Positives = 115/146 (79%), Gaps = 0/146 (0%)
 Frame = +3

Query  93   NGDAHDLRSILCSSDRDFLIRNSGHQVKVDDLKGKKIGIYFSASWCGPCHRFTPNLATVY  272
            +G  HDL S+L S+DR+FL+RN+G QV++  L GK +G+YFSASWCGPC RFTPNL  V+
Sbjct  7    HGVTHDLLSLLASADRNFLLRNNGDQVEISSLTGKIVGLYFSASWCGPCRRFTPNLVEVH  66

Query  273  NELLPKGNFEVVFVSADEDEESFKEYFGKMPWTAVPFSDSVTRERLDALFTVRGIPHLVI  452
             +L  KG+FEVVF+S+D DEESF  YF KMPW ++PFSD  TR+RL   F VRGIPHLVI
Sbjct  67   QDLAAKGDFEVVFISSDRDEESFNGYFSKMPWLSIPFSDLETRKRLKEFFKVRGIPHLVI  126

Query  453  LDESGKVTTEDGVDIVLEHGVEAYPF  530
            +D +GKV+ +DG  IV++HGV+ YPF
Sbjct  127  IDANGKVSIDDGTKIVMDHGVDGYPF  152


 Score =   128 bits (322),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 60/155 (39%), Positives = 90/155 (58%), Gaps = 2/155 (1%)
 Frame = +3

Query  69   KASSMAEQNGDAHDLRSILCSSDRDFLIRNSGHQVKVDDLKGKKIGIYFSASWCGPCHRF  248
            K + +AE   +   ++S+L +  RDF++  +G +V V +L GK I +YFSA WC PC  F
Sbjct  315  KIAELAELKLEEQTVQSLLVAGGRDFVVEKNGSRVPVSELAGKHILLYFSAHWCRPCRAF  374

Query  249  TPNLATVYNELLPKGN-FEVVFVSADEDEESFKEYFGKMPWTAVPFSDSVTRERLDALFT  425
             P L   YN++  K N  E++F+S+D D  SFKE+F  MPW A+P  D   +  L   F 
Sbjct  375  MPKLIKAYNQIKAKDNAIEIIFLSSDRDHHSFKEFFETMPWLAIPLGDP-RKALLQRKFK  433

Query  426  VRGIPHLVILDESGKVTTEDGVDIVLEHGVEAYPF  530
            ++ IP LV +  SG+  +     ++  HG +AYPF
Sbjct  434  IQAIPALVAISPSGQTLSTQARQLIQAHGADAYPF  468


 Score =   103 bits (257),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 55/132 (42%), Positives = 79/132 (60%), Gaps = 3/132 (2%)
 Frame = +3

Query  138  RDFLIRNSGHQVKVDDLKGKKIGIYFSASWCGPCHRFTPNLATVYNELLPKG-NFEVVFV  314
            RD+LI   G++V V +L+GK +G+YFS     PC   T  L   + EL  KG NFE+V +
Sbjct  182  RDYLISKDGNKVSVSELEGKIVGLYFSLYTHKPCKEXTQALVKFHEELKEKGENFEIVLI  241

Query  315  SADEDEESFKEYFGKMPWTAVPFSDSVTRERLDALFTVRGIPHLVILDESGKVTTEDGVD  494
            S D +EE FKE F ++ W A+PF D    E+L   F +  +P LVI+ + GK    +  +
Sbjct  242  SLDLEEEHFKEGF-QVSWLALPFKDK-NCEKLARYFALESLPRLVIIGQDGKTLHSNAAE  299

Query  495  IVLEHGVEAYPF  530
            ++ E+G EAYPF
Sbjct  300  LIEEYGAEAYPF  311



>emb|CAC87937.1| PDI-like protein [Quercus suber]
Length=506

 Score =   201 bits (510),  Expect = 4e-58, Method: Compositional matrix adjust.
 Identities = 92/150 (61%), Positives = 115/150 (77%), Gaps = 4/150 (3%)
 Frame = +3

Query  93   NGD----AHDLRSILCSSDRDFLIRNSGHQVKVDDLKGKKIGIYFSASWCGPCHRFTPNL  260
            NGD    +HDL S+L S +RD+L+RN+G QVK+ +L GK +G+YFS SWCGPC  FTPNL
Sbjct  3    NGDVDNVSHDLISLLSSEERDYLVRNNGDQVKISNLIGKTVGLYFSGSWCGPCCHFTPNL  62

Query  261  ATVYNELLPKGNFEVVFVSADEDEESFKEYFGKMPWTAVPFSDSVTRERLDALFTVRGIP  440
              VY ELLPKG+FEVVF+S+D ++ESF  Y  KMPW A+PFSDS TR+RL  LF VRGIP
Sbjct  63   VEVYEELLPKGDFEVVFISSDRNDESFNGYLAKMPWLAIPFSDSETRKRLKELFKVRGIP  122

Query  441  HLVILDESGKVTTEDGVDIVLEHGVEAYPF  530
            +L+ LD +GKV T  GV I+ E+GV+ YPF
Sbjct  123  NLIFLDATGKVVTNQGVRIIGEYGVDGYPF  152


 Score =   134 bits (338),  Expect = 9e-34, Method: Compositional matrix adjust.
 Identities = 64/145 (44%), Positives = 89/145 (61%), Gaps = 2/145 (1%)
 Frame = +3

Query  99   DAHDLRSILCSSDRDFLIRNSGHQVKVDDLKGKKIGIYFSASWCGPCHRFTPNLATVYNE  278
            +A  L +IL S + DF+I  SG +V V +L GK I +YFSA WC PC  F P L   YNE
Sbjct  327  EAQTLETILVSEESDFVIDKSGSKVLVSELVGKNILLYFSAHWCPPCRAFLPKLVKAYNE  386

Query  279  LLPKGN-FEVVFVSADEDEESFKEYFGKMPWTAVPFSDSVTRERLDALFTVRGIPHLVIL  455
            +  K N FE++F+S+D D+ SF E+F  MPW A+PF D   +  L   F ++GIP  V +
Sbjct  387  IKEKDNAFEIIFISSDRDQSSFDEFFAGMPWLALPFGDK-RKSFLARKFKIQGIPAAVAI  445

Query  456  DESGKVTTEDGVDIVLEHGVEAYPF  530
              SG+  T++   ++  HG +AYPF
Sbjct  446  GPSGRTVTKEARQLITAHGADAYPF  470


 Score =   110 bits (276),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 59/150 (39%), Positives = 87/150 (58%), Gaps = 5/150 (3%)
 Frame = +3

Query  87   EQNGDAHD-LRSILCSSDRDFLIRNSGHQVKVDDLKGKKIGIYFSASWCGPCHRFTPNLA  263
            E+N   +  L +IL    R  L+ N G+ V + +L+GK +G+YFS      C  FTP L 
Sbjct  164  EENAKKNQSLSTILVHGSRSHLVSNDGNGVPIPELEGKTVGLYFSIKRL--CLDFTPKLV  221

Query  264  TVYNELLPKG-NFEVVFVSADEDEESFKEYFGKMPWTAVPFSDSVTRERLDALFTVRGIP  440
             VY +L  +G +FE+V +S D++E  FKE F  MPW AVPF D    E+L   F +  +P
Sbjct  222  EVYKKLKERGESFEIVLISLDDEENDFKEGFNTMPWLAVPFKDKCC-EKLARYFDLETLP  280

Query  441  HLVILDESGKVTTEDGVDIVLEHGVEAYPF  530
             +V++   GK    +  +++ EHG+EAYPF
Sbjct  281  TVVVIGPDGKTLNPNVAELIEEHGIEAYPF  310



>gb|AAS02080.1| protein disulfide isomerase [Quercus suber]
Length=506

 Score =   201 bits (510),  Expect = 4e-58, Method: Compositional matrix adjust.
 Identities = 92/150 (61%), Positives = 115/150 (77%), Gaps = 4/150 (3%)
 Frame = +3

Query  93   NGD----AHDLRSILCSSDRDFLIRNSGHQVKVDDLKGKKIGIYFSASWCGPCHRFTPNL  260
            NGD    +HDL S+L S +RD+L+RN+G QVK+ +L GK +G+YFS SWCGPC  FTPNL
Sbjct  3    NGDVDNVSHDLISLLSSEERDYLVRNNGDQVKISNLIGKTVGLYFSGSWCGPCCHFTPNL  62

Query  261  ATVYNELLPKGNFEVVFVSADEDEESFKEYFGKMPWTAVPFSDSVTRERLDALFTVRGIP  440
              VY ELLPKG+FEVVF+S+D ++ESF  Y  KMPW A+PFSDS TR+RL  LF VRGIP
Sbjct  63   VEVYEELLPKGDFEVVFISSDRNDESFNGYLAKMPWLAIPFSDSETRKRLKELFKVRGIP  122

Query  441  HLVILDESGKVTTEDGVDIVLEHGVEAYPF  530
            +L+ LD +GKV T  GV I+ E+GV+ YPF
Sbjct  123  NLIFLDATGKVVTNQGVRIIGEYGVDGYPF  152


 Score =   134 bits (338),  Expect = 9e-34, Method: Compositional matrix adjust.
 Identities = 64/145 (44%), Positives = 89/145 (61%), Gaps = 2/145 (1%)
 Frame = +3

Query  99   DAHDLRSILCSSDRDFLIRNSGHQVKVDDLKGKKIGIYFSASWCGPCHRFTPNLATVYNE  278
            +A  L +IL S + DF+I  SG +V V +L GK I +YFSA WC PC  F P L   YNE
Sbjct  327  EAQTLETILVSEESDFVIDKSGSKVLVSELVGKNILLYFSAHWCPPCRAFLPKLVKAYNE  386

Query  279  LLPKGN-FEVVFVSADEDEESFKEYFGKMPWTAVPFSDSVTRERLDALFTVRGIPHLVIL  455
            +  K N FE++F+S+D D+ SF E+F  MPW A+PF D   +  L   F ++GIP  V +
Sbjct  387  IKEKDNAFEIIFISSDRDQSSFDEFFAGMPWLALPFGDK-RKSFLARKFKIQGIPAAVAI  445

Query  456  DESGKVTTEDGVDIVLEHGVEAYPF  530
              SG+  T++   ++  HG +AYPF
Sbjct  446  GPSGRTVTKEARQLITAHGADAYPF  470


 Score =   112 bits (279),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 59/150 (39%), Positives = 88/150 (59%), Gaps = 5/150 (3%)
 Frame = +3

Query  87   EQNGDAHD-LRSILCSSDRDFLIRNSGHQVKVDDLKGKKIGIYFSASWCGPCHRFTPNLA  263
            E+N   +  L +IL    R  L+ N G++V + +L+GK +G+YFS      C  FTP L 
Sbjct  164  EENAKKNQSLSTILVHGSRSHLVSNDGNEVPIPELEGKTVGLYFSIKRL--CLDFTPKLV  221

Query  264  TVYNELLPKG-NFEVVFVSADEDEESFKEYFGKMPWTAVPFSDSVTRERLDALFTVRGIP  440
             VY +L  +G +FE+V +S D++E  FKE F  MPW AVPF D    E+L   F +  +P
Sbjct  222  EVYKKLKERGESFEIVLISLDDEENDFKEGFNTMPWLAVPFKDKCC-EKLARYFDLETLP  280

Query  441  HLVILDESGKVTTEDGVDIVLEHGVEAYPF  530
             +V++   GK    +  +++ EHG+EAYPF
Sbjct  281  TVVVIGPDGKTLNPNVAELIEEHGIEAYPF  310



>gb|AAU04766.1| protein disulfide isomerase (PDI)-like protein 2 [Cucumis melo]
Length=563

 Score =   202 bits (513),  Expect = 4e-58, Method: Compositional matrix adjust.
 Identities = 91/142 (64%), Positives = 112/142 (79%), Gaps = 0/142 (0%)
 Frame = +3

Query  105  HDLRSILCSSDRDFLIRNSGHQVKVDDLKGKKIGIYFSASWCGPCHRFTPNLATVYNELL  284
            HDL S++ S  RDFLIR++G QVK+  L GK +G+YFSASWC PC RFTP  A VY EL+
Sbjct  7    HDLNSLVSSEGRDFLIRSNGDQVKISSLIGKNVGLYFSASWCPPCRRFTPVFAGVYEELV  66

Query  285  PKGNFEVVFVSADEDEESFKEYFGKMPWTAVPFSDSVTRERLDALFTVRGIPHLVILDES  464
            PKG FEV+F+S+D DE+SFK+YF KMPW ++PFSDS   +RL  LF VRGIPHLV+LD S
Sbjct  67   PKGEFEVIFISSDRDEDSFKDYFSKMPWLSIPFSDSEIVKRLKELFKVRGIPHLVVLDPS  126

Query  465  GKVTTEDGVDIVLEHGVEAYPF  530
            GKV+T+ GV +V EHG+ AYPF
Sbjct  127  GKVSTDQGVRLVSEHGINAYPF  148


 Score =   119 bits (297),  Expect = 7e-28, Method: Compositional matrix adjust.
 Identities = 62/149 (42%), Positives = 87/149 (58%), Gaps = 2/149 (1%)
 Frame = +3

Query  87   EQNGDAHDLRSILCSSDRDFLIRNSGHQVKVDDLKGKKIGIYFSASWCGPCHRFTPNLAT  266
            E+      + S+L S+ RD++I N G+Q+ V +L+GK IG+YFS      C  FTP L  
Sbjct  161  EEARRNQTISSLLVSNSRDYVISNGGNQIPVSELEGKVIGLYFSVYGYALCDEFTPILVD  220

Query  267  VYNELLPKG-NFEVVFVSADEDEESFKEYFGKMPWTAVPFSDSVTRERLDALFTVRGIPH  443
             Y +L  KG NFE+V +S D+  E F E    +PW A+PF D   R +L   F +  IP 
Sbjct  221  TYKKLKEKGQNFEIVSISLDDANEDFSEALKTVPWLALPFQDEKCR-KLTRYFELSTIPT  279

Query  444  LVILDESGKVTTEDGVDIVLEHGVEAYPF  530
            LVI+ + GK    +  ++V EHGV+AYPF
Sbjct  280  LVIIGQDGKTLISNAAELVEEHGVDAYPF  308


 Score =   106 bits (264),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 60/168 (36%), Positives = 97/168 (58%), Gaps = 7/168 (4%)
 Frame = +3

Query  36   FQFSKRKGEERKASSMAEQNGDAHDLRSILCSSDRDFLIRNSGHQVKVDDLKGKKIGIYF  215
            + F++ K EE   + + +   ++  L SIL   +RDF I  +G +V V +L GK I +YF
Sbjct  306  YPFTQEKLEE--LAEIEKSKLESQTLESILVHGERDFGIGKNGAKVSVSELGGKNILLYF  363

Query  216  SASWCG--PCHRFTPNLATVYNELLPK-GNFEVVFVSADEDEESFKEYFGKMPWTAVPFS  386
             ++     PC      L   YNE+  K   FEV+F+S+D D+ SF+E+F  MPW A+PF 
Sbjct  364  LSTLVPSVPCI-LCLKLIESYNEIKQKYKEFEVIFISSDRDDNSFQEFFSGMPWLALPFG  422

Query  387  DSVTRERLDALFTVRGIPHLVILDESGKVTTEDGVDIVLEHGVEAYPF  530
            D   +  ++  F ++GIP +V ++ESG+  + +   ++ E+G  AYPF
Sbjct  423  DE-RKNFINRRFKIQGIPAVVAINESGRTVSTEARKLITEYGANAYPF  469



>ref|XP_008459528.1| PREDICTED: probable nucleoredoxin 1 [Cucumis melo]
Length=562

 Score =   202 bits (513),  Expect = 4e-58, Method: Compositional matrix adjust.
 Identities = 91/142 (64%), Positives = 112/142 (79%), Gaps = 0/142 (0%)
 Frame = +3

Query  105  HDLRSILCSSDRDFLIRNSGHQVKVDDLKGKKIGIYFSASWCGPCHRFTPNLATVYNELL  284
            HDL S++ S  RDFLIR++G QVK+  L GK +G+YFSASWC PC RFTP  A VY EL+
Sbjct  7    HDLNSLVSSEGRDFLIRSNGDQVKISSLIGKNVGLYFSASWCPPCRRFTPVFAGVYEELV  66

Query  285  PKGNFEVVFVSADEDEESFKEYFGKMPWTAVPFSDSVTRERLDALFTVRGIPHLVILDES  464
            PKG FEV+F+S+D DE+SFK+YF KMPW ++PFSDS   +RL  LF VRGIPHLV+LD S
Sbjct  67   PKGEFEVIFISSDRDEDSFKDYFSKMPWLSIPFSDSEIVKRLKELFKVRGIPHLVVLDPS  126

Query  465  GKVTTEDGVDIVLEHGVEAYPF  530
            GKV+T+ GV +V EHG+ AYPF
Sbjct  127  GKVSTDQGVRLVSEHGINAYPF  148


 Score =   134 bits (337),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 66/166 (40%), Positives = 101/166 (61%), Gaps = 4/166 (2%)
 Frame = +3

Query  36   FQFSKRKGEERKASSMAEQNGDAHDLRSILCSSDRDFLIRNSGHQVKVDDLKGKKIGIYF  215
            + F++ K EE   + + +   ++  L SIL   +RDF+I   G +V V +L GK I +YF
Sbjct  306  YPFTQEKLEE--LAEIEKSKLESQTLESILVHGERDFVIGKDGAKVSVSELVGKNILLYF  363

Query  216  SASWCGPCHRFTPNLATVYNELLPK-GNFEVVFVSADEDEESFKEYFGKMPWTAVPFSDS  392
            SA WC PC  F P L   YNE+  K   FEV+F+S+D D+ SF+E+F  MPW A+PF D 
Sbjct  364  SAHWCPPCRAFLPKLIESYNEIKQKYKEFEVIFISSDRDDNSFQEFFSGMPWLALPFGDE  423

Query  393  VTRERLDALFTVRGIPHLVILDESGKVTTEDGVDIVLEHGVEAYPF  530
              +  ++  F ++GIP +V ++ESG+  + +   ++ E+G  AYPF
Sbjct  424  -RKNFINRRFKIQGIPAVVAINESGRTVSTEARKLITEYGANAYPF  468


 Score =   118 bits (296),  Expect = 8e-28, Method: Compositional matrix adjust.
 Identities = 62/149 (42%), Positives = 87/149 (58%), Gaps = 2/149 (1%)
 Frame = +3

Query  87   EQNGDAHDLRSILCSSDRDFLIRNSGHQVKVDDLKGKKIGIYFSASWCGPCHRFTPNLAT  266
            E+      + S+L S+ RD++I N G+Q+ V +L+GK IG+YFS      C  FTP L  
Sbjct  161  EEARRNQTISSLLVSNSRDYVISNGGNQIPVSELEGKVIGLYFSVYGYALCDEFTPILVD  220

Query  267  VYNELLPKG-NFEVVFVSADEDEESFKEYFGKMPWTAVPFSDSVTRERLDALFTVRGIPH  443
             Y +L  KG NFE+V +S D+  E F E    +PW A+PF D   R +L   F +  IP 
Sbjct  221  TYKKLKEKGQNFEIVSISLDDANEDFSEALKTVPWLALPFQDEKCR-KLTRYFELSTIPT  279

Query  444  LVILDESGKVTTEDGVDIVLEHGVEAYPF  530
            LVI+ + GK    +  ++V EHGV+AYPF
Sbjct  280  LVIIGQDGKTLISNAAELVEEHGVDAYPF  308



>ref|XP_004297483.1| PREDICTED: probable nucleoredoxin 1 [Fragaria vesca subsp. vesca]
Length=583

 Score =   202 bits (513),  Expect = 5e-58, Method: Compositional matrix adjust.
 Identities = 93/141 (66%), Positives = 109/141 (77%), Gaps = 0/141 (0%)
 Frame = +3

Query  108  DLRSILCSSDRDFLIRNSGHQVKVDDLKGKKIGIYFSASWCGPCHRFTPNLATVYNELLP  287
            D +S+L S  RD+L+RN+G QVKV+ LKGKK+G+YFSASWCGPC RFTP+L   YN L  
Sbjct  22   DFQSLLSSPARDYLVRNNGDQVKVETLKGKKLGLYFSASWCGPCQRFTPDLVETYNALAS  81

Query  288  KGNFEVVFVSADEDEESFKEYFGKMPWTAVPFSDSVTRERLDALFTVRGIPHLVILDESG  467
            KG+FEV+FVSADEDEESF  YF KMPW A+PFSDS  RE LD  F VRGIPHLV L E G
Sbjct  82   KGDFEVIFVSADEDEESFNGYFSKMPWLAIPFSDSEARESLDEQFKVRGIPHLVFLCEEG  141

Query  468  KVTTEDGVDIVLEHGVEAYPF  530
            +V    GV+IV E+GV+ YPF
Sbjct  142  RVRNASGVEIVREYGVDGYPF  162


 Score =   134 bits (338),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 64/144 (44%), Positives = 92/144 (64%), Gaps = 2/144 (1%)
 Frame = +3

Query  102  AHDLRSILCSSDRDFLIRNSGHQVKVDDLKGKKIGIYFSASWCGPCHRFTPNLATVYNEL  281
            A  L SIL S D++F+I   G ++ V DL GK I +YFSA WC PC  F P L   Y+++
Sbjct  341  AQTLESILISGDQNFVIGKDGIKIPVSDLVGKNILLYFSAHWCPPCRAFLPRLMEAYHKI  400

Query  282  LPKGN-FEVVFVSADEDEESFKEYFGKMPWTAVPFSDSVTRERLDALFTVRGIPHLVILD  458
              K + FEV+F+S+D D+ SF ++F  MPW A+PF DS  +  L   F V+GIP LV + 
Sbjct  401  KAKDDAFEVIFISSDRDQASFDDFFSGMPWLALPFGDS-RKASLSRRFKVQGIPMLVAIG  459

Query  459  ESGKVTTEDGVDIVLEHGVEAYPF  530
             +G+  T++  D+++ HG +AYPF
Sbjct  460  RAGQTVTKEARDLIMVHGADAYPF  483


 Score =   115 bits (287),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 66/158 (42%), Positives = 101/158 (64%), Gaps = 6/158 (4%)
 Frame = +3

Query  60   EERKASSMAEQNGDAHDLRSILCSSDRDFLIRNSGHQVKVDDLKGKKIGIYFSASWCGPC  239
            ++++A++  EQ+     L+++L S  RDF+I + G +V V +L+GK +G+YFS S   PC
Sbjct  171  QDQEAAAKREQS-----LKTVLVSRSRDFVIASGGKKVPVSELEGKMVGLYFSLSTYSPC  225

Query  240  HRFTPNLATVYNELLPKG-NFEVVFVSADEDEESFKEYFGKMPWTAVPFSDSVTRERLDA  416
              FTP L  VY +L  +G +FE+VF+S D++EE+F+E    MPW A+P  D+ T E+L  
Sbjct  226  IEFTPKLVEVYEKLKAQGESFEIVFISLDDEEEAFEEDLTNMPWFALPQKDTKTSEKLAR  285

Query  417  LFTVRGIPHLVILDESGKVTTEDGVDIVLEHGVEAYPF  530
             F +  +P LVIL   GK    + V+ + EHG+ AYPF
Sbjct  286  YFELSTLPTLVILGADGKTVHNNVVEAIEEHGLLAYPF  323



>ref|XP_003631262.2| PREDICTED: uncharacterized protein LOC100852797 [Vitis vinifera]
Length=1163

 Score =   206 bits (525),  Expect = 6e-58, Method: Compositional matrix adjust.
 Identities = 95/148 (64%), Positives = 117/148 (79%), Gaps = 0/148 (0%)
 Frame = +3

Query  87   EQNGDAHDLRSILCSSDRDFLIRNSGHQVKVDDLKGKKIGIYFSASWCGPCHRFTPNLAT  266
            E     HD+ S+L S +RD+LIRN+G+QVK+  L+GKKIG+YFSASWCGPC RFTP L  
Sbjct  4    EDGSAVHDVVSVLSSPNRDYLIRNNGNQVKITSLRGKKIGLYFSASWCGPCRRFTPELVE  63

Query  267  VYNELLPKGNFEVVFVSADEDEESFKEYFGKMPWTAVPFSDSVTRERLDALFTVRGIPHL  446
            VYN L  KG+FE+ FVSADED+E FKEYF +MPW A+PFSDS TR+ LD LF V GIPHL
Sbjct  64   VYNGLSLKGDFEITFVSADEDDEMFKEYFSEMPWLAIPFSDSDTRDHLDELFRVSGIPHL  123

Query  447  VILDESGKVTTEDGVDIVLEHGVEAYPF  530
            VI+ E+GKV T+ GV+I+ E+GVE +PF
Sbjct  124  VIIGENGKVLTDSGVEIIREYGVEGFPF  151


 Score =   199 bits (507),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 94/166 (57%), Positives = 122/166 (73%), Gaps = 5/166 (3%)
 Frame = +3

Query  48   KRKGEERKASSMAEQ-----NGDAHDLRSILCSSDRDFLIRNSGHQVKVDDLKGKKIGIY  212
            KRKG   +   + +      +G +HDL  +L S DRDFL+RN+GHQVKV+ LKGKKI +Y
Sbjct  577  KRKGAGSRPVRIEDMATDKIDGVSHDLVLLLTSEDRDFLVRNNGHQVKVESLKGKKIWLY  636

Query  213  FSASWCGPCHRFTPNLATVYNELLPKGNFEVVFVSADEDEESFKEYFGKMPWTAVPFSDS  392
            FSASWCGPC +FTP L  VY+E   KG+FE++FVS D+ ++ F EYF KMPW A+PFSDS
Sbjct  637  FSASWCGPCRQFTPKLVEVYDEFSSKGDFEIIFVSLDKGDQLFNEYFSKMPWLAIPFSDS  696

Query  393  VTRERLDALFTVRGIPHLVILDESGKVTTEDGVDIVLEHGVEAYPF  530
             TR+ L  LF +RGIP L +LDESGKV + +GV+I+ ++GVE YPF
Sbjct  697  DTRDHLKKLFKMRGIPSLAMLDESGKVLSSEGVEIIKDYGVEGYPF  742


 Score =   139 bits (351),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 71/166 (43%), Positives = 101/166 (61%), Gaps = 4/166 (2%)
 Frame = +3

Query  36   FQFSKRKGEERKASSMAEQNGDAHDLRSILCSSDRDFLIRNSGHQVKVDDLKGKKIGIYF  215
            + F+  K  E +    A+Q  +A  L SIL S +RD+LI   G +V V DL GK I +YF
Sbjct  309  YPFTPAKFAELEEIEKAKQ--EAQTLESILVSGNRDYLIGKHGVKVPVSDLVGKNILLYF  366

Query  216  SASWCGPCHRFTPNLATVYNELLPK-GNFEVVFVSADEDEESFKEYFGKMPWTAVPFSDS  392
            SA WC PC  F P L   Y+++  K   FEV+F+S+D D+ SF ++F +MPW A+PF D 
Sbjct  367  SAHWCSPCRAFLPKLTDAYHKIKAKDSGFEVIFISSDRDQTSFDDFFSEMPWLALPFGDE  426

Query  393  VTRERLDALFTVRGIPHLVILDESGKVTTEDGVDIVLEHGVEAYPF  530
              +E L  +F V+GIP +V +  +G+  T    D+V +HG +AYPF
Sbjct  427  -RKESLSKMFKVQGIPKVVAIGPTGRTITTQARDLVADHGADAYPF  471


 Score =   130 bits (326),  Expect = 5e-31, Method: Compositional matrix adjust.
 Identities = 63/145 (43%), Positives = 86/145 (59%), Gaps = 2/145 (1%)
 Frame = +3

Query  99    DAHDLRSILCSSDRDFLIRNSGHQVKVDDLKGKKIGIYFSASWCGPCHRFTPNLATVYNE  278
             +A  L SIL S D DF+I   G ++ V  L GK I +YFSA WC PC  F P L   Y  
Sbjct  919   EAQTLESILVSGDTDFVIGKDGVKIPVSHLAGKNILLYFSAHWCPPCRAFLPKLIEAYQN  978

Query  279   LLPKGN-FEVVFVSADEDEESFKEYFGKMPWTAVPFSDSVTRERLDALFTVRGIPHLVIL  455
             +  K   FEV+F+S+D D+ SF E+F  MPW A+PF D   +  L   F VR IP L+ +
Sbjct  979   IKAKDEAFEVIFISSDRDQASFDEFFSGMPWLALPFGDK-RKASLGRTFKVRSIPKLIAV  1037

Query  456   DESGKVTTEDGVDIVLEHGVEAYPF  530
             + +G+  T +  ++V+ HG +AYPF
Sbjct  1038  EPTGRTVTTEARNLVMIHGADAYPF  1062


 Score =   127 bits (319),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 63/143 (44%), Positives = 92/143 (64%), Gaps = 2/143 (1%)
 Frame = +3

Query  105  HDLRSILCSSDRDFLIRNSGHQVKVDDLKGKKIGIYFSASWCGPCHRFTPNLATVYNELL  284
              LRSIL S  RD++I   G +V V +L+GK +G+YFS S    C  FT  LA VY EL 
Sbjct  761  QSLRSILVSQSRDYVISADGRKVSVSELEGKLVGLYFSLSSYNACQEFTTTLAEVYEELR  820

Query  285  PKG-NFEVVFVSADEDEESFKEYFGKMPWTAVPFSDSVTRERLDALFTVRGIPHLVILDE  461
             KG +FE+V +S D++E+SFK+YF  MPW A+PF+D  +  +L   F +R +P LV++ +
Sbjct  821  AKGESFEIVMISLDDEEQSFKKYFESMPWFALPFNDK-SCGKLARYFKLRVLPTLVVIGQ  879

Query  462  SGKVTTEDGVDIVLEHGVEAYPF  530
             GK    +  + + +HG++AYPF
Sbjct  880  DGKTLHSNVAEAIEQHGIQAYPF  902


 Score =   111 bits (277),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 64/163 (39%), Positives = 96/163 (59%), Gaps = 5/163 (3%)
 Frame = +3

Query  45   SKRKGEERKASSMAEQNGDAHDLRSILCSSDRDFLIRNSGHQVKVDDLKGKKIGIYFSAS  224
            S+R  E ++   +A++      LRSIL S  RDF+I  +G +V +  L+G+ +G+YFS S
Sbjct  153  SERIKELKEQEEVAKRE---QSLRSILVSDSRDFVISANGMKVPISKLEGRLVGLYFSLS  209

Query  225  WCGPCHRFTPNLATVYNELLPKG-NFEVVFVSADEDEESFKEYFGKMPWTAVPFSDSVTR  401
                C  FT  L  VY ++   G +FE+V +S D+DEESF E FG MP  A+PF D   R
Sbjct  210  SYKLCVDFTSKLVDVYAKVKAMGESFEIVLISFDDDEESFNEGFGSMPCFALPFKDESCR  269

Query  402  ERLDALFTVRGIPHLVILDESGKVTTEDGVDIVLEHGVEAYPF  530
             +L   F +  +P LV++   GK    + V+ + E+G++AYPF
Sbjct  270  -KLARYFELSTVPTLVMIGPDGKTLHSNVVEAIEEYGIQAYPF  311



>emb|CBI28536.3| unnamed protein product [Vitis vinifera]
Length=542

 Score =   200 bits (508),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 90/146 (62%), Positives = 115/146 (79%), Gaps = 0/146 (0%)
 Frame = +3

Query  93   NGDAHDLRSILCSSDRDFLIRNSGHQVKVDDLKGKKIGIYFSASWCGPCHRFTPNLATVY  272
            +G +HDL  +L S DRDFL+RN+GHQVKV+ LKGKKI +YFSASWCGPC +FTP L  VY
Sbjct  7    DGVSHDLVLLLTSEDRDFLVRNNGHQVKVESLKGKKIWLYFSASWCGPCRQFTPKLVEVY  66

Query  273  NELLPKGNFEVVFVSADEDEESFKEYFGKMPWTAVPFSDSVTRERLDALFTVRGIPHLVI  452
            +E   KG+FE++FVS D+ ++ F EYF KMPW A+PFSDS TR+ L  LF +RGIP L +
Sbjct  67   DEFSSKGDFEIIFVSLDKGDQLFNEYFSKMPWLAIPFSDSDTRDHLKKLFKMRGIPSLAM  126

Query  453  LDESGKVTTEDGVDIVLEHGVEAYPF  530
            LDESGKV + +GV+I+ ++GVE YPF
Sbjct  127  LDESGKVLSSEGVEIIKDYGVEGYPF  152


 Score =   130 bits (327),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 63/145 (43%), Positives = 86/145 (59%), Gaps = 2/145 (1%)
 Frame = +3

Query  99   DAHDLRSILCSSDRDFLIRNSGHQVKVDDLKGKKIGIYFSASWCGPCHRFTPNLATVYNE  278
            +A  L SIL S D DF+I   G ++ V  L GK I +YFSA WC PC  F P L   Y  
Sbjct  329  EAQTLESILVSGDTDFVIGKDGVKIPVSHLAGKNILLYFSAHWCPPCRAFLPKLIEAYQN  388

Query  279  LLPKGN-FEVVFVSADEDEESFKEYFGKMPWTAVPFSDSVTRERLDALFTVRGIPHLVIL  455
            +  K   FEV+F+S+D D+ SF E+F  MPW A+PF D   +  L   F VR IP L+ +
Sbjct  389  IKAKDEAFEVIFISSDRDQASFDEFFSGMPWLALPFGDK-RKASLGRTFKVRSIPKLIAV  447

Query  456  DESGKVTTEDGVDIVLEHGVEAYPF  530
            + +G+  T +  ++V+ HG +AYPF
Sbjct  448  EPTGRTVTTEARNLVMIHGADAYPF  472


 Score =   127 bits (320),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 63/143 (44%), Positives = 92/143 (64%), Gaps = 2/143 (1%)
 Frame = +3

Query  105  HDLRSILCSSDRDFLIRNSGHQVKVDDLKGKKIGIYFSASWCGPCHRFTPNLATVYNELL  284
              LRSIL S  RD++I   G +V V +L+GK +G+YFS S    C  FT  LA VY EL 
Sbjct  171  QSLRSILVSQSRDYVISADGRKVSVSELEGKLVGLYFSLSSYNACQEFTTTLAEVYEELR  230

Query  285  PKG-NFEVVFVSADEDEESFKEYFGKMPWTAVPFSDSVTRERLDALFTVRGIPHLVILDE  461
             KG +FE+V +S D++E+SFK+YF  MPW A+PF+D  +  +L   F +R +P LV++ +
Sbjct  231  AKGESFEIVMISLDDEEQSFKKYFESMPWFALPFNDK-SCGKLARYFKLRVLPTLVVIGQ  289

Query  462  SGKVTTEDGVDIVLEHGVEAYPF  530
             GK    +  + + +HG++AYPF
Sbjct  290  DGKTLHSNVAEAIEQHGIQAYPF  312



>ref|XP_010917444.1| PREDICTED: LOW QUALITY PROTEIN: probable nucleoredoxin 1 [Elaeis 
guineensis]
Length=592

 Score =   200 bits (508),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 91/148 (61%), Positives = 114/148 (77%), Gaps = 1/148 (1%)
 Frame = +3

Query  90   QNGDAHDLRSILCSSDRDFLIRNSGHQVKVDDLKGKKIGIYFSASWCGPCHRFTPNLATV  269
              GDAHDL+S+L    RDFL+RN+G QVK+ +L GK  G+YFSASWCGPCHRFTP L   
Sbjct  9    NGGDAHDLKSLLSGEGRDFLVRNNGDQVKISNLDGKVTGLYFSASWCGPCHRFTPKLVEA  68

Query  270  YNELLPK-GNFEVVFVSADEDEESFKEYFGKMPWTAVPFSDSVTRERLDALFTVRGIPHL  446
            YNE+  +  +FEV+F+S+DEDEESF  YF +MPW A+PFSDS TR+ L+ LF V GIPHL
Sbjct  69   YNEISSRVEDFEVIFISSDEDEESFNNYFSEMPWLAIPFSDSETRDHLNELFDVSGIPHL  128

Query  447  VILDESGKVTTEDGVDIVLEHGVEAYPF  530
            VILD+SGKV T++ V +V ++G E YPF
Sbjct  129  VILDKSGKVLTDEAVQVVRDYGSEGYPF  156


 Score =   134 bits (336),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 67/166 (40%), Positives = 101/166 (61%), Gaps = 4/166 (2%)
 Frame = +3

Query  36   FQFSKRKGEERKASSMAEQNGDAHDLRSILCSSDRDFLIRNSGHQVKVDDLKGKKIGIYF  215
            + FS  K EE   + M +   +A  L S+L S +RD++I     +V + +L GK I +YF
Sbjct  319  YPFSPEKLEE--LAEMEKAKMEAQTLESLLVSGERDYVIGKGNVKVPISELVGKNILLYF  376

Query  216  SASWCGPCHRFTPNLATVYNELLPKGN-FEVVFVSADEDEESFKEYFGKMPWTAVPFSDS  392
            SA WC PC  F P L   Y+++  K + FEV+FVS+D+D+ SF ++F  MPW A+PF D 
Sbjct  377  SAQWCPPCRAFLPKLIEAYHKIKEKDSAFEVIFVSSDQDQSSFDDFFSGMPWLALPFGDE  436

Query  393  VTRERLDALFTVRGIPHLVILDESGKVTTEDGVDIVLEHGVEAYPF  530
              +  L   F + GIP LV +  +GK  T++  ++V++HG +AYPF
Sbjct  437  -RKNSLSRTFKIYGIPSLVAIGPTGKTITKEARELVMDHGADAYPF  481


 Score =   130 bits (328),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 75/170 (44%), Positives = 104/170 (61%), Gaps = 14/170 (8%)
 Frame = +3

Query  39   QFSKRKGEERKASSMAEQNGDAHDLRSILCSSDRDFLIRNSGHQ-----VKVDDLKGKKI  203
            + +K K EE+ A        D   LRS+L SS RDF+I NSG +     V V +L+GK +
Sbjct  160  RIAKMKEEEKAAK-------DNQTLRSVLVSSSRDFVISNSGIRXMLFFVPVTELEGKIV  212

Query  204  GIYFSASWCGPCHRFTPNLATVYNELLPKG-NFEVVFVSADEDEESFKEYFGKMPWTAVP  380
            G+YFS S  GPC+ F+  LA +Y +L  KG +FEVV VS D+DE SF++ F  MPW A+P
Sbjct  213  GLYFSLSSFGPCNGFSRVLADMYGKLKEKGESFEVVLVSLDDDESSFEQSFASMPWLAIP  272

Query  381  FSDSVTRERLDALFTVRGIPHLVILDESGKVTTEDGVDIVLEHGVEAYPF  530
              D  + E+L   F +  IP LV++   GK+   +  ++V E+GVEAYPF
Sbjct  273  VKDK-SSEKLARYFELETIPTLVVIGSDGKILNANAAELVEEYGVEAYPF  321



>ref|XP_004297482.1| PREDICTED: probable nucleoredoxin 1 [Fragaria vesca subsp. vesca]
Length=567

 Score =   199 bits (507),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 93/150 (62%), Positives = 113/150 (75%), Gaps = 0/150 (0%)
 Frame = +3

Query  81   MAEQNGDAHDLRSILCSSDRDFLIRNSGHQVKVDDLKGKKIGIYFSASWCGPCHRFTPNL  260
            MA  +G  HDL S+L S DRDFL+RN+G QVK++ L GK +G+YFS SWCGPC RFTP L
Sbjct  1    MAHGDGVTHDLVSLLGSGDRDFLVRNNGDQVKINTLSGKILGLYFSGSWCGPCRRFTPYL  60

Query  261  ATVYNELLPKGNFEVVFVSADEDEESFKEYFGKMPWTAVPFSDSVTRERLDALFTVRGIP  440
              VY EL  KG+FEVVF+S+D DEESF  YF +MPW AVPFSD  TR+ +  LF VRGIP
Sbjct  61   VEVYQELASKGDFEVVFISSDRDEESFSGYFSEMPWLAVPFSDLETRKGVKDLFKVRGIP  120

Query  441  HLVILDESGKVTTEDGVDIVLEHGVEAYPF  530
            H V++D +GKV T+ GV +V E+GVE YPF
Sbjct  121  HFVVIDANGKVCTDQGVVVVREYGVEGYPF  150


 Score =   135 bits (339),  Expect = 8e-34, Method: Compositional matrix adjust.
 Identities = 65/145 (45%), Positives = 90/145 (62%), Gaps = 2/145 (1%)
 Frame = +3

Query  99   DAHDLRSILCSSDRDFLIRNSGHQVKVDDLKGKKIGIYFSASWCGPCHRFTPNLATVYNE  278
            +A  L S+L S D DF+I  SG +V V +L GK I +YFSA WC PC  F P L T Y+E
Sbjct  326  EAQTLESLLVSEDTDFVIETSGAKVPVSELVGKHILLYFSAHWCPPCRSFLPKLITAYHE  385

Query  279  LLPKGN-FEVVFVSADEDEESFKEYFGKMPWTAVPFSDSVTRERLDALFTVRGIPHLVIL  455
            +  K N FEV+F+S+D D+ SF ++F  MPW A+PF D   +  L   F ++GIP +V +
Sbjct  386  IKAKDNAFEVIFISSDRDQSSFDDFFSSMPWLALPFGDP-RKAFLQRKFKIQGIPAVVAI  444

Query  456  DESGKVTTEDGVDIVLEHGVEAYPF  530
              +GK  T     ++L HG +A+PF
Sbjct  445  SPTGKTVTTTARKLILAHGADAFPF  469


 Score =   103 bits (257),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 55/132 (42%), Positives = 80/132 (61%), Gaps = 3/132 (2%)
 Frame = +3

Query  138  RDFLIRNSGHQVKVDDLKGKKIGIYFSASWCGPCHRFTPNLATVYNELLPKG-NFEVVFV  314
            RD+LI + G++V V +L+GK +G+YF+ +    C  FT  L   YN L  KG +FE+V +
Sbjct  180  RDYLISSEGNKVSVSELEGKLVGLYFTLNIRKACKDFTQTLVKFYNSLKEKGEDFEIVLI  239

Query  315  SADEDEESFKEYFGKMPWTAVPFSDSVTRERLDALFTVRGIPHLVILDESGKVTTEDGVD  494
            S D +EE FKE    +PW A+PF D    E+L   F +  +P LVI+   GK    +  +
Sbjct  240  SLDFEEEHFKEGIA-VPWLALPFKDK-NCEKLARYFELETVPTLVIIGHDGKTLHPNVTE  297

Query  495  IVLEHGVEAYPF  530
            ++ EHG+EAYPF
Sbjct  298  LIEEHGIEAYPF  309



>ref|XP_010100450.1| putative nucleoredoxin 1 [Morus notabilis]
 gb|EXB82584.1| putative nucleoredoxin 1 [Morus notabilis]
Length=568

 Score =   199 bits (505),  Expect = 6e-57, Method: Compositional matrix adjust.
 Identities = 89/146 (61%), Positives = 113/146 (77%), Gaps = 0/146 (0%)
 Frame = +3

Query  93   NGDAHDLRSILCSSDRDFLIRNSGHQVKVDDLKGKKIGIYFSASWCGPCHRFTPNLATVY  272
            NG +HDL ++  S  RDFL+RN+G +V +  L GK + IYFS SWCGPC RFTP L  VY
Sbjct  7    NGVSHDLSALFSSDPRDFLVRNNGDKVTISSLSGKVVAIYFSGSWCGPCRRFTPKLVEVY  66

Query  273  NELLPKGNFEVVFVSADEDEESFKEYFGKMPWTAVPFSDSVTRERLDALFTVRGIPHLVI  452
             E+ PKG+FEVVFVS+D DEESF +YF +MPW A+PFSDS TR+ L  LF VRGIP+LVI
Sbjct  67   QEVAPKGDFEVVFVSSDRDEESFNDYFSEMPWLAIPFSDSDTRKHLKELFKVRGIPNLVI  126

Query  453  LDESGKVTTEDGVDIVLEHGVEAYPF  530
            +D +G+VTTE+G  +V+E+GV+ YPF
Sbjct  127  IDSNGEVTTENGTMVVMEYGVDGYPF  152


 Score =   120 bits (301),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 66/151 (44%), Positives = 89/151 (59%), Gaps = 2/151 (1%)
 Frame = +3

Query  81   MAEQNGDAHDLRSILCSSDRDFLIRNSGHQVKVDDLKGKKIGIYFSASWCGPCHRFTPNL  260
            + E       L SIL S  R++L+ N+G+QV V  L+GK +G+YFS S   PC  FT  L
Sbjct  163  VEEATKRNQSLSSILVSRSRNYLVSNNGNQVPVSALEGKMVGLYFSMSSHEPCVEFTSTL  222

Query  261  ATVYNELLPKG-NFEVVFVSADEDEESFKEYFGKMPWTAVPFSDSVTRERLDALFTVRGI  437
              VYN+L  KG NFEVV +  D +EE  K+ F  MPW A+PF D  + E+L   F +  I
Sbjct  223  VDVYNKLKEKGENFEVVLIPLDYEEEEHKQGFEAMPWLALPFKDK-SCEKLVRYFELETI  281

Query  438  PHLVILDESGKVTTEDGVDIVLEHGVEAYPF  530
            P LVI+   GK    +  + + EHG++AYPF
Sbjct  282  PTLVIIGPDGKTLDPNVAERIEEHGIDAYPF  312


 Score =   108 bits (270),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 62/144 (43%), Positives = 90/144 (63%), Gaps = 2/144 (1%)
 Frame = +3

Query  102  AHDLRSILCSSDRDFLIRNSGHQVKVDDLKGKKIGIYFSASWCGPCHRFTPNLATVYNEL  281
            +  L S+L S D+DF+I  +  +V V +L GK + +YFSA WC PC  FTP L  +Y+E+
Sbjct  330  SQTLESLLVSGDKDFVIGKNDSKVPVSELVGKNVLLYFSAHWCPPCRGFTPKLNKIYHEI  389

Query  282  LPKGN-FEVVFVSADEDEESFKEYFGKMPWTAVPFSDSVTRERLDALFTVRGIPHLVILD  458
              K N FEV+F+S+D D+ SF EYF  MPW A+P+ D   ++ LD  F +  IP  + + 
Sbjct  390  KEKDNQFEVIFISSDSDQSSFDEYFSSMPWLALPYGDE-RKKLLDRKFKIEAIPAAIAIG  448

Query  459  ESGKVTTEDGVDIVLEHGVEAYPF  530
             SG+  T++  D++  HG  AYPF
Sbjct  449  SSGRTVTKEARDLIGVHGANAYPF  472



>ref|XP_008389657.1| PREDICTED: probable nucleoredoxin 1 [Malus domestica]
Length=566

 Score =   198 bits (503),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 87/149 (58%), Positives = 113/149 (76%), Gaps = 0/149 (0%)
 Frame = +3

Query  84   AEQNGDAHDLRSILCSSDRDFLIRNSGHQVKVDDLKGKKIGIYFSASWCGPCHRFTPNLA  263
             +++G  HDL S++ S+DR+FL+RN+G Q ++  L GK +G+YFSASWCGPC RFTPNL 
Sbjct  4    GDEDGVTHDLLSLISSADRNFLLRNNGGQAEISSLTGKIVGLYFSASWCGPCLRFTPNLV  63

Query  264  TVYNELLPKGNFEVVFVSADEDEESFKEYFGKMPWTAVPFSDSVTRERLDALFTVRGIPH  443
             V+ +L  KG FEVVF+S+D DEESF  YF KMPW ++PFSD  TR+RL   F VRGIPH
Sbjct  64   EVHQDLAAKGGFEVVFISSDRDEESFTGYFSKMPWLSIPFSDLETRKRLKEFFKVRGIPH  123

Query  444  LVILDESGKVTTEDGVDIVLEHGVEAYPF  530
            LVI+D +G+V T DG  IV++HG + YPF
Sbjct  124  LVIIDANGRVCTNDGTKIVMDHGADGYPF  152


 Score =   133 bits (335),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 63/155 (41%), Positives = 92/155 (59%), Gaps = 2/155 (1%)
 Frame = +3

Query  69   KASSMAEQNGDAHDLRSILCSSDRDFLIRNSGHQVKVDDLKGKKIGIYFSASWCGPCHRF  248
            K + +AE       ++S+L +  RDF+I N+G +V V +L GK I +YFSA WC PC  F
Sbjct  315  KIAVLAELKLKEQTIQSLLVAGGRDFVIENNGSKVPVSELAGKHILLYFSAHWCPPCRAF  374

Query  249  TPNLATVYNELLPKGN-FEVVFVSADEDEESFKEYFGKMPWTAVPFSDSVTRERLDALFT  425
             P L   YN++  KGN  E++F+S+D D+ SFKE F  MPW A+P  D   +  L   F 
Sbjct  375  MPKLIKAYNQIKAKGNAIEIIFLSSDRDQPSFKELFATMPWLAIPLGDP-RQALLQHKFK  433

Query  426  VRGIPHLVILDESGKVTTEDGVDIVLEHGVEAYPF  530
            ++GIP LV +  +G+  +     ++  HG +AYPF
Sbjct  434  IQGIPALVAISPNGQTLSTQARQLIQAHGSDAYPF  468


 Score =   103 bits (258),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 54/132 (41%), Positives = 81/132 (61%), Gaps = 3/132 (2%)
 Frame = +3

Query  138  RDFLIRNSGHQVKVDDLKGKKIGIYFSASWCGPCHRFTPNLATVYNELLPKG-NFEVVFV  314
            RD+LI   G++V V +L+GK +G+YFS +   PC  FT  L   + ++  KG NFE+V +
Sbjct  182  RDYLISKDGNKVSVSELEGKIVGLYFSLNTHKPCKEFTQALVKFHEKMKEKGENFEIVLI  241

Query  315  SADEDEESFKEYFGKMPWTAVPFSDSVTRERLDALFTVRGIPHLVILDESGKVTTEDGVD  494
            S D +EE FKE F ++ W A+PF D    E+L   F +  +P LVI+ + GK    +  +
Sbjct  242  SLDLEEEHFKEGF-QVSWLALPFKDK-NCEKLARYFELENLPTLVIIGQDGKTLHSNAAE  299

Query  495  IVLEHGVEAYPF  530
            ++ E+G EAYPF
Sbjct  300  LIEEYGAEAYPF  311



>ref|XP_008221826.1| PREDICTED: probable nucleoredoxin 1 [Prunus mume]
Length=579

 Score =   198 bits (503),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 90/146 (62%), Positives = 112/146 (77%), Gaps = 0/146 (0%)
 Frame = +3

Query  93   NGDAHDLRSILCSSDRDFLIRNSGHQVKVDDLKGKKIGIYFSASWCGPCHRFTPNLATVY  272
            N   H+ RS+L SS RDF++RN+G +VKV+ L+GK +G+YFSASWC PC RFT  L   Y
Sbjct  13   NSKPHNFRSLLSSSQRDFVVRNNGDKVKVESLEGKNLGLYFSASWCSPCQRFTSALVEAY  72

Query  273  NELLPKGNFEVVFVSADEDEESFKEYFGKMPWTAVPFSDSVTRERLDALFTVRGIPHLVI  452
            NEL PKG+FEVVF+SADED+ESF  YF KMPW A+PFSDS  R+ ++ LF V GIPHLVI
Sbjct  73   NELSPKGDFEVVFISADEDDESFNGYFSKMPWLAIPFSDSEARDCMNELFKVIGIPHLVI  132

Query  453  LDESGKVTTEDGVDIVLEHGVEAYPF  530
            L E GKV  + GV+I+ E+GV+ YPF
Sbjct  133  LGEDGKVLCDSGVEIIQEYGVDGYPF  158


 Score =   138 bits (347),  Expect = 7e-35, Method: Compositional matrix adjust.
 Identities = 66/144 (46%), Positives = 92/144 (64%), Gaps = 2/144 (1%)
 Frame = +3

Query  102  AHDLRSILCSSDRDFLIRNSGHQVKVDDLKGKKIGIYFSASWCGPCHRFTPNLATVYNEL  281
            A  L SIL S DR+F+I   G ++ V DL GK I +YFSA WC PC  F P L   Y+++
Sbjct  336  AQTLESILVSGDRNFVIGKGGTEILVSDLVGKNILLYFSAHWCHPCRAFLPKLVEAYHKI  395

Query  282  LPKGN-FEVVFVSADEDEESFKEYFGKMPWTAVPFSDSVTRERLDALFTVRGIPHLVILD  458
              K + FEV+F+S+D+D+  F E+F  MPW A+PF D + +  L   F VRGIP LV + 
Sbjct  396  KAKDDAFEVIFISSDKDQGDFDEFFSGMPWLALPFGD-LRKASLSHRFKVRGIPMLVAIG  454

Query  459  ESGKVTTEDGVDIVLEHGVEAYPF  530
             +G+  T++  D+V++HG  AYPF
Sbjct  455  HTGQTVTKEARDLVMQHGANAYPF  478


 Score =   120 bits (300),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 64/143 (45%), Positives = 87/143 (61%), Gaps = 2/143 (1%)
 Frame = +3

Query  105  HDLRSILCSSDRDFLIRNSGHQVKVDDLKGKKIGIYFSASWCGPCHRFTPNLATVYNELL  284
              L++IL S  RDF+I N G  V V +L+GK +G+YFS S   PC  FTP L  VY +L 
Sbjct  177  QSLKTILVSHLRDFVISNDGKNVPVSELEGKIVGLYFSLSVYSPCVDFTPKLLEVYEKLK  236

Query  285  PKG-NFEVVFVSADEDEESFKEYFGKMPWTAVPFSDSVTRERLDALFTVRGIPHLVILDE  461
              G +FEVV +  D+DEESFK+ F  MPW ++P  D    E+L   F +  +P LVI+  
Sbjct  237  ANGESFEVVVIPLDDDEESFKQDFKSMPWFSLPIGDK-NVEKLAGYFELSTLPTLVIIGA  295

Query  462  SGKVTTEDGVDIVLEHGVEAYPF  530
             GK  +++  + + EHGV AYPF
Sbjct  296  DGKTISKNVAEAIEEHGVLAYPF  318



>ref|XP_010682546.1| PREDICTED: probable nucleoredoxin 1 isoform X1 [Beta vulgaris 
subsp. vulgaris]
Length=566

 Score =   197 bits (502),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 92/143 (64%), Positives = 114/143 (80%), Gaps = 1/143 (1%)
 Frame = +3

Query  105  HDLRSILCSSDRDFLIRNSGHQVKVDDLKGKKIGIYFSASWCGPCHRFTPNLATVYNELL  284
            HDL SILCSS+R+FL RN+GHQV VD LKGK + +YFSASWCG C RFTP L  VYNEL 
Sbjct  6    HDLGSILCSSNRNFLCRNNGHQVSVDTLKGKIVALYFSASWCGLCCRFTPILIEVYNELT  65

Query  285  PKG-NFEVVFVSADEDEESFKEYFGKMPWTAVPFSDSVTRERLDALFTVRGIPHLVILDE  461
             +G +FEVVF++AD+D+ESF  YF KMPW A+PFSDS TR++LD +F V G+PH VILDE
Sbjct  66   SQGKDFEVVFITADDDDESFDNYFSKMPWLAIPFSDSETRDKLDDMFKVDGLPHFVILDE  125

Query  462  SGKVTTEDGVDIVLEHGVEAYPF  530
            +GKV T+DGV I+ ++  + YPF
Sbjct  126  TGKVLTDDGVAIIQDYEAQGYPF  148


 Score =   126 bits (317),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 63/156 (40%), Positives = 91/156 (58%), Gaps = 2/156 (1%)
 Frame = +3

Query  66   RKASSMAEQNGDAHDLRSILCSSDRDFLIRNSGHQVKVDDLKGKKIGIYFSASWCGPCHR  245
            ++ + + +   +A  L SIL S   DF+I  SG +V +  L GK I +YFSA WC PC  
Sbjct  311  KELAQIEKARQEAQTLESILVSGKLDFVIDKSGTKVPISHLVGKNILLYFSAHWCPPCRA  370

Query  246  FTPNLATVYNELLPKGN-FEVVFVSADEDEESFKEYFGKMPWTAVPFSDSVTRERLDALF  422
            F   L   Y ++  K + FEV+F+S D+D+ SF E+F  MPW A+P+ D  T   L  LF
Sbjct  371  FLSKLIEAYQQIKAKDDAFEVIFISGDKDQISFDEFFSAMPWLAIPYDDQRT-AYLSRLF  429

Query  423  TVRGIPHLVILDESGKVTTEDGVDIVLEHGVEAYPF  530
             V GIP LV +  SGK  + +   +++ HG ++YPF
Sbjct  430  KVFGIPKLVAIGPSGKTISTEARKLIMVHGAKSYPF  465


 Score =   115 bits (288),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 61/151 (40%), Positives = 89/151 (59%), Gaps = 2/151 (1%)
 Frame = +3

Query  81   MAEQNGDAHDLRSILCSSDRDFLIRNSGHQVKVDDLKGKKIGIYFSASWCGPCHRFTPNL  260
            + +Q      L+SIL S  R+F++  +G +V V +L+G+ IG+YFS S    C +F P L
Sbjct  156  LKKQEETTRTLKSILASDSRNFVLSANGKKVLVSELEGRTIGLYFSLSTYRSCMQFNPVL  215

Query  261  ATVYNELLPKG-NFEVVFVSADEDEESFKEYFGKMPWTAVPFSDSVTRERLDALFTVRGI  437
               Y EL  KG NFE+V +  DEDEE FK+ F  MPW ++P  D  +  +L   F +  +
Sbjct  216  IDFYEELKAKGENFEIVLIPLDEDEELFKQGFASMPWYSLPVKDK-SCVKLARYFDLSTL  274

Query  438  PHLVILDESGKVTTEDGVDIVLEHGVEAYPF  530
            P LVI+   G+    +G + + +HGVEAYPF
Sbjct  275  PTLVIVGPDGRTLHYNGREAIEDHGVEAYPF  305



>ref|XP_004141529.1| PREDICTED: probable nucleoredoxin 1-like [Cucumis sativus]
 ref|XP_004156195.1| PREDICTED: probable nucleoredoxin 1-like [Cucumis sativus]
 gb|KGN52625.1| hypothetical protein Csa_5G647470 [Cucumis sativus]
Length=562

 Score =   197 bits (501),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 90/142 (63%), Positives = 109/142 (77%), Gaps = 0/142 (0%)
 Frame = +3

Query  105  HDLRSILCSSDRDFLIRNSGHQVKVDDLKGKKIGIYFSASWCGPCHRFTPNLATVYNELL  284
            HDL S++ S  RDFLIRN+G QVK+  L GK +G+YFSASWC PC RFTP  A VY E+ 
Sbjct  7    HDLSSLVSSEGRDFLIRNNGDQVKISSLIGKNVGLYFSASWCPPCRRFTPVFAGVYEEVA  66

Query  285  PKGNFEVVFVSADEDEESFKEYFGKMPWTAVPFSDSVTRERLDALFTVRGIPHLVILDES  464
            PKG FEV+F+S+D DE+SFK+YF KMPW + PFSDS   +RL  LF VRGIP LV+LD S
Sbjct  67   PKGEFEVIFISSDRDEDSFKDYFSKMPWLSFPFSDSEIVKRLKELFEVRGIPRLVVLDPS  126

Query  465  GKVTTEDGVDIVLEHGVEAYPF  530
            GKV+T+ GV +V EHG+ AYPF
Sbjct  127  GKVSTDQGVRLVTEHGISAYPF  148


 Score =   136 bits (342),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 67/166 (40%), Positives = 102/166 (61%), Gaps = 4/166 (2%)
 Frame = +3

Query  36   FQFSKRKGEERKASSMAEQNGDAHDLRSILCSSDRDFLIRNSGHQVKVDDLKGKKIGIYF  215
            + F++ K +E   + + +   ++  L SIL   ++DF+I   G +V V +L GKKI +YF
Sbjct  306  YPFTQEKLDE--LAEIEKSKLESQTLESILVHGEKDFVIGKDGAKVPVSELVGKKILLYF  363

Query  216  SASWCGPCHRFTPNLATVYNELLPK-GNFEVVFVSADEDEESFKEYFGKMPWTAVPFSDS  392
            SA WC PC  F P L   YNE+  K   FEV+F+S+D D+ SF+E+F  MPW A+PF D 
Sbjct  364  SAHWCPPCRSFLPKLIESYNEIKQKYKEFEVIFISSDRDDNSFQEFFSGMPWLALPFGDE  423

Query  393  VTRERLDALFTVRGIPHLVILDESGKVTTEDGVDIVLEHGVEAYPF  530
              +  L+  F ++GIP +V ++ESG+  + +   ++ EHG  AYPF
Sbjct  424  -RKNFLNRRFKIQGIPAVVAINESGRTVSTEARKLITEHGANAYPF  468


 Score =   118 bits (295),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 61/149 (41%), Positives = 87/149 (58%), Gaps = 2/149 (1%)
 Frame = +3

Query  87   EQNGDAHDLRSILCSSDRDFLIRNSGHQVKVDDLKGKKIGIYFSASWCGPCHRFTPNLAT  266
            E+      + S+L S+ RD++I N G+Q+ V +L+GK IG+YFS      C  FTP L  
Sbjct  161  EEARRNQTISSLLVSNSRDYVISNDGNQIPVSELEGKVIGLYFSVYGYADCDEFTPILVD  220

Query  267  VYNELLPKG-NFEVVFVSADEDEESFKEYFGKMPWTAVPFSDSVTRERLDALFTVRGIPH  443
             Y +L  KG NFE+V +S D+  + F E    +PW A+PF D   R +L   F +  IP 
Sbjct  221  TYKKLKEKGQNFEIVLISLDDANKDFSEALKTVPWLALPFQDEKCR-KLTRYFDLSTIPT  279

Query  444  LVILDESGKVTTEDGVDIVLEHGVEAYPF  530
            LVI+ + GK    +  ++V EHGV+AYPF
Sbjct  280  LVIIGQDGKTLISNAAELVEEHGVDAYPF  308



>ref|XP_008340046.1| PREDICTED: probable nucleoredoxin 1 isoform X2 [Malus domestica]
Length=578

 Score =   197 bits (500),  Expect = 4e-56, Method: Compositional matrix adjust.
 Identities = 91/156 (58%), Positives = 118/156 (76%), Gaps = 2/156 (1%)
 Frame = +3

Query  63   ERKASSMAEQNGDAHDLRSILCSSDRDFLIRNSGHQVKVDDLKGKKIGIYFSASWCGPCH  242
            E KA+ +     + HD+ S+L +S+R+FL+RN+G Q+KV+ LKGKK+G+YFSASWC  C 
Sbjct  5    EVKAAKLV--GSEPHDVVSLLSASERNFLVRNNGDQIKVESLKGKKLGLYFSASWCSTCE  62

Query  243  RFTPNLATVYNELLPKGNFEVVFVSADEDEESFKEYFGKMPWTAVPFSDSVTRERLDALF  422
            RFT  L   YNEL PKG+FE+VF+SADED+ESFK YF +MPW A+PFSDS  R R+D LF
Sbjct  63   RFTQALVEAYNELSPKGDFEIVFISADEDDESFKGYFAEMPWLAIPFSDSKARSRVDELF  122

Query  423  TVRGIPHLVILDESGKVTTEDGVDIVLEHGVEAYPF  530
             VR IPHLV L E GKV ++ GV I+ ++G +AYPF
Sbjct  123  KVREIPHLVTLGEDGKVLSDSGVWIIRKYGADAYPF  158


 Score =   120 bits (302),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 62/143 (43%), Positives = 86/143 (60%), Gaps = 2/143 (1%)
 Frame = +3

Query  105  HDLRSILCSSDRDFLIRNSGHQVKVDDLKGKKIGIYFSASWCGPCHRFTPNLATVYNELL  284
              L++IL +  RDF+I N G +V V +L+GK +G+YFS    G C  FTP L   + +L 
Sbjct  177  QSLKTILVTRSRDFVISNDGEKVPVSELEGKIVGLYFSLFSRGACVEFTPKLVEAHEKLK  236

Query  285  PKG-NFEVVFVSADEDEESFKEYFGKMPWTAVPFSDSVTRERLDALFTVRGIPHLVILDE  461
              G NFE+V V  D+DEESFK+YF KMPW ++P  D   + +L   F    +P +VI+  
Sbjct  237  ANGENFEIVLVPLDDDEESFKQYFEKMPWFSLPIGDKSVK-KLARYFEHSTLPTVVIIGA  295

Query  462  SGKVTTEDGVDIVLEHGVEAYPF  530
             GK  +E+  D + EHG  AYPF
Sbjct  296  DGKTLSENVADAIDEHGSLAYPF  318


 Score =   115 bits (288),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 59/144 (41%), Positives = 86/144 (60%), Gaps = 2/144 (1%)
 Frame = +3

Query  102  AHDLRSILCSSDRDFLIRNSGHQVKVDDLKGKKIGIYFSASWCGPCHRFTPNLATVYNEL  281
            A  L SIL S DR+F+I   G Q+ V DL GK I +YFSA     C  F P L   Y+E+
Sbjct  336  AQTLESILISGDRNFVIGKDGTQIPVTDLVGKNILLYFSAHRSRACRAFLPKLVEAYHEI  395

Query  282  LPKGN-FEVVFVSADEDEESFKEYFGKMPWTAVPFSDSVTRERLDALFTVRGIPHLVILD  458
              K + FEV+F+S+D+ + +F + F  MPW A+PF DS  +  L + F V  IP L+ + 
Sbjct  396  KAKDDAFEVIFISSDKGQNAFDKVFATMPWLALPFGDS-RKAFLISKFKVLFIPKLIAIG  454

Query  459  ESGKVTTEDGVDIVLEHGVEAYPF  530
             +G+  T++  +++ +HG  AYPF
Sbjct  455  PTGQTVTKEARNLIKDHGANAYPF  478



>ref|XP_008340045.1| PREDICTED: probable nucleoredoxin 1 isoform X1 [Malus domestica]
Length=583

 Score =   197 bits (500),  Expect = 4e-56, Method: Compositional matrix adjust.
 Identities = 91/156 (58%), Positives = 118/156 (76%), Gaps = 2/156 (1%)
 Frame = +3

Query  63   ERKASSMAEQNGDAHDLRSILCSSDRDFLIRNSGHQVKVDDLKGKKIGIYFSASWCGPCH  242
            E KA+ +     + HD+ S+L +S+R+FL+RN+G Q+KV+ LKGKK+G+YFSASWC  C 
Sbjct  5    EVKAAKLV--GSEPHDVVSLLSASERNFLVRNNGDQIKVESLKGKKLGLYFSASWCSTCE  62

Query  243  RFTPNLATVYNELLPKGNFEVVFVSADEDEESFKEYFGKMPWTAVPFSDSVTRERLDALF  422
            RFT  L   YNEL PKG+FE+VF+SADED+ESFK YF +MPW A+PFSDS  R R+D LF
Sbjct  63   RFTQALVEAYNELSPKGDFEIVFISADEDDESFKGYFAEMPWLAIPFSDSKARSRVDELF  122

Query  423  TVRGIPHLVILDESGKVTTEDGVDIVLEHGVEAYPF  530
             VR IPHLV L E GKV ++ GV I+ ++G +AYPF
Sbjct  123  KVREIPHLVTLGEDGKVLSDSGVWIIRKYGADAYPF  158


 Score =   120 bits (302),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 62/143 (43%), Positives = 86/143 (60%), Gaps = 2/143 (1%)
 Frame = +3

Query  105  HDLRSILCSSDRDFLIRNSGHQVKVDDLKGKKIGIYFSASWCGPCHRFTPNLATVYNELL  284
              L++IL +  RDF+I N G +V V +L+GK +G+YFS    G C  FTP L   + +L 
Sbjct  177  QSLKTILVTRSRDFVISNDGEKVPVSELEGKIVGLYFSLFSRGACVEFTPKLVEAHEKLK  236

Query  285  PKG-NFEVVFVSADEDEESFKEYFGKMPWTAVPFSDSVTRERLDALFTVRGIPHLVILDE  461
              G NFE+V V  D+DEESFK+YF KMPW ++P  D   + +L   F    +P +VI+  
Sbjct  237  ANGENFEIVLVPLDDDEESFKQYFEKMPWFSLPIGDKSVK-KLARYFEHSTLPTVVIIGA  295

Query  462  SGKVTTEDGVDIVLEHGVEAYPF  530
             GK  +E+  D + EHG  AYPF
Sbjct  296  DGKTLSENVADAIDEHGSLAYPF  318


 Score =   115 bits (288),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 59/144 (41%), Positives = 86/144 (60%), Gaps = 2/144 (1%)
 Frame = +3

Query  102  AHDLRSILCSSDRDFLIRNSGHQVKVDDLKGKKIGIYFSASWCGPCHRFTPNLATVYNEL  281
            A  L SIL S DR+F+I   G Q+ V DL GK I +YFSA     C  F P L   Y+E+
Sbjct  336  AQTLESILISGDRNFVIGKDGTQIPVTDLVGKNILLYFSAHRSRACRAFLPKLVEAYHEI  395

Query  282  LPKGN-FEVVFVSADEDEESFKEYFGKMPWTAVPFSDSVTRERLDALFTVRGIPHLVILD  458
              K + FEV+F+S+D+ + +F + F  MPW A+PF DS  +  L + F V  IP L+ + 
Sbjct  396  KAKDDAFEVIFISSDKGQNAFDKVFATMPWLALPFGDS-RKAFLISKFKVLFIPKLIAIG  454

Query  459  ESGKVTTEDGVDIVLEHGVEAYPF  530
             +G+  T++  +++ +HG  AYPF
Sbjct  455  PTGQTVTKEARNLIKDHGANAYPF  478



>ref|XP_009391725.1| PREDICTED: probable nucleoredoxin 1 [Musa acuminata subsp. malaccensis]
Length=591

 Score =   196 bits (499),  Expect = 6e-56, Method: Compositional matrix adjust.
 Identities = 97/160 (61%), Positives = 117/160 (73%), Gaps = 4/160 (3%)
 Frame = +3

Query  63   ERKASSMAEQNG---DAHDLRSILCSSDRDFLIRNSGHQVKVDDLKGKKIGIYFSASWCG  233
            E  A S  E NG     HDL+S+L S  RDFL+RN+G QVK+ +L GK +G+YFSASWCG
Sbjct  3    EHDAESNGELNGHEETTHDLQSLLASVGRDFLVRNTGDQVKISNLDGKIVGLYFSASWCG  62

Query  234  PCHRFTPNLATVYNELLPK-GNFEVVFVSADEDEESFKEYFGKMPWTAVPFSDSVTRERL  410
            PC RFTP L   YNEL  + GNFE+VFVSADEDE+SF +YF KMPW A+PFSDS  R+RL
Sbjct  63   PCKRFTPKLVETYNELSSENGNFEIVFVSADEDEKSFTDYFSKMPWFAIPFSDSDIRDRL  122

Query  411  DALFTVRGIPHLVILDESGKVTTEDGVDIVLEHGVEAYPF  530
            + LF V GIP+LVI D +GKV T  GV +V ++G  AYPF
Sbjct  123  NDLFDVGGIPYLVIFDVNGKVLTSVGVQVVRDYGSNAYPF  162


 Score =   132 bits (331),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 69/166 (42%), Positives = 98/166 (59%), Gaps = 4/166 (2%)
 Frame = +3

Query  36   FQFSKRKGEERKASSMAEQNGDAHDLRSILCSSDRDFLIRNSGHQVKVDDLKGKKIGIYF  215
            + FS  K EE      A    +A  L S+L S ++D++I N G +V V +L GK I +YF
Sbjct  320  YPFSPEKLEEIAEKEKARI--EAQTLESLLASGEQDYVIGNGGIRVPVSELVGKNILLYF  377

Query  216  SASWCGPCHRFTPNLATVYNELLPKGN-FEVVFVSADEDEESFKEYFGKMPWTAVPFSDS  392
            SA WC PC  F P L   Y+++  K + FE++FVS D DE SF ++F +MPW A+PF D 
Sbjct  378  SAQWCPPCRMFLPKLIEAYHKIKEKDDAFEIIFVSNDRDESSFHDFFSEMPWLALPFGDE  437

Query  393  VTRERLDALFTVRGIPHLVILDESGKVTTEDGVDIVLEHGVEAYPF  530
              ++ L   F + GIP LV +  +GK  T +  ++V+ HG  AYPF
Sbjct  438  -RKKFLARTFKIYGIPSLVAIGPTGKTVTTEARELVMTHGAAAYPF  482


 Score =   122 bits (305),  Expect = 6e-29, Method: Compositional matrix adjust.
 Identities = 64/156 (41%), Positives = 95/156 (61%), Gaps = 5/156 (3%)
 Frame = +3

Query  66   RKASSMAEQNGDAHDLRSILCSSDRDFLIRNSGHQVKVDDLKGKKIGIYFSASWCGPCHR  245
            ++    A+QN     LRS+L SS RDF+I   G++V V +L+GK +GI+FS S    C  
Sbjct  171  KEEEEAAKQN---QTLRSLLVSSSRDFVISKDGNKVPVSELQGKIVGIFFSISSFNSCSE  227

Query  246  FTPNLATVYNELLPKG-NFEVVFVSADEDEESFKEYFGKMPWTAVPFSDSVTRERLDALF  422
            F  +L  +Y +L   G NFEVV VS D++E S+++ F  MPW A+PF D +  ++L   F
Sbjct  228  FAKSLKEMYLKLKENGENFEVVLVSLDDEESSYEQGFADMPWLAIPFKDKIC-DKLVRYF  286

Query  423  TVRGIPHLVILDESGKVTTEDGVDIVLEHGVEAYPF  530
             +  IP LV++   GK    +  +++ EHG+EAYPF
Sbjct  287  ELDSIPTLVVIGSDGKTLNSNVAELIEEHGIEAYPF  322



>emb|CBI28543.3| unnamed protein product [Vitis vinifera]
Length=540

 Score =   194 bits (494),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 92/152 (61%), Positives = 115/152 (76%), Gaps = 2/152 (1%)
 Frame = +3

Query  81   MAEQN--GDAHDLRSILCSSDRDFLIRNSGHQVKVDDLKGKKIGIYFSASWCGPCHRFTP  254
            MA +N  G AHDL  +L   DRDFL+R +GHQVKV+ LKGKKI +YFSASWCGP  +FTP
Sbjct  1    MASENVDGVAHDLVPLLTREDRDFLVRCNGHQVKVESLKGKKIWLYFSASWCGPRRQFTP  60

Query  255  NLATVYNELLPKGNFEVVFVSADEDEESFKEYFGKMPWTAVPFSDSVTRERLDALFTVRG  434
             L  VY+E   KG+FE++FVS D+ ++ F EYF KMPW A+PFSDS TR+ L  LF VRG
Sbjct  61   ELVEVYDEFSSKGDFEIIFVSRDKGDQLFNEYFSKMPWLAIPFSDSDTRDHLKKLFKVRG  120

Query  435  IPHLVILDESGKVTTEDGVDIVLEHGVEAYPF  530
            IP L +LDESGKV + +GV+I+ ++GVE YPF
Sbjct  121  IPSLAMLDESGKVLSSEGVEIIKDYGVEGYPF  152


 Score =   129 bits (325),  Expect = 7e-32, Method: Compositional matrix adjust.
 Identities = 63/145 (43%), Positives = 86/145 (59%), Gaps = 2/145 (1%)
 Frame = +3

Query  99   DAHDLRSILCSSDRDFLIRNSGHQVKVDDLKGKKIGIYFSASWCGPCHRFTPNLATVYNE  278
            +A  L SIL S +RDF+I     ++ V DL GK I +YFSA WC PC  F P L   Y  
Sbjct  329  EAQTLESILVSGNRDFVIGKDRVKIPVSDLVGKNILLYFSAHWCPPCRAFLPKLIEAYQN  388

Query  279  LLPKGN-FEVVFVSADEDEESFKEYFGKMPWTAVPFSDSVTRERLDALFTVRGIPHLVIL  455
            +  K   FEV+F+S+D D+ SF E+F  MPW A+PF D   +  L   F VR IP L+ +
Sbjct  389  IKAKDEAFEVIFISSDRDQASFDEFFSGMPWLALPFGDK-RKASLGRTFKVRSIPKLIAV  447

Query  456  DESGKVTTEDGVDIVLEHGVEAYPF  530
            + +G+  T +   +V+ HG +AYPF
Sbjct  448  EPTGRTVTTEARTLVMIHGADAYPF  472


 Score =   115 bits (288),  Expect = 9e-27, Method: Compositional matrix adjust.
 Identities = 60/143 (42%), Positives = 86/143 (60%), Gaps = 2/143 (1%)
 Frame = +3

Query  105  HDLRSILCSSDRDFLIRNSGHQVKVDDLKGKKIGIYFSASWCGPCHRFTPNLATVYNELL  284
              L SIL S  RD++I   G +V V +L+GK +G+YFS S   P  +FT  L  VY +L 
Sbjct  171  QSLISILVSQSRDYVISTDGKRVPVSELEGKFVGLYFSLSSSKPRLQFTRTLVDVYKKLR  230

Query  285  PKG-NFEVVFVSADEDEESFKEYFGKMPWTAVPFSDSVTRERLDALFTVRGIPHLVILDE  461
             KG +FE+V +S D++ ESFK  FG MPW A+PF D   + +L   F +  +P LV++  
Sbjct  231  AKGESFEIVMISLDDEIESFKTNFGSMPWLALPFKDRSCK-KLARYFELSALPTLVVIGP  289

Query  462  SGKVTTEDGVDIVLEHGVEAYPF  530
             GK    +  + + EHG++AYPF
Sbjct  290  DGKTLHSNVAEAIQEHGIQAYPF  312



>gb|EYU22494.1| hypothetical protein MIMGU_mgv1a005241mg [Erythranthe guttata]
Length=492

 Score =   193 bits (491),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 92/153 (60%), Positives = 111/153 (73%), Gaps = 1/153 (1%)
 Frame = +3

Query  75   SSMAEQNGDA-HDLRSILCSSDRDFLIRNSGHQVKVDDLKGKKIGIYFSASWCGPCHRFT  251
            S +   NGDA +DL SIL S +RD+L+RN+G QVK D  KGK IG+YFS SWCGPC  FT
Sbjct  3    SELEIANGDATYDLSSILSSPNRDYLVRNNGDQVKFDSFKGKIIGVYFSGSWCGPCQWFT  62

Query  252  PNLATVYNELLPKGNFEVVFVSADEDEESFKEYFGKMPWTAVPFSDSVTRERLDALFTVR  431
            P L  VYNE     NFE+VFVS D D+ESF  YF KMPW A+PFSDS TRE+L+ LF V 
Sbjct  63   PKLVEVYNERAQSNNFEIVFVSRDADDESFDAYFSKMPWLAIPFSDSDTREKLNELFGVS  122

Query  432  GIPHLVILDESGKVTTEDGVDIVLEHGVEAYPF  530
             IPHLVIL E GK+ T +GV +++E+G + YPF
Sbjct  123  EIPHLVILYEDGKILTSEGVRVIVENGSDGYPF  155


 Score =   134 bits (338),  Expect = 9e-34, Method: Compositional matrix adjust.
 Identities = 65/146 (45%), Positives = 92/146 (63%), Gaps = 4/146 (3%)
 Frame = +3

Query  99   DAHDLRSILCSSDRDFLIRNSGHQVKVDDLKGKKIGIYFSASWCGPCHRFTPNLATVYNE  278
            +A  L S+L + D D++I   G ++ V DL GK I +YFSA WC PC  F+P L   Y E
Sbjct  332  EAQTLESLLVNQDSDYVIGEDGVKIPVSDLIGKDILLYFSAHWCPPCRAFSPTLTKAYEE  391

Query  279  LLPKGN--FEVVFVSADEDEESFKEYFGKMPWTAVPFSDSVTRERLDALFTVRGIPHLVI  452
             + K N   EV+F+S+D D+++F++YF +MPW A+PF D   +E L + F V GIP LV 
Sbjct  392  -INKNNKRLEVIFISSDIDQKAFEDYFSEMPWLALPFGDK-RKESLSSWFKVEGIPTLVA  449

Query  453  LDESGKVTTEDGVDIVLEHGVEAYPF  530
            L  +GK  + D   +++ HG EAYPF
Sbjct  450  LGPTGKTVSTDARGLIMAHGAEAYPF  475


 Score =   114 bits (286),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 62/156 (40%), Positives = 91/156 (58%), Gaps = 5/156 (3%)
 Frame = +3

Query  66   RKASSMAEQNGDAHDLRSILCSSDRDFLIRNSGHQVKVDDLKGKKIGIYFSASWCGPCHR  245
            RK    A+ N     L+S+L +  RD++I + G +V V +L+GK +G+YF  +    C  
Sbjct  164  RKQREEAKMN---QSLKSLLVTESRDYVITSDGKKVPVAELEGKTVGLYFVFATVYECLH  220

Query  246  FTPNLATVYNELLPKG-NFEVVFVSADEDEESFKEYFGKMPWTAVPFSDSVTRERLDALF  422
            F P L  VYN L   G +FE+V V  DEDE+SF E F K+PW ++P +D     +L   F
Sbjct  221  FNPKLIKVYNSLREGGESFEIVMVPLDEDEDSFSEEFEKLPWLSLPINDKCCL-KLARYF  279

Query  423  TVRGIPHLVILDESGKVTTEDGVDIVLEHGVEAYPF  530
             +  IP +VI+  +GK    + V+ + EHGV+AYPF
Sbjct  280  ELGAIPTVVIISPNGKTLQSNVVEAIEEHGVKAYPF  315



>ref|XP_010651414.1| PREDICTED: probable nucleoredoxin 1 isoform X2 [Vitis vinifera]
Length=562

 Score =   194 bits (494),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 92/152 (61%), Positives = 115/152 (76%), Gaps = 2/152 (1%)
 Frame = +3

Query  81   MAEQN--GDAHDLRSILCSSDRDFLIRNSGHQVKVDDLKGKKIGIYFSASWCGPCHRFTP  254
            MA +N  G AHDL  +L   DRDFL+R +GHQVKV+ LKGKKI +YFSASWCGP  +FTP
Sbjct  1    MASENVDGVAHDLVPLLTREDRDFLVRCNGHQVKVESLKGKKIWLYFSASWCGPRRQFTP  60

Query  255  NLATVYNELLPKGNFEVVFVSADEDEESFKEYFGKMPWTAVPFSDSVTRERLDALFTVRG  434
             L  VY+E   KG+FE++FVS D+ ++ F EYF KMPW A+PFSDS TR+ L  LF VRG
Sbjct  61   ELVEVYDEFSSKGDFEIIFVSRDKGDQLFNEYFSKMPWLAIPFSDSDTRDHLKKLFKVRG  120

Query  435  IPHLVILDESGKVTTEDGVDIVLEHGVEAYPF  530
            IP L +LDESGKV + +GV+I+ ++GVE YPF
Sbjct  121  IPSLAMLDESGKVLSSEGVEIIKDYGVEGYPF  152


 Score =   129 bits (324),  Expect = 9e-32, Method: Compositional matrix adjust.
 Identities = 63/145 (43%), Positives = 86/145 (59%), Gaps = 2/145 (1%)
 Frame = +3

Query  99   DAHDLRSILCSSDRDFLIRNSGHQVKVDDLKGKKIGIYFSASWCGPCHRFTPNLATVYNE  278
            +A  L SIL S +RDF+I     ++ V DL GK I +YFSA WC PC  F P L   Y  
Sbjct  321  EAQTLESILVSGNRDFVIGKDRVKIPVSDLVGKNILLYFSAHWCPPCRAFLPKLIEAYQN  380

Query  279  LLPKGN-FEVVFVSADEDEESFKEYFGKMPWTAVPFSDSVTRERLDALFTVRGIPHLVIL  455
            +  K   FEV+F+S+D D+ SF E+F  MPW A+PF D   +  L   F VR IP L+ +
Sbjct  381  IKAKDEAFEVIFISSDRDQASFDEFFSGMPWLALPFGDK-RKASLGRTFKVRSIPKLIAV  439

Query  456  DESGKVTTEDGVDIVLEHGVEAYPF  530
            + +G+  T +   +V+ HG +AYPF
Sbjct  440  EPTGRTVTTEARTLVMIHGADAYPF  464


 Score =   103 bits (258),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 58/143 (41%), Positives = 82/143 (57%), Gaps = 10/143 (7%)
 Frame = +3

Query  105  HDLRSILCSSDRDFLIRNSGHQVKVDDLKGKKIGIYFSASWCGPCHRFTPNLATVYNELL  284
              L SIL S  RD+        V V +L+GK +G+YFS S   P  +FT  L  VY +L 
Sbjct  171  QSLISILVSQSRDY--------VPVSELEGKFVGLYFSLSSSKPRLQFTRTLVDVYKKLR  222

Query  285  PKG-NFEVVFVSADEDEESFKEYFGKMPWTAVPFSDSVTRERLDALFTVRGIPHLVILDE  461
             KG +FE+V +S D++ ESFK  FG MPW A+PF D   + +L   F +  +P LV++  
Sbjct  223  AKGESFEIVMISLDDEIESFKTNFGSMPWLALPFKDRSCK-KLARYFELSALPTLVVIGP  281

Query  462  SGKVTTEDGVDIVLEHGVEAYPF  530
             GK    +  + + EHG++AYPF
Sbjct  282  DGKTLHSNVAEAIQEHGIQAYPF  304



>gb|ABK25230.1| unknown [Picea sitchensis]
Length=387

 Score =   190 bits (483),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 86/148 (58%), Positives = 116/148 (78%), Gaps = 1/148 (1%)
 Frame = +3

Query  90   QNGDAHD-LRSILCSSDRDFLIRNSGHQVKVDDLKGKKIGIYFSASWCGPCHRFTPNLAT  266
            Q G++H+ L S+LCS +RDFLIRN+G +VKV++L+GK +G+YFSA WC PC  FTP L+ 
Sbjct  10   QAGESHESLSSLLCSEERDFLIRNNGEKVKVEELEGKYVGLYFSAHWCPPCRYFTPVLSE  69

Query  267  VYNELLPKGNFEVVFVSADEDEESFKEYFGKMPWTAVPFSDSVTRERLDALFTVRGIPHL  446
            +Y +LL KG+FE+VF+SAD DE+SF+EY   MPW A+PFSD  TR++LD +F V GIP L
Sbjct  70   IYKKLLEKGDFEIVFISADRDEKSFEEYHHTMPWLALPFSDENTRKKLDQVFKVDGIPCL  129

Query  447  VILDESGKVTTEDGVDIVLEHGVEAYPF  530
            V LD+ G+  T +GV+ + E+GVEAYPF
Sbjct  130  VFLDKEGRAITTEGVETIGEYGVEAYPF  157


 Score =   160 bits (406),  Expect = 5e-44, Method: Compositional matrix adjust.
 Identities = 76/166 (46%), Positives = 111/166 (67%), Gaps = 4/166 (2%)
 Frame = +3

Query  36   FQFSKRKGEERKASSMAEQNGDAHDLRSILCSSDRDFLIRNSGHQVKVDDLKGKKIGIYF  215
            + F+  + +E KA   A +   A  + S+L S +RDF++ + G QV V +L GK +G+YF
Sbjct  155  YPFTAERIDELKAKEEALRA--AQTVESLLLSDERDFVLGHEGTQVPVAELAGKTVGLYF  212

Query  216  SASWCGPCHRFTPNLATVYNELLPKGN-FEVVFVSADEDEESFKEYFGKMPWTAVPFSDS  392
            SA WCGPC  FTP L  +YNELL KG  FE+VF+S D++E++F+EY+  MPW A+PF+D+
Sbjct  213  SAHWCGPCRSFTPQLVEIYNELLKKGEAFEIVFLSRDKEEKAFEEYYASMPWLALPFADN  272

Query  393  VTRERLDALFTVRGIPHLVILDESGKVTTEDGVDIVLEHGVEAYPF  530
             T+++L   F + GIP L+IL   GK    D V ++ E+G+ AYPF
Sbjct  273  -TQKKLSRYFRIEGIPTLIILGSDGKTIRNDAVGLIREYGIRAYPF  317



>emb|CAN63033.1| hypothetical protein VITISV_044051 [Vitis vinifera]
Length=570

 Score =   194 bits (494),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 92/152 (61%), Positives = 115/152 (76%), Gaps = 2/152 (1%)
 Frame = +3

Query  81   MAEQN--GDAHDLRSILCSSDRDFLIRNSGHQVKVDDLKGKKIGIYFSASWCGPCHRFTP  254
            MA +N  G AHDL  +L   DRDFL+R +GHQVKV+ LKGKKI +YFSASWCGP  +FTP
Sbjct  1    MASENVDGVAHDLVPLLTREDRDFLVRCNGHQVKVESLKGKKIWLYFSASWCGPRRQFTP  60

Query  255  NLATVYNELLPKGNFEVVFVSADEDEESFKEYFGKMPWTAVPFSDSVTRERLDALFTVRG  434
             L  VY+E   KG+FE++FVS D+ ++ F EYF KMPW A+PFSDS TR+ L  LF VRG
Sbjct  61   ELVEVYDEFSSKGDFEIIFVSRDKGDQLFNEYFSKMPWLAIPFSDSDTRDHLKKLFKVRG  120

Query  435  IPHLVILDESGKVTTEDGVDIVLEHGVEAYPF  530
            IP L +LDESGKV + +GV+I+ ++GVE YPF
Sbjct  121  IPSLAMLDESGKVLSSEGVEIIKDYGVEGYPF  152


 Score =   129 bits (325),  Expect = 8e-32, Method: Compositional matrix adjust.
 Identities = 63/145 (43%), Positives = 86/145 (59%), Gaps = 2/145 (1%)
 Frame = +3

Query  99   DAHDLRSILCSSDRDFLIRNSGHQVKVDDLKGKKIGIYFSASWCGPCHRFTPNLATVYNE  278
            +A  L SIL S +RDF+I     ++ V DL GK I +YFSA WC PC  F P L   Y  
Sbjct  329  EAQTLESILVSGNRDFVIGKDRVKIPVSDLVGKNILLYFSAHWCPPCRAFLPKLIEAYQN  388

Query  279  LLPKGN-FEVVFVSADEDEESFKEYFGKMPWTAVPFSDSVTRERLDALFTVRGIPHLVIL  455
            +  K   FEV+F+S+D D+ SF E+F  MPW A+PF D   +  L   F VR IP L+ +
Sbjct  389  IKAKDEAFEVIFISSDRDQASFDEFFSGMPWXALPFGDK-RKASLGRTFKVRSIPKLIAV  447

Query  456  DESGKVTTEDGVDIVLEHGVEAYPF  530
            + +G+  T +   +V+ HG +AYPF
Sbjct  448  EPTGRTVTTEARTLVMIHGADAYPF  472


 Score =   115 bits (288),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 60/143 (42%), Positives = 86/143 (60%), Gaps = 2/143 (1%)
 Frame = +3

Query  105  HDLRSILCSSDRDFLIRNSGHQVKVDDLKGKKIGIYFSASWCGPCHRFTPNLATVYNELL  284
              L SIL S  RD++I   G +V V +L+GK +G+YFS S   P  +FT  L  VY +L 
Sbjct  171  QSLISILVSQSRDYVISTDGKRVPVSELEGKFVGLYFSLSSSKPRLQFTRTLVDVYKKLR  230

Query  285  PKG-NFEVVFVSADEDEESFKEYFGKMPWTAVPFSDSVTRERLDALFTVRGIPHLVILDE  461
             KG +FE+V +S D++ ESFK  FG MPW A+PF D   + +L   F +  +P LV++  
Sbjct  231  AKGESFEIVMISLDDEIESFKTNFGSMPWLALPFKDRSCK-KLARYFELSALPTLVVIGP  289

Query  462  SGKVTTEDGVDIVLEHGVEAYPF  530
             GK    +  + + EHG++AYPF
Sbjct  290  DGKTLHSNVAEAIQEHGIQAYPF  312



>ref|XP_008353015.1| PREDICTED: probable nucleoredoxin 1 [Malus domestica]
Length=399

 Score =   191 bits (484),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 85/149 (57%), Positives = 114/149 (77%), Gaps = 0/149 (0%)
 Frame = +3

Query  84   AEQNGDAHDLRSILCSSDRDFLIRNSGHQVKVDDLKGKKIGIYFSASWCGPCHRFTPNLA  263
             +++G  HDL S+L S+DR+FL+RN+G QV++  L GK +G+YFSA+WCGPC RFTP+L 
Sbjct  4    GDEHGVTHDLLSLLSSADRNFLLRNNGDQVEISSLTGKIVGLYFSATWCGPCLRFTPDLV  63

Query  264  TVYNELLPKGNFEVVFVSADEDEESFKEYFGKMPWTAVPFSDSVTRERLDALFTVRGIPH  443
             V+ EL  KG+FEVVF+S+D DEES+  YF KMPW ++PF DS TR+RL   F VRGIP+
Sbjct  64   EVHQELAAKGDFEVVFISSDRDEESYTGYFSKMPWLSIPFWDSETRKRLKEFFKVRGIPN  123

Query  444  LVILDESGKVTTEDGVDIVLEHGVEAYPF  530
            LVI+D +GKV+ +DG  IV ++G   YPF
Sbjct  124  LVIIDANGKVSIDDGTKIVRDYGANGYPF  152


 Score =   137 bits (345),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 67/144 (47%), Positives = 91/144 (63%), Gaps = 2/144 (1%)
 Frame = +3

Query  102  AHDLRSILCSSDRDFLIRNSGHQVKVDDLKGKKIGIYFSASWCGPCHRFTPNLATVYNEL  281
            A  L SIL S DR+F+I   G Q+ V DL GK I +YFSA WC PC  F P L   Y+E+
Sbjct  170  AQTLESILISGDRNFVIGKDGTQIPVADLVGKNILLYFSAHWCPPCRAFLPTLVEAYHEI  229

Query  282  LPKGN-FEVVFVSADEDEESFKEYFGKMPWTAVPFSDSVTRERLDALFTVRGIPHLVILD  458
              K + FEV+F+S+D D++SF E+F  MPW A+PF DS  +  L   F V+GIP LV + 
Sbjct  230  KAKDDAFEVIFISSDRDQDSFDEFFATMPWLALPFGDS-RKAFLSRKFKVQGIPMLVAIG  288

Query  459  ESGKVTTEDGVDIVLEHGVEAYPF  530
             +G+  T +  + ++ HG +AYPF
Sbjct  289  PTGQTVTREARNHIMAHGAKAYPF  312



>ref|XP_010651408.1| PREDICTED: probable nucleoredoxin 1 isoform X1 [Vitis vinifera]
Length=570

 Score =   194 bits (494),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 92/152 (61%), Positives = 115/152 (76%), Gaps = 2/152 (1%)
 Frame = +3

Query  81   MAEQN--GDAHDLRSILCSSDRDFLIRNSGHQVKVDDLKGKKIGIYFSASWCGPCHRFTP  254
            MA +N  G AHDL  +L   DRDFL+R +GHQVKV+ LKGKKI +YFSASWCGP  +FTP
Sbjct  1    MASENVDGVAHDLVPLLTREDRDFLVRCNGHQVKVESLKGKKIWLYFSASWCGPRRQFTP  60

Query  255  NLATVYNELLPKGNFEVVFVSADEDEESFKEYFGKMPWTAVPFSDSVTRERLDALFTVRG  434
             L  VY+E   KG+FE++FVS D+ ++ F EYF KMPW A+PFSDS TR+ L  LF VRG
Sbjct  61   ELVEVYDEFSSKGDFEIIFVSRDKGDQLFNEYFSKMPWLAIPFSDSDTRDHLKKLFKVRG  120

Query  435  IPHLVILDESGKVTTEDGVDIVLEHGVEAYPF  530
            IP L +LDESGKV + +GV+I+ ++GVE YPF
Sbjct  121  IPSLAMLDESGKVLSSEGVEIIKDYGVEGYPF  152


 Score =   129 bits (324),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 63/145 (43%), Positives = 86/145 (59%), Gaps = 2/145 (1%)
 Frame = +3

Query  99   DAHDLRSILCSSDRDFLIRNSGHQVKVDDLKGKKIGIYFSASWCGPCHRFTPNLATVYNE  278
            +A  L SIL S +RDF+I     ++ V DL GK I +YFSA WC PC  F P L   Y  
Sbjct  329  EAQTLESILVSGNRDFVIGKDRVKIPVSDLVGKNILLYFSAHWCPPCRAFLPKLIEAYQN  388

Query  279  LLPKGN-FEVVFVSADEDEESFKEYFGKMPWTAVPFSDSVTRERLDALFTVRGIPHLVIL  455
            +  K   FEV+F+S+D D+ SF E+F  MPW A+PF D   +  L   F VR IP L+ +
Sbjct  389  IKAKDEAFEVIFISSDRDQASFDEFFSGMPWLALPFGDK-RKASLGRTFKVRSIPKLIAV  447

Query  456  DESGKVTTEDGVDIVLEHGVEAYPF  530
            + +G+  T +   +V+ HG +AYPF
Sbjct  448  EPTGRTVTTEARTLVMIHGADAYPF  472


 Score =   115 bits (288),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 60/143 (42%), Positives = 86/143 (60%), Gaps = 2/143 (1%)
 Frame = +3

Query  105  HDLRSILCSSDRDFLIRNSGHQVKVDDLKGKKIGIYFSASWCGPCHRFTPNLATVYNELL  284
              L SIL S  RD++I   G +V V +L+GK +G+YFS S   P  +FT  L  VY +L 
Sbjct  171  QSLISILVSQSRDYVISTDGKRVPVSELEGKFVGLYFSLSSSKPRLQFTRTLVDVYKKLR  230

Query  285  PKG-NFEVVFVSADEDEESFKEYFGKMPWTAVPFSDSVTRERLDALFTVRGIPHLVILDE  461
             KG +FE+V +S D++ ESFK  FG MPW A+PF D   + +L   F +  +P LV++  
Sbjct  231  AKGESFEIVMISLDDEIESFKTNFGSMPWLALPFKDRSCK-KLARYFELSALPTLVVIGP  289

Query  462  SGKVTTEDGVDIVLEHGVEAYPF  530
             GK    +  + + EHG++AYPF
Sbjct  290  DGKTLHSNVAEAIQEHGIQAYPF  312



>ref|XP_008221830.1| PREDICTED: probable nucleoredoxin 1 [Prunus mume]
Length=561

 Score =   192 bits (489),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 85/149 (57%), Positives = 113/149 (76%), Gaps = 0/149 (0%)
 Frame = +3

Query  84   AEQNGDAHDLRSILCSSDRDFLIRNSGHQVKVDDLKGKKIGIYFSASWCGPCHRFTPNLA  263
             +++G  HDL S+L S DR+FL+RN+  QV +  L GK +G+YFS SWCGPC RFTP+L 
Sbjct  4    GDEDGVVHDLFSLLSSEDRNFLVRNNADQVDISSLSGKIVGLYFSGSWCGPCRRFTPSLV  63

Query  264  TVYNELLPKGNFEVVFVSADEDEESFKEYFGKMPWTAVPFSDSVTRERLDALFTVRGIPH  443
             VY +L  KG+FEVVF+S+D D++SF  YF +MPW A+PFSD   R+RL  LF VRGIP+
Sbjct  64   EVYQDLASKGDFEVVFISSDRDDKSFSGYFSEMPWLAIPFSDLEARKRLKELFKVRGIPN  123

Query  444  LVILDESGKVTTEDGVDIVLEHGVEAYPF  530
            LVI+D +GKV+T+ G  +V+EHGV+ YPF
Sbjct  124  LVIIDANGKVSTDQGTRVVMEHGVDGYPF  152


 Score =   108 bits (269),  Expect = 5e-24, Method: Compositional matrix adjust.
 Identities = 56/153 (37%), Positives = 89/153 (58%), Gaps = 8/153 (5%)
 Frame = +3

Query  75   SSMAEQNGDAHDLRSILCSSDRDFLIRNSGHQVKVDDLKGKKIGIYFSASWCGPCHRFTP  254
            + +++   +   L S+L + DR+F+I  +G +V V +L GK I +YFSA WC PC  F P
Sbjct  320  AEISKAKLEEQTLESLLVAGDRNFVIEKTGSKVPVSELAGKHIMLYFSAHWCPPCRAFMP  379

Query  255  NLATVYNELLPKGN-FEVVFVSADEDEESFKEYFGKMPWTAVPFSDSVTRERLDALFTVR  431
             L   YN++  K + FE++F+S+D D  SFKE+F  MPW A+P  D   +  +   F ++
Sbjct  380  KLIKAYNQIKAKDSAFEIIFISSDRDHSSFKEFFLTMPWLALPLGDP-RKALVQRKFKIQ  438

Query  432  GIPHLVILDESGKVTTEDGVDIVLEHGVEAYPF  530
              P+    D S  +TT+    ++  +G +AYPF
Sbjct  439  P-PN----DSSHHITTQ-ARQLIQAYGADAYPF  465


 Score =   103 bits (257),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 55/131 (42%), Positives = 81/131 (62%), Gaps = 3/131 (2%)
 Frame = +3

Query  141  DFLIRNSGHQVKVDDLKGKKIGIYFSASWCGPCHRFTPNLATVYNELLPKG-NFEVVFVS  317
            D+LI   G +V V +L+GK +G+YFS     PC  FT  L   + +L  KG NFE+V +S
Sbjct  183  DYLISKEGSKVPVSELEGKMVGLYFSLHTHKPCKDFTQALLKFHEKLKEKGENFEIVLIS  242

Query  318  ADEDEESFKEYFGKMPWTAVPFSDSVTRERLDALFTVRGIPHLVILDESGKVTTEDGVDI  497
             D +EE FKE F + PW A+PF  + + E+L   F +  +P LVI+ + GK    + V++
Sbjct  243  LDYEEEHFKEGF-QAPWLALPFK-AKSCEKLARHFELENVPTLVIIGQDGKTLRPNAVEL  300

Query  498  VLEHGVEAYPF  530
            + E+G+EAYPF
Sbjct  301  IEEYGIEAYPF  311



>ref|XP_011014070.1| PREDICTED: probable nucleoredoxin 1 [Populus euphratica]
Length=539

 Score =   192 bits (487),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 87/143 (61%), Positives = 109/143 (76%), Gaps = 0/143 (0%)
 Frame = +3

Query  102  AHDLRSILCSSDRDFLIRNSGHQVKVDDLKGKKIGIYFSASWCGPCHRFTPNLATVYNEL  281
            +HDL ++L S +RDFLIRN+G QVKV +L GK +G YFS SWCGPC  FTP L  VY +L
Sbjct  7    SHDLSALLSSEERDFLIRNNGDQVKVSNLVGKIVGFYFSGSWCGPCRNFTPLLVEVYEQL  66

Query  282  LPKGNFEVVFVSADEDEESFKEYFGKMPWTAVPFSDSVTRERLDALFTVRGIPHLVILDE  461
              KG+FEVVF+S+D D+ESF  YF +MPW A+PFSD+ TR+RL  +F VRGIP+LVI D 
Sbjct  67   SSKGDFEVVFISSDRDDESFNTYFSEMPWLAIPFSDTETRKRLKEVFKVRGIPNLVIFDT  126

Query  462  SGKVTTEDGVDIVLEHGVEAYPF  530
            +GKV+ + GV  V EHGV+ YPF
Sbjct  127  NGKVSCDSGVSTVKEHGVDGYPF  149


 Score =   130 bits (326),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 69/154 (45%), Positives = 96/154 (62%), Gaps = 5/154 (3%)
 Frame = +3

Query  81   MAEQNGDA---HDLRSILCSSDRDFLIRNSGHQVKVDDLKGKKIGIYFSASWCGPCHRFT  251
            + EQ  +A     + SIL SS RD++I N G  + V DL+GK +G+YFSA     C  FT
Sbjct  157  LKEQEENAKKNQTISSILVSSSRDYVISNDGKTIPVLDLEGKLVGLYFSAHARRMCREFT  216

Query  252  PNLATVYNELLPKG-NFEVVFVSADEDEESFKEYFGKMPWTAVPFSDSVTRERLDALFTV  428
            P L  +Y  L  K  NFEVV +S D++EE+FKE F  MPW A+PF D  + E+L   F +
Sbjct  217  PKLVELYKTLTEKRENFEVVLISLDDEEENFKESFETMPWLALPFKDK-SCEKLVRYFEL  275

Query  429  RGIPHLVILDESGKVTTEDGVDIVLEHGVEAYPF  530
            R IP+LVI+ + GK    +  +++ +HG+EAYPF
Sbjct  276  RTIPNLVIIGQDGKTLNPNVAELIEDHGIEAYPF  309


 Score =   122 bits (307),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 63/166 (38%), Positives = 97/166 (58%), Gaps = 4/166 (2%)
 Frame = +3

Query  36   FQFSKRKGEERKASSMAEQNGDAHDLRSILCSSDRDFLIRNSGHQVKVDDLKGKKIGIYF  215
            + F+  K EE  A   A+   ++  L S+L + + DF+I  SG +V V +L GK I +YF
Sbjct  307  YPFTPEKLEELAAIEKAKL--ESQTLESVLVNGENDFVIDKSGSKVPVSELVGKNILLYF  364

Query  216  SASWCGPCHRFTPNLATVYNELLPKGN-FEVVFVSADEDEESFKEYFGKMPWTAVPFSDS  392
            SA WC PC  F P L   Y+ +  K N FEV+F+S+D D+ +F E++ +MPW A+PF D 
Sbjct  365  SAQWCPPCRAFLPKLIEAYHTIKAKDNAFEVIFISSDSDQSTFDEFYSEMPWLALPFGDE  424

Query  393  VTRERLDALFTVRGIPHLVILDESGKVTTEDGVDIVLEHGVEAYPF  530
              ++ L   F + GIP  V +  SG+  T++    +  +G +A+PF
Sbjct  425  -RKQILGRKFKIEGIPAAVAIGPSGRTITKEARMHLTAYGADAFPF  469



>ref|XP_008782777.1| PREDICTED: probable nucleoredoxin 1-1 [Phoenix dactylifera]
Length=583

 Score =   192 bits (488),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 93/156 (60%), Positives = 116/156 (74%), Gaps = 3/156 (2%)
 Frame = +3

Query  72   ASSMAEQNGDA--HDLRSILCSSDRDFLIRNSGHQVKVDDLKGKKIGIYFSASWCGPCHR  245
            A    + NG A  HDL+S+L + +RDFL+RN+G QVK+ +L+GK IG+YFSASWC PC R
Sbjct  2    AGVGGDDNGAACRHDLKSLLAADERDFLVRNNGDQVKIANLEGKTIGLYFSASWCPPCRR  61

Query  246  FTPNLATVYNELLPKG-NFEVVFVSADEDEESFKEYFGKMPWTAVPFSDSVTRERLDALF  422
            FTP L   Y +L  +G +FEVVFVSAD DE+SF  YF KMPW A+PFSD+  R+RLD +F
Sbjct  62   FTPKLIETYGKLSSEGKDFEVVFVSADRDEDSFNGYFAKMPWLAIPFSDTKARDRLDEVF  121

Query  423  TVRGIPHLVILDESGKVTTEDGVDIVLEHGVEAYPF  530
             VRGIPHLVILD SG+V  E+GV  V ++G E YPF
Sbjct  122  KVRGIPHLVILDASGEVLNEEGVQAVGDYGSEGYPF  157


 Score =   130 bits (327),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 61/143 (43%), Positives = 92/143 (64%), Gaps = 2/143 (1%)
 Frame = +3

Query  105  HDLRSILCSSDRDFLIRNSGHQVKVDDLKGKKIGIYFSASWCGPCHRFTPNLATVYNELL  284
              L S+L S + D++I   G Q+ V +L GK I +YFSA WCGPC  F P L   Y ++ 
Sbjct  339  QSLESLLVSGEIDYVIGKDGVQIPVSELMGKNILLYFSAQWCGPCRAFLPKLIEEYRKIK  398

Query  285  PKGN-FEVVFVSADEDEESFKEYFGKMPWTAVPFSDSVTRERLDALFTVRGIPHLVILDE  461
             K + FEVVF+S+D D++SF+++   MPW A+PF D   ++ L+ +F +RGIP LV +  
Sbjct  399  DKDSAFEVVFISSDRDQKSFEDFLSGMPWLALPFGDE-RKKSLNRVFKIRGIPSLVAIGP  457

Query  462  SGKVTTEDGVDIVLEHGVEAYPF  530
            +G+  T+D   +++ HG +AYPF
Sbjct  458  TGRTVTKDAKLLLMIHGADAYPF  480


 Score =   119 bits (299),  Expect = 5e-28, Method: Compositional matrix adjust.
 Identities = 65/139 (47%), Positives = 88/139 (63%), Gaps = 2/139 (1%)
 Frame = +3

Query  111  LRSILCSSDRDFLIRNSGHQVKVDDLKGKKIGIYFSASWCGPCHRFTPNLATVYNELLPK  290
            L+++L S  RD+LI N+G+QV V +L+GK + +YFS S   PC  FT  LA +Y  L  K
Sbjct  178  LQTVLVSPSRDYLILNNGNQVPVSELEGKIVCLYFSVSGFQPCDEFTLVLAKIYRTLKEK  237

Query  291  G-NFEVVFVSADEDEESFKEYFGKMPWTAVPFSDSVTRERLDALFTVRGIPHLVILDESG  467
            G +FEVV VS D++E SFKE F  MPW A+PF D   + +L   F +R IP LV+L   G
Sbjct  238  GESFEVVMVSLDDEESSFKEGFAGMPWLAIPFGDESCK-KLVRYFELRTIPTLVVLGSDG  296

Query  468  KVTTEDGVDIVLEHGVEAY  524
            K    +  ++V EHG EA+
Sbjct  297  KTLHSNIAELVEEHGEEAW  315



>ref|XP_010682544.1| PREDICTED: probable nucleoredoxin 1 [Beta vulgaris subsp. vulgaris]
Length=514

 Score =   191 bits (485),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 87/154 (56%), Positives = 115/154 (75%), Gaps = 4/154 (3%)
 Frame = +3

Query  81   MAEQNG----DAHDLRSILCSSDRDFLIRNSGHQVKVDDLKGKKIGIYFSASWCGPCHRF  248
            MAE+N     + +DL S+  S +RDFLIRN+G +V + DL GK +G+YFSASWC PC  F
Sbjct  1    MAEENSINNNECYDLSSLFSSEERDFLIRNNGDKVNIKDLSGKILGLYFSASWCPPCRGF  60

Query  249  TPNLATVYNELLPKGNFEVVFVSADEDEESFKEYFGKMPWTAVPFSDSVTRERLDALFTV  428
            TP+L  VY EL  KG+FE+VF+S+D DEESF+ YF KMPW A+P SD+ T + L   F+V
Sbjct  61   TPSLIEVYKELSSKGDFEIVFISSDRDEESFQGYFSKMPWLAIPLSDNATIKSLKEKFSV  120

Query  429  RGIPHLVILDESGKVTTEDGVDIVLEHGVEAYPF  530
             GIPHLV LD+ GK++T++GV++V+EH  EAYPF
Sbjct  121  MGIPHLVFLDKDGKISTDEGVEVVMEHEAEAYPF  154


 Score =   129 bits (323),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 63/145 (43%), Positives = 88/145 (61%), Gaps = 2/145 (1%)
 Frame = +3

Query  99   DAHDLRSILCSSDRDFLIRNSGHQVKVDDLKGKKIGIYFSASWCGPCHRFTPNLATVYNE  278
            ++  L SIL   ++D++I  SG +V V  L GK + IYFSA WC PC  FTP L   Y+E
Sbjct  332  ESQTLESILVHGEKDYVIDKSGSKVPVSQLVGKHVLIYFSAHWCPPCRAFTPKLIETYHE  391

Query  279  LLPKGN-FEVVFVSADEDEESFKEYFGKMPWTAVPFSDSVTRERLDALFTVRGIPHLVIL  455
            +  K + FE++FVS+D D+ SF EY+  MPW A+PF D   +  L   F V+GIP LV +
Sbjct  392  IKAKESAFEIIFVSSDRDQPSFDEYYSDMPWLALPFGDE-RKAYLSRKFKVKGIPCLVAI  450

Query  456  DESGKVTTEDGVDIVLEHGVEAYPF  530
               GK  T +   ++  HG +A+PF
Sbjct  451  GPEGKTITTETRQLIGAHGADAFPF  475


 Score =   113 bits (282),  Expect = 6e-26, Method: Compositional matrix adjust.
 Identities = 63/164 (38%), Positives = 93/164 (57%), Gaps = 6/164 (4%)
 Frame = +3

Query  45   SKRKGEERKASSMAEQNGDAHDLRSILCSSDRDFLIRNSGHQVKVDDLKGKKIGIYFSAS  224
            S+R  + ++    A++N    +LR++L    RD++I +   +V V +L+GK +G+YF   
Sbjct  156  SERIDQLKEEEEAAKRN---QNLRNLLVYGSRDYVISSDETKVSVTELEGKMVGLYFCVG  212

Query  225  WCGPCHRFTPNLATVYNELLPKG-NFEVVFVSADEDEE-SFKEYFGKMPWTAVPFSDSVT  398
               PC  FT  L  VY +L  +G NFE+V +  DED+E  FKE    MPW ++PF D   
Sbjct  213  PYEPCTVFTQKLVEVYKKLREEGENFEIVLIYLDEDDEGGFKENLADMPWLSLPFKDKKI  272

Query  399  RERLDALFTVRGIPHLVILDESGKVTTEDGVDIVLEHGVEAYPF  530
             E+L   F +R IP LVI+   GK    D  +++ EHG  AYPF
Sbjct  273  -EKLVRYFELRSIPRLVIIGPDGKTLNPDVAELIQEHGAAAYPF  315



>ref|XP_007222607.1| hypothetical protein PRUPE_ppa003530mg [Prunus persica]
 gb|EMJ23806.1| hypothetical protein PRUPE_ppa003530mg [Prunus persica]
Length=567

 Score =   191 bits (485),  Expect = 4e-54, Method: Compositional matrix adjust.
 Identities = 84/149 (56%), Positives = 113/149 (76%), Gaps = 0/149 (0%)
 Frame = +3

Query  84   AEQNGDAHDLRSILCSSDRDFLIRNSGHQVKVDDLKGKKIGIYFSASWCGPCHRFTPNLA  263
             +++G  HDL S+L S DR+FL+ N+  QV++  L GK +G+YFS SWCGPC RFTP+L 
Sbjct  4    GDEDGVVHDLFSLLSSEDRNFLVHNNADQVEISSLSGKIVGLYFSGSWCGPCRRFTPSLV  63

Query  264  TVYNELLPKGNFEVVFVSADEDEESFKEYFGKMPWTAVPFSDSVTRERLDALFTVRGIPH  443
             VY +L  KG+FEVVF+S+D D++SF  YF +MPW A+PFSD   R+RL  LF VRGIP+
Sbjct  64   EVYQDLASKGDFEVVFISSDRDDKSFSGYFSEMPWLAIPFSDLEARKRLKELFKVRGIPN  123

Query  444  LVILDESGKVTTEDGVDIVLEHGVEAYPF  530
            LVI+D +GKV+T+ G  +V+EHGV+ YPF
Sbjct  124  LVIIDANGKVSTDQGTRVVMEHGVDGYPF  152


 Score =   126 bits (317),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 57/145 (39%), Positives = 87/145 (60%), Gaps = 2/145 (1%)
 Frame = +3

Query  99   DAHDLRSILCSSDRDFLIRNSGHQVKVDDLKGKKIGIYFSASWCGPCHRFTPNLATVYNE  278
            +   L S+L + DR+F+I  +G +V V +L GK I +YFSA WC PC  F P L   YN+
Sbjct  328  EEQTLESLLVAGDRNFVIEKTGSKVPVSELAGKHIMLYFSAHWCPPCRAFMPKLIKAYNQ  387

Query  279  LLPKGN-FEVVFVSADEDEESFKEYFGKMPWTAVPFSDSVTRERLDALFTVRGIPHLVIL  455
            +  K + FE++F+S+D D  SFKE+F  MPW A+P  D   +  +   F ++GIP LV +
Sbjct  388  IKAKDSAFEIIFISSDRDHSSFKEFFSTMPWLALPLGDP-RKALVQRKFKIQGIPALVAI  446

Query  456  DESGKVTTEDGVDIVLEHGVEAYPF  530
              +G+  +     ++  +G +AYPF
Sbjct  447  SPNGQTLSTQARQLIQAYGADAYPF  471


 Score =   103 bits (257),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 54/131 (41%), Positives = 82/131 (63%), Gaps = 3/131 (2%)
 Frame = +3

Query  141  DFLIRNSGHQVKVDDLKGKKIGIYFSASWCGPCHRFTPNLATVYNELLPKG-NFEVVFVS  317
            D+LI   G +V V +L+GK +G+YFS     PC  FT  L   + +L  KG NFE+V +S
Sbjct  183  DYLISKDGSKVPVSELEGKMVGLYFSLHTHKPCQDFTQALLKFHEKLKEKGENFEIVLIS  242

Query  318  ADEDEESFKEYFGKMPWTAVPFSDSVTRERLDALFTVRGIPHLVILDESGKVTTEDGVDI  497
             D +EE FK+ F ++PW A+PF  + + E+L   F +  +P LVI+ + GK    + V++
Sbjct  243  LDYEEEHFKQGF-QVPWLALPFK-AKSCEKLARHFELENVPTLVIIGQDGKTLRPNAVEL  300

Query  498  VLEHGVEAYPF  530
            + E+G+EAYPF
Sbjct  301  IEEYGIEAYPF  311



>ref|XP_010937313.1| PREDICTED: probable nucleoredoxin 1-2 [Elaeis guineensis]
Length=519

 Score =   189 bits (481),  Expect = 8e-54, Method: Compositional matrix adjust.
 Identities = 88/150 (59%), Positives = 110/150 (73%), Gaps = 1/150 (1%)
 Frame = +3

Query  84   AEQNGDAHDLRSILCSSDRDFLIRNSGHQVKVDDLKGKKIGIYFSASWCGPCHRFTPNLA  263
            A   G+ HDL+S+L   +RDFL+RN+G QV++ +L+GK IG+YFSASWC PC RFTP L 
Sbjct  11   AVNGGECHDLKSLLAGDERDFLVRNNGDQVRIANLEGKTIGLYFSASWCPPCRRFTPQLI  70

Query  264  TVYNELLPKGN-FEVVFVSADEDEESFKEYFGKMPWTAVPFSDSVTRERLDALFTVRGIP  440
              Y EL  +G   EVVFVS D DE+SF  YF KMPW A+PFSDS  R++L+ LF VRGIP
Sbjct  71   ETYGELSSEGKGLEVVFVSGDRDEDSFNGYFSKMPWLAIPFSDSKARDQLNKLFKVRGIP  130

Query  441  HLVILDESGKVTTEDGVDIVLEHGVEAYPF  530
            HLVILD  G+V  E+GV+ V ++G  AYPF
Sbjct  131  HLVILDARGEVVNEEGVEAVRDYGSGAYPF  160


 Score =   139 bits (351),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 70/153 (46%), Positives = 97/153 (63%), Gaps = 2/153 (1%)
 Frame = +3

Query  75   SSMAEQNGDAHDLRSILCSSDRDFLIRNSGHQVKVDDLKGKKIGIYFSASWCGPCHRFTP  254
            +  A+   +A  L S+L S + DF+I   G +V V +L GK I +YFSA WCGPC  F P
Sbjct  332  AEKAKAKLEAQTLESLLVSGEIDFVIGKDGVKVPVSELNGKTILLYFSARWCGPCRAFLP  391

Query  255  NLATVYNELLPKGN-FEVVFVSADEDEESFKEYFGKMPWTAVPFSDSVTRERLDALFTVR  431
             L   Y ++  K + FEVVF+S DED+ SF+++F  MPW A+PF D V ++ L+ LF +R
Sbjct  392  KLIEEYKKIKDKDSAFEVVFISDDEDQNSFEDFFSGMPWLALPFGD-VRKKSLNRLFKIR  450

Query  432  GIPHLVILDESGKVTTEDGVDIVLEHGVEAYPF  530
            GIP LV +  +GK  T D   ++L HG +AYPF
Sbjct  451  GIPSLVAIGPTGKTVTTDAKLLLLIHGADAYPF  483


 Score =   116 bits (290),  Expect = 5e-27, Method: Compositional matrix adjust.
 Identities = 64/146 (44%), Positives = 89/146 (61%), Gaps = 5/146 (3%)
 Frame = +3

Query  105  HDLRSILCSSDRDFLIRNSGHQVKVDDLKGKKIGIYFSASWCGPCHRFTPNLATVYNELL  284
              L+++L S  RD+LI N+G++V V +L+GK + +YF+ +   PC  FT  LA +Y  L 
Sbjct  179  QTLQTVLVSPSRDYLISNNGNKVSVSELEGKIVCLYFTVNGFDPCDEFTVVLAKIYKTLK  238

Query  285  PKG-NFEVVFVSADEDEESFKEYFGKMPWTAVPFSDSVTRERLDALFTVRGIPHLVILDE  461
             +G +FEVV VS D++E SFKE F  MPW A+PF D  +RERL   F     P LV+L  
Sbjct  239  ERGESFEVVLVSLDDEESSFKEGFASMPWLAIPFEDK-SRERLVHYFEFETPPTLVVLGP  297

Query  462  SGKVTTEDGVDIVLEHGVEA---YPF  530
             GK    +  ++V EHG EA   +PF
Sbjct  298  DGKTLHTNIAELVEEHGEEAWEGFPF  323



>ref|XP_010937315.1| PREDICTED: probable nucleoredoxin 1-2 [Elaeis guineensis]
Length=519

 Score =   189 bits (481),  Expect = 8e-54, Method: Compositional matrix adjust.
 Identities = 88/150 (59%), Positives = 110/150 (73%), Gaps = 1/150 (1%)
 Frame = +3

Query  84   AEQNGDAHDLRSILCSSDRDFLIRNSGHQVKVDDLKGKKIGIYFSASWCGPCHRFTPNLA  263
            A   G+ HDL+S+L   +RDFL+RN+G QV++ +L+GK IG+YFSASWC PC RFTP L 
Sbjct  11   AVNGGECHDLKSLLAGDERDFLVRNNGDQVRIANLEGKTIGLYFSASWCPPCRRFTPQLI  70

Query  264  TVYNELLPKGN-FEVVFVSADEDEESFKEYFGKMPWTAVPFSDSVTRERLDALFTVRGIP  440
              Y EL  +G   EVVFVS D DE+SF  YF KMPW A+PFSDS  R++L+ LF VRGIP
Sbjct  71   ETYGELSSEGKGLEVVFVSGDRDEDSFNGYFSKMPWLAIPFSDSKARDQLNKLFKVRGIP  130

Query  441  HLVILDESGKVTTEDGVDIVLEHGVEAYPF  530
            HLVILD  G+V  E+GV+ V ++G  AYPF
Sbjct  131  HLVILDARGEVVNEEGVEAVRDYGSGAYPF  160


 Score =   139 bits (350),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 70/153 (46%), Positives = 96/153 (63%), Gaps = 2/153 (1%)
 Frame = +3

Query  75   SSMAEQNGDAHDLRSILCSSDRDFLIRNSGHQVKVDDLKGKKIGIYFSASWCGPCHRFTP  254
            +  A+   +A  L S+L S + D++I   G QV V +L GK I +YFSA WCGPC  F P
Sbjct  332  AEKAKAKLEAQTLESLLVSGEIDYVIGKDGVQVPVSELNGKTILLYFSARWCGPCRAFLP  391

Query  255  NLATVYNELLPKGN-FEVVFVSADEDEESFKEYFGKMPWTAVPFSDSVTRERLDALFTVR  431
             L   Y ++  K + FEVVF+S DED+ SF+++F  MPW A+PF D V ++ L  LF +R
Sbjct  392  KLIEEYKKIKDKDSAFEVVFISDDEDQNSFEDFFSGMPWLALPFGD-VRKKSLSRLFKIR  450

Query  432  GIPHLVILDESGKVTTEDGVDIVLEHGVEAYPF  530
            GIP LV +  +GK  T D   ++L HG +AYPF
Sbjct  451  GIPSLVAIGPTGKTVTTDAKLLLLIHGADAYPF  483


 Score =   117 bits (294),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 64/146 (44%), Positives = 90/146 (62%), Gaps = 5/146 (3%)
 Frame = +3

Query  105  HDLRSILCSSDRDFLIRNSGHQVKVDDLKGKKIGIYFSASWCGPCHRFTPNLATVYNELL  284
              L+++L S  RD+LI N+G++V V +L+GK + +YF+ +   PC  FT  LA +Y  L 
Sbjct  179  QTLQTVLVSPSRDYLISNNGNKVSVSELEGKIVCLYFTVNGFDPCDEFTVVLAKIYKTLK  238

Query  285  PKG-NFEVVFVSADEDEESFKEYFGKMPWTAVPFSDSVTRERLDALFTVRGIPHLVILDE  461
             +G +FEVV VS D++E SFKE F  MPW A+PF D  +RERL   F +   P LV+L  
Sbjct  239  ERGESFEVVLVSLDDEESSFKEGFASMPWLAIPFEDK-SRERLVRYFELETAPTLVVLGP  297

Query  462  SGKVTTEDGVDIVLEHGVEA---YPF  530
             GK    +  ++V EHG EA   +PF
Sbjct  298  DGKTLHTNIAELVEEHGEEAWEGFPF  323



>ref|XP_011014064.1| PREDICTED: probable nucleoredoxin 1 [Populus euphratica]
Length=195

 Score =   179 bits (454),  Expect = 4e-53, Method: Compositional matrix adjust.
 Identities = 81/131 (62%), Positives = 100/131 (76%), Gaps = 0/131 (0%)
 Frame = +3

Query  138  RDFLIRNSGHQVKVDDLKGKKIGIYFSASWCGPCHRFTPNLATVYNELLPKGNFEVVFVS  317
            RDFLIRN+G QV V +L GK +G+YFS SWCGPC  FTP L  VY +L  KG+FEVVF+S
Sbjct  19   RDFLIRNNGDQVPVSNLVGKIVGVYFSGSWCGPCRNFTPLLVEVYEQLSSKGDFEVVFIS  78

Query  318  ADEDEESFKEYFGKMPWTAVPFSDSVTRERLDALFTVRGIPHLVILDESGKVTTEDGVDI  497
            +D D+ESF  YF +MPW A+PFSD+ TR+RL  +F VRGIP+LVI D +GKV+ + GV  
Sbjct  79   SDRDDESFNTYFSEMPWLAIPFSDTETRKRLKEVFKVRGIPNLVIFDTNGKVSCDSGVST  138

Query  498  VLEHGVEAYPF  530
            V EHGV+ YPF
Sbjct  139  VKEHGVDGYPF  149



>gb|ABK25413.1| unknown [Picea sitchensis]
Length=587

 Score =   189 bits (479),  Expect = 4e-53, Method: Compositional matrix adjust.
 Identities = 86/148 (58%), Positives = 116/148 (78%), Gaps = 1/148 (1%)
 Frame = +3

Query  90   QNGDAHD-LRSILCSSDRDFLIRNSGHQVKVDDLKGKKIGIYFSASWCGPCHRFTPNLAT  266
            Q G++H+ L S+LCS +RDFLIRN+G +VKV++L+GK +G+YFSA WC PC  FTP L+ 
Sbjct  10   QAGESHESLSSLLCSEERDFLIRNNGEKVKVEELEGKYVGLYFSAHWCPPCRYFTPVLSE  69

Query  267  VYNELLPKGNFEVVFVSADEDEESFKEYFGKMPWTAVPFSDSVTRERLDALFTVRGIPHL  446
            +Y +LL KG+FE+VF+SAD DE+SF+EY   MPW A+PFSD  TR++LD +F V GIP L
Sbjct  70   IYKKLLEKGDFEIVFISADRDEKSFEEYHHTMPWLALPFSDENTRKKLDQVFKVDGIPCL  129

Query  447  VILDESGKVTTEDGVDIVLEHGVEAYPF  530
            V LD+ G+  T +GV+ + E+GVEAYPF
Sbjct  130  VFLDKEGRAITTEGVETIGEYGVEAYPF  157


 Score =   159 bits (402),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 76/166 (46%), Positives = 111/166 (67%), Gaps = 4/166 (2%)
 Frame = +3

Query  36   FQFSKRKGEERKASSMAEQNGDAHDLRSILCSSDRDFLIRNSGHQVKVDDLKGKKIGIYF  215
            + F+  + +E KA   A +   A  + S+L S +RDF++ + G QV V +L GK +G+YF
Sbjct  155  YPFTAERIDELKAKEEALRA--AQTVESLLLSDERDFVLGHEGTQVPVAELAGKTVGLYF  212

Query  216  SASWCGPCHRFTPNLATVYNELLPKGN-FEVVFVSADEDEESFKEYFGKMPWTAVPFSDS  392
            SA WCGPC  FTP L  +YNELL KG  FE+VF+S D++E++F+EY+  MPW A+PF+D+
Sbjct  213  SAHWCGPCRSFTPQLVEIYNELLKKGEAFEIVFLSRDKEEKAFEEYYASMPWLALPFADN  272

Query  393  VTRERLDALFTVRGIPHLVILDESGKVTTEDGVDIVLEHGVEAYPF  530
             T+++L   F + GIP L+IL   GK    D V ++ E+G+ AYPF
Sbjct  273  -TQKKLSRYFRIEGIPTLIILGPDGKTIRNDAVGLIREYGIRAYPF  317


 Score =   152 bits (383),  Expect = 8e-40, Method: Compositional matrix adjust.
 Identities = 73/166 (44%), Positives = 111/166 (67%), Gaps = 4/166 (2%)
 Frame = +3

Query  36   FQFSKRKGEERKASSMAEQNGDAHDLRSILCSSDRDFLIRNSGHQVKVDDLKGKKIGIYF  215
            + F+K + ++ +A   A++  +A  L S+L S +R+F+I++ G QV V +L GK + +YF
Sbjct  315  YPFTKERLDDLEAEEKAKR--EAQTLESVLVSDERNFVIKHGGAQVLVSELVGKTVALYF  372

Query  216  SASWCGPCHRFTPNLATVYNELLPKGN-FEVVFVSADEDEESFKEYFGKMPWTAVPFSDS  392
            SA WC PC  FTP L  VYNEL  +G  FE+VF+S+D+D+E+F++Y+  MPW A+PF D 
Sbjct  373  SAHWCPPCRGFTPKLIQVYNELKERGEAFEIVFISSDKDQEAFEDYYKSMPWLALPFGDK  432

Query  393  VTRERLDALFTVRGIPHLVILDESGKVTTEDGVDIVLEHGVEAYPF  530
             T++ L  +F VRGIP L+++   GK  T++    V  HG +AYPF
Sbjct  433  -TKKDLSRIFRVRGIPSLIVVGPDGKTLTDNARGAVSTHGAKAYPF  477



>ref|XP_010937316.1| PREDICTED: probable nucleoredoxin 1-1 [Elaeis guineensis]
Length=614

 Score =   189 bits (479),  Expect = 6e-53, Method: Compositional matrix adjust.
 Identities = 91/150 (61%), Positives = 107/150 (71%), Gaps = 1/150 (1%)
 Frame = +3

Query  84   AEQNGDAHDLRSILCSSDRDFLIRNSGHQVKVDDLKGKKIGIYFSASWCGPCHRFTPNLA  263
            A   G+ HDL+SIL   +RDFLI N+G QVK+ +L+GK +G+YFSASWC PC  FTP L 
Sbjct  40   ASDGGECHDLKSILAGDERDFLIHNNGDQVKIANLEGKTVGLYFSASWCPPCRGFTPKLI  99

Query  264  TVYNELLPKG-NFEVVFVSADEDEESFKEYFGKMPWTAVPFSDSVTRERLDALFTVRGIP  440
              Y EL  +G +FEVVFVS D DE+SF  YF KMPW A+PFSDS  R+RLD LF VRGIP
Sbjct  100  ETYGELSSEGKDFEVVFVSGDRDEDSFNGYFSKMPWLAIPFSDSKARDRLDELFKVRGIP  159

Query  441  HLVILDESGKVTTEDGVDIVLEHGVEAYPF  530
            HLVIL   G+V  E GV  V E+G E YPF
Sbjct  160  HLVILGARGEVLNEKGVPAVREYGSEGYPF  189


 Score =   136 bits (343),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 71/166 (43%), Positives = 102/166 (61%), Gaps = 4/166 (2%)
 Frame = +3

Query  36   FQFSKRKGEERKASSMAEQNGDAHDLRSILCSSDRDFLIRNSGHQVKVDDLKGKKIGIYF  215
            F FS+ K +    +  A+   +A  L S+L S + D++I   G +V V +L GK I +YF
Sbjct  350  FPFSQDKMD--MLAEKAKAKLEAQTLESLLVSGELDYVIGKDGVKVPVSELIGKNILLYF  407

Query  216  SASWCGPCHRFTPNLATVYNELLPKGN-FEVVFVSADEDEESFKEYFGKMPWTAVPFSDS  392
            SA WCGPC  F P L   YN++  K + FE+VFVS+D D+ SF+++F  MPW A+PF D 
Sbjct  408  SAKWCGPCRAFLPKLVEEYNKIKEKDSAFELVFVSSDRDQNSFEDFFSGMPWLALPFGDE  467

Query  393  VTRERLDALFTVRGIPHLVILDESGKVTTEDGVDIVLEHGVEAYPF  530
              ++ L  LF +RGIP LV +  +GK  T D   +++ HG +AYPF
Sbjct  468  -RKKTLSRLFKIRGIPSLVAIGPTGKTVTTDARHLLMIHGADAYPF  512


 Score =   110 bits (274),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 58/139 (42%), Positives = 85/139 (61%), Gaps = 2/139 (1%)
 Frame = +3

Query  111  LRSILCSSDRDFLIRNSGHQVKVDDLKGKKIGIYFSASWCGPCHRFTPNLATVYNELLPK  290
            L+++L S  RD+LI N G++V V +L+GK + +YF+ +   PC  FT  L  +Y +L  +
Sbjct  210  LQTVLVSPSRDYLISNDGNKVSVSELEGKIVCLYFTINGMKPCDEFTLVLGKIYRKLKER  269

Query  291  G-NFEVVFVSADEDEESFKEYFGKMPWTAVPFSDSVTRERLDALFTVRGIPHLVILDESG  467
            G +FEVV VS D++E SFK  F  MPW A+PF D     +L   F +R +P LV+L   G
Sbjct  270  GESFEVVMVSLDDEESSFKGGFATMPWLAIPFQDKSCG-KLVRYFELRTVPTLVVLGADG  328

Query  468  KVTTEDGVDIVLEHGVEAY  524
            K    +  ++V EHG EA+
Sbjct  329  KTLHSNIAEVVEEHGEEAW  347



>ref|XP_008448920.1| PREDICTED: probable nucleoredoxin 1 [Cucumis melo]
Length=562

 Score =   187 bits (474),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 84/142 (59%), Positives = 111/142 (78%), Gaps = 0/142 (0%)
 Frame = +3

Query  105  HDLRSILCSSDRDFLIRNSGHQVKVDDLKGKKIGIYFSASWCGPCHRFTPNLATVYNELL  284
            H L ++  S  +++L+RN+G +V+++ LKGK +G+YFSA+WCG   RFTP+L  VYNEL 
Sbjct  12   HFLHALFRSETQNYLLRNNGEKVEIEMLKGKTLGLYFSAAWCGQSQRFTPSLVEVYNELS  71

Query  285  PKGNFEVVFVSADEDEESFKEYFGKMPWTAVPFSDSVTRERLDALFTVRGIPHLVILDES  464
             K NFEV+FVSAD+DE+SF++YF KMPW AVPFSD   R+ LD+LF VRGIP L+ILD++
Sbjct  72   SKANFEVIFVSADDDEKSFRKYFSKMPWLAVPFSDLERRDHLDSLFEVRGIPQLIILDKN  131

Query  465  GKVTTEDGVDIVLEHGVEAYPF  530
            GK +T+ GVD VLE G E YPF
Sbjct  132  GKFSTDSGVDFVLEFGAEGYPF  153


 Score =   124 bits (310),  Expect = 9e-30, Method: Compositional matrix adjust.
 Identities = 65/167 (39%), Positives = 93/167 (56%), Gaps = 4/167 (2%)
 Frame = +3

Query  36   FQFSKRKGEERKASSMAEQNGDAHDLRSILCSSDRDFLIRNSGHQVKVDDLKGKKIGIYF  215
            + F++ K  E      A++  +A  L SIL   + D++I+N   ++ V +L GK I IY 
Sbjct  311  YPFTEEKFAELAKIEKAKE--EAQTLESILVLGEHDYVIKNDETKIPVSNLVGKNILIYI  368

Query  216  SASWCGPCHRFTPNLATVYNELLPK-GNFEVVFVSADEDEESFKEYFGKMPWTAVPFSDS  392
            SA WC PC  F P L   Y+ +  K  N EV+F+S D DE SFK  F +MPW AVPF D 
Sbjct  369  SADWCPPCRVFLPKLIETYHNVKKKDDNLEVIFISCDRDESSFKNMFSRMPWLAVPFDDQ  428

Query  393  VTRE-RLDALFTVRGIPHLVILDESGKVTTEDGVDIVLEHGVEAYPF  530
                 R      V G+P L+ + E G+  T+D V+++  +G +AYPF
Sbjct  429  RKASIRRKFKVQVEGMPALISIGEDGRTVTDDAVELISNYGAKAYPF  475


 Score =   114 bits (286),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 62/141 (44%), Positives = 85/141 (60%), Gaps = 2/141 (1%)
 Frame = +3

Query  111  LRSILCSSDRDFLIRNSGHQVKVDDLKGKKIGIYFSASWCGPCHRFTPNLATVYNELLPK  290
            LRSI+ SS RDF+I + G +V V +L+GK IG+YFS S    C  FTP L   Y +L  K
Sbjct  174  LRSIMVSSSRDFVITSKGEKVPVAELEGKVIGLYFSLSSYERCIAFTPKLVDAYEKLKAK  233

Query  291  G-NFEVVFVSADEDEESFKEYFGKMPWTAVPFSDSVTRERLDALFTVRGIPHLVILDESG  467
            G  FE+V ++ D+DEE +KE    +PW A+PF D+   ++L   F V  +P LVI+ + G
Sbjct  234  GEKFEIVLIAIDQDEELYKEALRNVPWFALPFRDNRC-DKLIRYFEVSTLPTLVIIGQDG  292

Query  468  KVTTEDGVDIVLEHGVEAYPF  530
            K    +  + V EHG   YPF
Sbjct  293  KTLHSNVANAVAEHGFLPYPF  313



>ref|XP_008459538.1| PREDICTED: probable nucleoredoxin 1 [Cucumis melo]
 gb|AAU04765.1| protein disulfide isomerase (PDI)-like protein 1 [Cucumis melo]
 gb|AGH33852.1| PDI1 [Cucumis melo]
Length=341

 Score =   181 bits (460),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 83/143 (58%), Positives = 110/143 (77%), Gaps = 1/143 (1%)
 Frame = +3

Query  105  HDLRSILCSSDRDFLIRNSGHQVKVDDLKGKKIGIYFSASWCGPCHRFTPNLATVYNELL  284
            +DL+S+L S  RDFLIRN+G QVK+  L GK +G+YFSA WC PC  FTP LA VY EL 
Sbjct  7    YDLKSLLSSEGRDFLIRNNGDQVKISSLSGKIVGLYFSAGWCPPCRFFTPKLAKVYKELA  66

Query  285  PKGN-FEVVFVSADEDEESFKEYFGKMPWTAVPFSDSVTRERLDALFTVRGIPHLVILDE  461
             + N FEVVF+S+D DE SF+ YF +MPW ++PF DS T+ +L +LF + GIPHLV++D 
Sbjct  67   SENNDFEVVFISSDGDEYSFEAYFLRMPWLSIPFEDSETKTKLKSLFQLSGIPHLVVIDG  126

Query  462  SGKVTTEDGVDIVLEHGVEAYPF  530
            +GKV+++DGVD+V + GV+AYPF
Sbjct  127  NGKVSSDDGVDLVRDFGVDAYPF  149


 Score =   123 bits (309),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 66/168 (39%), Positives = 98/168 (58%), Gaps = 4/168 (2%)
 Frame = +3

Query  36   FQFSKRKGEERKASSMAEQNGDAHDLRSILCSSDRDFLIRNSGHQVKVDDLKGKKIGIYF  215
            + F+  + ++       E   +   + S+L S+ R++++ N G+Q+ V +L+GK IG+YF
Sbjct  147  YPFTSDRKKQLLIQKEEEAKRNNQTIDSLLVSTSRNYVVSNDGNQIPVYELEGKLIGLYF  206

Query  216  SASWCGPCHRFTPNLATVYNELLPK-GNFEVVFVSAD--EDEESFKEYFGKMPWTAVPFS  386
            S      C  FTP L   YN+L  K  NFE+VF+S D  EDE  FKE F  MPW A+PF 
Sbjct  207  SKQGHEDCGNFTPKLIEAYNKLKKKEENFEIVFISLDEEEDENLFKEAFKTMPWLALPFK  266

Query  387  DSVTRERLDALFTVRGIPHLVILDESGKVTTEDGVDIVLEHGVEAYPF  530
            D   +E L   F V  IP LVI+ + GK +  + V+++  HG++AYPF
Sbjct  267  DERCQE-LKLYFEVTHIPALVIIGQDGKTSNPNAVELIKGHGIDAYPF  313



>ref|XP_010682545.1| PREDICTED: probable nucleoredoxin 1 [Beta vulgaris subsp. vulgaris]
Length=572

 Score =   186 bits (471),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 90/153 (59%), Positives = 112/153 (73%), Gaps = 3/153 (2%)
 Frame = +3

Query  81   MAEQNG---DAHDLRSILCSSDRDFLIRNSGHQVKVDDLKGKKIGIYFSASWCGPCHRFT  251
            MAE+N    + +DL S+L S +RDFLIRN+G +V + DL GK + +YFSASWC PC  FT
Sbjct  1    MAEENSINSECYDLSSLLSSEERDFLIRNNGDKVTIKDLSGKILALYFSASWCPPCRGFT  60

Query  252  PNLATVYNELLPKGNFEVVFVSADEDEESFKEYFGKMPWTAVPFSDSVTRERLDALFTVR  431
            P L  VY EL  KG+FEVVFVS+D DEESF+ YF KMPW A+P SD  T + L   F+V 
Sbjct  61   PILIEVYKELSSKGDFEVVFVSSDFDEESFQNYFSKMPWLAIPISDEATIKSLGEKFSVM  120

Query  432  GIPHLVILDESGKVTTEDGVDIVLEHGVEAYPF  530
            GIPHLVIL++ GKV+T++GV +V EH  EAYPF
Sbjct  121  GIPHLVILNKDGKVSTDEGVKVVKEHEAEAYPF  153


 Score =   132 bits (333),  Expect = 5e-33, Method: Compositional matrix adjust.
 Identities = 63/145 (43%), Positives = 91/145 (63%), Gaps = 2/145 (1%)
 Frame = +3

Query  99   DAHDLRSILCSSDRDFLIRNSGHQVKVDDLKGKKIGIYFSASWCGPCHRFTPNLATVYNE  278
            ++  L SIL S+++D+++  SG +V V  L GK + IYFSA WC PC  FTP L   Y+E
Sbjct  331  ESQTLESILVSAEKDYVVDKSGSKVSVSQLVGKHVLIYFSAHWCPPCRAFTPKLIETYHE  390

Query  279  LLPKGN-FEVVFVSADEDEESFKEYFGKMPWTAVPFSDSVTRERLDALFTVRGIPHLVIL  455
            +  K + FE++FVS+D D+ SF EY+  MPW A+PF D   +  L   F V+GIP LV +
Sbjct  391  IKAKESAFEIIFVSSDRDQSSFDEYYSHMPWLALPFGDE-RKAYLSRKFKVKGIPCLVAI  449

Query  456  DESGKVTTEDGVDIVLEHGVEAYPF  530
               GK  T +  +++  HG +A+PF
Sbjct  450  GPQGKTITTEARELIGSHGADAFPF  474


 Score =   111 bits (278),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 61/144 (42%), Positives = 80/144 (56%), Gaps = 3/144 (2%)
 Frame = +3

Query  105  HDLRSILCSSDRDFLIRNSGHQVKVDDLKGKKIGIYFSASWCGPCHRFTPNLATVYNELL  284
              L ++L    RD++I N   +V + +L+GK +G+YF      PC  FT  L  VY  L 
Sbjct  172  QSLTNLLAHGPRDYVISNDEKKVPITELEGKMVGLYFCVGSYKPCTEFTRKLVEVYKSLK  231

Query  285  PKG-NFEVVFVSADEDEE-SFKEYFGKMPWTAVPFSDSVTRERLDALFTVRGIPHLVILD  458
              G NFEVV +  DED+E  FKE   +MPW A+PF D     RL   F +R IP LVI+ 
Sbjct  232  ENGENFEVVLIYLDEDDEGGFKEGLAEMPWVALPFKDKKIA-RLVRYFELRNIPRLVIIG  290

Query  459  ESGKVTTEDGVDIVLEHGVEAYPF  530
              GK    D V+++ EHG  AYPF
Sbjct  291  PDGKTLNPDVVELIDEHGAVAYPF  314



>ref|XP_006836611.1| hypothetical protein AMTR_s00131p00113720 [Amborella trichopoda]
 gb|ERM99464.1| hypothetical protein AMTR_s00131p00113720 [Amborella trichopoda]
Length=603

 Score =   186 bits (472),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 83/150 (55%), Positives = 111/150 (74%), Gaps = 0/150 (0%)
 Frame = +3

Query  81   MAEQNGDAHDLRSILCSSDRDFLIRNSGHQVKVDDLKGKKIGIYFSASWCGPCHRFTPNL  260
            +++   +  D++S+L    RDFL+RN+G QVK+D+L+GK +G+YFSASWCGPC RFTP L
Sbjct  16   LSDIKSEPLDIKSLLSGEGRDFLVRNNGDQVKIDNLEGKLVGLYFSASWCGPCRRFTPKL  75

Query  261  ATVYNELLPKGNFEVVFVSADEDEESFKEYFGKMPWTAVPFSDSVTRERLDALFTVRGIP  440
               Y++L   G+FEVVFVS D DE+SF++YF KMPW A+PFSDS  R +LD  F V GIP
Sbjct  76   IKTYDQLSTNGDFEVVFVSGDSDEKSFEDYFHKMPWLAIPFSDSTVRSKLDEGFEVYGIP  135

Query  441  HLVILDESGKVTTEDGVDIVLEHGVEAYPF  530
            HLVI+ +  K+ T +GV  V E+GV+ YPF
Sbjct  136  HLVIVGKDSKILTSEGVGTVSEYGVDGYPF  165


 Score =   142 bits (358),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 64/155 (41%), Positives = 98/155 (63%), Gaps = 2/155 (1%)
 Frame = +3

Query  69   KASSMAEQNGDAHDLRSILCSSDRDFLIRNSGHQVKVDDLKGKKIGIYFSASWCGPCHRF  248
            + + + ++  ++  L S+L S D DF+I   G +V + +L GK + +YFSA WC PC  F
Sbjct  332  QLAEIEKKRLESMTLESLLMSDDGDFIIGKGGIKVPISELVGKNVCLYFSAEWCPPCRAF  391

Query  249  TPNLATVYNELLPK-GNFEVVFVSADEDEESFKEYFGKMPWTAVPFSDSVTRERLDALFT  425
             P L   YNE+     NFE+VF+S+D+D+  F E+F  MPW A+PF D   +E+L   F 
Sbjct  392  LPKLIEAYNEIKTNDSNFEIVFISSDQDQGKFDEFFSSMPWLALPFGDK-AKEKLSRTFK  450

Query  426  VRGIPHLVILDESGKVTTEDGVDIVLEHGVEAYPF  530
            +RGIP LV LD+ G++ T D  ++++ HG +A+PF
Sbjct  451  IRGIPSLVALDKKGRLVTNDARNLIMRHGSKAFPF  485


 Score =   131 bits (329),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 68/166 (41%), Positives = 101/166 (61%), Gaps = 4/166 (2%)
 Frame = +3

Query  36   FQFSKRKGEERKASSMAEQNGDAHDLRSILCSSDRDFLIRNSGHQVKVDDLKGKKIGIYF  215
            + F+  + EE K     E+     +LR++L +  RDF+I N G Q+ + +L+GK IG+YF
Sbjct  163  YPFTNERLEELKEQD--EEIRQNQNLRTLLVTDRRDFVISNDGRQIPISELEGKTIGLYF  220

Query  216  SASWCGPCHRFTPNLATVYNELLPKG-NFEVVFVSADEDEESFKEYFGKMPWTAVPFSDS  392
            + S    C +FTP L  VY +L  KG +FE+V VS+DE+ + F E+F  MPW A+PF D 
Sbjct  221  AVSGHPFCEKFTPELIEVYKKLKEKGESFEIVLVSSDENIKDFNEHFSSMPWLALPFED-  279

Query  393  VTRERLDALFTVRGIPHLVILDESGKVTTEDGVDIVLEHGVEAYPF  530
            +   RL  LF ++G P L ++   GK   +D V+ + +HG EAYPF
Sbjct  280  IALSRLRRLFELQGFPTLTVIGPDGKTLKDDVVETIGDHGPEAYPF  325



>ref|XP_011041504.1| PREDICTED: probable nucleoredoxin 1 isoform X3 [Populus euphratica]
Length=499

 Score =   184 bits (467),  Expect = 6e-52, Method: Compositional matrix adjust.
 Identities = 87/143 (61%), Positives = 110/143 (77%), Gaps = 0/143 (0%)
 Frame = +3

Query  102  AHDLRSILCSSDRDFLIRNSGHQVKVDDLKGKKIGIYFSASWCGPCHRFTPNLATVYNEL  281
            +HDL S+L S +RDFLIRN+G QV+V +L GK +G YFS SWCGPC  FTP L  VY +L
Sbjct  7    SHDLSSLLSSGERDFLIRNNGDQVRVSNLVGKIVGFYFSGSWCGPCRNFTPLLVEVYEQL  66

Query  282  LPKGNFEVVFVSADEDEESFKEYFGKMPWTAVPFSDSVTRERLDALFTVRGIPHLVILDE  461
              KG+FEVVF+S+D D+ESF  YF +MPW A+PFSD+ TR+RL  +F V GIP+LVI D 
Sbjct  67   SSKGDFEVVFISSDRDDESFNTYFSEMPWLAIPFSDTETRQRLKEVFEVTGIPNLVIFDT  126

Query  462  SGKVTTEDGVDIVLEHGVEAYPF  530
            +GKV+ +DGV  V+EHGV+ YPF
Sbjct  127  NGKVSCDDGVSTVMEHGVDGYPF  149


 Score =   130 bits (326),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 71/154 (46%), Positives = 95/154 (62%), Gaps = 7/154 (5%)
 Frame = +3

Query  81   MAEQNGDA---HDLRSILCSSDRDFLIRNSGHQVKVDDLKGKKIGIYFSASWCGPCHRFT  251
            + EQ  +A     + SIL SS RD++I N G ++ V DL+GK +G+YFS      C  FT
Sbjct  157  LKEQEENAKKNQTISSILVSSSRDYVISNDGKKIPVLDLEGKLVGLYFSIH--AICCEFT  214

Query  252  PNLATVYNELLPKG-NFEVVFVSADEDEESFKEYFGKMPWTAVPFSDSVTRERLDALFTV  428
            P L  +Y  L  KG NFEVV +S D DEE FKE F  MPW A+PF D + + +L   F +
Sbjct  215  PKLVELYKTLKEKGENFEVVLISLDYDEEDFKESFETMPWLALPFKDKICK-KLVRYFEL  273

Query  429  RGIPHLVILDESGKVTTEDGVDIVLEHGVEAYPF  530
            R IP+LVI+ + GK    +  +++ EHGVEAYPF
Sbjct  274  RTIPNLVIIGQDGKTLNPNVAELIEEHGVEAYPF  307


 Score =   122 bits (307),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 62/166 (37%), Positives = 98/166 (59%), Gaps = 4/166 (2%)
 Frame = +3

Query  36   FQFSKRKGEERKASSMAEQNGDAHDLRSILCSSDRDFLIRNSGHQVKVDDLKGKKIGIYF  215
            + F+ +K +E  A   A+   ++  L S+L + + DF+I  SG +V V +L GK I +YF
Sbjct  305  YPFTPKKLDELAAIEKAKL--ESQTLESVLVNGENDFVIDKSGSKVPVSELVGKNILLYF  362

Query  216  SASWCGPCHRFTPNLATVYNELLPKGN-FEVVFVSADEDEESFKEYFGKMPWTAVPFSDS  392
            SA WC PC  F P L   Y+ +  K N FEV+F+S+D D+ +F E++ +MPW A+PF D 
Sbjct  363  SAQWCSPCRAFLPKLIEAYHTIKGKDNAFEVIFISSDSDQSTFDEFYSEMPWLALPFGDG  422

Query  393  VTRERLDALFTVRGIPHLVILDESGKVTTEDGVDIVLEHGVEAYPF  530
              ++ L   F + GIP  V +  SG+  T++    +  +G +A+PF
Sbjct  423  -RKQILSRKFKIEGIPAAVAIGPSGRTITKEARMHLTAYGADAFPF  467



>ref|NP_001105407.1| nucleoredoxin1 [Zea mays]
 gb|AAD04231.1| PDI-like protein [Zea mays]
Length=569

 Score =   185 bits (470),  Expect = 7e-52, Method: Compositional matrix adjust.
 Identities = 90/139 (65%), Positives = 106/139 (76%), Gaps = 2/139 (1%)
 Frame = +3

Query  120  ILCSSDRDFLIRNSGHQVKVDDLKGKKIGIYFSASWCGPCHRFTPNLATVYNELLPKG-N  296
            IL +SDRDFL+RNSG QVK+  ++   + IYFSASWC PC RFTP L  VY +L  +G +
Sbjct  15   ILATSDRDFLVRNSGEQVKISSVEASPVAIYFSASWCPPCRRFTPKLIEVYEKLASQGKS  74

Query  297  FEVVFVSADEDEESFKEYFGKMPWTAVPFSDSVTRERLDALFTVRGIPHLVILD-ESGKV  473
            FEVVF SAD +EE+F EYF KMPW AVPFSDS  RE LD  F V GIPHLVILD ++G+V
Sbjct  75   FEVVFASADRNEEAFNEYFAKMPWLAVPFSDSEGREALDGQFKVSGIPHLVILDAKTGEV  134

Query  474  TTEDGVDIVLEHGVEAYPF  530
             TEDGV+ V E+GVEAYPF
Sbjct  135  YTEDGVEFVSEYGVEAYPF  153


 Score =   127 bits (320),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 66/166 (40%), Positives = 95/166 (57%), Gaps = 4/166 (2%)
 Frame = +3

Query  36   FQFSKRKGEERKASSMAEQNGDAHDLRSILCSSDRDFLIRNSGHQVKVDDLKGKKIGIYF  215
            F FS  K E    +  A+    +  L SIL S   DF+I   G +V V +L GK + +YF
Sbjct  314  FPFSAEKLE--ILAEKAKIKAASQTLESILISGHLDFVIGKDGAKVPVSELVGKTVLVYF  371

Query  216  SASWCGPCHRFTPNLATVYNELLPK-GNFEVVFVSADEDEESFKEYFGKMPWTAVPFSDS  392
            S  WC PC  F P L   YN++  K  +FE+VF+S+DED+ SF ++F +MPW AVP+ D 
Sbjct  372  SGKWCPPCRAFLPTLVKEYNKIKEKNSDFEIVFISSDEDQSSFDDFFSEMPWLAVPWEDE  431

Query  393  VTRERLDALFTVRGIPHLVILDESGKVTTEDGVDIVLEHGVEAYPF  530
              +  L   F +RGIP LV +  +G+  + D    ++ HG +A+PF
Sbjct  432  -RKASLKKTFKIRGIPSLVAIGPTGQTVSRDAKSQLMIHGADAFPF  476


 Score =   102 bits (254),  Expect = 6e-22, Method: Compositional matrix adjust.
 Identities = 60/164 (37%), Positives = 89/164 (54%), Gaps = 4/164 (2%)
 Frame = +3

Query  36   FQFSKRKGEERKASSMAEQNGDAHDLRSILCSSDRDFLIRNSGHQVKVDDLKGKKIGIYF  215
            + F+  +  E K    AE+      ++S+L +S RD+LI N G +V + +L+GK +G+ F
Sbjct  151  YPFTPDRINELKEQEKAEKEN--QTIQSVLVTSTRDYLISNKGDKVPISELEGKYVGLCF  208

Query  216  SASWCGPCHRFTPNLATVYNELLPKG-NFEVVFVSADEDEESFKEYFGKMPWTAVPFSDS  392
                  P   FT  LA +Y +L   G  FEVV VS D +E SF E F KMPW A+P  D 
Sbjct  209  VVDGFPPLAEFTEVLAKIYEKLKEVGEKFEVVAVSLDSEESSFNESFAKMPWLAIPQGD-  267

Query  393  VTRERLDALFTVRGIPHLVILDESGKVTTEDGVDIVLEHGVEAY  524
            +  + L   F +  +P LV++   GK    +  DI+ +HG EA+
Sbjct  268  IKCQTLVRYFELSSLPTLVLIGPDGKTLNNNVADIIDDHGFEAW  311



>ref|XP_006365237.1| PREDICTED: probable nucleoredoxin 1-like [Solanum tuberosum]
Length=547

 Score =   185 bits (469),  Expect = 7e-52, Method: Compositional matrix adjust.
 Identities = 83/142 (58%), Positives = 103/142 (73%), Gaps = 0/142 (0%)
 Frame = +3

Query  105  HDLRSILCSSDRDFLIRNSGHQVKVDDLKGKKIGIYFSASWCGPCHRFTPNLATVYNELL  284
            +DL  +L S +RDFLI  +G QV +  + GK +G+YFS SWCGPC +FTP L   Y  L 
Sbjct  12   NDLTVVLSSKERDFLICTNGEQVTLSSITGKIVGLYFSGSWCGPCRQFTPKLVEAYESLY  71

Query  285  PKGNFEVVFVSADEDEESFKEYFGKMPWTAVPFSDSVTRERLDALFTVRGIPHLVILDES  464
            PKG+FE+VF+S+D+D+ESF EYFGKMPW AVPFSD+  R+ L  LF VR IPHLVILD +
Sbjct  72   PKGDFEIVFISSDKDDESFNEYFGKMPWLAVPFSDAEARKNLKQLFKVRAIPHLVILDGT  131

Query  465  GKVTTEDGVDIVLEHGVEAYPF  530
            GKV + DGV  +   G EAYPF
Sbjct  132  GKVLSNDGVKFIKNFGPEAYPF  153


 Score =   119 bits (297),  Expect = 6e-28, Method: Compositional matrix adjust.
 Identities = 61/153 (40%), Positives = 87/153 (57%), Gaps = 2/153 (1%)
 Frame = +3

Query  75   SSMAEQNGDAHDLRSILCSSDRDFLIRNSGHQVKVDDLKGKKIGIYFSASWCGPCHRFTP  254
            +++ ++  +A  L SIL ++DRDF+I N G +V V  L G  I +YF+ASW  P   F P
Sbjct  320  ANLKKKKLEAQTLESILVTADRDFVISNGGLKVPVHKLVGNNIVLYFAASWSLPSREFQP  379

Query  255  NLATVYNELLPKG-NFEVVFVSADEDEESFKEYFGKMPWTAVPFSDSVTRERLDALFTVR  431
             L T Y+E+  K   FEV+F+S+D+DE SF   F  MPW A+PF D   R  L   F++ 
Sbjct  380  KLVTAYHEIKKKDETFEVIFISSDQDEPSFNNIFSSMPWLALPFDDE-RRSFLSRRFSIV  438

Query  432  GIPHLVILDESGKVTTEDGVDIVLEHGVEAYPF  530
            GIP  + +  +G         ++  HG  AYPF
Sbjct  439  GIPVAIAISPNGCTVNTQVRQLLEAHGAGAYPF  471


 Score =   115 bits (288),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 64/148 (43%), Positives = 83/148 (56%), Gaps = 2/148 (1%)
 Frame = +3

Query  87   EQNGDAHDLRSILCSSDRDFLIRNSGHQVKVDDLKGKKIGIYFSASWCGPCHRFTPNLAT  266
            E+  +   LRS+L    RDFLI N   ++ V +L+GK + +YF  S    C  FT  LA 
Sbjct  166  ERAKENQSLRSLLVYGSRDFLISNEEKKISVSELEGKTVCLYFGTSTHRGCKNFTLKLAE  225

Query  267  VYNELLPKGNFEVVFVSADEDEESFKEYFGKMPWTAVPFSDSVTRERLDALFTVRGIPHL  446
            VY E L   NFE+V +S DE  E FKE F  MPW A+PF D    ERL   F  + +P L
Sbjct  226  VY-EKLKGNNFEIVLISLDEKYEDFKEGFEAMPWLALPFKDK-NCERLVQYFEHKLLPQL  283

Query  447  VILDESGKVTTEDGVDIVLEHGVEAYPF  530
            V+L   GK   ++ V  V E+G EA+PF
Sbjct  284  VVLSPDGKTLQQNAVKFVEEYGDEAFPF  311



>tpg|DAA45727.1| TPA: PDI-like protein [Zea mays]
Length=569

 Score =   185 bits (470),  Expect = 7e-52, Method: Compositional matrix adjust.
 Identities = 90/139 (65%), Positives = 106/139 (76%), Gaps = 2/139 (1%)
 Frame = +3

Query  120  ILCSSDRDFLIRNSGHQVKVDDLKGKKIGIYFSASWCGPCHRFTPNLATVYNELLPKG-N  296
            IL +SDRDFL+RNSG QVK+  ++   + IYFSASWC PC RFTP L  VY +L  +G +
Sbjct  15   ILATSDRDFLVRNSGEQVKISSVEASPVAIYFSASWCPPCRRFTPKLIEVYEKLASQGKS  74

Query  297  FEVVFVSADEDEESFKEYFGKMPWTAVPFSDSVTRERLDALFTVRGIPHLVILD-ESGKV  473
            FEVVF SAD +EE+F EYF KMPW AVPFSDS  RE LD  F V GIPHLVILD ++G+V
Sbjct  75   FEVVFASADRNEEAFNEYFAKMPWLAVPFSDSEGREALDGQFKVSGIPHLVILDAKTGEV  134

Query  474  TTEDGVDIVLEHGVEAYPF  530
             TEDGV+ V E+GVEAYPF
Sbjct  135  YTEDGVEFVSEYGVEAYPF  153


 Score =   129 bits (324),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 67/166 (40%), Positives = 96/166 (58%), Gaps = 4/166 (2%)
 Frame = +3

Query  36   FQFSKRKGEERKASSMAEQNGDAHDLRSILCSSDRDFLIRNSGHQVKVDDLKGKKIGIYF  215
            F FS  K E    +  A+    +  L SIL S   DF+I   G +V V +L GK + +YF
Sbjct  314  FPFSAEKLE--ILAEKAKIKAASQTLESILISGHLDFVIGKDGAKVPVSELVGKTVLVYF  371

Query  216  SASWCGPCHRFTPNLATVYNELLPK-GNFEVVFVSADEDEESFKEYFGKMPWTAVPFSDS  392
            SA WC PC  F P L   YN++  K  +FE+VF+S+DED+ SF ++F +MPW AVP+ D 
Sbjct  372  SAKWCPPCRAFLPTLVKEYNKIKEKNSDFEIVFISSDEDQSSFDDFFSEMPWLAVPWEDE  431

Query  393  VTRERLDALFTVRGIPHLVILDESGKVTTEDGVDIVLEHGVEAYPF  530
              +  L   F +RGIP LV +  +G+  + D    ++ HG +A+PF
Sbjct  432  -RKASLKKTFKIRGIPSLVAIGPTGQTVSRDAKSQLMIHGADAFPF  476


 Score =   101 bits (252),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 60/164 (37%), Positives = 89/164 (54%), Gaps = 4/164 (2%)
 Frame = +3

Query  36   FQFSKRKGEERKASSMAEQNGDAHDLRSILCSSDRDFLIRNSGHQVKVDDLKGKKIGIYF  215
            + F+  +  E K    AE+      ++S+L +S RD+LI N G +V + +L+GK +G+ F
Sbjct  151  YPFTPDRINELKEQEKAEKEN--QTIQSVLGTSTRDYLISNKGDKVPISELEGKYVGLCF  208

Query  216  SASWCGPCHRFTPNLATVYNELLPKG-NFEVVFVSADEDEESFKEYFGKMPWTAVPFSDS  392
                  P   FT  LA +Y +L   G  FEVV VS D +E SF E F KMPW A+P  D 
Sbjct  209  VVDGFPPLAEFTEVLAKIYEKLKEVGEKFEVVAVSLDSEESSFNESFAKMPWLAIPQGD-  267

Query  393  VTRERLDALFTVRGIPHLVILDESGKVTTEDGVDIVLEHGVEAY  524
            +  + L   F +  +P LV++   GK    +  DI+ +HG EA+
Sbjct  268  IKCQTLVRYFELSSLPTLVLIGPDGKTLNNNVADIIDDHGFEAW  311



>gb|ACF82903.1| unknown [Zea mays]
Length=569

 Score =   185 bits (469),  Expect = 8e-52, Method: Compositional matrix adjust.
 Identities = 90/139 (65%), Positives = 106/139 (76%), Gaps = 2/139 (1%)
 Frame = +3

Query  120  ILCSSDRDFLIRNSGHQVKVDDLKGKKIGIYFSASWCGPCHRFTPNLATVYNELLPKG-N  296
            IL +SDRDFL+RNSG QVK+  ++   + IYFSASWC PC RFTP L  VY +L  +G +
Sbjct  15   ILATSDRDFLVRNSGEQVKISSVEASPVAIYFSASWCPPCRRFTPKLIEVYEKLASQGKS  74

Query  297  FEVVFVSADEDEESFKEYFGKMPWTAVPFSDSVTRERLDALFTVRGIPHLVILD-ESGKV  473
            FEVVF SAD +EE+F EYF KMPW AVPFSDS  RE LD  F V GIPHLVILD ++G+V
Sbjct  75   FEVVFASADRNEEAFNEYFAKMPWLAVPFSDSEGREALDGRFKVSGIPHLVILDAKTGEV  134

Query  474  TTEDGVDIVLEHGVEAYPF  530
             TEDGV+ V E+GVEAYPF
Sbjct  135  YTEDGVEFVSEYGVEAYPF  153


 Score =   129 bits (324),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 67/166 (40%), Positives = 96/166 (58%), Gaps = 4/166 (2%)
 Frame = +3

Query  36   FQFSKRKGEERKASSMAEQNGDAHDLRSILCSSDRDFLIRNSGHQVKVDDLKGKKIGIYF  215
            F FS  K E    +  A+    +  L SIL S   DF+I   G +V V +L GK + +YF
Sbjct  314  FPFSAEKLE--ILAEKAKIKAASQTLESILISGHLDFVIGKDGAKVPVSELVGKTVLVYF  371

Query  216  SASWCGPCHRFTPNLATVYNELLPK-GNFEVVFVSADEDEESFKEYFGKMPWTAVPFSDS  392
            SA WC PC  F P L   YN++  K  +FE+VF+S+DED+ SF ++F +MPW AVP+ D 
Sbjct  372  SAKWCPPCRAFLPTLVKEYNKIKEKNSDFEIVFISSDEDQSSFDDFFSEMPWLAVPWEDE  431

Query  393  VTRERLDALFTVRGIPHLVILDESGKVTTEDGVDIVLEHGVEAYPF  530
              +  L   F +RGIP LV +  +G+  + D    ++ HG +A+PF
Sbjct  432  -RKASLKKTFKIRGIPSLVAIGPTGQTVSRDAKSQLMIHGADAFPF  476


 Score =   101 bits (251),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 60/164 (37%), Positives = 89/164 (54%), Gaps = 4/164 (2%)
 Frame = +3

Query  36   FQFSKRKGEERKASSMAEQNGDAHDLRSILCSSDRDFLIRNSGHQVKVDDLKGKKIGIYF  215
            + F+  +  E K    AE+      ++S+L +S RD+LI N G +V + +L+GK +G+ F
Sbjct  151  YPFTPDRINELKEQEKAEKEN--QTIQSVLGTSTRDYLISNKGDKVPISELEGKYVGLCF  208

Query  216  SASWCGPCHRFTPNLATVYNELLPKG-NFEVVFVSADEDEESFKEYFGKMPWTAVPFSDS  392
                  P   FT  LA +Y +L   G  FEVV VS D +E SF E F KMPW A+P  D 
Sbjct  209  VVDGFPPLAEFTEVLAKIYEKLKEVGEKFEVVAVSLDSEESSFNESFAKMPWLAIPQGD-  267

Query  393  VTRERLDALFTVRGIPHLVILDESGKVTTEDGVDIVLEHGVEAY  524
            +  + L   F +  +P LV++   GK    +  DI+ +HG EA+
Sbjct  268  IKCQTLVRYFELSSLPTLVLIGPDGKTLNNNVADIIDDHGFEAW  311



>ref|XP_004147954.1| PREDICTED: probable nucleoredoxin 1-like [Cucumis sativus]
 ref|XP_004159502.1| PREDICTED: probable nucleoredoxin 1-like [Cucumis sativus]
 gb|KGN55925.1| hypothetical protein Csa_3G036510 [Cucumis sativus]
Length=562

 Score =   184 bits (467),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 83/142 (58%), Positives = 111/142 (78%), Gaps = 0/142 (0%)
 Frame = +3

Query  105  HDLRSILCSSDRDFLIRNSGHQVKVDDLKGKKIGIYFSASWCGPCHRFTPNLATVYNELL  284
            H L S+  S  +++L+RN+G +V+++ LKGK +G+YFSA+WCG   RFTP+L  VYNEL 
Sbjct  12   HFLHSLFRSESQNYLLRNNGDKVEIEMLKGKTLGLYFSAAWCGQSQRFTPSLVEVYNELS  71

Query  285  PKGNFEVVFVSADEDEESFKEYFGKMPWTAVPFSDSVTRERLDALFTVRGIPHLVILDES  464
             K NFEV+FVSAD+DE+SFK+YF +MPW AVPFSD   R+ LD+LF VRG+P L+ILD++
Sbjct  72   SKANFEVIFVSADDDEKSFKKYFSEMPWLAVPFSDLERRDHLDSLFEVRGVPQLIILDKN  131

Query  465  GKVTTEDGVDIVLEHGVEAYPF  530
            GK++T+ GVD V E G E YPF
Sbjct  132  GKLSTDTGVDFVQEFGAEGYPF  153


 Score =   119 bits (298),  Expect = 5e-28, Method: Compositional matrix adjust.
 Identities = 63/169 (37%), Positives = 93/169 (55%), Gaps = 8/169 (5%)
 Frame = +3

Query  36   FQFSKRKGEERKASSMAEQNGDAHDLRSILCSSDRDFLIRNSGHQVKVDDLKGKKIGIYF  215
            + F+K K  E   + + +   +A  L SIL   + + +I+N   ++ V +L GK I IY 
Sbjct  311  YPFTKEKFAE--LAEIVKAKEEAQTLESILVLGEHNHVIKNDETKIPVSNLVGKNILIYI  368

Query  216  SASWCGPCHRFTPNLATVYNELLPK-GNFEVVFVSADEDEESFKEYFGKMPWTAVPFSD-  389
            SA WC PC  F P L   Y+ +  K  N EV+F+S D DE SFK  F +MPW AVPF D 
Sbjct  369  SADWCPPCRVFLPKLIETYHNVKKKDDNLEVIFISCDRDESSFKNMFSRMPWLAVPFDDP  428

Query  390  --SVTRERLDALFTVRGIPHLVILDESGKVTTEDGVDIVLEHGVEAYPF  530
              +  R +      V G+P L+ + E G+  T D V+++  +G +A+PF
Sbjct  429  RKAWIRRKFKV--QVEGMPALISIGEDGRTATNDAVELISNYGAKAFPF  475


 Score =   113 bits (282),  Expect = 9e-26, Method: Compositional matrix adjust.
 Identities = 62/141 (44%), Positives = 85/141 (60%), Gaps = 2/141 (1%)
 Frame = +3

Query  111  LRSILCSSDRDFLIRNSGHQVKVDDLKGKKIGIYFSASWCGPCHRFTPNLATVYNELLPK  290
            LRSI+ SS RDF+I + G +V V +L+GK IG+YF  S    C  FTP L   Y +L  K
Sbjct  174  LRSIMVSSSRDFVITSKGEKVPVAELEGKIIGLYFLLSSYERCIAFTPKLVDAYEKLKAK  233

Query  291  G-NFEVVFVSADEDEESFKEYFGKMPWTAVPFSDSVTRERLDALFTVRGIPHLVILDESG  467
            G  FE+V ++ D+DEE +KE   K+PW A+PF D+   ++L   F V  +P LVI+ + G
Sbjct  234  GERFEIVLITIDQDEELYKEALRKVPWFALPFRDNRC-DKLIRYFEVSTLPTLVIIGQDG  292

Query  468  KVTTEDGVDIVLEHGVEAYPF  530
            K    +  + V EHG   YPF
Sbjct  293  KTLYSNVANAVDEHGFLPYPF  313



>ref|XP_004984067.1| PREDICTED: probable nucleoredoxin 1-1-like [Setaria italica]
Length=580

 Score =   184 bits (466),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 88/138 (64%), Positives = 104/138 (75%), Gaps = 2/138 (1%)
 Frame = +3

Query  123  LCSSDRDFLIRNSGHQVKVDDLKGKKIGIYFSASWCGPCHRFTPNLATVYNELLPKG-NF  299
            L + DRDFL+RNSG QVK+  ++   + +YFSASWC PC RFTP L   Y EL  +G +F
Sbjct  19   LAAGDRDFLVRNSGEQVKISSIEASPVALYFSASWCPPCRRFTPKLIEAYKELASQGKSF  78

Query  300  EVVFVSADEDEESFKEYFGKMPWTAVPFSDSVTRERLDALFTVRGIPHLVILD-ESGKVT  476
            EVVFVS D+DEE+F EYF KMPW AVPFSDS  RE LD  F V GIPHLVILD ++G+V 
Sbjct  79   EVVFVSGDQDEEAFNEYFAKMPWLAVPFSDSEGREALDGRFKVSGIPHLVILDAKTGEVY  138

Query  477  TEDGVDIVLEHGVEAYPF  530
            TEDGV +V E+GVEAYPF
Sbjct  139  TEDGVGLVSEYGVEAYPF  156


 Score =   117 bits (293),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 62/144 (43%), Positives = 89/144 (62%), Gaps = 2/144 (1%)
 Frame = +3

Query  102  AHDLRSILCSSDRDFLIRNSGHQVKVDDLKGKKIGIYFSASWCGPCHRFTPNLATVYNEL  281
            +  L S+L S D DF+I   G +V V +L GK + +YFSA WCGPC  F P L   YN++
Sbjct  337  SQTLESLLISGDLDFVIGKGGAKVPVSELVGKTVLLYFSAKWCGPCRAFLPMLVKEYNKI  396

Query  282  LPK-GNFEVVFVSADEDEESFKEYFGKMPWTAVPFSDSVTRERLDALFTVRGIPHLVILD  458
              K  +FE+VF+S+D D+ SF E+F +MPW A+P  D   +  L+  F +RGIP LV + 
Sbjct  397  KEKHSDFEIVFISSDSDQSSFDEFFTEMPWLALPLEDE-RKAFLEKTFRIRGIPSLVAIG  455

Query  459  ESGKVTTEDGVDIVLEHGVEAYPF  530
             +G+  + D    ++ HG EA+PF
Sbjct  456  PNGQTVSRDAKAQLMIHGAEAFPF  479


 Score =   107 bits (267),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 61/160 (38%), Positives = 90/160 (56%), Gaps = 5/160 (3%)
 Frame = +3

Query  48   KRKGEERKASSMAEQNGDAHDLRSILCSSDRDFLIRNSGHQVKVDDLKGKKIGIYFSASW  227
            +R  E ++    A++N     ++S+L +S RD+LI + G +V + +L+GK +G+ F    
Sbjct  159  ERINELKEQEKAAKEN---QTIKSVLGTSTRDYLITSKGDKVPISELEGKYVGLCFVVPG  215

Query  228  CGPCHRFTPNLATVYNELLPKG-NFEVVFVSADEDEESFKEYFGKMPWTAVPFSDSVTRE  404
             GP   F   LA +Y +L   G  FEVV VS D DE SF E   KMPW A+P  D +  E
Sbjct  216  YGPVDEFISVLAKIYEKLKEVGEKFEVVAVSLDSDESSFNESLAKMPWLAIPQGDKMC-E  274

Query  405  RLDALFTVRGIPHLVILDESGKVTTEDGVDIVLEHGVEAY  524
            +L   F +R +P LV++   GK    +  DI+ EHG EA+
Sbjct  275  KLVRYFELRTLPTLVLIGTDGKTLNTNVADIIEEHGFEAW  314



>ref|XP_011041503.1| PREDICTED: probable nucleoredoxin 1 isoform X2 [Populus euphratica]
Length=562

 Score =   183 bits (465),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 87/143 (61%), Positives = 110/143 (77%), Gaps = 0/143 (0%)
 Frame = +3

Query  102  AHDLRSILCSSDRDFLIRNSGHQVKVDDLKGKKIGIYFSASWCGPCHRFTPNLATVYNEL  281
            +HDL S+L S +RDFLIRN+G QV+V +L GK +G YFS SWCGPC  FTP L  VY +L
Sbjct  7    SHDLSSLLSSGERDFLIRNNGDQVRVSNLVGKIVGFYFSGSWCGPCRNFTPLLVEVYEQL  66

Query  282  LPKGNFEVVFVSADEDEESFKEYFGKMPWTAVPFSDSVTRERLDALFTVRGIPHLVILDE  461
              KG+FEVVF+S+D D+ESF  YF +MPW A+PFSD+ TR+RL  +F V GIP+LVI D 
Sbjct  67   SSKGDFEVVFISSDRDDESFNTYFSEMPWLAIPFSDTETRQRLKEVFEVTGIPNLVIFDT  126

Query  462  SGKVTTEDGVDIVLEHGVEAYPF  530
            +GKV+ +DGV  V+EHGV+ YPF
Sbjct  127  NGKVSCDDGVSTVMEHGVDGYPF  149


 Score =   129 bits (324),  Expect = 9e-32, Method: Compositional matrix adjust.
 Identities = 71/154 (46%), Positives = 95/154 (62%), Gaps = 7/154 (5%)
 Frame = +3

Query  81   MAEQNGDA---HDLRSILCSSDRDFLIRNSGHQVKVDDLKGKKIGIYFSASWCGPCHRFT  251
            + EQ  +A     + SIL SS RD++I N G ++ V DL+GK +G+YFS      C  FT
Sbjct  157  LKEQEENAKKNQTISSILVSSSRDYVISNDGKKIPVLDLEGKLVGLYFSIH--AICCEFT  214

Query  252  PNLATVYNELLPKG-NFEVVFVSADEDEESFKEYFGKMPWTAVPFSDSVTRERLDALFTV  428
            P L  +Y  L  KG NFEVV +S D DEE FKE F  MPW A+PF D + + +L   F +
Sbjct  215  PKLVELYKTLKEKGENFEVVLISLDYDEEDFKESFETMPWLALPFKDKICK-KLVRYFEL  273

Query  429  RGIPHLVILDESGKVTTEDGVDIVLEHGVEAYPF  530
            R IP+LVI+ + GK    +  +++ EHGVEAYPF
Sbjct  274  RTIPNLVIIGQDGKTLNPNVAELIEEHGVEAYPF  307


 Score =   122 bits (305),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 62/166 (37%), Positives = 98/166 (59%), Gaps = 4/166 (2%)
 Frame = +3

Query  36   FQFSKRKGEERKASSMAEQNGDAHDLRSILCSSDRDFLIRNSGHQVKVDDLKGKKIGIYF  215
            + F+ +K +E  A   A+   ++  L S+L + + DF+I  SG +V V +L GK I +YF
Sbjct  305  YPFTPKKLDELAAIEKAKL--ESQTLESVLVNGENDFVIDKSGSKVPVSELVGKNILLYF  362

Query  216  SASWCGPCHRFTPNLATVYNELLPKGN-FEVVFVSADEDEESFKEYFGKMPWTAVPFSDS  392
            SA WC PC  F P L   Y+ +  K N FEV+F+S+D D+ +F E++ +MPW A+PF D 
Sbjct  363  SAQWCSPCRAFLPKLIEAYHTIKGKDNAFEVIFISSDSDQSTFDEFYSEMPWLALPFGDG  422

Query  393  VTRERLDALFTVRGIPHLVILDESGKVTTEDGVDIVLEHGVEAYPF  530
              ++ L   F + GIP  V +  SG+  T++    +  +G +A+PF
Sbjct  423  -RKQILSRKFKIEGIPAAVAIGPSGRTITKEARMHLTAYGADAFPF  467



>ref|XP_006378294.1| hypothetical protein POPTR_0010s06990g [Populus trichocarpa]
 gb|ERP56091.1| hypothetical protein POPTR_0010s06990g [Populus trichocarpa]
Length=553

 Score =   183 bits (465),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 83/132 (63%), Positives = 102/132 (77%), Gaps = 0/132 (0%)
 Frame = +3

Query  135  DRDFLIRNSGHQVKVDDLKGKKIGIYFSASWCGPCHRFTPNLATVYNELLPKGNFEVVFV  314
            +RDFLIRN+G QV+V +L GK +G YFS SWCGPC  FTP L  VY +L  KG+FEVVF+
Sbjct  18   ERDFLIRNNGDQVRVSNLVGKIVGFYFSGSWCGPCRNFTPLLVEVYEQLSSKGDFEVVFI  77

Query  315  SADEDEESFKEYFGKMPWTAVPFSDSVTRERLDALFTVRGIPHLVILDESGKVTTEDGVD  494
            S+D D+ESF  YF +MPW A+PFSD+ TR RL  +F VRGIPHLVI D +GKV+ +DGV 
Sbjct  78   SSDGDDESFNTYFSEMPWLAIPFSDTETRLRLKEVFEVRGIPHLVIFDTNGKVSCDDGVS  137

Query  495  IVLEHGVEAYPF  530
             V+EHGV+ YPF
Sbjct  138  TVMEHGVDGYPF  149


 Score =   121 bits (304),  Expect = 6e-29, Method: Compositional matrix adjust.
 Identities = 67/156 (43%), Positives = 96/156 (62%), Gaps = 7/156 (4%)
 Frame = +3

Query  66   RKASSMAEQNGDAHDLRSILCSSDRDFLIRNSGHQVKVDDLKGKKIGIYFSASWCGPCHR  245
            +K    A++N     + SIL SS RD++I N G ++ + DL+GK +G+ FS      C  
Sbjct  158  KKQEENAKKN---QTISSILVSSSRDYVISNDGKKIPLLDLEGKLVGLCFSIH--TMCCE  212

Query  246  FTPNLATVYNELLPKG-NFEVVFVSADEDEESFKEYFGKMPWTAVPFSDSVTRERLDALF  422
            FTP L  +Y  L  KG NFEVV +S D++EE FKE F  MPW A+PF+D  + E+L   F
Sbjct  213  FTPKLVELYKTLKEKGENFEVVLISLDDEEEDFKESFETMPWLALPFNDK-SCEKLVRYF  271

Query  423  TVRGIPHLVILDESGKVTTEDGVDIVLEHGVEAYPF  530
             +  IP+LVI+ + GK    +  +++ EHG+EAYPF
Sbjct  272  ELSTIPNLVIIGQDGKTLNSNVAELIEEHGIEAYPF  307


 Score =   103 bits (258),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 49/120 (41%), Positives = 74/120 (62%), Gaps = 2/120 (2%)
 Frame = +3

Query  174  KVDDLKGKKIGIYFSASWCGPCHRFTPNLATVYNELLPKGN-FEVVFVSADEDEESFKEY  350
            KV +L GK I +YFSA WC PC  F P L   Y+ +  K N FEV+F+S+D D+ +F E+
Sbjct  340  KVSELVGKNILLYFSAQWCPPCRAFLPKLIEAYHTIKGKDNAFEVIFISSDSDQSTFDEF  399

Query  351  FGKMPWTAVPFSDSVTRERLDALFTVRGIPHLVILDESGKVTTEDGVDIVLEHGVEAYPF  530
            + +MPW A+PF D   ++ L   F ++GIP  V +  SG+  T++    +  +G +A+PF
Sbjct  400  YSEMPWLALPFVDG-RKQILSRKFKIQGIPAAVAIGPSGRTITKEARKHLTAYGADAFPF  458



>ref|XP_011041502.1| PREDICTED: probable nucleoredoxin 1 isoform X1 [Populus euphratica]
Length=562

 Score =   183 bits (465),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 87/143 (61%), Positives = 110/143 (77%), Gaps = 0/143 (0%)
 Frame = +3

Query  102  AHDLRSILCSSDRDFLIRNSGHQVKVDDLKGKKIGIYFSASWCGPCHRFTPNLATVYNEL  281
            +HDL S+L S +RDFLIRN+G QV+V +L GK +G YFS SWCGPC  FTP L  VY +L
Sbjct  7    SHDLSSLLSSGERDFLIRNNGDQVRVSNLVGKIVGFYFSGSWCGPCRNFTPLLVEVYEQL  66

Query  282  LPKGNFEVVFVSADEDEESFKEYFGKMPWTAVPFSDSVTRERLDALFTVRGIPHLVILDE  461
              KG+FEVVF+S+D D+ESF  YF +MPW A+PFSD+ TR+RL  +F V GIP+LVI D 
Sbjct  67   SSKGDFEVVFISSDRDDESFNTYFSEMPWLAIPFSDTETRQRLKEVFEVTGIPNLVIFDT  126

Query  462  SGKVTTEDGVDIVLEHGVEAYPF  530
            +GKV+ +DGV  V+EHGV+ YPF
Sbjct  127  NGKVSCDDGVSTVMEHGVDGYPF  149


 Score =   129 bits (324),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 71/154 (46%), Positives = 95/154 (62%), Gaps = 7/154 (5%)
 Frame = +3

Query  81   MAEQNGDA---HDLRSILCSSDRDFLIRNSGHQVKVDDLKGKKIGIYFSASWCGPCHRFT  251
            + EQ  +A     + SIL SS RD++I N G ++ V DL+GK +G+YFS      C  FT
Sbjct  157  LKEQEENAKKNQTISSILVSSSRDYVISNDGKKIPVLDLEGKLVGLYFSIH--AICCEFT  214

Query  252  PNLATVYNELLPKG-NFEVVFVSADEDEESFKEYFGKMPWTAVPFSDSVTRERLDALFTV  428
            P L  +Y  L  KG NFEVV +S D DEE FKE F  MPW A+PF D + + +L   F +
Sbjct  215  PKLVELYKTLKEKGENFEVVLISLDYDEEDFKESFETMPWLALPFKDKICK-KLVRYFEL  273

Query  429  RGIPHLVILDESGKVTTEDGVDIVLEHGVEAYPF  530
            R IP+LVI+ + GK    +  +++ EHGVEAYPF
Sbjct  274  RTIPNLVIIGQDGKTLNPNVAELIEEHGVEAYPF  307


 Score =   121 bits (304),  Expect = 6e-29, Method: Compositional matrix adjust.
 Identities = 62/166 (37%), Positives = 98/166 (59%), Gaps = 4/166 (2%)
 Frame = +3

Query  36   FQFSKRKGEERKASSMAEQNGDAHDLRSILCSSDRDFLIRNSGHQVKVDDLKGKKIGIYF  215
            + F+ +K +E  A   A+   ++  L S+L + + DF+I  SG +V V +L GK I +YF
Sbjct  305  YPFTPKKLDELAAIEKAKL--ESQTLESVLVNGENDFVIDKSGSKVPVSELVGKNILLYF  362

Query  216  SASWCGPCHRFTPNLATVYNELLPKGN-FEVVFVSADEDEESFKEYFGKMPWTAVPFSDS  392
            SA WC PC  F P L   Y+ +  K N FEV+F+S+D D+ +F E++ +MPW A+PF D 
Sbjct  363  SAQWCSPCRAFLPKLIEAYHTIKGKDNAFEVIFISSDSDQSTFDEFYSEMPWLALPFGDG  422

Query  393  VTRERLDALFTVRGIPHLVILDESGKVTTEDGVDIVLEHGVEAYPF  530
              ++ L   F + GIP  V +  SG+  T++    +  +G +A+PF
Sbjct  423  -RKQILSRKFKIEGIPAAVAIGPSGRTITKEARMHLTAYGADAFPF  467



>ref|XP_006378293.1| disulfide isomerase family protein [Populus trichocarpa]
 gb|ERP56090.1| disulfide isomerase family protein [Populus trichocarpa]
Length=553

 Score =   182 bits (463),  Expect = 5e-51, Method: Compositional matrix adjust.
 Identities = 88/143 (62%), Positives = 109/143 (76%), Gaps = 0/143 (0%)
 Frame = +3

Query  102  AHDLRSILCSSDRDFLIRNSGHQVKVDDLKGKKIGIYFSASWCGPCHRFTPNLATVYNEL  281
            +HDL S+L S +RD LIRN+G QV+V +L GK +G YFS SWCGPC  FTP L  VY +L
Sbjct  7    SHDLSSLLSSEERDSLIRNNGDQVRVSNLVGKIVGFYFSGSWCGPCRNFTPLLVEVYEQL  66

Query  282  LPKGNFEVVFVSADEDEESFKEYFGKMPWTAVPFSDSVTRERLDALFTVRGIPHLVILDE  461
              KG+FEVVF+S+D D+ESF  YF +MPW A+PFSD+ TR RL  +F VRGIPHLVI D 
Sbjct  67   SSKGDFEVVFISSDGDDESFNTYFSEMPWLAIPFSDTETRLRLKEVFEVRGIPHLVIFDT  126

Query  462  SGKVTTEDGVDIVLEHGVEAYPF  530
            +GKV+ +DGV  V+EHGV+ YPF
Sbjct  127  NGKVSCDDGVSTVMEHGVDGYPF  149


 Score =   121 bits (304),  Expect = 7e-29, Method: Compositional matrix adjust.
 Identities = 67/156 (43%), Positives = 96/156 (62%), Gaps = 7/156 (4%)
 Frame = +3

Query  66   RKASSMAEQNGDAHDLRSILCSSDRDFLIRNSGHQVKVDDLKGKKIGIYFSASWCGPCHR  245
            +K    A++N     + SIL SS RD++I N G ++ + DL+GK +G+ FS      C  
Sbjct  158  KKQEENAKKN---QTISSILVSSSRDYVISNDGKKIPLLDLEGKLVGLCFSIH--TMCCE  212

Query  246  FTPNLATVYNELLPKG-NFEVVFVSADEDEESFKEYFGKMPWTAVPFSDSVTRERLDALF  422
            FTP L  +Y  L  KG NFEVV +S D++EE FKE F  MPW A+PF+D  + E+L   F
Sbjct  213  FTPKLVELYKTLKEKGENFEVVLISLDDEEEDFKESFETMPWLALPFNDK-SCEKLVRYF  271

Query  423  TVRGIPHLVILDESGKVTTEDGVDIVLEHGVEAYPF  530
             +  IP+LVI+ + GK    +  +++ EHG+EAYPF
Sbjct  272  ELSTIPNLVIIGQDGKTLNSNVAELIEEHGIEAYPF  307


 Score =   104 bits (259),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 49/120 (41%), Positives = 74/120 (62%), Gaps = 2/120 (2%)
 Frame = +3

Query  174  KVDDLKGKKIGIYFSASWCGPCHRFTPNLATVYNELLPKGN-FEVVFVSADEDEESFKEY  350
            KV +L GK I +YFSA WC PC  F P L   Y+ +  K N FEV+F+S+D D+ +F E+
Sbjct  340  KVSELVGKNILLYFSAQWCPPCRAFLPKLIEAYHTIKGKDNAFEVIFISSDSDQSTFDEF  399

Query  351  FGKMPWTAVPFSDSVTRERLDALFTVRGIPHLVILDESGKVTTEDGVDIVLEHGVEAYPF  530
            + +MPW A+PF D   ++ L   F ++GIP  V +  SG+  T++    +  +G +A+PF
Sbjct  400  YSEMPWLALPFVDG-RKQILSRKFKIQGIPAAVAIGPSGRTITKEARKHLTAYGADAFPF  458



>gb|KDO82402.1| hypothetical protein CISIN_1g008336mg [Citrus sinensis]
Length=551

 Score =   182 bits (463),  Expect = 5e-51, Method: Compositional matrix adjust.
 Identities = 86/121 (71%), Positives = 102/121 (84%), Gaps = 1/121 (1%)
 Frame = +3

Query  168  QVKVDDLKGKKIGIYFSASWCGPCHRFTPNLATVYNELLPKGNFEVVFVSADEDEESFKE  347
            +VK+D LKGK IG+YFSASWCGPC RFTP LA VYNEL  +G+FEV+FVS DED+E+FK 
Sbjct  12   RVKLDSLKGK-IGLYFSASWCGPCQRFTPILAEVYNELSRQGDFEVIFVSGDEDDEAFKG  70

Query  348  YFGKMPWTAVPFSDSVTRERLDALFTVRGIPHLVILDESGKVTTEDGVDIVLEHGVEAYP  527
            YF KMPW AVPFSDS TR++LD LF V GIPHLVILDE+GKV ++ GV+I+ E+GVE YP
Sbjct  71   YFSKMPWLAVPFSDSETRDKLDELFKVMGIPHLVILDENGKVLSDGGVEIIREYGVEGYP  130

Query  528  F  530
            F
Sbjct  131  F  131


 Score =   131 bits (330),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 69/166 (42%), Positives = 97/166 (58%), Gaps = 4/166 (2%)
 Frame = +3

Query  36   FQFSKRKGEERKASSMAEQNGDAHDLRSILCSSDRDFLIRNSGHQVKVDDLKGKKIGIYF  215
            F F+  K  E      A++  ++  L S+L S D DF++  +G +V V DL GK I +YF
Sbjct  289  FPFTPEKFAELAEIQRAKE--ESQTLESVLVSGDLDFVVGKNGGKVPVSDLAGKTILLYF  346

Query  216  SASWCGPCHRFTPNLATVYNELLPKG-NFEVVFVSADEDEESFKEYFGKMPWTAVPFSDS  392
            SA WC PC  F P L   Y ++  +  + EVVF+S+D D+ SF E+F  MPW A+PF D+
Sbjct  347  SAHWCPPCRAFLPKLIDAYKKIKERNESLEVVFISSDRDQTSFDEFFKGMPWLALPFGDA  406

Query  393  VTRERLDALFTVRGIPHLVILDESGKVTTEDGVDIVLEHGVEAYPF  530
              +  L   F V GIP LV +  SG+  T++  D++  HG EAYPF
Sbjct  407  -RKASLSRKFKVSGIPMLVAIGPSGRTITKEARDMIAVHGAEAYPF  451


 Score =   125 bits (315),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 69/158 (44%), Positives = 93/158 (59%), Gaps = 5/158 (3%)
 Frame = +3

Query  69   KASSMAEQNGDA---HDLRSILCSSDRDFLIRNSGHQVKVDDLKGKKIGIYFSASWCGPC  239
            +   M EQ   A     LRS+L S  RDF+I + G ++ V DL+GK IG+YFS S     
Sbjct  135  RIKEMKEQEERAKREQSLRSVLTSHSRDFVISSDGRKISVSDLEGKTIGLYFSMSSYKAS  194

Query  240  HRFTPNLATVYNELLPKG-NFEVVFVSADEDEESFKEYFGKMPWTAVPFSDSVTRERLDA  416
              FTP L  VY +L  KG +FE+V +S D++EESFK   G MPW A+PF D  +RE+L  
Sbjct  195  AEFTPRLVEVYEKLKGKGESFEIVLISLDDEEESFKRDLGSMPWLALPFKDK-SREKLAR  253

Query  417  LFTVRGIPHLVILDESGKVTTEDGVDIVLEHGVEAYPF  530
             F +  +P LVI+   GK    +  + + EHGV A+PF
Sbjct  254  YFELSTLPTLVIIGPDGKTLHSNVAEAIEEHGVGAFPF  291



>ref|XP_009762379.1| PREDICTED: probable nucleoredoxin 1 [Nicotiana sylvestris]
Length=547

 Score =   182 bits (462),  Expect = 6e-51, Method: Compositional matrix adjust.
 Identities = 82/148 (55%), Positives = 105/148 (71%), Gaps = 0/148 (0%)
 Frame = +3

Query  87   EQNGDAHDLRSILCSSDRDFLIRNSGHQVKVDDLKGKKIGIYFSASWCGPCHRFTPNLAT  266
            +Q    HDL  +L S +RDFLI  +G QVK+  +KGK +G+YFS  WCG C +FTP L  
Sbjct  6    DQESFPHDLAVVLSSEERDFLICGNGEQVKISSIKGKIVGLYFSGLWCGLCRQFTPKLVE  65

Query  267  VYNELLPKGNFEVVFVSADEDEESFKEYFGKMPWTAVPFSDSVTRERLDALFTVRGIPHL  446
             Y +L PKG+FE+VF+S+D+D ESF EYFGKMPW AVPF+D+  R++L   F VR IPHL
Sbjct  66   AYEDLYPKGDFEIVFISSDKDNESFNEYFGKMPWLAVPFADAEARKKLKQSFKVRAIPHL  125

Query  447  VILDESGKVTTEDGVDIVLEHGVEAYPF  530
            VILD +GKV + +GV  +   G EAYPF
Sbjct  126  VILDGTGKVLSNEGVKFIKHFGPEAYPF  153


 Score =   115 bits (287),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 59/153 (39%), Positives = 85/153 (56%), Gaps = 2/153 (1%)
 Frame = +3

Query  75   SSMAEQNGDAHDLRSILCSSDRDFLIRNSGHQVKVDDLKGKKIGIYFSASWCGPCHRFTP  254
            +++ ++  +A  L SIL ++DRDF+I N G +V V  L G  I +YF+A W  P   F P
Sbjct  320  ANLKKEKLEAQTLESILVTADRDFVISNGGLKVPVSKLVGNNIVLYFAAQWSLPSREFLP  379

Query  255  NLATVYNELLPKG-NFEVVFVSADEDEESFKEYFGKMPWTAVPFSDSVTRERLDALFTVR  431
             L T Y E+  K   FEV+F+S+D+DE SF   F +MPW  +PF D   +  L   F + 
Sbjct  380  KLITTYQEIKKKDETFEVIFISSDQDESSFNNLFSRMPWLELPFDDD-RKAFLWRRFNIV  438

Query  432  GIPHLVILDESGKVTTEDGVDIVLEHGVEAYPF  530
            GIP ++ +  SG         ++  HG  AYPF
Sbjct  439  GIPVVIAISPSGCTVNTQVRQLLETHGAGAYPF  471


 Score =   113 bits (283),  Expect = 5e-26, Method: Compositional matrix adjust.
 Identities = 66/162 (41%), Positives = 91/162 (56%), Gaps = 5/162 (3%)
 Frame = +3

Query  45   SKRKGEERKASSMAEQNGDAHDLRSILCSSDRDFLIRNSGHQVKVDDLKGKKIGIYFSAS  224
            S+R    R+    A++N     LRSIL    RDFLI N   ++ V DL+GK +G+YF+ +
Sbjct  155  SERVNYLREEEEKAKEN---QSLRSILVHESRDFLISNEESKIVVSDLEGKTVGLYFAMA  211

Query  225  WCGPCHRFTPNLATVYNELLPKGNFEVVFVSADEDEESFKEYFGKMPWTAVPFSDSVTRE  404
                C  FT  LA VY +L  K NFE+V +S DE  E F E F  MPW A+ F D    E
Sbjct  212  SHKGCRNFTLKLADVYKKLKQK-NFEIVLLSLDEKYEDFNEGFEAMPWLALSFKDK-NCE  269

Query  405  RLDALFTVRGIPHLVILDESGKVTTEDGVDIVLEHGVEAYPF  530
            RL   F  + +P LV++   GK   ++ V +V E+G +A+PF
Sbjct  270  RLVRYFEHKLLPQLVVISPDGKTLQQNAVKLVEEYGDQAFPF  311



>gb|ABK25089.1| unknown [Picea sitchensis]
Length=398

 Score =   179 bits (454),  Expect = 7e-51, Method: Compositional matrix adjust.
 Identities = 80/158 (51%), Positives = 118/158 (75%), Gaps = 2/158 (1%)
 Frame = +3

Query  57   GEERKASSMAEQNGDAHDLRSILCSSDRDFLIRNSGHQVKVDDLKGKKIGIYFSASWCGP  236
             ++    S+A+++  +  LRS+LC  +R+F IRN+G +VK+++L+GK +G+YFSA WC P
Sbjct  5    NQQENVVSLADESQKS--LRSLLCDEERNFFIRNNGEKVKIEELEGKYVGLYFSAHWCPP  62

Query  237  CHRFTPNLATVYNELLPKGNFEVVFVSADEDEESFKEYFGKMPWTAVPFSDSVTRERLDA  416
            C  FTP L+ +Y +LL KG+FE+VF+SAD DE+SF++Y   MPW A+PFSD  TR++L+ 
Sbjct  63   CRAFTPILSEIYAKLLEKGDFEIVFISADVDEKSFEKYHRIMPWLALPFSDENTRQKLEQ  122

Query  417  LFTVRGIPHLVILDESGKVTTEDGVDIVLEHGVEAYPF  530
             F V  IP LV++D+ GKV T +GV I+ ++GVEAYPF
Sbjct  123  AFQVNSIPCLVVIDKEGKVVTTEGVKIIGDYGVEAYPF  160


 Score =   144 bits (364),  Expect = 7e-38, Method: Compositional matrix adjust.
 Identities = 66/144 (46%), Positives = 96/144 (67%), Gaps = 2/144 (1%)
 Frame = +3

Query  102  AHDLRSILCSSDRDFLIRNSGHQVKVDDLKGKKIGIYFSASWCGPCHRFTPNLATVYNEL  281
            A  + S+L S +RDF+I + G ++ V +L GK + +YFSA WC PC  FTP L  VY EL
Sbjct  178  AQTVESLLVSDERDFVIAHGGRKIPVSELVGKTVALYFSAHWCPPCRSFTPKLIQVYTEL  237

Query  282  LPKGN-FEVVFVSADEDEESFKEYFGKMPWTAVPFSDSVTRERLDALFTVRGIPHLVILD  458
              +G  FEVVF+S+DE +++F++Y+  MPW A+PF D  T++ L   F V GIP +++L 
Sbjct  238  KERGEVFEVVFISSDEHQDAFEDYYSSMPWLALPFGDK-TKKDLTRHFRVEGIPTMIVLG  296

Query  459  ESGKVTTEDGVDIVLEHGVEAYPF  530
             +GK  T+D + +V  HG +AYPF
Sbjct  297  PNGKTVTDDAISVVSIHGSKAYPF  320



>gb|EPS71977.1| hypothetical protein M569_02774, partial [Genlisea aurea]
Length=573

 Score =   182 bits (463),  Expect = 7e-51, Method: Compositional matrix adjust.
 Identities = 85/142 (60%), Positives = 106/142 (75%), Gaps = 0/142 (0%)
 Frame = +3

Query  105  HDLRSILCSSDRDFLIRNSGHQVKVDDLKGKKIGIYFSASWCGPCHRFTPNLATVYNELL  284
            +DL  IL S +RD+L+RN+G +V +  LKGK IGIYFSASWCGPC  FTP L  VYNEL 
Sbjct  9    YDLSLILSSENRDYLVRNNGDRVDLSRLKGKVIGIYFSASWCGPCRLFTPTLVQVYNELA  68

Query  285  PKGNFEVVFVSADEDEESFKEYFGKMPWTAVPFSDSVTRERLDALFTVRGIPHLVILDES  464
               +FE+VF S D+++ SF  YF +MPW A+PFSDS TRE+L  LF+V GIPHLV LDE 
Sbjct  69   RDKDFEIVFSSGDQEDASFDAYFSEMPWLAIPFSDSETREKLGELFSVAGIPHLVFLDEK  128

Query  465  GKVTTEDGVDIVLEHGVEAYPF  530
            GK+ T DGV+ V E+G +A+PF
Sbjct  129  GKLLTGDGVEAVREYGSDAFPF  150


 Score =   132 bits (331),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 64/146 (44%), Positives = 90/146 (62%), Gaps = 3/146 (2%)
 Frame = +3

Query  99   DAHDLRSILCSSD-RDFLIRNSGHQVKVDDLKGKKIGIYFSASWCGPCHRFTPNLATVYN  275
            +A  L SIL  +D  +F+I   G +V V DL GK + +YFSA WC PC  F P L   Y 
Sbjct  330  EAQTLESILVLNDSENFVIGKDGIKVPVSDLSGKTVLLYFSAHWCPPCRSFLPTLIKAYE  389

Query  276  ELLPKGN-FEVVFVSADEDEESFKEYFGKMPWTAVPFSDSVTRERLDALFTVRGIPHLVI  452
            ++  KGN  EV+F+S+D D++SF E+F  MPW A+PF D   +E L   F VRGIP ++ 
Sbjct  390  QMKEKGNEIEVIFISSDRDQQSFDEFFSTMPWLALPFGDG-RKESLGRAFKVRGIPMVIA  448

Query  453  LDESGKVTTEDGVDIVLEHGVEAYPF  530
            +  +GK  T +  ++++ HG  AYPF
Sbjct  449  IGPNGKTLTTEARELIMSHGAGAYPF  474


 Score =   106 bits (264),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 58/166 (35%), Positives = 94/166 (57%), Gaps = 8/166 (5%)
 Frame = +3

Query  45   SKRKGEERKASSMAEQNGDAHDLRSILCSSDRDFLIRNSGHQVKVDDLKGKKIGIYFSAS  224
            S+R  + R     A++N     L+S+L S  RD++I   G +V V +L+GK + +YFS S
Sbjct  152  SERIAKFRAEEEEAKRN---QSLKSLLVSESRDYVIAADGSKVPVSELQGKTVCLYFSLS  208

Query  225  WCGPCHRFTPNLATVYNELLPKG-NFEVVFVSADED---EESFKEYFGKMPWTAVPFSDS  392
              G C  F P L  ++  L  +G NFE+V +  D+D   EE+F++ F K+PW ++P  D 
Sbjct  209  EDGGCKAFNPKLIELHKALKQEGDNFEIVMIPLDDDDDKEEAFQQQFEKLPWLSLPAKDK  268

Query  393  VTRERLDALFTVRGIPHLVILDESGKVTTEDGVDIVLEHGVEAYPF  530
            ++  +L   F + G+P +V++   G     D  + + EHG +AYPF
Sbjct  269  ISM-KLAKYFELAGLPTVVVIGPEGNTIHSDVAEAIEEHGAKAYPF  313



>ref|XP_002467709.1| hypothetical protein SORBIDRAFT_01g032910 [Sorghum bicolor]
 gb|EER94707.1| hypothetical protein SORBIDRAFT_01g032910 [Sorghum bicolor]
Length=584

 Score =   182 bits (463),  Expect = 7e-51, Method: Compositional matrix adjust.
 Identities = 87/139 (63%), Positives = 106/139 (76%), Gaps = 2/139 (1%)
 Frame = +3

Query  120  ILCSSDRDFLIRNSGHQVKVDDLKGKKIGIYFSASWCGPCHRFTPNLATVYNELLPKG-N  296
            IL +++RDFL+RNSG QVK+  ++   + IYFSASWC PC RFTP L  VY EL  +G +
Sbjct  22   ILATAERDFLVRNSGEQVKISSIEASPVAIYFSASWCPPCRRFTPKLIEVYKELAEQGKS  81

Query  297  FEVVFVSADEDEESFKEYFGKMPWTAVPFSDSVTRERLDALFTVRGIPHLVILD-ESGKV  473
            FEV+F SAD++EE F EYF KMPW AVPFSD+  R  LDA F V GIPHLVILD ++G+V
Sbjct  82   FEVIFASADQNEEGFNEYFAKMPWLAVPFSDTEGRAALDARFKVSGIPHLVILDAKTGEV  141

Query  474  TTEDGVDIVLEHGVEAYPF  530
             TEDGV+ V E+GVEAYPF
Sbjct  142  YTEDGVEFVSEYGVEAYPF  160


 Score =   129 bits (324),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 60/144 (42%), Positives = 88/144 (61%), Gaps = 2/144 (1%)
 Frame = +3

Query  102  AHDLRSILCSSDRDFLIRNSGHQVKVDDLKGKKIGIYFSASWCGPCHRFTPNLATVYNEL  281
            +  L S+L S D DF+I   G +V V +L GK + +YFSA WCGPC  F P L   YN++
Sbjct  341  SQTLESLLISGDLDFVIGKGGAKVPVSELVGKTVLLYFSAKWCGPCRAFLPTLVKEYNKI  400

Query  282  LPKG-NFEVVFVSADEDEESFKEYFGKMPWTAVPFSDSVTRERLDALFTVRGIPHLVILD  458
              K  +FE+VF+S+D D+ SF ++F +MPW A+P  D   +  L   F +RGIP LV + 
Sbjct  401  KEKNSDFEIVFISSDRDQSSFDDFFSQMPWLALPLEDE-RKVSLKKTFKIRGIPSLVAIG  459

Query  459  ESGKVTTEDGVDIVLEHGVEAYPF  530
             +G+  + D    ++ HG +A+PF
Sbjct  460  PTGQTVSRDAKAQLMIHGADAFPF  483


 Score =   110 bits (275),  Expect = 9e-25, Method: Compositional matrix adjust.
 Identities = 63/164 (38%), Positives = 93/164 (57%), Gaps = 4/164 (2%)
 Frame = +3

Query  36   FQFSKRKGEERKASSMAEQNGDAHDLRSILCSSDRDFLIRNSGHQVKVDDLKGKKIGIYF  215
            + F+  +  E K    AE+  +   ++S+L +S RD+LI N G +V + +L+GK +G+ F
Sbjct  158  YPFTPDRINELKEQEKAEK--ENQTIQSVLGTSTRDYLISNKGDKVPISELEGKYVGLCF  215

Query  216  SASWCGPCHRFTPNLATVYNELLPKG-NFEVVFVSADEDEESFKEYFGKMPWTAVPFSDS  392
                 GP   FT +LA +Y +L   G  FEVV VS D +E +F E F KMPW A+P  D 
Sbjct  216  VVDGYGPVIEFTDSLAKIYEKLKEVGEKFEVVAVSLDSEESAFNESFAKMPWLAIPQGDQ  275

Query  393  VTRERLDALFTVRGIPHLVILDESGKVTTEDGVDIVLEHGVEAY  524
               E+L   F +R +P LV++   GK    +  DI+ EHG EA+
Sbjct  276  KC-EKLVRYFELRSLPTLVLIGPDGKTLNSNVADIIDEHGFEAW  318



>ref|XP_002314537.2| hypothetical protein POPTR_0010s06940g [Populus trichocarpa]
 gb|EEF00708.2| hypothetical protein POPTR_0010s06940g [Populus trichocarpa]
Length=564

 Score =   182 bits (462),  Expect = 7e-51, Method: Compositional matrix adjust.
 Identities = 83/132 (63%), Positives = 102/132 (77%), Gaps = 0/132 (0%)
 Frame = +3

Query  135  DRDFLIRNSGHQVKVDDLKGKKIGIYFSASWCGPCHRFTPNLATVYNELLPKGNFEVVFV  314
            +RDFLIRN+G QVKV +L GK +G YFS SWCGPC  FTP L  VY +L  KG+FEVVF+
Sbjct  18   ERDFLIRNNGDQVKVSNLVGKIVGFYFSGSWCGPCRNFTPLLVEVYEQLSSKGDFEVVFI  77

Query  315  SADEDEESFKEYFGKMPWTAVPFSDSVTRERLDALFTVRGIPHLVILDESGKVTTEDGVD  494
            S+D D+ESF  YF +MPW A+PFSD+ TR+RL  +F VRGIP+LVI D +GKV+ +DGV 
Sbjct  78   SSDRDDESFNTYFSEMPWLAIPFSDTETRKRLKEVFKVRGIPNLVIFDTNGKVSCDDGVS  137

Query  495  IVLEHGVEAYPF  530
             V EHGV+ YPF
Sbjct  138  TVKEHGVDGYPF  149


 Score =   128 bits (321),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 68/154 (44%), Positives = 95/154 (62%), Gaps = 5/154 (3%)
 Frame = +3

Query  81   MAEQNGDA---HDLRSILCSSDRDFLIRNSGHQVKVDDLKGKKIGIYFSASWCGPCHRFT  251
            + EQ  +A     + SIL SS RD++I N G ++ V DL+GK +G+YFS      C  FT
Sbjct  157  LKEQEENAKKNQTISSILVSSSRDYVISNDGKKIPVLDLEGKLVGLYFSIHAHRMCREFT  216

Query  252  PNLATVYNELLPKG-NFEVVFVSADEDEESFKEYFGKMPWTAVPFSDSVTRERLDALFTV  428
            P L  +Y  L  KG NFEVV +S D +E+ FKE F  MPW A+PF D  + E+L   F +
Sbjct  217  PKLVELYKRLKEKGENFEVVLISLDSEEKHFKESFETMPWFALPFKDK-SCEKLARYFEL  275

Query  429  RGIPHLVILDESGKVTTEDGVDIVLEHGVEAYPF  530
            R IP+LVI+ + GK    +  +++ +HG+EAYPF
Sbjct  276  RTIPNLVIIGQDGKTLNPNVAELIEDHGIEAYPF  309


 Score =   124 bits (311),  Expect = 6e-30, Method: Compositional matrix adjust.
 Identities = 62/166 (37%), Positives = 99/166 (60%), Gaps = 4/166 (2%)
 Frame = +3

Query  36   FQFSKRKGEERKASSMAEQNGDAHDLRSILCSSDRDFLIRNSGHQVKVDDLKGKKIGIYF  215
            + F+  K EE   + + +   ++  L S+L + + DF+I  SG +V+V DL GK I +YF
Sbjct  307  YPFTPEKLEE--LAEIEKAKLESQTLESVLVNGENDFVIDKSGSKVRVSDLVGKNILLYF  364

Query  216  SASWCGPCHRFTPNLATVYNELLPKGN-FEVVFVSADEDEESFKEYFGKMPWTAVPFSDS  392
            SA WC PC  F P L   Y+ +  K N FEV+F+S+D D+ +F E++ +MPW A+PF D 
Sbjct  365  SAQWCPPCRAFLPKLIEAYHTIKAKDNAFEVIFISSDSDQSTFDEFYSEMPWLALPFGDE  424

Query  393  VTRERLDALFTVRGIPHLVILDESGKVTTEDGVDIVLEHGVEAYPF  530
              ++ L   F ++GIP  V +  SG+  T++    +  +G +A+PF
Sbjct  425  -RKQILSRKFKIQGIPAAVAIGPSGRTITKEARMHLTAYGADAFPF  469



>gb|ABR16144.1| unknown [Picea sitchensis]
 gb|ACN41140.1| unknown [Picea sitchensis]
Length=586

 Score =   182 bits (462),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 83/146 (57%), Positives = 112/146 (77%), Gaps = 1/146 (1%)
 Frame = +3

Query  96   GDAHD-LRSILCSSDRDFLIRNSGHQVKVDDLKGKKIGIYFSASWCGPCHRFTPNLATVY  272
            G+ H+ L S+LC+ +RDFLIRN+G +VKV++L+GK +G+YFSA WC PC  FTP L+ +Y
Sbjct  14   GETHESLSSLLCNEERDFLIRNNGDKVKVEELEGKYVGLYFSAHWCPPCRSFTPVLSEIY  73

Query  273  NELLPKGNFEVVFVSADEDEESFKEYFGKMPWTAVPFSDSVTRERLDALFTVRGIPHLVI  452
             +LL KG+F++VF+SAD DE+SF+EY   MPW A+PFSD  TR+ L+  F V GIP LVI
Sbjct  74   KKLLEKGDFDIVFISADRDEKSFEEYHHTMPWLALPFSDENTRKNLNQAFQVHGIPCLVI  133

Query  453  LDESGKVTTEDGVDIVLEHGVEAYPF  530
            LD+ G+V T  GV+I+ E+  EAYPF
Sbjct  134  LDKEGRVITAKGVEIIKEYSAEAYPF  159


 Score =   155 bits (391),  Expect = 8e-41, Method: Compositional matrix adjust.
 Identities = 75/166 (45%), Positives = 109/166 (66%), Gaps = 4/166 (2%)
 Frame = +3

Query  36   FQFSKRKGEERKASSMAEQNGDAHDLRSILCSSDRDFLIRNSGHQVKVDDLKGKKIGIYF  215
            + F+  + +E +A   A +   A  + S+L S +RDF++ + G QV V +L GK +G+YF
Sbjct  157  YPFTAERLDELRAKEEAIRA--AQTVESLLLSDERDFVLGHEGTQVPVAELAGKTVGLYF  214

Query  216  SASWCGPCHRFTPNLATVYNELLPKGN-FEVVFVSADEDEESFKEYFGKMPWTAVPFSDS  392
            SA WCGPC  FTP L  +YNELL KG  FE+VF+S D++E++F+EY+  MPW A+PF+D+
Sbjct  215  SAHWCGPCRSFTPQLVEIYNELLKKGEAFEIVFLSRDKEEKAFEEYYASMPWLALPFADN  274

Query  393  VTRERLDALFTVRGIPHLVILDESGKVTTEDGVDIVLEHGVEAYPF  530
             T + L   F V GIP L+IL   GK    D V ++ ++G+ AYPF
Sbjct  275  -TEKNLSRYFRVPGIPTLIILGPDGKTVQTDAVGLIRDYGIRAYPF  319


 Score =   139 bits (350),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 65/141 (46%), Positives = 90/141 (64%), Gaps = 2/141 (1%)
 Frame = +3

Query  111  LRSILCSSDRDFLIRNSGHQVKVDDLKGKKIGIYFSASWCGPCHRFTPNLATVYNELLPK  290
            L S+L S +R+F+I +   QV V +L GK + +YFSA WC PC  FTP L  VYNEL  +
Sbjct  340  LESLLVSDERNFVINHGDAQVLVSELVGKTVALYFSAHWCPPCRSFTPELTKVYNELKER  399

Query  291  G-NFEVVFVSADEDEESFKEYFGKMPWTAVPFSDSVTRERLDALFTVRGIPHLVILDESG  467
            G  FE+VF+S D ++++F++Y+  MPW A+PF D  T++ L   F VRGIP L+++   G
Sbjct  400  GETFEIVFISMDRNQDAFEDYYKSMPWLALPFGDK-TKKDLSRFFRVRGIPSLIVVGPDG  458

Query  468  KVTTEDGVDIVLEHGVEAYPF  530
            K  T +    V  HG  AYPF
Sbjct  459  KTVTSNARSAVSTHGARAYPF  479



>ref|NP_001050329.1| Os03g0405500 [Oryza sativa Japonica Group]
 sp|Q7Y0E8.1|NRX11_ORYSJ RecName: Full=Probable nucleoredoxin 1-1; Short=OsNrx1-1 [Oryza 
sativa Japonica Group]
 gb|AAP50936.1| putative trypanothione-dependent peroxidase [Oryza sativa Japonica 
Group]
 gb|ABF96507.1| PDI, putative, expressed [Oryza sativa Japonica Group]
 dbj|BAF12243.1| Os03g0405500 [Oryza sativa Japonica Group]
 gb|EAZ27269.1| hypothetical protein OsJ_11206 [Oryza sativa Japonica Group]
 dbj|BAG91502.1| unnamed protein product [Oryza sativa Japonica Group]
Length=569

 Score =   182 bits (461),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 86/147 (59%), Positives = 107/147 (73%), Gaps = 2/147 (1%)
 Frame = +3

Query  96   GDAHDLRSILCSSDRDFLIRNSGHQVKVDDLKGKKIGIYFSASWCGPCHRFTPNLATVYN  275
             DA  + ++L +  RDFL+RNS  QVK+  ++   + +YFSASWC PC RFTP L   YN
Sbjct  2    ADAAGIATVLAADGRDFLLRNSADQVKISSIEASTVALYFSASWCPPCRRFTPKLIEAYN  61

Query  276  ELLPKG-NFEVVFVSADEDEESFKEYFGKMPWTAVPFSDSVTRERLDALFTVRGIPHLVI  452
            EL+ +G NFEVVFVS D+D+E+F  YF KMPW AVPFSDS  R +L+  F VRGIPHLVI
Sbjct  62   ELVSQGKNFEVVFVSGDKDQEAFDAYFAKMPWLAVPFSDSECRAKLNKRFKVRGIPHLVI  121

Query  453  LDE-SGKVTTEDGVDIVLEHGVEAYPF  530
            L+  SG+V TEDGV++V  HG EAYPF
Sbjct  122  LNATSGEVYTEDGVELVTVHGTEAYPF  148


 Score =   127 bits (319),  Expect = 6e-31, Method: Compositional matrix adjust.
 Identities = 64/166 (39%), Positives = 92/166 (55%), Gaps = 4/166 (2%)
 Frame = +3

Query  36   FQFSKRKGEERKASSMAEQNGDAHDLRSILCSSDRDFLIRNSGHQVKVDDLKGKKIGIYF  215
            F F+  K E    +  A+   +   L S+L   D DF++   G +V V +L GK + +YF
Sbjct  309  FPFTAEKME--ILAEKAKAKAELQTLESLLVIGDLDFVLGKDGAKVPVSELVGKTVLLYF  366

Query  216  SASWCGPCHRFTPNLATVYNELLPKGN-FEVVFVSADEDEESFKEYFGKMPWTAVPFSDS  392
            SA WCGPC  F P L   YN++  K N FE++F+S+D D+ S+ E+F  MPW A+P  D 
Sbjct  367  SAKWCGPCRAFLPKLVDEYNKIKEKHNDFEIIFISSDRDQSSYDEFFSGMPWLALPLGDE  426

Query  393  VTRERLDALFTVRGIPHLVILDESGKVTTEDGVDIVLEHGVEAYPF  530
              ++ L   F VRGIP LV +   G+    D    +  HG +A+PF
Sbjct  427  -RKQHLSKTFRVRGIPSLVAIGADGRTVARDAKTPLTAHGADAFPF  471


 Score =   105 bits (262),  Expect = 5e-23, Method: Compositional matrix adjust.
 Identities = 62/164 (38%), Positives = 91/164 (55%), Gaps = 4/164 (2%)
 Frame = +3

Query  36   FQFSKRKGEERKASSMAEQNGDAHDLRSILCSSDRDFLIRNSGHQVKVDDLKGKKIGIYF  215
            + F+  +  E K    A +  D   ++S+L +  RD+L+ N G +V + DL+GK +G+ F
Sbjct  146  YPFTTERINELKEQEKAAK--DNQTVQSVLGTPTRDYLLSNKGDRVPISDLEGKYVGLCF  203

Query  216  SASWCGPCHRFTPNLATVYNELLPKG-NFEVVFVSADEDEESFKEYFGKMPWTAVPFSDS  392
              +  GP  +FT  LA  Y +L   G  FEVV VS D DEE   E F  MPW A+P  D 
Sbjct  204  VVNGYGPVVQFTSLLAKFYEKLKEVGEKFEVVAVSLDSDEELSNESFAGMPWLAIPQEDK  263

Query  393  VTRERLDALFTVRGIPHLVILDESGKVTTEDGVDIVLEHGVEAY  524
            +  E+L   F +RG+P LV++   GK    +  DI+ EHG +A+
Sbjct  264  MG-EKLARYFELRGLPTLVLIGPDGKTLNNNVADIIDEHGQDAW  306



>ref|XP_009626672.1| PREDICTED: probable nucleoredoxin 1 [Nicotiana tomentosiformis]
Length=547

 Score =   181 bits (459),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 81/148 (55%), Positives = 104/148 (70%), Gaps = 0/148 (0%)
 Frame = +3

Query  87   EQNGDAHDLRSILCSSDRDFLIRNSGHQVKVDDLKGKKIGIYFSASWCGPCHRFTPNLAT  266
            +Q    HDL  +L S+ RDFLI  +G +V++  +KGK +G+YFS  WCG C +FTP L  
Sbjct  6    DQESIPHDLTVVLSSTQRDFLICRNGERVRISSIKGKIVGLYFSGLWCGLCRQFTPKLVE  65

Query  267  VYNELLPKGNFEVVFVSADEDEESFKEYFGKMPWTAVPFSDSVTRERLDALFTVRGIPHL  446
             Y +L PKG+FE+VF+S+D+D ESF EYFGKMPW AVPFSD+  R+ L  LF VR IPH 
Sbjct  66   AYEDLYPKGDFEIVFISSDKDNESFNEYFGKMPWLAVPFSDADARKNLKQLFKVRAIPHF  125

Query  447  VILDESGKVTTEDGVDIVLEHGVEAYPF  530
            VILD +GKV + +GV  +   G EAYPF
Sbjct  126  VILDGTGKVLSNEGVKFIKHFGSEAYPF  153


 Score =   119 bits (297),  Expect = 6e-28, Method: Compositional matrix adjust.
 Identities = 61/153 (40%), Positives = 85/153 (56%), Gaps = 2/153 (1%)
 Frame = +3

Query  75   SSMAEQNGDAHDLRSILCSSDRDFLIRNSGHQVKVDDLKGKKIGIYFSASWCGPCHRFTP  254
            +++ ++  +A  L SIL ++DRDF+I N G +V V  L G  I +YF+A W  P   F P
Sbjct  320  ANLKKEKLEAQTLESILVTADRDFVISNVGLKVPVSKLVGNNIVLYFAAQWSLPSREFLP  379

Query  255  NLATVYNELLPKG-NFEVVFVSADEDEESFKEYFGKMPWTAVPFSDSVTRERLDALFTVR  431
             L T Y E+  K  NFEV+F+S+D+DE SF   F  MPW A+PF D   +  L   F + 
Sbjct  380  KLITTYEEIKKKDENFEVIFISSDQDESSFNNLFSSMPWLALPFDDE-RKTFLSRRFNIV  438

Query  432  GIPHLVILDESGKVTTEDGVDIVLEHGVEAYPF  530
            GIP  + +  SG         ++  HG  AYPF
Sbjct  439  GIPVAIAISTSGCTVNTQVRQLLETHGAGAYPF  471


 Score =   115 bits (287),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 64/162 (40%), Positives = 92/162 (57%), Gaps = 5/162 (3%)
 Frame = +3

Query  45   SKRKGEERKASSMAEQNGDAHDLRSILCSSDRDFLIRNSGHQVKVDDLKGKKIGIYFSAS  224
            S+R    R+    A++N     LRSIL    RDFLI N  +++ V +L+GK +G+YF+ +
Sbjct  155  SERVNYLREEEEKAKEN---QSLRSILVHESRDFLISNEENKISVSELEGKTVGLYFAMA  211

Query  225  WCGPCHRFTPNLATVYNELLPKGNFEVVFVSADEDEESFKEYFGKMPWTAVPFSDSVTRE  404
                C  FT  LA VY +L  K NFE+  +S DE  E FK+ F  MPW  +PF D    E
Sbjct  212  SHKGCKNFTLKLADVYKKLKQK-NFEIALISLDEKYEDFKQGFETMPWLGLPFKDK-NCE  269

Query  405  RLDALFTVRGIPHLVILDESGKVTTEDGVDIVLEHGVEAYPF  530
            RL   F  + +P LV++   GK   ++ V +V E+G +A+PF
Sbjct  270  RLVRYFEHKLLPQLVVISPDGKTLQQNAVKLVEEYGDQAFPF  311



>ref|XP_002314533.2| hypothetical protein POPTR_0010s06960g [Populus trichocarpa]
 gb|EEF00704.2| hypothetical protein POPTR_0010s06960g [Populus trichocarpa]
Length=564

 Score =   181 bits (459),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 88/143 (62%), Positives = 109/143 (76%), Gaps = 0/143 (0%)
 Frame = +3

Query  102  AHDLRSILCSSDRDFLIRNSGHQVKVDDLKGKKIGIYFSASWCGPCHRFTPNLATVYNEL  281
            +HDL S+L S +RDFLIRN+G QVKV +L GK +G YFS SWCGPC  FTP L  VY +L
Sbjct  7    SHDLSSLLSSEERDFLIRNNGDQVKVSNLVGKIVGFYFSGSWCGPCRNFTPLLVEVYEQL  66

Query  282  LPKGNFEVVFVSADEDEESFKEYFGKMPWTAVPFSDSVTRERLDALFTVRGIPHLVILDE  461
              KG FEVVF+S+D D+ESF  YF +MPW A+PFSD+ TR+RL  +F VRGIP LVI D 
Sbjct  67   SSKGGFEVVFISSDGDDESFNTYFSEMPWLAIPFSDTETRQRLKEVFKVRGIPRLVIFDT  126

Query  462  SGKVTTEDGVDIVLEHGVEAYPF  530
            +GKV++++GV  V EHGV+ YPF
Sbjct  127  NGKVSSDNGVRHVKEHGVDGYPF  149


 Score =   131 bits (329),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 71/154 (46%), Positives = 96/154 (62%), Gaps = 5/154 (3%)
 Frame = +3

Query  81   MAEQNGDA---HDLRSILCSSDRDFLIRNSGHQVKVDDLKGKKIGIYFSASWCGPCHRFT  251
            + EQ  +A     + SIL SS RD++I N G ++ V DL+GK +G+YFSA     C  FT
Sbjct  157  LKEQEENAKKNQTISSILVSSSRDYVISNDGKKIPVLDLEGKLVGLYFSAHAHRMCREFT  216

Query  252  PNLATVYNELLPKG-NFEVVFVSADEDEESFKEYFGKMPWTAVPFSDSVTRERLDALFTV  428
            P L  +Y  L  KG NFEVV +S D++EE FKE F  MPW A+PF D  + E+L   F +
Sbjct  217  PKLVELYKTLKEKGENFEVVLISLDDEEEDFKESFETMPWLALPFKDK-SCEKLVRYFEL  275

Query  429  RGIPHLVILDESGKVTTEDGVDIVLEHGVEAYPF  530
            R IP+LVI+ + GK       +++ EHG+EAYPF
Sbjct  276  RTIPNLVIIGQDGKTLNPYVAELIEEHGIEAYPF  309


 Score =   120 bits (302),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 62/166 (37%), Positives = 98/166 (59%), Gaps = 4/166 (2%)
 Frame = +3

Query  36   FQFSKRKGEERKASSMAEQNGDAHDLRSILCSSDRDFLIRNSGHQVKVDDLKGKKIGIYF  215
            + F+  K +E  A   A+   ++  L S+L + + DF+I  SG +V V +L GK I +YF
Sbjct  307  YPFTPEKLDELAAIEKAKL--ESQTLESVLVNGENDFVIDKSGSKVPVSELVGKNILLYF  364

Query  216  SASWCGPCHRFTPNLATVYNELLPKGN-FEVVFVSADEDEESFKEYFGKMPWTAVPFSDS  392
            SA WC PC  F P L   Y+ +  K N FEV+F+S+D D+ +F E++ +MPW A+PF D 
Sbjct  365  SAQWCPPCRAFLPKLIEAYHTIKRKDNAFEVIFISSDRDQSTFDEFYSEMPWLALPFGDG  424

Query  393  VTRERLDALFTVRGIPHLVILDESGKVTTEDGVDIVLEHGVEAYPF  530
              ++ L   F ++GIP  V +  SG+  T++    +  +G +A+PF
Sbjct  425  -RKQILSRKFKIQGIPAAVAIGPSGRTITKEARMHLTAYGADAFPF  469



>ref|XP_002314536.2| hypothetical protein POPTR_0010s06970g [Populus trichocarpa]
 gb|EEF00707.2| hypothetical protein POPTR_0010s06970g [Populus trichocarpa]
Length=473

 Score =   179 bits (455),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 82/132 (62%), Positives = 100/132 (76%), Gaps = 0/132 (0%)
 Frame = +3

Query  135  DRDFLIRNSGHQVKVDDLKGKKIGIYFSASWCGPCHRFTPNLATVYNELLPKGNFEVVFV  314
            +RDFLIRN+G QVKV DL GK +G YFS SWCGPC  FTP L  VY  L  KG+FEVVF+
Sbjct  18   ERDFLIRNNGDQVKVSDLVGKIVGFYFSGSWCGPCRNFTPLLVEVYEHLSSKGDFEVVFI  77

Query  315  SADEDEESFKEYFGKMPWTAVPFSDSVTRERLDALFTVRGIPHLVILDESGKVTTEDGVD  494
            S+D D+ESF  YF +MPW A+PFS++ TR+RL  +F VRGIP LVI D +GKV+ ++GV 
Sbjct  78   SSDGDDESFNTYFSEMPWLAIPFSETETRQRLKEVFKVRGIPRLVIFDTNGKVSCDNGVS  137

Query  495  IVLEHGVEAYPF  530
             V EHGV+ YPF
Sbjct  138  TVKEHGVDGYPF  149


 Score =   130 bits (326),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 69/154 (45%), Positives = 95/154 (62%), Gaps = 5/154 (3%)
 Frame = +3

Query  81   MAEQNGDA---HDLRSILCSSDRDFLIRNSGHQVKVDDLKGKKIGIYFSASWCGPCHRFT  251
            + EQ  +A     + SIL SS RD++I N G ++ V DL+GK +G+YFS      C  FT
Sbjct  157  LKEQEENAKKNQTISSILVSSSRDYVISNDGKKIPVSDLEGKLVGLYFSVHAHRMCGEFT  216

Query  252  PNLATVYNELLPKG-NFEVVFVSADEDEESFKEYFGKMPWTAVPFSDSVTRERLDALFTV  428
            P L  +Y  L  KG NFEVV +S D++EE FKE F  MPW A+P  D  + E+L   F +
Sbjct  217  PKLVELYKTLKEKGENFEVVLLSLDDEEEDFKESFETMPWLALPLKDK-SCEKLVRYFEL  275

Query  429  RGIPHLVILDESGKVTTEDGVDIVLEHGVEAYPF  530
            R IP+LVI+ + GK    +  +++ EHG+EAYPF
Sbjct  276  RTIPNLVIIGQDGKTLNPNVAELIEEHGIEAYPF  309


 Score =   121 bits (303),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 62/166 (37%), Positives = 97/166 (58%), Gaps = 4/166 (2%)
 Frame = +3

Query  36   FQFSKRKGEERKASSMAEQNGDAHDLRSILCSSDRDFLIRNSGHQVKVDDLKGKKIGIYF  215
            + F+  K +E  A   A+   ++  L S+L + + DF+I  SG +V V DL GK I +YF
Sbjct  307  YPFTPEKLDELAAIEKAKL--ESQTLESVLVNGENDFVIGKSGSKVPVSDLVGKNILLYF  364

Query  216  SASWCGPCHRFTPNLATVYNELLPKGN-FEVVFVSADEDEESFKEYFGKMPWTAVPFSDS  392
            SA WC PC  F P L   Y+ +  K N FEV+F+S+D D+ +F E++ +MPW A+PF D 
Sbjct  365  SAQWCPPCRAFLPKLIEAYHTIKRKDNAFEVIFISSDRDQSTFDEFYSEMPWLALPFGDE  424

Query  393  VTRERLDALFTVRGIPHLVILDESGKVTTEDGVDIVLEHGVEAYPF  530
              ++ L   F ++GIP  V +  SG+  T++    +  +G +A+P 
Sbjct  425  -RKQILSRKFKIQGIPAAVAIGPSGRTITKEARMHLTAYGADAFPL  469



>ref|XP_002314534.2| hypothetical protein POPTR_0010s07000g [Populus trichocarpa]
 gb|EEF00705.2| hypothetical protein POPTR_0010s07000g [Populus trichocarpa]
Length=564

 Score =   181 bits (458),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 88/143 (62%), Positives = 109/143 (76%), Gaps = 0/143 (0%)
 Frame = +3

Query  102  AHDLRSILCSSDRDFLIRNSGHQVKVDDLKGKKIGIYFSASWCGPCHRFTPNLATVYNEL  281
            +HDL S+L S +RDFLIRN+G QVKV +L GK +G YFS SWCGPC  FTP L  VY +L
Sbjct  7    SHDLSSLLSSEERDFLIRNNGDQVKVSNLVGKIVGFYFSGSWCGPCRNFTPLLVEVYEQL  66

Query  282  LPKGNFEVVFVSADEDEESFKEYFGKMPWTAVPFSDSVTRERLDALFTVRGIPHLVILDE  461
              KG+FEVVF+S+D D+ESF  YF +MPW A+PFSD+ TR+RL  +F VRGIP LVI D 
Sbjct  67   SSKGDFEVVFISSDGDDESFNTYFSEMPWLAIPFSDTETRQRLKEVFKVRGIPRLVIFDT  126

Query  462  SGKVTTEDGVDIVLEHGVEAYPF  530
            +GKV+ ++GV  V EHGV+ YPF
Sbjct  127  NGKVSCDNGVRHVKEHGVDGYPF  149


 Score =   130 bits (326),  Expect = 6e-32, Method: Compositional matrix adjust.
 Identities = 70/154 (45%), Positives = 96/154 (62%), Gaps = 5/154 (3%)
 Frame = +3

Query  81   MAEQNGDA---HDLRSILCSSDRDFLIRNSGHQVKVDDLKGKKIGIYFSASWCGPCHRFT  251
            + EQ  +A     + SIL SS RD++I N G ++ V DL+GK +G+YFSA     C  FT
Sbjct  157  LKEQEENAKKNQTISSILVSSSRDYVISNDGKKIPVLDLEGKLVGLYFSAHAHRMCREFT  216

Query  252  PNLATVYNELLPKG-NFEVVFVSADEDEESFKEYFGKMPWTAVPFSDSVTRERLDALFTV  428
            P L  +Y  L  K  NFEVV +S D++EE FKE F  MPW A+PF D  + E+L   F +
Sbjct  217  PKLVELYKTLKEKRENFEVVLISLDDEEEDFKESFETMPWLALPFKDK-SCEKLVRYFEL  275

Query  429  RGIPHLVILDESGKVTTEDGVDIVLEHGVEAYPF  530
            R IP+LVI+ + GK    +  +++ EHG+EAYPF
Sbjct  276  RTIPNLVIIGQDGKTLNPNVAELIEEHGIEAYPF  309


 Score =   120 bits (301),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 62/166 (37%), Positives = 98/166 (59%), Gaps = 4/166 (2%)
 Frame = +3

Query  36   FQFSKRKGEERKASSMAEQNGDAHDLRSILCSSDRDFLIRNSGHQVKVDDLKGKKIGIYF  215
            + F+  K +E  A   A+   ++  L S+L + + DF+I  SG +V V +L GK I +YF
Sbjct  307  YPFTPEKLDELAAIEKAKL--ESQTLESVLVNGENDFVIDKSGSKVPVSELVGKNILLYF  364

Query  216  SASWCGPCHRFTPNLATVYNELLPKGN-FEVVFVSADEDEESFKEYFGKMPWTAVPFSDS  392
            SA WC PC  F P L   Y+ +  K N FEV+F+S+D D+ +F E++ +MPW A+PF D 
Sbjct  365  SAQWCPPCRAFLPKLIEAYHTIKRKDNAFEVIFISSDRDQSTFDEFYSEMPWLALPFGDG  424

Query  393  VTRERLDALFTVRGIPHLVILDESGKVTTEDGVDIVLEHGVEAYPF  530
              ++ L   F ++GIP  V +  SG+  T++    +  +G +A+PF
Sbjct  425  -RKQILSRKFKIQGIPAAVAIGPSGRTITKEARMHLTAYGADAFPF  469



>ref|XP_003562828.1| PREDICTED: probable nucleoredoxin 1-2 [Brachypodium distachyon]
Length=577

 Score =   180 bits (457),  Expect = 5e-50, Method: Compositional matrix adjust.
 Identities = 86/152 (57%), Positives = 110/152 (72%), Gaps = 2/152 (1%)
 Frame = +3

Query  81   MAEQNGDAHDLRSILCSSDRDFLIRNSGHQVKVDDLKGKKIGIYFSASWCGPCHRFTPNL  260
            MA  +     + +IL + +RD+L+RNSG QVK+  ++   + +YFSASWC PC RFTP L
Sbjct  1    MAAASTTDGGVGAILTAGERDYLVRNSGEQVKISSIEAGTVALYFSASWCPPCRRFTPKL  60

Query  261  ATVYNELLPKG-NFEVVFVSADEDEESFKEYFGKMPWTAVPFSDSVTRERLDALFTVRGI  437
               Y EL  +G +FEVVFVS D+DEE+F  YF KMPW AVPF+DS  R+ LD  F VRGI
Sbjct  61   IEAYKELASQGKSFEVVFVSGDQDEEAFNAYFAKMPWLAVPFTDSEGRKSLDERFQVRGI  120

Query  438  PHLVILD-ESGKVTTEDGVDIVLEHGVEAYPF  530
            PHLVILD ++GKV TEDGV+ V E+G++AYPF
Sbjct  121  PHLVILDAKTGKVCTEDGVEFVSEYGIDAYPF  152


 Score =   132 bits (333),  Expect = 7e-33, Method: Compositional matrix adjust.
 Identities = 63/150 (42%), Positives = 89/150 (59%), Gaps = 2/150 (1%)
 Frame = +3

Query  84   AEQNGDAHDLRSILCSSDRDFLIRNSGHQVKVDDLKGKKIGIYFSASWCGPCHRFTPNLA  263
            A    ++  L+S+L + D DF+I   G +V V  L GK + +YFSA WCGPC  F P L 
Sbjct  327  ARAKAESQTLQSLLVTGDLDFVIGKDGAKVPVSQLVGKTVLLYFSAQWCGPCRAFLPTLV  386

Query  264  TVYNELLPK-GNFEVVFVSADEDEESFKEYFGKMPWTAVPFSDSVTRERLDALFTVRGIP  440
             VYN++  K  +FE+VF+S+D D+ SF ++F  MPW A+P  D   +  L  +F +RGIP
Sbjct  387  DVYNKIKEKNSDFEIVFISSDRDQSSFDDFFSGMPWLALPLEDE-RKAYLKKMFKIRGIP  445

Query  441  HLVILDESGKVTTEDGVDIVLEHGVEAYPF  530
             LV +  SGK    D    +  HG +A+PF
Sbjct  446  SLVAIGPSGKTVNTDAKAPLAVHGADAFPF  475


 Score =   108 bits (270),  Expect = 5e-24, Method: Compositional matrix adjust.
 Identities = 62/164 (38%), Positives = 91/164 (55%), Gaps = 4/164 (2%)
 Frame = +3

Query  36   FQFSKRKGEERKASSMAEQNGDAHDLRSILCSSDRDFLIRNSGHQVKVDDLKGKKIGIYF  215
            + F+  +  E K    A +  D   + S+L +  RD+LI N G +V + DL+GK +G+ F
Sbjct  150  YPFTPERINELKEQEKAAK--DNQTIHSVLSAPTRDYLISNKGDKVPISDLEGKYVGLCF  207

Query  216  SASWCGPCHRFTPNLATVYNELLPKG-NFEVVFVSADEDEESFKEYFGKMPWTAVPFSDS  392
              S  GP   FT  LA +Y +L   G  FEVV VS D DE SF E F  MPW A+P  D 
Sbjct  208  VVSGYGPVEEFTTVLAKIYGKLKEVGKKFEVVAVSMDNDEASFNESFQNMPWLAIPQGDK  267

Query  393  VTRERLDALFTVRGIPHLVILDESGKVTTEDGVDIVLEHGVEAY  524
            +  ++L + F +  +P LV++   GK    +  DI+ E+GVE++
Sbjct  268  MC-QKLVSYFELNDLPTLVLIGPDGKTLNSNIADIIEENGVESW  310



>ref|XP_003557743.1| PREDICTED: probable nucleoredoxin 1-2 [Brachypodium distachyon]
Length=577

 Score =   180 bits (457),  Expect = 5e-50, Method: Compositional matrix adjust.
 Identities = 86/152 (57%), Positives = 110/152 (72%), Gaps = 2/152 (1%)
 Frame = +3

Query  81   MAEQNGDAHDLRSILCSSDRDFLIRNSGHQVKVDDLKGKKIGIYFSASWCGPCHRFTPNL  260
            MA  +     + +IL + +RD+L+RNSG QVK+  ++   + +YFSASWC PC RFTP L
Sbjct  1    MAAASTTDGGVGAILTAGERDYLVRNSGEQVKISSIEAGTVALYFSASWCPPCRRFTPKL  60

Query  261  ATVYNELLPKG-NFEVVFVSADEDEESFKEYFGKMPWTAVPFSDSVTRERLDALFTVRGI  437
               Y EL  +G +FEVVFVS D+DEE+F  YF KMPW AVPF+DS  R+ LD  F VRGI
Sbjct  61   IEAYKELASQGKSFEVVFVSGDQDEEAFNAYFAKMPWLAVPFTDSEGRKSLDERFQVRGI  120

Query  438  PHLVILD-ESGKVTTEDGVDIVLEHGVEAYPF  530
            PHLVILD ++GKV TEDGV+ V E+G++AYPF
Sbjct  121  PHLVILDAKTGKVCTEDGVEFVSEYGIDAYPF  152


 Score =   132 bits (333),  Expect = 7e-33, Method: Compositional matrix adjust.
 Identities = 63/150 (42%), Positives = 89/150 (59%), Gaps = 2/150 (1%)
 Frame = +3

Query  84   AEQNGDAHDLRSILCSSDRDFLIRNSGHQVKVDDLKGKKIGIYFSASWCGPCHRFTPNLA  263
            A    ++  L+S+L + D DF+I   G +V V  L GK + +YFSA WCGPC  F P L 
Sbjct  327  ARAKAESQTLQSLLVTGDLDFVIGKDGAKVPVSQLVGKTVLLYFSAQWCGPCRAFLPTLV  386

Query  264  TVYNELLPK-GNFEVVFVSADEDEESFKEYFGKMPWTAVPFSDSVTRERLDALFTVRGIP  440
             VYN++  K  +FE+VF+S+D D+ SF ++F  MPW A+P  D   +  L  +F +RGIP
Sbjct  387  DVYNKIKEKNSDFEIVFISSDRDQSSFDDFFSGMPWLALPLEDE-RKAYLKKMFKIRGIP  445

Query  441  HLVILDESGKVTTEDGVDIVLEHGVEAYPF  530
             LV +  SGK    D    +  HG +A+PF
Sbjct  446  SLVAIGPSGKTVNTDAKAPLAVHGADAFPF  475


 Score =   108 bits (270),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 62/164 (38%), Positives = 91/164 (55%), Gaps = 4/164 (2%)
 Frame = +3

Query  36   FQFSKRKGEERKASSMAEQNGDAHDLRSILCSSDRDFLIRNSGHQVKVDDLKGKKIGIYF  215
            + F+  +  E K    A +  D   + S+L +  RD+LI N G +V + DL+GK +G+ F
Sbjct  150  YPFTPERINELKEQEKAAK--DNQTIHSVLSTPTRDYLISNKGDKVPISDLEGKYVGLCF  207

Query  216  SASWCGPCHRFTPNLATVYNELLPKG-NFEVVFVSADEDEESFKEYFGKMPWTAVPFSDS  392
              S  GP   FT  LA +Y +L   G  FEVV VS D DE SF E F  MPW A+P  D 
Sbjct  208  VVSGYGPVEEFTTVLAKIYGKLKEVGEKFEVVAVSMDNDEASFNESFQNMPWLAIPQGDK  267

Query  393  VTRERLDALFTVRGIPHLVILDESGKVTTEDGVDIVLEHGVEAY  524
            +  ++L + F +  +P LV++   GK    +  DI+ E+GVE++
Sbjct  268  MC-QKLVSYFELNDLPTLVLIGPDGKTLNSNIADIIEENGVESW  310



>ref|XP_006378292.1| hypothetical protein POPTR_0010s06950g [Populus trichocarpa]
 gb|ERP56089.1| hypothetical protein POPTR_0010s06950g [Populus trichocarpa]
Length=564

 Score =   180 bits (457),  Expect = 5e-50, Method: Compositional matrix adjust.
 Identities = 83/132 (63%), Positives = 100/132 (76%), Gaps = 0/132 (0%)
 Frame = +3

Query  135  DRDFLIRNSGHQVKVDDLKGKKIGIYFSASWCGPCHRFTPNLATVYNELLPKGNFEVVFV  314
            +RDFLIRN+G QVKV DL GK +G YFS SWCGPC  FTP L  VY  L  KG+FEVVF+
Sbjct  18   ERDFLIRNNGDQVKVSDLVGKIVGFYFSGSWCGPCRNFTPLLVEVYEHLSSKGDFEVVFI  77

Query  315  SADEDEESFKEYFGKMPWTAVPFSDSVTRERLDALFTVRGIPHLVILDESGKVTTEDGVD  494
            S+D D+ESF  YF +MPW A+PFS++ TR+RL  LF VRGIP LVI D +GKV+ ++GV 
Sbjct  78   SSDGDDESFNTYFSEMPWLAIPFSETETRQRLKELFKVRGIPRLVIFDTNGKVSCDNGVS  137

Query  495  IVLEHGVEAYPF  530
             V EHGV+ YPF
Sbjct  138  TVKEHGVDGYPF  149


 Score =   127 bits (320),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 68/154 (44%), Positives = 95/154 (62%), Gaps = 5/154 (3%)
 Frame = +3

Query  81   MAEQNGDA---HDLRSILCSSDRDFLIRNSGHQVKVDDLKGKKIGIYFSASWCGPCHRFT  251
            + EQ  +A     + SIL SS RD++I N G ++ V DL+GK +G+YFS      C  FT
Sbjct  157  LKEQEENAKKNQTISSILVSSSRDYVISNDGKKIPVLDLEGKLVGLYFSIHAHRMCREFT  216

Query  252  PNLATVYNELLPKG-NFEVVFVSADEDEESFKEYFGKMPWTAVPFSDSVTRERLDALFTV  428
            P L  +Y  L  KG NFEVV +S D +E+ FKE F  MPW A+PF D  + E+L   F +
Sbjct  217  PKLVELYKRLKEKGENFEVVLISLDSEEKHFKESFETMPWFALPFKDK-SCEKLARYFEL  275

Query  429  RGIPHLVILDESGKVTTEDGVDIVLEHGVEAYPF  530
            R IP+LVI+ + GK    +  +++ +HG+EAYPF
Sbjct  276  RTIPNLVIIGQDGKTLNPNVAELIEDHGIEAYPF  309


 Score =   122 bits (305),  Expect = 5e-29, Method: Compositional matrix adjust.
 Identities = 58/145 (40%), Positives = 89/145 (61%), Gaps = 2/145 (1%)
 Frame = +3

Query  99   DAHDLRSILCSSDRDFLIRNSGHQVKVDDLKGKKIGIYFSASWCGPCHRFTPNLATVYNE  278
            ++  L S+L + + DF+I  SG +V V DL GK I +YFSA WC PC  F P L   Y+ 
Sbjct  326  ESQTLESVLVNGENDFVIGKSGSKVPVSDLVGKNILLYFSAQWCPPCRAFLPKLIEAYHA  385

Query  279  LLPKGN-FEVVFVSADEDEESFKEYFGKMPWTAVPFSDSVTRERLDALFTVRGIPHLVIL  455
            +  K N FEV+F+S+D D+ +F E++ +MPW A+PF D   ++ L   F ++GIP  V +
Sbjct  386  IKAKDNAFEVIFISSDSDQTTFDEFYSEMPWLALPFGDG-RKQILSRKFKIQGIPAAVAI  444

Query  456  DESGKVTTEDGVDIVLEHGVEAYPF  530
              SG+  T++    +  +G +A+PF
Sbjct  445  GPSGRTITKEARMHLTAYGADAFPF  469



>ref|XP_011041505.1| PREDICTED: probable nucleoredoxin 1 [Populus euphratica]
Length=561

 Score =   179 bits (455),  Expect = 8e-50, Method: Compositional matrix adjust.
 Identities = 86/143 (60%), Positives = 109/143 (76%), Gaps = 0/143 (0%)
 Frame = +3

Query  102  AHDLRSILCSSDRDFLIRNSGHQVKVDDLKGKKIGIYFSASWCGPCHRFTPNLATVYNEL  281
            +HDL S+L S +RDFLIRN+G QV+V +L GK +G YFS SWCGPC  FTP L  VY +L
Sbjct  7    SHDLSSLLSSGERDFLIRNNGDQVRVSNLVGKIVGFYFSGSWCGPCRNFTPLLVEVYEQL  66

Query  282  LPKGNFEVVFVSADEDEESFKEYFGKMPWTAVPFSDSVTRERLDALFTVRGIPHLVILDE  461
              KG+FEVVF+S+D D+ESF  YF +MPW A+PFSD+ TR+RL  +F VRGIP+ VI D 
Sbjct  67   SSKGDFEVVFISSDRDDESFNTYFSEMPWLAIPFSDTETRKRLKEVFKVRGIPNHVIFDT  126

Query  462  SGKVTTEDGVDIVLEHGVEAYPF  530
            +GKV+ ++GV  V EHGV+ YPF
Sbjct  127  NGKVSCDNGVSTVKEHGVDGYPF  149


 Score =   127 bits (320),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 71/154 (46%), Positives = 94/154 (61%), Gaps = 7/154 (5%)
 Frame = +3

Query  81   MAEQNGDA---HDLRSILCSSDRDFLIRNSGHQVKVDDLKGKKIGIYFSASWCGPCHRFT  251
            + EQ  +A     + SIL SS RD++I N G ++ V DL+GK +G+YFS      C  FT
Sbjct  157  LKEQEENAKKNQTISSILVSSSRDYVISNDGKKIPVLDLEGKLVGLYFSIH--AICCEFT  214

Query  252  PNLATVYNELLPKG-NFEVVFVSADEDEESFKEYFGKMPWTAVPFSDSVTRERLDALFTV  428
            P L  +Y  L  KG NFEVV +S D DEE FKE F  MPW A+PF D   + +L   F +
Sbjct  215  PKLVELYKTLKEKGENFEVVLISLDYDEEDFKESFETMPWLALPFKDKSCK-KLVRYFEL  273

Query  429  RGIPHLVILDESGKVTTEDGVDIVLEHGVEAYPF  530
            R IP+LVI+ + GK    +  +++ EHGVEAYPF
Sbjct  274  RTIPNLVIIGQDGKTLNPNVAELIEEHGVEAYPF  307


 Score =   125 bits (313),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 63/166 (38%), Positives = 100/166 (60%), Gaps = 4/166 (2%)
 Frame = +3

Query  36   FQFSKRKGEERKASSMAEQNGDAHDLRSILCSSDRDFLIRNSGHQVKVDDLKGKKIGIYF  215
            + F+ +K +E  A   A+   ++  L S+L + + DF+I  SG +V+V DL GK I +YF
Sbjct  305  YPFTPKKLDELAAIEKAKL--ESQTLESVLVNGENDFVIDKSGSKVRVSDLVGKNILLYF  362

Query  216  SASWCGPCHRFTPNLATVYNELLPKGN-FEVVFVSADEDEESFKEYFGKMPWTAVPFSDS  392
            SA WC PC  F P L   Y+ +  K N FEV+F+S+D D+ +F E++ +MPW A+PF D 
Sbjct  363  SAQWCPPCRAFLPKLIEAYHTIKAKDNAFEVIFISSDSDQSTFDEFYSEMPWLALPFGDG  422

Query  393  VTRERLDALFTVRGIPHLVILDESGKVTTEDGVDIVLEHGVEAYPF  530
              ++ L   F ++GIP  V +  SG+  T++    +  +G +A+PF
Sbjct  423  -RKQILSRKFKIQGIPAAVAIGPSGRTITKEARMHLTAYGADAFPF  467



>gb|AHL29285.1| nucleoredoxin [Triticum aestivum]
Length=577

 Score =   178 bits (452),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 85/142 (60%), Positives = 105/142 (74%), Gaps = 2/142 (1%)
 Frame = +3

Query  111  LRSILCSSDRDFLIRNSGHQVKVDDLKGKKIGIYFSASWCGPCHRFTPNLATVYNELLPK  290
            L +IL + DRD+LIRNSG QVK+  ++G  + IYFSASWC PC RFTP L   Y EL   
Sbjct  12   LGAILAAGDRDYLIRNSGEQVKISSIEGDTVAIYFSASWCPPCQRFTPKLIEAYKELTSH  71

Query  291  G-NFEVVFVSADEDEESFKEYFGKMPWTAVPFSDSVTRERLDALFTVRGIPHLVILD-ES  464
            G +FEV+FVS D+DEE+F  YF KMPW AVPFSDS  R+ LD  F V GIPHLV LD ++
Sbjct  72   GKSFEVIFVSGDQDEEAFNAYFAKMPWLAVPFSDSEGRKSLDERFEVNGIPHLVFLDAKT  131

Query  465  GKVTTEDGVDIVLEHGVEAYPF  530
            G+V T++GV+ V E+G+EAYPF
Sbjct  132  GEVLTDEGVEFVSEYGIEAYPF  153


 Score =   127 bits (319),  Expect = 6e-31, Method: Compositional matrix adjust.
 Identities = 62/144 (43%), Positives = 85/144 (59%), Gaps = 2/144 (1%)
 Frame = +3

Query  102  AHDLRSILCSSDRDFLIRNSGHQVKVDDLKGKKIGIYFSASWCGPCHRFTPNLATVYNEL  281
            +  L S+L + D DF+I   G +V V +L GK + +YFSA WCGPC  F P L  VYN++
Sbjct  334  SQTLESLLVTGDVDFVIGKDGAKVPVAELVGKTVLLYFSAKWCGPCRAFLPTLVDVYNKI  393

Query  282  LPK-GNFEVVFVSADEDEESFKEYFGKMPWTAVPFSDSVTRERLDALFTVRGIPHLVILD  458
              K  +FE+VFVS+D D+ SF ++F  MPW A+P  D   +  L   F +RGIP LV + 
Sbjct  394  KEKNSDFEIVFVSSDRDQSSFDDFFSGMPWLAIPLEDE-RKAYLKKKFKIRGIPSLVAIG  452

Query  459  ESGKVTTEDGVDIVLEHGVEAYPF  530
              GK    D    +  HG +A+PF
Sbjct  453  PDGKTVNTDAKTSLAVHGADAFPF  476


 Score =   108 bits (269),  Expect = 5e-24, Method: Compositional matrix adjust.
 Identities = 60/164 (37%), Positives = 94/164 (57%), Gaps = 4/164 (2%)
 Frame = +3

Query  36   FQFSKRKGEERKASSMAEQNGDAHDLRSILCSSDRDFLIRNSGHQVKVDDLKGKKIGIYF  215
            + F+  +  E K    A +  D   + S+L + +R+++I N+G +V + DL+GK +GI F
Sbjct  151  YPFTTERINELKEQEKAAK--DNQTIHSVLATPNRNYVISNTGEKVPIVDLEGKYVGICF  208

Query  216  SASWCGPCHRFTPNLATVYNELLPKG-NFEVVFVSADEDEESFKEYFGKMPWTAVPFSDS  392
              +   P   FTP LA +Y +L   G  FEVV VS D DEESF   F  MPW A+P  D 
Sbjct  209  VVNGYPPVEEFTPVLAKIYAKLKEVGEKFEVVAVSLDSDEESFNNSFSSMPWLAIPQGDK  268

Query  393  VTRERLDALFTVRGIPHLVILDESGKVTTEDGVDIVLEHGVEAY  524
            +  ++L + F +  +P LV++   GK  + +  DI+ EHG++A+
Sbjct  269  MC-QKLVSYFELSDLPTLVLIGPDGKTLSSNIADIINEHGLDAW  311



>gb|EMT12941.1| Nucleoredoxin [Aegilops tauschii]
Length=577

 Score =   178 bits (452),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 85/142 (60%), Positives = 105/142 (74%), Gaps = 2/142 (1%)
 Frame = +3

Query  111  LRSILCSSDRDFLIRNSGHQVKVDDLKGKKIGIYFSASWCGPCHRFTPNLATVYNELLPK  290
            L +IL + DRD+LIRNSG QVK+  ++G  + IYFSASWC PC RFTP L   Y EL   
Sbjct  12   LGAILAAGDRDYLIRNSGEQVKISSIEGDTVAIYFSASWCPPCQRFTPKLIEAYKELTSH  71

Query  291  G-NFEVVFVSADEDEESFKEYFGKMPWTAVPFSDSVTRERLDALFTVRGIPHLVILD-ES  464
            G +FEV+FVS D+DEE+F  YF KMPW AVPFSDS  R+ LD  F V GIPHLV LD ++
Sbjct  72   GKSFEVIFVSGDQDEEAFNAYFAKMPWLAVPFSDSEGRKSLDERFEVNGIPHLVFLDAKT  131

Query  465  GKVTTEDGVDIVLEHGVEAYPF  530
            G+V T++GV+ V E+G+EAYPF
Sbjct  132  GEVLTDEGVEFVSEYGIEAYPF  153


 Score =   126 bits (317),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 61/144 (42%), Positives = 85/144 (59%), Gaps = 2/144 (1%)
 Frame = +3

Query  102  AHDLRSILCSSDRDFLIRNSGHQVKVDDLKGKKIGIYFSASWCGPCHRFTPNLATVYNEL  281
            +  L S+L + D DF+I   G +V V +L GK + +YFSA WCGPC  F P L  VYN++
Sbjct  334  SQTLESLLVTGDVDFVIGKDGAKVPVAELVGKTVLLYFSAKWCGPCRAFLPTLVDVYNKI  393

Query  282  LPK-GNFEVVFVSADEDEESFKEYFGKMPWTAVPFSDSVTRERLDALFTVRGIPHLVILD  458
              K  +FE+VF+S+D D+ SF ++F  MPW A+P  D   +  L   F +RGIP LV + 
Sbjct  394  KEKNSDFEIVFISSDRDQSSFDDFFSGMPWLAIPLEDE-RKAYLKKKFKIRGIPSLVAIG  452

Query  459  ESGKVTTEDGVDIVLEHGVEAYPF  530
              GK    D    +  HG +A+PF
Sbjct  453  PDGKTVNTDAKTSLAVHGADAFPF  476


 Score =   108 bits (269),  Expect = 5e-24, Method: Compositional matrix adjust.
 Identities = 60/164 (37%), Positives = 94/164 (57%), Gaps = 4/164 (2%)
 Frame = +3

Query  36   FQFSKRKGEERKASSMAEQNGDAHDLRSILCSSDRDFLIRNSGHQVKVDDLKGKKIGIYF  215
            + F+  +  E K    A +  D   + S+L + +R+++I N+G +V + DL+GK +GI F
Sbjct  151  YPFTTERINELKEQEKAAK--DNQTIHSVLATPNRNYVISNTGEKVPIVDLEGKYVGICF  208

Query  216  SASWCGPCHRFTPNLATVYNELLPKG-NFEVVFVSADEDEESFKEYFGKMPWTAVPFSDS  392
              +   P   FTP LA +Y +L   G  FEVV VS D DEESF   F  MPW A+P  D 
Sbjct  209  VVNGYPPVEEFTPVLAKIYAKLKEVGEKFEVVAVSLDSDEESFNNSFSSMPWLAIPQGDK  268

Query  393  VTRERLDALFTVRGIPHLVILDESGKVTTEDGVDIVLEHGVEAY  524
            +  ++L + F +  +P LV++   GK  + +  DI+ EHG++A+
Sbjct  269  MC-QKLVSYFELSDLPTLVLIGPDGKTLSSNIADIINEHGLDAW  311



>gb|KGN52628.1| hypothetical protein Csa_5G647500 [Cucumis sativus]
Length=342

 Score =   173 bits (439),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 79/144 (55%), Positives = 106/144 (74%), Gaps = 2/144 (1%)
 Frame = +3

Query  105  HDLRSILCSSDRDFLIRNSGHQVKVDDLKGKKIGIYFSASWCGPCHRFTPNLATVYNELL  284
            +DL S+L S  RDFLIRN+G QVK+  L GK +G+YFSA WC PC  FTP L   Y EL 
Sbjct  7    YDLNSLLSSEGRDFLIRNNGDQVKISSLSGKIVGLYFSAGWCPPCRFFTPKLLKTYKELA  66

Query  285  PKG--NFEVVFVSADEDEESFKEYFGKMPWTAVPFSDSVTRERLDALFTVRGIPHLVILD  458
             K   +FEVVF+S+D DE SF+ YF +MPW ++PF DS T+++L +LF + GIPHLV++D
Sbjct  67   SKNINDFEVVFISSDGDEYSFEAYFLRMPWLSIPFEDSETKQKLKSLFQLSGIPHLVVID  126

Query  459  ESGKVTTEDGVDIVLEHGVEAYPF  530
             +GKV+++DGV +V + G +AYPF
Sbjct  127  GNGKVSSDDGVGLVRDFGADAYPF  150


 Score =   119 bits (298),  Expect = 9e-29, Method: Compositional matrix adjust.
 Identities = 62/150 (41%), Positives = 90/150 (60%), Gaps = 3/150 (2%)
 Frame = +3

Query  87   EQNGDAHDLRSILCSSDRDFLIRNSGHQVKVDDLKGKKIGIYFSASWCGPCHRFTPNLAT  266
            E   +   + S+L S+ R +++ N G+Q+ + +L+GK IG+YFS      C  FTP L  
Sbjct  165  EARRNNQTIDSLLVSTSRTYVVSNDGNQIPISELEGKLIGLYFSKQGHEDCGNFTPKLIE  224

Query  267  VYNELLPK-GNFEVVFVSADEDEES-FKEYFGKMPWTAVPFSDSVTRERLDALFTVRGIP  440
             YN+L  K  NFE+VF+S DE+ E  FKE F  MPW A+PF D   +E L   F V  IP
Sbjct  225  AYNKLKKKEENFEIVFISLDEENEDLFKEAFKTMPWLALPFKDEKCQE-LKLYFEVTHIP  283

Query  441  HLVILDESGKVTTEDGVDIVLEHGVEAYPF  530
             LVI+ + GK +  + V+++   G++AYPF
Sbjct  284  ALVIIGQDGKTSNPNAVELIKGRGIDAYPF  313



>ref|XP_008459536.1| PREDICTED: probable nucleoredoxin 1 isoform X6 [Cucumis melo]
Length=371

 Score =   174 bits (441),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 78/146 (53%), Positives = 107/146 (73%), Gaps = 4/146 (3%)
 Frame = +3

Query  105  HDLRSILCSSDRDFLIRNSGHQVKVDDLKGKKIGIYFSASWCGPCHRFTPNLATVYNELL  284
            HD+ S+L S  RDFLIRN+G QVK+  L GK++G+YFSA WC PC  FTP L+  Y ELL
Sbjct  7    HDISSLLSSERRDFLIRNNGDQVKISSLIGKRVGLYFSAGWCPPCRLFTPKLSEFYKELL  66

Query  285  PKG----NFEVVFVSADEDEESFKEYFGKMPWTAVPFSDSVTRERLDALFTVRGIPHLVI  452
                   +FE++F+S+D D  SFK YF KMPW ++PF D  T+++L  LF +R IP+LV+
Sbjct  67   ANNSKNNDFEIIFISSDRDALSFKAYFSKMPWLSIPFDDLETQKKLKILFQLRSIPYLVV  126

Query  453  LDESGKVTTEDGVDIVLEHGVEAYPF  530
            +D +GKV+++DGV++V E GV+AYPF
Sbjct  127  IDGNGKVSSDDGVNLVKEFGVDAYPF  152


 Score =   111 bits (278),  Expect = 7e-26, Method: Compositional matrix adjust.
 Identities = 65/161 (40%), Positives = 95/161 (59%), Gaps = 6/161 (4%)
 Frame = +3

Query  63   ERKASSMA---EQNGDAHDLRSILCSSDRDFLIRNSGHQVKVDDLKGKKIGIYFSASWCG  233
            +RK   +A   E   +   + S+L S+ R++L+ N G Q+ V  L+GK IG+YFS     
Sbjct  155  DRKKQLLAQKEEAKKNTQTITSVLASASRNYLVSNDGKQIPVSKLEGKLIGLYFSLPGHE  214

Query  234  PCHRFTPNLATVYNELLPKG-NFEVVFVSADEDEESFKEY-FGKMPWTAVPFSDSVTRER  407
             C  FTP L+ VYN+L  K  NFE+VFVS +E++E   +  F  MPW A+PF D    ++
Sbjct  215  HCEDFTPKLSEVYNKLKKKDENFEIVFVSLEEEDEDLFDEAFESMPWLALPFKDEKC-QK  273

Query  408  LDALFTVRGIPHLVILDESGKVTTEDGVDIVLEHGVEAYPF  530
            L   F V  IP LVI  + G+    + VD++ +HG++AYPF
Sbjct  274  LKLYFDVGEIPALVITGQDGRTLNPNAVDLIKQHGIDAYPF  314



>ref|XP_010937371.1| PREDICTED: probable nucleoredoxin 1-1 [Elaeis guineensis]
Length=564

 Score =   177 bits (450),  Expect = 4e-49, Method: Compositional matrix adjust.
 Identities = 85/146 (58%), Positives = 104/146 (71%), Gaps = 1/146 (1%)
 Frame = +3

Query  96   GDAHDLRSILCSSDRDFLIRNSGHQVKVDDLKGKKIGIYFSASWCGPCHRFTPNLATVYN  275
            G  HDL+ +L + +RDFL+ N+G QVK+ +L+GK IG+YFSASWC  C RFTP L   Y 
Sbjct  15   GKGHDLKLLLATDERDFLVCNNGDQVKIANLEGKTIGLYFSASWCRRCGRFTPKLVETYG  74

Query  276  ELLPKGN-FEVVFVSADEDEESFKEYFGKMPWTAVPFSDSVTRERLDALFTVRGIPHLVI  452
            EL  +G  FEVV VS D DE+SF   F KMPW A+PFSDS  R+RLD LF VRGIPHLVI
Sbjct  75   ELSSEGKEFEVVLVSGDRDEDSFNGSFSKMPWLAIPFSDSKARDRLDELFKVRGIPHLVI  134

Query  453  LDESGKVTTEDGVDIVLEHGVEAYPF  530
            LD +G+V  + GV  V ++G E YPF
Sbjct  135  LDANGEVLNKKGVQAVGDYGSEGYPF  160


 Score =   136 bits (342),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 68/166 (41%), Positives = 103/166 (62%), Gaps = 4/166 (2%)
 Frame = +3

Query  36   FQFSKRKGEERKASSMAEQNGDAHDLRSILCSSDRDFLIRNSGHQVKVDDLKGKKIGIYF  215
            F FS+ K +     + A+  G  H L S+L S + D++I   G +V V +L GK I +YF
Sbjct  322  FPFSQDKVDMLAEKAKAKLEG--HTLESLLVSGELDYVIGKDGVKVPVSELNGKNILLYF  379

Query  216  SASWCGPCHRFTPNLATVYNELLPKGN-FEVVFVSADEDEESFKEYFGKMPWTAVPFSDS  392
            SA WCGPC  F P L   YN +  K + FE+VF+S+D D+ SF+++F  MPW A+P+ D 
Sbjct  380  SAQWCGPCRAFLPKLVEEYNNIKDKDSAFEMVFISSDRDQNSFEDFFSGMPWLALPYGDE  439

Query  393  VTRERLDALFTVRGIPHLVILDESGKVTTEDGVDIVLEHGVEAYPF  530
              ++ L ++F +RGIP LV +  +G+  T+D   +++ HG +AYPF
Sbjct  440  -RKKSLSSVFKIRGIPSLVAIGPTGRTITKDAKLLMMVHGADAYPF  484


 Score =   124 bits (310),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 67/158 (42%), Positives = 94/158 (59%), Gaps = 4/158 (3%)
 Frame = +3

Query  69   KASSMAEQNGDAHDLRSILCSSDRDFLIRNSGHQVKVDDLKGKKIGIYFSASWCGPCHRF  248
            K     E       L+++L S  RD+LI N+G++V + +L+GK + +YFS +    C  F
Sbjct  167  KLKEEEEATKREQTLQTVLVSPSRDYLILNNGNKVSISELEGKMVCLYFSINGSKTCDEF  226

Query  249  TPNLATVYNELLPKG-NFEVVFVSADEDEESFKEYFGKMPWTAVPFSDSVTRERLDALFT  425
            T  LA +Y  L  +G +FEVV VS D++E SFKE F  MPW A+PF+D  + +RL   F 
Sbjct  227  TLVLAKIYRNLKERGESFEVVMVSLDDEESSFKEGFATMPWLAIPFNDKKSCKRLARYFE  286

Query  426  VRGIPHLVILDESGKVTTEDGVDIVLEHGVEA---YPF  530
            +RGIP LV+L   GK    +  +IV EHG EA   +PF
Sbjct  287  LRGIPTLVVLGTDGKTLHNNIAEIVEEHGEEAWEGFPF  324



>ref|XP_006378291.1| hypothetical protein POPTR_0010s06930g [Populus trichocarpa]
 gb|ERP56088.1| hypothetical protein POPTR_0010s06930g [Populus trichocarpa]
Length=564

 Score =   177 bits (450),  Expect = 4e-49, Method: Compositional matrix adjust.
 Identities = 81/132 (61%), Positives = 101/132 (77%), Gaps = 0/132 (0%)
 Frame = +3

Query  135  DRDFLIRNSGHQVKVDDLKGKKIGIYFSASWCGPCHRFTPNLATVYNELLPKGNFEVVFV  314
            +RDFLIRN+G QVKV +L GK +G YFS SWCGPC  FTP L  VY +L  KG+FEVVF+
Sbjct  18   ERDFLIRNNGDQVKVSNLVGKIVGFYFSGSWCGPCRNFTPLLVEVYEQLSSKGDFEVVFI  77

Query  315  SADEDEESFKEYFGKMPWTAVPFSDSVTRERLDALFTVRGIPHLVILDESGKVTTEDGVD  494
            S+D D+ESF  YF +MPW A+PFSD+ TR+RL  +F VRGIP+LVI   +GKV+ ++GV 
Sbjct  78   SSDRDDESFNTYFSEMPWLAIPFSDTETRKRLKEVFKVRGIPNLVIFYTNGKVSCDNGVS  137

Query  495  IVLEHGVEAYPF  530
             V EHGV+ YPF
Sbjct  138  TVKEHGVDGYPF  149


 Score =   126 bits (317),  Expect = 9e-31, Method: Compositional matrix adjust.
 Identities = 67/154 (44%), Positives = 95/154 (62%), Gaps = 5/154 (3%)
 Frame = +3

Query  81   MAEQNGDA---HDLRSILCSSDRDFLIRNSGHQVKVDDLKGKKIGIYFSASWCGPCHRFT  251
            + EQ  +A     + SIL SS RD++I N G ++ V DL+GK +G+YFS      C  FT
Sbjct  157  LKEQEENAKKNQTISSILVSSSRDYVISNDGKKIPVLDLEGKLVGLYFSIHAHRMCREFT  216

Query  252  PNLATVYNELLPKG-NFEVVFVSADEDEESFKEYFGKMPWTAVPFSDSVTRERLDALFTV  428
            P L  +Y  L  KG NFEVV +S + +E+ FKE F  MPW A+PF D  + E+L   F +
Sbjct  217  PKLVELYKRLKEKGENFEVVLISLNSEEKHFKESFETMPWFALPFKDK-SCEKLARYFEL  275

Query  429  RGIPHLVILDESGKVTTEDGVDIVLEHGVEAYPF  530
            R IP+LVI+ + GK    +  +++ +HG+EAYPF
Sbjct  276  RTIPNLVIIGQDGKTLNPNVAELIEDHGIEAYPF  309


 Score =   124 bits (312),  Expect = 5e-30, Method: Compositional matrix adjust.
 Identities = 62/166 (37%), Positives = 99/166 (60%), Gaps = 4/166 (2%)
 Frame = +3

Query  36   FQFSKRKGEERKASSMAEQNGDAHDLRSILCSSDRDFLIRNSGHQVKVDDLKGKKIGIYF  215
            + F+  K EE   + + +   ++  L S+L + + DF+I  SG +V+V DL GK I +YF
Sbjct  307  YPFTPEKLEE--LAEIEKAKLESQTLESVLVNGENDFVIDKSGSKVRVSDLVGKNILLYF  364

Query  216  SASWCGPCHRFTPNLATVYNELLPKGN-FEVVFVSADEDEESFKEYFGKMPWTAVPFSDS  392
            SA WC PC  F P L   Y+ +  K N FEV+F+S+D D+ +F E++ +MPW A+PF D 
Sbjct  365  SAQWCPPCRAFLPKLIEAYHTIKAKDNAFEVIFISSDSDQSTFDEFYSEMPWLALPFGDE  424

Query  393  VTRERLDALFTVRGIPHLVILDESGKVTTEDGVDIVLEHGVEAYPF  530
              ++ L   F ++GIP  V +  SG+  T++    +  +G +A+PF
Sbjct  425  -RKQILSRKFKIQGIPAAVAIGPSGRTITKEARMHLTSYGADAFPF  469



>ref|XP_002314535.2| hypothetical protein POPTR_0010s06980g [Populus trichocarpa]
 gb|EEF00706.2| hypothetical protein POPTR_0010s06980g [Populus trichocarpa]
Length=564

 Score =   177 bits (449),  Expect = 5e-49, Method: Compositional matrix adjust.
 Identities = 87/143 (61%), Positives = 107/143 (75%), Gaps = 0/143 (0%)
 Frame = +3

Query  102  AHDLRSILCSSDRDFLIRNSGHQVKVDDLKGKKIGIYFSASWCGPCHRFTPNLATVYNEL  281
            +HDL S+L S +RDFLIRN+G QVK  +L GK +G YFS SWCGPC  FTP L  VY +L
Sbjct  7    SHDLSSLLSSEERDFLIRNNGDQVKFSNLVGKIVGFYFSGSWCGPCRNFTPLLVEVYEQL  66

Query  282  LPKGNFEVVFVSADEDEESFKEYFGKMPWTAVPFSDSVTRERLDALFTVRGIPHLVILDE  461
              KG+FEVVFVS+D D+ESF  YF +MPW A+PF D+ TR+RL  +F VRGIP LVI D 
Sbjct  67   SSKGDFEVVFVSSDGDDESFNTYFSEMPWLAIPFPDTETRQRLKEVFKVRGIPKLVIFDT  126

Query  462  SGKVTTEDGVDIVLEHGVEAYPF  530
            +GKV+ ++GV  V EHGV+ YPF
Sbjct  127  NGKVSCDNGVRHVKEHGVDGYPF  149


 Score =   130 bits (327),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 70/154 (45%), Positives = 96/154 (62%), Gaps = 5/154 (3%)
 Frame = +3

Query  81   MAEQNGDA---HDLRSILCSSDRDFLIRNSGHQVKVDDLKGKKIGIYFSASWCGPCHRFT  251
            + EQ  +A     + SIL SS RD++I N G ++ V DL+GK +G+YFSA     C  FT
Sbjct  157  LKEQEENAKKNQTISSILVSSSRDYVISNDGKKIPVSDLEGKLVGLYFSAHAHRMCREFT  216

Query  252  PNLATVYNELLPKG-NFEVVFVSADEDEESFKEYFGKMPWTAVPFSDSVTRERLDALFTV  428
            P L  +Y  L  K  NFEVV +S D++EE FKE F  MPW A+PF D  + E+L   F +
Sbjct  217  PKLVELYKTLKEKRENFEVVLLSLDDEEEDFKESFETMPWLALPFKDK-SCEKLVRYFEL  275

Query  429  RGIPHLVILDESGKVTTEDGVDIVLEHGVEAYPF  530
            R IP+LVI+ + GK    +  +++ EHG+EAYPF
Sbjct  276  RTIPNLVIIGQDGKTLNPNVAELIEEHGIEAYPF  309


 Score =   120 bits (301),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 62/166 (37%), Positives = 97/166 (58%), Gaps = 4/166 (2%)
 Frame = +3

Query  36   FQFSKRKGEERKASSMAEQNGDAHDLRSILCSSDRDFLIRNSGHQVKVDDLKGKKIGIYF  215
            + F+  K +E  A   A+   ++  L S+L + + DFLI  SG +V V DL GK I +YF
Sbjct  307  YPFTPEKLDELAAIEKAKL--ESQTLESVLVNGENDFLIDKSGSKVPVSDLVGKNILLYF  364

Query  216  SASWCGPCHRFTPNLATVYNELLPKGN-FEVVFVSADEDEESFKEYFGKMPWTAVPFSDS  392
            SA WC PC  F P L   Y+ +  K   FEV+F+S+D D+ +F E++ +MPW A+PF D 
Sbjct  365  SAQWCPPCRAFLPKLIEAYHTIKRKDKAFEVIFISSDRDQSTFDEFYSEMPWLALPFGDG  424

Query  393  VTRERLDALFTVRGIPHLVILDESGKVTTEDGVDIVLEHGVEAYPF  530
              ++ L   F ++GIP  + +  SG+  T++    +  +G +A+PF
Sbjct  425  -RKQILSRKFKIQGIPAALAIGPSGRTVTKEARMHLTAYGADAFPF  469



>emb|CCP27784.1| unnamed protein product [Arabidopsis halleri subsp. halleri]
Length=662

 Score =   178 bits (451),  Expect = 6e-49, Method: Compositional matrix adjust.
 Identities = 80/121 (66%), Positives = 97/121 (80%), Gaps = 0/121 (0%)
 Frame = +3

Query  168  QVKVDDLKGKKIGIYFSASWCGPCHRFTPNLATVYNELLPKGNFEVVFVSADEDEESFKE  347
            QVK+D L GKKIG+YFSA+WCGPC RFTP L  VYNEL  K  FE+VFVS DEDEESF +
Sbjct  307  QVKIDSLIGKKIGLYFSAAWCGPCQRFTPQLVEVYNELSSKVGFEIVFVSGDEDEESFGD  366

Query  348  YFGKMPWTAVPFSDSVTRERLDALFTVRGIPHLVILDESGKVTTEDGVDIVLEHGVEAYP  527
            YF KMPW AVPF+DS TR+RLD LF VRGIP+LV++D+ GK+  E+GV ++  +G +AYP
Sbjct  367  YFSKMPWLAVPFTDSETRDRLDELFKVRGIPNLVMVDDHGKLVNENGVGVIRSYGADAYP  426

Query  528  F  530
            F
Sbjct  427  F  427



>ref|XP_011014068.1| PREDICTED: probable nucleoredoxin 1 isoform X3 [Populus euphratica]
Length=563

 Score =   177 bits (449),  Expect = 6e-49, Method: Compositional matrix adjust.
 Identities = 80/131 (61%), Positives = 100/131 (76%), Gaps = 0/131 (0%)
 Frame = +3

Query  138  RDFLIRNSGHQVKVDDLKGKKIGIYFSASWCGPCHRFTPNLATVYNELLPKGNFEVVFVS  317
            RD+LIRN+G QV V +L GK +G+YFS SWCGPC  FTP L  VY +L  KG+FEVVF+S
Sbjct  19   RDYLIRNNGDQVPVSNLVGKIVGVYFSGSWCGPCRNFTPLLVEVYEQLSSKGDFEVVFIS  78

Query  318  ADEDEESFKEYFGKMPWTAVPFSDSVTRERLDALFTVRGIPHLVILDESGKVTTEDGVDI  497
            +D D+ESF  YF +MPW A+PFSD+ TR+RL  +F VRGIP+LVI D +GKV+ + GV  
Sbjct  79   SDRDDESFNTYFSEMPWLAIPFSDTETRKRLKEVFKVRGIPNLVIFDTNGKVSCDSGVST  138

Query  498  VLEHGVEAYPF  530
            V EHGV+ YPF
Sbjct  139  VKEHGVDGYPF  149


 Score =   125 bits (315),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 69/154 (45%), Positives = 95/154 (62%), Gaps = 5/154 (3%)
 Frame = +3

Query  81   MAEQNGDA---HDLRSILCSSDRDFLIRNSGHQVKVDDLKGKKIGIYFSASWCGPCHRFT  251
            + EQ  +A     + SIL SS RD++I N G +  V DL+GK +G+YFSA     C  FT
Sbjct  157  LKEQEENAKKNQTISSILVSSSRDYVISNDGKKNPVLDLEGKLVGLYFSAHAHRMCCEFT  216

Query  252  PNLATVYNELLPKG-NFEVVFVSADEDEESFKEYFGKMPWTAVPFSDSVTRERLDALFTV  428
            P L  +Y  L  KG NFEVV +S D +E+ FKE F  MPW A+PF D  + E+L   F +
Sbjct  217  PKLMELYKRLREKGENFEVVLISLDFEEKHFKESFETMPWLALPFEDR-SCEKLARYFEL  275

Query  429  RGIPHLVILDESGKVTTEDGVDIVLEHGVEAYPF  530
            R IP+LVI+ + GK    +  +++ +HG+EAYPF
Sbjct  276  RTIPNLVIIGQDGKTLNPNVAELIEDHGIEAYPF  309


 Score =   123 bits (309),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 65/166 (39%), Positives = 96/166 (58%), Gaps = 4/166 (2%)
 Frame = +3

Query  36   FQFSKRKGEERKASSMAEQNGDAHDLRSILCSSDRDFLIRNSGHQVKVDDLKGKKIGIYF  215
            + F+  K EE  A   A+   ++  L S+L     DFLI  SG +V+V DL GK I +YF
Sbjct  307  YPFTPEKLEELAAIEKAKL--ESQTLESVLGYGGNDFLIDKSGSKVRVSDLGGKNILLYF  364

Query  216  SASWCGPCHRFTPNLATVYNELLPKGN-FEVVFVSADEDEESFKEYFGKMPWTAVPFSDS  392
            SA WC PC  F P L   Y+ +  K N FEV+F+S+D D+ +F E++ +MPW A+PF D 
Sbjct  365  SAQWCPPCRAFLPKLIEAYHTIKAKDNAFEVIFISSDSDQSTFDEFYSEMPWLALPFGDE  424

Query  393  VTRERLDALFTVRGIPHLVILDESGKVTTEDGVDIVLEHGVEAYPF  530
              ++ L   F + GIP  V +  SG+  T++    +  +G +A+PF
Sbjct  425  -RKQILGRKFKIEGIPAAVAIGPSGRTITKEARMHLTAYGADAFPF  469



>ref|XP_011014069.1| PREDICTED: probable nucleoredoxin 1 isoform X4 [Populus euphratica]
Length=563

 Score =   177 bits (449),  Expect = 6e-49, Method: Compositional matrix adjust.
 Identities = 80/131 (61%), Positives = 100/131 (76%), Gaps = 0/131 (0%)
 Frame = +3

Query  138  RDFLIRNSGHQVKVDDLKGKKIGIYFSASWCGPCHRFTPNLATVYNELLPKGNFEVVFVS  317
            RD+LIRN+G QV V +L GK +G+YFS SWCGPC  FTP L  VY +L  KG+FEVVF+S
Sbjct  19   RDYLIRNNGDQVPVSNLVGKIVGVYFSGSWCGPCRNFTPLLVEVYEQLSSKGDFEVVFIS  78

Query  318  ADEDEESFKEYFGKMPWTAVPFSDSVTRERLDALFTVRGIPHLVILDESGKVTTEDGVDI  497
            +D D+ESF  YF +MPW A+PFSD+ TR+RL  +F VRGIP+LVI D +GKV+ + GV  
Sbjct  79   SDRDDESFNTYFSEMPWLAIPFSDTETRKRLKEVFKVRGIPNLVIFDTNGKVSCDSGVST  138

Query  498  VLEHGVEAYPF  530
            V EHGV+ YPF
Sbjct  139  VKEHGVDGYPF  149


 Score =   125 bits (315),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 69/154 (45%), Positives = 95/154 (62%), Gaps = 5/154 (3%)
 Frame = +3

Query  81   MAEQNGDA---HDLRSILCSSDRDFLIRNSGHQVKVDDLKGKKIGIYFSASWCGPCHRFT  251
            + EQ  +A     + SIL SS RD++I N G +  V DL+GK +G+YFSA     C  FT
Sbjct  157  LKEQEENAKKNQTISSILVSSSRDYVISNDGKKNPVLDLEGKLVGLYFSAHAHRMCCEFT  216

Query  252  PNLATVYNELLPKG-NFEVVFVSADEDEESFKEYFGKMPWTAVPFSDSVTRERLDALFTV  428
            P L  +Y  L  KG NFEVV +S D +E+ FKE F  MPW A+PF D  + E+L   F +
Sbjct  217  PKLMELYKRLREKGENFEVVLISLDFEEKHFKESFETMPWLALPFEDR-SCEKLARYFEL  275

Query  429  RGIPHLVILDESGKVTTEDGVDIVLEHGVEAYPF  530
            R IP+LVI+ + GK    +  +++ +HG+EAYPF
Sbjct  276  RTIPNLVIIGQDGKTLNPNVAELIEDHGIEAYPF  309


 Score =   123 bits (309),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 65/166 (39%), Positives = 96/166 (58%), Gaps = 4/166 (2%)
 Frame = +3

Query  36   FQFSKRKGEERKASSMAEQNGDAHDLRSILCSSDRDFLIRNSGHQVKVDDLKGKKIGIYF  215
            + F+  K EE  A   A+   ++  L S+L     DFLI  SG +V+V DL GK I +YF
Sbjct  307  YPFTPEKLEELAAIEKAKL--ESQTLESVLGYGGNDFLIDKSGSKVRVSDLGGKNILLYF  364

Query  216  SASWCGPCHRFTPNLATVYNELLPKGN-FEVVFVSADEDEESFKEYFGKMPWTAVPFSDS  392
            SA WC PC  F P L   Y+ +  K N FEV+F+S+D D+ +F E++ +MPW A+PF D 
Sbjct  365  SAQWCPPCRAFLPKLIEAYHTIKAKDNAFEVIFISSDSDQSTFDEFYSEMPWLALPFGDE  424

Query  393  VTRERLDALFTVRGIPHLVILDESGKVTTEDGVDIVLEHGVEAYPF  530
              ++ L   F + GIP  V +  SG+  T++    +  +G +A+PF
Sbjct  425  -RKQILGRKFKIEGIPAAVAIGPSGRTITKEARMHLTAYGADAFPF  469



>ref|XP_011014066.1| PREDICTED: probable nucleoredoxin 1 isoform X1 [Populus euphratica]
Length=563

 Score =   177 bits (448),  Expect = 7e-49, Method: Compositional matrix adjust.
 Identities = 80/131 (61%), Positives = 100/131 (76%), Gaps = 0/131 (0%)
 Frame = +3

Query  138  RDFLIRNSGHQVKVDDLKGKKIGIYFSASWCGPCHRFTPNLATVYNELLPKGNFEVVFVS  317
            RD+LIRN+G QV V +L GK +G+YFS SWCGPC  FTP L  VY +L  KG+FEVVF+S
Sbjct  19   RDYLIRNNGDQVPVSNLVGKIVGVYFSGSWCGPCRNFTPLLVEVYEQLSSKGDFEVVFIS  78

Query  318  ADEDEESFKEYFGKMPWTAVPFSDSVTRERLDALFTVRGIPHLVILDESGKVTTEDGVDI  497
            +D D+ESF  YF +MPW A+PFSD+ TR+RL  +F VRGIP+LVI D +GKV+ + GV  
Sbjct  79   SDRDDESFNTYFSEMPWLAIPFSDTETRKRLKEVFKVRGIPNLVIFDTNGKVSCDSGVST  138

Query  498  VLEHGVEAYPF  530
            V EHGV+ YPF
Sbjct  139  VKEHGVDGYPF  149


 Score =   125 bits (315),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 69/154 (45%), Positives = 95/154 (62%), Gaps = 5/154 (3%)
 Frame = +3

Query  81   MAEQNGDA---HDLRSILCSSDRDFLIRNSGHQVKVDDLKGKKIGIYFSASWCGPCHRFT  251
            + EQ  +A     + SIL SS RD++I N G +  V DL+GK +G+YFSA     C  FT
Sbjct  157  LKEQEENAKKNQTISSILVSSSRDYVISNDGKKNPVLDLEGKLVGLYFSAHAHRMCCEFT  216

Query  252  PNLATVYNELLPKG-NFEVVFVSADEDEESFKEYFGKMPWTAVPFSDSVTRERLDALFTV  428
            P L  +Y  L  KG NFEVV +S D +E+ FKE F  MPW A+PF D  + E+L   F +
Sbjct  217  PKLMELYKRLREKGENFEVVLISLDFEEKHFKESFETMPWLALPFEDR-SCEKLARYFEL  275

Query  429  RGIPHLVILDESGKVTTEDGVDIVLEHGVEAYPF  530
            R IP+LVI+ + GK    +  +++ +HG+EAYPF
Sbjct  276  RTIPNLVIIGQDGKTLNPNVAELIEDHGIEAYPF  309


 Score =   123 bits (309),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 65/166 (39%), Positives = 96/166 (58%), Gaps = 4/166 (2%)
 Frame = +3

Query  36   FQFSKRKGEERKASSMAEQNGDAHDLRSILCSSDRDFLIRNSGHQVKVDDLKGKKIGIYF  215
            + F+  K EE  A   A+   ++  L S+L     DFLI  SG +V+V DL GK I +YF
Sbjct  307  YPFTPEKLEELAAIEKAKL--ESQTLESVLGYGGNDFLIDKSGSKVRVSDLGGKNILLYF  364

Query  216  SASWCGPCHRFTPNLATVYNELLPKGN-FEVVFVSADEDEESFKEYFGKMPWTAVPFSDS  392
            SA WC PC  F P L   Y+ +  K N FEV+F+S+D D+ +F E++ +MPW A+PF D 
Sbjct  365  SAQWCPPCRAFLPKLIEAYHTIKAKDNAFEVIFISSDSDQSTFDEFYSEMPWLALPFGDE  424

Query  393  VTRERLDALFTVRGIPHLVILDESGKVTTEDGVDIVLEHGVEAYPF  530
              ++ L   F + GIP  V +  SG+  T++    +  +G +A+PF
Sbjct  425  -RKQILGRKFKIEGIPAAVAIGPSGRTITKEARMHLTAYGADAFPF  469



>ref|XP_011014067.1| PREDICTED: probable nucleoredoxin 1 isoform X2 [Populus euphratica]
Length=563

 Score =   177 bits (448),  Expect = 8e-49, Method: Compositional matrix adjust.
 Identities = 80/131 (61%), Positives = 100/131 (76%), Gaps = 0/131 (0%)
 Frame = +3

Query  138  RDFLIRNSGHQVKVDDLKGKKIGIYFSASWCGPCHRFTPNLATVYNELLPKGNFEVVFVS  317
            RD+LIRN+G QV V +L GK +G+YFS SWCGPC  FTP L  VY +L  KG+FEVVF+S
Sbjct  19   RDYLIRNNGDQVPVSNLVGKIVGVYFSGSWCGPCRNFTPLLVEVYEQLSSKGDFEVVFIS  78

Query  318  ADEDEESFKEYFGKMPWTAVPFSDSVTRERLDALFTVRGIPHLVILDESGKVTTEDGVDI  497
            +D D+ESF  YF +MPW A+PFSD+ TR+RL  +F VRGIP+LVI D +GKV+ + GV  
Sbjct  79   SDRDDESFNTYFSEMPWLAIPFSDTETRKRLKEVFKVRGIPNLVIFDTNGKVSCDSGVST  138

Query  498  VLEHGVEAYPF  530
            V EHGV+ YPF
Sbjct  139  VKEHGVDGYPF  149


 Score =   125 bits (314),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 69/154 (45%), Positives = 95/154 (62%), Gaps = 5/154 (3%)
 Frame = +3

Query  81   MAEQNGDA---HDLRSILCSSDRDFLIRNSGHQVKVDDLKGKKIGIYFSASWCGPCHRFT  251
            + EQ  +A     + SIL SS RD++I N G +  V DL+GK +G+YFSA     C  FT
Sbjct  157  LKEQEENAKKNQTISSILVSSSRDYVISNDGKKNPVLDLEGKLVGLYFSAHAHRMCCEFT  216

Query  252  PNLATVYNELLPKG-NFEVVFVSADEDEESFKEYFGKMPWTAVPFSDSVTRERLDALFTV  428
            P L  +Y  L  KG NFEVV +S D +E+ FKE F  MPW A+PF D  + E+L   F +
Sbjct  217  PKLMELYKRLREKGENFEVVLISLDFEEKHFKESFETMPWLALPFEDR-SCEKLARYFEL  275

Query  429  RGIPHLVILDESGKVTTEDGVDIVLEHGVEAYPF  530
            R IP+LVI+ + GK    +  +++ +HG+EAYPF
Sbjct  276  RTIPNLVIIGQDGKTLNPNVAELIEDHGIEAYPF  309


 Score =   123 bits (308),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 65/166 (39%), Positives = 96/166 (58%), Gaps = 4/166 (2%)
 Frame = +3

Query  36   FQFSKRKGEERKASSMAEQNGDAHDLRSILCSSDRDFLIRNSGHQVKVDDLKGKKIGIYF  215
            + F+  K EE  A   A+   ++  L S+L     DFLI  SG +V+V DL GK I +YF
Sbjct  307  YPFTPEKLEELAAIEKAKL--ESQTLESVLGYGGNDFLIDKSGSKVRVSDLGGKNILLYF  364

Query  216  SASWCGPCHRFTPNLATVYNELLPKGN-FEVVFVSADEDEESFKEYFGKMPWTAVPFSDS  392
            SA WC PC  F P L   Y+ +  K N FEV+F+S+D D+ +F E++ +MPW A+PF D 
Sbjct  365  SAQWCPPCRAFLPKLIEAYHTIKAKDNAFEVIFISSDSDQSTFDEFYSEMPWLALPFGDE  424

Query  393  VTRERLDALFTVRGIPHLVILDESGKVTTEDGVDIVLEHGVEAYPF  530
              ++ L   F + GIP  V +  SG+  T++    +  +G +A+PF
Sbjct  425  -RKQILGRKFKIEGIPAAVAIGPSGRTITKEARMHLTAYGADAFPF  469



>ref|XP_008459535.1| PREDICTED: probable nucleoredoxin 1-1 isoform X5 [Cucumis melo]
Length=403

 Score =   174 bits (440),  Expect = 9e-49, Method: Compositional matrix adjust.
 Identities = 78/146 (53%), Positives = 107/146 (73%), Gaps = 4/146 (3%)
 Frame = +3

Query  105  HDLRSILCSSDRDFLIRNSGHQVKVDDLKGKKIGIYFSASWCGPCHRFTPNLATVYNELL  284
            HD+ S+L S  RDFLIRN+G QVK+  L GK++G+YFSA WC PC  FTP L+  Y ELL
Sbjct  7    HDISSLLSSERRDFLIRNNGDQVKISSLIGKRVGLYFSAGWCPPCRLFTPKLSEFYKELL  66

Query  285  PKG----NFEVVFVSADEDEESFKEYFGKMPWTAVPFSDSVTRERLDALFTVRGIPHLVI  452
                   +FE++F+S+D D  SFK YF KMPW ++PF D  T+++L  LF +R IP+LV+
Sbjct  67   ANNSKNNDFEIIFISSDRDALSFKAYFSKMPWLSIPFDDLETQKKLKILFQLRSIPYLVV  126

Query  453  LDESGKVTTEDGVDIVLEHGVEAYPF  530
            +D +GKV+++DGV++V E GV+AYPF
Sbjct  127  IDGNGKVSSDDGVNLVKEFGVDAYPF  152


 Score =   111 bits (278),  Expect = 9e-26, Method: Compositional matrix adjust.
 Identities = 65/161 (40%), Positives = 95/161 (59%), Gaps = 6/161 (4%)
 Frame = +3

Query  63   ERKASSMA---EQNGDAHDLRSILCSSDRDFLIRNSGHQVKVDDLKGKKIGIYFSASWCG  233
            +RK   +A   E   +   + S+L S+ R++L+ N G Q+ V  L+GK IG+YFS     
Sbjct  155  DRKKQLLAQKEEAKKNTQTITSVLASASRNYLVSNDGKQIPVSKLEGKLIGLYFSLPGHE  214

Query  234  PCHRFTPNLATVYNELLPKG-NFEVVFVSADEDEESFKEY-FGKMPWTAVPFSDSVTRER  407
             C  FTP L+ VYN+L  K  NFE+VFVS +E++E   +  F  MPW A+PF D    ++
Sbjct  215  HCEDFTPKLSEVYNKLKKKDENFEIVFVSLEEEDEDLFDEAFESMPWLALPFKDEKC-QK  273

Query  408  LDALFTVRGIPHLVILDESGKVTTEDGVDIVLEHGVEAYPF  530
            L   F V  IP LVI  + G+    + VD++ +HG++AYPF
Sbjct  274  LKLYFDVGEIPALVITGQDGRTLNPNAVDLIKQHGIDAYPF  314



>ref|XP_004239348.2| PREDICTED: probable nucleoredoxin 1 [Solanum lycopersicum]
Length=540

 Score =   176 bits (446),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 81/143 (57%), Positives = 100/143 (70%), Gaps = 0/143 (0%)
 Frame = +3

Query  102  AHDLRSILCSSDRDFLIRNSGHQVKVDDLKGKKIGIYFSASWCGPCHRFTPNLATVYNEL  281
            A+DL  +L S +RDFLI  +G QV +  + GK +G+YFS  WCGPC +FTP L   Y  L
Sbjct  4    ANDLTVVLSSKERDFLISTNGEQVTLSSITGKIVGLYFSGLWCGPCRQFTPKLVEAYESL  63

Query  282  LPKGNFEVVFVSADEDEESFKEYFGKMPWTAVPFSDSVTRERLDALFTVRGIPHLVILDE  461
             PKG+FE+VF+S+D+D+ESF EYF KM W AVPFSD   R+ L  LF VR IPHLVILD 
Sbjct  64   YPKGDFEIVFISSDKDDESFNEYFEKMLWLAVPFSDVEARKNLKQLFKVRTIPHLVILDG  123

Query  462  SGKVTTEDGVDIVLEHGVEAYPF  530
            +GKV + DGV  +   G EAYPF
Sbjct  124  TGKVLSSDGVKYIKHFGPEAYPF  146


 Score =   122 bits (307),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 63/153 (41%), Positives = 87/153 (57%), Gaps = 2/153 (1%)
 Frame = +3

Query  75   SSMAEQNGDAHDLRSILCSSDRDFLIRNSGHQVKVDDLKGKKIGIYFSASWCGPCHRFTP  254
            +++ ++  +A  L SIL ++DRDF+I N G +V V  L G  I +YF+ASW  P   F P
Sbjct  313  ANLKKKKLEAQTLESILVTADRDFVISNGGLKVPVHKLVGNNIVLYFAASWSLPSREFQP  372

Query  255  NLATVYNELLPKG-NFEVVFVSADEDEESFKEYFGKMPWTAVPFSDSVTRERLDALFTVR  431
             L T Y E+  K  NFEV+F+S+D+DE SF  +F  MPW A+PF D   R  L   F + 
Sbjct  373  KLETAYQEIKKKDENFEVIFISSDQDESSFTNFFSSMPWLALPFDDE-RRSFLSRRFNIV  431

Query  432  GIPHLVILDESGKVTTEDGVDIVLEHGVEAYPF  530
            GIP  + +  SG         ++  HG  AYPF
Sbjct  432  GIPVAIAISPSGFTVNTQVRQLLETHGSGAYPF  464


 Score =   109 bits (272),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 62/148 (42%), Positives = 82/148 (55%), Gaps = 2/148 (1%)
 Frame = +3

Query  87   EQNGDAHDLRSILCSSDRDFLIRNSGHQVKVDDLKGKKIGIYFSASWCGPCHRFTPNLAT  266
            E+  +   LRS+L    RDFLI N  +++ V +L+GK + +YF  S       FT  LA 
Sbjct  159  EKAKENQSLRSLLVYGSRDFLISNEENKISVSELEGKTVCLYFGTSTHRGGKNFTLKLAE  218

Query  267  VYNELLPKGNFEVVFVSADEDEESFKEYFGKMPWTAVPFSDSVTRERLDALFTVRGIPHL  446
            VY E     NFE+V +S DE  E FKE F  MPW A+PF D    ERL   F  + +P L
Sbjct  219  VY-EKHKGNNFEIVLISLDEKYEDFKESFEAMPWLALPFKDK-NCERLVQYFEHKLLPQL  276

Query  447  VILDESGKVTTEDGVDIVLEHGVEAYPF  530
            V+L   GK   ++ V  V E+G EA+PF
Sbjct  277  VVLSPDGKTLQQNAVKFVEEYGDEAFPF  304



>ref|XP_008459534.1| PREDICTED: probable nucleoredoxin 1-1 isoform X4 [Cucumis melo]
Length=414

 Score =   174 bits (440),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 78/146 (53%), Positives = 107/146 (73%), Gaps = 4/146 (3%)
 Frame = +3

Query  105  HDLRSILCSSDRDFLIRNSGHQVKVDDLKGKKIGIYFSASWCGPCHRFTPNLATVYNELL  284
            HD+ S+L S  RDFLIRN+G QVK+  L GK++G+YFSA WC PC  FTP L+  Y ELL
Sbjct  7    HDISSLLSSERRDFLIRNNGDQVKISSLIGKRVGLYFSAGWCPPCRLFTPKLSEFYKELL  66

Query  285  PKG----NFEVVFVSADEDEESFKEYFGKMPWTAVPFSDSVTRERLDALFTVRGIPHLVI  452
                   +FE++F+S+D D  SFK YF KMPW ++PF D  T+++L  LF +R IP+LV+
Sbjct  67   ANNSKNNDFEIIFISSDRDALSFKAYFSKMPWLSIPFDDLETQKKLKILFQLRSIPYLVV  126

Query  453  LDESGKVTTEDGVDIVLEHGVEAYPF  530
            +D +GKV+++DGV++V E GV+AYPF
Sbjct  127  IDGNGKVSSDDGVNLVKEFGVDAYPF  152


 Score =   111 bits (278),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 65/161 (40%), Positives = 95/161 (59%), Gaps = 6/161 (4%)
 Frame = +3

Query  63   ERKASSMA---EQNGDAHDLRSILCSSDRDFLIRNSGHQVKVDDLKGKKIGIYFSASWCG  233
            +RK   +A   E   +   + S+L S+ R++L+ N G Q+ V  L+GK IG+YFS     
Sbjct  155  DRKKQLLAQKEEAKKNTQTITSVLASASRNYLVSNDGKQIPVSKLEGKLIGLYFSLPGHE  214

Query  234  PCHRFTPNLATVYNELLPKG-NFEVVFVSADEDEESFKEY-FGKMPWTAVPFSDSVTRER  407
             C  FTP L+ VYN+L  K  NFE+VFVS +E++E   +  F  MPW A+PF D    ++
Sbjct  215  HCEDFTPKLSEVYNKLKKKDENFEIVFVSLEEEDEDLFDEAFESMPWLALPFKDEKC-QK  273

Query  408  LDALFTVRGIPHLVILDESGKVTTEDGVDIVLEHGVEAYPF  530
            L   F V  IP LVI  + G+    + VD++ +HG++AYPF
Sbjct  274  LKLYFDVGEIPALVITGQDGRTLNPNAVDLIKQHGIDAYPF  314



>ref|XP_008459533.1| PREDICTED: probable nucleoredoxin 1 isoform X3 [Cucumis melo]
Length=417

 Score =   174 bits (440),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 78/146 (53%), Positives = 107/146 (73%), Gaps = 4/146 (3%)
 Frame = +3

Query  105  HDLRSILCSSDRDFLIRNSGHQVKVDDLKGKKIGIYFSASWCGPCHRFTPNLATVYNELL  284
            HD+ S+L S  RDFLIRN+G QVK+  L GK++G+YFSA WC PC  FTP L+  Y ELL
Sbjct  7    HDISSLLSSERRDFLIRNNGDQVKISSLIGKRVGLYFSAGWCPPCRLFTPKLSEFYKELL  66

Query  285  PKG----NFEVVFVSADEDEESFKEYFGKMPWTAVPFSDSVTRERLDALFTVRGIPHLVI  452
                   +FE++F+S+D D  SFK YF KMPW ++PF D  T+++L  LF +R IP+LV+
Sbjct  67   ANNSKNNDFEIIFISSDRDALSFKAYFSKMPWLSIPFDDLETQKKLKILFQLRSIPYLVV  126

Query  453  LDESGKVTTEDGVDIVLEHGVEAYPF  530
            +D +GKV+++DGV++V E GV+AYPF
Sbjct  127  IDGNGKVSSDDGVNLVKEFGVDAYPF  152


 Score =   111 bits (278),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 65/161 (40%), Positives = 95/161 (59%), Gaps = 6/161 (4%)
 Frame = +3

Query  63   ERKASSMA---EQNGDAHDLRSILCSSDRDFLIRNSGHQVKVDDLKGKKIGIYFSASWCG  233
            +RK   +A   E   +   + S+L S+ R++L+ N G Q+ V  L+GK IG+YFS     
Sbjct  155  DRKKQLLAQKEEAKKNTQTITSVLASASRNYLVSNDGKQIPVSKLEGKLIGLYFSLPGHE  214

Query  234  PCHRFTPNLATVYNELLPKG-NFEVVFVSADEDEESFKEY-FGKMPWTAVPFSDSVTRER  407
             C  FTP L+ VYN+L  K  NFE+VFVS +E++E   +  F  MPW A+PF D    ++
Sbjct  215  HCEDFTPKLSEVYNKLKKKDENFEIVFVSLEEEDEDLFDEAFESMPWLALPFKDEKC-QK  273

Query  408  LDALFTVRGIPHLVILDESGKVTTEDGVDIVLEHGVEAYPF  530
            L   F V  IP LVI  + G+    + VD++ +HG++AYPF
Sbjct  274  LKLYFDVGEIPALVITGQDGRTLNPNAVDLIKQHGIDAYPF  314



>ref|XP_002965590.1| hypothetical protein SELMODRAFT_143457 [Selaginella moellendorffii]
 gb|EFJ33010.1| hypothetical protein SELMODRAFT_143457 [Selaginella moellendorffii]
Length=490

 Score =   175 bits (443),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 86/166 (52%), Positives = 114/166 (69%), Gaps = 10/166 (6%)
 Frame = +3

Query  36   FQFSKRKGEERKASSMAEQNGDAHDLRSILCSSDRDFLIRNSGHQVKVDDLKGKKIGIYF  215
             Q  +++ EERKA+           L+S+L S DRDF+I N G +VKV+ L+GK + +YF
Sbjct  65   IQALEKEAEERKAN---------QSLKSLLVSPDRDFVIANDGSKVKVESLEGKIVALYF  115

Query  216  SASWCGPCHRFTPNLATVYNELLPKGN-FEVVFVSADEDEESFKEYFGKMPWTAVPFSDS  392
            S  WCGPC  FTP LA +Y +L  KG  FEVVFVSAD DE++F+EY  +MPW A+PFSDS
Sbjct  116  SGHWCGPCRSFTPVLARLYKQLKDKGEEFEVVFVSADNDEDAFEEYHKEMPWLAIPFSDS  175

Query  393  VTRERLDALFTVRGIPHLVILDESGKVTTEDGVDIVLEHGVEAYPF  530
             TR++LD +F + GIP LV+L + GK    D V +V +HGV+AYPF
Sbjct  176  KTRKQLDRIFDIGGIPSLVVLGKDGKTVHTDAVQLVSKHGVDAYPF  221


 Score =   152 bits (384),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 77/166 (46%), Positives = 102/166 (61%), Gaps = 3/166 (2%)
 Frame = +3

Query  36   FQFSKRKGEERKASSMAEQNGDAHDLRSILCSSDRDFLIRNSGHQVKVDDLKGKKIGIYF  215
            + F+  K +E KA    E+      L S+L S+ RDF++ + G +VK+ +LKGK +G+YF
Sbjct  219  YPFTPEKLDEIKAEQ--EKRRAQQTLDSLLVSNSRDFVVTHDGKEVKISELKGKTVGLYF  276

Query  216  SASWCGPCHRFTPNLATVYNELLPK-GNFEVVFVSADEDEESFKEYFGKMPWTAVPFSDS  392
            SA WC PC  FTP L  VYNEL  K   FE++FVS+D DE +FK YF  MPW A+PFSD 
Sbjct  277  SAHWCPPCRGFTPELVQVYNELKQKNAEFEIIFVSSDRDEGAFKSYFASMPWLALPFSDR  336

Query  393  VTRERLDALFTVRGIPHLVILDESGKVTTEDGVDIVLEHGVEAYPF  530
             ++  L + F V GIP LVIL   GK  T  G  +V  +   A+PF
Sbjct  337  ESKSELSSYFEVEGIPTLVILGPDGKTLTAAGRRLVGAYKAAAFPF  382


 Score = 55.5 bits (132),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 26/56 (46%), Positives = 36/56 (64%), Gaps = 1/56 (2%)
 Frame = +3

Query  366  WTAVPFSDSVTRERL-DALFTVRGIPHLVILDESGKVTTEDGVDIVLEHGVEAYPF  530
            W AVP  DS TRE L   L +  GI HL ++ E G+V T+DG+D++ + G E +PF
Sbjct  5    WMAVPLEDSATRESLLKDLRSGAGIFHLAVIGEDGEVLTQDGLDVIYKWGAEGFPF  60



>ref|XP_008459531.1| PREDICTED: probable nucleoredoxin 1 isoform X1 [Cucumis melo]
Length=428

 Score =   174 bits (440),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 78/146 (53%), Positives = 107/146 (73%), Gaps = 4/146 (3%)
 Frame = +3

Query  105  HDLRSILCSSDRDFLIRNSGHQVKVDDLKGKKIGIYFSASWCGPCHRFTPNLATVYNELL  284
            HD+ S+L S  RDFLIRN+G QVK+  L GK++G+YFSA WC PC  FTP L+  Y ELL
Sbjct  7    HDISSLLSSERRDFLIRNNGDQVKISSLIGKRVGLYFSAGWCPPCRLFTPKLSEFYKELL  66

Query  285  PKG----NFEVVFVSADEDEESFKEYFGKMPWTAVPFSDSVTRERLDALFTVRGIPHLVI  452
                   +FE++F+S+D D  SFK YF KMPW ++PF D  T+++L  LF +R IP+LV+
Sbjct  67   ANNSKNNDFEIIFISSDRDALSFKAYFSKMPWLSIPFDDLETQKKLKILFQLRSIPYLVV  126

Query  453  LDESGKVTTEDGVDIVLEHGVEAYPF  530
            +D +GKV+++DGV++V E GV+AYPF
Sbjct  127  IDGNGKVSSDDGVNLVKEFGVDAYPF  152


 Score =   111 bits (277),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 65/161 (40%), Positives = 95/161 (59%), Gaps = 6/161 (4%)
 Frame = +3

Query  63   ERKASSMA---EQNGDAHDLRSILCSSDRDFLIRNSGHQVKVDDLKGKKIGIYFSASWCG  233
            +RK   +A   E   +   + S+L S+ R++L+ N G Q+ V  L+GK IG+YFS     
Sbjct  155  DRKKQLLAQKEEAKKNTQTITSVLASASRNYLVSNDGKQIPVSKLEGKLIGLYFSLPGHE  214

Query  234  PCHRFTPNLATVYNELLPKG-NFEVVFVSADEDEESFKEY-FGKMPWTAVPFSDSVTRER  407
             C  FTP L+ VYN+L  K  NFE+VFVS +E++E   +  F  MPW A+PF D    ++
Sbjct  215  HCEDFTPKLSEVYNKLKKKDENFEIVFVSLEEEDEDLFDEAFESMPWLALPFKDEKC-QK  273

Query  408  LDALFTVRGIPHLVILDESGKVTTEDGVDIVLEHGVEAYPF  530
            L   F V  IP LVI  + G+    + VD++ +HG++AYPF
Sbjct  274  LKLYFDVGEIPALVITGQDGRTLNPNAVDLIKQHGIDAYPF  314



>ref|XP_008459532.1| PREDICTED: probable nucleoredoxin 1 isoform X2 [Cucumis melo]
Length=425

 Score =   173 bits (439),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 78/146 (53%), Positives = 107/146 (73%), Gaps = 4/146 (3%)
 Frame = +3

Query  105  HDLRSILCSSDRDFLIRNSGHQVKVDDLKGKKIGIYFSASWCGPCHRFTPNLATVYNELL  284
            HD+ S+L S  RDFLIRN+G QVK+  L GK++G+YFSA WC PC  FTP L+  Y ELL
Sbjct  7    HDISSLLSSERRDFLIRNNGDQVKISSLIGKRVGLYFSAGWCPPCRLFTPKLSEFYKELL  66

Query  285  PKG----NFEVVFVSADEDEESFKEYFGKMPWTAVPFSDSVTRERLDALFTVRGIPHLVI  452
                   +FE++F+S+D D  SFK YF KMPW ++PF D  T+++L  LF +R IP+LV+
Sbjct  67   ANNSKNNDFEIIFISSDRDALSFKAYFSKMPWLSIPFDDLETQKKLKILFQLRSIPYLVV  126

Query  453  LDESGKVTTEDGVDIVLEHGVEAYPF  530
            +D +GKV+++DGV++V E GV+AYPF
Sbjct  127  IDGNGKVSSDDGVNLVKEFGVDAYPF  152


 Score =   111 bits (277),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 65/161 (40%), Positives = 95/161 (59%), Gaps = 6/161 (4%)
 Frame = +3

Query  63   ERKASSMA---EQNGDAHDLRSILCSSDRDFLIRNSGHQVKVDDLKGKKIGIYFSASWCG  233
            +RK   +A   E   +   + S+L S+ R++L+ N G Q+ V  L+GK IG+YFS     
Sbjct  155  DRKKQLLAQKEEAKKNTQTITSVLASASRNYLVSNDGKQIPVSKLEGKLIGLYFSLPGHE  214

Query  234  PCHRFTPNLATVYNELLPKG-NFEVVFVSADEDEESFKEY-FGKMPWTAVPFSDSVTRER  407
             C  FTP L+ VYN+L  K  NFE+VFVS +E++E   +  F  MPW A+PF D    ++
Sbjct  215  HCEDFTPKLSEVYNKLKKKDENFEIVFVSLEEEDEDLFDEAFESMPWLALPFKDEKC-QK  273

Query  408  LDALFTVRGIPHLVILDESGKVTTEDGVDIVLEHGVEAYPF  530
            L   F V  IP LVI  + G+    + VD++ +HG++AYPF
Sbjct  274  LKLYFDVGEIPALVITGQDGRTLNPNAVDLIKQHGIDAYPF  314



>ref|XP_002968070.1| hypothetical protein SELMODRAFT_440252 [Selaginella moellendorffii]
 gb|EFJ30324.1| hypothetical protein SELMODRAFT_440252 [Selaginella moellendorffii]
Length=596

 Score =   176 bits (445),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 86/166 (52%), Positives = 114/166 (69%), Gaps = 10/166 (6%)
 Frame = +3

Query  36   FQFSKRKGEERKASSMAEQNGDAHDLRSILCSSDRDFLIRNSGHQVKVDDLKGKKIGIYF  215
             Q  +++ EERKA+           L+S+L S DRDF+I N G +VKV+ L+GK + +YF
Sbjct  171  IQALEKEAEERKAN---------QSLKSLLVSPDRDFVIANDGSKVKVESLEGKIVALYF  221

Query  216  SASWCGPCHRFTPNLATVYNELLPKGN-FEVVFVSADEDEESFKEYFGKMPWTAVPFSDS  392
            S  WCGPC  FTP LA +Y +L  KG  FEVVFVSAD DE++F+EY  +MPW A+PFSDS
Sbjct  222  SGHWCGPCRSFTPVLARLYKQLKDKGEEFEVVFVSADNDEDAFEEYHKEMPWLAIPFSDS  281

Query  393  VTRERLDALFTVRGIPHLVILDESGKVTTEDGVDIVLEHGVEAYPF  530
             TR++LD +F + GIP LV+L + GK    D V +V +HGV+AYPF
Sbjct  282  KTRKQLDRIFDIGGIPSLVVLGKDGKTVHTDAVQLVSKHGVDAYPF  327


 Score =   155 bits (393),  Expect = 5e-41, Method: Compositional matrix adjust.
 Identities = 78/166 (47%), Positives = 103/166 (62%), Gaps = 3/166 (2%)
 Frame = +3

Query  36   FQFSKRKGEERKASSMAEQNGDAHDLRSILCSSDRDFLIRNSGHQVKVDDLKGKKIGIYF  215
            + F+  K +E KA    E+      L S+L S+ RDF++ + G +VK+ +LKGK +G+YF
Sbjct  325  YPFTPEKLDEIKAEQ--EKRRAQQTLDSLLVSNSRDFVVTHDGKEVKISELKGKTVGLYF  382

Query  216  SASWCGPCHRFTPNLATVYNELLPK-GNFEVVFVSADEDEESFKEYFGKMPWTAVPFSDS  392
            SA WC PC  FTP L  VYNEL  K   FE++FVS+D DEE+FK YF  MPW A+PFSD 
Sbjct  383  SAHWCPPCRGFTPELVQVYNELKQKNAEFEIIFVSSDRDEEAFKSYFASMPWLALPFSDR  442

Query  393  VTRERLDALFTVRGIPHLVILDESGKVTTEDGVDIVLEHGVEAYPF  530
             ++  L + F V GIP LVIL   GK  T  G  +V  +   A+PF
Sbjct  443  ESKSELSSYFEVEGIPTLVILGPDGKTLTAAGRRLVGAYKAAAFPF  488


 Score = 62.4 bits (150),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 47/151 (31%), Positives = 70/151 (46%), Gaps = 27/151 (18%)
 Frame = +3

Query  159  SGHQVKVDD-LKGKKIGIYFSASWCG-PCHRFTPNLATVYNELLPKGN-FEVVFVSADED  329
            SG  +K  D L+ K   +  +  W   P  +   +L  V +EL  +G    +V+V+ D D
Sbjct  16   SGESIKAADALRNKVTLLAIAPHWLPMPLRQTMASLVEVVDELQQQGKEIALVYVAVDRD  75

Query  330  E---------------------ESFKEYFGKMP--WTAVPFSDSVTRERL-DALFTVRGI  437
            E                     E F +   +M   W AVP  DS TRE L   L +  GI
Sbjct  76   EDMIAKLKARGNDRVLDDRPSQECFDDLRKQMSQGWMAVPLEDSATRESLLKDLRSGAGI  135

Query  438  PHLVILDESGKVTTEDGVDIVLEHGVEAYPF  530
             HL ++ E G+V T+DG+D++ + G E +PF
Sbjct  136  FHLAVIGEDGEVLTQDGLDVIYKWGAEGFPF  166



>ref|XP_006836608.1| hypothetical protein AMTR_s00131p00112160 [Amborella trichopoda]
 gb|ERM99461.1| hypothetical protein AMTR_s00131p00112160 [Amborella trichopoda]
Length=559

 Score =   174 bits (440),  Expect = 9e-48, Method: Compositional matrix adjust.
 Identities = 83/149 (56%), Positives = 108/149 (72%), Gaps = 2/149 (1%)
 Frame = +3

Query  90   QNGDAHDLRSILCSSDRDFLIRNSGHQVKVDDLKGKKIGIYFSASWCGPCHRFTPNLATV  269
            QNG + D++S+L   +RDFLIR++  QVK+ +L GK IG++FSASW GPC  FTP L  +
Sbjct  14   QNGFSLDIKSLLSGEERDFLIRSNDDQVKIGELNGKVIGLFFSASWSGPCMTFTPELIAI  73

Query  270  YNEL--LPKGNFEVVFVSADEDEESFKEYFGKMPWTAVPFSDSVTRERLDALFTVRGIPH  443
            Y EL    KG+FEVVFVS D +E+SF+EYF KMPW A+PFSDS TR +L+  F V  IPH
Sbjct  74   YKELEIAIKGDFEVVFVSLDSEEKSFEEYFSKMPWLAIPFSDSKTRSKLEKDFKVSSIPH  133

Query  444  LVILDESGKVTTEDGVDIVLEHGVEAYPF  530
            L+I+ + GK+ T  GVDI   +GV+ YPF
Sbjct  134  LIIVGKDGKILTTGGVDIASNYGVDGYPF  162


 Score =   128 bits (321),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 56/142 (39%), Positives = 91/142 (64%), Gaps = 2/142 (1%)
 Frame = +3

Query  108  DLRSILCSSDRDFLIRNSGHQVKVDDLKGKKIGIYFSASWCGPCHRFTPNLATVYNELLP  287
            ++ S+L + DRDF+I  SG++V + DL GK + +YF+A WC  CH F P L  VYN++  
Sbjct  342  NIESLLLTEDRDFVIDKSGNEVPISDLAGKNVCLYFAAKWCHLCHDFMPKLIHVYNDIKA  401

Query  288  KG-NFEVVFVSADEDEESFKEYFGKMPWTAVPFSDSVTRERLDALFTVRGIPHLVILDES  464
            +  NFE+VF+S D+DE SF ++   MPW A+P+ D    + L  LF +  +P LV++ + 
Sbjct  402  RDPNFEIVFISGDQDEASFNDFLWDMPWLALPYGDMAVGKLLQ-LFKIASVPTLVVVGKD  460

Query  465  GKVTTEDGVDIVLEHGVEAYPF  530
            G + + + + ++ +HG  +YPF
Sbjct  461  GGLVSSNAIKLLWKHGPRSYPF  482


 Score =   123 bits (309),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 63/143 (44%), Positives = 86/143 (60%), Gaps = 2/143 (1%)
 Frame = +3

Query  105  HDLRSILCSSDRDFLIRNSGHQVKVDDLKGKKIGIYFSASWCGPCHRFTPNLATVYNELL  284
              LR +L ++ R F+I N   Q+ V +L+GK IG YF+A     C  FTP L  VY +L 
Sbjct  181  QSLRPLLVTNTRGFVISNDNKQIPVSELEGKTIGFYFAAYGHPYCQTFTPELIRVYEKLK  240

Query  285  PKG-NFEVVFVSADEDEESFKEYFGKMPWTAVPFSDSVTRERLDALFTVRGIPHLVILDE  461
              G NFE+V VS+D   ESF ++F  MPW A+PF D+    RL  +F ++G P L+++  
Sbjct  241  ENGENFEIVLVSSDLKLESFNKHFSSMPWFALPFQDTALT-RLTRIFQIQGFPTLLVVGP  299

Query  462  SGKVTTEDGVDIVLEHGVEAYPF  530
             GK   +D V  + EHGVEAYPF
Sbjct  300  DGKTLKDDAVGAIEEHGVEAYPF  322



>gb|KGN52627.1| hypothetical protein Csa_5G647490 [Cucumis sativus]
Length=462

 Score =   172 bits (436),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 79/146 (54%), Positives = 105/146 (72%), Gaps = 4/146 (3%)
 Frame = +3

Query  105  HDLRSILCSSDRDFLIRNSGHQVKVDDLKGKKIGIYFSASWCGPCHRFTPNLATVYNELL  284
            HDL S+L S  RDFLIRN+G QVK+  L GK++G+YFSA WC PC  FTP L+  Y ELL
Sbjct  7    HDLTSLLSSDRRDFLIRNNGDQVKISSLIGKRVGLYFSAGWCPPCRLFTPKLSEFYKELL  66

Query  285  PK----GNFEVVFVSADEDEESFKEYFGKMPWTAVPFSDSVTRERLDALFTVRGIPHLVI  452
                   +FE++F+S+D D  SFK YF KMPW A+PF D  T+++L  LF +  IP+LV+
Sbjct  67   ANKSKNNDFEIIFISSDRDALSFKAYFSKMPWLAIPFDDLETQKKLKILFQLSSIPYLVV  126

Query  453  LDESGKVTTEDGVDIVLEHGVEAYPF  530
            +D +GKV++ DGV++V E GV+AYPF
Sbjct  127  IDGNGKVSSADGVNLVKEFGVDAYPF  152


 Score =   111 bits (277),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 68/161 (42%), Positives = 96/161 (60%), Gaps = 6/161 (4%)
 Frame = +3

Query  63   ERKASSMA---EQNGDAHDLRSILCSSDRDFLIRNSGHQVKVDDLKGKKIGIYFSASWCG  233
            +RK   +A   E   +   + S+L S+ R++L+ N G Q+ V +L+GK IG+YFS     
Sbjct  155  DRKKQLLAQKEEAKKNNQTITSVLASASRNYLVSNDGKQIPVSELEGKLIGLYFSLPGHE  214

Query  234  PCHRFTPNLATVYNELLPKG-NFEVVFVS-ADEDEESFKEYFGKMPWTAVPFSDSVTRER  407
             C  FTP L+ VYN L  K  NFE+VFVS  +EDE+ F E F  MPW A+PF D    ++
Sbjct  215  HCDAFTPKLSEVYNNLKKKKENFEIVFVSLEEEDEDFFNEAFKSMPWLALPFKDEKC-QK  273

Query  408  LDALFTVRGIPHLVILDESGKVTTEDGVDIVLEHGVEAYPF  530
            L   F V  IP LVI  + G+    + VD++ +HG++AYPF
Sbjct  274  LKLYFDVDDIPALVITGQDGRTLNPNAVDLIKQHGIDAYPF  314



>ref|XP_004141531.1| PREDICTED: probable nucleoredoxin 1-like [Cucumis sativus]
 ref|XP_004156197.1| PREDICTED: probable nucleoredoxin 1-like [Cucumis sativus]
Length=803

 Score =   173 bits (438),  Expect = 9e-47, Method: Compositional matrix adjust.
 Identities = 79/144 (55%), Positives = 106/144 (74%), Gaps = 2/144 (1%)
 Frame = +3

Query  105  HDLRSILCSSDRDFLIRNSGHQVKVDDLKGKKIGIYFSASWCGPCHRFTPNLATVYNELL  284
            +DL S+L S  RDFLIRN+G QVK+  L GK +G+YFSA WC PC  FTP L   Y EL 
Sbjct  7    YDLNSLLSSEGRDFLIRNNGDQVKISSLSGKIVGLYFSAGWCPPCRFFTPKLLKTYKELA  66

Query  285  PKG--NFEVVFVSADEDEESFKEYFGKMPWTAVPFSDSVTRERLDALFTVRGIPHLVILD  458
             K   +FEVVF+S+D DE SF+ YF +MPW ++PF DS T+++L +LF + GIPHLV++D
Sbjct  67   SKNINDFEVVFISSDGDEYSFEAYFLRMPWLSIPFEDSETKQKLKSLFQLSGIPHLVVID  126

Query  459  ESGKVTTEDGVDIVLEHGVEAYPF  530
             +GKV+++DGV +V + G +AYPF
Sbjct  127  GNGKVSSDDGVGLVRDFGADAYPF  150


 Score =   162 bits (410),  Expect = 8e-43, Method: Compositional matrix adjust.
 Identities = 73/135 (54%), Positives = 98/135 (73%), Gaps = 4/135 (3%)
 Frame = +3

Query  138  RDFLIRNSGHQVKVDDLKGKKIGIYFSASWCGPCHRFTPNLATVYNELLPK----GNFEV  305
            RDFLIRN+G QVK+  L GK++G+YFSA WC PC  FTP L+  Y ELL       +FE+
Sbjct  344  RDFLIRNNGDQVKISSLIGKRVGLYFSAGWCPPCRLFTPKLSEFYKELLANKSKNNDFEI  403

Query  306  VFVSADEDEESFKEYFGKMPWTAVPFSDSVTRERLDALFTVRGIPHLVILDESGKVTTED  485
            +F+S+D D  SFK YF KMPW A+PF D  T+++L  LF +  IP+LV++D +GKV++ D
Sbjct  404  IFISSDRDALSFKAYFSKMPWLAIPFDDLETQKKLKILFQLSSIPYLVVIDGNGKVSSAD  463

Query  486  GVDIVLEHGVEAYPF  530
            GV++V E GV+AYPF
Sbjct  464  GVNLVKEFGVDAYPF  478


 Score =   119 bits (297),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 62/150 (41%), Positives = 90/150 (60%), Gaps = 3/150 (2%)
 Frame = +3

Query  87   EQNGDAHDLRSILCSSDRDFLIRNSGHQVKVDDLKGKKIGIYFSASWCGPCHRFTPNLAT  266
            E   +   + S+L S+ R +++ N G+Q+ + +L+GK IG+YFS      C  FTP L  
Sbjct  165  EARRNNQTIDSLLVSTSRTYVVSNDGNQIPISELEGKLIGLYFSKQGHEDCGNFTPKLIE  224

Query  267  VYNELLPK-GNFEVVFVSADEDEES-FKEYFGKMPWTAVPFSDSVTRERLDALFTVRGIP  440
             YN+L  K  NFE+VF+S DE+ E  FKE F  MPW A+PF D   +E L   F V  IP
Sbjct  225  AYNKLKKKEENFEIVFISLDEENEDLFKEAFKTMPWLALPFKDEKCQE-LKLYFEVTHIP  283

Query  441  HLVILDESGKVTTEDGVDIVLEHGVEAYPF  530
             LVI+ + GK +  + V+++   G++AYPF
Sbjct  284  ALVIIGQDGKTSNPNAVELIKGRGIDAYPF  313


 Score =   111 bits (278),  Expect = 7e-25, Method: Compositional matrix adjust.
 Identities = 68/161 (42%), Positives = 96/161 (60%), Gaps = 6/161 (4%)
 Frame = +3

Query  63   ERKASSMA---EQNGDAHDLRSILCSSDRDFLIRNSGHQVKVDDLKGKKIGIYFSASWCG  233
            +RK   +A   E   +   + S+L S+ R++L+ N G Q+ V +L+GK IG+YFS     
Sbjct  481  DRKKQLLAQKEEAKKNNQTITSVLASASRNYLVSNDGKQIPVSELEGKLIGLYFSLPGHE  540

Query  234  PCHRFTPNLATVYNELLPKG-NFEVVFVS-ADEDEESFKEYFGKMPWTAVPFSDSVTRER  407
             C  FTP L+ VYN L  K  NFE+VFVS  +EDE+ F E F  MPW A+PF D    ++
Sbjct  541  HCDAFTPKLSEVYNNLKKKKENFEIVFVSLEEEDEDFFNEAFKSMPWLALPFKDEKC-QK  599

Query  408  LDALFTVRGIPHLVILDESGKVTTEDGVDIVLEHGVEAYPF  530
            L   F V  IP LVI  + G+    + VD++ +HG++AYPF
Sbjct  600  LKLYFDVDDIPALVITGQDGRTLNPNAVDLIKQHGIDAYPF  640



>gb|EEC75442.1| hypothetical protein OsI_11975 [Oryza sativa Indica Group]
Length=581

 Score =   171 bits (433),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 86/155 (55%), Positives = 111/155 (72%), Gaps = 5/155 (3%)
 Frame = +3

Query  81   MAEQNGDAHD--LRSILCSSD-RDFLIRNSGHQVKVDDLKGKKIGIYFSASWCGPCHRFT  251
            MA+    A D  + +IL S+D RDFL+RNS  +VK+  +K   + +YFSASWC PC RFT
Sbjct  1    MADATHAAADGGVATILASADGRDFLLRNSADKVKISSIKASTVALYFSASWCPPCRRFT  60

Query  252  PNLATVYNELLPKG-NFEVVFVSADEDEESFKEYFGKMPWTAVPFSDSVTRERLDALFTV  428
            P L   YNEL+ +G +FEVVFVS D D+++F  YF KMPW AVPFSDS    +L+  + V
Sbjct  61   PKLIEAYNELVSQGKSFEVVFVSGDSDQDAFNAYFAKMPWLAVPFSDSEALAKLNERYKV  120

Query  429  RGIPHLVILD-ESGKVTTEDGVDIVLEHGVEAYPF  530
             GIPHLVILD +SG++ TEDGV++V E+G EAYPF
Sbjct  121  MGIPHLVILDAKSGEIYTEDGVELVHEYGTEAYPF  155


 Score =   129 bits (325),  Expect = 9e-32, Method: Compositional matrix adjust.
 Identities = 64/166 (39%), Positives = 97/166 (58%), Gaps = 4/166 (2%)
 Frame = +3

Query  36   FQFSKRKGEERKASSMAEQNGDAHDLRSILCSSDRDFLIRNSGHQVKVDDLKGKKIGIYF  215
            F FS  K E    +  A+   ++  L S+L + D DF++   G +V V +L GK + +YF
Sbjct  316  FPFSAEKLE--ILAEKAKAKAESQTLESLLVTGDLDFVLGKDGAKVPVSELVGKTVLLYF  373

Query  216  SASWCGPCHRFTPNLATVYNELLPKGN-FEVVFVSADEDEESFKEYFGKMPWTAVPFSDS  392
            SA WC PC  F P L   YN++  K N FE+VF+S+D ++ S+ E+F  MPW A+P  D 
Sbjct  374  SAKWCPPCRAFLPKLVNEYNKIKEKHNDFEIVFISSDREQSSYDEFFSGMPWLALPLGDE  433

Query  393  VTRERLDALFTVRGIPHLVILDESGKVTTEDGVDIVLEHGVEAYPF  530
              +++L  +F + GIP LV +   GK  T+D    ++ HG +A+PF
Sbjct  434  -RKQQLSKIFKITGIPSLVAIGPDGKTVTKDAKTPLVAHGADAFPF  478


 Score =   111 bits (278),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 64/164 (39%), Positives = 92/164 (56%), Gaps = 4/164 (2%)
 Frame = +3

Query  36   FQFSKRKGEERKASSMAEQNGDAHDLRSILCSSDRDFLIRNSGHQVKVDDLKGKKIGIYF  215
            + F+  +  E K    A +  D   + S+  +  RD+LI N G +V + DL+GK +G+ F
Sbjct  153  YPFTTERINELKEQEKAAK--DNQTIHSLFGTPTRDYLITNKGDKVPISDLEGKYVGLCF  210

Query  216  SASWCGPCHRFTPNLATVYNELLPKG-NFEVVFVSADEDEESFKEYFGKMPWTAVPFSDS  392
              +  GP  +FT  LA +Y +L   G  FEVV VS D DEESF E F  MPW A+P  D 
Sbjct  211  VVNGYGPVVQFTSVLAKIYEKLKVVGEKFEVVMVSLDGDEESFNESFADMPWLAIPQGDK  270

Query  393  VTRERLDALFTVRGIPHLVILDESGKVTTEDGVDIVLEHGVEAY  524
            +  E+L   F + G+P LV++   GK   +D  DI+ EHG +A+
Sbjct  271  MC-EKLARYFELSGLPMLVLIGPDGKTLNDDIADIIDEHGPDAW  313



>sp|Q7Y0F2.1|NRX12_ORYSJ RecName: Full=Probable nucleoredoxin 1-2; Short=OsNrx1-2 [Oryza 
sativa Japonica Group]
 gb|AAP50932.1| putative trypanothione-dependent peroxidase [Oryza sativa Japonica 
Group]
 gb|ABF96516.1| PDI, putative, expressed [Oryza sativa Japonica Group]
 gb|EEE59229.1| hypothetical protein OsJ_11208 [Oryza sativa Japonica Group]
Length=581

 Score =   171 bits (433),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 86/155 (55%), Positives = 111/155 (72%), Gaps = 5/155 (3%)
 Frame = +3

Query  81   MAEQNGDAHD--LRSILCSSD-RDFLIRNSGHQVKVDDLKGKKIGIYFSASWCGPCHRFT  251
            MA+    A D  + +IL S+D RDFL+RNS  +VK+  +K   + +YFSASWC PC RFT
Sbjct  1    MADATHAAADGGVATILASADGRDFLLRNSADKVKISSIKASTVALYFSASWCPPCRRFT  60

Query  252  PNLATVYNELLPKG-NFEVVFVSADEDEESFKEYFGKMPWTAVPFSDSVTRERLDALFTV  428
            P L   YNEL+ +G +FEVVFVS D D+++F  YF KMPW AVPFSDS    +L+  + V
Sbjct  61   PKLIEAYNELVSQGKSFEVVFVSGDSDQDAFNAYFAKMPWLAVPFSDSEALAKLNERYKV  120

Query  429  RGIPHLVILD-ESGKVTTEDGVDIVLEHGVEAYPF  530
             GIPHLVILD +SG++ TEDGV++V E+G EAYPF
Sbjct  121  MGIPHLVILDAKSGEIYTEDGVELVHEYGTEAYPF  155


 Score =   129 bits (325),  Expect = 9e-32, Method: Compositional matrix adjust.
 Identities = 67/168 (40%), Positives = 98/168 (58%), Gaps = 8/168 (5%)
 Frame = +3

Query  36   FQFSKRKGE--ERKASSMAEQNGDAHDLRSILCSSDRDFLIRNSGHQVKVDDLKGKKIGI  209
            F FS  K E    KA + AE    +  L S+L + D DF++   G +V V +L GK + +
Sbjct  316  FPFSAEKLEILAEKAKAKAE----SQTLESLLVTGDLDFVLGKDGAKVPVSELVGKTVLL  371

Query  210  YFSASWCGPCHRFTPNLATVYNELLPKGN-FEVVFVSADEDEESFKEYFGKMPWTAVPFS  386
            YFSA WC PC  F P L   YN++  K N FE+VF+S+D ++ S+ E+F  MPW A+P  
Sbjct  372  YFSAKWCPPCRAFLPKLVNEYNKIKEKHNDFEIVFISSDREQSSYDEFFSGMPWLALPLG  431

Query  387  DSVTRERLDALFTVRGIPHLVILDESGKVTTEDGVDIVLEHGVEAYPF  530
            D   +++L  +F + GIP LV +   GK  T+D    ++ HG +A+PF
Sbjct  432  DE-RKQQLSKIFKITGIPSLVAIGPDGKTVTKDAKTPLVAHGADAFPF  478


 Score =   112 bits (280),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 64/164 (39%), Positives = 92/164 (56%), Gaps = 4/164 (2%)
 Frame = +3

Query  36   FQFSKRKGEERKASSMAEQNGDAHDLRSILCSSDRDFLIRNSGHQVKVDDLKGKKIGIYF  215
            + F+  +  E K    A +  D   + S+  +  RD+LI N G +V + DL+GK +G+ F
Sbjct  153  YPFTTERINELKEQEKAAK--DNQTIHSLFGTPTRDYLITNKGDKVPISDLEGKYVGLCF  210

Query  216  SASWCGPCHRFTPNLATVYNELLPKG-NFEVVFVSADEDEESFKEYFGKMPWTAVPFSDS  392
              +  GP  +FT  LA +Y +L   G  FEVV VS D DEESF E F  MPW A+P  D 
Sbjct  211  VVNGYGPVVQFTSVLAKIYEKLKAVGEKFEVVMVSLDGDEESFNESFADMPWLAIPQGDK  270

Query  393  VTRERLDALFTVRGIPHLVILDESGKVTTEDGVDIVLEHGVEAY  524
            +  E+L   F + G+P LV++   GK   +D  DI+ EHG +A+
Sbjct  271  MC-EKLARYFELSGLPMLVLIGPDGKTLNDDIADIIDEHGPDAW  313



>gb|EAY90397.1| hypothetical protein OsI_11974 [Oryza sativa Indica Group]
Length=588

 Score =   170 bits (431),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 86/166 (52%), Positives = 107/166 (64%), Gaps = 21/166 (13%)
 Frame = +3

Query  96   GDAHDLRSILCSSDRDFLIRNSGHQ-------------------VKVDDLKGKKIGIYFS  218
             DA  + ++L +  RDFL+RNS  Q                   VK+  ++   + +YFS
Sbjct  2    ADAAGIATVLAADGRDFLLRNSADQLPATRAAVRCCAIEMSHEKVKISSIEASTVALYFS  61

Query  219  ASWCGPCHRFTPNLATVYNELLPKG-NFEVVFVSADEDEESFKEYFGKMPWTAVPFSDSV  395
            ASWC PC RFTP L   YNEL+ +G NFEVVFVS D+D+E+F  YF KMPW AVPFSDS 
Sbjct  62   ASWCPPCRRFTPKLIEAYNELVSQGKNFEVVFVSGDKDQEAFDAYFAKMPWLAVPFSDSE  121

Query  396  TRERLDALFTVRGIPHLVILDE-SGKVTTEDGVDIVLEHGVEAYPF  530
             R +L+  F VRGIPHLVIL+  SG+V TEDGV++V  HG EAYPF
Sbjct  122  CRAKLNKRFKVRGIPHLVILNATSGEVYTEDGVELVTVHGTEAYPF  167


 Score =   127 bits (319),  Expect = 6e-31, Method: Compositional matrix adjust.
 Identities = 64/166 (39%), Positives = 92/166 (55%), Gaps = 4/166 (2%)
 Frame = +3

Query  36   FQFSKRKGEERKASSMAEQNGDAHDLRSILCSSDRDFLIRNSGHQVKVDDLKGKKIGIYF  215
            F F+  K E    +  A+   +   L S+L   D DF++   G +V V +L GK + +YF
Sbjct  328  FPFTAEKME--ILAEKAKAKAELQTLESLLVIGDLDFVLGKDGAKVPVSELVGKTVLLYF  385

Query  216  SASWCGPCHRFTPNLATVYNELLPKGN-FEVVFVSADEDEESFKEYFGKMPWTAVPFSDS  392
            SA WCGPC  F P L   YN++  K N FE++F+S+D D+ S+ E+F  MPW A+P  D 
Sbjct  386  SAKWCGPCRAFLPKLVDEYNKIKEKHNDFEIIFISSDRDQSSYDEFFSGMPWLALPLGDE  445

Query  393  VTRERLDALFTVRGIPHLVILDESGKVTTEDGVDIVLEHGVEAYPF  530
              ++ L   F VRGIP LV +   G+    D    +  HG +A+PF
Sbjct  446  -RKQHLSKTFRVRGIPSLVAIGADGRTVARDAKTPLTAHGADAFPF  490


 Score =   105 bits (262),  Expect = 6e-23, Method: Compositional matrix adjust.
 Identities = 64/169 (38%), Positives = 93/169 (55%), Gaps = 7/169 (4%)
 Frame = +3

Query  36   FQFSKRKGEERKASSMAEQNGDAHDLRSILCSSDRDFLIRNSGHQVKVDDLKGKKIGIYF  215
            + F+  +  E K    A +  D   ++S+L +  RD+L+ N G +V + DL+GK +G+ F
Sbjct  165  YPFTTERINELKEQEKAAK--DNQTVQSVLGTPTRDYLLSNKGDRVPISDLEGKYVGLCF  222

Query  216  SASWCGPCHRFTPNLATVYNELLPKG-NFEVVFVSADEDEESFKEYFGKMPWTAVPFSDS  392
              +  GP  +FT  LA  Y +L   G  FEVV VS D DEE   E F  MPW A+P  D 
Sbjct  223  VVNGYGPVVQFTSLLAKFYEKLKEVGEKFEVVAVSLDSDEELSNESFAGMPWLAIPQEDK  282

Query  393  VTRERLDALFTVRGIPHLVILDESGKVTTEDGVDIVLEHGVEA---YPF  530
            +  E+L   F +RG+P LV++   GK    +  DI+ EHG +A   +PF
Sbjct  283  MG-EKLARYFELRGLPTLVLIGPDGKTLNNNVADIIDEHGQDAWEGFPF  330



>gb|AAU89249.1| C1-like domain containing protein [Oryza sativa Japonica Group]
Length=764

 Score =   171 bits (434),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 86/155 (55%), Positives = 111/155 (72%), Gaps = 5/155 (3%)
 Frame = +3

Query  81   MAEQNGDAHD--LRSILCSSD-RDFLIRNSGHQVKVDDLKGKKIGIYFSASWCGPCHRFT  251
            MA+    A D  + +IL S+D RDFL+RNS  +VK+  +K   + +YFSASWC PC RFT
Sbjct  1    MADATHAAADGGVATILASADGRDFLLRNSADKVKISSIKASTVALYFSASWCPPCRRFT  60

Query  252  PNLATVYNELLPKG-NFEVVFVSADEDEESFKEYFGKMPWTAVPFSDSVTRERLDALFTV  428
            P L   YNEL+ +G +FEVVFVS D D+++F  YF KMPW AVPFSDS    +L+  + V
Sbjct  61   PKLIEAYNELVSQGKSFEVVFVSGDSDQDAFNAYFAKMPWLAVPFSDSEALAKLNERYKV  120

Query  429  RGIPHLVILD-ESGKVTTEDGVDIVLEHGVEAYPF  530
             GIPHLVILD +SG++ TEDGV++V E+G EAYPF
Sbjct  121  MGIPHLVILDAKSGEIYTEDGVELVHEYGTEAYPF  155


 Score =   129 bits (324),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 64/166 (39%), Positives = 97/166 (58%), Gaps = 4/166 (2%)
 Frame = +3

Query  36   FQFSKRKGEERKASSMAEQNGDAHDLRSILCSSDRDFLIRNSGHQVKVDDLKGKKIGIYF  215
            F FS  K E    +  A+   ++  L S+L + D DF++   G +V V +L GK + +YF
Sbjct  316  FPFSAEKLE--ILAEKAKAKAESQTLESLLVTGDLDFVLGKDGAKVPVSELVGKTVLLYF  373

Query  216  SASWCGPCHRFTPNLATVYNELLPKGN-FEVVFVSADEDEESFKEYFGKMPWTAVPFSDS  392
            SA WC PC  F P L   YN++  K N FE+VF+S+D ++ S+ E+F  MPW A+P  D 
Sbjct  374  SAKWCPPCRAFLPKLVNEYNKIKEKHNDFEIVFISSDREQSSYDEFFSGMPWLALPLGDE  433

Query  393  VTRERLDALFTVRGIPHLVILDESGKVTTEDGVDIVLEHGVEAYPF  530
              +++L  +F + GIP LV +   GK  T+D    ++ HG +A+PF
Sbjct  434  -RKQQLSKIFKITGIPSLVAIGPDGKTVTKDAKTPLVAHGADAFPF  478


 Score =   112 bits (279),  Expect = 5e-25, Method: Compositional matrix adjust.
 Identities = 64/164 (39%), Positives = 92/164 (56%), Gaps = 4/164 (2%)
 Frame = +3

Query  36   FQFSKRKGEERKASSMAEQNGDAHDLRSILCSSDRDFLIRNSGHQVKVDDLKGKKIGIYF  215
            + F+  +  E K    A +  D   + S+  +  RD+LI N G +V + DL+GK +G+ F
Sbjct  153  YPFTTERINELKEQEKAAK--DNQTIHSLFGTPTRDYLITNKGDKVPISDLEGKYVGLCF  210

Query  216  SASWCGPCHRFTPNLATVYNELLPKG-NFEVVFVSADEDEESFKEYFGKMPWTAVPFSDS  392
              +  GP  +FT  LA +Y +L   G  FEVV VS D DEESF E F  MPW A+P  D 
Sbjct  211  VVNGYGPVVQFTSVLAKIYEKLKAVGEKFEVVMVSLDGDEESFNESFADMPWLAIPQGDK  270

Query  393  VTRERLDALFTVRGIPHLVILDESGKVTTEDGVDIVLEHGVEAY  524
            +  E+L   F + G+P LV++   GK   +D  DI+ EHG +A+
Sbjct  271  MC-EKLARYFELSGLPMLVLIGPDGKTLNDDIADIIDEHGPDAW  313


 Score = 68.6 bits (166),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 38/82 (46%), Positives = 51/82 (62%), Gaps = 6/82 (7%)
 Frame = +3

Query  294  NFEVVFVSADEDEESFKEYFGKMPWTAVPFSDSVTRERLDALFTVRG-IPHLVILDE--S  464
            +FE+V VS D+ EESF  +     W AVPFSDS  R  L A F   G +P LV++ E  +
Sbjct  589  SFEIVLVSCDDGEESFDAHLA---WHAVPFSDSERRRALVARFNAAGEVPRLVVVLEATT  645

Query  465  GKVTTEDGVDIVLEHGVEAYPF  530
            G+  TE GV+++ EHG + YPF
Sbjct  646  GEAVTECGVELIAEHGADTYPF  667



>gb|AGH33853.1| PDI4 [Cucumis melo]
Length=487

 Score =   169 bits (427),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 78/147 (53%), Positives = 107/147 (73%), Gaps = 5/147 (3%)
 Frame = +3

Query  105  HDLRSILCSSDRDFLIRNSGHQV-KVDDLKGKKIGIYFSASWCGPCHRFTPNLATVYNEL  281
            HD+ S+L S  RDFLIRN+G QV K+  L GK++G+YFSA WC PC  FTP L+  Y EL
Sbjct  7    HDISSLLSSERRDFLIRNNGDQVVKISSLIGKRVGLYFSAGWCPPCRLFTPKLSEFYKEL  66

Query  282  LPKG----NFEVVFVSADEDEESFKEYFGKMPWTAVPFSDSVTRERLDALFTVRGIPHLV  449
            L       +FE++F+S+D D  SFK YF KMPW ++PF D  T+++L  LF +R IP+LV
Sbjct  67   LANNSKNNDFEIIFISSDRDALSFKAYFSKMPWLSIPFDDLETQKKLKILFQLRSIPYLV  126

Query  450  ILDESGKVTTEDGVDIVLEHGVEAYPF  530
            ++D +GKV+++DGV++V E GV+AYPF
Sbjct  127  VIDGNGKVSSDDGVNLVKEFGVDAYPF  153


 Score =   110 bits (276),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 65/161 (40%), Positives = 95/161 (59%), Gaps = 6/161 (4%)
 Frame = +3

Query  63   ERKASSMA---EQNGDAHDLRSILCSSDRDFLIRNSGHQVKVDDLKGKKIGIYFSASWCG  233
            +RK   +A   E   +   + S+L S+ R++L+ N G Q+ V  L+GK IG+YFS     
Sbjct  156  DRKKQLLAQKEEAKKNTQTITSVLASASRNYLVSNDGKQIPVSKLEGKLIGLYFSLPGHE  215

Query  234  PCHRFTPNLATVYNELLPKG-NFEVVFVSADEDEESFKEY-FGKMPWTAVPFSDSVTRER  407
             C  FTP L+ VYN+L  K  NFE+VFVS +E++E   +  F  MPW A+PF D    ++
Sbjct  216  HCEDFTPKLSEVYNKLKKKDENFEIVFVSLEEEDEDLFDEAFESMPWLALPFKDEKC-QK  274

Query  408  LDALFTVRGIPHLVILDESGKVTTEDGVDIVLEHGVEAYPF  530
            L   F V  IP LVI  + G+    + VD++ +HG++AYPF
Sbjct  275  LKLYFDVGEIPALVITGQDGRTLNPNAVDLIKQHGIDAYPF  315



>ref|XP_002525368.1| nucleoredoxin, putative [Ricinus communis]
 gb|EEF37006.1| nucleoredoxin, putative [Ricinus communis]
Length=553

 Score =   169 bits (427),  Expect = 6e-46, Method: Compositional matrix adjust.
 Identities = 78/129 (60%), Positives = 94/129 (73%), Gaps = 0/129 (0%)
 Frame = +3

Query  144  FLIRNSGHQVKVDDLKGKKIGIYFSASWCGPCHRFTPNLATVYNELLPKGNFEVVFVSAD  323
            FLIR++G QVK+ +L GK +G+YFS SWCGPC  FTPNL  VY EL  KG+FEVVF+S+D
Sbjct  24   FLIRSNGDQVKISNLVGKIVGLYFSGSWCGPCRHFTPNLVQVYEELSLKGDFEVVFISSD  83

Query  324  EDEESFKEYFGKMPWTAVPFSDSVTRERLDALFTVRGIPHLVILDESGKVTTEDGVDIVL  503
             D ESF  YF KMPW A+PFSD  T + L  LF VRGIP+LV LD  GKV+ + GV  + 
Sbjct  84   RDAESFDAYFSKMPWLAIPFSDQETCKHLKDLFKVRGIPNLVFLDADGKVSCDQGVRFIR  143

Query  504  EHGVEAYPF  530
            E+G E YPF
Sbjct  144  EYGAEGYPF  152


 Score =   129 bits (325),  Expect = 6e-32, Method: Compositional matrix adjust.
 Identities = 60/145 (41%), Positives = 90/145 (62%), Gaps = 2/145 (1%)
 Frame = +3

Query  99   DAHDLRSILCSSDRDFLIRNSGHQVKVDDLKGKKIGIYFSASWCGPCHRFTPNLATVYNE  278
            +A  L S+L   D+DF+I  SG +V V +L GK I +YFSA WC PC  F P L   Y+E
Sbjct  329  EAQTLESVLVHGDKDFVIEESGSKVPVSELVGKNILLYFSAKWCPPCRAFLPKLIEAYHE  388

Query  279  LLPKGN-FEVVFVSADEDEESFKEYFGKMPWTAVPFSDSVTRERLDALFTVRGIPHLVIL  455
            +  K N FE++F+S+D D+ SF E++ +MPW A+PF D   +  L   F ++GIP  + +
Sbjct  389  IKAKDNAFEIIFISSDRDQSSFDEFYTEMPWLALPFGDD-RKTILQRKFKIKGIPAAIAI  447

Query  456  DESGKVTTEDGVDIVLEHGVEAYPF  530
              +GK  T++  + +  +G +AYPF
Sbjct  448  SPTGKTLTKEAREHITAYGADAYPF  472


 Score =   125 bits (313),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 68/156 (44%), Positives = 93/156 (60%), Gaps = 5/156 (3%)
 Frame = +3

Query  66   RKASSMAEQNGDAHDLRSILCSSDRDFLIRNSGHQVKVDDLKGKKIGIYFSASWCGPCHR  245
            R+    A++N     L SIL SS RDFLI   G ++ V +L+GK +G+YFS      C  
Sbjct  161  RQEEENAKKN---QTLSSILVSSSRDFLISKDGTKIPVSELEGKMVGLYFSVHSHRLCLD  217

Query  246  FTPNLATVYNELLPKG-NFEVVFVSADEDEESFKEYFGKMPWTAVPFSDSVTRERLDALF  422
            FTP L  VY +L  KG  FEVV +S D DE +FK+    MPW A+PF D  +RERL   F
Sbjct  218  FTPRLEEVYKKLKEKGEKFEVVLISMDYDENNFKQGLETMPWLALPFEDK-SRERLARYF  276

Query  423  TVRGIPHLVILDESGKVTTEDGVDIVLEHGVEAYPF  530
             +  +P LVI+ E GK   ++  +++  HG++AYPF
Sbjct  277  ELSALPTLVIIGEDGKTLNKNVAELIEGHGIQAYPF  312



>dbj|BAJ87919.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=577

 Score =   169 bits (428),  Expect = 7e-46, Method: Compositional matrix adjust.
 Identities = 80/134 (60%), Positives = 99/134 (74%), Gaps = 2/134 (1%)
 Frame = +3

Query  135  DRDFLIRNSGHQVKVDDLKGKKIGIYFSASWCGPCHRFTPNLATVYNELLPKG-NFEVVF  311
            DRD+L+RNSG QVK+  ++   + +YFSASWC PC RFTP L   Y EL   G +FEVVF
Sbjct  20   DRDYLVRNSGEQVKISGIEADTVALYFSASWCPPCRRFTPKLIEAYKELTSLGKSFEVVF  79

Query  312  VSADEDEESFKEYFGKMPWTAVPFSDSVTRERLDALFTVRGIPHLVILD-ESGKVTTEDG  488
            VS D+DEE+F  YF KMPW AVPFSDS  R+ LD  F V GIPHLV LD ++G+V T++G
Sbjct  80   VSGDQDEEAFNAYFAKMPWLAVPFSDSEGRKNLDERFEVNGIPHLVFLDAKTGEVLTDEG  139

Query  489  VDIVLEHGVEAYPF  530
            V+ V E+G+EAYPF
Sbjct  140  VEFVSEYGIEAYPF  153


 Score =   127 bits (319),  Expect = 5e-31, Method: Compositional matrix adjust.
 Identities = 61/144 (42%), Positives = 86/144 (60%), Gaps = 2/144 (1%)
 Frame = +3

Query  102  AHDLRSILCSSDRDFLIRNSGHQVKVDDLKGKKIGIYFSASWCGPCHRFTPNLATVYNEL  281
            +  L S+L + D DF+I   G +V V +L GK + +YFSA WCGPC  F P L  VYN++
Sbjct  334  SQTLESLLVTGDLDFVIGKDGAKVPVAELVGKTVLLYFSAKWCGPCRAFLPTLVDVYNKI  393

Query  282  LPK-GNFEVVFVSADEDEESFKEYFGKMPWTAVPFSDSVTRERLDALFTVRGIPHLVILD  458
              K  +FE+VF+S+D+D+ SF ++F  MPW A+P  D   +  L   F +RGIP LV + 
Sbjct  394  KEKNSDFEIVFISSDKDQSSFDDFFSGMPWLAIPLEDE-RKADLKKRFKIRGIPSLVAIG  452

Query  459  ESGKVTTEDGVDIVLEHGVEAYPF  530
              GK    D    +  HG +A+PF
Sbjct  453  PDGKTVNTDAKTSLAVHGADAFPF  476


 Score =   100 bits (249),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 58/164 (35%), Positives = 92/164 (56%), Gaps = 4/164 (2%)
 Frame = +3

Query  36   FQFSKRKGEERKASSMAEQNGDAHDLRSILCSSDRDFLIRNSGHQVKVDDLKGKKIGIYF  215
            + F+  +  E K    A +  D   + S+L +++R ++I N+G +V + DL+GK +GI F
Sbjct  151  YPFTTERINELKEQEKAAK--DNQTIHSVLGTANRAYVISNTGKKVPIVDLEGKYVGICF  208

Query  216  SASWCGPCHRFTPNLATVYNELLPKG-NFEVVFVSADEDEESFKEYFGKMPWTAVPFSDS  392
              +   P   FT  LA +Y +L   G  FEVV VS D DEESF   F  MPW A+P  D 
Sbjct  209  VVNGYPPVEEFTSVLAKIYAKLKEVGEKFEVVAVSLDSDEESFNTSFSSMPWLAIPQGDK  268

Query  393  VTRERLDALFTVRGIPHLVILDESGKVTTEDGVDIVLEHGVEAY  524
            +  ++L + F +  +P LV++   GK  + +   I+ EHG++A+
Sbjct  269  MC-QKLVSYFELSDLPTLVLIGPDGKTLSSNIAGIIDEHGLDAW  311



>gb|KDP26596.1| hypothetical protein JCGZ_17754 [Jatropha curcas]
Length=567

 Score =   167 bits (422),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 74/129 (57%), Positives = 95/129 (74%), Gaps = 0/129 (0%)
 Frame = +3

Query  144  FLIRNSGHQVKVDDLKGKKIGIYFSASWCGPCHRFTPNLATVYNELLPKGNFEVVFVSAD  323
            F+IR++G Q+++  L GK +G+YFS SWCGPC  FTP L   Y EL  KG+FEVVF+S+D
Sbjct  24   FVIRSNGDQIRISSLVGKIVGLYFSGSWCGPCRHFTPILVEAYEELSSKGDFEVVFISSD  83

Query  324  EDEESFKEYFGKMPWTAVPFSDSVTRERLDALFTVRGIPHLVILDESGKVTTEDGVDIVL  503
             D+ESF  YF KMPW A+PF D  T +RL  LF VRGIP+LV+LD +GKV+ + GVDI+ 
Sbjct  84   RDDESFNGYFSKMPWLAIPFPDQGTLKRLKELFKVRGIPNLVVLDANGKVSCDRGVDIIR  143

Query  504  EHGVEAYPF  530
             +G E YPF
Sbjct  144  NYGAEGYPF  152


 Score =   136 bits (342),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 68/149 (46%), Positives = 94/149 (63%), Gaps = 2/149 (1%)
 Frame = +3

Query  87   EQNGDAHDLRSILCSSDRDFLIRNSGHQVKVDDLKGKKIGIYFSASWCGPCHRFTPNLAT  266
            E   +   + SIL SS RD+LI N G ++ V DL+GK +G+YFSA     C  FTP L  
Sbjct  165  ENAKNNQTISSILVSSSRDYLISNEGTKIPVSDLQGKMVGLYFSAYPHRLCLEFTPKLVE  224

Query  267  VYNELLPKG-NFEVVFVSADEDEESFKEYFGKMPWTAVPFSDSVTRERLDALFTVRGIPH  443
            +Y +L  KG NFE+V +S D DE+ FK+ F KMPW A+PF D   RE+L   F +  +P 
Sbjct  225  IYKKLKEKGENFEIVLISIDYDEKDFKQSFEKMPWLALPFQDK-GREKLARYFELSALPS  283

Query  444  LVILDESGKVTTEDGVDIVLEHGVEAYPF  530
            LVI+ E GK   ++  +++ +HG+EAYPF
Sbjct  284  LVIIGEDGKTLNQNVAELIEDHGIEAYPF  312


 Score =   128 bits (322),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 58/145 (40%), Positives = 88/145 (61%), Gaps = 2/145 (1%)
 Frame = +3

Query  99   DAHDLRSILCSSDRDFLIRNSGHQVKVDDLKGKKIGIYFSASWCGPCHRFTPNLATVYNE  278
            +A  L S+L   D+DF+I  +G +V V +L G+ + +YFSA WC PC  F P L   Y E
Sbjct  329  EAQTLESVLVHGDKDFVIEKTGSKVPVSELAGRNVLLYFSAKWCPPCRAFLPKLIEAYKE  388

Query  279  LLPK-GNFEVVFVSADEDEESFKEYFGKMPWTAVPFSDSVTRERLDALFTVRGIPHLVIL  455
            +  K   FE++FVS+D D+ SF+E++  MPW A+PF D   +  L   F ++GIP  + +
Sbjct  389  IKEKDSRFEIIFVSSDRDQSSFEEFYSGMPWLALPFGDE-RKTILQKKFKIKGIPAAIAI  447

Query  456  DESGKVTTEDGVDIVLEHGVEAYPF  530
              SGK  T++  + +  +G +AYPF
Sbjct  448  SSSGKTVTKEAKEHLTAYGADAYPF  472



>gb|AAU04768.1| protein disulfide isomerase (PDI)-like protein 4 [Cucumis melo]
Length=486

 Score =   165 bits (418),  Expect = 6e-45, Method: Compositional matrix adjust.
 Identities = 75/146 (51%), Positives = 104/146 (71%), Gaps = 4/146 (3%)
 Frame = +3

Query  105  HDLRSILCSSDRDFLIRNSGHQVKVDDLKGKKIGIYFSASWCGPCHRFTPNLATVYNELL  284
            HD+ S+L S  RDFLIRN+G QVK+  L GK++G+YFSA WC PC  FTP L+  Y ELL
Sbjct  7    HDISSLLSSERRDFLIRNNGDQVKISSLIGKRVGLYFSAGWCPPCRLFTPKLSEFYKELL  66

Query  285  PKG----NFEVVFVSADEDEESFKEYFGKMPWTAVPFSDSVTRERLDALFTVRGIPHLVI  452
                   +FE++F+S+D D  SFK YF KMPW ++PF D  T+++L  LF ++ IP+LV 
Sbjct  67   ANNSKNNDFEIIFISSDRDALSFKAYFSKMPWLSIPFDDLETQKKLKILFQLKSIPYLVG  126

Query  453  LDESGKVTTEDGVDIVLEHGVEAYPF  530
            +D +GK +++DGV++V E G +AYPF
Sbjct  127  IDGNGKSSSDDGVNLVKEFGSDAYPF  152


 Score =   110 bits (276),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 65/161 (40%), Positives = 95/161 (59%), Gaps = 6/161 (4%)
 Frame = +3

Query  63   ERKASSMA---EQNGDAHDLRSILCSSDRDFLIRNSGHQVKVDDLKGKKIGIYFSASWCG  233
            +RK   +A   E   +   + S+L S+ R++L+ N G Q+ V  L+GK IG+YFS     
Sbjct  155  DRKKQLLAQKEEAKKNTQTITSVLASASRNYLVSNDGKQIPVSKLEGKLIGLYFSLPGHE  214

Query  234  PCHRFTPNLATVYNELLPKG-NFEVVFVSADEDEESFKEY-FGKMPWTAVPFSDSVTRER  407
             C  FTP L+ VYN+L  K  NFE+VFVS +E++E   +  F  MPW A+PF D    ++
Sbjct  215  HCEDFTPKLSEVYNKLKKKDENFEIVFVSLEEEDEDLFDEAFESMPWLALPFKDEKC-QK  273

Query  408  LDALFTVRGIPHLVILDESGKVTTEDGVDIVLEHGVEAYPF  530
            L   F V  IP LVI  + G+    + VD++ +HG++AYPF
Sbjct  274  LKLYFDVGEIPALVITGQDGRTLNPNAVDLIKQHGIDAYPF  314



>ref|XP_010256393.1| PREDICTED: uncharacterized protein LOC104596799 [Nelumbo nucifera]
Length=1312

 Score =   169 bits (427),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 80/159 (50%), Positives = 110/159 (69%), Gaps = 2/159 (1%)
 Frame = +3

Query  60   EERKASSMA--EQNGDAHDLRSILCSSDRDFLIRNSGHQVKVDDLKGKKIGIYFSASWCG  233
            E  KA  +A  +  GD H+L S+LC+  RDFL++N+G QV+V +  GK +G+YF+  W  
Sbjct  825  ERTKAEDVAIGQTEGDFHNLTSLLCTEQRDFLVQNNGKQVRVQEFMGKFVGLYFAGWWHS  884

Query  234  PCHRFTPNLATVYNELLPKGNFEVVFVSADEDEESFKEYFGKMPWTAVPFSDSVTRERLD  413
              H FT  L   YN+L  K +FEV+FVS+D+D ESF ++F KMPW AVPFSD++TR+RL 
Sbjct  885  AVHWFTQILVETYNDLYHKNDFEVIFVSSDKDNESFIQHFSKMPWFAVPFSDAMTRDRLH  944

Query  414  ALFTVRGIPHLVILDESGKVTTEDGVDIVLEHGVEAYPF  530
             +F V  IP LVILD+ G+V++ +G  IV  HGV+ YPF
Sbjct  945  EVFKVNNIPSLVILDKKGRVSSYNGAWIVRVHGVQGYPF  983


 Score =   120 bits (300),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 62/152 (41%), Positives = 89/152 (59%), Gaps = 4/152 (3%)
 Frame = +3

Query  81    MAEQNGDAHDLRSILCSSDRDFLIRNSGHQVKVDDLKGKKIGIYFSASWCGPCHRFTPNL  260
             M   N +   L SIL S ++DF+IRN   ++ V +L GK I  YFSA W  PC      L
Sbjct  1153  MGNLNPNQQSLESILVSGEKDFVIRNDDARIHVSELVGKSILFYFSAQWFPPCRVSLQKL  1212

Query  261   ATVYNELLPKGN-FEVVFVSADEDEESFKEYFGKMPWTAVPFSDSVTRER-LDALFTVRG  434
                Y+E+  K + FEV+++S D D  SFKE+F  MPW A+P+ D   RE+ L   F + G
Sbjct  1213  IKAYHEIKHKDDEFEVIYISYDTDLASFKEFFSGMPWLALPYGDD--REKLLSRKFKIEG  1270

Query  435   IPHLVILDESGKVTTEDGVDIVLEHGVEAYPF  530
             IP +V + ++G+  T++  D ++ HG  AYPF
Sbjct  1271  IPTVVAIGQTGRTITKNAWDHLMVHGANAYPF  1302


 Score = 92.0 bits (227),  Expect = 7e-18, Method: Compositional matrix adjust.
 Identities = 52/143 (36%), Positives = 81/143 (57%), Gaps = 3/143 (2%)
 Frame = +3

Query  105   HDLRSILCSSDRDFLIRNSGHQVKVDDLKGKKIGIYFSASWCGPCHRFTPNLATVYNELL  284
               L SI+ +S  D LI N  ++V + +L+ K +G+YF+ +    C  FT  L  VY EL 
Sbjct  1002  QSLLSIM-TSISDHLISNERNKVPISELQQKVVGMYFTTTSEVECLDFTAKLVEVYKELK  1060

Query  285   PKG-NFEVVFVSADEDEESFKEYFGKMPWTAVPFSDSVTRERLDALFTVRGIPHLVILDE  461
              KG +FEV+++S    +ES++  F  MPW A PF D  + ++L     +  +P LV+L  
Sbjct  1061  NKGESFEVIWISLGNSQESYENGFRNMPWLAFPFEDK-SYKKLYPYLELTTLPTLVVLGP  1119

Query  462   SGKVTTEDGVDIVLEHGVEAYPF  530
             +G+    + VD+V E+   AYPF
Sbjct  1120  NGETLNSNAVDLVREYAALAYPF  1142



>gb|ABR18079.1| unknown [Picea sitchensis]
Length=487

 Score =   160 bits (404),  Expect = 6e-43, Method: Compositional matrix adjust.
 Identities = 76/166 (46%), Positives = 111/166 (67%), Gaps = 4/166 (2%)
 Frame = +3

Query  36   FQFSKRKGEERKASSMAEQNGDAHDLRSILCSSDRDFLIRNSGHQVKVDDLKGKKIGIYF  215
            + F+  + +E KA   A +   A  + S+L S +RDF++ + G QV V +L GK +G+YF
Sbjct  55   YPFTAERIDELKAKEEALRA--AQTVESLLLSDERDFVLGHEGTQVPVAELAGKTVGLYF  112

Query  216  SASWCGPCHRFTPNLATVYNELLPKGN-FEVVFVSADEDEESFKEYFGKMPWTAVPFSDS  392
            SA WCGPC  FTP L  +YNELL KG  FE+VF+S D++E++F+EY+  MPW A+PF+D+
Sbjct  113  SAHWCGPCRSFTPQLVEIYNELLKKGEAFEIVFLSRDKEEKAFEEYYASMPWLALPFADN  172

Query  393  VTRERLDALFTVRGIPHLVILDESGKVTTEDGVDIVLEHGVEAYPF  530
             T+++L   F + GIP L+IL   GK    D V ++ E+G+ AYPF
Sbjct  173  -TQKKLSRYFRIEGIPTLIILGPDGKTIRNDAVGLIREYGIRAYPF  217


 Score =   152 bits (385),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 73/166 (44%), Positives = 111/166 (67%), Gaps = 4/166 (2%)
 Frame = +3

Query  36   FQFSKRKGEERKASSMAEQNGDAHDLRSILCSSDRDFLIRNSGHQVKVDDLKGKKIGIYF  215
            + F+K + ++ +A   A++  +A  L S+L S +R+F+I++ G QV V +L GK + +YF
Sbjct  215  YPFTKERLDDLEAEEKAKR--EAQTLESVLVSDERNFVIKHGGAQVLVSELVGKTVALYF  272

Query  216  SASWCGPCHRFTPNLATVYNELLPKGN-FEVVFVSADEDEESFKEYFGKMPWTAVPFSDS  392
            SA WC PC  FTP L  VYNEL  +G  FE+VF+S+D+D+E+F++Y+  MPW A+PF D 
Sbjct  273  SAHWCPPCRGFTPKLIQVYNELKERGEAFEIVFISSDKDQEAFEDYYKSMPWLALPFGDK  332

Query  393  VTRERLDALFTVRGIPHLVILDESGKVTTEDGVDIVLEHGVEAYPF  530
             T++ L  +F VRGIP L+++   GK  T++    V  HG +AYPF
Sbjct  333  -TKKDLSRIFRVRGIPSLIVVGPDGKTLTDNARGAVSTHGAKAYPF  377


 Score = 75.5 bits (184),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 33/57 (58%), Positives = 43/57 (75%), Gaps = 0/57 (0%)
 Frame = +3

Query  360  MPWTAVPFSDSVTRERLDALFTVRGIPHLVILDESGKVTTEDGVDIVLEHGVEAYPF  530
            MPW A+PFSD  TR++LD +F V GIP LV LD+ G+  T +GV+ + E+GVEAYPF
Sbjct  1    MPWLALPFSDENTRKKLDQVFKVDGIPCLVFLDKEGRAITTEGVETIGEYGVEAYPF  57



>ref|XP_010431903.1| PREDICTED: probable nucleoredoxin 1 [Camelina sativa]
Length=178

 Score =   150 bits (380),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 69/108 (64%), Positives = 81/108 (75%), Gaps = 0/108 (0%)
 Frame = +3

Query  207  IYFSASWCGPCHRFTPNLATVYNELLPKGNFEVVFVSADEDEESFKEYFGKMPWTAVPFS  386
            I FSA+WCGPC RFTP L  VYNEL PK  FEVVFVS DEDEESF +YF KMPW  VPF+
Sbjct  6    IVFSAAWCGPCQRFTPQLVEVYNELAPKVGFEVVFVSGDEDEESFGDYFSKMPWLTVPFA  65

Query  387  DSVTRERLDALFTVRGIPHLVILDESGKVTTEDGVDIVLEHGVEAYPF  530
            DS T ERLD LF V GIP+L+I+D+ GK+   +GV ++  +G  AYPF
Sbjct  66   DSETHERLDGLFKVTGIPNLMIVDDHGKLVNNNGVGVIRSYGAGAYPF  113



>ref|XP_010470488.1| PREDICTED: probable nucleoredoxin 1 isoform X2 [Camelina sativa]
Length=203

 Score =   150 bits (380),  Expect = 5e-42, Method: Compositional matrix adjust.
 Identities = 72/129 (56%), Positives = 87/129 (67%), Gaps = 0/129 (0%)
 Frame = +3

Query  144  FLIRNSGHQVKVDDLKGKKIGIYFSASWCGPCHRFTPNLATVYNELLPKGNFEVVFVSAD  323
            F +   G  + V     +K  I FSA+WCGPC RFTP L  VYNEL PK  FEVVFVS D
Sbjct  40   FSLLRRGISLFVTTANREKDWIVFSAAWCGPCQRFTPQLVEVYNELAPKVGFEVVFVSGD  99

Query  324  EDEESFKEYFGKMPWTAVPFSDSVTRERLDALFTVRGIPHLVILDESGKVTTEDGVDIVL  503
            EDEESF +YF KMPW  VPF+DS T +RLD LF V GIP+LVI+D+ GK+   +G  ++ 
Sbjct  100  EDEESFGDYFSKMPWLTVPFADSETHDRLDGLFKVTGIPNLVIVDDHGKLVNNNGFGVIR  159

Query  504  EHGVEAYPF  530
             +G  AYPF
Sbjct  160  SYGAGAYPF  168



>ref|XP_010470487.1| PREDICTED: probable nucleoredoxin 1 isoform X1 [Camelina sativa]
Length=232

 Score =   150 bits (378),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 72/129 (56%), Positives = 87/129 (67%), Gaps = 0/129 (0%)
 Frame = +3

Query  144  FLIRNSGHQVKVDDLKGKKIGIYFSASWCGPCHRFTPNLATVYNELLPKGNFEVVFVSAD  323
            F +   G  + V     +K  I FSA+WCGPC RFTP L  VYNEL PK  FEVVFVS D
Sbjct  40   FSLLRRGISLFVTTANREKDWIVFSAAWCGPCQRFTPQLVEVYNELAPKVGFEVVFVSGD  99

Query  324  EDEESFKEYFGKMPWTAVPFSDSVTRERLDALFTVRGIPHLVILDESGKVTTEDGVDIVL  503
            EDEESF +YF KMPW  VPF+DS T +RLD LF V GIP+LVI+D+ GK+   +G  ++ 
Sbjct  100  EDEESFGDYFSKMPWLTVPFADSETHDRLDGLFKVTGIPNLVIVDDHGKLVNNNGFGVIR  159

Query  504  EHGVEAYPF  530
             +G  AYPF
Sbjct  160  SYGAGAYPF  168



>ref|NP_001130856.1| hypothetical protein [Zea mays]
 gb|ACF79225.1| unknown [Zea mays]
 gb|ACF87677.1| unknown [Zea mays]
 gb|ACN29161.1| unknown [Zea mays]
 tpg|DAA45730.1| TPA: hypothetical protein ZEAMMB73_073655 [Zea mays]
Length=580

 Score =   150 bits (380),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 76/139 (55%), Positives = 95/139 (68%), Gaps = 2/139 (1%)
 Frame = +3

Query  120  ILCSSDRDFLIRNSGHQVKVDDLKGKKIGIYFSASWCGPCHRFTPNLATVYNELLPKG-N  296
            IL + DRDFL+RNSG QVK+  ++   + IYFS SW  P   FTP L  VY +L  +G +
Sbjct  15   ILVTRDRDFLVRNSGEQVKISSIEASPVAIYFSNSWFPPSRWFTPKLIQVYKQLASEGKS  74

Query  297  FEVVFVSADEDEESFKEYFGKMPWTAVPFSDSVTRERLDALFTVRGIPHLVILD-ESGKV  473
            FEV+F   D  E++F EYF KMPW A+PFSD   RE LD  F V   PHLVILD ++G+V
Sbjct  75   FEVIFAWGDLKEKTFNEYFAKMPWLALPFSDIERREALDIRFKVTDTPHLVILDAKTGEV  134

Query  474  TTEDGVDIVLEHGVEAYPF  530
             T+DGV IV E+GV+AYPF
Sbjct  135  YTKDGVRIVSEYGVDAYPF  153


 Score =   123 bits (308),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 61/144 (42%), Positives = 86/144 (60%), Gaps = 2/144 (1%)
 Frame = +3

Query  102  AHDLRSILCSSDRDFLIRNSGHQVKVDDLKGKKIGIYFSASWCGPCHRFTPNLATVYNEL  281
               L S+L S   DF+I   G +V V +L GK + +YFS+ WCGP   F P L   Y+++
Sbjct  334  TQTLESLLISGHLDFVIGKDGVKVPVSELVGKTVLLYFSSKWCGPSRGFLPTLVEAYSKI  393

Query  282  LPK-GNFEVVFVSADEDEESFKEYFGKMPWTAVPFSDSVTRERLDALFTVRGIPHLVILD  458
              K  +FEVVF+S D D+ SF EYF +MPW AVP+ D  T   L   F  RG P LV++ 
Sbjct  394  KEKNSDFEVVFISHDRDQRSFDEYFSEMPWLAVPWEDERTAP-LKTTFKARGFPILVVIG  452

Query  459  ESGKVTTEDGVDIVLEHGVEAYPF  530
             +GK  + D  ++++ HG +A+PF
Sbjct  453  PNGKTVSWDATELLVVHGADAFPF  476


 Score = 89.4 bits (220),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 52/146 (36%), Positives = 78/146 (53%), Gaps = 5/146 (3%)
 Frame = +3

Query  105  HDLRSILCSSDRDFLIRNSGHQVKVDDLKGKKIGIYFSASWCGPCHRFTPNLATVYNELL  284
              ++ +L +S RD+LI N G +V + +L+GK +G++F      P   F   LA +Y +L 
Sbjct  172  QTIQIVLGTSTRDYLISNKGDKVPISELEGKYVGLFFVGVGYPPFIEFIDLLAKIYEKLK  231

Query  285  PKG-NFEVVFVSADEDEESFKEYFGKMPWTAVPFSDSVTRERLDALFTVRGIPHLVILDE  461
              G  FEVV VS   +E SF E F KMPW A+P  D+     L   F    +P LV++  
Sbjct  232  EVGEKFEVVAVSIYSEESSFNESFAKMPWLAIPHGDNKCL-TLTRYFGFMSLPTLVLIGP  290

Query  462  SGKVTTEDGVDIVLEHGV---EAYPF  530
             GK    +  +I+++HG    E +PF
Sbjct  291  DGKTLNNNVAEIIIDHGFDVWEGFPF  316



>ref|XP_006855862.1| hypothetical protein AMTR_s00037p00109800 [Amborella trichopoda]
 gb|ERN17329.1| hypothetical protein AMTR_s00037p00109800 [Amborella trichopoda]
Length=424

 Score =   147 bits (372),  Expect = 8e-39, Method: Compositional matrix adjust.
 Identities = 67/142 (47%), Positives = 98/142 (69%), Gaps = 1/142 (1%)
 Frame = +3

Query  108  DLRSILCSSDRDFLIRNSGHQVKVDDLKGKKIGIYFSASWCGPCHRFTPNLATVYNELLP  287
            +L+S+L S +RDFLI  +G QVKV++L G  +G+YF+A+W   C  FTP LA+VY +L  
Sbjct  22   NLKSLLSSDERDFLITPTGTQVKVEELHGMTVGLYFAANWYFQCQNFTPVLASVYEQLKQ  81

Query  288  K-GNFEVVFVSADEDEESFKEYFGKMPWTAVPFSDSVTRERLDALFTVRGIPHLVILDES  464
            +  NFE+VF+S DED+ SF +Y   MPW A+PFSD  T++ L+ +F V GIP L+ILD+ 
Sbjct  82   RDANFEIVFISCDEDQSSFDKYHATMPWLAIPFSDLKTKKSLNDMFQVEGIPCLIILDQH  141

Query  465  GKVTTEDGVDIVLEHGVEAYPF  530
                  + V+++  +GV A+PF
Sbjct  142  AHTVQTEAVELIYRYGVWAFPF  163


 Score =   127 bits (319),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 67/169 (40%), Positives = 99/169 (59%), Gaps = 10/169 (6%)
 Frame = +3

Query  36   FQFSKRKGEERKASSMAEQNGDAHDLRSILCSSDRDFLIRNSGHQVKVDDLKGKKIGIYF  215
            F F+K +  E ++   A+   ++  L +++    RDF+I +   QV +  L GK +G+YF
Sbjct  161  FPFTKERVVELESEEKAKH--ESQTLENLISIDGRDFVIGHDNEQVPISSLVGKTVGLYF  218

Query  216  SASWCGPCHRFTPNLATVYNELLPKG-NFEVVFVSADEDEESFKEYFGKMPWTAVPFSDS  392
            SA WC PC +FTP L ++Y+       +FE+VFVS D DE  F E F  MPW A+PF D 
Sbjct  219  SAQWCPPCVKFTPRLVSIYDTHKQNNEDFEIVFVSCDRDEAGFLECFKPMPWLALPFGD-  277

Query  393  VTRERLDAL---FTVRGIPHLVILDESGKVTTEDGVDIVLEHGVEAYPF  530
               ER+  L   F ++GIP LVI+  +GK  T +G +++  H  +AYPF
Sbjct  278  ---ERIKGLSRYFNIQGIPALVIIGPNGKTVTREGRNLINLHMEKAYPF  323



>ref|XP_010266892.1| PREDICTED: probable nucleoredoxin 2 [Nelumbo nucifera]
Length=429

 Score =   147 bits (370),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 73/142 (51%), Positives = 98/142 (69%), Gaps = 4/142 (3%)
 Frame = +3

Query  117  SILCSSDRDFLIRNSGHQVKVDDLKGKKIGIYFSASWCGPCHRFTPNLATVYNELLPKG-  293
            S+L S DRDFL+ ++G QVKV DL+GK +GIYFSA+W  PC  FTP LA VY +L  +G 
Sbjct  35   SLLASKDRDFLLSSTGDQVKVSDLEGKVVGIYFSANWYQPCRNFTPVLAGVYEQLKDRGC  94

Query  294  NFEVVFVSADEDEESFKEYFGKMPWTAVPFSDSVTRERLDALFTVRGIPHLVIL---DES  464
             FEVVFVS+DED ++F  Y   MPW A+PFSD  +++ L+  F V GIP L+IL   D  
Sbjct  95   GFEVVFVSSDEDSDAFASYRACMPWLAIPFSDLESKKALNRRFQVEGIPCLIILQPDDNE  154

Query  465  GKVTTEDGVDIVLEHGVEAYPF  530
             + T  +GV+++  +GV A+PF
Sbjct  155  DESTLREGVELIYRYGVRAFPF  176


 Score =   120 bits (300),  Expect = 9e-29, Method: Compositional matrix adjust.
 Identities = 64/155 (41%), Positives = 91/155 (59%), Gaps = 14/155 (9%)
 Frame = +3

Query  105  HDLRSILCSSDRDFLIRNS-GHQVKVDDLKGKKIGIYFSASWCGPCHRFTPNLATVYNEL  281
              +  +L + +R FL+  S   QV+V+ L G+ IG+YFSA WC PC RFTP L ++Y+++
Sbjct  195  QTITKLLINHNRSFLLSQSILKQVEVESLVGRTIGLYFSAQWCLPCLRFTPKLISIYHKI  254

Query  282  L------------PKGNFEVVFVSADEDEESFKEYFGKMPWTAVPFSDSVTRERLDALFT  425
                          +  FE+VFVS+D D  +F  YFG MPW A+PF D  T + L   F 
Sbjct  255  KQVIVEKKRAADSKEEGFEIVFVSSDRDRAAFDSYFGTMPWLALPFGDP-TIKNLTRYFD  313

Query  426  VRGIPHLVILDESGKVTTEDGVDIVLEHGVEAYPF  530
            V+GIP LVIL   GK  T+ G +++  +  +AYPF
Sbjct  314  VQGIPCLVILGPDGKTLTKHGRNLINLYQEKAYPF  348



>ref|XP_011083440.1| PREDICTED: probable nucleoredoxin 2 [Sesamum indicum]
Length=432

 Score =   146 bits (368),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 76/147 (52%), Positives = 95/147 (65%), Gaps = 4/147 (3%)
 Frame = +3

Query  102  AHDLRSILCSSDRDFLIRNSGHQVKVDDLKGKKIGIYFSASWCGPCHRFTPNLATVYNEL  281
            A  L S+L S DRDFL+  SG QVK+ DL+GK +GIYFSA+W  PCH+FTP LA  Y +L
Sbjct  40   ASRLFSLLASKDRDFLLSPSGSQVKIADLEGKIVGIYFSANWYQPCHKFTPVLANAYEQL  99

Query  282  LPKG-NFEVVFVSADEDEESFKEYFGKMPWTAVPFSDSVTRERLDALFTVRGIPHLVILD  458
                  FE+VFVS+DED  +F +Y   MPW AVPFSD   +  L   F V GIP L+IL 
Sbjct  100  KNSDPGFEIVFVSSDEDVNAFDDYRSSMPWLAVPFSDLELKRALSRRFDVEGIPCLIILQ  159

Query  459  ES---GKVTTEDGVDIVLEHGVEAYPF  530
             +   G     DGVD++  +GV+AYPF
Sbjct  160  PNNCKGDSIVIDGVDLIYRYGVQAYPF  186


 Score =   124 bits (312),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 72/176 (41%), Positives = 102/176 (58%), Gaps = 17/176 (10%)
 Frame = +3

Query  36   FQFSKRKGEERKASSMAEQNGDAHD---LRSILCSSDRDFLIRNS-GHQVKVDDLKGKKI  203
            + F+K + EE     + E+  D H+   LR +L + +RDFLI +    QV V  L GK I
Sbjct  184  YPFTKERVEE-----LLEKEKDKHENQTLRDLLTNHERDFLISHKIPKQVSVASLIGKTI  238

Query  204  GIYFSASWCGPCHRFTPNLATVYNELLPKG-------NFEVVFVSADEDEESFKEYFGKM  362
            G+YFSA WC P  +FTP LA++Y ++  +        +FE+VFVS+D D+ SF  YF  M
Sbjct  239  GLYFSAKWCFPGVKFTPKLASIYQKINQESSLNSHHQDFEIVFVSSDHDQTSFLSYFQTM  298

Query  363  PWTAVPFSDSVTRERLDALFTVRGIPHLVILDESGKVTTEDGVDIVLEHGVEAYPF  530
            PW A+P+ D   +  L   F +RGIP LVIL   GK  T+ G +++  +   AYPF
Sbjct  299  PWLALPYGDPNIKA-LTKHFDIRGIPSLVILGPDGKTVTKQGRNLLNLYQENAYPF  353



>ref|XP_002306954.1| hypothetical protein POPTR_0005s26610g [Populus trichocarpa]
 gb|EEE93950.1| hypothetical protein POPTR_0005s26610g [Populus trichocarpa]
Length=423

 Score =   143 bits (360),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 76/162 (47%), Positives = 103/162 (64%), Gaps = 10/162 (6%)
 Frame = +3

Query  75   SSMAEQNGDAHDLRS-----ILCSSDRDFLIRNSGHQVKVDDLKGKKIGIYFSASWCGPC  239
            +S AE NGD+H + S     +L S DRD+L+   G QVKV DL+GK +G+YFSA+W  PC
Sbjct  12   ASKAEANGDSHRISSSRFSSLLASKDRDYLLSQDGTQVKVSDLEGKVLGLYFSANWYAPC  71

Query  240  HRFTPN-LATVYNELLPKG-NFEVVFVSADEDEESFKEYFGKMPWTAVPFSDSVTRERLD  413
              FT   L   Y +L   G NFE+VFVS+DED ++F  Y   MPW ++PFSD  T++ L+
Sbjct  72   RSFTSQVLIGAYQDLKSNGSNFEIVFVSSDEDLDAFNNYRANMPWLSIPFSDLETKKALN  131

Query  414  ALFTVRGIPHLVIL---DESGKVTTEDGVDIVLEHGVEAYPF  530
            + F V  IP LVIL   D   + T  DGV+++   GV+A+PF
Sbjct  132  SKFDVEAIPCLVILHPKDNKDEATLHDGVELLHRFGVQAFPF  173


 Score =   116 bits (291),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 63/148 (43%), Positives = 88/148 (59%), Gaps = 9/148 (6%)
 Frame = +3

Query  111  LRSILCSSDRDFLIRNSG-HQVKVDDLKGKKIGIYFSASWCGPCHRFTPNLATVYNE---  278
            L ++L   +RD+L+ +    QV V  L GK IG+YFS+ WC P  +FTP L ++Y +   
Sbjct  194  LTNLLICHNRDYLLGHPAPRQVPVASLVGKTIGLYFSSHWCLPGGKFTPKLISIYQKIKQ  253

Query  279  -LLPKGN---FEVVFVSADEDEESFKEYFGKMPWTAVPFSDSVTRERLDALFTVRGIPHL  446
             L+ KGN   FE+VFVS+D D+  F  YF  MPW A+PF D   +  L   F V+GIP L
Sbjct  254  MLVNKGNDDDFEIVFVSSDRDQAEFDSYFNSMPWLALPFGDPANKT-LAKHFDVKGIPCL  312

Query  447  VILDESGKVTTEDGVDIVLEHGVEAYPF  530
            VIL   GK  ++ G +++  +   AYPF
Sbjct  313  VILGPDGKTVSKHGRNLINLYQENAYPF  340



>ref|XP_011003080.1| PREDICTED: probable nucleoredoxin 2 [Populus euphratica]
Length=423

 Score =   143 bits (360),  Expect = 5e-37, Method: Compositional matrix adjust.
 Identities = 76/162 (47%), Positives = 103/162 (64%), Gaps = 10/162 (6%)
 Frame = +3

Query  75   SSMAEQNGDAHDLRS-----ILCSSDRDFLIRNSGHQVKVDDLKGKKIGIYFSASWCGPC  239
            +S AE NGD+H + S     +L S DRD+L+   G QVKV DL+GK +G+YFSA+W  PC
Sbjct  12   ASKAEANGDSHRISSSRFSSLLASKDRDYLLSQDGTQVKVSDLEGKVLGLYFSANWYAPC  71

Query  240  HRFTPN-LATVYNELLPKG-NFEVVFVSADEDEESFKEYFGKMPWTAVPFSDSVTRERLD  413
              FT   L   Y +L   G NFE+VFVS+DED ++F  Y   MPW ++PFSD  T++ L+
Sbjct  72   RSFTSQVLIGAYQDLKSNGSNFEIVFVSSDEDLDAFNNYRANMPWLSIPFSDLETKKALN  131

Query  414  ALFTVRGIPHLVIL---DESGKVTTEDGVDIVLEHGVEAYPF  530
            + F V  IP LVIL   D   + T  DGV+++   GV+A+PF
Sbjct  132  SKFDVEAIPCLVILHPKDNKDEATLHDGVELLHRFGVQAFPF  173


 Score =   118 bits (296),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 64/148 (43%), Positives = 88/148 (59%), Gaps = 9/148 (6%)
 Frame = +3

Query  111  LRSILCSSDRDFLIRNSG-HQVKVDDLKGKKIGIYFSASWCGPCHRFTPNLATVYNE---  278
            L ++L   DRD+L+ +    QV V  L GK IG+YFS+ WC P  +FTP L ++Y +   
Sbjct  194  LTNLLACHDRDYLLGHPAPRQVPVASLVGKTIGLYFSSHWCLPGGKFTPKLISIYQKIKE  253

Query  279  -LLPKGN---FEVVFVSADEDEESFKEYFGKMPWTAVPFSDSVTRERLDALFTVRGIPHL  446
             L+ KGN   FE+VFVS+D D+  F  YF  MPW A+PF D   +  L   F V+GIP L
Sbjct  254  ILVNKGNDDDFEIVFVSSDRDQAEFDSYFNSMPWLALPFGDPANK-TLAKHFDVKGIPCL  312

Query  447  VILDESGKVTTEDGVDIVLEHGVEAYPF  530
            VIL   GK  ++ G +++  +   AYPF
Sbjct  313  VILGPDGKTVSKHGRNLINLYQENAYPF  340



>ref|XP_009620045.1| PREDICTED: probable nucleoredoxin 2 isoform X1 [Nicotiana tomentosiformis]
 ref|XP_009620046.1| PREDICTED: probable nucleoredoxin 2 isoform X2 [Nicotiana tomentosiformis]
Length=442

 Score =   141 bits (356),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 73/148 (49%), Positives = 94/148 (64%), Gaps = 5/148 (3%)
 Frame = +3

Query  102  AHDLRSILCSSDRDFLIRNSGHQVKVDDLKGKKIGIYFSASWCGPCHRFTPNLATVYNEL  281
            A D RSIL S D DFL+ ++G QVKV DL+ K +G+YFSA+W  PC +FT  L  VY +L
Sbjct  49   AEDYRSILASKDSDFLLSSTGAQVKVSDLESKVVGLYFSANWYAPCTKFTDLLINVYEQL  108

Query  282  LPKGN--FEVVFVSADEDEESFKEYFGKMPWTAVPFSDSVTRERLDALFTVRGIPHLVIL  455
                N  FE+VFVS+DED ++F  Y   MPW A+PFSD  TR  L   F V GIP L+IL
Sbjct  109  KDHINPGFEIVFVSSDEDSDAFNTYKSSMPWLAIPFSDLETRRALTRKFDVEGIPCLIIL  168

Query  456  DESGK---VTTEDGVDIVLEHGVEAYPF  530
              +         DGV++V  +GV+A+PF
Sbjct  169  QPNSNKDAAVISDGVELVYRYGVQAFPF  196


 Score =   118 bits (296),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 63/151 (42%), Positives = 86/151 (57%), Gaps = 8/151 (5%)
 Frame = +3

Query  99   DAHDLRSILCSSDRDFLIRNSG-HQVKVDDLKGKKIGIYFSASWCGPCHRFTPNLATVYN  275
            D   L ++L    RD+L+   G  QV V  L GK +G+YFSA WC P  +FTP L +VY 
Sbjct  213  DNQTLSNLLTRDGRDYLLVQPGSKQVPVASLVGKTVGLYFSAQWCIPAFKFTPRLMSVYQ  272

Query  276  ELLPK------GNFEVVFVSADEDEESFKEYFGKMPWTAVPFSDSVTRERLDALFTVRGI  437
            ++  +       +FE+VFVS+D D+  F  YF  MPW AVP+ D  T + L   F +RGI
Sbjct  273  KIKQQLEGKEDEDFEIVFVSSDRDQVQFLTYFETMPWLAVPYDDP-TIKNLAKYFDIRGI  331

Query  438  PHLVILDESGKVTTEDGVDIVLEHGVEAYPF  530
            P LV+L   GK  T+ G  ++  +   AYPF
Sbjct  332  PSLVVLGPDGKTVTKQGRSLINLYKENAYPF  362



>gb|KDP36878.1| hypothetical protein JCGZ_08169 [Jatropha curcas]
Length=418

 Score =   140 bits (353),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 76/167 (46%), Positives = 106/167 (63%), Gaps = 6/167 (4%)
 Frame = +3

Query  48   KRKGEERKA-SSMAEQNGDAH-DLRSILCSSDRDFLIRNSGHQVKVDDLKGKKIGIYFSA  221
            +++ E+RK     A+ NG  H    S+L S DRDFL+ + G Q+KV +L+GK +G+YFSA
Sbjct  2    RKEEEDRKLLVEEAKTNGGPHCRFSSLLASKDRDFLLSSDGTQIKVSELEGKVLGLYFSA  61

Query  222  SWCGPCHRFTPNLATVYNELLPKG-NFEVVFVSADEDEESFKEYFGKMPWTAVPFSDSVT  398
            +W  PC  FT  L   Y EL   G +FEVVFVS+DED E+F +Y   MPW ++PF D  T
Sbjct  62   NWYPPCGSFTQFLVGAYEELKRNGCDFEVVFVSSDEDLEAFNKYRASMPWLSIPFPDLET  121

Query  399  RERLDALFTVRGIPHLVIL---DESGKVTTEDGVDIVLEHGVEAYPF  530
            ++ LD  F + GIP L+IL   D   + T  DGV+++   GV+A+PF
Sbjct  122  KKALDHKFNIEGIPCLIILQPHDYKDEATLHDGVELLYRFGVQAFPF  168


 Score =   117 bits (293),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 62/147 (42%), Positives = 88/147 (60%), Gaps = 8/147 (5%)
 Frame = +3

Query  111  LRSILCSSDRDFLIRNSGH-QVKVDDLKGKKIGIYFSASWCGPCHRFTPNLATVYNELLP  287
            L ++L +  RDFL  +    QV VD L GK IG++FSA WC P  +FTP L ++YN++  
Sbjct  189  LTNLLTNHHRDFLFAHPARKQVAVDSLVGKTIGLFFSAEWCRPGLKFTPKLISIYNKIKQ  248

Query  288  K------GNFEVVFVSADEDEESFKEYFGKMPWTAVPFSDSVTRERLDALFTVRGIPHLV  449
                    +FE+V+VS D D++ F+ YF  MPW A+PF D  T + L   F V+GIP L+
Sbjct  249  MVKQKDDEDFEIVYVSTDRDQQGFESYFSIMPWLALPFGDP-TIKSLAKHFEVQGIPCLI  307

Query  450  ILDESGKVTTEDGVDIVLEHGVEAYPF  530
            IL   GK  T  G +++  +  +AYPF
Sbjct  308  ILGPDGKTITRHGRNLINLYQEKAYPF  334



>ref|XP_007222806.1| hypothetical protein PRUPE_ppa005061mg [Prunus persica]
 gb|EMJ24005.1| hypothetical protein PRUPE_ppa005061mg [Prunus persica]
Length=479

 Score =   140 bits (353),  Expect = 8e-36, Method: Compositional matrix adjust.
 Identities = 70/166 (42%), Positives = 102/166 (61%), Gaps = 4/166 (2%)
 Frame = +3

Query  36   FQFSKRKGEERKASSMAEQNGDAHDLRSILCSSDRDFLIRNSGHQVKVDDLKGKKIGIYF  215
            + F+ +K EE      A++   A  L SIL S DR+F+I   G ++ V DL GK I +YF
Sbjct  215  YPFTPKKFEELIEIEKAKEK--AQTLESILISGDRNFVIGKGGTEIPVSDLVGKNILLYF  272

Query  216  SASWCGPCHRFTPNLATVYNELLPKGN-FEVVFVSADEDEESFKEYFGKMPWTAVPFSDS  392
            SA WC PC  F P L   Y+++  K + FEV+F+S+D D+ +F E+F  MPW A+PF DS
Sbjct  273  SAHWCPPCRAFLPKLVEAYHKIKAKDDAFEVIFISSDRDQGAFDEFFSGMPWLALPFGDS  332

Query  393  VTRERLDALFTVRGIPHLVILDESGKVTTEDGVDIVLEHGVEAYPF  530
              +  L   F V+GIP L+ +  +G+  T++  D+V++HG  AYPF
Sbjct  333  -RKASLSRRFKVQGIPMLIAIGPTGQTVTKEARDLVMQHGANAYPF  377


 Score =   117 bits (292),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 62/143 (43%), Positives = 86/143 (60%), Gaps = 2/143 (1%)
 Frame = +3

Query  105  HDLRSILCSSDRDFLIRNSGHQVKVDDLKGKKIGIYFSASWCGPCHRFTPNLATVYNELL  284
              L++IL S  RDF+I N G  V V +L+GK +G+YFS S   PC  F+P L  VY +L 
Sbjct  76   QSLKTILVSRLRDFVISNDGKNVPVSELEGKIVGLYFSLSAYSPCVDFSPKLLEVYEKLK  135

Query  285  PKG-NFEVVFVSADEDEESFKEYFGKMPWTAVPFSDSVTRERLDALFTVRGIPHLVILDE  461
              G +FEVV +  D+DEESFK+ F  MPW ++P  D     +L   F +  +P LVI+  
Sbjct  136  ANGESFEVVVIPLDDDEESFKQDFKNMPWFSLPIGDKNVG-KLARYFELSTLPTLVIIGA  194

Query  462  SGKVTTEDGVDIVLEHGVEAYPF  530
             GK  +++  + + EHGV AYPF
Sbjct  195  DGKTVSKNVAEAIEEHGVLAYPF  217


 Score = 84.3 bits (207),  Expect = 8e-16, Method: Compositional matrix adjust.
 Identities = 37/57 (65%), Positives = 45/57 (79%), Gaps = 0/57 (0%)
 Frame = +3

Query  360  MPWTAVPFSDSVTRERLDALFTVRGIPHLVILDESGKVTTEDGVDIVLEHGVEAYPF  530
            MPW A+PFSDS  R+ +D LF VRGIPHLVIL E GKV ++ GV+I+ EHGV+ YPF
Sbjct  1    MPWLAIPFSDSEARDGVDELFKVRGIPHLVILGEDGKVLSDSGVEIIEEHGVDGYPF  57



>ref|XP_006292691.1| hypothetical protein CARUB_v10018937mg, partial [Capsella rubella]
 gb|EOA25589.1| hypothetical protein CARUB_v10018937mg, partial [Capsella rubella]
Length=496

 Score =   140 bits (353),  Expect = 8e-36, Method: Compositional matrix adjust.
 Identities = 68/120 (57%), Positives = 84/120 (70%), Gaps = 0/120 (0%)
 Frame = +3

Query  171  VKVDDLKGKKIGIYFSASWCGPCHRFTPNLATVYNELLPKGNFEVVFVSADEDEESFKEY  350
            VK++ L+GKKIG+YFS S CG   +FTP L  VYNEL P   FE+VFVS DEDEESFK+Y
Sbjct  1    VKIESLEGKKIGLYFSVSRCGLSQKFTPQLVEVYNELSPTVGFEIVFVSFDEDEESFKDY  60

Query  351  FGKMPWTAVPFSDSVTRERLDALFTVRGIPHLVILDESGKVTTEDGVDIVLEHGVEAYPF  530
            F KMPW AVPF+ S T + L  +F VRG P LVI+++ G+V  ED       +G +AYPF
Sbjct  61   FIKMPWLAVPFTSSETCKHLAEMFKVRGSPTLVIVNDRGEVVNEDAFCFTRTYGADAYPF  120


 Score =   115 bits (289),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 63/167 (38%), Positives = 96/167 (57%), Gaps = 5/167 (3%)
 Frame = +3

Query  33   IFQFSKRKGEERKASSMAEQNGDAHDLRSILCSSDRDFLIRNSGHQVKVDDLKGKKIGIY  212
            ++ F+  K EE K    A+   +   L S+L S D ++++   G +V V DL GK + +Y
Sbjct  241  VYHFTTEKFEELKEIEKAK--AEPQTLESLLVSDDLNYVLGKDGDKVLVYDLVGKDVLLY  298

Query  213  FSASWCGPCHRFTPNLATVYNELLPKGNFEVVFVSADEDEESFKEYFGKMPWTAVPFSDS  392
            FSA W   C  FT  L  VY  +     FE++F+S+D D+E+F+EY+ +MPW A+PF DS
Sbjct  299  FSAQWSFRCRAFTQILVEVYKHINKDQAFELIFISSDRDQEAFEEYYSQMPWLALPFGDS  358

Query  393  VTRERLDALFTVRG--IPHLVILDESGKVTTEDGVDIVLEHGVEAYP  527
              +  L   F V+G  IP LV   ++GK  T++ +D+V     +AYP
Sbjct  359  -KKPSLAKTFKVKGNCIPRLVSAGQTGKTVTKEAIDLVRCLLADAYP  404



>gb|KHG29175.1| hypothetical protein F383_13074 [Gossypium arboreum]
Length=422

 Score =   139 bits (349),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 73/157 (46%), Positives = 100/157 (64%), Gaps = 9/157 (6%)
 Frame = +3

Query  84   AEQNGDAHDLR-----SILCSSDRDFLIRNSGH--QVKVDDLKGKKIGIYFSASWCGPCH  242
            A  NGDA  +      S+L S DRD+L+ ++    QVK+ DL+GK IG+YFSA+W  PC 
Sbjct  13   ALTNGDAEKISTSRFSSLLASKDRDYLLSSTTQDDQVKISDLEGKVIGLYFSANWYPPCR  72

Query  243  RFTPNLATVYNELLPKG-NFEVVFVSADEDEESFKEYFGKMPWTAVPFSDSVTRERLDAL  419
             F   L  VY +L   G NFE+VFVS+DED  +F  Y   MPW ++PFSD  T++ L+  
Sbjct  73   NFNKVLIGVYEQLKSNGSNFEIVFVSSDEDLSAFNSYRESMPWLSIPFSDLETKKALNRK  132

Query  420  FTVRGIPHLVILDESGKVTTEDGVDIVLEHGVEAYPF  530
            F V GIP+L+IL   G  T  DGV+++  +G+EA+PF
Sbjct  133  FEVEGIPYLIILQPDGS-TLHDGVELIYRYGIEAFPF  168


 Score =   125 bits (314),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 65/153 (42%), Positives = 93/153 (61%), Gaps = 10/153 (7%)
 Frame = +3

Query  99   DAHDLRSILCSSDRDFLI-RNSGHQVKVDDLKGKKIGIYFSASWCGPCHRFTPNLATVYN  275
            ++  L ++L +  RD+L+ +    +V VD L GK IG+YFSA WC PC +FTP L ++Y 
Sbjct  185  ESQTLTNLLTNPGRDYLLDQTMTRKVPVDSLIGKTIGLYFSAQWCFPCAKFTPKLISIYQ  244

Query  276  E----LLPKG----NFEVVFVSADEDEESFKEYFGKMPWTAVPFSDSVTRERLDALFTVR  431
            +    L  KG    +FE+VFVS D D+ SF  Y+G MPW A+PF D + R  L   F V+
Sbjct  245  KIKQSLEGKGGGVEDFEIVFVSNDRDQSSFDSYYGTMPWLALPFGDPIIRT-LAKYFDVQ  303

Query  432  GIPHLVILDESGKVTTEDGVDIVLEHGVEAYPF  530
            GIP L+I+   GK  T+ G +++  +   AYPF
Sbjct  304  GIPCLIIIGPDGKTVTKQGRNLINLYQENAYPF  336



>ref|XP_008653605.1| PREDICTED: probable nucleoredoxin 3 [Zea mays]
Length=299

 Score =   135 bits (341),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 69/167 (41%), Positives = 98/167 (59%), Gaps = 5/167 (3%)
 Frame = +3

Query  36   FQFSKRKGEERKASSMAEQNGDAHDLRSILCSSDRDFLIRNSGHQVKVDDLKGKKIGIYF  215
            + FS ++   R+  SM +   +   L+ +L   +RDF+I      + + DL GK +G+YF
Sbjct  119  YPFSAQR--RRELESMDDARREGGRLQELLGCEERDFVISADDINIPIADLTGKTVGLYF  176

Query  216  SASWCGPCHRFTPNLATVYNEL--LPKGNFEVVFVSADEDEESFKEYFGKMPWTAVPFSD  389
             A WC PCH FT  L  VYNEL  L  G+FEV+FVS D  +  F+     MPW A+P+SD
Sbjct  177  GAHWCPPCHVFTKQLKEVYNELKILRPGSFEVIFVSIDRSKGEFQASMSSMPWLAIPYSD  236

Query  390  SVTRERLDALFTVRGIPHLVILDESGKVTTEDGVDIVLEHGVEAYPF  530
            + TR+RL  +F+V+GIP L+IL   GK    DG   +  +G  A+PF
Sbjct  237  A-TRKRLTRIFSVKGIPGLLILGLDGKALKTDGRTTISTYGAAAFPF  282


 Score = 69.3 bits (168),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 36/85 (42%), Positives = 53/85 (62%), Gaps = 6/85 (7%)
 Frame = +3

Query  294  NFEVVFVSADEDEESFKEYFGKMPWTAVPF-SDSVTRERLDALFTVRGIPHLVILDESGK  470
            + E++FVS D DE SF+++F  M W AVPF +  + R++L A F +  IP L+ L  S  
Sbjct  37   DVEIIFVSLDRDEASFRDHFQGMSWLAVPFDAAGLLRQKLCARFAIERIPALIPLSASAT  96

Query  471  VTT-----EDGVDIVLEHGVEAYPF  530
             ++     ED V +V E+GV+AYPF
Sbjct  97   SSSGLGCREDAVRLVGEYGVDAYPF  121



>gb|KJB14360.1| hypothetical protein B456_002G121200 [Gossypium raimondii]
Length=380

 Score =   137 bits (345),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 72/157 (46%), Positives = 99/157 (63%), Gaps = 9/157 (6%)
 Frame = +3

Query  84   AEQNGDAHDLR-----SILCSSDRDFLIRNSGH--QVKVDDLKGKKIGIYFSASWCGPCH  242
            A  NGD   +      S+L S DRD+L+ ++    QVK+ DL+GK IG+YFSA+W  PC 
Sbjct  13   ALTNGDPEKISTSRFSSLLASKDRDYLLSSTTQDDQVKISDLEGKAIGLYFSANWYPPCR  72

Query  243  RFTPNLATVYNELLPKG-NFEVVFVSADEDEESFKEYFGKMPWTAVPFSDSVTRERLDAL  419
             F   L  VY +L   G NFE+VFVS+DED  +F  Y   MPW ++PFSD  T++ L+  
Sbjct  73   NFNKVLIGVYEQLKSNGSNFEIVFVSSDEDLSAFNSYRESMPWLSIPFSDLETKKALNRK  132

Query  420  FTVRGIPHLVILDESGKVTTEDGVDIVLEHGVEAYPF  530
            F V GIP+L+IL   G  T  DGV+++  +G+EA+PF
Sbjct  133  FEVEGIPYLIILQPDGS-TLHDGVELIYRYGIEAFPF  168


 Score =   117 bits (294),  Expect = 5e-28, Method: Compositional matrix adjust.
 Identities = 60/138 (43%), Positives = 87/138 (63%), Gaps = 9/138 (7%)
 Frame = +3

Query  99   DAHDLRSILCSSDRDFLI-RNSGHQVKVDDLKGKKIGIYFSASWCGPCHRFTPNLATVYN  275
            ++  L ++L +  RD+L+ +    +V VD L GK +G+YFSA WC PC +FTP L ++Y+
Sbjct  185  ESQTLTNLLINPGRDYLLDQTMTRKVPVDSLIGKTVGLYFSAQWCFPCAKFTPKLISIYH  244

Query  276  E----LLPKG---NFEVVFVSADEDEESFKEYFGKMPWTAVPFSDSVTRERLDALFTVRG  434
            +    L  KG   +FE+VFVS D D+ SF  Y+G MPW A+PF + + R  L   F V+G
Sbjct  245  KIKQSLEGKGGGEDFEIVFVSNDRDQSSFDSYYGTMPWLALPFGEPIIRT-LAKYFDVQG  303

Query  435  IPHLVILDESGKVTTEDG  488
            IP L+I+D  GK  T+ G
Sbjct  304  IPCLIIIDPDGKTVTKQG  321



>ref|XP_008221829.1| PREDICTED: probable nucleoredoxin 1 isoform X2 [Prunus mume]
Length=479

 Score =   138 bits (347),  Expect = 5e-35, Method: Compositional matrix adjust.
 Identities = 66/144 (46%), Positives = 92/144 (64%), Gaps = 2/144 (1%)
 Frame = +3

Query  102  AHDLRSILCSSDRDFLIRNSGHQVKVDDLKGKKIGIYFSASWCGPCHRFTPNLATVYNEL  281
            A  L SIL S DR+F+I   G ++ V DL GK I +YFSA WC PC  F P L   Y+++
Sbjct  235  AQTLESILVSGDRNFVIGKGGTEIPVSDLVGKNILLYFSAHWCPPCRAFLPKLVEAYHKI  294

Query  282  LPKGN-FEVVFVSADEDEESFKEYFGKMPWTAVPFSDSVTRERLDALFTVRGIPHLVILD  458
              K + FEV+F+S+D+D+  F E+F  MPW A+PF D + +  L   F VRGIP LV + 
Sbjct  295  KAKDDAFEVIFISSDKDQGDFDEFFSGMPWFALPFGD-LRKASLSRRFKVRGIPMLVAIG  353

Query  459  ESGKVTTEDGVDIVLEHGVEAYPF  530
             +G+  T++  D+V++HG  AYPF
Sbjct  354  PTGQTVTKEARDLVMQHGANAYPF  377


 Score =   117 bits (293),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 67/166 (40%), Positives = 96/166 (58%), Gaps = 4/166 (2%)
 Frame = +3

Query  36   FQFSKRKGEERKASSMAEQNGDAHDLRSILCSSDRDFLIRNSGHQVKVDDLKGKKIGIYF  215
            + F+  K +E K    A +   +  L++IL S  RDF+I N G  V V +L+GK +G+YF
Sbjct  55   YPFTPEKVKELKDQEEAARRNQS--LKTILVSRSRDFVISNDGKNVPVSELEGKIVGLYF  112

Query  216  SASWCGPCHRFTPNLATVYNELLPKG-NFEVVFVSADEDEESFKEYFGKMPWTAVPFSDS  392
            S S    C  FTP L  VY +L   G +F+VV +  D+DEESFK+ F  MPW ++P  D 
Sbjct  113  SLSVYNRCVDFTPKLLEVYEKLKANGESFQVVVIPLDDDEESFKQDFKSMPWFSLPIGDK  172

Query  393  VTRERLDALFTVRGIPHLVILDESGKVTTEDGVDIVLEHGVEAYPF  530
               E+L   F +  +P LVI+   GK  +++  + + EHGV AYPF
Sbjct  173  -NVEKLARYFELSTLPTLVIIGADGKTISKNVAEAIEEHGVLAYPF  217


 Score = 73.9 bits (180),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 33/57 (58%), Positives = 42/57 (74%), Gaps = 0/57 (0%)
 Frame = +3

Query  360  MPWTAVPFSDSVTRERLDALFTVRGIPHLVILDESGKVTTEDGVDIVLEHGVEAYPF  530
            MPW A+PF D   R+R+D LF V GIP LVIL E GKV ++ GV+I+ E+GV+ YPF
Sbjct  1    MPWLAIPFFDKKARDRVDKLFKVIGIPCLVILGEDGKVLSDSGVEIIKEYGVDGYPF  57



>gb|KJB14359.1| hypothetical protein B456_002G121200 [Gossypium raimondii]
Length=421

 Score =   137 bits (345),  Expect = 5e-35, Method: Compositional matrix adjust.
 Identities = 72/157 (46%), Positives = 99/157 (63%), Gaps = 9/157 (6%)
 Frame = +3

Query  84   AEQNGDAHDLR-----SILCSSDRDFLIRNSGH--QVKVDDLKGKKIGIYFSASWCGPCH  242
            A  NGD   +      S+L S DRD+L+ ++    QVK+ DL+GK IG+YFSA+W  PC 
Sbjct  13   ALTNGDPEKISTSRFSSLLASKDRDYLLSSTTQDDQVKISDLEGKAIGLYFSANWYPPCR  72

Query  243  RFTPNLATVYNELLPKG-NFEVVFVSADEDEESFKEYFGKMPWTAVPFSDSVTRERLDAL  419
             F   L  VY +L   G NFE+VFVS+DED  +F  Y   MPW ++PFSD  T++ L+  
Sbjct  73   NFNKVLIGVYEQLKSNGSNFEIVFVSSDEDLSAFNSYRESMPWLSIPFSDLETKKALNRK  132

Query  420  FTVRGIPHLVILDESGKVTTEDGVDIVLEHGVEAYPF  530
            F V GIP+L+IL   G  T  DGV+++  +G+EA+PF
Sbjct  133  FEVEGIPYLIILQPDGS-TLHDGVELIYRYGIEAFPF  168


 Score =   125 bits (315),  Expect = 8e-31, Method: Compositional matrix adjust.
 Identities = 64/152 (42%), Positives = 95/152 (63%), Gaps = 9/152 (6%)
 Frame = +3

Query  99   DAHDLRSILCSSDRDFLI-RNSGHQVKVDDLKGKKIGIYFSASWCGPCHRFTPNLATVYN  275
            ++  L ++L +  RD+L+ +    +V VD L GK +G+YFSA WC PC +FTP L ++Y+
Sbjct  185  ESQTLTNLLINPGRDYLLDQTMTRKVPVDSLIGKTVGLYFSAQWCFPCAKFTPKLISIYH  244

Query  276  E----LLPKG---NFEVVFVSADEDEESFKEYFGKMPWTAVPFSDSVTRERLDALFTVRG  434
            +    L  KG   +FE+VFVS D D+ SF  Y+G MPW A+PF + + R  L   F V+G
Sbjct  245  KIKQSLEGKGGGEDFEIVFVSNDRDQSSFDSYYGTMPWLALPFGEPIIRT-LAKYFDVQG  303

Query  435  IPHLVILDESGKVTTEDGVDIVLEHGVEAYPF  530
            IP L+I+D  GK  T+ G +++  +   AYPF
Sbjct  304  IPCLIIIDPDGKTVTKQGRNLINLYQENAYPF  335



>ref|XP_009798867.1| PREDICTED: probable nucleoredoxin 2 [Nicotiana sylvestris]
Length=442

 Score =   137 bits (346),  Expect = 5e-35, Method: Compositional matrix adjust.
 Identities = 72/148 (49%), Positives = 93/148 (63%), Gaps = 5/148 (3%)
 Frame = +3

Query  102  AHDLRSILCSSDRDFLIRNSGHQVKVDDLKGKKIGIYFSASWCGPCHRFTPNLATVYNEL  281
            A D RSIL S D DFL+ ++G QVKV DL+ K +G+YFSA+W  PC +FT  L  VY +L
Sbjct  48   AQDYRSILASKDGDFLLSSTGAQVKVSDLESKIVGLYFSANWYPPCTKFTDLLINVYQQL  107

Query  282  LPKGN--FEVVFVSADEDEESFKEYFGKMPWTAVPFSDSVTRERLDALFTVRGIPHLVIL  455
                +  FEVVFVS+DED ++F  Y   MPW A+PFSD   R  L   F V GIP L+IL
Sbjct  108  KDHSDPGFEVVFVSSDEDLDAFNTYKSSMPWLAIPFSDLDARRALTQKFDVEGIPTLIIL  167

Query  456  DESGK---VTTEDGVDIVLEHGVEAYPF  530
              +         DGV++V  +GV+A+PF
Sbjct  168  QPNSNKDAAVISDGVELVYRYGVQAFPF  195


 Score =   119 bits (299),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 64/151 (42%), Positives = 87/151 (58%), Gaps = 8/151 (5%)
 Frame = +3

Query  99   DAHDLRSILCSSDRDFLIRNSG-HQVKVDDLKGKKIGIYFSASWCGPCHRFTPNLATVYN  275
            D   L ++L    RD+L+ + G  QV V  L GK IG+YFSA WC P  +FTP L +VY 
Sbjct  212  DNQTLSNLLTYDGRDYLLAHPGPKQVPVTSLMGKTIGLYFSAQWCIPAFKFTPRLMSVYQ  271

Query  276  ELLPK------GNFEVVFVSADEDEESFKEYFGKMPWTAVPFSDSVTRERLDALFTVRGI  437
            ++  +       +FE+VFVS+D D+  F  YF  MPW AVP+ D  T + L   F +RGI
Sbjct  272  KIKQQLEGKEDEDFEIVFVSSDRDQVQFVTYFETMPWLAVPYDDP-TIKNLAKYFDIRGI  330

Query  438  PHLVILDESGKVTTEDGVDIVLEHGVEAYPF  530
            P LV+L   GK  T+ G  ++  +   AYPF
Sbjct  331  PSLVVLGPDGKTVTKQGRSLINLYKGNAYPF  361



>ref|XP_006652793.1| PREDICTED: probable nucleoredoxin 3-like [Oryza brachyantha]
Length=394

 Score =   136 bits (343),  Expect = 7e-35, Method: Compositional matrix adjust.
 Identities = 65/167 (39%), Positives = 102/167 (61%), Gaps = 5/167 (3%)
 Frame = +3

Query  36   FQFSKRKGEERKASSMAEQNGDAHDLRSILCSSDRDFLIRNSGHQVKVDDLKGKKIGIYF  215
            + F +++  E +    A + G   +L+ +L   +R+++I   G ++ + DL GK IG+YF
Sbjct  155  YPFGEKRRHELEGMDDARRQGG--NLQELLGCKERNYVISADGIKIPISDLNGKTIGLYF  212

Query  216  SASWCGPCHRFTPNLATVYNEL--LPKGNFEVVFVSADEDEESFKEYFGKMPWTAVPFSD  389
             A WC PC  FT  L  VYNEL  L  GNF+V+F+S D +EE F+    +MPW ++P+SD
Sbjct  213  GAHWCPPCRTFTKQLREVYNELKTLRPGNFQVIFISMDRNEEEFQASLTEMPWFSIPYSD  272

Query  390  SVTRERLDALFTVRGIPHLVILDESGKVTTEDGVDIVLEHGVEAYPF  530
             +T + L  +FT++GIP L+IL   GK    DG  ++ ++G  A+PF
Sbjct  273  -ITMQELSRIFTIKGIPTLLILGPDGKAYKTDGRTVISKYGAMAFPF  318


 Score =   107 bits (267),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 54/132 (41%), Positives = 79/132 (60%), Gaps = 5/132 (4%)
 Frame = +3

Query  147  LIRNSGHQVKVDDLKGKKIGIYFSASWCGPCHRFTPNLATVYNELLPKG-NFEVVFVSAD  323
            L+ + G +V +  + GK+  ++FSA WC PC  FTP L  +Y +L   G N E++F+S D
Sbjct  27   LLSSGGKEVPLSSINGKRTCLFFSAHWCRPCRNFTPKLLQIYKKLRNTGKNIEIIFISLD  86

Query  324  EDEESFKEYFGKMPWTAVPFSDSVTRERLDALFTVRGIPHLVILDES---GKVTTEDGVD  494
             DE SF ++F  MPW A+PF+  + R++L   F +  IP L+ L      G    ED V 
Sbjct  87   HDEISFLDHFKCMPWLALPFNTGL-RQKLFKQFDIEHIPALIPLSTKIYDGFGIEEDAVK  145

Query  495  IVLEHGVEAYPF  530
            +V E+GV+AYPF
Sbjct  146  LVEEYGVDAYPF  157



>gb|KJB14358.1| hypothetical protein B456_002G121200 [Gossypium raimondii]
Length=422

 Score =   137 bits (344),  Expect = 7e-35, Method: Compositional matrix adjust.
 Identities = 72/159 (45%), Positives = 99/159 (62%), Gaps = 10/159 (6%)
 Frame = +3

Query  81   MAEQNGDAHDLR-----SILCSSDRDFLIRNSGH---QVKVDDLKGKKIGIYFSASWCGP  236
             A  NGD   +      S+L S DRD+L+ ++     QVK+ DL+GK IG+YFSA+W  P
Sbjct  12   QALTNGDPEKISTSRFSSLLASKDRDYLLSSTTQDDQQVKISDLEGKAIGLYFSANWYPP  71

Query  237  CHRFTPNLATVYNELLPKG-NFEVVFVSADEDEESFKEYFGKMPWTAVPFSDSVTRERLD  413
            C  F   L  VY +L   G NFE+VFVS+DED  +F  Y   MPW ++PFSD  T++ L+
Sbjct  72   CRNFNKVLIGVYEQLKSNGSNFEIVFVSSDEDLSAFNSYRESMPWLSIPFSDLETKKALN  131

Query  414  ALFTVRGIPHLVILDESGKVTTEDGVDIVLEHGVEAYPF  530
              F V GIP+L+IL   G  T  DGV+++  +G+EA+PF
Sbjct  132  RKFEVEGIPYLIILQPDGS-TLHDGVELIYRYGIEAFPF  169


 Score =   125 bits (315),  Expect = 8e-31, Method: Compositional matrix adjust.
 Identities = 64/152 (42%), Positives = 95/152 (63%), Gaps = 9/152 (6%)
 Frame = +3

Query  99   DAHDLRSILCSSDRDFLI-RNSGHQVKVDDLKGKKIGIYFSASWCGPCHRFTPNLATVYN  275
            ++  L ++L +  RD+L+ +    +V VD L GK +G+YFSA WC PC +FTP L ++Y+
Sbjct  186  ESQTLTNLLINPGRDYLLDQTMTRKVPVDSLIGKTVGLYFSAQWCFPCAKFTPKLISIYH  245

Query  276  E----LLPKG---NFEVVFVSADEDEESFKEYFGKMPWTAVPFSDSVTRERLDALFTVRG  434
            +    L  KG   +FE+VFVS D D+ SF  Y+G MPW A+PF + + R  L   F V+G
Sbjct  246  KIKQSLEGKGGGEDFEIVFVSNDRDQSSFDSYYGTMPWLALPFGEPIIRT-LAKYFDVQG  304

Query  435  IPHLVILDESGKVTTEDGVDIVLEHGVEAYPF  530
            IP L+I+D  GK  T+ G +++  +   AYPF
Sbjct  305  IPCLIIIDPDGKTVTKQGRNLINLYQENAYPF  336



>gb|KJB14361.1| hypothetical protein B456_002G121200 [Gossypium raimondii]
Length=455

 Score =   137 bits (345),  Expect = 8e-35, Method: Compositional matrix adjust.
 Identities = 72/157 (46%), Positives = 99/157 (63%), Gaps = 9/157 (6%)
 Frame = +3

Query  84   AEQNGDAHDLR-----SILCSSDRDFLIRNSGH--QVKVDDLKGKKIGIYFSASWCGPCH  242
            A  NGD   +      S+L S DRD+L+ ++    QVK+ DL+GK IG+YFSA+W  PC 
Sbjct  13   ALTNGDPEKISTSRFSSLLASKDRDYLLSSTTQDDQVKISDLEGKAIGLYFSANWYPPCR  72

Query  243  RFTPNLATVYNELLPKG-NFEVVFVSADEDEESFKEYFGKMPWTAVPFSDSVTRERLDAL  419
             F   L  VY +L   G NFE+VFVS+DED  +F  Y   MPW ++PFSD  T++ L+  
Sbjct  73   NFNKVLIGVYEQLKSNGSNFEIVFVSSDEDLSAFNSYRESMPWLSIPFSDLETKKALNRK  132

Query  420  FTVRGIPHLVILDESGKVTTEDGVDIVLEHGVEAYPF  530
            F V GIP+L+IL   G  T  DGV+++  +G+EA+PF
Sbjct  133  FEVEGIPYLIILQPDGS-TLHDGVELIYRYGIEAFPF  168


 Score =   119 bits (298),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 59/128 (46%), Positives = 82/128 (64%), Gaps = 8/128 (6%)
 Frame = +3

Query  168  QVKVDDLKGKKIGIYFSASWCGPCHRFTPNLATVYNE----LLPKG---NFEVVFVSADE  326
            +V VD L GK +G+YFSA WC PC +FTP L ++Y++    L  KG   +FE+VFVS D 
Sbjct  243  EVPVDSLIGKTVGLYFSAQWCFPCAKFTPKLISIYHKIKQSLEGKGGGEDFEIVFVSNDR  302

Query  327  DEESFKEYFGKMPWTAVPFSDSVTRERLDALFTVRGIPHLVILDESGKVTTEDGVDIVLE  506
            D+ SF  Y+G MPW A+PF + + R  L   F V+GIP L+I+D  GK  T+ G +++  
Sbjct  303  DQSSFDSYYGTMPWLALPFGEPIIRT-LAKYFDVQGIPCLIIIDPDGKTVTKQGRNLINL  361

Query  507  HGVEAYPF  530
            +   AYPF
Sbjct  362  YQENAYPF  369



>ref|XP_008221212.1| PREDICTED: probable nucleoredoxin 2 [Prunus mume]
Length=427

 Score =   136 bits (343),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 68/136 (50%), Positives = 92/136 (68%), Gaps = 4/136 (3%)
 Frame = +3

Query  135  DRDFLIRNSGHQVKVDDLKGKKIGIYFSASWCGPCHRFTPNLATVYNELLPKG-NFEVVF  311
            DRDFL+  +G+QVKV DL+GK IG+YFSA+W  PC  F   L  +Y +L   G NFE+V+
Sbjct  41   DRDFLLSPTGNQVKVCDLEGKIIGLYFSANWYPPCWNFNQVLVGIYEQLKSSGSNFEIVY  100

Query  312  VSADEDEESFKEYFGKMPWTAVPFSDSVTRERLDALFTVRGIPHLVIL---DESGKVTTE  482
            VS+DED ++F  Y G MPW A+PFSD  T++ L+  F + GIP LVIL   D   + T  
Sbjct  101  VSSDEDADAFNIYHGCMPWLAIPFSDLDTKKALNRRFDIEGIPSLVILHPNDNKDEATLR  160

Query  483  DGVDIVLEHGVEAYPF  530
            DG +++  +GVEA+PF
Sbjct  161  DGAELIYRYGVEAFPF  176


 Score =   120 bits (300),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 72/175 (41%), Positives = 100/175 (57%), Gaps = 13/175 (7%)
 Frame = +3

Query  36   FQFSKRKGEERKASSMAEQNGDAHDLRSILCSSDRDFLIRN-SGHQVKVDDLKGKKIGIY  212
            F F+K++ EE +    A    +   L ++L + DRD L  + +  QV V  L GK IG+Y
Sbjct  174  FPFTKQRLEELQDEERARH--ENQTLTNLLTNHDRDNLWGHPTPEQVPVAALVGKTIGLY  231

Query  213  FSASWCGPCHRFTPNLATVYN----ELLPKG-----NFEVVFVSADEDEESFKEYFGKMP  365
            FSA WC PC  FTP L ++Y     ++L  G     +FE+VFVS+D D+ SF  YF  MP
Sbjct  232  FSAHWCRPCVNFTPRLISIYQKIKEQMLVDGDQDGEDFEIVFVSSDRDQASFDSYFVTMP  291

Query  366  WTAVPFSDSVTRERLDALFTVRGIPHLVILDESGKVTTEDGVDIVLEHGVEAYPF  530
            W A+PF D   ++ L   F V+GIP LVIL   GK  T+ G +++  +   AYPF
Sbjct  292  WLALPFGDPNIKQ-LVKHFDVKGIPCLVILGPDGKTVTKQGRNLINLYQENAYPF  345



>gb|KCW59852.1| hypothetical protein EUGRSUZ_H025922, partial [Eucalyptus grandis]
Length=370

 Score =   135 bits (341),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 63/153 (41%), Positives = 94/153 (61%), Gaps = 2/153 (1%)
 Frame = +3

Query  75   SSMAEQNGDAHDLRSILCSSDRDFLIRNSGHQVKVDDLKGKKIGIYFSASWCGPCHRFTP  254
            + + ++  ++  L SIL S D DF+I   G ++ V DL GK + +YFSA WC PC  F P
Sbjct  108  AEIEKKREESQTLESILVSGDLDFVIGKDGTKIPVPDLVGKTVLLYFSAHWCPPCRAFLP  167

Query  255  NLATVYNELLPKGN-FEVVFVSADEDEESFKEYFGKMPWTAVPFSDSVTRERLDALFTVR  431
             L   Y ++   GN  EV+F+S+D+D+ +F  YF +MPW A+PF D   ++ L   F VR
Sbjct  168  VLTEAYEKIKAAGNALEVIFISSDKDQTAFDNYFAQMPWLALPFGDE-RKKSLSRKFKVR  226

Query  432  GIPHLVILDESGKVTTEDGVDIVLEHGVEAYPF  530
            GIP LV +  +G+  T    D++++HG +AYPF
Sbjct  227  GIPMLVAIGPTGRTVTNKARDLIMDHGADAYPF  259


 Score = 82.0 bits (201),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 42/99 (42%), Positives = 59/99 (60%), Gaps = 2/99 (2%)
 Frame = +3

Query  237  CHRFTPNLATVYNELLPKG-NFEVVFVSADEDEESFKEYFGKMPWTAVPFSDSVTRERLD  413
            C  FTP L  VY +L  +G +FE+V +  D+DE SF + FG MPW ++PF D    E+L 
Sbjct  2    CVDFTPKLLEVYEKLKARGESFEIVQIPLDDDEASFNQSFGSMPWLSLPFKDKKC-EKLV  60

Query  414  ALFTVRGIPHLVILDESGKVTTEDGVDIVLEHGVEAYPF  530
              F +  +P LVI+ + GK    +  + V EHG+ AYPF
Sbjct  61   RYFKLSTLPTLVIIGQDGKTVHANVAETVEEHGITAYPF  99



>emb|CDP07350.1| unnamed protein product [Coffea canephora]
Length=424

 Score =   136 bits (343),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 70/164 (43%), Positives = 98/164 (60%), Gaps = 4/164 (2%)
 Frame = +3

Query  51   RKGEERKASSMAEQNGDAHDLRSILCSSDRDFLIRNSGHQVKVDDLKGKKIGIYFSASWC  230
            R  +   A+   +Q     +  SIL + DRDFL+  +G QVK+ +L+GK +GIYFSA+W 
Sbjct  9    RVRDSNNATEEGDQEFKNTNFLSILATEDRDFLLSATGSQVKISELEGKIVGIYFSANWY  68

Query  231  GPCHRFTPNLATVYNELLPKG-NFEVVFVSADEDEESFKEYFGKMPWTAVPFSDSVTRER  407
             PC  FTP L   + E   +   FEVVFVS DED ++F  Y   MPW A+PFSD  T++ 
Sbjct  69   PPCKNFTPLLVNAFEEFKSQTPGFEVVFVSCDEDLDAFNNYRACMPWLAIPFSDLNTKKN  128

Query  408  LDALFTVRGIPHLVILDESGKVTTE---DGVDIVLEHGVEAYPF  530
            L++ F V GIP L+IL        E   DGV+++  +G +A+PF
Sbjct  129  LNSRFDVEGIPSLIILQPDNYKVDEAIHDGVELLYRYGKQAFPF  172


 Score =   122 bits (305),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 74/175 (42%), Positives = 104/175 (59%), Gaps = 16/175 (9%)
 Frame = +3

Query  36   FQFSKRKGEERKASSMAEQNGDAHD---LRSILCSSDRDFLIRNSGHQ-VKVDDLKGKKI  203
            F F+K + +E     + E+  + H+   L ++L S +RDFL+ +S  + V V  LKGK +
Sbjct  170  FPFTKERLQE-----LQEREREKHENQTLMNLLTSQNRDFLLGHSTSKLVPVASLKGKTV  224

Query  204  GIYFSASWCGPCHRFTPNLATVYNE----LLPKG--NFEVVFVSADEDEESFKEYFGKMP  365
            G+YFSA WC P  +FT  L ++Y +    LL  G  +FE+VFVS D DE SF  +FG MP
Sbjct  225  GLYFSAQWCFPGVKFTSRLISIYQKIKEVLLENGGEDFEIVFVSTDHDELSFNLFFGTMP  284

Query  366  WTAVPFSDSVTRERLDALFTVRGIPHLVILDESGKVTTEDGVDIVLEHGVEAYPF  530
            W A+PF+D  T + L   F V+ IP LVIL   GK  T+ G ++V  +   AYPF
Sbjct  285  WLALPFNDP-TIKNLTKHFDVQWIPSLVILGPDGKTVTKKGRNLVNLYQENAYPF  338



>ref|XP_002285895.1| PREDICTED: probable nucleoredoxin 2 isoform X1 [Vitis vinifera]
Length=425

 Score =   136 bits (342),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 73/156 (47%), Positives = 98/156 (63%), Gaps = 10/156 (6%)
 Frame = +3

Query  93   NGDAHDLR------SILCSSDRDFLIRNSGHQVKVDDLKGKKIGIYFSASWCGPCHRFTP  254
            NG + DL       S+L S+ RDFL+  +G QVKV +L  K IG+YFSA+W  PC +FT 
Sbjct  21   NGVSDDLNYRSRFSSLLASTHRDFLLSPTGQQVKVSELNDKVIGLYFSANWYAPCRKFTQ  80

Query  255  NLATVYNELLPKG-NFEVVFVSADEDEESFKEYFGKMPWTAVPFSDSVTRERLDALFTVR  431
             LA  Y +L   G  FE+VFVS+DED ++F  +   MPW AVPFSD  T++ L+  F + 
Sbjct  81   VLAGAYEQLKSCGAGFEIVFVSSDEDSDAFDNFRACMPWLAVPFSDLETKKALNRKFDIE  140

Query  432  GIPHLVIL---DESGKVTTEDGVDIVLEHGVEAYPF  530
            GIP LVIL   D   + T  DGV+++  +GV A+PF
Sbjct  141  GIPCLVILQPNDNKDEATLHDGVELIYRYGVNAFPF  176


 Score =   123 bits (309),  Expect = 7e-30, Method: Compositional matrix adjust.
 Identities = 66/151 (44%), Positives = 92/151 (61%), Gaps = 8/151 (5%)
 Frame = +3

Query  99   DAHDLRSILCSSDRDFLI-RNSGHQVKVDDLKGKKIGIYFSASWCGPCHRFTPNLATVYN  275
            ++  L ++L + +RDFL+ R +  QV +  L GK IG+YFSA WC P  +FTP L ++Y 
Sbjct  193  ESQTLPNLLTNHNRDFLLGRPTAKQVPISSLIGKTIGLYFSAQWCLPGVKFTPKLISIYQ  252

Query  276  ELLP------KGNFEVVFVSADEDEESFKEYFGKMPWTAVPFSDSVTRERLDALFTVRGI  437
            ++        + +FE+VFVS+D D+ SF  YFG MPW AVPF D  T + L   F V+GI
Sbjct  253  KIKQTLVDDNEEDFEIVFVSSDRDQPSFDSYFGTMPWLAVPFGDP-TIKTLTKYFDVQGI  311

Query  438  PHLVILDESGKVTTEDGVDIVLEHGVEAYPF  530
            P LVIL   GK  T+ G  ++  +   AYPF
Sbjct  312  PCLVILGPDGKTVTKQGRYLINLYQENAYPF  342



>gb|KHN45956.1| Putative nucleoredoxin 2 [Glycine soja]
Length=419

 Score =   136 bits (342),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 65/154 (42%), Positives = 96/154 (62%), Gaps = 4/154 (3%)
 Frame = +3

Query  81   MAEQNGDAHDLRSILCSSDRDFLIRNSGHQVKVDDLKGKKIGIYFSASWCGPCHRFTPNL  260
            +   NG+      +L S DRD+L+  +G QVKV DL+GK +G+ F+A+W  PC  FT  L
Sbjct  9    VMNHNGNHGKFSHLLASQDRDYLLSPTGAQVKVSDLEGKVVGLLFAANWYPPCRGFTQVL  68

Query  261  ATVYNELLPK-GNFEVVFVSADEDEESFKEYFGKMPWTAVPFSDSVTRERLDALFTVRGI  437
            A +Y EL  +   FE+V+VS+DED  +F  ++G MPW A+PFSD  T++ L   F V  +
Sbjct  69   AGIYEELKSRVPQFEIVYVSSDEDLNAFNSFYGSMPWIAIPFSDLETKKSLTRKFDVEAV  128

Query  438  PHLVIL---DESGKVTTEDGVDIVLEHGVEAYPF  530
            P L++L   D     T  DGV+++  +G++AYPF
Sbjct  129  PCLILLQPDDRKEHATVRDGVELIYRYGIQAYPF  162


 Score =   115 bits (289),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 67/174 (39%), Positives = 99/174 (57%), Gaps = 12/174 (7%)
 Frame = +3

Query  36   FQFSKRKGEERKASSMAEQNGDAHDLRSILCSSDRDFLIRNSG---HQVKVDDLKGKKIG  206
            + FSK + E+ +     ++  D   L ++L +  RD+++ ++     +V V  L GK IG
Sbjct  160  YPFSKDRLEQLQKEDKVKR--DNQTLTNLLANHHRDYVLSHTHTGLKKVPVASLVGKTIG  217

Query  207  IYFSASWCGPCHRFTPNLATVY----NELLPKG--NFEVVFVSADEDEESFKEYFGKMPW  368
            +YFSA WC PC +FTP L +VY    +EL  KG  +FEVV +S+D D+ SF  Y+  MPW
Sbjct  218  LYFSAEWCVPCAKFTPKLISVYEKIKHELAEKGEEDFEVVLISSDRDQASFDSYYSTMPW  277

Query  369  TAVPFSDSVTRERLDALFTVRGIPHLVILDESGKVTTEDGVDIVLEHGVEAYPF  530
             A+PF D   +  L   + V+GIP LVI+   GK  T  G  ++  +   AYPF
Sbjct  278  LALPFGDPEIK-NLVRHYNVQGIPWLVIIGPDGKTITVHGRSLINLYQENAYPF  330



>ref|XP_007221797.1| hypothetical protein PRUPE_ppa006064mg [Prunus persica]
 gb|EMJ22996.1| hypothetical protein PRUPE_ppa006064mg [Prunus persica]
Length=429

 Score =   136 bits (342),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 68/136 (50%), Positives = 92/136 (68%), Gaps = 4/136 (3%)
 Frame = +3

Query  135  DRDFLIRNSGHQVKVDDLKGKKIGIYFSASWCGPCHRFTPNLATVYNELLPKG-NFEVVF  311
            DRDFL+  +G+QVKV DL+GK IG+YFSA+W  PC  F   L  +Y +L   G NFE+V+
Sbjct  41   DRDFLLSPTGNQVKVCDLEGKIIGLYFSANWYPPCWNFNQVLVGIYEQLKSSGSNFEIVY  100

Query  312  VSADEDEESFKEYFGKMPWTAVPFSDSVTRERLDALFTVRGIPHLVIL---DESGKVTTE  482
            VS+DED ++F  Y   MPW A+PFSD  T++ L+  F + GIP LVIL   D   + T  
Sbjct  101  VSSDEDADAFNIYHACMPWLAIPFSDLDTKKALNRRFDIEGIPSLVILHPNDNKDEATLR  160

Query  483  DGVDIVLEHGVEAYPF  530
            DGV+++  +GVEA+PF
Sbjct  161  DGVELIYRYGVEAFPF  176


 Score =   122 bits (307),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 72/175 (41%), Positives = 101/175 (58%), Gaps = 13/175 (7%)
 Frame = +3

Query  36   FQFSKRKGEERKASSMAEQNGDAHDLRSILCSSDRDFLIRN-SGHQVKVDDLKGKKIGIY  212
            F F+K++ EE +    A    +   L ++L + DRD L+ + +  QV V  L GK IG+Y
Sbjct  174  FPFTKQRLEELQDEERARH--ENQTLTNLLTNHDRDNLLGHPTPEQVPVASLVGKTIGLY  231

Query  213  FSASWCGPCHRFTPNLATVYN----ELLPKG-----NFEVVFVSADEDEESFKEYFGKMP  365
            FSA WC PC  FTP L ++Y     ++L  G     +FE+VFVS+D D+ SF  YF  MP
Sbjct  232  FSAHWCRPCVNFTPRLISIYQKIKEQMLVDGDQDGEDFEIVFVSSDRDQASFDSYFDTMP  291

Query  366  WTAVPFSDSVTRERLDALFTVRGIPHLVILDESGKVTTEDGVDIVLEHGVEAYPF  530
            W A+PF D   ++ L   F V+GIP LVIL   GK  T+ G +++  +   AYPF
Sbjct  292  WLALPFGDPNIKQ-LVKHFDVKGIPCLVILGPDGKTVTKQGRNLINLYQENAYPF  345



>ref|NP_001276271.1| probable nucleoredoxin 2-like [Glycine max]
 gb|ACU20924.1| unknown [Glycine max]
Length=423

 Score =   135 bits (341),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 64/154 (42%), Positives = 96/154 (62%), Gaps = 4/154 (3%)
 Frame = +3

Query  81   MAEQNGDAHDLRSILCSSDRDFLIRNSGHQVKVDDLKGKKIGIYFSASWCGPCHRFTPNL  260
            +   NG+      +L S DRD+L+  +G QVKV DL+GK +G+ F+A+W  PC  FT  L
Sbjct  13   VMNHNGNHGKFSHLLASQDRDYLLSPTGAQVKVSDLEGKVVGLLFAANWYPPCRGFTQVL  72

Query  261  ATVYNELLPK-GNFEVVFVSADEDEESFKEYFGKMPWTAVPFSDSVTRERLDALFTVRGI  437
            A +Y EL  +   FE+V+VS+DED  +F  ++G MPW A+PFSD  T++ L   F V  +
Sbjct  73   AGIYEELKSRVPQFEIVYVSSDEDLNAFNSFYGSMPWIAIPFSDLETKKSLTRKFDVEAV  132

Query  438  PHLVIL---DESGKVTTEDGVDIVLEHGVEAYPF  530
            P L++L   D     T  DG++++  +G++AYPF
Sbjct  133  PCLILLQPDDRKEHATVRDGIELIYRYGIQAYPF  166


 Score =   116 bits (290),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 67/174 (39%), Positives = 99/174 (57%), Gaps = 12/174 (7%)
 Frame = +3

Query  36   FQFSKRKGEERKASSMAEQNGDAHDLRSILCSSDRDFLIRNSG---HQVKVDDLKGKKIG  206
            + FSK + E+ +     ++  D   L ++L +  RD+++ ++     +V V  L GK IG
Sbjct  164  YPFSKDRLEQLQKEDKVKR--DNQTLTNLLANHHRDYVLSHTHTGLKKVPVASLVGKTIG  221

Query  207  IYFSASWCGPCHRFTPNLATVY----NELLPKG--NFEVVFVSADEDEESFKEYFGKMPW  368
            +YFSA WC PC +FTP L +VY    +EL  KG  +FEVV +S+D D+ SF  Y+  MPW
Sbjct  222  LYFSAEWCVPCAKFTPKLISVYEKIKHELAEKGEEDFEVVLISSDRDQASFDSYYSTMPW  281

Query  369  TAVPFSDSVTRERLDALFTVRGIPHLVILDESGKVTTEDGVDIVLEHGVEAYPF  530
             A+PF D   +  L   + V+GIP LVI+   GK  T  G  ++  +   AYPF
Sbjct  282  LALPFGDPEIK-NLVRHYNVQGIPWLVIIGPDGKTITVHGRSLINLYQENAYPF  334



>ref|XP_006577959.1| PREDICTED: probable nucleoredoxin 2-like isoform X2 [Glycine 
max]
Length=446

 Score =   135 bits (341),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 65/154 (42%), Positives = 96/154 (62%), Gaps = 4/154 (3%)
 Frame = +3

Query  81   MAEQNGDAHDLRSILCSSDRDFLIRNSGHQVKVDDLKGKKIGIYFSASWCGPCHRFTPNL  260
            +   NG+      +L S DRD+L+  +G QVKV DL+GK +G+ F+A+W  PC  FT  L
Sbjct  13   VMNHNGNHGKFSHLLASQDRDYLLSPTGAQVKVSDLEGKVVGLLFAANWYPPCRGFTQVL  72

Query  261  ATVYNELLPK-GNFEVVFVSADEDEESFKEYFGKMPWTAVPFSDSVTRERLDALFTVRGI  437
            A +Y EL  +   FE+V+VS+DED  +F  ++G MPW A+PFSD  T++ L   F V  +
Sbjct  73   AGIYEELKSRVPQFEIVYVSSDEDLNAFNSFYGSMPWIAIPFSDLETKKSLTRKFDVEAV  132

Query  438  PHLVIL---DESGKVTTEDGVDIVLEHGVEAYPF  530
            P L++L   D     T  DGV+++  +G++AYPF
Sbjct  133  PCLILLQPDDRKEHATVRDGVELIYRYGIQAYPF  166


 Score =   109 bits (273),  Expect = 5e-25, Method: Compositional matrix adjust.
 Identities = 60/130 (46%), Positives = 77/130 (59%), Gaps = 7/130 (5%)
 Frame = +3

Query  159  SGHQVKVDDLKGKKIGIYFSASWCGPCHRFTPNLATVY----NELLPKG--NFEVVFVSA  320
            S  QV V  L GK IG+YFSA WC PC +FTP L +VY    +EL  KG  +FEVV +S+
Sbjct  229  SCTQVPVASLVGKTIGLYFSAEWCVPCAKFTPKLISVYEKIKHELAEKGEEDFEVVLISS  288

Query  321  DEDEESFKEYFGKMPWTAVPFSDSVTRERLDALFTVRGIPHLVILDESGKVTTEDGVDIV  500
            D D+ SF  Y+  MPW A+PF D   +  L   + V+GIP LVI+   GK  T  G  ++
Sbjct  289  DRDQASFDSYYSTMPWLALPFGDPEIKN-LVRHYNVQGIPWLVIIGPDGKTITVHGRSLI  347

Query  501  LEHGVEAYPF  530
              +   AYPF
Sbjct  348  NLYQENAYPF  357



>ref|XP_010266051.1| PREDICTED: probable nucleoredoxin 2 [Nelumbo nucifera]
Length=416

 Score =   135 bits (340),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 70/144 (49%), Positives = 94/144 (65%), Gaps = 6/144 (4%)
 Frame = +3

Query  117  SILCSSDRDFLIRNSGHQVKVDDLKGKKIGIYFSASWCGPCHRFTPNLATVYNELLPKG-  293
            S+L S DRDFL+  + +QVKV DL GK +GIYFSA+W  PC +FTP LA VY +L  +G 
Sbjct  23   SLLASKDRDFLLSPTENQVKVSDLDGKVVGIYFSANWYPPCRKFTPILAGVYEQLKGRGC  82

Query  294  NFEVVFVSADEDEESFKEYFGKMPWTAVPFSDSVTRERLDALFTVRGIPHLVIL-----D  458
             FEVVFVS+DED ++F  Y   MPW A+PFSD  +++ L+  F +  IP L+IL     D
Sbjct  83   GFEVVFVSSDEDCDAFASYRSSMPWLAIPFSDLESKKGLNRRFEIEDIPCLIILQPVSTD  142

Query  459  ESGKVTTEDGVDIVLEHGVEAYPF  530
                    DGV+++  +GV A+PF
Sbjct  143  NEEDEILRDGVELIYRYGVRAFPF  166


 Score =   115 bits (287),  Expect = 5e-27, Method: Compositional matrix adjust.
 Identities = 63/155 (41%), Positives = 92/155 (59%), Gaps = 13/155 (8%)
 Frame = +3

Query  99   DAHDLRSILCSSDRDFLIRNSGH----QVKVDDLKGKKIGIYFSASWCGPCHRFTPNLAT  266
            +   + ++L + +R+FL+   GH    QV V  L GK +G+YFSA WC PC +FTP L +
Sbjct  183  ENQTITNLLTNHNRNFLL-GHGHPVPKQVDVGSLVGKTVGLYFSAQWCLPCLKFTPKLIS  241

Query  267  VYN---ELL----PKGNFEVVFVSADEDEESFKEYFGKMPWTAVPFSDSVTRERLDALFT  425
            +Y+   E+L       +FE+VFVS+D ++  F  YFG MPW A+PF D   R  L   F 
Sbjct  242  IYHKIKEMLVEEKENEDFEIVFVSSDSEQVGFDSYFGTMPWLALPFGDPTVRS-LTKYFD  300

Query  426  VRGIPHLVILDESGKVTTEDGVDIVLEHGVEAYPF  530
            V+ +P LVIL   GK  T+ G +++  +  +AYPF
Sbjct  301  VQRVPCLVILGPDGKTLTKQGRNLINLYQEKAYPF  335



>ref|XP_011034968.1| PREDICTED: probable nucleoredoxin 2 [Populus euphratica]
Length=458

 Score =   135 bits (341),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 73/163 (45%), Positives = 100/163 (61%), Gaps = 11/163 (7%)
 Frame = +3

Query  75   SSMAEQNGD------AHDLRSILCSSDRDFLIRNSGHQVKVDDLKGKKIGIYFSASWCGP  236
            +S  E+NGD      +    S+L + DRD+L+   G QVKV DL+GK +G+YFSA+W  P
Sbjct  46   ASEDEENGDHSQKISSSRFSSLLATKDRDYLLSQDGTQVKVSDLEGKVLGLYFSANWYVP  105

Query  237  CHRFTPN-LATVYNELLPKG-NFEVVFVSADEDEESFKEYFGKMPWTAVPFSDSVTRERL  410
            C  FT   L   Y  L  KG NFE+VF+S+DED ++F  Y   MPW ++PFSD  T+  L
Sbjct  106  CRSFTTQVLVGAYEHLKSKGSNFEIVFISSDEDLDAFNNYRANMPWLSIPFSDLETKRAL  165

Query  411  DALFTVRGIPHLVIL---DESGKVTTEDGVDIVLEHGVEAYPF  530
            ++ F V  IP LVIL   D   + T  DGV+++   GV+A+PF
Sbjct  166  NSKFEVEAIPFLVILQPEDNKYEATIHDGVELLSRFGVQAFPF  208


 Score =   112 bits (279),  Expect = 7e-26, Method: Compositional matrix adjust.
 Identities = 62/151 (41%), Positives = 90/151 (60%), Gaps = 9/151 (6%)
 Frame = +3

Query  102  AHDLRSILCSSDRDFLI-RNSGHQVKVDDLKGKKIGIYFSASWCGPCHRFTPNLATVYNE  278
            +  L ++L + DRD+L+   +  +V V  L GK IG+YFSA WC P  +FT  L ++Y++
Sbjct  226  SQTLINLLTNHDRDYLLGPPAAQRVPVASLVGKTIGLYFSAQWCLPGVKFTHKLISIYHK  285

Query  279  L----LPKGN---FEVVFVSADEDEESFKEYFGKMPWTAVPFSDSVTRERLDALFTVRGI  437
            +    + KGN   FE+VFVS+D D+ +F  YF  MPW  +PF D  ++  L   F V+GI
Sbjct  286  IKQMVVHKGNEDDFEIVFVSSDRDQAAFDSYFNSMPWLTLPFGDPASK-ILAKHFDVKGI  344

Query  438  PHLVILDESGKVTTEDGVDIVLEHGVEAYPF  530
            P LVIL   GK  T+ G  ++  +   AYPF
Sbjct  345  PCLVILGPDGKTVTKHGRSLINLYKENAYPF  375



>ref|XP_006435251.1| hypothetical protein CICLE_v10001187mg [Citrus clementina]
 gb|ESR48491.1| hypothetical protein CICLE_v10001187mg [Citrus clementina]
Length=410

 Score =   135 bits (339),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 73/159 (46%), Positives = 99/159 (62%), Gaps = 6/159 (4%)
 Frame = +3

Query  72   ASSMAEQNGDAHDLR--SILCSSDRDFLIRNSGHQVKVDDLKGKKIGIYFSASWCGPCHR  245
             SS++E    +   R  S+L S DRD+L+   G QVKV DL+GK   +YFSA+W  PC  
Sbjct  19   GSSISEHQKISTSSRFSSLLASKDRDYLLNQHGTQVKVSDLEGKVTALYFSANWYPPCGN  78

Query  246  FTPNLATVYNELLPKG-NFEVVFVSADEDEESFKEYFGKMPWTAVPFSDSVTRERLDALF  422
            FT  L  VY EL   G +FEVVFVS+DED  +F  Y   MPW AVP+SD  T++ L+  F
Sbjct  79   FTGVLVDVYEELRNNGSDFEVVFVSSDEDLNAFNNYRACMPWLAVPYSDLETKKALNRKF  138

Query  423  TVRGIPHLVIL---DESGKVTTEDGVDIVLEHGVEAYPF  530
             + GIP LV+L   D+    T  DGV+++ ++G+ A+PF
Sbjct  139  DIEGIPCLVVLQPYDDKDDATLHDGVELIYKYGIRAFPF  177


 Score = 99.4 bits (246),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 57/142 (40%), Positives = 82/142 (58%), Gaps = 16/142 (11%)
 Frame = +3

Query  111  LRSILCSSDRDFLIRNSGH----QVKVDDLKGKKIGIYFSASWCGPCHRFTPNLATVYNE  278
            L ++L + DR +L+   GH    +V V  L GK +G+YFSA WC PC +F P L ++Y +
Sbjct  198  LINLLTNHDRGYLL---GHPPDEKVPVSSLVGKTVGLYFSARWCIPCEKFMPKLLSIYQK  254

Query  279  ----LLPKGN----FEVVFVSADEDEESFKEYFGKMPWTAVPFSDSVTRERLDALFTVRG  434
                L+ KG+    FEVVFVS D D+ SF+ YFG MPW A+PF D   +E L   F V+G
Sbjct  255  IKQNLVEKGDALEDFEVVFVSTDRDQTSFESYFGTMPWLALPFGDPTIKE-LTKYFDVQG  313

Query  435  IPHLVILDESGKVTTEDGVDIV  500
               + +  E+    TE  ++ +
Sbjct  314  RNLINLYQENAYPFTEAKLEFL  335



>ref|XP_008466458.1| PREDICTED: probable nucleoredoxin 2 isoform X1 [Cucumis melo]
 ref|XP_008466459.1| PREDICTED: probable nucleoredoxin 2 isoform X2 [Cucumis melo]
Length=412

 Score =   134 bits (338),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 70/145 (48%), Positives = 95/145 (66%), Gaps = 9/145 (6%)
 Frame = +3

Query  117  SILCSSDRDFLIRNSGHQVKVDDLKGKKIGIYFSASWCGPCHRFTPNLATVYNELLPKG-  293
            S+L S DRD+L+  +G QVKV +L GK +G+YFSA+W  PC  F   L   Y +L   G 
Sbjct  21   SLLASGDRDYLLSPTGAQVKVSNLDGKVLGLYFSANWYPPCRNFNQILVRTYEKLQDNGS  80

Query  294  NFEVVFVSADEDEESFKEYFGKMPWTAVPFSDSVTRERLDALFTVRGIPHLVIL------  455
            NFEVV+VS+DED ++F EY   MPW A+PFSD  T+  L+  F + GIP L+IL      
Sbjct  81   NFEVVYVSSDEDSDAFNEYRASMPWPAIPFSDLETKIALNRKFGIEGIPCLIILQPRESK  140

Query  456  DESGKVTTEDGVDIVLEHGVEAYPF  530
            DE+G  T  +GV++V  +GV+A+PF
Sbjct  141  DETG--TLNEGVEVVYRYGVDAFPF  163


 Score =   122 bits (307),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 72/172 (42%), Positives = 102/172 (59%), Gaps = 11/172 (6%)
 Frame = +3

Query  36   FQFSKRKGEERKASSMAEQNGDAHDLRSILCSSDRDFLIRNS-GHQVKVDDLKGKKIGIY  212
            F F+K + E+ K     ++  +   L ++L ++ RD+L+ +    QV V  L GK IG+Y
Sbjct  161  FPFTKERLEQLKEEDREKE--ENQTLVTLLTNNYRDYLLAHPFPKQVPVVSLVGKTIGLY  218

Query  213  FSASWCGPCHRFTPNLATVYN------ELLPKGNFEVVFVSADEDEESFKEYFGKMPWTA  374
            FS  WC P   FTP L +VYN      E+    +FE+VFVS+D DE+SF  YFG MPW A
Sbjct  219  FSGKWCLP-GMFTPKLISVYNKIKRMVEMKEDEDFEIVFVSSDRDEDSFHSYFGSMPWLA  277

Query  375  VPFSDSVTRERLDALFTVRGIPHLVILDESGKVTTEDGVDIVLEHGVEAYPF  530
            +PF D + RE L   F V+GIP L+IL  +GK  T+ G +++  +   AYPF
Sbjct  278  LPFGDPMIRE-LAKHFDVQGIPCLIILAPNGKTITKQGRNLINLYRENAYPF  328



>ref|XP_010263377.1| PREDICTED: probable nucleoredoxin 3 [Nelumbo nucifera]
 ref|XP_010263378.1| PREDICTED: probable nucleoredoxin 3 [Nelumbo nucifera]
Length=387

 Score =   134 bits (337),  Expect = 5e-34, Method: Compositional matrix adjust.
 Identities = 67/167 (40%), Positives = 95/167 (57%), Gaps = 5/167 (3%)
 Frame = +3

Query  36   FQFSKRKGEERKASSMAEQNGDAHDLRSILCSSDRDFLIRNSGHQVKVDDLKGKKIGIYF  215
            F FSK + EE KA    ++ G    L  +L   +RDF++  SG ++ V  L GK IG+YF
Sbjct  152  FPFSKERREELKAMDNVKRQGGK--LEDLLVLGERDFVVSGSGEKIPVSSLVGKAIGLYF  209

Query  216  SASWCGPCHRFTPNLATVYNEL--LPKGNFEVVFVSADEDEESFKEYFGKMPWTAVPFSD  389
             A WC PC  FT  L   YNEL      N E++F+S D D+E F      MPW A+P+ D
Sbjct  210  GAHWCPPCRAFTAQLTEAYNELNTTQNKNLEIIFISTDRDQEEFDLNIRTMPWLAIPYGD  269

Query  390  SVTRERLDALFTVRGIPHLVILDESGKVTTEDGVDIVLEHGVEAYPF  530
              TR+ L  +F ++GIP LV+L   GK+   +G  ++  +G +A+PF
Sbjct  270  R-TRQDLCRIFDIKGIPALVLLGPDGKILNTNGRALISSYGAKAFPF  315


 Score =   111 bits (278),  Expect = 9e-26, Method: Compositional matrix adjust.
 Identities = 61/147 (41%), Positives = 86/147 (59%), Gaps = 5/147 (3%)
 Frame = +3

Query  93   NGDAHDLRSILCSSDRDFLIRNSGHQVKVDDLKGKKIGIYFSASWCGPCHRFTPNLATVY  272
            NG A+   SIL S   +FL+   G +V +  L+ K I + FSA+WC PC  F P L  +Y
Sbjct  12   NGSANT--SILASEGVEFLLSAEG-KVPLSSLEQKTIYLVFSANWCRPCRNFIPQLVQLY  68

Query  273  NELLPKG-NFEVVFVSADEDEESFKEYFGKMPWTAVPFSDSVTRERLDALFTVRGIPHLV  449
            N L       E++FVS D DE  F+E+F  MPW A+PF D   R RL   + V  IP L+
Sbjct  69   NTLRKTNVKLEIIFVSFDRDENGFREHFKCMPWLALPF-DVSLRRRLCDRYHVDRIPSLI  127

Query  450  ILDESGKVTTEDGVDIVLEHGVEAYPF  530
             L   GK+  ED V+++ ++G++A+PF
Sbjct  128  PLCMEGKLVEEDAVELIEDYGIDAFPF  154



>ref|XP_006435250.1| hypothetical protein CICLE_v10001187mg [Citrus clementina]
 ref|XP_006473711.1| PREDICTED: probable nucleoredoxin 2-like isoform X2 [Citrus sinensis]
 gb|ESR48490.1| hypothetical protein CICLE_v10001187mg [Citrus clementina]
 gb|KDO84953.1| hypothetical protein CISIN_1g013684mg [Citrus sinensis]
Length=428

 Score =   134 bits (338),  Expect = 5e-34, Method: Compositional matrix adjust.
 Identities = 73/159 (46%), Positives = 99/159 (62%), Gaps = 6/159 (4%)
 Frame = +3

Query  72   ASSMAEQNGDAHDLR--SILCSSDRDFLIRNSGHQVKVDDLKGKKIGIYFSASWCGPCHR  245
             SS++E    +   R  S+L S DRD+L+   G QVKV DL+GK   +YFSA+W  PC  
Sbjct  19   GSSISEHQKISTSSRFSSLLASKDRDYLLNQHGTQVKVSDLEGKVTALYFSANWYPPCGN  78

Query  246  FTPNLATVYNELLPKG-NFEVVFVSADEDEESFKEYFGKMPWTAVPFSDSVTRERLDALF  422
            FT  L  VY EL   G +FEVVFVS+DED  +F  Y   MPW AVP+SD  T++ L+  F
Sbjct  79   FTGVLVDVYEELRNNGSDFEVVFVSSDEDLNAFNNYRACMPWLAVPYSDLETKKALNRKF  138

Query  423  TVRGIPHLVIL---DESGKVTTEDGVDIVLEHGVEAYPF  530
             + GIP LV+L   D+    T  DGV+++ ++G+ A+PF
Sbjct  139  DIEGIPCLVVLQPYDDKDDATLHDGVELIYKYGIRAFPF  177


 Score =   122 bits (306),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 67/152 (44%), Positives = 92/152 (61%), Gaps = 16/152 (11%)
 Frame = +3

Query  111  LRSILCSSDRDFLIRNSGH----QVKVDDLKGKKIGIYFSASWCGPCHRFTPNLATVYNE  278
            L ++L + DR +L+   GH    +V V  L GK +G+YFSA WC PC +F P L ++Y +
Sbjct  198  LINLLTNHDRGYLL---GHPPDEKVPVSSLVGKTVGLYFSARWCIPCEKFMPKLLSIYQK  254

Query  279  ----LLPKGN----FEVVFVSADEDEESFKEYFGKMPWTAVPFSDSVTRERLDALFTVRG  434
                L+ KG+    FEVVFVS D D+ SF+ YFG MPW A+PF D   +E L   F V+G
Sbjct  255  IKQNLVEKGDALEDFEVVFVSTDRDQTSFESYFGTMPWLALPFGDPTIKE-LTKYFDVQG  313

Query  435  IPHLVILDESGKVTTEDGVDIVLEHGVEAYPF  530
            IP LVI+   GK  T+ G +++  +   AYPF
Sbjct  314  IPCLVIIGPEGKTVTKQGRNLINLYQENAYPF  345



>ref|XP_007017890.1| DC1 domain-containing protein isoform 1 [Theobroma cacao]
 gb|EOY15115.1| DC1 domain-containing protein isoform 1 [Theobroma cacao]
Length=428

 Score =   134 bits (337),  Expect = 8e-34, Method: Compositional matrix adjust.
 Identities = 72/161 (45%), Positives = 100/161 (62%), Gaps = 15/161 (9%)
 Frame = +3

Query  93   NGDAHDLR-----SILCSSDRDFLIRNS------GHQVKVDDLKGKKIGIYFSASWCGPC  239
            NGD+  +      S+L S DRD+L+ +S        QVK+ DL+G+ IG+YFSA+W  PC
Sbjct  19   NGDSEKISTSRFSSLLASKDRDYLLSSSEAEAEADQQVKISDLEGRVIGLYFSANWYPPC  78

Query  240  HRFTPNLATVYNELLPKG-NFEVVFVSADEDEESFKEYFGKMPWTAVPFSDSVTRERLDA  416
              F   L  VY++L   G NFE+VFVS+DED ++F  Y   MPW ++PFSD  T++ L+ 
Sbjct  79   RNFNQVLVDVYDQLKSNGSNFEIVFVSSDEDLDAFNNYRKSMPWLSIPFSDLETKKALNR  138

Query  417  LFTVRGIPHLVIL---DESGKVTTEDGVDIVLEHGVEAYPF  530
             F V GIP L+IL   D     T  DGV+++  +GVEA+PF
Sbjct  139  KFEVEGIPCLIILQPEDNKDGATFYDGVELIYRYGVEAFPF  179


 Score =   119 bits (299),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 68/172 (40%), Positives = 98/172 (57%), Gaps = 10/172 (6%)
 Frame = +3

Query  36   FQFSKRKGEERKASSMAEQNGDAHDLRSILCSSDRDFLIRNS-GHQVKVDDLKGKKIGIY  212
            F F+K K EE +         +   L+++L + DRD+++      +V+VD L  K IG+Y
Sbjct  177  FPFTKEKLEELQREERMRH--ETQTLKNLLTNPDRDYILGQPITRKVQVDSLIDKTIGLY  234

Query  213  FSASWCGPCHRFTPNLATVYNE----LLPKG--NFEVVFVSADEDEESFKEYFGKMPWTA  374
            FSA WC P   FTP L ++Y +    L  KG  +F++VFVS D D+ SF  YFG MPW A
Sbjct  235  FSAQWCLPGVTFTPRLISIYQKIKQTLEEKGGEDFDIVFVSNDRDQSSFDTYFGSMPWLA  294

Query  375  VPFSDSVTRERLDALFTVRGIPHLVILDESGKVTTEDGVDIVLEHGVEAYPF  530
            +PF D   +  L   F V+GIP L+I+   GK  T+ G +++  +   AYPF
Sbjct  295  LPFGDPSIKS-LAKYFDVQGIPCLIIIGPDGKTVTKQGRNLINLYQENAYPF  345



>ref|XP_007017892.1| DC1 domain-containing protein isoform 3 [Theobroma cacao]
 gb|EOY15117.1| DC1 domain-containing protein isoform 3 [Theobroma cacao]
Length=427

 Score =   134 bits (337),  Expect = 8e-34, Method: Compositional matrix adjust.
 Identities = 72/160 (45%), Positives = 100/160 (63%), Gaps = 14/160 (9%)
 Frame = +3

Query  93   NGDAHDLR-----SILCSSDRDFLIRNS-----GHQVKVDDLKGKKIGIYFSASWCGPCH  242
            NGD+  +      S+L S DRD+L+ +S       QVK+ DL+G+ IG+YFSA+W  PC 
Sbjct  19   NGDSEKISTSRFSSLLASKDRDYLLSSSEAEAEADQVKISDLEGRVIGLYFSANWYPPCR  78

Query  243  RFTPNLATVYNELLPKG-NFEVVFVSADEDEESFKEYFGKMPWTAVPFSDSVTRERLDAL  419
             F   L  VY++L   G NFE+VFVS+DED ++F  Y   MPW ++PFSD  T++ L+  
Sbjct  79   NFNQVLVDVYDQLKSNGSNFEIVFVSSDEDLDAFNNYRKSMPWLSIPFSDLETKKALNRK  138

Query  420  FTVRGIPHLVIL---DESGKVTTEDGVDIVLEHGVEAYPF  530
            F V GIP L+IL   D     T  DGV+++  +GVEA+PF
Sbjct  139  FEVEGIPCLIILQPEDNKDGATFYDGVELIYRYGVEAFPF  178


 Score =   119 bits (299),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 68/172 (40%), Positives = 98/172 (57%), Gaps = 10/172 (6%)
 Frame = +3

Query  36   FQFSKRKGEERKASSMAEQNGDAHDLRSILCSSDRDFLIRNS-GHQVKVDDLKGKKIGIY  212
            F F+K K EE +         +   L+++L + DRD+++      +V+VD L  K IG+Y
Sbjct  176  FPFTKEKLEELQREERMRH--ETQTLKNLLTNPDRDYILGQPITRKVQVDSLIDKTIGLY  233

Query  213  FSASWCGPCHRFTPNLATVYNE----LLPKG--NFEVVFVSADEDEESFKEYFGKMPWTA  374
            FSA WC P   FTP L ++Y +    L  KG  +F++VFVS D D+ SF  YFG MPW A
Sbjct  234  FSAQWCLPGVTFTPRLISIYQKIKQTLEEKGGEDFDIVFVSNDRDQSSFDTYFGSMPWLA  293

Query  375  VPFSDSVTRERLDALFTVRGIPHLVILDESGKVTTEDGVDIVLEHGVEAYPF  530
            +PF D   +  L   F V+GIP L+I+   GK  T+ G +++  +   AYPF
Sbjct  294  LPFGDPSIKS-LAKYFDVQGIPCLIIIGPDGKTVTKQGRNLINLYQENAYPF  344



>sp|Q7XPE8.2|NRX3_ORYSJ RecName: Full=Probable nucleoredoxin 3; Short=OsNrx3 [Oryza sativa 
Japonica Group]
 emb|CAE03648.2| OSJNBa0060N03.13 [Oryza sativa Japonica Group]
Length=471

 Score =   134 bits (338),  Expect = 8e-34, Method: Compositional matrix adjust.
 Identities = 67/164 (41%), Positives = 96/164 (59%), Gaps = 6/164 (4%)
 Frame = +3

Query  45   SKRKGEERKASSMAEQNGDAHDLRSILCSSDRDFLIRNSGHQVKVDDLKGKKIGIYFSAS  224
            +KR+ E         Q G+   L  +L   +R+++I   G +  + DL GK IG+YF A 
Sbjct  158  AKRRSELEGMDDARRQGGN---LLQLLGCKEREYVISADGIKTPISDLNGKTIGLYFGAH  214

Query  225  WCGPCHRFTPNLATVYNEL--LPKGNFEVVFVSADEDEESFKEYFGKMPWTAVPFSDSVT  398
            WC PC  FT  L   Y+EL  L  GNF+V+F+S D +EE F+     MPW A+P+SD+  
Sbjct  215  WCPPCRAFTKQLREAYDELKALRPGNFQVIFISMDRNEEEFQASLSAMPWFAIPYSDTTV  274

Query  399  RERLDALFTVRGIPHLVILDESGKVTTEDGVDIVLEHGVEAYPF  530
            +E L  +FT++GIP L+IL   GKV   DG  I+ ++G  A+PF
Sbjct  275  QE-LSRIFTIKGIPTLLILGPDGKVFKTDGRRIISKYGAMAFPF  317


 Score =   114 bits (285),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 56/132 (42%), Positives = 81/132 (61%), Gaps = 5/132 (4%)
 Frame = +3

Query  147  LIRNSGHQVKVDDLKGKKIGIYFSASWCGPCHRFTPNLATVYNELLPK-GNFEVVFVSAD  323
            L+ N G ++ +  ++GK+I ++FSA WC PC  FTP L  +Y +L     N E++F+S D
Sbjct  26   LLSNGGKEIPLSSIEGKRICLFFSAHWCRPCRNFTPKLLQIYRKLRNTCKNMEIIFISLD  85

Query  324  EDEESFKEYFGKMPWTAVPFSDSVTRERLDALFTVRGIPHLVILDES---GKVTTEDGVD  494
             DE SF +YF  MPW A+PF D+  R++L   F +  IP L+ L  +   G    ED V 
Sbjct  86   RDEISFLDYFKGMPWLALPF-DTGLRQKLCVQFDIEHIPALIPLSTTLSHGFRVEEDAVK  144

Query  495  IVLEHGVEAYPF  530
            +V E+GV+AYPF
Sbjct  145  LVEEYGVDAYPF  156



>ref|XP_007136118.1| hypothetical protein PHAVU_009G019400g [Phaseolus vulgaris]
 gb|ESW08112.1| hypothetical protein PHAVU_009G019400g [Phaseolus vulgaris]
Length=418

 Score =   134 bits (336),  Expect = 9e-34, Method: Compositional matrix adjust.
 Identities = 66/164 (40%), Positives = 99/164 (60%), Gaps = 4/164 (2%)
 Frame = +3

Query  51   RKGEERKASSMAEQNGDAHDLRSILCSSDRDFLIRNSGHQVKVDDLKGKKIGIYFSASWC  230
            R   + +A ++     +      +L S DRD+L+  +G QVKV DL+GK +G+ F+A+W 
Sbjct  2    RAEMKHEAQAVVNNICNTGKFSQLLASQDRDYLLSPTGSQVKVSDLEGKVVGLLFAANWY  61

Query  231  GPCHRFTPNLATVYNELLPK-GNFEVVFVSADEDEESFKEYFGKMPWTAVPFSDSVTRER  407
             PC  FT  L  +Y EL      FE+V+VS+DED ++F  ++G MPW A+PFSD  T++ 
Sbjct  62   PPCRGFTQVLVGIYEELKSSFREFEIVYVSSDEDLDAFSSFYGNMPWLAIPFSDLETKKS  121

Query  408  LDALFTVRGIPHLVIL---DESGKVTTEDGVDIVLEHGVEAYPF  530
            L   + V GIP L+ L   D   + T  DGV+++  +GV+AYPF
Sbjct  122  LTRKYDVEGIPCLIFLQPQDRKDQATVRDGVELIYRYGVQAYPF  165


 Score =   115 bits (289),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 68/171 (40%), Positives = 97/171 (57%), Gaps = 13/171 (8%)
 Frame = +3

Query  45   SKRKGEERKASSMAEQNGDAHDLRSILCSSDRDFLIRNSG---HQVKVDDLKGKKIGIYF  215
            ++R  + RK   +  +N     L ++L +  RD+++ ++     QV +  L GK I +YF
Sbjct  167  NERLEQLRKEDKIKREN---QTLLNLLSNRHRDYVLSHTHFGLKQVPLASLVGKTIALYF  223

Query  216  SASWCGPCHRFTPNLATVY----NELLPKG--NFEVVFVSADEDEESFKEYFGKMPWTAV  377
            SA WC PC +FTP L +VY     EL  KG  +FEVV VS+D D+ SF  Y+  MPW A+
Sbjct  224  SAEWCVPCAKFTPKLISVYEKIKQELAEKGEEDFEVVLVSSDRDKASFDSYYSSMPWLAL  283

Query  378  PFSDSVTRERLDALFTVRGIPHLVILDESGKVTTEDGVDIVLEHGVEAYPF  530
            PF D+ T+  L   F V+GIP LVI+   GK  T  G  ++  +   AYPF
Sbjct  284  PFGDTETKN-LVRHFNVQGIPWLVIIGPDGKTITVHGRSLINLYRENAYPF  333



>gb|EEC77960.1| hypothetical protein OsI_17320 [Oryza sativa Indica Group]
 gb|EEE61648.1| hypothetical protein OsJ_16096 [Oryza sativa Japonica Group]
Length=448

 Score =   134 bits (337),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 67/164 (41%), Positives = 96/164 (59%), Gaps = 6/164 (4%)
 Frame = +3

Query  45   SKRKGEERKASSMAEQNGDAHDLRSILCSSDRDFLIRNSGHQVKVDDLKGKKIGIYFSAS  224
            +KR+ E         Q G+   L  +L   +R+++I   G +  + DL GK IG+YF A 
Sbjct  158  AKRRSELEGMDDARRQGGN---LLQLLGCKEREYVISADGIKTPISDLNGKTIGLYFGAH  214

Query  225  WCGPCHRFTPNLATVYNEL--LPKGNFEVVFVSADEDEESFKEYFGKMPWTAVPFSDSVT  398
            WC PC  FT  L   Y+EL  L  GNF+V+F+S D +EE F+     MPW A+P+SD+  
Sbjct  215  WCPPCRAFTKQLREAYDELKALRPGNFQVIFISMDRNEEEFQASLSAMPWFAIPYSDTTV  274

Query  399  RERLDALFTVRGIPHLVILDESGKVTTEDGVDIVLEHGVEAYPF  530
            +E L  +FT++GIP L+IL   GKV   DG  I+ ++G  A+PF
Sbjct  275  QE-LSRIFTIKGIPTLLILGPDGKVFKTDGRRIISKYGAMAFPF  317


 Score =   113 bits (283),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 56/132 (42%), Positives = 81/132 (61%), Gaps = 5/132 (4%)
 Frame = +3

Query  147  LIRNSGHQVKVDDLKGKKIGIYFSASWCGPCHRFTPNLATVYNELLPK-GNFEVVFVSAD  323
            L+ N G ++ +  ++GK+I ++FSA WC PC  FTP L  +Y +L     N E++F+S D
Sbjct  26   LLSNGGKEIPLSSIEGKRICLFFSAHWCRPCRNFTPKLLQIYRKLRNTCKNMEIIFISLD  85

Query  324  EDEESFKEYFGKMPWTAVPFSDSVTRERLDALFTVRGIPHLVILDES---GKVTTEDGVD  494
             DE SF +YF  MPW A+PF D+  R++L   F +  IP L+ L  +   G    ED V 
Sbjct  86   RDEISFLDYFKGMPWLALPF-DTGLRQKLCVQFDIEHIPALIPLSTTLSHGFRVEEDAVK  144

Query  495  IVLEHGVEAYPF  530
            +V E+GV+AYPF
Sbjct  145  LVEEYGVDAYPF  156



>ref|XP_006386162.1| hypothetical protein POPTR_0002s01870g [Populus trichocarpa]
 gb|ERP63959.1| hypothetical protein POPTR_0002s01870g [Populus trichocarpa]
Length=427

 Score =   134 bits (336),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 70/166 (42%), Positives = 99/166 (60%), Gaps = 5/166 (3%)
 Frame = +3

Query  48   KRKGEERKASSMAEQNGDAHDLRSILCSSDRDFLIRNSGHQVKVDDLKGKKIGIYFSASW  227
            K +  E + +    Q   +    S+L + DRD+L+   G QVKV DL+GK +G+YFSA+W
Sbjct  12   KLQASEDEVNGDHSQKISSSRFSSLLATKDRDYLLSQDGTQVKVSDLEGKVLGLYFSANW  71

Query  228  CGPCHRFTPN-LATVYNELLPKG-NFEVVFVSADEDEESFKEYFGKMPWTAVPFSDSVTR  401
              PC  FT   L   Y  L  KG NFE+VF+S+DED ++F  Y   MPW ++PFSD  T+
Sbjct  72   YVPCRSFTTQVLVGAYEHLKSKGSNFEIVFISSDEDLDAFNNYRANMPWLSIPFSDLETK  131

Query  402  ERLDALFTVRGIPHLVIL---DESGKVTTEDGVDIVLEHGVEAYPF  530
              L++ F +  IP LVIL   D   + T  DGV+++   GV+A+PF
Sbjct  132  RALNSKFEIEAIPFLVILQPEDNKYEATIHDGVELLNRFGVQAFPF  177


 Score =   117 bits (294),  Expect = 6e-28, Method: Compositional matrix adjust.
 Identities = 63/151 (42%), Positives = 91/151 (60%), Gaps = 9/151 (6%)
 Frame = +3

Query  102  AHDLRSILCSSDRDFLIRN-SGHQVKVDDLKGKKIGIYFSASWCGPCHRFTPNLATVYNE  278
            +  L ++L + DRD+L+ + +  QV V  L GK +G+YFSA WC P  +FTP L ++Y +
Sbjct  195  SQTLINLLTNHDRDYLLGHPAAKQVPVASLVGKTLGLYFSAQWCLPGVKFTPKLISIYQK  254

Query  279  L----LPKGN---FEVVFVSADEDEESFKEYFGKMPWTAVPFSDSVTRERLDALFTVRGI  437
            +    + KGN   FE+VFVS+D D+ +F  YF  MPW  +PF D   +  L   F V+GI
Sbjct  255  IKQMVVHKGNEDDFEIVFVSSDRDQAAFDSYFNSMPWLTLPFGDPANK-ILAKHFDVKGI  313

Query  438  PHLVILDESGKVTTEDGVDIVLEHGVEAYPF  530
            P LVIL   GK  T+ G +++  +   AYPF
Sbjct  314  PCLVILGPDGKTVTKHGRNLINLYKENAYPF  344



>ref|XP_004238384.1| PREDICTED: probable nucleoredoxin 2 [Solanum lycopersicum]
Length=440

 Score =   134 bits (336),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 70/149 (47%), Positives = 93/149 (62%), Gaps = 8/149 (5%)
 Frame = +3

Query  108  DLRSILCSSDRDFLIRNSGHQVKVDDLKGKKIGIYFSASWCGPCHRFTPNLATVYNELLP  287
            D  SIL S D +FL+  +G QVKV +L+GK +G+YFSA+W  PC +FT  L  VY +L  
Sbjct  45   DYLSILASKDGEFLLSPTGAQVKVSELEGKVVGLYFSANWYSPCTKFTNLLVNVYQQLKE  104

Query  288  KGN----FEVVFVSADEDEESFKEYFGKMPWTAVPFSDSVTRERLDALFTVRGIPHLVIL  455
              N    FE+VFVS+DED  +F  Y   MPW A+PFSD  TR  L   F V GIP L++L
Sbjct  105  CSNINLGFEIVFVSSDEDLNAFNTYRSSMPWLAIPFSDLETRRALTQKFDVEGIPCLIVL  164

Query  456  ----DESGKVTTEDGVDIVLEHGVEAYPF  530
                D+      +DGV++V  +GV+A+PF
Sbjct  165  LPNDDKLDTAVIKDGVELVYRYGVQAFPF  193


 Score =   123 bits (308),  Expect = 9e-30, Method: Compositional matrix adjust.
 Identities = 71/175 (41%), Positives = 97/175 (55%), Gaps = 16/175 (9%)
 Frame = +3

Query  36   FQFSKRKGEERKASSMAEQNGDAHDLRSILCSSDRDFLIRNSGH----QVKVDDLKGKKI  203
            F F+K + +E +     ++  D   L S+L    RD L   SGH    QV V  LKGK +
Sbjct  191  FPFTKERLDELRKKE--KEKRDNQTLSSLLTHDARDVL---SGHPSPKQVSVASLKGKTV  245

Query  204  GIYFSASWCGPCHRFTPNLATVYNELLPK------GNFEVVFVSADEDEESFKEYFGKMP  365
            G+YFSA WC P  +FTP L +VY ++  +       +FE+VFVS+D ++  F  YF  MP
Sbjct  246  GLYFSAQWCNPAKKFTPRLISVYKKIKQQLEGKDDEDFEIVFVSSDHNQVDFTTYFETMP  305

Query  366  WTAVPFSDSVTRERLDALFTVRGIPHLVILDESGKVTTEDGVDIVLEHGVEAYPF  530
            W A+PF D  T + L   F +RGIP LVIL   GK  T+ G  ++  +   AYPF
Sbjct  306  WLAIPFDDP-TIKALAKYFDIRGIPSLVILGPDGKTVTKQGRSLINLYKENAYPF  359



>ref|XP_003603818.1| Nucleoredoxin [Medicago truncatula]
 gb|AES74069.1| nucleoredoxin, putative [Medicago truncatula]
Length=429

 Score =   134 bits (336),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 64/143 (45%), Positives = 98/143 (69%), Gaps = 8/143 (6%)
 Frame = +3

Query  120  ILCSSDRDFLIRNSGHQVKVDDLKGKKIGIYFSASWCGPCHRFTPNLATVYNEL---LPK  290
            +L S DRDFL+ ++G QVK+ +L+GK +G+ F+A+W  PC  FT  L  +Y +L   +P+
Sbjct  40   LLASKDRDFLLSSTGTQVKISELEGKVVGLLFAANWYPPCRGFTQLLIGIYEQLKSNIPQ  99

Query  291  GNFEVVFVSADEDEESFKEYFGKMPWTAVPFSDSVTRERLDALFTVRGIPHLVILD---E  461
              FE+V+VS+DED ++F  ++G MPW A+PFSD  T++ L+  + V GIP LV+L     
Sbjct  100  --FEIVYVSSDEDLDAFNGFYGNMPWLAIPFSDLETKKALNRKYDVEGIPCLVMLQPDHS  157

Query  462  SGKVTTEDGVDIVLEHGVEAYPF  530
             G+ T  DGV+++  +GV+AYPF
Sbjct  158  KGEATLRDGVELIYRYGVQAYPF  180


 Score =   117 bits (294),  Expect = 6e-28, Method: Compositional matrix adjust.
 Identities = 69/177 (39%), Positives = 98/177 (55%), Gaps = 15/177 (8%)
 Frame = +3

Query  36   FQFSKRKGEERKASSMAEQNGDAHDLRSILCSSDRDFLIRNSGH----QVKVDDLKGKKI  203
            + FSK + E+   +    +  +   L ++L ++ RD+++ ++G     QV V  L GK I
Sbjct  178  YPFSKERLEQLHVAE--REKLENQTLANLLANNHRDYVLSHTGTGLLTQVPVASLVGKTI  235

Query  204  GIYFSASWCGPCHRFTPNLATVY----NELL----PKGNFEVVFVSADEDEESFKEYFGK  359
            G+YFSA WC PC +FTP L  VY     EL     P  +FE+V VS D D+ESF  Y+  
Sbjct  236  GLYFSAGWCVPCTKFTPKLINVYQIIKQELAEKQDPHEDFEIVLVSNDRDQESFDSYYNI  295

Query  360  MPWTAVPFSDSVTRERLDALFTVRGIPHLVILDESGKVTTEDGVDIVLEHGVEAYPF  530
            MPW A+PF D   +  L   F V+GIP LVI+   GK  T  G +++  +   AYPF
Sbjct  296  MPWLALPFGDPEIK-NLARHFDVQGIPCLVIIGPDGKTITIHGRNLINLYQENAYPF  351



>ref|XP_004976749.1| PREDICTED: probable nucleoredoxin 3-like [Setaria italica]
Length=389

 Score =   133 bits (334),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 69/168 (41%), Positives = 96/168 (57%), Gaps = 7/168 (4%)
 Frame = +3

Query  36   FQFS-KRKGEERKASSMAEQNGDAHDLRSILCSSDRDFLIRNSGHQVKVDDLKGKKIGIY  212
            + FS KR+GE         Q G    L+ +L   DRD+++   G +V + DL GK +G+Y
Sbjct  150  YPFSVKRRGELEAIDDARRQGGK---LQELLGCKDRDYVVSAYGTKVSIADLTGKTVGLY  206

Query  213  FSASWCGPCHRFTPNLATVYNEL--LPKGNFEVVFVSADEDEESFKEYFGKMPWTAVPFS  386
            F A WC PC  FT  L  VYNEL  L   +FEV+F+S D  +E F+E     PW A+P+S
Sbjct  207  FGAHWCPPCRAFTKQLMEVYNELKILRPRSFEVIFISIDRSKEEFEESLSATPWLAIPYS  266

Query  387  DSVTRERLDALFTVRGIPHLVILDESGKVTTEDGVDIVLEHGVEAYPF  530
            D+  R+ L  +F ++GIP L+IL   GKV   DG   +  +G  A+PF
Sbjct  267  DT-ARQELTRIFAIKGIPALLILGLDGKVLKTDGRTAISTYGATAFPF  313


 Score =   110 bits (276),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 57/132 (43%), Positives = 81/132 (61%), Gaps = 5/132 (4%)
 Frame = +3

Query  147  LIRNSGHQVKVDDLKGKKIGIYFSASWCGPCHRFTPNLATVYNELLPKG-NFEVVFVSAD  323
            L+ N G +V +  ++GK   ++FSA WC PC  FTP L  +Y  L   G N E++F+S D
Sbjct  22   LLSNGGKEVPLSSIEGKVTCLFFSAHWCRPCRNFTPKLVQIYTMLRNTGKNIEIIFISLD  81

Query  324  EDEESFKEYFGKMPWTAVPFSDSVTRERLDALFTVRGIPHLVILD--ESGKVT-TEDGVD  494
             DE SF ++F  MPW A+PF+ S+ R +L + F +  IP L+ L    SG++   ED V 
Sbjct  82   HDETSFLDHFKSMPWLALPFNSSL-RRKLCSHFGIEHIPALIPLSVTPSGELGFEEDAVK  140

Query  495  IVLEHGVEAYPF  530
            +V E+G EAYPF
Sbjct  141  LVEEYGAEAYPF  152



>ref|XP_004167003.1| PREDICTED: probable nucleoredoxin 2-like [Cucumis sativus]
Length=410

 Score =   133 bits (334),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 67/143 (47%), Positives = 92/143 (64%), Gaps = 5/143 (3%)
 Frame = +3

Query  117  SILCSSDRDFLIRNSGHQVKVDDLKGKKIGIYFSASWCGPCHRFTPNLATVYNELLPKG-  293
            S+L S DRD+L+  +G QVKV +L GK +G+YFSA+W  PC  F   L   Y +L   G 
Sbjct  21   SLLASGDRDYLLSPTGAQVKVSNLDGKVLGLYFSANWYPPCRNFNQILVRTYEKLQDNGS  80

Query  294  NFEVVFVSADEDEESFKEYFGKMPWTAVPFSDSVTRERLDALFTVRGIPHLVILD----E  461
            NFEVV+VS+DED ++F EY   MPW A+PFSD  T+  L+  F + GIP L+IL     +
Sbjct  81   NFEVVYVSSDEDSDAFNEYRASMPWPAIPFSDLETKIALNRKFGIEGIPCLIILQPRESK  140

Query  462  SGKVTTEDGVDIVLEHGVEAYPF  530
                T  +GV++V  +GV+A+PF
Sbjct  141  DETATLHEGVEVVYRYGVDAFPF  163


 Score =   117 bits (293),  Expect = 9e-28, Method: Compositional matrix adjust.
 Identities = 68/172 (40%), Positives = 102/172 (59%), Gaps = 11/172 (6%)
 Frame = +3

Query  36   FQFSKRKGEERKASSMAEQNGDAHDLRSILCSSDRDFLIRNS-GHQVKVDDLKGKKIGIY  212
            F F++ + E+ K     ++  +   L ++L ++ RD+L  +S   QV V  L GK +G+Y
Sbjct  161  FPFTQERLEQLKEEDREKE--ENQTLVTLLTNNYRDYLFAHSFPKQVPVVSLVGKTVGLY  218

Query  213  FSASWCGPCHRFTPNLATVYN------ELLPKGNFEVVFVSADEDEESFKEYFGKMPWTA  374
            FSA WC P   FTP L +VY+      E+    +FE+VFVS+D DE+SF  YFG MPW  
Sbjct  219  FSAKWCLP-GMFTPKLISVYSKIKRMVEMKEDEDFEIVFVSSDRDEDSFHSYFGSMPWLG  277

Query  375  VPFSDSVTRERLDALFTVRGIPHLVILDESGKVTTEDGVDIVLEHGVEAYPF  530
            +P+ D + +E L   F V+GIP L+IL  +GK  T+ G +++  +   AYPF
Sbjct  278  LPYGDPMIKE-LAKHFDVQGIPCLIILAPNGKTITKQGRNLINLYRENAYPF  328



>ref|XP_010100128.1| hypothetical protein L484_014319 [Morus notabilis]
 gb|EXB81511.1| hypothetical protein L484_014319 [Morus notabilis]
Length=472

 Score =   133 bits (335),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 66/143 (46%), Positives = 93/143 (65%), Gaps = 5/143 (3%)
 Frame = +3

Query  117  SILCSSDRDFLIRNSGHQVKVDDLKGKKIGIYFSASWCGPCHRFTPNLATVYNELLPKG-  293
            S+L S DRD+L+   G+QVK+ DL GK +G+YFSA+W  PC  F   L  +Y +L   G 
Sbjct  33   SLLASKDRDYLLSPKGNQVKISDLNGKVVGLYFSANWYPPCRNFNQVLVEIYEQLKQSGS  92

Query  294  NFEVVFVSADEDEESFKEYF-GKMPWTAVPFSDSVTRERLDALFTVRGIPHLVIL---DE  461
            NFE+V+VS+DED  +F  Y+   MPW A+PFSD  T++ L+  F + GIP LV+L   D 
Sbjct  93   NFEIVYVSSDEDIAAFNTYYHACMPWLAIPFSDLETKKALNRKFDIEGIPCLVVLQPNDN  152

Query  462  SGKVTTEDGVDIVLEHGVEAYPF  530
              + T  DGV++V  +GV+ +PF
Sbjct  153  KDEATLFDGVELVYRYGVQVFPF  175


 Score =   113 bits (283),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 70/183 (38%), Positives = 100/183 (55%), Gaps = 22/183 (12%)
 Frame = +3

Query  30   SIFQFSKRKGEERKASSMAEQNGDAHDLRSILCSSDRDFLIRNSGH----QVKVDDLKGK  197
             +F F+K + EE +      +  +  +L ++L S  RD+L+   GH    QV V  L GK
Sbjct  171  QVFPFTKERLEELQRED--RERHENQNLTNLLTSQHRDYLL---GHPRPKQVHVASLVGK  225

Query  198  KIGIYFSASWCGPCHRFTPNLATVYNELLP-----KGN-------FEVVFVSADEDEESF  341
             IG++FSA W  PC +F   L + Y+++       +GN       FE+VFVS+D D+ SF
Sbjct  226  TIGLFFSAEWGIPCVKFITKLMSNYHKIKQMIADKQGNNGHDDEDFEIVFVSSDHDQTSF  285

Query  342  KEYFGKMPWTAVPFSDSVTRERLDALFTVRGIPHLVILDESGKVTTEDGVDIVLEHGVEA  521
              YFG MPW A+PF D   +  L   F V+GIP LVIL   GK  T +G +++  +   A
Sbjct  286  DFYFGSMPWLALPFGDPNIK-NLVKHFDVKGIPSLVILGPDGKTITRNGRNLINLYQENA  344

Query  522  YPF  530
            YPF
Sbjct  345  YPF  347



>ref|XP_010913793.1| PREDICTED: probable nucleoredoxin 3 [Elaeis guineensis]
Length=387

 Score =   132 bits (333),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 67/167 (40%), Positives = 100/167 (60%), Gaps = 5/167 (3%)
 Frame = +3

Query  36   FQFSKRKGEERKASSMAEQNGDAHDLRSILCSSDRDFLIRNSGHQVKVDDLKGKKIGIYF  215
            F F   + +E +A   A+++G    L  +L  + RD++I + G ++ + DL GK IG+YF
Sbjct  151  FPFGVERRKELEAVDEAKRHGGK--LEELLGCNGRDYVISSDGAKIPIADLVGKTIGLYF  208

Query  216  SASWCGPCHRFTPNLATVYNELLPKGN--FEVVFVSADEDEESFKEYFGKMPWTAVPFSD  389
             A WC PC  FT  LA  YNEL    N  F+++F+S D DE+ F+    +MPW A+P++D
Sbjct  209  GAHWCPPCRTFTSMLAEAYNELRDAKNESFQIIFISTDRDEDEFQSSLEEMPWLAIPYAD  268

Query  390  SVTRERLDALFTVRGIPHLVILDESGKVTTEDGVDIVLEHGVEAYPF  530
              TR  L  +F V+GIP LV+L   GKV   DG  ++  +G +A+PF
Sbjct  269  K-TRYDLSRIFDVKGIPRLVLLGADGKVLGTDGRAMISSYGAKAFPF  314


 Score =   104 bits (260),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 57/150 (38%), Positives = 85/150 (57%), Gaps = 6/150 (4%)
 Frame = +3

Query  87   EQNGDAHDLRSILCSSDRDFLIRNSGHQVKVDDLKGKKIGIYFSASWCGPCHRFTPNLAT  266
            +  G+ H  RSIL  +  +FL+     +V +  ++GK I +++SA+WC PC  FT +L  
Sbjct  8    DMEGEIH--RSILAEAGVEFLLSGE-EKVPLSCIEGKTICLFYSANWCRPCRNFTTHLVQ  64

Query  267  VYNELLPK--GNFEVVFVSADEDEESFKEYFGKMPWTAVPFSDSVTRERLDALFTVRGIP  440
            +Y  L  +     E+VFVS D DE SF ++F  MPW AVPF D   R++L     +  IP
Sbjct  65   LYTTLKTQLGKKLEIVFVSLDRDENSFLDHFKHMPWLAVPF-DVNIRKQLSGRLLIEHIP  123

Query  441  HLVILDESGKVTTEDGVDIVLEHGVEAYPF  530
             L+ L   G+   ED V +V + G +A+PF
Sbjct  124  SLIPLAPDGRTKKEDAVQLVEDFGPDAFPF  153



>gb|AFW59396.1| hypothetical protein ZEAMMB73_974140 [Zea mays]
Length=432

 Score =   132 bits (332),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 67/167 (40%), Positives = 98/167 (59%), Gaps = 5/167 (3%)
 Frame = +3

Query  36   FQFSKRKGEERKASSMAEQNGDAHDLRSILCSSDRDFLIRNSGHQVKVDDLKGKKIGIYF  215
            + FS ++   R+  SM +   +   L+ +L   +RD++I     ++ + DL GK +G+YF
Sbjct  193  YPFSAQR--RRELESMDDARREGGRLQELLGCEERDYVISADDIKIPIADLDGKTVGLYF  250

Query  216  SASWCGPCHRFTPNLATVYNEL--LPKGNFEVVFVSADEDEESFKEYFGKMPWTAVPFSD  389
             A WC PCH FT  L  VYNEL  L  G+FEV+FVS D  +  F+     MPW A+P+SD
Sbjct  251  GAHWCPPCHVFTKQLKEVYNELKILRPGSFEVIFVSIDRSKGEFQASMSSMPWLAIPYSD  310

Query  390  SVTRERLDALFTVRGIPHLVILDESGKVTTEDGVDIVLEHGVEAYPF  530
            +  R++L  +F V+GIP L+IL   GKV   DG   +  +G  A+PF
Sbjct  311  A-ARKKLTRIFAVKGIPGLLILGLDGKVLKTDGRTAISTYGAAAFPF  356


 Score =   108 bits (271),  Expect = 9e-25, Method: Compositional matrix adjust.
 Identities = 58/138 (42%), Positives = 82/138 (59%), Gaps = 9/138 (7%)
 Frame = +3

Query  144  FLIRNSGHQVKVDDLKGKK--IGIYFSASWCGPCHRFTPNLATVYNELLPKG-NFEVVFV  314
            FL+ N G +V +  ++ +   + ++FSA WC PC  FTP L   Y  L   G + E++FV
Sbjct  58   FLLSNEGKEVPLSSIEDRTACLCLFFSAHWCRPCRSFTPTLLQAYTALRSAGKSVEIIFV  117

Query  315  SADEDEESFKEYFGKMPWTAVPF-SDSVTRERLDALFTVRGIPHLVILD-----ESGKVT  476
            S D DE SF+++F  MPW AVPF +  + R++L A F V  IP L+ L       SG  +
Sbjct  118  SLDRDEASFRDHFQGMPWLAVPFDAAGLLRQKLCARFAVERIPALIPLSASATPSSGLGS  177

Query  477  TEDGVDIVLEHGVEAYPF  530
             ED V +V E+GV+AYPF
Sbjct  178  GEDAVRLVGEYGVDAYPF  195



>ref|XP_008377128.1| PREDICTED: probable nucleoredoxin 2 [Malus domestica]
Length=443

 Score =   132 bits (332),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 67/136 (49%), Positives = 90/136 (66%), Gaps = 4/136 (3%)
 Frame = +3

Query  135  DRDFLIRNSGHQVKVDDLKGKKIGIYFSASWCGPCHRFTPNLATVYNELLPKG-NFEVVF  311
            DRD+L+  +G+QVKV DL    IG+YFSA+W  PC  F   L  +Y +L   G NFE+V+
Sbjct  47   DRDYLLSPTGNQVKVSDLNEMIIGLYFSANWYPPCWNFNQVLVGIYEQLKSSGSNFEIVY  106

Query  312  VSADEDEESFKEYFGKMPWTAVPFSDSVTRERLDALFTVRGIPHLVIL---DESGKVTTE  482
            VS+DED E+F +Y   MPW A+PFSD  T++ L+  F V  IP LVIL   D   +VT  
Sbjct  107  VSSDEDSEAFNKYHACMPWLAIPFSDLDTKKALNRKFDVESIPSLVILQPNDNKEEVTLH  166

Query  483  DGVDIVLEHGVEAYPF  530
            DGV+I+  +GV+A+PF
Sbjct  167  DGVEIIYRYGVDAFPF  182


 Score =   127 bits (319),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 73/177 (41%), Positives = 101/177 (57%), Gaps = 18/177 (10%)
 Frame = +3

Query  36   FQFSKRKGEERKASSMAEQNGDAHDLRSILCSSDRDFLIRNSGH----QVKVDDLKGKKI  203
            F F++++ EE +    A    +   L ++L + DRD+L+   GH    QV V  L GK I
Sbjct  180  FPFTEQRLEELQDEERARH--ENQTLTNLLTAHDRDYLL---GHPMPKQVSVASLSGKTI  234

Query  204  GIYFSASWCGPCHRFTPNLATVYNELLPK--------GNFEVVFVSADEDEESFKEYFGK  359
            G+YFSA WC PC  FTP L ++Y+ +  K         +FE+VFVS+D D+ SF  YF  
Sbjct  235  GLYFSAQWCRPCVNFTPKLISIYDMIKEKVLEDDHDGEDFEIVFVSSDRDQTSFDSYFNT  294

Query  360  MPWTAVPFSDSVTRERLDALFTVRGIPHLVILDESGKVTTEDGVDIVLEHGVEAYPF  530
            MPW A+PF D   +E L   F V+GIP LVIL   GK  T+ G +++  +   AYPF
Sbjct  295  MPWLALPFGDPNIKE-LVKHFDVKGIPLLVILGPDGKTVTQQGRNLINLYKENAYPF  350



>ref|XP_004291331.1| PREDICTED: probable nucleoredoxin 2 [Fragaria vesca subsp. vesca]
Length=435

 Score =   132 bits (332),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 68/150 (45%), Positives = 96/150 (64%), Gaps = 10/150 (7%)
 Frame = +3

Query  111  LRSILCSSDRDFLIRNSGHQVKVDDLKGKKIGIYFSASWCGPCHRFTPNLATVYNEL---  281
            + S+L S DRD+L+  +G+QVKV DL GK IG+YFSA+W  PC  F   L  +YN+L   
Sbjct  35   ISSLLASPDRDYLLSPTGNQVKVSDLDGKIIGLYFSANWYPPCWNFNKVLVGIYNQLKNS  94

Query  282  -LPKGNFEVVFVSADEDEESFKEYFGK-MPWTAVPFSDSVTRERLDALFTVRGIPHLVIL  455
                 +FE+V++S+DED ++F  Y    MPW A+PFSD  T++ L+  F V GIP LVIL
Sbjct  95   STTGSSFEIVYISSDEDTDAFVRYHAACMPWLAIPFSDLETKKALNRKFEVEGIPSLVIL  154

Query  456  D-----ESGKVTTEDGVDIVLEHGVEAYPF  530
                  +  + T  DGV+I+  +GV+A+PF
Sbjct  155  QPGDYKDGDEATLRDGVEIIYRYGVQAFPF  184


 Score =   119 bits (297),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 67/176 (38%), Positives = 99/176 (56%), Gaps = 14/176 (8%)
 Frame = +3

Query  36   FQFSKRKGEERKASSMAEQNGDAHDLRSILCSSDRDFLI-RNSGHQVKVDDLKGKKIGIY  212
            F F+K++ E+ +     +    +  L ++L + DR +L+   + +QV V  L GK +G+Y
Sbjct  182  FPFTKQRLEQLEKEEKEKHENQS--LTNLLTNHDRHYLLGHGTPNQVPVASLIGKTVGLY  239

Query  213  FSASWCGPCHRFTPNLATVYNELLPK----------GNFEVVFVSADEDEESFKEYFGKM  362
            FSA WC PC  FTP L ++YN++  +           +FE+VFVS+D D  SF+ YF  M
Sbjct  240  FSAQWCIPCVNFTPRLVSIYNKIKEQMLVGDQQQDGEDFEIVFVSSDRDRTSFEAYFSTM  299

Query  363  PWTAVPFSDSVTRERLDALFTVRGIPHLVILDESGKVTTEDGVDIVLEHGVEAYPF  530
            PW A+PF D   +E L   F V+ IP LVIL   GK  T  G +++  +   AYPF
Sbjct  300  PWLALPFDDPNIKE-LVKHFDVKAIPCLVILGPDGKTVTRQGRNLINLYKENAYPF  354



>ref|XP_008387909.1| PREDICTED: probable nucleoredoxin 2 [Malus domestica]
Length=436

 Score =   132 bits (332),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 67/137 (49%), Positives = 90/137 (66%), Gaps = 4/137 (3%)
 Frame = +3

Query  132  SDRDFLIRNSGHQVKVDDLKGKKIGIYFSASWCGPCHRFTPNLATVYNELLPKG-NFEVV  308
             D D+L+  +G+QVKV DL+GK IG+YFSA+W  PC  F   L  +Y +L   G NFE+V
Sbjct  47   QDHDYLLTPTGNQVKVSDLEGKIIGLYFSANWYPPCWNFNQVLVGIYEQLKNSGTNFEIV  106

Query  309  FVSADEDEESFKEYFGKMPWTAVPFSDSVTRERLDALFTVRGIPHLVIL---DESGKVTT  479
            +VS+DED ++F  Y   MPW A+PFSD  T++ L+  F V  IP LVIL   D   + T 
Sbjct  107  YVSSDEDSDAFNIYHACMPWLAIPFSDLDTKKALNRKFDVESIPSLVILQPNDNKDEATL  166

Query  480  EDGVDIVLEHGVEAYPF  530
             DGV+I+  +GVEA+PF
Sbjct  167  HDGVEIIYRYGVEAFPF  183


 Score =   129 bits (324),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 72/174 (41%), Positives = 100/174 (57%), Gaps = 12/174 (7%)
 Frame = +3

Query  36   FQFSKRKGEERKASSMAEQNGDAHDLRSILCSSDRDFLIRN-SGHQVKVDDLKGKKIGIY  212
            F F+K+K EE +    A        L ++L + DRD+L+ + +  QV V  L+GK IG+Y
Sbjct  181  FPFTKQKLEELQDEDRARHENQT--LTNLLTNHDRDYLLGHPTPKQVSVASLRGKTIGLY  238

Query  213  FSASWCGPCHRFTPNLATVYNELLPK--------GNFEVVFVSADEDEESFKEYFGKMPW  368
            FSA WC PC  FTP L ++Y ++  K         +FE+V VS+D D+ SF  YF  MPW
Sbjct  239  FSAQWCRPCVNFTPKLISIYEKIKEKMLVDDHDGEDFEIVLVSSDRDQTSFDSYFNTMPW  298

Query  369  TAVPFSDSVTRERLDALFTVRGIPHLVILDESGKVTTEDGVDIVLEHGVEAYPF  530
             A+PF D   +E L   F V+GIP LVIL   GK  T+ G +++  +   AYPF
Sbjct  299  LALPFGDPNIKE-LVKHFDVKGIPCLVILGPDGKTVTQQGRNLINLYKENAYPF  351



>gb|KHN09060.1| Putative nucleoredoxin 2 [Glycine soja]
Length=411

 Score =   132 bits (331),  Expect = 5e-33, Method: Compositional matrix adjust.
 Identities = 62/157 (39%), Positives = 97/157 (62%), Gaps = 4/157 (3%)
 Frame = +3

Query  72   ASSMAEQNGDAHDLRSILCSSDRDFLIRNSGHQVKVDDLKGKKIGIYFSASWCGPCHRFT  251
            A  +   NG+      +L S DRD+L+  +G QVKV DL+G+ +G+ F+A+W  PC  FT
Sbjct  5    AQVVVNDNGNYGKFSHLLASQDRDYLLSPTGAQVKVSDLEGRVVGLLFAANWYPPCRGFT  64

Query  252  PNLATVYNELLPK-GNFEVVFVSADEDEESFKEYFGKMPWTAVPFSDSVTRERLDALFTV  428
              L  +Y EL  +    E+V+VS+DE+ ++F  ++G MPW A+PFSD  T++ L   + V
Sbjct  65   QILVGIYEELKSRVPQLEIVYVSSDENLDAFNSFYGNMPWLAIPFSDLETKKSLTRKYDV  124

Query  429  RGIPHLVIL---DESGKVTTEDGVDIVLEHGVEAYPF  530
              +P L++L   D    VT  DGV+++  +G++AYPF
Sbjct  125  EAVPCLILLQPDDRKEHVTVRDGVELIYRYGIQAYPF  161


 Score =   114 bits (284),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 66/174 (38%), Positives = 98/174 (56%), Gaps = 12/174 (7%)
 Frame = +3

Query  36   FQFSKRKGEERKASSMAEQNGDAHDLRSILCSSDRDFLIRNSG---HQVKVDDLKGKKIG  206
            + FS  + E+ +     ++  D   L ++L +  RD+++ ++     +V V  L GK IG
Sbjct  159  YPFSNERLEQLQKEDKVKR--DNQTLTNLLANHHRDYVLSHTHTGLKKVPVAWLVGKTIG  216

Query  207  IYFSASWCGPCHRFTPNLATVY----NELLPKG--NFEVVFVSADEDEESFKEYFGKMPW  368
            +YFSA WC PC +FTP L +VY    +EL  KG  +FEVV +S+D D+ SF  Y+  MPW
Sbjct  217  LYFSAEWCVPCAKFTPKLISVYEKIKHELAGKGEEDFEVVLISSDRDQASFDSYYSTMPW  276

Query  369  TAVPFSDSVTRERLDALFTVRGIPHLVILDESGKVTTEDGVDIVLEHGVEAYPF  530
             A+PF D   +  L   + V+GIP LVI+   GK  T  G  ++  +   AYPF
Sbjct  277  LALPFGDPEIKN-LVRHYNVQGIPWLVIIGPDGKTITVHGRSLINLYQENAYPF  329



>ref|XP_008663577.1| PREDICTED: probable nucleoredoxin 3 [Zea mays]
Length=499

 Score =   132 bits (333),  Expect = 5e-33, Method: Compositional matrix adjust.
 Identities = 67/167 (40%), Positives = 98/167 (59%), Gaps = 5/167 (3%)
 Frame = +3

Query  36   FQFSKRKGEERKASSMAEQNGDAHDLRSILCSSDRDFLIRNSGHQVKVDDLKGKKIGIYF  215
            + FS ++   R+  SM +   +   L+ +L   +RD++I     ++ + DL GK +G+YF
Sbjct  260  YPFSAQR--RRELESMDDARREGGRLQELLGCEERDYVISADDIKIPIADLDGKTVGLYF  317

Query  216  SASWCGPCHRFTPNLATVYNEL--LPKGNFEVVFVSADEDEESFKEYFGKMPWTAVPFSD  389
             A WC PCH FT  L  VYNEL  L  G+FEV+FVS D  +  F+     MPW A+P+SD
Sbjct  318  GAHWCPPCHVFTKQLKEVYNELKILRPGSFEVIFVSIDRSKGEFQASMSSMPWLAIPYSD  377

Query  390  SVTRERLDALFTVRGIPHLVILDESGKVTTEDGVDIVLEHGVEAYPF  530
            +  R++L  +F V+GIP L+IL   GKV   DG   +  +G  A+PF
Sbjct  378  A-ARKKLTRIFAVKGIPGLLILGLDGKVLKTDGRTAISTYGAAAFPF  423


 Score =   108 bits (271),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 58/139 (42%), Positives = 82/139 (59%), Gaps = 9/139 (6%)
 Frame = +3

Query  141  DFLIRNSGHQVKVDDLKGKK--IGIYFSASWCGPCHRFTPNLATVYNELLPKG-NFEVVF  311
             FL+ N G +V +  ++ +   + ++FSA WC PC  FTP L   Y  L   G + E++F
Sbjct  124  QFLLSNEGKEVPLSSIEDRTACLCLFFSAHWCRPCRSFTPTLLQAYTALRSAGKSVEIIF  183

Query  312  VSADEDEESFKEYFGKMPWTAVPF-SDSVTRERLDALFTVRGIPHLVILD-----ESGKV  473
            VS D DE SF+++F  MPW AVPF +  + R++L A F V  IP L+ L       SG  
Sbjct  184  VSLDRDEASFRDHFQGMPWLAVPFDAAGLLRQKLCARFAVERIPALIPLSASATPSSGLG  243

Query  474  TTEDGVDIVLEHGVEAYPF  530
            + ED V +V E+GV+AYPF
Sbjct  244  SGEDAVRLVGEYGVDAYPF  262



>ref|XP_002504076.1| thioredoxin [Micromonas sp. RCC299]
 gb|ACO65334.1| thioredoxin [Micromonas sp. RCC299]
Length=422

 Score =   132 bits (331),  Expect = 5e-33, Method: Compositional matrix adjust.
 Identities = 66/132 (50%), Positives = 89/132 (67%), Gaps = 3/132 (2%)
 Frame = +3

Query  141  DFLIRNSGHQVKVDD-LKGKKIGIYFSASWCGPCHRFTPNLATVYNELLPKG-NFEVVFV  314
            D L+   G +VK +D LK K +G+YFSA WC PC +FTP    +Y EL  +G NFEVVF 
Sbjct  11   DTLVAEGGSEVKTEDALKDKIVGVYFSAHWCPPCRQFTPIFGEIYKELKSRGKNFEVVFA  70

Query  315  SADEDEESFKEYFGKMPWTAVPFSDSVTRERLDALFTVRGIPHLVILDESGKVTTEDGVD  494
            S+D DE SF EY G+ PW A+PF++   + +L A + V+GIP LVILDE+G V T+DG  
Sbjct  71   SSDRDEASFAEYHGEQPWLAMPFANRDLKNKLSAKYKVQGIPTLVILDENGDVITKDGRS  130

Query  495  IVLEHGVEAYPF  530
             V++   EA+P+
Sbjct  131  AVMKD-PEAFPW  141


 Score =   116 bits (290),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 57/133 (43%), Positives = 78/133 (59%), Gaps = 5/133 (4%)
 Frame = +3

Query  147  LIRNSGHQVKVDDL--KGKKIGIYFSASWCGPCHRFTPNLATVYNELLPKGN--FEVVFV  314
             +R  G +V +  +   G  +G+YFSA WCGPC +FTP L   Y+++L      FEV+FV
Sbjct  154  FVRADGSEVSLASIAKSGANVGVYFSAHWCGPCRQFTPKLIEAYDKMLGDQTKPFEVIFV  213

Query  315  SADEDEESFKEYFGKMPWTAVPFSDSVTRERLDALFTVRGIPHLVILDESGKVTTEDGVD  494
            S D DE  FKEYFG MPW AVPF D   R+ L+  F V+GIPH V+L    K+   +   
Sbjct  214  SGDRDEAGFKEYFGSMPWLAVPFDDEKRRDALNEYFGVQGIPHFVMLTSELKMINPNARG  273

Query  495  IVL-EHGVEAYPF  530
             V+ +   E +P+
Sbjct  274  SVMSDPACEEFPW  286



>ref|XP_003527520.1| PREDICTED: probable nucleoredoxin 2-like isoform 1 [Glycine max]
Length=411

 Score =   131 bits (330),  Expect = 7e-33, Method: Compositional matrix adjust.
 Identities = 62/157 (39%), Positives = 97/157 (62%), Gaps = 4/157 (3%)
 Frame = +3

Query  72   ASSMAEQNGDAHDLRSILCSSDRDFLIRNSGHQVKVDDLKGKKIGIYFSASWCGPCHRFT  251
            A  +   NG+      +L S DRD+L+  +G QVKV DL+G+ +G+ F+A+W  PC  FT
Sbjct  5    AQVVLNDNGNYGKFSHLLASQDRDYLLSPTGAQVKVSDLEGRVVGLLFAANWYPPCRGFT  64

Query  252  PNLATVYNELLPK-GNFEVVFVSADEDEESFKEYFGKMPWTAVPFSDSVTRERLDALFTV  428
              L  +Y EL  +    E+V+VS+DE+ ++F  ++G MPW A+PFSD  T++ L   + V
Sbjct  65   QILVGIYEELKSRVPQLEIVYVSSDENLDAFNSFYGNMPWLAIPFSDLETKKSLTRKYDV  124

Query  429  RGIPHLVIL---DESGKVTTEDGVDIVLEHGVEAYPF  530
              +P L++L   D    VT  DGV+++  +G++AYPF
Sbjct  125  EAVPCLILLQPDDRKEHVTVRDGVELIYRYGIQAYPF  161


 Score =   114 bits (284),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 66/174 (38%), Positives = 98/174 (56%), Gaps = 12/174 (7%)
 Frame = +3

Query  36   FQFSKRKGEERKASSMAEQNGDAHDLRSILCSSDRDFLIRNSG---HQVKVDDLKGKKIG  206
            + FS  + E+ +     ++  D   L ++L +  RD+++ ++     +V V  L GK IG
Sbjct  159  YPFSNERLEQLQKEDKVKR--DNQTLTNLLANHHRDYVLSHTHTGLKKVPVAWLVGKTIG  216

Query  207  IYFSASWCGPCHRFTPNLATVY----NELLPKG--NFEVVFVSADEDEESFKEYFGKMPW  368
            +YFSA WC PC +FTP L +VY    +EL  KG  +FEVV +S+D D+ SF  Y+  MPW
Sbjct  217  LYFSAEWCVPCAKFTPKLISVYEKIKHELAGKGEEDFEVVLISSDRDQASFDSYYSTMPW  276

Query  369  TAVPFSDSVTRERLDALFTVRGIPHLVILDESGKVTTEDGVDIVLEHGVEAYPF  530
             A+PF D   +  L   + V+GIP LVI+   GK  T  G  ++  +   AYPF
Sbjct  277  LALPFGDPEIKN-LVRHYNVQGIPWLVIIGPDGKTITVHGRSLINLYQENAYPF  329



>gb|KDO82403.1| hypothetical protein CISIN_1g008336mg [Citrus sinensis]
Length=477

 Score =   132 bits (331),  Expect = 7e-33, Method: Compositional matrix adjust.
 Identities = 69/166 (42%), Positives = 97/166 (58%), Gaps = 4/166 (2%)
 Frame = +3

Query  36   FQFSKRKGEERKASSMAEQNGDAHDLRSILCSSDRDFLIRNSGHQVKVDDLKGKKIGIYF  215
            F F+  K  E      A++  ++  L S+L S D DF++  +G +V V DL GK I +YF
Sbjct  215  FPFTPEKFAELAEIQRAKE--ESQTLESVLVSGDLDFVVGKNGGKVPVSDLAGKTILLYF  272

Query  216  SASWCGPCHRFTPNLATVYNELLPKG-NFEVVFVSADEDEESFKEYFGKMPWTAVPFSDS  392
            SA WC PC  F P L   Y ++  +  + EVVF+S+D D+ SF E+F  MPW A+PF D+
Sbjct  273  SAHWCPPCRAFLPKLIDAYKKIKERNESLEVVFISSDRDQTSFDEFFKGMPWLALPFGDA  332

Query  393  VTRERLDALFTVRGIPHLVILDESGKVTTEDGVDIVLEHGVEAYPF  530
              +  L   F V GIP LV +  SG+  T++  D++  HG EAYPF
Sbjct  333  -RKASLSRKFKVSGIPMLVAIGPSGRTITKEARDMIAVHGAEAYPF  377


 Score =   125 bits (313),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 69/158 (44%), Positives = 93/158 (59%), Gaps = 5/158 (3%)
 Frame = +3

Query  69   KASSMAEQNGDA---HDLRSILCSSDRDFLIRNSGHQVKVDDLKGKKIGIYFSASWCGPC  239
            +   M EQ   A     LRS+L S  RDF+I + G ++ V DL+GK IG+YFS S     
Sbjct  61   RIKEMKEQEERAKREQSLRSVLTSHSRDFVISSDGRKISVSDLEGKTIGLYFSMSSYKAS  120

Query  240  HRFTPNLATVYNELLPKG-NFEVVFVSADEDEESFKEYFGKMPWTAVPFSDSVTRERLDA  416
              FTP L  VY +L  KG +FE+V +S D++EESFK   G MPW A+PF D  +RE+L  
Sbjct  121  AEFTPRLVEVYEKLKGKGESFEIVLISLDDEEESFKRDLGSMPWLALPFKDK-SREKLAR  179

Query  417  LFTVRGIPHLVILDESGKVTTEDGVDIVLEHGVEAYPF  530
             F +  +P LVI+   GK    +  + + EHGV A+PF
Sbjct  180  YFELSTLPTLVIIGPDGKTLHSNVAEAIEEHGVGAFPF  217


 Score = 89.4 bits (220),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 40/57 (70%), Positives = 48/57 (84%), Gaps = 0/57 (0%)
 Frame = +3

Query  360  MPWTAVPFSDSVTRERLDALFTVRGIPHLVILDESGKVTTEDGVDIVLEHGVEAYPF  530
            MPW AVPFSDS TR++LD LF V GIPHLVILDE+GKV ++ GV+I+ E+GVE YPF
Sbjct  1    MPWLAVPFSDSETRDKLDELFKVMGIPHLVILDENGKVLSDGGVEIIREYGVEGYPF  57



>ref|XP_010648454.1| PREDICTED: probable nucleoredoxin 3 [Vitis vinifera]
Length=399

 Score =   131 bits (329),  Expect = 9e-33, Method: Compositional matrix adjust.
 Identities = 66/169 (39%), Positives = 98/169 (58%), Gaps = 5/169 (3%)
 Frame = +3

Query  30   SIFQFSKRKGEERKASSMAEQNGDAHDLRSILCSSDRDFLIRNSGHQVKVDDLKGKKIGI  209
            S F F+ ++ EE KA   A++ G    L  +L +  R+ +I +SG ++ V +L GK IG+
Sbjct  150  SAFPFTSQRREELKAMDNAKRQGGK--LEELLANEGRNHVISSSGREILVSELVGKTIGL  207

Query  210  YFSASWCGPCHRFTPNLATVYNELLPKGN--FEVVFVSADEDEESFKEYFGKMPWTAVPF  383
            YF+A WC PC  FT  L   YN+L+   N  FE++FVS D D + F      MPW A+P+
Sbjct  208  YFAAHWCPPCRAFTAQLIEAYNKLVATRNQCFEIIFVSTDRDHQEFDLSLSNMPWLAIPY  267

Query  384  SDSVTRERLDALFTVRGIPHLVILDESGKVTTEDGVDIVLEHGVEAYPF  530
             D   R+ L  +F ++GIP LV+L   GK  + +G  I+  +G  A+PF
Sbjct  268  EDK-ARQDLCRIFDIKGIPALVLLGSDGKTISTNGRAIISSYGAMAFPF  315


 Score =   115 bits (288),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 57/145 (39%), Positives = 86/145 (59%), Gaps = 3/145 (2%)
 Frame = +3

Query  99   DAHDLRSILCSSDRDFLIRNSGHQVKVDDLKGKKIGIYFSASWCGPCHRFTPNLATVYNE  278
            D++D+ ++L S   +FL+   G +V +   +GK I ++FSA+WC PC  FTP L  +YN 
Sbjct  12   DSNDIITVLASEGIEFLLSGEG-KVSLSSTEGKMICLFFSANWCRPCRTFTPQLVQIYNS  70

Query  279  LLPKGNF-EVVFVSADEDEESFKEYFGKMPWTAVPFSDSVTRERLDALFTVRGIPHLVIL  455
            L+  G   E++F+S D DE  F E+F  MPW AVPF+  + R RL   + V  IP  + L
Sbjct  71   LIKTGRMIEIIFISFDRDETGFGEHFKSMPWLAVPFNVDLHR-RLSDHYHVDHIPSFIPL  129

Query  456  DESGKVTTEDGVDIVLEHGVEAYPF  530
               GK   ED + ++ ++G  A+PF
Sbjct  130  GLDGKSIEEDAIGLIEDYGASAFPF  154



>ref|XP_003527521.1| PREDICTED: probable nucleoredoxin 2-like isoform 2 [Glycine max]
Length=434

 Score =   131 bits (330),  Expect = 9e-33, Method: Compositional matrix adjust.
 Identities = 62/157 (39%), Positives = 97/157 (62%), Gaps = 4/157 (3%)
 Frame = +3

Query  72   ASSMAEQNGDAHDLRSILCSSDRDFLIRNSGHQVKVDDLKGKKIGIYFSASWCGPCHRFT  251
            A  +   NG+      +L S DRD+L+  +G QVKV DL+G+ +G+ F+A+W  PC  FT
Sbjct  5    AQVVLNDNGNYGKFSHLLASQDRDYLLSPTGAQVKVSDLEGRVVGLLFAANWYPPCRGFT  64

Query  252  PNLATVYNELLPK-GNFEVVFVSADEDEESFKEYFGKMPWTAVPFSDSVTRERLDALFTV  428
              L  +Y EL  +    E+V+VS+DE+ ++F  ++G MPW A+PFSD  T++ L   + V
Sbjct  65   QILVGIYEELKSRVPQLEIVYVSSDENLDAFNSFYGNMPWLAIPFSDLETKKSLTRKYDV  124

Query  429  RGIPHLVIL---DESGKVTTEDGVDIVLEHGVEAYPF  530
              +P L++L   D    VT  DGV+++  +G++AYPF
Sbjct  125  EAVPCLILLQPDDRKEHVTVRDGVELIYRYGIQAYPF  161


 Score =   108 bits (270),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 60/130 (46%), Positives = 77/130 (59%), Gaps = 7/130 (5%)
 Frame = +3

Query  159  SGHQVKVDDLKGKKIGIYFSASWCGPCHRFTPNLATVY----NELLPKG--NFEVVFVSA  320
            S  QV V  L GK IG+YFSA WC PC +FTP L +VY    +EL  KG  +FEVV +S+
Sbjct  224  SCTQVPVAWLVGKTIGLYFSAEWCVPCAKFTPKLISVYEKIKHELAGKGEEDFEVVLISS  283

Query  321  DEDEESFKEYFGKMPWTAVPFSDSVTRERLDALFTVRGIPHLVILDESGKVTTEDGVDIV  500
            D D+ SF  Y+  MPW A+PF D   +  L   + V+GIP LVI+   GK  T  G  ++
Sbjct  284  DRDQASFDSYYSTMPWLALPFGDPEIKN-LVRHYNVQGIPWLVIIGPDGKTITVHGRSLI  342

Query  501  LEHGVEAYPF  530
              +   AYPF
Sbjct  343  NLYQENAYPF  352



>ref|XP_006342078.1| PREDICTED: probable nucleoredoxin 2-like [Solanum tuberosum]
Length=440

 Score =   131 bits (330),  Expect = 9e-33, Method: Compositional matrix adjust.
 Identities = 69/149 (46%), Positives = 92/149 (62%), Gaps = 8/149 (5%)
 Frame = +3

Query  108  DLRSILCSSDRDFLIRNSGHQVKVDDLKGKKIGIYFSASWCGPCHRFTPNLATVYNELLP  287
            D  SIL S D DFL+  +G QVKV +L+GK +G+YFSA+W  PC +FT  L  VY +L  
Sbjct  45   DYLSILASKDGDFLLSPTGAQVKVSELEGKVVGLYFSANWYSPCTKFTNLLVNVYQQLKE  104

Query  288  KGN----FEVVFVSADEDEESFKEYFGKMPWTAVPFSDSVTRERLDALFTVRGIPHLVIL  455
              N    FE+VFVS+DE+  +F  Y   MPW A+PFSD   R  L   F V GIP ++IL
Sbjct  105  CNNINLGFEIVFVSSDENLNAFNTYRSSMPWFAIPFSDLEKRRALTQKFDVEGIPCMIIL  164

Query  456  ----DESGKVTTEDGVDIVLEHGVEAYPF  530
                D+      +DGV++V  +GV+A+PF
Sbjct  165  QPNDDKLDTAVIKDGVELVYRYGVQAFPF  193


 Score =   122 bits (306),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 69/172 (40%), Positives = 96/172 (56%), Gaps = 10/172 (6%)
 Frame = +3

Query  36   FQFSKRKGEERKASSMAEQNGDAHDLRSILCSSDRDFLIRN-SGHQVKVDDLKGKKIGIY  212
            F F+K + +E +     ++  D   L ++L    RD L+ N S  QV V  LKGK +G+Y
Sbjct  191  FPFTKERLDELREKE--KEKRDNQTLSNLLTHDARDVLLGNPSPKQVSVASLKGKTVGLY  248

Query  213  FSASWCGPCHRFTPNLATVYNELLPK------GNFEVVFVSADEDEESFKEYFGKMPWTA  374
            FSA WC P  +FTP L +VY ++  +       +FE+VFVS+D ++  F  YF  MPW A
Sbjct  249  FSAQWCIPAKKFTPRLISVYKKIKQQLEGKEDEDFEIVFVSSDHNQVDFTTYFETMPWLA  308

Query  375  VPFSDSVTRERLDALFTVRGIPHLVILDESGKVTTEDGVDIVLEHGVEAYPF  530
            +PF D  T   L   F +RGIP LVIL   GK  T+ G  ++  +   AYPF
Sbjct  309  IPFDDP-TINALAKYFDIRGIPSLVILGPDGKTVTKQGRSLINLYKENAYPF  359



>ref|XP_009334668.1| PREDICTED: probable nucleoredoxin 2 [Pyrus x bretschneideri]
 ref|XP_009334675.1| PREDICTED: probable nucleoredoxin 2 [Pyrus x bretschneideri]
Length=432

 Score =   131 bits (330),  Expect = 9e-33, Method: Compositional matrix adjust.
 Identities = 67/137 (49%), Positives = 89/137 (65%), Gaps = 4/137 (3%)
 Frame = +3

Query  132  SDRDFLIRNSGHQVKVDDLKGKKIGIYFSASWCGPCHRFTPNLATVYNELLPKG-NFEVV  308
             DRD+L+  +G+QVKV DL GK IG+YFSA+W  PC  F   L  +Y +L   G NFE+V
Sbjct  45   QDRDYLLTPTGNQVKVSDLDGKIIGLYFSANWYPPCWNFNQVLVGIYEQLKNSGTNFEIV  104

Query  309  FVSADEDEESFKEYFGKMPWTAVPFSDSVTRERLDALFTVRGIPHLVIL---DESGKVTT  479
            +VS+DED ++F  Y   MPW A+PFSD  T++ L+  F V  IP LVIL   D   + T 
Sbjct  105  YVSSDEDSDAFNIYHACMPWLAIPFSDLDTKKALNRKFDVESIPSLVILQPNDNKDEATL  164

Query  480  EDGVDIVLEHGVEAYPF  530
             DGV+I+  +GV A+PF
Sbjct  165  HDGVEIIYRYGVVAFPF  181


 Score =   130 bits (326),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 72/174 (41%), Positives = 101/174 (58%), Gaps = 12/174 (7%)
 Frame = +3

Query  36   FQFSKRKGEERKASSMAEQNGDAHDLRSILCSSDRDFLIRN-SGHQVKVDDLKGKKIGIY  212
            F F+ +K EE +    A    +   L ++L + DRD+L+ + +  QV V  L+GK IG+Y
Sbjct  179  FPFTTQKLEELQDEDRARH--ENQTLTNLLANHDRDYLLGHPTPKQVSVASLRGKTIGLY  236

Query  213  FSASWCGPCHRFTPNLATVYNELLPK--------GNFEVVFVSADEDEESFKEYFGKMPW  368
            FSA WC PC  FTP L ++Y ++  K         +FE+VFVS+D D+ SF  YF  MPW
Sbjct  237  FSAQWCRPCVNFTPKLISIYEKIKEKMLVDDHDGEDFEIVFVSSDRDQTSFDSYFNTMPW  296

Query  369  TAVPFSDSVTRERLDALFTVRGIPHLVILDESGKVTTEDGVDIVLEHGVEAYPF  530
             A+PF D   +E L   F V+GIP LVIL   GK  T+ G +++  +   AYPF
Sbjct  297  VALPFGDPNIKE-LVKHFDVKGIPCLVILGPDGKTVTQQGRNLINLYKENAYPF  349



>ref|XP_004136369.1| PREDICTED: probable nucleoredoxin 2-like [Cucumis sativus]
 gb|KGN60060.1| hypothetical protein Csa_3G874380 [Cucumis sativus]
Length=410

 Score =   130 bits (327),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 66/143 (46%), Positives = 91/143 (64%), Gaps = 5/143 (3%)
 Frame = +3

Query  117  SILCSSDRDFLIRNSGHQVKVDDLKGKKIGIYFSASWCGPCHRFTPNLATVYNELLPKG-  293
            S+L S  RD+L+  +G QVKV +L GK +G+YFSA+W  PC  F   L   Y +L   G 
Sbjct  21   SLLASGGRDYLLSPTGAQVKVSNLDGKVLGLYFSANWYPPCRNFNQILVRTYEKLQDNGS  80

Query  294  NFEVVFVSADEDEESFKEYFGKMPWTAVPFSDSVTRERLDALFTVRGIPHLVILD----E  461
            NFEVV+VS+DED ++F EY   MPW A+PFSD  T+  L+  F + GIP L+IL     +
Sbjct  81   NFEVVYVSSDEDSDAFNEYRASMPWPAIPFSDLETKIALNRKFGIEGIPCLIILQPRESK  140

Query  462  SGKVTTEDGVDIVLEHGVEAYPF  530
                T  +GV++V  +GV+A+PF
Sbjct  141  DETATLHEGVEVVYRYGVDAFPF  163


 Score =   117 bits (293),  Expect = 9e-28, Method: Compositional matrix adjust.
 Identities = 68/172 (40%), Positives = 102/172 (59%), Gaps = 11/172 (6%)
 Frame = +3

Query  36   FQFSKRKGEERKASSMAEQNGDAHDLRSILCSSDRDFLIRNS-GHQVKVDDLKGKKIGIY  212
            F F++ + E+ K     ++  +   L ++L ++ RD+L  +S   QV V  L GK +G+Y
Sbjct  161  FPFTQERLEQLKEEDREKE--ENQTLVTLLTNNYRDYLFAHSFPKQVPVVSLVGKTVGLY  218

Query  213  FSASWCGPCHRFTPNLATVYN------ELLPKGNFEVVFVSADEDEESFKEYFGKMPWTA  374
            FSA WC P   FTP L +VY+      E+    +FE+VFVS+D DE+SF  YFG MPW  
Sbjct  219  FSAKWCLP-GMFTPKLISVYSKIKRMVEMKEDEDFEIVFVSSDRDEDSFHSYFGSMPWLG  277

Query  375  VPFSDSVTRERLDALFTVRGIPHLVILDESGKVTTEDGVDIVLEHGVEAYPF  530
            +P+ D + +E L   F V+GIP L+IL  +GK  T+ G +++  +   AYPF
Sbjct  278  LPYGDPMIKE-LAKHFDVQGIPCLIILAPNGKTITKQGRNLINLYRENAYPF  328



>ref|XP_002448495.1| hypothetical protein SORBIDRAFT_06g027950 [Sorghum bicolor]
 gb|EES12823.1| hypothetical protein SORBIDRAFT_06g027950 [Sorghum bicolor]
Length=389

 Score =   130 bits (326),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 66/167 (40%), Positives = 98/167 (59%), Gaps = 5/167 (3%)
 Frame = +3

Query  36   FQFSKRKGEERKASSMAEQNGDAHDLRSILCSSDRDFLIRNSGHQVKVDDLKGKKIGIYF  215
            + FS ++  E +A   A + G    L+ +L   +RD++I     ++ + DL GK +G+YF
Sbjct  150  YPFSAQRRRELEAMDDARRKGG--KLQELLGCKERDYVISADDIKIPIADLTGKTVGLYF  207

Query  216  SASWCGPCHRFTPNLATVYNEL--LPKGNFEVVFVSADEDEESFKEYFGKMPWTAVPFSD  389
             A WC PCH FT  L  VYNEL  L   +FEV+F+S D ++  F+     MPW A+P+SD
Sbjct  208  GAHWCPPCHVFTKQLKEVYNELKILRPESFEVIFISIDRNKGEFQASMSSMPWLAIPYSD  267

Query  390  SVTRERLDALFTVRGIPHLVILDESGKVTTEDGVDIVLEHGVEAYPF  530
            +  R++L  +F V+GIP L+IL   GKV   DG   +  +G  A+PF
Sbjct  268  T-ARQKLTRIFAVKGIPGLLILGLDGKVLKTDGRTAISTYGATAFPF  313


 Score =   108 bits (271),  Expect = 8e-25, Method: Compositional matrix adjust.
 Identities = 57/133 (43%), Positives = 79/133 (59%), Gaps = 5/133 (4%)
 Frame = +3

Query  144  FLIRNSGHQVKVDDLKGKKIGIYFSASWCGPCHRFTPNLATVYNELLPKG-NFEVVFVSA  320
            FL+ N G +V +  ++GK   ++FSA WC PC  FTPNL  +Y  L   G N E++F+S 
Sbjct  21   FLLNNEGKEVPLSSIEGKTTCLFFSAHWCRPCRSFTPNLVQIYTALRNTGKNIEIIFISL  80

Query  321  DEDEESFKEYFGKMPWTAVPFSDSVTRERLDALFTVRGIPHLVILD---ESGKVTTEDGV  491
            D DE SF ++F  M W A+PF D+   ++L A F +  IP L+ L     SG    ED V
Sbjct  81   DHDEASFWDHFKGMSWLALPF-DTGLSQKLCAHFGIEHIPALIPLSATPSSGVGFEEDAV  139

Query  492  DIVLEHGVEAYPF  530
             +V E+G +AYPF
Sbjct  140  RLVDEYGEDAYPF  152



>ref|XP_010061105.1| PREDICTED: probable nucleoredoxin 2 isoform X2 [Eucalyptus grandis]
Length=426

 Score =   130 bits (327),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 67/142 (47%), Positives = 89/142 (63%), Gaps = 4/142 (3%)
 Frame = +3

Query  117  SILCSSDRDFLIRNSGHQVKVDDLKGKKIGIYFSASWCGPCHRFTPNLATVYNEL-LPKG  293
            S+L S DRD+L+  +G QV V DL+G  +G+YFSA+W  PC  F   L+  Y +L   + 
Sbjct  34   SLLASKDRDYLLSPTGSQVTVSDLEGHVVGLYFSANWYSPCRNFNCVLSEAYEQLKTNQS  93

Query  294  NFEVVFVSADEDEESFKEYFGKMPWTAVPFSDSVTRERLDALFTVRGIPHLVILDESGKV  473
             FEVVFVSADED  +F  Y   MPW A+PFSD  +++ L   F V GIP LVIL   G  
Sbjct  94   KFEVVFVSADEDLSAFNSYHSSMPWLAIPFSDLESKKALSRRFDVEGIPCLVILQPDGNK  153

Query  474  TTE---DGVDIVLEHGVEAYPF  530
              E   +GV+++  +GVEA+PF
Sbjct  154  EEEILRNGVELIHRYGVEAFPF  175


 Score =   108 bits (271),  Expect = 9e-25, Method: Compositional matrix adjust.
 Identities = 63/150 (42%), Positives = 86/150 (57%), Gaps = 16/150 (11%)
 Frame = +3

Query  117  SILCSSDRDFLIRNSGH-----QVKVDDLKGKKIGIYFSASWCGPCHRFTPNLATVYNEL  281
            S+L S DRDFL+   GH     QV V  L GK +G++FSA WC P  +FTP L ++Y ++
Sbjct  198  SLLSSHDRDFLL---GHHPVTGQVPVASLVGKTLGLFFSAQWCLPGMKFTPKLVSIYQKI  254

Query  282  ------LPKG-NFEVVFVSADEDEESFKEYFGKMPWTAVPFSDSVTRERLDALFTVRGIP  440
                   P   +FE+V+VS+D D  SF  YF  +PW A+PF D   R  L   F V+ IP
Sbjct  255  KHAISERPGAEDFEIVYVSSDRDRASFDSYFALIPWLALPFGDPKIRT-LARHFDVQDIP  313

Query  441  HLVILDESGKVTTEDGVDIVLEHGVEAYPF  530
             LV+L   GK  T+ G  ++  +  +AYPF
Sbjct  314  CLVVLGPDGKTVTKHGRSLINLYQEQAYPF  343



>ref|XP_008350516.1| PREDICTED: probable nucleoredoxin 2 [Malus domestica]
Length=389

 Score =   129 bits (325),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 72/174 (41%), Positives = 101/174 (58%), Gaps = 12/174 (7%)
 Frame = +3

Query  36   FQFSKRKGEERKASSMAEQNGDAHDLRSILCSSDRDFLIRN-SGHQVKVDDLKGKKIGIY  212
            F F+K+K EE +    A    +   L ++L + DRD+L+ + +  QV V  L+GK IG+Y
Sbjct  134  FPFTKQKLEELQDEDRARH--ENQTLTNLLTNHDRDYLLGHPTPKQVSVASLRGKTIGLY  191

Query  213  FSASWCGPCHRFTPNLATVYNELLPKG--------NFEVVFVSADEDEESFKEYFGKMPW  368
            FSA WC PC  FTP L ++Y ++  K         +FE+V VS+D D+ SF  YF  MPW
Sbjct  192  FSAQWCRPCVNFTPKLISIYEKIKEKMLVDDHDGEDFEIVLVSSDRDQTSFDSYFNTMPW  251

Query  369  TAVPFSDSVTRERLDALFTVRGIPHLVILDESGKVTTEDGVDIVLEHGVEAYPF  530
             A+PF D   +E L   F V+GIP LVIL   GK  T+ G +++  +   AYPF
Sbjct  252  LALPFGDPNIKE-LVKHFDVKGIPCLVILGPDGKTVTQQGRNLINLYKENAYPF  304


 Score =   121 bits (303),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 62/124 (50%), Positives = 79/124 (64%), Gaps = 4/124 (3%)
 Frame = +3

Query  171  VKVDDLKGKKIGIYFSASWCGPCHRFTPNLATVYNELLPKG-NFEVVFVSADEDEESFKE  347
            VKV DL GK IG+YFSA+W  PC  F   L  +Y +L   G NFE+V+VS+DED  +F  
Sbjct  13   VKVSDLXGKIIGLYFSANWYPPCWNFNQVLVGIYEQLKXSGXNFEIVYVSSDEDSXAFNX  72

Query  348  YFGKMPWTAVPFSDSVTRERLDALFTVRGIPHLVIL---DESGKVTTEDGVDIVLEHGVE  518
            Y   MPW A+PFSD  T++ L+  F V  IP LVIL   D   + T  DGV+I+  +GVE
Sbjct  73   YHACMPWLAIPFSDLDTKKALNRKFDVESIPSLVILQPNDNKDEATLHDGVEIIYRYGVE  132

Query  519  AYPF  530
            A+PF
Sbjct  133  AFPF  136



>gb|KCW68002.1| hypothetical protein EUGRSUZ_F01693 [Eucalyptus grandis]
Length=489

 Score =   130 bits (327),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 67/142 (47%), Positives = 89/142 (63%), Gaps = 4/142 (3%)
 Frame = +3

Query  117  SILCSSDRDFLIRNSGHQVKVDDLKGKKIGIYFSASWCGPCHRFTPNLATVYNEL-LPKG  293
            S+L S DRD+L+  +G QV V DL+G  +G+YFSA+W  PC  F   L+  Y +L   + 
Sbjct  97   SLLASKDRDYLLSPTGSQVTVSDLEGHVVGLYFSANWYSPCRNFNCVLSEAYEQLKTNQS  156

Query  294  NFEVVFVSADEDEESFKEYFGKMPWTAVPFSDSVTRERLDALFTVRGIPHLVILDESGKV  473
             FEVVFVSADED  +F  Y   MPW A+PFSD  +++ L   F V GIP LVIL   G  
Sbjct  157  KFEVVFVSADEDLSAFNSYHSSMPWLAIPFSDLESKKALSRRFDVEGIPCLVILQPDGNK  216

Query  474  TTE---DGVDIVLEHGVEAYPF  530
              E   +GV+++  +GVEA+PF
Sbjct  217  EEEILRNGVELIHRYGVEAFPF  238


 Score =   109 bits (272),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 63/150 (42%), Positives = 86/150 (57%), Gaps = 16/150 (11%)
 Frame = +3

Query  117  SILCSSDRDFLIRNSGH-----QVKVDDLKGKKIGIYFSASWCGPCHRFTPNLATVYNEL  281
            S+L S DRDFL+   GH     QV V  L GK +G++FSA WC P  +FTP L ++Y ++
Sbjct  261  SLLSSHDRDFLL---GHHPVTGQVPVASLVGKTLGLFFSAQWCLPGMKFTPKLVSIYQKI  317

Query  282  ------LPKG-NFEVVFVSADEDEESFKEYFGKMPWTAVPFSDSVTRERLDALFTVRGIP  440
                   P   +FE+V+VS+D D  SF  YF  +PW A+PF D   R  L   F V+ IP
Sbjct  318  KHAISERPGAEDFEIVYVSSDRDRASFDSYFALIPWLALPFGDPKIRT-LARHFDVQDIP  376

Query  441  HLVILDESGKVTTEDGVDIVLEHGVEAYPF  530
             LV+L   GK  T+ G  ++  +  +AYPF
Sbjct  377  CLVVLGPDGKTVTKHGRSLINLYQEQAYPF  406



>ref|NP_001050331.2| Os03g0405900 [Oryza sativa Japonica Group]
 dbj|BAF12245.2| Os03g0405900 [Oryza sativa Japonica Group]
Length=413

 Score =   129 bits (324),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 64/166 (39%), Positives = 97/166 (58%), Gaps = 4/166 (2%)
 Frame = +3

Query  36   FQFSKRKGEERKASSMAEQNGDAHDLRSILCSSDRDFLIRNSGHQVKVDDLKGKKIGIYF  215
            F FS  K E    +  A+   ++  L S+L + D DF++   G +V V +L GK + +YF
Sbjct  148  FPFSAEKLE--ILAEKAKAKAESQTLESLLVTGDLDFVLGKDGAKVPVSELVGKTVLLYF  205

Query  216  SASWCGPCHRFTPNLATVYNELLPKGN-FEVVFVSADEDEESFKEYFGKMPWTAVPFSDS  392
            SA WC PC  F P L   YN++  K N FE+VF+S+D ++ S+ E+F  MPW A+P  D 
Sbjct  206  SAKWCPPCRAFLPKLVNEYNKIKEKHNDFEIVFISSDREQSSYDEFFSGMPWLALPLGDE  265

Query  393  VTRERLDALFTVRGIPHLVILDESGKVTTEDGVDIVLEHGVEAYPF  530
              +++L  +F + GIP LV +   GK  T+D    ++ HG +A+PF
Sbjct  266  -RKQQLSKIFKITGIPSLVAIGPDGKTVTKDAKTPLVAHGADAFPF  310


 Score = 99.0 bits (245),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 56/128 (44%), Positives = 77/128 (60%), Gaps = 3/128 (2%)
 Frame = +3

Query  144  FLIRNSGHQVKVDDLKGKKIGIYFSASWCGPCHRFTPNLATVYNELLPKG-NFEVVFVSA  320
            FL+ + G QV + DL+GK +G+ F  +  GP  +FT  LA +Y +L   G  FEVV VS 
Sbjct  20   FLLVD-GTQVPISDLEGKYVGLCFVVNGYGPVVQFTSVLAKIYEKLKAVGEKFEVVMVSL  78

Query  321  DEDEESFKEYFGKMPWTAVPFSDSVTRERLDALFTVRGIPHLVILDESGKVTTEDGVDIV  500
            D DEESF E F  MPW A+P  D +  E+L   F + G+P LV++   GK   +D  DI+
Sbjct  79   DGDEESFNESFADMPWLAIPQGDKMC-EKLARYFELSGLPMLVLIGPDGKTLNDDIADII  137

Query  501  LEHGVEAY  524
             EHG +A+
Sbjct  138  DEHGPDAW  145



>ref|XP_006438372.1| hypothetical protein CICLE_v10031097mg [Citrus clementina]
 gb|ESR51612.1| hypothetical protein CICLE_v10031097mg [Citrus clementina]
Length=477

 Score =   129 bits (324),  Expect = 7e-32, Method: Compositional matrix adjust.
 Identities = 68/166 (41%), Positives = 96/166 (58%), Gaps = 4/166 (2%)
 Frame = +3

Query  36   FQFSKRKGEERKASSMAEQNGDAHDLRSILCSSDRDFLIRNSGHQVKVDDLKGKKIGIYF  215
            F F+  K  E      A++  ++  L  +L S D DF++  +G +V V DL GK I +YF
Sbjct  215  FPFTPEKFAELAEIQRAKE--ESQTLELVLVSGDLDFVVGKNGGKVPVSDLVGKTILLYF  272

Query  216  SASWCGPCHRFTPNLATVYNELLPKG-NFEVVFVSADEDEESFKEYFGKMPWTAVPFSDS  392
            SA WC PC  F P L   Y ++  +  + EVVF+S+D D+ SF E+F  MPW A+PF D+
Sbjct  273  SAHWCPPCRAFLPKLIEAYKKIKERNESLEVVFISSDRDQTSFDEFFKGMPWLALPFGDA  332

Query  393  VTRERLDALFTVRGIPHLVILDESGKVTTEDGVDIVLEHGVEAYPF  530
              +  L   F V GIP LV +  SG+  T++  D++  HG EAYPF
Sbjct  333  -RKASLSRKFKVSGIPMLVAIGPSGRTITKEAKDMIAVHGAEAYPF  377


 Score =   125 bits (314),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 69/158 (44%), Positives = 93/158 (59%), Gaps = 5/158 (3%)
 Frame = +3

Query  69   KASSMAEQNGDA---HDLRSILCSSDRDFLIRNSGHQVKVDDLKGKKIGIYFSASWCGPC  239
            +   M EQ   A     LRS+L S  RDF+I + G ++ V DL+GK IG+YFS S     
Sbjct  61   RIKEMKEQEERAKREQSLRSVLTSHSRDFVISSDGRKISVSDLEGKTIGLYFSMSSYKAS  120

Query  240  HRFTPNLATVYNELLPKG-NFEVVFVSADEDEESFKEYFGKMPWTAVPFSDSVTRERLDA  416
              FTP L  VY +L  KG +FE+V +S D++EESFK   G MPW A+PF D  +RE+L  
Sbjct  121  AEFTPRLVEVYEKLKGKGESFEIVLISLDDEEESFKRDLGSMPWLALPFKDK-SREKLAR  179

Query  417  LFTVRGIPHLVILDESGKVTTEDGVDIVLEHGVEAYPF  530
             F +  +P LVI+   GK    +  + + EHGV A+PF
Sbjct  180  YFELSTLPTLVIIGPDGKTLHSNVAEAIEEHGVGAFPF  217


 Score = 89.4 bits (220),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 40/57 (70%), Positives = 48/57 (84%), Gaps = 0/57 (0%)
 Frame = +3

Query  360  MPWTAVPFSDSVTRERLDALFTVRGIPHLVILDESGKVTTEDGVDIVLEHGVEAYPF  530
            MPW AVPFSDS TR++LD LF V GIPHLVILDE+GKV ++ GV+I+ E+GVE YPF
Sbjct  1    MPWLAVPFSDSETRDKLDELFKVMGIPHLVILDENGKVLSDGGVEIIREYGVEGYPF  57



>ref|XP_009417222.1| PREDICTED: probable nucleoredoxin 2 isoform X1 [Musa acuminata 
subsp. malaccensis]
Length=397

 Score =   128 bits (322),  Expect = 7e-32, Method: Compositional matrix adjust.
 Identities = 64/158 (41%), Positives = 102/158 (65%), Gaps = 5/158 (3%)
 Frame = +3

Query  60   EERKASSMAEQNGDAHDLRSILCSSDRDFLIRNSGHQVKVDDLKGKKIGIYFSASWCGPC  239
            E    + +A   GD   L ++L +   +FLI  SG++V   D++GK IG+YF+A+W   C
Sbjct  2    EAPTVTGVASATGDG-GLSALLST---EFLICPSGNKVNPKDIEGKTIGLYFAANWFQKC  57

Query  240  HRFTPNLATVYNELLPKG-NFEVVFVSADEDEESFKEYFGKMPWTAVPFSDSVTRERLDA  416
              FTP L +VY++L+ +   FE+VFVS+DE++ SF++++  MPW AVPFSD  ++  L  
Sbjct  58   VSFTPVLVSVYHKLMEQELPFEIVFVSSDENQSSFEQFYSSMPWPAVPFSDINSKRSLSH  117

Query  417  LFTVRGIPHLVILDESGKVTTEDGVDIVLEHGVEAYPF  530
             F + GIP L+IL   G +   +GV+I+  +G++A+PF
Sbjct  118  KFQIEGIPALIILKPGGGLIQTEGVEILYRYGLQAFPF  155


 Score =   118 bits (295),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 64/159 (40%), Positives = 91/159 (57%), Gaps = 5/159 (3%)
 Frame = +3

Query  63   ERKASSMAEQNGD--AHDLRSILCSSDRDFLIRNSGHQVKVDDLKGKKIGIYFSASWCGP  236
            ER A   AE+     +  L  +L  S +D +I+ +  QV    L GK +G+YF+A WC P
Sbjct  158  ERIAELEAEEKRKYASQTLEKLLAISGKDHMIKRN-DQVTFSSLVGKTVGLYFAAQWCPP  216

Query  237  CHRFTPNLATVYNELLPKG-NFEVVFVSADEDEESFKEYFGKMPWTAVPFSDSVTRERLD  413
            C +FT  L ++YN L  +G  FEVVFVS D DE  F +YF  MPW A+P+ +  ++  L 
Sbjct  217  CLKFTSRLMSIYNHLQERGEEFEVVFVSMDRDEAGFLQYFSGMPWLALPYGEESSKA-LA  275

Query  414  ALFTVRGIPHLVILDESGKVTTEDGVDIVLEHGVEAYPF  530
              F ++ IP LVI+   GK  T+ G +++  H   AYPF
Sbjct  276  RYFDIQEIPMLVIIGPDGKTVTKGGRNLINLHMEMAYPF  314



>ref|XP_004986914.1| PREDICTED: LOW QUALITY PROTEIN: probable nucleoredoxin 1-2-like 
[Setaria italica]
Length=554

 Score =   129 bits (325),  Expect = 8e-32, Method: Compositional matrix adjust.
 Identities = 63/123 (51%), Positives = 80/123 (65%), Gaps = 2/123 (2%)
 Frame = +3

Query  168  QVKVDDLKGKKIGIYFSASWCGPCHRFTPNLATVYNELLPKGN-FEVVFVSADEDEESFK  344
            QVK+  ++   + +YFSASWC PC RFTP    VY EL  + N  EVVFVS D DEESF 
Sbjct  18   QVKISAIEASTVALYFSASWCPPCRRFTPTFVEVYEELTSQDNSLEVVFVSRDRDEESFN  77

Query  345  EYFGKMPWTAVPFSDSVTRERLDALFTVRGIPHLVILD-ESGKVTTEDGVDIVLEHGVEA  521
             Y  KMPW AVP +DS   +RL   + V GIP+LVIL  E+G + T++GV  + E+G+ A
Sbjct  78   AYLAKMPWLAVPLADSECLQRLMKGYKVNGIPNLVILSGETGXIYTKEGVKFISEYGIGA  137

Query  522  YPF  530
             PF
Sbjct  138  SPF  140


 Score =   116 bits (290),  Expect = 6e-27, Method: Compositional matrix adjust.
 Identities = 56/150 (37%), Positives = 85/150 (57%), Gaps = 2/150 (1%)
 Frame = +3

Query  84   AEQNGDAHDLRSILCSSDRDFLIRNSGHQVKVDDLKGKKIGIYFSASWCGPCHRFTPNLA  263
            ++    +  L S+L   D +F+    G +V V +L GK + +YFS  WC PC  F P L 
Sbjct  312  SKTKAASQSLESLLVKDDLEFVTGKDGVKVPVSELVGKTVILYFSTKWCPPCRDFLPTLV  371

Query  264  TVYNELLPK-GNFEVVFVSADEDEESFKEYFGKMPWTAVPFSDSVTRERLDALFTVRGIP  440
              Y ++  K  +FE++F+S D+DE S+ E+F  MPW A+P  D   +E L   F +R IP
Sbjct  372  KEYKKMKEKNSDFEILFISIDKDEXSYDEFFSDMPWLALPLGDE-RKELLMKKFRIREIP  430

Query  441  HLVILDESGKVTTEDGVDIVLEHGVEAYPF  530
             L+++  SG   T+D    +L HG +A+PF
Sbjct  431  SLIVIGPSGLTLTKDAKSHLLAHGADAFPF  460


 Score = 82.8 bits (203),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 50/157 (32%), Positives = 80/157 (51%), Gaps = 8/157 (5%)
 Frame = +3

Query  66   RKASSMAEQNGDAHD---LRSILCSSDRDFLIRNSGHQVKVDDLKGKKIGIYFSASWCGP  236
            ++ + + EQ   A D   + S+L +  RD+LI + G +V +  L+GK + ++F      P
Sbjct  143  QRINELKEQEKAAKDNQTIHSVLGTPTRDYLISSEGDKVPISVLEGKYVALFFMVR---P  199

Query  237  CHRFTPNLATVYNELLPKG-NFEVVFVSADEDEESFKEYFGKMPWTAVPFSDSVTRERLD  413
               FT  L  +Y +L   G  FEVV V    +E  F E F  MPW A+P  D +  ++L 
Sbjct  200  IDEFTAVLTKIYEKLRAVGEKFEVVAVYFGSNESVFNESFASMPWFAIPHGDKMC-DKLV  258

Query  414  ALFTVRGIPHLVILDESGKVTTEDGVDIVLEHGVEAY  524
              F +  +P LV++   G     +  D++ EHG EA+
Sbjct  259  RYFELTTLPTLVLIGPDGNTLNNNIADVIEEHGSEAW  295



>ref|XP_008054249.1| PREDICTED: nucleoredoxin [Tarsius syrichta]
Length=318

 Score =   127 bits (318),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 57/130 (44%), Positives = 85/130 (65%), Gaps = 2/130 (2%)
 Frame = +3

Query  147  LIRNSGHQVKVDDLKGKKIGIYFSASWCGPCHRFTPNLATVYNELLPKG-NFEVVFVSAD  323
            L+RN+G  ++   L+G  +G+YFSA WC PC   T  L   Y ++   G NFE++FVSAD
Sbjct  61   LLRNNGQSLESGSLEGSHVGVYFSAHWCPPCRSLTRVLVESYRKIKEAGQNFEIIFVSAD  120

Query  324  EDEESFKEYFGKMPWTAVPFSDSVTRERLDALFTVRGIPHLVILDESGKVTTEDG-VDIV  500
              EESFK+YF +MPW AVP++D   R RL+ L+ ++GIP L++LD  G+V T  G V+++
Sbjct  121  RSEESFKQYFSEMPWLAVPYTDEARRSRLNRLYGIQGIPTLIVLDPQGEVITRQGRVEVL  180

Query  501  LEHGVEAYPF  530
             +     +P+
Sbjct  181  NDEDCREFPW  190



>ref|NP_001053815.2| Os04g0608600 [Oryza sativa Japonica Group]
 dbj|BAF15729.2| Os04g0608600, partial [Oryza sativa Japonica Group]
Length=200

 Score =   124 bits (310),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 58/123 (47%), Positives = 78/123 (63%), Gaps = 3/123 (2%)
 Frame = +3

Query  168  QVKVDDLKGKKIGIYFSASWCGPCHRFTPNLATVYNEL--LPKGNFEVVFVSADEDEESF  341
            Q  + DL GK IG+YF A WC PC  FT  L   Y+EL  L  GNF+V+F+S D +EE F
Sbjct  3    QTPISDLNGKTIGLYFGAHWCPPCRAFTKQLREAYDELKALRPGNFQVIFISMDRNEEEF  62

Query  342  KEYFGKMPWTAVPFSDSVTRERLDALFTVRGIPHLVILDESGKVTTEDGVDIVLEHGVEA  521
            +     MPW A+P+SD+  +E L  +FT++GIP L+IL   GKV   DG  I+ ++G  A
Sbjct  63   QASLSAMPWFAIPYSDTTVQE-LSRIFTIKGIPTLLILGPDGKVFKTDGRRIISKYGAMA  121

Query  522  YPF  530
            +PF
Sbjct  122  FPF  124



>ref|XP_008806406.1| PREDICTED: probable nucleoredoxin 2 [Phoenix dactylifera]
Length=413

 Score =   127 bits (320),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 65/153 (42%), Positives = 97/153 (63%), Gaps = 4/153 (3%)
 Frame = +3

Query  75   SSMAEQNGDAHDLRSILCSSDRDFLIRNSGHQVKVDDLKGKKIGIYFSASWCGPCHRFTP  254
            + +A    D  DL ++L +   DFL+  SG++V + +L+GK IG+YF+A+W   C  FTP
Sbjct  6    TGLAAATEDGIDLFTVLST---DFLLSPSGNKVDLKELEGKTIGLYFAANWYSKCETFTP  62

Query  255  NLATVYNELLPKGN-FEVVFVSADEDEESFKEYFGKMPWTAVPFSDSVTRERLDALFTVR  431
             LA VY++L   G+ FEVV+VS+DED  SF+ +   M W A+PFSD  +R  L   F + 
Sbjct  63   VLARVYHQLKELGSEFEVVYVSSDEDHASFERFHSLMLWPAIPFSDLKSRRSLTQRFQIE  122

Query  432  GIPHLVILDESGKVTTEDGVDIVLEHGVEAYPF  530
            GIP L+IL+  G++   DGV++V  +   A+PF
Sbjct  123  GIPSLIILNSKGELIRTDGVELVNRYECRAFPF  155


 Score =   111 bits (278),  Expect = 8e-26, Method: Compositional matrix adjust.
 Identities = 61/166 (37%), Positives = 96/166 (58%), Gaps = 5/166 (3%)
 Frame = +3

Query  36   FQFSKRKGEERKASSMAEQNGDAHDLRSILCSSDRDFLIRNSGHQVKVDDLKGKKIGIYF  215
            F F+  +  E +A   A+    +  L  +L    RD +I +   QV +  L GK +G+YF
Sbjct  153  FPFTSERMAELEADEKAKHA--SQTLEKLLSLHGRDCVISHE-QQVPISKLVGKTVGLYF  209

Query  216  SASWCGPCHRFTPNLATVYNELLPKG-NFEVVFVSADEDEESFKEYFGKMPWTAVPFSDS  392
            SA  C PC +FT  LA++Y+ L  K   FE+VFVS D+DE  + + + +MPW A+P++D 
Sbjct  210  SAQECLPCTKFTSKLASIYDNLKEKNEEFEIVFVSMDKDEAGYLQCYSEMPWLALPYNDE  269

Query  393  VTRERLDALFTVRGIPHLVILDESGKVTTEDGVDIVLEHGVEAYPF  530
             +R  L   F ++GIP L+I+   GK  T++G +++  H   A+PF
Sbjct  270  SSR-ALARYFDLQGIPALIIIGPDGKTVTKEGRNLINLHLEMAFPF  314



>emb|CBI20806.3| unnamed protein product [Vitis vinifera]
Length=1126

 Score =   131 bits (329),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 66/169 (39%), Positives = 98/169 (58%), Gaps = 5/169 (3%)
 Frame = +3

Query  30   SIFQFSKRKGEERKASSMAEQNGDAHDLRSILCSSDRDFLIRNSGHQVKVDDLKGKKIGI  209
            S F F+ ++ EE KA   A++ G    L  +L +  R+ +I +SG ++ V +L GK IG+
Sbjct  150  SAFPFTSQRREELKAMDNAKRQGG--KLEELLANEGRNHVISSSGREILVSELVGKTIGL  207

Query  210  YFSASWCGPCHRFTPNLATVYNELLPKGN--FEVVFVSADEDEESFKEYFGKMPWTAVPF  383
            YF+A WC PC  FT  L   YN+L+   N  FE++FVS D D + F      MPW A+P+
Sbjct  208  YFAAHWCPPCRAFTAQLIEAYNKLVATRNQCFEIIFVSTDRDHQEFDLSLSNMPWLAIPY  267

Query  384  SDSVTRERLDALFTVRGIPHLVILDESGKVTTEDGVDIVLEHGVEAYPF  530
             D   R+ L  +F ++GIP LV+L   GK  + +G  I+  +G  A+PF
Sbjct  268  EDKA-RQDLCRIFDIKGIPALVLLGSDGKTISTNGRAIISSYGAMAFPF  315


 Score =   115 bits (288),  Expect = 5e-26, Method: Compositional matrix adjust.
 Identities = 57/145 (39%), Positives = 86/145 (59%), Gaps = 3/145 (2%)
 Frame = +3

Query  99   DAHDLRSILCSSDRDFLIRNSGHQVKVDDLKGKKIGIYFSASWCGPCHRFTPNLATVYNE  278
            D++D+ ++L S   +FL+   G +V +   +GK I ++FSA+WC PC  FTP L  +YN 
Sbjct  12   DSNDIITVLASEGIEFLLSGEG-KVSLSSTEGKMICLFFSANWCRPCRTFTPQLVQIYNS  70

Query  279  LLPKGNF-EVVFVSADEDEESFKEYFGKMPWTAVPFSDSVTRERLDALFTVRGIPHLVIL  455
            L+  G   E++F+S D DE  F E+F  MPW AVPF+  + R RL   + V  IP  + L
Sbjct  71   LIKTGRMIEIIFISFDRDETGFGEHFKSMPWLAVPFNVDLHR-RLSDHYHVDHIPSFIPL  129

Query  456  DESGKVTTEDGVDIVLEHGVEAYPF  530
               GK   ED + ++ ++G  A+PF
Sbjct  130  GLDGKSIEEDAIGLIEDYGASAFPF  154



>gb|KJB58048.1| hypothetical protein B456_009G191800 [Gossypium raimondii]
Length=430

 Score =   127 bits (320),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 69/173 (40%), Positives = 102/173 (59%), Gaps = 11/173 (6%)
 Frame = +3

Query  36   FQFSKRKGEERKASSMAEQNGDAHDLRSILCSSDRDFLIRNS-GHQVKVDDLKGKKIGIY  212
            F F+K K +E +     ++  D+  + ++L + +RD+L+  +   +V VD LKGK +G+Y
Sbjct  177  FPFTKEKLDELRREE--KRKHDSQTVTNLLTNPERDYLLDQTITRKVPVDSLKGKTVGLY  234

Query  213  FSASWCGPCHRFTPNLATVYNE----LLPKG---NFEVVFVSADEDEESFKEYFGKMPWT  371
             SA WC PC  FTP L ++Y +    L  KG   +FE+VFVS D D+ SF+ YFG MPW 
Sbjct  235  LSAQWCMPCVEFTPKLISIYQKIKQALQEKGGGEDFEIVFVSNDRDQSSFESYFGTMPWL  294

Query  372  AVPFSDSVTRERLDALFTVRGIPHLVILDESGKVTTEDGVDIVLEHGVEAYPF  530
            A+PF D   R  L   F V+ IP L+I+   GK  T+ G +++  +   AYPF
Sbjct  295  ALPFRDPTAR-TLAKYFDVQWIPCLIIIGPDGKTVTKQGRNLINLYQENAYPF  346


 Score =   119 bits (299),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 64/141 (45%), Positives = 88/141 (62%), Gaps = 9/141 (6%)
 Frame = +3

Query  135  DRDFLIRNSG-----HQVKVDDLKGKKIGIYFSASWCGPCHRFTPNLATVYNELLPKG-N  296
            DRD+L+ ++       QVK+ DL+GK IGIYFSA+W  PC  F   L  VY +L   G N
Sbjct  39   DRDYLLCSTAAAAETDQVKISDLEGKVIGIYFSANWYPPCRNFNRVLIGVYEQLKSNGSN  98

Query  297  FEVVFVSADEDEESFKEYFGKMPWTAVPFSDSVTRERLDALFTVRGIPHLVILDESGKV-  473
            FE+VFVS+DED ++F  Y   MPW ++PFSD  T++ L+  + V  IP LVIL       
Sbjct  99   FEIVFVSSDEDLDAFNSYRENMPWLSIPFSDLETKKALNRKYDVESIPCLVILQPDNTKD  158

Query  474  --TTEDGVDIVLEHGVEAYPF  530
              T  DGV+++  +GV+A+PF
Sbjct  159  DDTYYDGVELIYRYGVDAFPF  179



>gb|KJB58049.1| hypothetical protein B456_009G191800 [Gossypium raimondii]
Length=431

 Score =   127 bits (320),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 69/173 (40%), Positives = 102/173 (59%), Gaps = 11/173 (6%)
 Frame = +3

Query  36   FQFSKRKGEERKASSMAEQNGDAHDLRSILCSSDRDFLIRNS-GHQVKVDDLKGKKIGIY  212
            F F+K K +E +     ++  D+  + ++L + +RD+L+  +   +V VD LKGK +G+Y
Sbjct  178  FPFTKEKLDELRREE--KRKHDSQTVTNLLTNPERDYLLDQTITRKVPVDSLKGKTVGLY  235

Query  213  FSASWCGPCHRFTPNLATVYNE----LLPKG---NFEVVFVSADEDEESFKEYFGKMPWT  371
             SA WC PC  FTP L ++Y +    L  KG   +FE+VFVS D D+ SF+ YFG MPW 
Sbjct  236  LSAQWCMPCVEFTPKLISIYQKIKQALQEKGGGEDFEIVFVSNDRDQSSFESYFGTMPWL  295

Query  372  AVPFSDSVTRERLDALFTVRGIPHLVILDESGKVTTEDGVDIVLEHGVEAYPF  530
            A+PF D   R  L   F V+ IP L+I+   GK  T+ G +++  +   AYPF
Sbjct  296  ALPFRDPTAR-TLAKYFDVQWIPCLIIIGPDGKTVTKQGRNLINLYQENAYPF  347


 Score =   120 bits (300),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 64/142 (45%), Positives = 88/142 (62%), Gaps = 10/142 (7%)
 Frame = +3

Query  135  DRDFLIRNSG------HQVKVDDLKGKKIGIYFSASWCGPCHRFTPNLATVYNELLPKG-  293
            DRD+L+ ++        QVK+ DL+GK IGIYFSA+W  PC  F   L  VY +L   G 
Sbjct  39   DRDYLLCSTAAAAETDQQVKISDLEGKVIGIYFSANWYPPCRNFNRVLIGVYEQLKSNGS  98

Query  294  NFEVVFVSADEDEESFKEYFGKMPWTAVPFSDSVTRERLDALFTVRGIPHLVILDESGKV  473
            NFE+VFVS+DED ++F  Y   MPW ++PFSD  T++ L+  + V  IP LVIL      
Sbjct  99   NFEIVFVSSDEDLDAFNSYRENMPWLSIPFSDLETKKALNRKYDVESIPCLVILQPDNTK  158

Query  474  ---TTEDGVDIVLEHGVEAYPF  530
               T  DGV+++  +GV+A+PF
Sbjct  159  DDDTYYDGVELIYRYGVDAFPF  180



>gb|KJB58046.1| hypothetical protein B456_009G191800 [Gossypium raimondii]
Length=478

 Score =   127 bits (320),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 69/173 (40%), Positives = 102/173 (59%), Gaps = 11/173 (6%)
 Frame = +3

Query  36   FQFSKRKGEERKASSMAEQNGDAHDLRSILCSSDRDFLIRNS-GHQVKVDDLKGKKIGIY  212
            F F+K K +E +     ++  D+  + ++L + +RD+L+  +   +V VD LKGK +G+Y
Sbjct  177  FPFTKEKLDELRREE--KRKHDSQTVTNLLTNPERDYLLDQTITRKVPVDSLKGKTVGLY  234

Query  213  FSASWCGPCHRFTPNLATVYNE----LLPKG---NFEVVFVSADEDEESFKEYFGKMPWT  371
             SA WC PC  FTP L ++Y +    L  KG   +FE+VFVS D D+ SF+ YFG MPW 
Sbjct  235  LSAQWCMPCVEFTPKLISIYQKIKQALQEKGGGEDFEIVFVSNDRDQSSFESYFGTMPWL  294

Query  372  AVPFSDSVTRERLDALFTVRGIPHLVILDESGKVTTEDGVDIVLEHGVEAYPF  530
            A+PF D   R  L   F V+ IP L+I+   GK  T+ G +++  +   AYPF
Sbjct  295  ALPFRDPTART-LAKYFDVQWIPCLIIIGPDGKTVTKQGRNLINLYQENAYPF  346


 Score =   120 bits (300),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 64/141 (45%), Positives = 88/141 (62%), Gaps = 9/141 (6%)
 Frame = +3

Query  135  DRDFLIRNSG-----HQVKVDDLKGKKIGIYFSASWCGPCHRFTPNLATVYNELLPKG-N  296
            DRD+L+ ++       QVK+ DL+GK IGIYFSA+W  PC  F   L  VY +L   G N
Sbjct  39   DRDYLLCSTAAAAETDQVKISDLEGKVIGIYFSANWYPPCRNFNRVLIGVYEQLKSNGSN  98

Query  297  FEVVFVSADEDEESFKEYFGKMPWTAVPFSDSVTRERLDALFTVRGIPHLVILDESGKV-  473
            FE+VFVS+DED ++F  Y   MPW ++PFSD  T++ L+  + V  IP LVIL       
Sbjct  99   FEIVFVSSDEDLDAFNSYRENMPWLSIPFSDLETKKALNRKYDVESIPCLVILQPDNTKD  158

Query  474  --TTEDGVDIVLEHGVEAYPF  530
              T  DGV+++  +GV+A+PF
Sbjct  159  DDTYYDGVELIYRYGVDAFPF  179



>gb|KJB58047.1| hypothetical protein B456_009G191800 [Gossypium raimondii]
Length=479

 Score =   127 bits (320),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 69/173 (40%), Positives = 102/173 (59%), Gaps = 11/173 (6%)
 Frame = +3

Query  36   FQFSKRKGEERKASSMAEQNGDAHDLRSILCSSDRDFLIRNS-GHQVKVDDLKGKKIGIY  212
            F F+K K +E +     ++  D+  + ++L + +RD+L+  +   +V VD LKGK +G+Y
Sbjct  178  FPFTKEKLDELRREE--KRKHDSQTVTNLLTNPERDYLLDQTITRKVPVDSLKGKTVGLY  235

Query  213  FSASWCGPCHRFTPNLATVYNE----LLPKG---NFEVVFVSADEDEESFKEYFGKMPWT  371
             SA WC PC  FTP L ++Y +    L  KG   +FE+VFVS D D+ SF+ YFG MPW 
Sbjct  236  LSAQWCMPCVEFTPKLISIYQKIKQALQEKGGGEDFEIVFVSNDRDQSSFESYFGTMPWL  295

Query  372  AVPFSDSVTRERLDALFTVRGIPHLVILDESGKVTTEDGVDIVLEHGVEAYPF  530
            A+PF D   R  L   F V+ IP L+I+   GK  T+ G +++  +   AYPF
Sbjct  296  ALPFRDPTART-LAKYFDVQWIPCLIIIGPDGKTVTKQGRNLINLYQENAYPF  347


 Score =   120 bits (301),  Expect = 9e-29, Method: Compositional matrix adjust.
 Identities = 64/142 (45%), Positives = 88/142 (62%), Gaps = 10/142 (7%)
 Frame = +3

Query  135  DRDFLIRNSG------HQVKVDDLKGKKIGIYFSASWCGPCHRFTPNLATVYNELLPKG-  293
            DRD+L+ ++        QVK+ DL+GK IGIYFSA+W  PC  F   L  VY +L   G 
Sbjct  39   DRDYLLCSTAAAAETDQQVKISDLEGKVIGIYFSANWYPPCRNFNRVLIGVYEQLKSNGS  98

Query  294  NFEVVFVSADEDEESFKEYFGKMPWTAVPFSDSVTRERLDALFTVRGIPHLVILDESGKV  473
            NFE+VFVS+DED ++F  Y   MPW ++PFSD  T++ L+  + V  IP LVIL      
Sbjct  99   NFEIVFVSSDEDLDAFNSYRENMPWLSIPFSDLETKKALNRKYDVESIPCLVILQPDNTK  158

Query  474  ---TTEDGVDIVLEHGVEAYPF  530
               T  DGV+++  +GV+A+PF
Sbjct  159  DDDTYYDGVELIYRYGVDAFPF  180



>ref|XP_008781716.1| PREDICTED: probable nucleoredoxin 3 [Phoenix dactylifera]
Length=386

 Score =   127 bits (318),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 64/167 (38%), Positives = 98/167 (59%), Gaps = 5/167 (3%)
 Frame = +3

Query  36   FQFSKRKGEERKASSMAEQNGDAHDLRSILCSSDRDFLIRNSGHQVKVDDLKGKKIGIYF  215
            F F   + +E +A   A+++G    L  +L    RD++I   G ++ + DL GK IG+YF
Sbjct  150  FPFGAERRKELEAMDEAKRHGG--KLEELLGCGGRDYVISGDGAKILIADLVGKTIGLYF  207

Query  216  SASWCGPCHRFTPNLATVYNEL--LPKGNFEVVFVSADEDEESFKEYFGKMPWTAVPFSD  389
             A WC PC  FT  LA  YNEL    K +F+++++S D DE+ F+    +M W A+P++D
Sbjct  208  GARWCPPCRAFTSMLAEAYNELRDARKESFQIIYISTDRDEDEFQASLEEMAWLAIPYAD  267

Query  390  SVTRERLDALFTVRGIPHLVILDESGKVTTEDGVDIVLEHGVEAYPF  530
              TR  L  +F V+GIP LV+L + GK    DG  ++  +G +A+PF
Sbjct  268  K-TRYDLSRIFDVKGIPRLVLLGDDGKALEADGRAMISSYGAKAFPF  313


 Score =   111 bits (277),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 60/149 (40%), Positives = 87/149 (58%), Gaps = 5/149 (3%)
 Frame = +3

Query  87   EQNGDAHDLRSILCSSDRDFLIRNSGHQVKVDDLKGKKIGIYFSASWCGPCHRFTPNLAT  266
            +  G+ H  RSIL  +  +FL+ +   +V +  ++GK I  +FSA+WC PC  F+P+L  
Sbjct  8    DMEGEIH--RSILAVAGVEFLL-SGEERVPLSCIEGKSICFFFSANWCRPCRNFSPHLVQ  64

Query  267  VYNELLPKG-NFEVVFVSADEDEESFKEYFGKMPWTAVPFSDSVTRERLDALFTVRGIPH  443
            +Y  L  +G   E+VFVS D DE SF ++F  MPW AVPF D   R+RL     +  IP 
Sbjct  65   LYTTLKTQGEKLEIVFVSLDRDENSFLDHFKHMPWLAVPF-DINIRKRLSRRLLIEHIPS  123

Query  444  LVILDESGKVTTEDGVDIVLEHGVEAYPF  530
            L+ L   G+   ED V +V + G +A+PF
Sbjct  124  LIPLASDGRTVKEDAVQLVEDFGPDAFPF  152



>gb|KHG03676.1| hypothetical protein F383_28340 [Gossypium arboreum]
 gb|KHG17378.1| hypothetical protein F383_21915 [Gossypium arboreum]
Length=390

 Score =   126 bits (317),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 66/167 (40%), Positives = 100/167 (60%), Gaps = 5/167 (3%)
 Frame = +3

Query  36   FQFSKRKGEERKASSMAEQNGDAHDLRSILCSSDRDFLIRNSGHQVKVDDLKGKKIGIYF  215
            F F+K++ EE KA   +++ G   D   +L    RD+++ + G +V V  L GK +G+YF
Sbjct  155  FPFTKKRREELKAIDDSKRQGGKID--QLLARPGRDYVVASDGGKVLVSKLIGKTVGLYF  212

Query  216  SASWCGPCHRFTPNLATVYNELL-PKGN-FEVVFVSADEDEESFKEYFGKMPWTAVPFSD  389
             A WC PC  FT  L   YN+LL  +G+ FEVV VS+D D++ F      MPW A+PF D
Sbjct  213  GAHWCPPCRAFTAQLVEAYNQLLSSRGDCFEVVLVSSDRDQKEFDVNISGMPWLALPFED  272

Query  390  SVTRERLDALFTVRGIPHLVILDESGKVTTEDGVDIVLEHGVEAYPF  530
              TR+ L  +F ++ IP LV++   GK  + +G +I+  +G +A+PF
Sbjct  273  R-TRQDLCRIFNIKAIPALVLIGPDGKPISTNGKNIITLYGAKAFPF  318


 Score =   101 bits (252),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 56/144 (39%), Positives = 79/144 (55%), Gaps = 4/144 (3%)
 Frame = +3

Query  108  DLRSILCSSDRDFLIRNSGHQVKVD--DLKGKKIGIYFSASWCGPCHRFTPNLATVYNEL  281
            D  +IL S   DFL+     +V +   D +   I ++FSA+WC PC  FTP L  +YN L
Sbjct  15   DFLTILASEGVDFLLSGEEDKVTLSSFDYEKTTICLFFSANWCRPCQSFTPKLVQLYNML  74

Query  282  LPKGN-FEVVFVSADEDEESFKEYFGKMPWTAVPFSDSVTRERLDALFTVRGIPHLVILD  458
               G   E+VF+S D DE+ F  +F  MPW  VPF D    ++L   F V  IP LV L+
Sbjct  75   RTMGKELEIVFISLDHDEDGFNAHFETMPWLTVPF-DVNLHKKLRERFHVVRIPFLVPLN  133

Query  459  ESGKVTTEDGVDIVLEHGVEAYPF  530
              G+   ED + ++ + G +A+PF
Sbjct  134  LDGQSVEEDLIGLIEDFGEDAFPF  157



>ref|XP_004500916.1| PREDICTED: probable nucleoredoxin 2-like isoform X1 [Cicer arietinum]
 ref|XP_004500917.1| PREDICTED: probable nucleoredoxin 2-like isoform X2 [Cicer arietinum]
Length=425

 Score =   126 bits (317),  Expect = 5e-31, Method: Compositional matrix adjust.
 Identities = 62/142 (44%), Positives = 92/142 (65%), Gaps = 4/142 (3%)
 Frame = +3

Query  117  SILCSSDRDFLIRNSGHQVKVDDLKGKKIGIYFSASWCGPCHRFTPNLATVYNELLPKG-  293
             +L SS RDFL+  +G QVKV +L+GK +G+ F+A+W  PC  FT  L  +Y EL     
Sbjct  32   QLLASSHRDFLLSPTGAQVKVSELEGKVVGLLFAANWYPPCRVFTQLLIGIYEELKTNNP  91

Query  294  NFEVVFVSADEDEESFKEYFGKMPWTAVPFSDSVTRERLDALFTVRGIPHLVILDESG--  467
            +FE+V+VS+DED ++F E++  MPW A+PF D  T++ L+  + V GIP L++L  S   
Sbjct  92   HFEIVYVSSDEDLDAFNEFYKNMPWLAIPFYDLETKKSLNRKYEVEGIPCLIMLQPSKVD  151

Query  468  -KVTTEDGVDIVLEHGVEAYPF  530
               T   GV+++  +GV+AYPF
Sbjct  152  DATTLRHGVELIYRYGVQAYPF  173


 Score =   113 bits (283),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 63/155 (41%), Positives = 89/155 (57%), Gaps = 12/155 (8%)
 Frame = +3

Query  99   DAHDLRSILCSSDRDFLIRNSGH----QVKVDDLKGKKIGIYFSASWCGPCHRFTPNLAT  266
            +   L ++L ++ RD+++  +      QV +  L GK IG+YFSA WC PC +FTP L +
Sbjct  190  ENQTLINLLANNFRDYVLSQTHTGLFTQVPIASLVGKTIGLYFSAGWCVPCTKFTPKLIS  249

Query  267  VY----NELLPKG---NFEVVFVSADEDEESFKEYFGKMPWTAVPFSDSVTRERLDALFT  425
            VY     EL  KG   +FE+V VS D D+ESF  Y+  MPW A+PF D   +  L   F 
Sbjct  250  VYEKIKQELTEKGDNEDFEIVLVSNDRDQESFDSYYNTMPWLALPFGDPEIK-NLARHFD  308

Query  426  VRGIPHLVILDESGKVTTEDGVDIVLEHGVEAYPF  530
            ++GIP LVI+   GK  T  G +++  +   AYPF
Sbjct  309  IQGIPCLVIIGPDGKTITIHGRNLINLYQENAYPF  343



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 559039970400