BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFF036M02

Length=562
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009786071.1|  PREDICTED: aquaporin PIP2-7-like                   238   7e-75   Nicotiana sylvestris
ref|XP_009615789.1|  PREDICTED: aquaporin PIP2-7-like                   237   3e-74   Nicotiana tomentosiformis
tpg|DAA64677.1|  TPA: aquaporin PIP2 4a                                 236   3e-74   Nicotiana tabacum [American tobacco]
gb|AFQ23186.1|  aquaporin PIP2;1                                        235   9e-74   Eustoma exaltatum subsp. russellianum [bluebells]
ref|NP_001275065.1|  major intrinsic protein 2                          234   3e-73   Solanum tuberosum [potatoes]
gb|AAB18227.1|  MipC                                                    233   6e-73   Mesembryanthemum crystallinum
ref|XP_009595123.1|  PREDICTED: aquaporin PIP2-4-like                   232   2e-72   Nicotiana tomentosiformis
ref|XP_009780213.1|  PREDICTED: aquaporin PIP2-4-like                   230   8e-72   Nicotiana sylvestris
ref|NP_001289846.1|  probable aquaporin PIP2-1                          230   9e-72   
gb|ABB13430.2|  plasma membrane intrinsic protein                       228   6e-71   Olea europaea
ref|XP_006357563.1|  PREDICTED: probable aquaporin PIP2-1-like          227   2e-70   Solanum tuberosum [potatoes]
gb|KCW51391.1|  hypothetical protein EUGRSUZ_J00930                     224   2e-70   Eucalyptus grandis [rose gum]
ref|XP_004953172.1|  PREDICTED: aquaporin PIP2-4-like                   224   4e-69   Setaria italica
ref|XP_003575410.1|  PREDICTED: aquaporin PIP2-4                        224   4e-69   Brachypodium distachyon [annual false brome]
ref|XP_010521765.1|  PREDICTED: aquaporin PIP2-7-like                   223   4e-69   Tarenaya hassleriana [spider flower]
ref|NP_001105026.1|  aquaporin PIP2-4                                   223   5e-69   Zea mays [maize]
gb|AFK47400.1|  unknown                                                 223   5e-69   Lotus japonicus
ref|XP_004505993.1|  PREDICTED: aquaporin PIP2-7-like                   223   6e-69   Cicer arietinum [garbanzo]
emb|CDP07111.1|  unnamed protein product                                223   7e-69   Coffea canephora [robusta coffee]
ref|XP_010031998.1|  PREDICTED: aquaporin PIP2-7-like                   223   1e-68   Eucalyptus grandis [rose gum]
ref|NP_001105025.1|  aquaporin PIP2-3                                   223   1e-68   Zea mays [maize]
gb|ACU23034.1|  unknown                                                 218   1e-68   Glycine max [soybeans]
gb|ACG33001.1|  aquaporin PIP2.2                                        222   1e-68   Zea mays [maize]
ref|NP_001240223.1|  prolactin-inducible protein                        221   2e-68   Glycine max [soybeans]
gb|ADK25057.1|  plasma membrane intrinsic protein                       221   3e-68   Glycine max [soybeans]
dbj|BAE02729.1|  PIP aquaporin                                          221   3e-68   Hordeum vulgare [barley]
ref|XP_003606384.1|  Aquaporin PIP2-7                                   218   3e-68   
ref|XP_010253676.1|  PREDICTED: aquaporin PIP2-4-like                   221   4e-68   Nelumbo nucifera [Indian lotus]
ref|XP_002452483.1|  hypothetical protein SORBIDRAFT_04g026650          221   5e-68   Sorghum bicolor [broomcorn]
gb|AAF61464.1|AF139815_1  plasma membrane intrinsic protein 2           220   5e-68   Triticum aestivum [Canadian hard winter wheat]
gb|KDO73275.1|  hypothetical protein CISIN_1g022966mg                   220   5e-68   Citrus sinensis [apfelsine]
ref|XP_006424577.1|  hypothetical protein CICLE_v10028975mg             220   5e-68   
gb|KJB56129.1|  hypothetical protein B456_009G107200                    219   5e-68   Gossypium raimondii
gb|AEO13898.1|  aquaporin 7                                             220   6e-68   Triticum aestivum [Canadian hard winter wheat]
gb|KJB62460.1|  hypothetical protein B456_009G418100                    218   7e-68   Gossypium raimondii
emb|CAB45651.1|  putative plasma membrane intrinsic protein             220   8e-68   Pisum sativum [garden pea]
ref|XP_008785285.1|  PREDICTED: aquaporin PIP2-4                        220   1e-67   Phoenix dactylifera
gb|KHN05685.1|  Aquaporin PIP2-7                                        220   1e-67   Glycine soja [wild soybean]
gb|EAY86778.1|  hypothetical protein OsI_08158                          220   1e-67   Oryza sativa Indica Group [Indian rice]
ref|NP_001047491.1|  Os02g0629200                                       220   1e-67   
ref|XP_002877918.1|  hypothetical protein ARALYDRAFT_485715             220   1e-67   
gb|AAC17529.1|  aquaporin 2                                             219   1e-67   Samanea saman [cow-tamarind]
ref|XP_006424576.1|  hypothetical protein CICLE_v10028975mg             219   1e-67   Citrus clementina [clementine]
ref|XP_003538174.1|  PREDICTED: aquaporin PIP2-7                        219   1e-67   Glycine max [soybeans]
ref|XP_008791535.1|  PREDICTED: aquaporin PIP2-4-like                   219   1e-67   Phoenix dactylifera
ref|XP_006291609.1|  hypothetical protein CARUB_v10017763mg             219   1e-67   Capsella rubella
gb|EMT09900.1|  Putative aquaporin PIP2-2                               220   1e-67   
gb|KHN38765.1|  Aquaporin PIP2-7                                        219   2e-67   Glycine soja [wild soybean]
gb|KJB16797.1|  hypothetical protein B456_002G2484002                   214   2e-67   Gossypium raimondii
gb|AFH36337.1|  aquaporin PIP2;2                                        219   2e-67   Quercus petraea [durmast oak]
dbj|BAA23744.1|  HvPIP2;1                                               219   2e-67   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|KHG00060.1|  putative aquaporin PIP2-2                               219   2e-67   Gossypium arboreum [tree cotton]
gb|KJB56128.1|  hypothetical protein B456_009G107200                    218   4e-67   Gossypium raimondii
ref|XP_007143702.1|  hypothetical protein PHAVU_007G094600g             218   4e-67   Phaseolus vulgaris [French bean]
ref|XP_010426989.1|  PREDICTED: aquaporin PIP2-1                        218   5e-67   Camelina sativa [gold-of-pleasure]
ref|XP_010920406.1|  PREDICTED: aquaporin PIP2-4 isoform X2             216   5e-67   Elaeis guineensis
gb|KJB36606.1|  hypothetical protein B456_006G166800                    215   5e-67   Gossypium raimondii
gb|ABK60195.2|  PIP2 protein                                            218   6e-67   Gossypium hirsutum [American cotton]
ref|XP_010920407.1|  PREDICTED: probable aquaporin PIP2-2               218   6e-67   Elaeis guineensis
gb|KJB11821.1|  hypothetical protein B456_002G2484001                   218   6e-67   Gossypium raimondii
ref|XP_003606383.1|  Aquaporin PIP2-7                                   218   6e-67   Medicago truncatula
gb|AIA83106.1|  putative aquaporin PIP2                                 218   6e-67   Citrus trifoliata [hardy orange]
gb|AHG32324.1|  PIP2-3                                                  218   6e-67   Pisum sativum [garden pea]
gb|AGD98714.1|  aquaporin protein 11                                    218   7e-67   Camellia sinensis [black tea]
gb|KHG29841.1|  putative aquaporin PIP2-2                               218   7e-67   Gossypium arboreum [tree cotton]
gb|AEH76326.1|  plasma membrane intrinsic protein 2A                    218   7e-67   Camelina sativa [gold-of-pleasure]
gb|KJB62459.1|  hypothetical protein B456_009G418100                    217   1e-66   Gossypium raimondii
ref|XP_003536353.1|  PREDICTED: aquaporin PIP2-1-like isoform 1         217   1e-66   
gb|ABK60196.1|  PIP2 protein                                            217   1e-66   Gossypium hirsutum [American cotton]
gb|AFK35635.1|  unknown                                                 213   1e-66   Medicago truncatula
gb|AEC45513.1|  plasma membrane intrinsic protein                       217   1e-66   Hevea brasiliensis [jebe]
ref|NP_190910.1|  aquaporin PIP2-1                                      217   1e-66   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002530280.1|  Aquaporin PIP2.1, putative                         217   1e-66   Ricinus communis
gb|AAB67868.1|  plasma membrane major intrinsic protein 1               217   1e-66   Beta vulgaris [beet]
ref|XP_010504105.1|  PREDICTED: aquaporin PIP2-1-like                   217   2e-66   Camelina sativa [gold-of-pleasure]
ref|XP_006403691.1|  hypothetical protein EUTSA_v10010598mg             217   2e-66   Eutrema salsugineum [saltwater cress]
ref|XP_010264685.1|  PREDICTED: aquaporin PIP2-1-like                   217   2e-66   Nelumbo nucifera [Indian lotus]
ref|XP_003540176.1|  PREDICTED: aquaporin PIP2-7                        216   2e-66   
ref|NP_001237286.1|  PIP2,2                                             216   2e-66   
gb|ACU19125.1|  unknown                                                 216   2e-66   Glycine max [soybeans]
ref|XP_009628968.1|  PREDICTED: probable aquaporin PIP2-1               216   2e-66   Nicotiana tomentosiformis
ref|NP_001105639.1|  aquaporin PIP2-7                                   216   3e-66   
ref|XP_010920405.1|  PREDICTED: aquaporin PIP2-4 isoform X1             216   3e-66   Elaeis guineensis
emb|CAA53478.1|  plasma membrane intrinsic protein 2b                   216   3e-66   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010934344.1|  PREDICTED: aquaporin PIP2-4-like                   216   3e-66   Elaeis guineensis
gb|AAO39007.1|  plasma intrinsic protein 2,1                            216   3e-66   Juglans regia
gb|AAO39008.1|  plasma intrinsic protein 2,2                            216   3e-66   Juglans regia
ref|XP_009794928.1|  PREDICTED: LOW QUALITY PROTEIN: probable aqu...    216   3e-66   Nicotiana sylvestris
gb|ACU00104.1|  plasma membrane intrinsic protein PIP2.2                216   4e-66   Populus trichocarpa x Populus deltoides
gb|KHG30776.1|  Aquaporin PIP2-2 -like protein                          216   4e-66   Gossypium arboreum [tree cotton]
ref|NP_001234625.1|  aquaporin                                          215   4e-66   Solanum lycopersicum
emb|CDY56697.1|  BnaCnng31040D                                          216   5e-66   Brassica napus [oilseed rape]
gb|EYU42155.1|  hypothetical protein MIMGU_mgv1a011301mg                215   5e-66   Erythranthe guttata [common monkey flower]
tpg|DAA33865.1|  TPA: aquaporin PIP2;10                                 215   5e-66   Gossypium hirsutum [American cotton]
ref|XP_002322877.1|  major intrinsic protein 1                          215   5e-66   Populus trichocarpa [western balsam poplar]
ref|NP_181254.1|  aquaporin PIP2-2                                      215   6e-66   Arabidopsis thaliana [mouse-ear cress]
ref|NP_001240039.1|  uncharacterized protein LOC100782155               215   6e-66   Glycine max [soybeans]
gb|KHN00691.1|  Aquaporin PIP2-2                                        215   7e-66   Glycine soja [wild soybean]
gb|KDP44053.1|  hypothetical protein JCGZ_05520                         215   8e-66   Jatropha curcas
ref|XP_004976254.1|  PREDICTED: aquaporin PIP2-5-like                   215   8e-66   Setaria italica
ref|XP_007151871.1|  hypothetical protein PHAVU_004G082600g             215   8e-66   Phaseolus vulgaris [French bean]
ref|NP_001235204.1|  Pip1 protein                                       215   9e-66   
gb|AFK47442.1|  unknown                                                 215   9e-66   Medicago truncatula
gb|KHG10662.1|  Aquaporin PIP2-1 -like protein                          215   9e-66   Gossypium arboreum [tree cotton]
gb|KDP44363.1|  hypothetical protein JCGZ_20043                         215   9e-66   Jatropha curcas
ref|NP_001289999.1|  aquaporin PIP2-1                                   215   1e-65   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_008791536.1|  PREDICTED: aquaporin PIP2-4-like                   215   1e-65   Phoenix dactylifera
ref|XP_002519539.1|  Aquaporin PIP2.2, putative                         215   1e-65   Ricinus communis
gb|ABU94631.1|  putative aquaporin PIP2;3                               214   1e-65   Phaseolus vulgaris [French bean]
gb|AIG92831.1|  aquaporin PIP2                                          214   1e-65   Chrysanthemum x morifolium [florist's chrysanthemum]
ref|XP_003518297.1|  PREDICTED: aquaporin PIP2-2-like                   214   1e-65   Glycine max [soybeans]
ref|XP_003548071.1|  PREDICTED: aquaporin PIP2-2-like                   214   1e-65   Glycine max [soybeans]
ref|XP_007151872.1|  hypothetical protein PHAVU_004G082700g             214   2e-65   Phaseolus vulgaris [French bean]
gb|KJB20285.1|  hypothetical protein B456_003G141600                    215   2e-65   Gossypium raimondii
ref|XP_011015478.1|  PREDICTED: aquaporin PIP2-2-like                   214   2e-65   Populus euphratica
ref|XP_009116034.1|  PREDICTED: aquaporin PIP2-1                        214   2e-65   Brassica rapa
dbj|BAA32778.1|  Plasma membrane aquaporin (PAQ2)                       214   2e-65   Raphanus sativus
gb|EYU36189.1|  hypothetical protein MIMGU_mgv1a011437mg                213   3e-65   Erythranthe guttata [common monkey flower]
gb|ACU21481.1|  unknown                                                 214   3e-65   Glycine max [soybeans]
ref|XP_006294744.1|  hypothetical protein CARUB_v10023789mg             213   3e-65   Capsella rubella
ref|NP_181255.1|  aquaporin PIP2-3                                      213   4e-65   Arabidopsis thaliana [mouse-ear cress]
emb|CDX74983.1|  BnaA05g07290D                                          210   4e-65   
gb|ACU20229.1|  unknown                                                 213   4e-65   Glycine max [soybeans]
gb|AIA83104.1|  putative aquaporin PIP2                                 213   5e-65   Citrus sinensis x Citrus trifoliata [Carrizo citrange]
emb|CDY13298.1|  BnaC06g14590D                                          213   5e-65   Brassica napus [oilseed rape]
gb|EMS56715.1|  putative aquaporin PIP2-2                               214   6e-65   Triticum urartu
gb|ACJ85173.1|  unknown                                                 212   9e-65   Medicago truncatula
ref|XP_010505293.1|  PREDICTED: aquaporin PIP2-2                        212   9e-65   Camelina sativa [gold-of-pleasure]
gb|ABC69040.1|  aquaporin PIP2-1                                        212   9e-65   Rhododendron catawbiense [Catawba rosebay]
ref|XP_010516975.1|  PREDICTED: aquaporin PIP2-2-like                   212   9e-65   Camelina sativa [gold-of-pleasure]
gb|AIK66515.1|  putative aquaporin                                      212   1e-64   Vitis vinifera
emb|CAN75442.1|  hypothetical protein VITISV_019657                     212   1e-64   Vitis vinifera
ref|NP_001267922.1|  aquaporin-like                                     212   1e-64   Vitis vinifera
gb|AAV69744.1|  aquaporin                                               212   1e-64   Vitis vinifera
ref|XP_011048549.1|  PREDICTED: aquaporin PIP2-1-like                   212   1e-64   Populus euphratica
gb|ABH09326.1|  putative aquaporin                                      212   1e-64   Vitis vinifera
gb|KCW49751.1|  hypothetical protein EUGRSUZ_K03244                     211   1e-64   Eucalyptus grandis [rose gum]
ref|XP_006381453.1|  hypothetical protein POPTR_0006s12980g             212   1e-64   Populus trichocarpa [western balsam poplar]
ref|XP_002881493.1|  hypothetical protein ARALYDRAFT_482707             212   1e-64   Arabidopsis lyrata subsp. lyrata
gb|AAF71816.1|AF141642_1  putative aquaporin PIP2-1                     212   1e-64   Vitis cinerea var. helleri x Vitis rupestris
ref|XP_010529747.1|  PREDICTED: aquaporin PIP2-2-like                   212   1e-64   Tarenaya hassleriana [spider flower]
ref|XP_002446796.1|  hypothetical protein SORBIDRAFT_06g022840          212   1e-64   Sorghum bicolor [broomcorn]
ref|XP_009381972.1|  PREDICTED: probable aquaporin PIP2-2               211   2e-64   Musa acuminata subsp. malaccensis [pisang utan]
gb|KHG06004.1|  Aquaporin PIP2-2 -like protein                          211   2e-64   Gossypium arboreum [tree cotton]
gb|ACX37450.1|  plasma membrane intrinsic protein                       211   2e-64   Hevea brasiliensis [jebe]
dbj|BAE06148.1|  PIP aquaporin isoform                                  211   2e-64   Hordeum vulgare [barley]
gb|AHB33479.1|  plasma intrinsic protein 2-3                            211   2e-64   Cucumis sativus [cucumbers]
gb|AAY22203.1|  putative aquaporin                                      211   3e-64   Phaseolus vulgaris [French bean]
ref|XP_007132257.1|  hypothetical protein PHAVU_011G079300g             211   3e-64   Phaseolus vulgaris [French bean]
gb|KDP29110.1|  hypothetical protein JCGZ_16499                         211   3e-64   Jatropha curcas
gb|AHA84284.1|  prolactin-inducible protein                             211   3e-64   Phaseolus vulgaris [French bean]
ref|XP_006410896.1|  hypothetical protein EUTSA_v10017874mg             211   3e-64   Eutrema salsugineum [saltwater cress]
ref|XP_011048552.1|  PREDICTED: aquaporin PIP2-2-like                   211   3e-64   Populus euphratica
ref|XP_010037961.1|  PREDICTED: probable aquaporin PIP2-2               211   3e-64   Eucalyptus grandis [rose gum]
ref|XP_004496281.1|  PREDICTED: aquaporin PIP2-1-like                   211   3e-64   Cicer arietinum [garbanzo]
emb|CAB46351.1|  major intrinsic protein 2                              211   3e-64   Solanum tuberosum [potatoes]
ref|XP_006381455.1|  hypothetical protein POPTR_0006s13000g             211   4e-64   Populus trichocarpa [western balsam poplar]
ref|NP_001105616.1|  aquaporin PIP2-5                                   211   4e-64   Zea mays [maize]
gb|AHK05706.1|  plasma membrane intrinsic protein PIP2;3                211   4e-64   Hevea brasiliensis [jebe]
dbj|BAF33069.1|  aquaporin                                              211   4e-64   Hordeum vulgare [barley]
gb|AAM61438.1|  aquaporin (plasma membrane intrinsic protein 2C)        211   4e-64   Arabidopsis thaliana [mouse-ear cress]
emb|CDP06739.1|  unnamed protein product                                211   5e-64   Coffea canephora [robusta coffee]
ref|XP_009398603.1|  PREDICTED: probable aquaporin PIP2-2               210   5e-64   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_004156296.1|  PREDICTED: aquaporin PIP2-2-like                   210   5e-64   
gb|ABI96813.1|  plasma membrane intrinsic protein                       210   5e-64   Triticum aestivum [Canadian hard winter wheat]
ref|XP_004304427.1|  PREDICTED: aquaporin PIP2-1-like                   210   5e-64   Fragaria vesca subsp. vesca
emb|CAH60724.1|  putative plasma membrane intrinsic protein             210   6e-64   Populus tremula x Populus tremuloides
gb|AHW81492.1|  ECFP-tagged plasma membrane intrinsic protein 2a        217   6e-64   Cloning vector pBullet-pm-n
ref|XP_008449253.1|  PREDICTED: aquaporin PIP2-2-like isoform X3        210   7e-64   Cucumis melo [Oriental melon]
ref|XP_006410897.1|  hypothetical protein EUTSA_v10017041mg             210   7e-64   Eutrema salsugineum [saltwater cress]
ref|XP_007016740.1|  Plasma membrane intrinsic protein 2,4              210   7e-64   
dbj|BAD90699.1|  plasma membrane intrinsic protein 2;3                  210   8e-64   Mimosa pudica [sensitive-plant]
gb|KEH39328.1|  major intrinsic protein (MIP) family transporter        209   9e-64   Medicago truncatula
dbj|BAB40143.1|  plasma membrane intrinsic protein 2-2                  210   9e-64   Pyrus communis
gb|KHG08488.1|  putative aquaporin PIP2-2                               209   9e-64   Gossypium arboreum [tree cotton]
ref|XP_007027328.1|  Plasma membrane intrinsic protein 2                209   1e-63   Theobroma cacao [chocolate]
ref|XP_008365039.1|  PREDICTED: probable aquaporin PIP2-5               209   1e-63   
ref|XP_010509371.1|  PREDICTED: aquaporin PIP2-2-like                   209   1e-63   Camelina sativa [gold-of-pleasure]
ref|XP_010516976.1|  PREDICTED: aquaporin PIP2-2-like                   209   1e-63   Camelina sativa [gold-of-pleasure]
gb|ACU00103.1|  plasma membrane intrinsic protein PIP2.1                209   1e-63   Populus trichocarpa x Populus deltoides
ref|XP_009345382.1|  PREDICTED: probable aquaporin PIP2-5               209   1e-63   Pyrus x bretschneideri [bai li]
emb|CDX91341.1|  BnaC04g08090D                                          209   1e-63   
ref|XP_003556232.1|  PREDICTED: aquaporin PIP2-1-like                   209   2e-63   Glycine max [soybeans]
gb|KJB21561.1|  hypothetical protein B456_004G001400                    209   2e-63   Gossypium raimondii
gb|AHA84128.1|  plasma membrane integral protein ZmPIP2-7               209   2e-63   Phaseolus vulgaris [French bean]
ref|XP_009143524.1|  PREDICTED: aquaporin PIP2-2                        209   2e-63   Brassica rapa
gb|AGC24024.1|  plasma membrane intrinsic protein 1                     209   2e-63   Lilium hybrid cultivar
ref|XP_003597235.1|  Aquaporin PIP2-7                                   209   2e-63   Medicago truncatula
ref|XP_010043748.1|  PREDICTED: probable aquaporin PIP2-4               209   2e-63   Eucalyptus grandis [rose gum]
gb|AFH36338.1|  aquaporin PIP2;3                                        209   2e-63   Quercus petraea [durmast oak]
gb|ADJ67992.1|  aquaporin                                               209   2e-63   Fragaria x ananassa
gb|ACZ06859.1|  plasma membrane intrinsic protein                       209   2e-63   Glycine soja [wild soybean]
gb|ABB88840.1|  aquaporin                                               208   2e-63   Stevia rebaudiana
ref|XP_004143245.1|  PREDICTED: aquaporin PIP2-2-like                   209   2e-63   
ref|XP_011041003.1|  PREDICTED: probable aquaporin PIP2-5               208   3e-63   Populus euphratica
ref|NP_001268056.1|  aquaporin PIP2                                     208   3e-63   Vitis vinifera
ref|XP_009133124.1|  PREDICTED: aquaporin PIP2-2-like                   208   3e-63   Brassica rapa
ref|XP_007218772.1|  hypothetical protein PRUPE_ppa009540mg             208   3e-63   Prunus persica
ref|XP_002316367.1|  putative aquaporin family protein                  208   3e-63   Populus trichocarpa [western balsam poplar]
ref|XP_010505294.1|  PREDICTED: aquaporin PIP2-2-like                   208   4e-63   Camelina sativa [gold-of-pleasure]
ref|XP_009387242.1|  PREDICTED: aquaporin PIP2-5                        208   4e-63   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009614931.1|  PREDICTED: aquaporin PIP2-1-like                   208   4e-63   Nicotiana tomentosiformis
dbj|BAB40141.1|  plasma membrane intrinsic protein 2-1                  208   4e-63   Pyrus communis
ref|XP_009413716.1|  PREDICTED: probable aquaporin PIP2-3 isoform X2    207   4e-63   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009335091.1|  PREDICTED: probable aquaporin PIP2-2               207   5e-63   Pyrus x bretschneideri [bai li]
gb|AAD31846.1|AF133530_1  water channel protein MipH                    208   5e-63   Mesembryanthemum crystallinum
gb|AGD98708.1|  aquaporin protein 5                                     207   5e-63   Camellia sinensis [black tea]
ref|XP_009792249.1|  PREDICTED: aquaporin PIP2-1-like                   207   6e-63   Nicotiana sylvestris
gb|AGG39693.1|  aquaporin protein AQU15                                 207   6e-63   Camellia sinensis [black tea]
dbj|BAA92261.1|  Plasma membrane aquaporin 2c                           207   6e-63   Raphanus sativus
gb|ACR56613.1|  plasma intrinsic protein 2;3                            207   6e-63   Juglans regia
ref|XP_009413714.1|  PREDICTED: aquaporin PIP2-4-like isoform X1        207   7e-63   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009133125.1|  PREDICTED: aquaporin PIP2-2-like                   207   7e-63   Brassica rapa
ref|XP_007150204.1|  hypothetical protein PHAVU_005G135300g             207   7e-63   Phaseolus vulgaris [French bean]
ref|XP_004487111.1|  PREDICTED: aquaporin PIP2-7-like                   207   7e-63   Cicer arietinum [garbanzo]
gb|ABI96814.1|  plasma membrane intrinsic protein                       207   8e-63   Triticum aestivum [Canadian hard winter wheat]
gb|AFB83068.1|  plasma intrinsic protein PIP2.2                         207   9e-63   Helianthemum almeriense
gb|AAL32127.1|  aquaporin                                               207   9e-63   Medicago truncatula
gb|ACU24483.1|  unknown                                                 207   9e-63   Glycine max [soybeans]
gb|AGD98707.1|  aquaporin protein 4                                     207   9e-63   Camellia sinensis [black tea]
ref|NP_001280185.1|  aquaporin PIP2-2                                   207   1e-62   Prunus mume [ume]
gb|ACM50914.1|  aquaporin                                               207   1e-62   Medicago falcata [sickle alfalfa]
ref|XP_006846771.1|  hypothetical protein AMTR_s00148p00023270          207   1e-62   Amborella trichopoda
ref|XP_009624885.1|  PREDICTED: aquaporin PIP2-1-like                   207   1e-62   Nicotiana tomentosiformis
ref|XP_003625627.1|  Aquaporin PIP2-1                                   207   1e-62   Medicago truncatula
gb|ABO69705.2|  aquaporin PIP2                                          206   1e-62   Prunus humilis
ref|XP_004304426.1|  PREDICTED: aquaporin PIP2-1-like                   206   2e-62   Fragaria vesca subsp. vesca
gb|AFK33316.1|  unknown                                                 206   2e-62   Medicago truncatula
ref|XP_011031744.1|  PREDICTED: probable aquaporin PIP2-5               206   2e-62   Populus euphratica
ref|XP_010483715.1|  PREDICTED: probable aquaporin PIP2-4               206   2e-62   Camelina sativa [gold-of-pleasure]
ref|XP_010689549.1|  PREDICTED: aquaporin PIP2-1-like                   206   2e-62   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_002532756.1|  Aquaporin PIP2.1, putative                         206   2e-62   Ricinus communis
gb|ACJ85211.1|  unknown                                                 206   2e-62   Medicago truncatula
emb|CDX91340.1|  BnaC04g08100D                                          206   2e-62   
ref|XP_008233329.1|  PREDICTED: probable aquaporin PIP2-5               206   2e-62   Prunus mume [ume]
ref|XP_008385311.1|  PREDICTED: probable aquaporin PIP2-2               206   2e-62   
dbj|BAA92260.1|  Plasma membrane aquaporin 2b                           206   2e-62   Raphanus sativus
emb|CAC82712.1|  major intrinsic protein 1                              206   2e-62   Populus tremula x Populus tremuloides
ref|XP_006400824.1|  hypothetical protein EUTSA_v10014299mg             206   2e-62   Eutrema salsugineum [saltwater cress]
ref|XP_010098191.1|  Aquaporin PIP2-7                                   206   2e-62   Morus notabilis
ref|XP_004291577.1|  PREDICTED: aquaporin PIP2-2                        206   2e-62   Fragaria vesca subsp. vesca
gb|EYU39575.1|  hypothetical protein MIMGU_mgv1a011441mg                206   3e-62   Erythranthe guttata [common monkey flower]
emb|CDX10333.1|  aquaporin                                              206   3e-62   Coffea arabica [arabica coffee]
gb|AEY75242.1|  plasma membrane intrinsic protein                       206   3e-62   Malus hupehensis
gb|ABK93567.1|  unknown                                                 206   3e-62   Populus trichocarpa [western balsam poplar]
tpg|DAA64674.1|  TPA: aquaporin PIP2 2                                  206   3e-62   Nicotiana tabacum [American tobacco]
ref|XP_009131906.1|  PREDICTED: probable aquaporin PIP2-4               206   3e-62   Brassica rapa
ref|XP_009760326.1|  PREDICTED: aquaporin PIP2-1-like                   206   4e-62   Nicotiana sylvestris
ref|XP_009126591.1|  PREDICTED: probable aquaporin PIP2-4               205   4e-62   Brassica rapa
ref|XP_004956113.1|  PREDICTED: aquaporin PIP2-1-like                   206   4e-62   Setaria italica
emb|CDX74984.1|  BnaA05g07300D                                          206   4e-62   
ref|XP_006296058.1|  hypothetical protein CARUB_v10025207mg             205   4e-62   Capsella rubella
ref|XP_003580150.1|  PREDICTED: aquaporin PIP2-5                        205   5e-62   Brachypodium distachyon [annual false brome]
gb|AHG32323.1|  PIP2-2                                                  205   5e-62   Pisum sativum [garden pea]
tpg|DAA64673.1|  TPA: aquaporin PIP2 1                                  205   5e-62   Nicotiana tabacum [American tobacco]
ref|XP_004304428.1|  PREDICTED: aquaporin PIP2-1-like                   205   6e-62   Fragaria vesca subsp. vesca
ref|XP_002311092.1|  plasma membrane intrinsic protein 1-1              205   6e-62   Populus trichocarpa [western balsam poplar]
ref|XP_009619670.1|  PREDICTED: aquaporin PIP2-1-like                   205   6e-62   Nicotiana tomentosiformis
ref|XP_004956115.1|  PREDICTED: aquaporin PIP2-6-like                   205   6e-62   Setaria italica
ref|XP_004493972.1|  PREDICTED: probable aquaporin PIP2-5-like          205   7e-62   Cicer arietinum [garbanzo]
gb|EMS51072.1|  Aquaporin PIP2-5                                        205   7e-62   Triticum urartu
ref|XP_004956116.1|  PREDICTED: aquaporin PIP2-6-like                   205   7e-62   Setaria italica
gb|AEQ20672.1|  PIP2;1                                                  205   7e-62   Karelinia caspia
gb|ABU94630.1|  putative aquaporin PIP2;2                               205   7e-62   Phaseolus vulgaris [French bean]
emb|CDX67611.1|  BnaA07g16510D                                          205   7e-62   
ref|XP_003563177.1|  PREDICTED: probable aquaporin PIP2-1               205   8e-62   Brachypodium distachyon [annual false brome]
ref|XP_002313510.1|  hypothetical protein POPTR_0009s01940g             204   9e-62   Populus trichocarpa [western balsam poplar]
gb|KFK34721.1|  hypothetical protein AALP_AA5G183600                    204   1e-61   Arabis alpina [alpine rockcress]
ref|NP_001274397.1|  aquaporin PIP2-1-like                              204   1e-61   Cucumis sativus [cucumbers]
gb|ABN11917.1|  aquaporin                                               204   1e-61   Cucurbita ficifolia [chilacayote]
ref|XP_008449255.1|  PREDICTED: aquaporin PIP2-2-like                   204   1e-61   Cucumis melo [Oriental melon]
ref|XP_010443868.1|  PREDICTED: probable aquaporin PIP2-4               204   1e-61   Camelina sativa [gold-of-pleasure]
ref|XP_006436426.1|  hypothetical protein CICLE_v10032302mg             201   1e-61   
ref|XP_009345759.1|  PREDICTED: probable aquaporin PIP2-5               204   2e-61   Pyrus x bretschneideri [bai li]
ref|XP_011044357.1|  PREDICTED: probable aquaporin PIP2-4               204   2e-61   Populus euphratica
emb|CAH60723.1|  putative plasma membrane intrinsic protein             204   2e-61   Populus tremula x Populus tremuloides
ref|XP_006280883.1|  hypothetical protein CARUB_v10026881mg             204   2e-61   
ref|XP_011077012.1|  PREDICTED: probable aquaporin PIP2-5               203   2e-61   Sesamum indicum [beniseed]
ref|XP_010456647.1|  PREDICTED: probable aquaporin PIP2-4               203   2e-61   Camelina sativa [gold-of-pleasure]
ref|XP_006403531.1|  hypothetical protein EUTSA_v10010603mg             203   2e-61   
ref|NP_001053335.1|  Os04g0521100                                       204   2e-61   
dbj|BAD90697.1|  plasma membrane intrinsic protein 2;1                  203   3e-61   
ref|XP_010043747.1|  PREDICTED: probable aquaporin PIP2-5               203   3e-61   
emb|CDY07519.1|  BnaC06g15450D                                          203   3e-61   
ref|XP_009120600.1|  PREDICTED: LOW QUALITY PROTEIN: probable aqu...    203   3e-61   
ref|NP_001268058.1|  aquaporin-like                                     203   3e-61   
gb|KDO44717.1|  hypothetical protein CISIN_1g0196812mg                  202   3e-61   
gb|ACU87558.1|  PIP protein                                             203   3e-61   
ref|XP_002461930.1|  hypothetical protein SORBIDRAFT_02g010760          203   4e-61   
sp|Q8GRI8.1|PIP25_ORYSJ  RecName: Full=Aquaporin PIP2-5; AltName:...    203   4e-61   
gb|AEQ29857.1|  aquaporin PIP2                                          202   4e-61   
ref|XP_008345040.1|  PREDICTED: aquaporin PIP2-1-like                   199   5e-61   
gb|AAF61463.1|AF139814_1  plasma membrane intrinsic protein 1           202   5e-61   
emb|CDY46759.1|  BnaA03g17030D                                          202   6e-61   
ref|XP_008363507.1|  PREDICTED: aquaporin PIP2-2                        202   6e-61   
ref|XP_010032196.1|  PREDICTED: aquaporin PIP2-1                        202   7e-61   
ref|XP_008366675.1|  PREDICTED: probable aquaporin PIP2-5               202   7e-61   
ref|XP_008387595.1|  PREDICTED: probable aquaporin PIP2-5               202   7e-61   
gb|AEY75244.1|  plasma membrane intrinsic protein                       202   7e-61   
gb|AAV80229.1|  aquaporin 2                                             202   9e-61   
gb|KCW51593.1|  hypothetical protein EUGRSUZ_J01087                     203   1e-60   
gb|ADG03686.1|  aquaporin                                               202   1e-60   
dbj|BAG06231.1|  plasma membrane intrinsic protein                      202   1e-60   
ref|XP_010555818.1|  PREDICTED: probable aquaporin PIP2-5               202   1e-60   
gb|AAL49752.1|AF452014_1  aquaporin-like protein                        202   1e-60   
ref|XP_009116159.1|  PREDICTED: probable aquaporin PIP2-5               202   1e-60   
emb|CDX73446.1|  BnaC08g25570D                                          201   1e-60   
ref|XP_010554547.1|  PREDICTED: probable aquaporin PIP2-5               201   1e-60   
ref|XP_002461932.1|  hypothetical protein SORBIDRAFT_02g010790          201   2e-60   
ref|XP_009103935.1|  PREDICTED: probable aquaporin PIP2-5               201   2e-60   
ref|NP_001105027.1|  aquaporin PIP2-6                                   201   2e-60   
gb|AAW80918.1|  putative plasma membrane intrinsic protein              201   2e-60   
ref|XP_004307390.1|  PREDICTED: aquaporin PIP2-1                        201   2e-60   
ref|XP_002461936.1|  hypothetical protein SORBIDRAFT_02g010830          201   2e-60   
gb|KFK34592.1|  hypothetical protein AALP_AA5G165800                    201   2e-60   
gb|AAF65845.1|AF255795_1  aquaporin 1                                   201   3e-60   
ref|XP_009342858.1|  PREDICTED: probable aquaporin PIP2-5 isoform X1    200   4e-60   
ref|XP_006436425.1|  hypothetical protein CICLE_v10032302mg             200   4e-60   
gb|KJB26182.1|  hypothetical protein B456_004G229000                    200   4e-60   
gb|ABX83874.1|  plasma membrane intrinsic protein                       200   5e-60   
gb|AFQ23181.1|  aquaporin PIP2;2                                        200   5e-60   
ref|XP_008345410.1|  PREDICTED: aquaporin PIP2-1-like                   198   5e-60   
ref|XP_002866389.1|  hypothetical protein ARALYDRAFT_919301             200   5e-60   
ref|XP_009342865.1|  PREDICTED: probable aquaporin PIP2-5 isoform X2    200   6e-60   
gb|KCW51592.1|  hypothetical protein EUGRSUZ_J01087                     202   8e-60   
gb|KDO44716.1|  hypothetical protein CISIN_1g0196812mg                  201   8e-60   
ref|XP_010100853.1|  Aquaporin PIP2-1                                   199   1e-59   
ref|NP_191042.1|  putative aquaporin PIP2-5                             199   1e-59   
ref|XP_002461933.1|  hypothetical protein SORBIDRAFT_02g010800          199   1e-59   
gb|EMT03221.1|  hypothetical protein F775_43871                         199   1e-59   
gb|AGD98705.1|  aquaporin                                               199   1e-59   
gb|EYU34445.1|  hypothetical protein MIMGU_mgv1a011350mg                199   1e-59   
dbj|BAK20223.1|  plasma membrane intrinsic protein 2                    199   2e-59   
ref|NP_001059542.1|  Os07g0448100                                       199   2e-59   
ref|XP_007207344.1|  hypothetical protein PRUPE_ppa009630mg             199   2e-59   
ref|XP_006428786.1|  hypothetical protein CICLE_v10012379mg             199   2e-59   
ref|XP_008463943.1|  PREDICTED: aquaporin PIP2-7                        199   2e-59   
gb|EAZ03711.1|  hypothetical protein OsI_25843                          199   2e-59   
ref|XP_008243934.1|  PREDICTED: probable aquaporin PIP2-5               199   2e-59   
ref|XP_004143248.1|  PREDICTED: aquaporin PIP2-1-like                   197   2e-59   
gb|ACV70050.1|  aquaporin PIP2;1                                        196   2e-59   
ref|XP_009414435.1|  PREDICTED: probable aquaporin PIP2-6               198   3e-59   
ref|XP_006291621.1|  hypothetical protein CARUB_v10017773mg             197   3e-59   
ref|NP_001274386.1|  aquaporin PIP2-1-like                              198   3e-59   
gb|EAZ39657.1|  hypothetical protein OsJ_24085                          199   4e-59   
ref|XP_010046653.1|  PREDICTED: aquaporin PIP2-1-like                   197   4e-59   
gb|ACV70048.1|  aquaporin PIP2;1                                        196   5e-59   
ref|NP_200874.1|  putative aquaporin PIP2-4                             197   5e-59   
ref|XP_006481456.1|  PREDICTED: aquaporin PIP2-2-like                   194   5e-59   
ref|XP_002521292.1|  Aquaporin PIP2.7, putative                         197   7e-59   
dbj|BAD90700.1|  plasma membrane intrinsic protein 2;4                  197   8e-59   
gb|AFQ23567.1|  aquaporin PIP2;2                                        197   9e-59   
ref|XP_008670063.1|  PREDICTED: aquaporin PIP2-6-like                   197   1e-58   
ref|XP_008449252.1|  PREDICTED: aquaporin PIP2-1-like isoform X2        197   1e-58   
ref|XP_002461931.1|  hypothetical protein SORBIDRAFT_02g010780          197   1e-58   
ref|XP_010505564.1|  PREDICTED: probable aquaporin PIP2-6               197   1e-58   
ref|XP_006481459.1|  PREDICTED: aquaporin PIP2-2-like                   196   1e-58   
ref|XP_008449251.1|  PREDICTED: aquaporin PIP2-1-like isoform X1        196   1e-58   
ref|XP_010509080.1|  PREDICTED: probable aquaporin PIP2-6               196   1e-58   
ref|XP_006481455.1|  PREDICTED: aquaporin PIP2-2-like                   196   1e-58   
ref|XP_010427203.1|  PREDICTED: probable aquaporin PIP2-5               196   1e-58   
gb|ACV70051.1|  aquaporin PIP2;1                                        194   2e-58   
ref|XP_010516024.1|  PREDICTED: probable aquaporin PIP2-5               196   2e-58   
ref|XP_006428787.1|  hypothetical protein CICLE_v10012633mg             194   2e-58   
gb|KCW88815.1|  hypothetical protein EUGRSUZ_A01153                     198   2e-58   
gb|KCW88816.1|  hypothetical protein EUGRSUZ_A01153                     197   2e-58   
ref|XP_006652526.1|  PREDICTED: probable aquaporin PIP2-3-like          196   2e-58   
gb|AAC16545.1|  aquaporin                                               196   2e-58   
gb|ACV70049.1|  aquaporin PIP2;1                                        194   2e-58   
ref|XP_006291622.1|  hypothetical protein CARUB_v10017773mg             196   2e-58   
ref|XP_006481457.1|  PREDICTED: aquaporin PIP2-1-like isoform X1        196   3e-58   
ref|XP_010684101.1|  PREDICTED: aquaporin PIP2-1-like                   196   3e-58   
ref|XP_006339071.1|  PREDICTED: aquaporin PIP2-1-like                   195   3e-58   
ref|XP_010507447.1|  PREDICTED: probable aquaporin PIP2-5               196   3e-58   
gb|ACV70053.1|  aquaporin PIP2;2                                        193   4e-58   
ref|XP_006294722.1|  hypothetical protein CARUB_v10023768mg             195   5e-58   
gb|ABM54183.1|  aquaporin                                               194   6e-58   
ref|XP_006367009.1|  PREDICTED: probable aquaporin PIP2-2-like          192   7e-58   
ref|XP_002876271.1|  PIP2_5/PIP2D                                       195   7e-58   
gb|ACB87734.1|  aquaporin                                               194   7e-58   
ref|XP_007162747.1|  hypothetical protein PHAVU_001G177000g             194   8e-58   
ref|NP_179277.1|  putative aquaporin PIP2-8                             194   9e-58   
tpg|DAA39707.1|  TPA: plasma membrane intrinsic protein2                193   9e-58   
ref|XP_009355655.1|  PREDICTED: probable aquaporin PIP2-8               194   9e-58   
ref|NP_001059545.1|  Os07g0448800                                       194   1e-57   
ref|XP_008446888.1|  PREDICTED: aquaporin PIP2-1-like                   194   1e-57   
gb|ACR38689.1|  unknown                                                 192   1e-57   
ref|XP_011094668.1|  PREDICTED: aquaporin PIP2-4-like                   194   1e-57   
dbj|BAD90698.1|  plasma membrane intrinsic protein 2;2                  194   1e-57   
tpg|DAA64687.1|  TPA: aquaporin PIP2 10                                 194   1e-57   
gb|ADJ57599.1|  plasma membrane intrinsic protein PIP2;1                194   1e-57   
gb|EAZ39662.1|  hypothetical protein OsJ_24090                          194   1e-57   
ref|XP_009772697.1|  PREDICTED: aquaporin PIP2-2-like                   194   1e-57   
gb|ACV70052.1|  aquaporin PIP2;1                                        192   1e-57   
tpg|DAA60471.1|  TPA: plasma membrane intrinsic protein2                193   1e-57   
ref|XP_004157526.1|  PREDICTED: aquaporin PIP2-7-like                   194   1e-57   
ref|XP_008807132.1|  PREDICTED: probable aquaporin PIP2-6               194   1e-57   
gb|KDO41796.1|  hypothetical protein CISIN_1g023108mg                   194   2e-57   
gb|AAM63463.1|  aquaporin (plasma membrane intrinsic protein 2B)        193   2e-57   
ref|NP_001274308.1|  aquaporin PIP2-1-like                              193   2e-57   
ref|XP_009593453.1|  PREDICTED: aquaporin PIP2-2-like                   193   2e-57   
gb|ABH09328.1|  putative aquaporin                                      193   3e-57   
gb|ACV70057.1|  aquaporin PIP2;3                                        191   3e-57   
ref|NP_001274381.1|  aquaporin PIP2-7-like                              192   4e-57   
ref|NP_001289823.1|  aquaporin PIP2-1-like                              192   4e-57   
ref|XP_006846905.1|  hypothetical protein AMTR_s00152p00041700          192   4e-57   
ref|XP_010920097.1|  PREDICTED: probable aquaporin PIP2-6               192   4e-57   
gb|ACV70056.1|  aquaporin PIP2;3                                        190   5e-57   
gb|AGD98712.1|  aquaporin protein 9                                     192   5e-57   
ref|XP_006422583.1|  hypothetical protein CICLE_v10029003mg             189   6e-57   
ref|XP_009414436.1|  PREDICTED: probable aquaporin PIP2-6               192   6e-57   
ref|NP_001105638.1|  aquaporin PIP2-2                                   192   6e-57   
ref|NP_001267957.1|  aquaporin PIP2;2                                   192   8e-57   
ref|NP_001105024.1|  aquaporin PIP2-1                                   192   9e-57   
gb|EPS68613.1|  hypothetical protein M569_06155                         191   1e-56   
ref|XP_009367074.1|  PREDICTED: aquaporin PIP2-2                        191   1e-56   
gb|ABH09327.1|  putative aquaporin                                      191   1e-56   
tpg|DAA60472.1|  TPA: plasma membrane intrinsic protein2                192   1e-56   
ref|XP_009344758.1|  PREDICTED: probable aquaporin PIP2-5               191   1e-56   
gb|AAO86707.1|  aquaporin                                               191   1e-56   
gb|ACF79873.1|  unknown                                                 191   1e-56   
gb|EAZ03714.1|  hypothetical protein OsI_25847                          191   1e-56   
gb|AAG44947.1|AF290620_1  putative PIP2                                 191   2e-56   
ref|XP_004142421.1|  PREDICTED: LOW QUALITY PROTEIN: aquaporin PI...    191   2e-56   
gb|AAF71820.1|AF141900_1  putative aquaporin PIP2-2                     191   2e-56   
ref|XP_008377729.1|  PREDICTED: probable aquaporin PIP2-8               191   2e-56   
gb|ACV70054.1|  aquaporin PIP2;3                                        188   3e-56   
ref|XP_006367007.1|  PREDICTED: aquaporin PIP2-1-like isoform X1        191   3e-56   
ref|XP_006657662.1|  PREDICTED: LOW QUALITY PROTEIN: aquaporin PI...    190   3e-56   
ref|XP_006367008.1|  PREDICTED: aquaporin PIP2-1-like isoform X2        190   3e-56   
ref|XP_007041805.1|  Plasma membrane intrinsic protein 3 isoform 2      187   3e-56   
ref|XP_006428788.1|  hypothetical protein CICLE_v10012375mg             190   4e-56   
gb|ACV70047.1|  aquaporin PIP2;1                                        188   4e-56   
dbj|BAF32042.1|  putative aquaporin                                     189   5e-56   
ref|XP_006384579.1|  hypothetical protein POPTR_0004s18240g             187   5e-56   
ref|XP_006422584.1|  hypothetical protein CICLE_v10029003mg             189   6e-56   
gb|KDO68091.1|  hypothetical protein CISIN_1g023370mg                   189   7e-56   
gb|ACB71281.1|  plasma membrane intrinsic protein                       189   9e-56   
ref|XP_002884019.1|  PIP2_8/PIP3B                                       189   9e-56   
ref|XP_010467415.1|  PREDICTED: probable aquaporin PIP2-8               189   1e-55   
ref|XP_006367014.1|  PREDICTED: aquaporin PIP2-1-like                   189   1e-55   
ref|XP_006846005.1|  hypothetical protein AMTR_s00155p00061840          188   2e-55   
gb|ACE60220.1|  plasma membrane aquaporin                               188   2e-55   
dbj|BAF32141.1|  putative aquaporin                                     188   2e-55   
ref|XP_008809438.1|  PREDICTED: probable aquaporin PIP2-6               188   2e-55   
ref|XP_004290727.1|  PREDICTED: aquaporin PIP2-7                        188   2e-55   
gb|AFH36336.1|  aquaporin PIP2;1                                        188   2e-55   
gb|ABK21046.1|  unknown                                                 188   3e-55   
ref|XP_003563179.1|  PREDICTED: aquaporin PIP2-6                        188   3e-55   
ref|XP_009389186.1|  PREDICTED: probable aquaporin PIP2-6               187   3e-55   
gb|ACG39551.1|  aquaporin PIP2.1                                        188   3e-55   
ref|NP_181434.1|  plasma membrane intrinsic protein 2E                  187   3e-55   
ref|XP_010516059.1|  PREDICTED: probable aquaporin PIP2-8               187   4e-55   
gb|AEF32110.1|  aquaporin PIP2                                          187   4e-55   
ref|XP_007205689.1|  hypothetical protein PRUPE_ppa009689mg             187   4e-55   
ref|XP_002879778.1|  PIP2_6/PIP2E                                       187   5e-55   
ref|XP_009412922.1|  PREDICTED: probable aquaporin PIP2-6               187   5e-55   
gb|KCW55551.1|  hypothetical protein EUGRSUZ_I01429                     187   6e-55   
gb|KCW55550.1|  hypothetical protein EUGRSUZ_I01429                     187   6e-55   
dbj|BAG68662.1|  plasma membrane intrinsic protein                      187   6e-55   
ref|XP_010526891.1|  PREDICTED: probable aquaporin PIP2-8               187   6e-55   
gb|KJB73581.1|  hypothetical protein B456_011G239500                    186   6e-55   
ref|XP_011046666.1|  PREDICTED: probable aquaporin PIP2-8               187   7e-55   
ref|XP_007041804.1|  Plasma membrane intrinsic protein 2,8 isoform 1    187   7e-55   
gb|ACV70055.1|  aquaporin PIP2;3                                        184   7e-55   
gb|AEC45512.1|  plasma membrane intrinsic protein                       186   8e-55   
gb|ACV66986.1|  plasma membrane aquaporin 2                             186   8e-55   
ref|XP_003604054.1|  Aquaporin PIP22                                    186   1e-54   
gb|ABK22146.1|  unknown                                                 186   1e-54   
gb|ACG32567.1|  aquaporin PIP2.1                                        186   1e-54   
dbj|BAF63508.1|  plasma membrane intrinsic protein                      186   1e-54   
ref|XP_002306187.1|  membrane intrinsic family protein                  186   2e-54   
ref|XP_009138343.1|  PREDICTED: aquaporin PIP2-7-like                   186   2e-54   
ref|XP_006412151.1|  hypothetical protein EUTSA_v10025940mg             184   2e-54   
gb|EMS55627.1|  Aquaporin PIP2-3                                        181   2e-54   
gb|ACU00102.1|  plasma membrane intrinsic protein PIP2.6                185   3e-54   
dbj|BAG68661.1|  plasma membrane intrinsic protein                      185   3e-54   
ref|XP_006298288.1|  hypothetical protein CARUB_v10014353mg             185   3e-54   
ref|XP_009105909.1|  PREDICTED: aquaporin PIP2-7                        185   3e-54   
ref|XP_009376943.1|  PREDICTED: probable aquaporin PIP2-8               185   3e-54   
ref|NP_195236.1|  plasma membrane intrinsic protein 3                   185   3e-54   
ref|XP_010325988.1|  PREDICTED: aquaporin PIP2-1-like                   184   3e-54   
ref|XP_009400343.1|  PREDICTED: probable aquaporin PIP2-6               185   3e-54   
emb|CDX69112.1|  BnaC01g03410D                                          185   3e-54   
ref|XP_010548112.1|  PREDICTED: probable aquaporin PIP2-8               185   4e-54   
ref|XP_006412152.1|  hypothetical protein EUTSA_v10025940mg             185   4e-54   
gb|KFK36762.1|  hypothetical protein AALP_AA4G166800                    184   4e-54   
gb|KHG01329.1|  Aquaporin PIP2-7 -like protein                          183   4e-54   
gb|ABL76066.1|  aquaporin 2                                             184   4e-54   
gb|AFO63679.1|  plasma intrinsic protein 2                              184   4e-54   
gb|EYU40445.1|  hypothetical protein MIMGU_mgv1a011413mg                184   4e-54   
gb|KJB73580.1|  hypothetical protein B456_011G239500                    184   5e-54   
gb|KHG20375.1|  putative aquaporin PIP2-5 -like protein                 184   5e-54   
gb|ADL16407.1|  aquaporin                                               184   5e-54   
gb|ACR56615.1|  plasma intrinsic protein 2;5                            184   6e-54   
ref|XP_010489282.1|  PREDICTED: probable aquaporin PIP2-8               184   7e-54   
ref|XP_010266027.1|  PREDICTED: aquaporin PIP2-7-like                   184   7e-54   
gb|AFN53630.1|  putative aquaporin PIP2-8                               192   7e-54   
gb|KFK30134.1|  hypothetical protein AALP_AA7G221400                    184   9e-54   
ref|XP_008236033.1|  PREDICTED: aquaporin PIP2-7                        184   1e-53   



>ref|XP_009786071.1| PREDICTED: aquaporin PIP2-7-like [Nicotiana sylvestris]
 tpg|DAA64678.1| TPA_exp: aquaporin PIP2 4b [Nicotiana tabacum]
Length=287

 Score =   238 bits (608),  Expect = 7e-75, Method: Compositional matrix adjust.
 Identities = 126/150 (84%), Positives = 138/150 (92%), Gaps = 0/150 (0%)
 Frame = +3

Query  63   MTKDVEAVPEQPAEFSAKDYHDPPPSPLIDFDELTKWSFYRAVIAEFIAtllflyvtvlt  242
            MTK+VEAV EQPAE+SAKDY DPPP+PLIDF+ELTKWS YRA IAEFIATLLFLYVTVLT
Sbjct  1    MTKEVEAVSEQPAEYSAKDYTDPPPTPLIDFEELTKWSLYRACIAEFIATLLFLYVTVLT  60

Query  243  vIGYKHQTDPKAGGQDCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLAR  422
            VIGYKHQ+D K GG  CGGVGILGIAWAFGGMIF+LVYCTAGISGGHINPAVTFGLFLAR
Sbjct  61   VIGYKHQSDTKDGGDICGGVGILGIAWAFGGMIFVLVYCTAGISGGHINPAVTFGLFLAR  120

Query  423  KVTLPRAVLYMIAQCLGAICGVGVGEGFPE  512
            KV+L RAVLYM++QCLGAICGVG+ + F +
Sbjct  121  KVSLMRAVLYMVSQCLGAICGVGLVKAFQK  150



>ref|XP_009615789.1| PREDICTED: aquaporin PIP2-7-like [Nicotiana tomentosiformis]
Length=287

 Score =   237 bits (604),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 125/150 (83%), Positives = 138/150 (92%), Gaps = 0/150 (0%)
 Frame = +3

Query  63   MTKDVEAVPEQPAEFSAKDYHDPPPSPLIDFDELTKWSFYRAVIAEFIAtllflyvtvlt  242
            M+K+VEAV EQPAE+SAKDY DPPP+PLIDF+ELTKWS YRA IAEFIATLLFLYVTVLT
Sbjct  1    MSKEVEAVSEQPAEYSAKDYTDPPPTPLIDFEELTKWSLYRACIAEFIATLLFLYVTVLT  60

Query  243  vIGYKHQTDPKAGGQDCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLAR  422
            VIGYKHQ+D K GG  CGGVGILGIAWAFGGMIF+LVYCTAGISGGHINPAVTFGLFLAR
Sbjct  61   VIGYKHQSDTKDGGDICGGVGILGIAWAFGGMIFVLVYCTAGISGGHINPAVTFGLFLAR  120

Query  423  KVTLPRAVLYMIAQCLGAICGVGVGEGFPE  512
            KV+L RAVLYM++QCLGAICGVG+ + F +
Sbjct  121  KVSLIRAVLYMVSQCLGAICGVGLVKAFQK  150



>tpg|DAA64677.1| TPA_exp: aquaporin PIP2 4a [Nicotiana tabacum]
Length=287

 Score =   236 bits (603),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 125/150 (83%), Positives = 138/150 (92%), Gaps = 0/150 (0%)
 Frame = +3

Query  63   MTKDVEAVPEQPAEFSAKDYHDPPPSPLIDFDELTKWSFYRAVIAEFIAtllflyvtvlt  242
            M+K+VEAV EQPAE+SAKDY DPPP+PLIDF+ELTKWS YRA IAEFIATLLFLYVTVLT
Sbjct  1    MSKEVEAVSEQPAEYSAKDYTDPPPTPLIDFEELTKWSLYRACIAEFIATLLFLYVTVLT  60

Query  243  vIGYKHQTDPKAGGQDCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLAR  422
            VIGYKHQ+D K GG  CGGVGILGIAWAFGGMIF+LVYCTAGISGGHINPAVTFGLFLAR
Sbjct  61   VIGYKHQSDTKDGGDICGGVGILGIAWAFGGMIFVLVYCTAGISGGHINPAVTFGLFLAR  120

Query  423  KVTLPRAVLYMIAQCLGAICGVGVGEGFPE  512
            KV+L RAVLYM++QCLGAICGVG+ + F +
Sbjct  121  KVSLIRAVLYMVSQCLGAICGVGLVKAFQK  150



>gb|AFQ23186.1| aquaporin PIP2;1 [Eustoma exaltatum subsp. russellianum]
Length=286

 Score =   235 bits (600),  Expect = 9e-74, Method: Compositional matrix adjust.
 Identities = 123/148 (83%), Positives = 133/148 (90%), Gaps = 1/148 (1%)
 Frame = +3

Query  63   MTKDVEAVPEQPAEFSAKDYHDPPPSPLIDFDELTKWSFYRAVIAEFIAtllflyvtvlt  242
            M K+VE V EQP E+SAKDYHDPPP+   D DELTKWSFYRA+IAEF+ATLLFLY+ VLT
Sbjct  1    MAKEVEGVSEQP-EYSAKDYHDPPPAAFFDLDELTKWSFYRALIAEFVATLLFLYIKVLT  59

Query  243  vIGYKHQTDPKAGGQDCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLAR  422
            VIGYKHQTDP AGG DCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLAR
Sbjct  60   VIGYKHQTDPDAGGADCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLAR  119

Query  423  KVTLPRAVLYMIAQCLGAICGVGVGEGF  506
            KV+LPRA  YM+AQCLGAICGVG+ + F
Sbjct  120  KVSLPRAFFYMVAQCLGAICGVGLVKAF  147



>ref|NP_001275065.1| major intrinsic protein 2 [Solanum tuberosum]
 gb|ABB29939.1| major intrinsic protein 2-like [Solanum tuberosum]
 emb|CBI99236.1| major intrinsic protein 2 [Solanum tuberosum]
Length=287

 Score =   234 bits (597),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 125/148 (84%), Positives = 135/148 (91%), Gaps = 0/148 (0%)
 Frame = +3

Query  63   MTKDVEAVPEQPAEFSAKDYHDPPPSPLIDFDELTKWSFYRAVIAEFIAtllflyvtvlt  242
            MTK+VEAV EQ AE+SAKDY DPPP+PLIDF+ELTKWS YRAVIAEFIATLLFLY+TVLT
Sbjct  1    MTKEVEAVHEQAAEYSAKDYTDPPPAPLIDFEELTKWSLYRAVIAEFIATLLFLYITVLT  60

Query  243  vIGYKHQTDPKAGGQDCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLAR  422
            VIGYKHQ D  AGG  CGGVG+LGIAWAFGGMIF+LVYCTAGISGGHINPAVTFGLFLAR
Sbjct  61   VIGYKHQADVDAGGDVCGGVGLLGIAWAFGGMIFVLVYCTAGISGGHINPAVTFGLFLAR  120

Query  423  KVTLPRAVLYMIAQCLGAICGVGVGEGF  506
            KV+L RAVLYM+AQCLGAICGVG  + F
Sbjct  121  KVSLIRAVLYMVAQCLGAICGVGFVKAF  148



>gb|AAB18227.1| MipC [Mesembryanthemum crystallinum]
Length=287

 Score =   233 bits (595),  Expect = 6e-73, Method: Compositional matrix adjust.
 Identities = 123/150 (82%), Positives = 132/150 (88%), Gaps = 0/150 (0%)
 Frame = +3

Query  63   MTKDVEAVPEQPAEFSAKDYHDPPPSPLIDFDELTKWSFYRAVIAEFIAtllflyvtvlt  242
            MTKDVE   +Q  EFSAKDYHDPPP+PLIDF+EL KWSFYRAVIAEFIATLLFLY+TVLT
Sbjct  1    MTKDVEVAEQQAPEFSAKDYHDPPPAPLIDFEELRKWSFYRAVIAEFIATLLFLYITVLT  60

Query  243  vIGYKHQTDPKAGGQDCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLAR  422
            VIGYK QTDP      CGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLAR
Sbjct  61   VIGYKSQTDPNTNADQCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLAR  120

Query  423  KVTLPRAVLYMIAQCLGAICGVGVGEGFPE  512
            KV+L +AVLYM+AQCLGAICGVG  + F +
Sbjct  121  KVSLIKAVLYMVAQCLGAICGVGFVKAFQK  150



>ref|XP_009595123.1| PREDICTED: aquaporin PIP2-4-like [Nicotiana tomentosiformis]
 tpg|DAA64685.1| TPA_exp: aquaporin PIP2 9a [Nicotiana tabacum]
Length=287

 Score =   232 bits (591),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 125/148 (84%), Positives = 135/148 (91%), Gaps = 0/148 (0%)
 Frame = +3

Query  63   MTKDVEAVPEQPAEFSAKDYHDPPPSPLIDFDELTKWSFYRAVIAEFIAtllflyvtvlt  242
            MTK+VE   EQ AEFSAKDY DPPP+PL+DF+ELT+WS YRAVIAEFIATLLFLYVTVLT
Sbjct  1    MTKEVEVAREQAAEFSAKDYTDPPPAPLVDFEELTQWSLYRAVIAEFIATLLFLYVTVLT  60

Query  243  vIGYKHQTDPKAGGQDCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLAR  422
            VIGYK Q+D KA G  CGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLAR
Sbjct  61   VIGYKVQSDVKADGDICGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLAR  120

Query  423  KVTLPRAVLYMIAQCLGAICGVGVGEGF  506
            KV+L RAVLYM+AQCLGAICGVG+ +GF
Sbjct  121  KVSLIRAVLYMVAQCLGAICGVGLVKGF  148



>ref|XP_009780213.1| PREDICTED: aquaporin PIP2-4-like [Nicotiana sylvestris]
 tpg|DAA64686.1| TPA_exp: aquaporin PIP2 9b [Nicotiana tabacum]
Length=287

 Score =   230 bits (587),  Expect = 8e-72, Method: Compositional matrix adjust.
 Identities = 124/148 (84%), Positives = 133/148 (90%), Gaps = 0/148 (0%)
 Frame = +3

Query  63   MTKDVEAVPEQPAEFSAKDYHDPPPSPLIDFDELTKWSFYRAVIAEFIAtllflyvtvlt  242
            MTK+VE   EQP EFSAKDY DPPP+PL+DF+ELT+WS YRAVIAEFIATLLFLYVTVLT
Sbjct  1    MTKEVEVATEQPTEFSAKDYTDPPPAPLVDFEELTQWSLYRAVIAEFIATLLFLYVTVLT  60

Query  243  vIGYKHQTDPKAGGQDCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLAR  422
            VIGYK Q+D KA G  CGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLAR
Sbjct  61   VIGYKVQSDVKADGDICGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLAR  120

Query  423  KVTLPRAVLYMIAQCLGAICGVGVGEGF  506
            KV+L RAVLYM+AQCLGAICGVG  + F
Sbjct  121  KVSLIRAVLYMVAQCLGAICGVGFVKAF  148



>ref|NP_001289846.1| probable aquaporin PIP2-1 [Solanum lycopersicum]
 dbj|BAO18629.1| plasmamembrane intrinsic protein 2;6 [Solanum lycopersicum]
Length=287

 Score =   230 bits (587),  Expect = 9e-72, Method: Compositional matrix adjust.
 Identities = 121/148 (82%), Positives = 133/148 (90%), Gaps = 0/148 (0%)
 Frame = +3

Query  63   MTKDVEAVPEQPAEFSAKDYHDPPPSPLIDFDELTKWSFYRAVIAEFIAtllflyvtvlt  242
            MTK+VEA  EQ  E+SAKDY DPPP+PLIDF+ELTKWS YRA IAEFIATLLFLY+T+LT
Sbjct  1    MTKEVEAAHEQAVEYSAKDYTDPPPAPLIDFEELTKWSLYRAAIAEFIATLLFLYITILT  60

Query  243  vIGYKHQTDPKAGGQDCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLAR  422
            VIGYKHQ D KAGG  CGGVG+LGIAWAFGGMIF+LVYCTAGISGGHINPAVTFGLFLAR
Sbjct  61   VIGYKHQADVKAGGDICGGVGLLGIAWAFGGMIFVLVYCTAGISGGHINPAVTFGLFLAR  120

Query  423  KVTLPRAVLYMIAQCLGAICGVGVGEGF  506
            KV+L RA+LYM+AQCLGAICGVG  + F
Sbjct  121  KVSLIRAILYMVAQCLGAICGVGFVKAF  148



>gb|ABB13430.2| plasma membrane intrinsic protein [Olea europaea]
Length=287

 Score =   228 bits (581),  Expect = 6e-71, Method: Compositional matrix adjust.
 Identities = 122/150 (81%), Positives = 133/150 (89%), Gaps = 0/150 (0%)
 Frame = +3

Query  63   MTKDVEAVPEQPAEFSAKDYHDPPPSPLIDFDELTKWSFYRAVIAEFIAtllflyvtvlt  242
            MTKDVE+  E   E+SAKDYHDPPP+PLIDFDEL+ WSFYRA+IAEF+ATLLFLYVTVLT
Sbjct  1    MTKDVESHVEPAEEYSAKDYHDPPPAPLIDFDELSSWSFYRALIAEFVATLLFLYVTVLT  60

Query  243  vIGYKHQTDPKAGGQDCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLAR  422
            VIGYK Q DP  GG DCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVT GLFL R
Sbjct  61   VIGYKSQIDPAHGGDDCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTLGLFLGR  120

Query  423  KVTLPRAVLYMIAQCLGAICGVGVGEGFPE  512
            KV+L RAVLYM+AQCLGAICGVG+ + F +
Sbjct  121  KVSLIRAVLYMVAQCLGAICGVGLVKAFQK  150



>ref|XP_006357563.1| PREDICTED: probable aquaporin PIP2-1-like [Solanum tuberosum]
Length=286

 Score =   227 bits (578),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 121/148 (82%), Positives = 135/148 (91%), Gaps = 1/148 (1%)
 Frame = +3

Query  63   MTKDVEAVPEQPAEFSAKDYHDPPPSPLIDFDELTKWSFYRAVIAEFIAtllflyvtvlt  242
            MTK+VE+V E+  EFSAKDY DPPP+PL+DF+ELT+WSFYRA+IAEFIATLLFLY+T+LT
Sbjct  1    MTKEVESVTER-GEFSAKDYTDPPPAPLVDFEELTQWSFYRAIIAEFIATLLFLYITILT  59

Query  243  vIGYKHQTDPKAGGQDCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLAR  422
            VIGY+HQ D  AGG  CGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLAR
Sbjct  60   VIGYQHQADVDAGGDVCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLAR  119

Query  423  KVTLPRAVLYMIAQCLGAICGVGVGEGF  506
            KV+L RAVLYM+AQCLGAICGVG  + F
Sbjct  120  KVSLIRAVLYMVAQCLGAICGVGFVKAF  147



>gb|KCW51391.1| hypothetical protein EUGRSUZ_J00930 [Eucalyptus grandis]
Length=209

 Score =   224 bits (571),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 121/150 (81%), Positives = 132/150 (88%), Gaps = 2/150 (1%)
 Frame = +3

Query  63   MTKDVEAVPEQPAEFSAKDYHDPPPSPLIDFDELTKWSFYRAVIAEFIAtllflyvtvlt  242
            M KDVE    +PAEF+AKDYHDPPP+PLID +ELTKWSFYRA+IAEFIATLLFLY+TVLT
Sbjct  1    MAKDVEVA--EPAEFAAKDYHDPPPAPLIDAEELTKWSFYRALIAEFIATLLFLYITVLT  58

Query  243  vIGYKHQTDPKAGGQDCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLAR  422
            VIGYK QTDP   G DC GVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLAR
Sbjct  59   VIGYKSQTDPALKGTDCDGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLAR  118

Query  423  KVTLPRAVLYMIAQCLGAICGVGVGEGFPE  512
            KV+L RAV YM+AQCLGAICG G+ + F +
Sbjct  119  KVSLIRAVSYMVAQCLGAICGCGLVKAFQK  148



>ref|XP_004953172.1| PREDICTED: aquaporin PIP2-4-like [Setaria italica]
Length=288

 Score =   224 bits (570),  Expect = 4e-69, Method: Compositional matrix adjust.
 Identities = 121/150 (81%), Positives = 131/150 (87%), Gaps = 2/150 (1%)
 Frame = +3

Query  63   MTKDVEAVPEQPAEFSAKDYHDPPPSPLIDFDELTKWSFYRAVIAEFIAtllflyvtvlt  242
            M KD+EA   +  EFSAKDY DPPP+PLID +ELTKWS YRA IAEF+ATLLFLY+TV T
Sbjct  1    MAKDIEASGPEAGEFSAKDYSDPPPAPLIDAEELTKWSLYRAAIAEFVATLLFLYITVAT  60

Query  243  vIGYKHQTDPKAGGQD--CGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFL  416
            VIGYKHQTD  A G D  CGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFL
Sbjct  61   VIGYKHQTDAAASGPDAACGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFL  120

Query  417  ARKVTLPRAVLYMIAQCLGAICGVGVGEGF  506
            ARKV+L RAVLY+IAQCLGAICGVG+ +GF
Sbjct  121  ARKVSLVRAVLYIIAQCLGAICGVGLVKGF  150



>ref|XP_003575410.1| PREDICTED: aquaporin PIP2-4 [Brachypodium distachyon]
Length=288

 Score =   224 bits (570),  Expect = 4e-69, Method: Compositional matrix adjust.
 Identities = 117/150 (78%), Positives = 132/150 (88%), Gaps = 2/150 (1%)
 Frame = +3

Query  63   MTKDVEAVPEQPAEFSAKDYHDPPPSPLIDFDELTKWSFYRAVIAEFIAtllflyvtvlt  242
            M KD+EA   +  EFSAKDY DPPP+P++DF+ELTKWS YRA IAEF+ATLLFLY+TV T
Sbjct  1    MAKDIEASAPEGGEFSAKDYSDPPPAPIVDFEELTKWSLYRAAIAEFVATLLFLYITVAT  60

Query  243  vIGYKHQTDPKAGGQD--CGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFL  416
            VIGYKHQTD  A G D  CGGVGILGIAWAFGGMIF+LVYCTAG+SGGHINPAVTFGLFL
Sbjct  61   VIGYKHQTDVSASGPDAACGGVGILGIAWAFGGMIFVLVYCTAGVSGGHINPAVTFGLFL  120

Query  417  ARKVTLPRAVLYMIAQCLGAICGVGVGEGF  506
            ARKV+L RAVLY++AQCLGAICGVG+ +GF
Sbjct  121  ARKVSLVRAVLYIVAQCLGAICGVGLVKGF  150



>ref|XP_010521765.1| PREDICTED: aquaporin PIP2-7-like [Tarenaya hassleriana]
Length=286

 Score =   223 bits (569),  Expect = 4e-69, Method: Compositional matrix adjust.
 Identities = 123/150 (82%), Positives = 134/150 (89%), Gaps = 1/150 (1%)
 Frame = +3

Query  63   MTKDVEAVPEQPAEFSAKDYHDPPPSPLIDFDELTKWSFYRAVIAEFIAtllflyvtvlt  242
            M KDVE V E   EF+AKDY DPPP+PLID +ELTKWSFYRA+IAEFIATLLFLYVTVLT
Sbjct  1    MAKDVE-VQESAPEFTAKDYTDPPPAPLIDPEELTKWSFYRALIAEFIATLLFLYVTVLT  59

Query  243  vIGYKHQTDPKAGGQDCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLAR  422
            VIGYK Q+D KAGG DCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLAR
Sbjct  60   VIGYKVQSDTKAGGDDCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLAR  119

Query  423  KVTLPRAVLYMIAQCLGAICGVGVGEGFPE  512
            KV+L RA+LYM+AQCLGAICG G+ + F +
Sbjct  120  KVSLVRALLYMVAQCLGAICGCGLVKAFQK  149



>ref|NP_001105026.1| aquaporin PIP2-4 [Zea mays]
 sp|Q9ATM6.1|PIP24_MAIZE RecName: Full=Aquaporin PIP2-4; AltName: Full=Plasma membrane 
intrinsic protein 2-4; AltName: Full=ZmPIP2-4; AltName: Full=ZmPIP2;4 
[Zea mays]
 gb|AAK26761.1| plasma membrane integral protein ZmPIP2-4 [Zea mays]
 gb|ACN28082.1| unknown [Zea mays]
 gb|AFW72774.1| plasma membrane intrinsic protein2 [Zea mays]
Length=288

 Score =   223 bits (569),  Expect = 5e-69, Method: Compositional matrix adjust.
 Identities = 121/150 (81%), Positives = 132/150 (88%), Gaps = 2/150 (1%)
 Frame = +3

Query  63   MTKDVEAVPEQPAEFSAKDYHDPPPSPLIDFDELTKWSFYRAVIAEFIAtllflyvtvlt  242
            M KD+EA   +  EFSAKDY DPPP+PLID +ELT+WS YRAVIAEFIATLLFLY+TV T
Sbjct  1    MAKDIEASGPEAGEFSAKDYTDPPPAPLIDAEELTQWSLYRAVIAEFIATLLFLYITVAT  60

Query  243  vIGYKHQTDPKAGGQD--CGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFL  416
            VIGYKHQTD  A G D  CGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFL
Sbjct  61   VIGYKHQTDASASGPDAACGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFL  120

Query  417  ARKVTLPRAVLYMIAQCLGAICGVGVGEGF  506
            ARKV+L RA+LY+IAQCLGAICGVG+ +GF
Sbjct  121  ARKVSLVRALLYIIAQCLGAICGVGLVKGF  150



>gb|AFK47400.1| unknown [Lotus japonicus]
Length=287

 Score =   223 bits (568),  Expect = 5e-69, Method: Compositional matrix adjust.
 Identities = 121/150 (81%), Positives = 133/150 (89%), Gaps = 2/150 (1%)
 Frame = +3

Query  63   MTKDVEAVPEQPAEFSAKDYHDPPPSPLIDFDELTKWSFYRAVIAEFIAtllflyvtvlt  242
            M KDVE    +   FS+KDYHDPPP+PLID +ELTKWSFYRAVIAEFIATLLFLY+TVLT
Sbjct  1    MAKDVEV--AERGSFSSKDYHDPPPAPLIDAEELTKWSFYRAVIAEFIATLLFLYITVLT  58

Query  243  vIGYKHQTDPKAGGQDCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLAR  422
            VIGYK Q+D K GG DCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLAR
Sbjct  59   VIGYKVQSDVKNGGDDCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLAR  118

Query  423  KVTLPRAVLYMIAQCLGAICGVGVGEGFPE  512
            KV+L RA+LYM+AQCLGAICGVG+ + F +
Sbjct  119  KVSLIRAILYMVAQCLGAICGVGLVKAFQK  148



>ref|XP_004505993.1| PREDICTED: aquaporin PIP2-7-like [Cicer arietinum]
Length=285

 Score =   223 bits (568),  Expect = 6e-69, Method: Compositional matrix adjust.
 Identities = 118/150 (79%), Positives = 131/150 (87%), Gaps = 2/150 (1%)
 Frame = +3

Query  63   MTKDVEAVPEQPAEFSAKDYHDPPPSPLIDFDELTKWSFYRAVIAEFIAtllflyvtvlt  242
            M KDVE   ++  EFSAKDY DPPP+PLIDFDELTKWSFYRA+IAEF+ATLLFLYVT+LT
Sbjct  1    MAKDVEV--QEHGEFSAKDYQDPPPAPLIDFDELTKWSFYRALIAEFVATLLFLYVTILT  58

Query  243  vIGYKHQTDPKAGGQDCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLAR  422
            +IGY HQ+DPKAGG DC GVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLF+ R
Sbjct  59   IIGYSHQSDPKAGGTDCDGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFVGR  118

Query  423  KVTLPRAVLYMIAQCLGAICGVGVGEGFPE  512
            KV+L RAV YM AQC GAI G G+ +GF +
Sbjct  119  KVSLLRAVFYMAAQCAGAISGTGLAKGFQK  148



>emb|CDP07111.1| unnamed protein product [Coffea canephora]
 emb|CDX10334.1| aquaporin [Coffea arabica]
Length=288

 Score =   223 bits (568),  Expect = 7e-69, Method: Compositional matrix adjust.
 Identities = 120/151 (79%), Positives = 130/151 (86%), Gaps = 1/151 (1%)
 Frame = +3

Query  63   MTKDVE-AVPEQPAEFSAKDYHDPPPSPLIDFDELTKWSFYRAVIAEFIAtllflyvtvl  239
            M KDVE  V  +  EFSAKDYHDPPP+   D DELTKWSF+RA+IAEF+ATLLFLYVTVL
Sbjct  1    MAKDVEGVVAAEQGEFSAKDYHDPPPAAFFDLDELTKWSFHRALIAEFVATLLFLYVTVL  60

Query  240  tvIGYKHQTDPKAGGQDCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLA  419
            TVIGYKHQTD  AGG DC GVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLA
Sbjct  61   TVIGYKHQTDATAGGDDCNGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLA  120

Query  420  RKVTLPRAVLYMIAQCLGAICGVGVGEGFPE  512
            RKV+L RA  YM+AQCLGAICGVG+ + F +
Sbjct  121  RKVSLLRAFFYMVAQCLGAICGVGLVKAFQK  151



>ref|XP_010031998.1| PREDICTED: aquaporin PIP2-7-like [Eucalyptus grandis]
 gb|KCW51390.1| hypothetical protein EUGRSUZ_J00930 [Eucalyptus grandis]
Length=285

 Score =   223 bits (567),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 121/150 (81%), Positives = 132/150 (88%), Gaps = 2/150 (1%)
 Frame = +3

Query  63   MTKDVEAVPEQPAEFSAKDYHDPPPSPLIDFDELTKWSFYRAVIAEFIAtllflyvtvlt  242
            M KDVE    +PAEF+AKDYHDPPP+PLID +ELTKWSFYRA+IAEFIATLLFLY+TVLT
Sbjct  1    MAKDVEV--AEPAEFAAKDYHDPPPAPLIDAEELTKWSFYRALIAEFIATLLFLYITVLT  58

Query  243  vIGYKHQTDPKAGGQDCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLAR  422
            VIGYK QTDP   G DC GVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLAR
Sbjct  59   VIGYKSQTDPALKGTDCDGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLAR  118

Query  423  KVTLPRAVLYMIAQCLGAICGVGVGEGFPE  512
            KV+L RAV YM+AQCLGAICG G+ + F +
Sbjct  119  KVSLIRAVSYMVAQCLGAICGCGLVKAFQK  148



>ref|NP_001105025.1| aquaporin PIP2-3 [Zea mays]
 sp|Q9ATM7.1|PIP23_MAIZE RecName: Full=Aquaporin PIP2-3; AltName: Full=Plasma membrane 
intrinsic protein 2-3; AltName: Full=ZmPIP2-3; AltName: Full=ZmPIP2;3 
[Zea mays]
 gb|AAK26760.1| plasma membrane integral protein ZmPIP2-3 [Zea mays]
 gb|ACR38296.1| unknown [Zea mays]
 gb|AFW63074.1| plasma membrane intrinsic protein2 [Zea mays]
Length=289

 Score =   223 bits (567),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 121/148 (82%), Positives = 131/148 (89%), Gaps = 2/148 (1%)
 Frame = +3

Query  69   KDVEAVPEQPAEFSAKDYHDPPPSPLIDFDELTKWSFYRAVIAEFIAtllflyvtvltvI  248
            +D+EA   +  EFSAKDY DPPP+PLID DELTKWS YRAVIAEFIATLLFLY+TV TVI
Sbjct  4    QDIEASGPEAGEFSAKDYTDPPPAPLIDADELTKWSLYRAVIAEFIATLLFLYITVATVI  63

Query  249  GYKHQTDPKAGGQD--CGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLAR  422
            GYKHQTD  A G D  CGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLAR
Sbjct  64   GYKHQTDAAASGPDAACGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLAR  123

Query  423  KVTLPRAVLYMIAQCLGAICGVGVGEGF  506
            KV+L RA+LY+IAQCLGAICGVG+ +GF
Sbjct  124  KVSLVRALLYIIAQCLGAICGVGLVKGF  151



>gb|ACU23034.1| unknown [Glycine max]
Length=158

 Score =   218 bits (555),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 117/150 (78%), Positives = 130/150 (87%), Gaps = 2/150 (1%)
 Frame = +3

Query  63   MTKDVEAVPEQPAEFSAKDYHDPPPSPLIDFDELTKWSFYRAVIAEFIAtllflyvtvlt  242
            M KDVE    +   FS KDY DPPP+PLID +ELTKWSFYRA+IAEFIATLLFLY+TVLT
Sbjct  1    MAKDVEVA--ERGSFSGKDYQDPPPAPLIDAEELTKWSFYRALIAEFIATLLFLYITVLT  58

Query  243  vIGYKHQTDPKAGGQDCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLAR  422
            VIGY HQTD K  G+ CGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLAR
Sbjct  59   VIGYNHQTDLKENGEICGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLAR  118

Query  423  KVTLPRAVLYMIAQCLGAICGVGVGEGFPE  512
            KV+L RA++YM+AQCLGAICGVG+ + F +
Sbjct  119  KVSLIRAIMYMVAQCLGAICGVGLVKAFQK  148



>gb|ACG33001.1| aquaporin PIP2.2 [Zea mays]
Length=288

 Score =   222 bits (566),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 119/150 (79%), Positives = 132/150 (88%), Gaps = 2/150 (1%)
 Frame = +3

Query  63   MTKDVEAVPEQPAEFSAKDYHDPPPSPLIDFDELTKWSFYRAVIAEFIAtllflyvtvlt  242
            M KD+EA   +  EFSAKDY DPPP+PL+D +ELT+WS YRAVIAEFIATLLFLY+TV T
Sbjct  1    MAKDIEASGPEAGEFSAKDYTDPPPAPLVDAEELTQWSLYRAVIAEFIATLLFLYITVAT  60

Query  243  vIGYKHQTDPKAGGQD--CGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFL  416
            VIGYKHQTD  A G D  CGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFL
Sbjct  61   VIGYKHQTDASASGPDAACGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFL  120

Query  417  ARKVTLPRAVLYMIAQCLGAICGVGVGEGF  506
            ARKV+L RA+LY++AQCLGAICGVG+ +GF
Sbjct  121  ARKVSLVRALLYIVAQCLGAICGVGLVKGF  150



>ref|NP_001240223.1| prolactin-inducible protein [Glycine max]
 gb|ACU20043.1| unknown [Glycine max]
Length=286

 Score =   221 bits (564),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 119/150 (79%), Positives = 131/150 (87%), Gaps = 1/150 (1%)
 Frame = +3

Query  63   MTKDVEAVPEQPAEFSAKDYHDPPPSPLIDFDELTKWSFYRAVIAEFIAtllflyvtvlt  242
            M KDVE V EQ  E+SAKDYHDPPP+PL D +ELT+WSFYRA+IAEFIATLLFLYVTVLT
Sbjct  1    MAKDVE-VQEQGGEYSAKDYHDPPPAPLFDPEELTQWSFYRALIAEFIATLLFLYVTVLT  59

Query  243  vIGYKHQTDPKAGGQDCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLAR  422
            +IGYK QTD   GG DC GVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFL R
Sbjct  60   IIGYKRQTDTTVGGTDCDGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLGR  119

Query  423  KVTLPRAVLYMIAQCLGAICGVGVGEGFPE  512
            KV+L RA+LYM+AQC GAICG G+ +GF +
Sbjct  120  KVSLIRALLYMVAQCAGAICGTGLAKGFQK  149



>gb|ADK25057.1| plasma membrane intrinsic protein [Glycine max]
Length=286

 Score =   221 bits (564),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 119/150 (79%), Positives = 131/150 (87%), Gaps = 1/150 (1%)
 Frame = +3

Query  63   MTKDVEAVPEQPAEFSAKDYHDPPPSPLIDFDELTKWSFYRAVIAEFIAtllflyvtvlt  242
            M KDVE V EQ  E+SAKDYHDPPP+PL D +ELT+WSFYRA+IAEFIATLLFLYVTVLT
Sbjct  1    MAKDVE-VQEQGGEYSAKDYHDPPPAPLFDPEELTQWSFYRALIAEFIATLLFLYVTVLT  59

Query  243  vIGYKHQTDPKAGGQDCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLAR  422
            +IGYK QTD   GG DC GVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFL R
Sbjct  60   IIGYKRQTDTTVGGTDCDGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLGR  119

Query  423  KVTLPRAVLYMIAQCLGAICGVGVGEGFPE  512
            KV+L RA+LYM+AQC GAICG G+ +GF +
Sbjct  120  KVSLIRALLYMVAQCAGAICGTGLAKGFQK  149



>dbj|BAE02729.1| PIP aquaporin [Hordeum vulgare]
Length=286

 Score =   221 bits (563),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 116/150 (77%), Positives = 132/150 (88%), Gaps = 3/150 (2%)
 Frame = +3

Query  63   MTKDVEAVPEQPAEFSAKDYHDPPPSPLIDFDELTKWSFYRAVIAEFIAtllflyvtvlt  242
            M KD+EA P Q  EFS+KDY DPPP+P++DF+ELTKWS YRAVIAEF+ATLLFLY+TV T
Sbjct  1    MAKDIEAAP-QGGEFSSKDYSDPPPAPIVDFEELTKWSLYRAVIAEFVATLLFLYITVAT  59

Query  243  vIGYKHQTDPKAGGQD--CGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFL  416
            VIGYKHQ+DP     D  C GVGILGIAWAFGGMIF+LVYCTAG+SGGHINPAVTFGLFL
Sbjct  60   VIGYKHQSDPTVNTTDAACSGVGILGIAWAFGGMIFVLVYCTAGVSGGHINPAVTFGLFL  119

Query  417  ARKVTLPRAVLYMIAQCLGAICGVGVGEGF  506
            ARKV+L RA+LY+IAQCLGAICGVG+ +GF
Sbjct  120  ARKVSLIRALLYIIAQCLGAICGVGLVKGF  149



>ref|XP_003606384.1| Aquaporin PIP2-7 [Medicago truncatula]
 gb|AES88581.1| major intrinsic protein (MIP) family transporter [Medicago truncatula]
Length=204

 Score =   218 bits (556),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 116/150 (77%), Positives = 130/150 (87%), Gaps = 2/150 (1%)
 Frame = +3

Query  63   MTKDVEAVPEQPAEFSAKDYHDPPPSPLIDFDELTKWSFYRAVIAEFIAtllflyvtvlt  242
            M KDVE   ++  E+SAKDY DPPP+PLID +ELTKWSFYRA+IAEF+ATLLFLYVTVLT
Sbjct  1    MAKDVEV--QEQGEYSAKDYQDPPPAPLIDVEELTKWSFYRALIAEFVATLLFLYVTVLT  58

Query  243  vIGYKHQTDPKAGGQDCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLAR  422
            +IGY HQ+DPKAGG DC GVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLF+ R
Sbjct  59   IIGYSHQSDPKAGGTDCDGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFVGR  118

Query  423  KVTLPRAVLYMIAQCLGAICGVGVGEGFPE  512
            KV+L RAV YM AQ  GAICG G+ +GF +
Sbjct  119  KVSLIRAVFYMAAQSAGAICGTGLAKGFQK  148



>ref|XP_010253676.1| PREDICTED: aquaporin PIP2-4-like [Nelumbo nucifera]
Length=287

 Score =   221 bits (562),  Expect = 4e-68, Method: Compositional matrix adjust.
 Identities = 119/150 (79%), Positives = 134/150 (89%), Gaps = 2/150 (1%)
 Frame = +3

Query  63   MTKDVEAVPEQPAEFSAKDYHDPPPSPLIDFDELTKWSFYRAVIAEFIAtllflyvtvlt  242
            M KDVE+   + ++FSAKDYHDPPP+ LID DEL+KWSFYRA+IAEFIATLLFLY+TVLT
Sbjct  1    MAKDVES--SEHSQFSAKDYHDPPPASLIDPDELSKWSFYRALIAEFIATLLFLYITVLT  58

Query  243  vIGYKHQTDPKAGGQDCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLAR  422
            VIGYK QTD    G DCGGVG+LGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLAR
Sbjct  59   VIGYKRQTDSSHNGTDCGGVGLLGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLAR  118

Query  423  KVTLPRAVLYMIAQCLGAICGVGVGEGFPE  512
            KV+L RAV+Y+IAQCLGAICGVG+ +GF +
Sbjct  119  KVSLIRAVMYIIAQCLGAICGVGLVKGFQK  148



>ref|XP_002452483.1| hypothetical protein SORBIDRAFT_04g026650 [Sorghum bicolor]
 gb|EES05459.1| hypothetical protein SORBIDRAFT_04g026650 [Sorghum bicolor]
Length=289

 Score =   221 bits (562),  Expect = 5e-68, Method: Compositional matrix adjust.
 Identities = 120/150 (80%), Positives = 131/150 (87%), Gaps = 2/150 (1%)
 Frame = +3

Query  63   MTKDVEAVPEQPAEFSAKDYHDPPPSPLIDFDELTKWSFYRAVIAEFIAtllflyvtvlt  242
            M KD+EA   +  EFSAKDY DPPP+PLID  ELT+WS YRAVIAEFIATLLFLY+TV T
Sbjct  1    MAKDIEASGPEAGEFSAKDYTDPPPAPLIDAAELTQWSLYRAVIAEFIATLLFLYITVAT  60

Query  243  vIGYKHQTDPKAGGQD--CGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFL  416
            VIGYKHQTD  A G D  CGGVGILGIAW+FGGMIFILVYCTAGISGGHINPAVTFGLFL
Sbjct  61   VIGYKHQTDATASGPDAACGGVGILGIAWSFGGMIFILVYCTAGISGGHINPAVTFGLFL  120

Query  417  ARKVTLPRAVLYMIAQCLGAICGVGVGEGF  506
            ARKV+L RA+LY+IAQCLGAICGVG+ +GF
Sbjct  121  ARKVSLVRALLYIIAQCLGAICGVGLVKGF  150



>gb|AAF61464.1|AF139815_1 plasma membrane intrinsic protein 2 [Triticum aestivum]
Length=257

 Score =   220 bits (560),  Expect = 5e-68, Method: Compositional matrix adjust.
 Identities = 116/150 (77%), Positives = 131/150 (87%), Gaps = 3/150 (2%)
 Frame = +3

Query  63   MTKDVEAVPEQPAEFSAKDYHDPPPSPLIDFDELTKWSFYRAVIAEFIAtllflyvtvlt  242
            M KD+EA P Q  EFS KDY DPPP+P++DF+ELTKWS YRAVIAEF+ATLLFLY+TV T
Sbjct  1    MAKDIEAAP-QGGEFSTKDYSDPPPAPIVDFEELTKWSLYRAVIAEFVATLLFLYITVAT  59

Query  243  vIGYKHQTDPKAGGQD--CGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFL  416
            VIGYKHQ+DP     D  C GVGILGIAWAFGGMIF+LVYCTAG+SGGHINPAVTFGLFL
Sbjct  60   VIGYKHQSDPTVNTTDAACSGVGILGIAWAFGGMIFVLVYCTAGVSGGHINPAVTFGLFL  119

Query  417  ARKVTLPRAVLYMIAQCLGAICGVGVGEGF  506
            ARKV+L RA+LY+IAQCLGAICGVG+ +GF
Sbjct  120  ARKVSLIRALLYIIAQCLGAICGVGLVKGF  149



>gb|KDO73275.1| hypothetical protein CISIN_1g022966mg [Citrus sinensis]
Length=264

 Score =   220 bits (560),  Expect = 5e-68, Method: Compositional matrix adjust.
 Identities = 121/152 (80%), Positives = 129/152 (85%), Gaps = 2/152 (1%)
 Frame = +3

Query  63   MTKDVEAVPEQPA--EFSAKDYHDPPPSPLIDFDELTKWSFYRAVIAEFIAtllflyvtv  236
            M KDVE   +Q    EFSAKDYHDPPP+PLIDF+EL KWSFYRAVIAEFIATLLFLYVTV
Sbjct  1    MGKDVEVAEQQGGGGEFSAKDYHDPPPAPLIDFEELGKWSFYRAVIAEFIATLLFLYVTV  60

Query  237  ltvIGYKHQTDPKAGGQDCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFL  416
            LTVIGYK QTDP      CGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFL
Sbjct  61   LTVIGYKSQTDPNLNTDQCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFL  120

Query  417  ARKVTLPRAVLYMIAQCLGAICGVGVGEGFPE  512
             RKV+L RA+LYM+AQCLGAICG G  + F +
Sbjct  121  GRKVSLIRALLYMVAQCLGAICGCGFVKAFQK  152



>ref|XP_006424577.1| hypothetical protein CICLE_v10028975mg [Citrus clementina]
 gb|ESR37817.1| hypothetical protein CICLE_v10028975mg [Citrus clementina]
Length=264

 Score =   220 bits (560),  Expect = 5e-68, Method: Compositional matrix adjust.
 Identities = 121/152 (80%), Positives = 129/152 (85%), Gaps = 2/152 (1%)
 Frame = +3

Query  63   MTKDVEAVPEQPA--EFSAKDYHDPPPSPLIDFDELTKWSFYRAVIAEFIAtllflyvtv  236
            M KDVE   +Q    EFSAKDYHDPPP+PLIDF+EL KWSFYRAVIAEFIATLLFLYVTV
Sbjct  1    MGKDVEVAEQQGGGGEFSAKDYHDPPPAPLIDFEELGKWSFYRAVIAEFIATLLFLYVTV  60

Query  237  ltvIGYKHQTDPKAGGQDCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFL  416
            LTVIGYK QTDP      CGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFL
Sbjct  61   LTVIGYKSQTDPNLNTDQCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFL  120

Query  417  ARKVTLPRAVLYMIAQCLGAICGVGVGEGFPE  512
             RKV+L RA+LYM+AQCLGAICG G  + F +
Sbjct  121  GRKVSLIRALLYMVAQCLGAICGCGFVKAFQK  152



>gb|KJB56129.1| hypothetical protein B456_009G107200 [Gossypium raimondii]
Length=232

 Score =   219 bits (557),  Expect = 5e-68, Method: Compositional matrix adjust.
 Identities = 119/152 (78%), Positives = 131/152 (86%), Gaps = 2/152 (1%)
 Frame = +3

Query  63   MTKDVEAVPEQPAEFSAKDYHDPPPSPLIDFDELTKWSFYRAVIAEFIAtllflyvtvlt  242
            MTKD+E   +   EFSAKDYHDPPP+PLID +ELTKWSFYRAVIAEFIATLLFLYVTVLT
Sbjct  1    MTKDIETAEQHGGEFSAKDYHDPPPAPLIDAEELTKWSFYRAVIAEFIATLLFLYVTVLT  60

Query  243  vIGYKHQTDPKAG--GQDCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFL  416
            VIGYK QTDP       DCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLF+
Sbjct  61   VIGYKVQTDPAKNTVDPDCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFV  120

Query  417  ARKVTLPRAVLYMIAQCLGAICGVGVGEGFPE  512
             RKV+L RA++YM+AQCLGAICG G+ + F +
Sbjct  121  GRKVSLIRALMYMVAQCLGAICGCGLVKAFQK  152



>gb|AEO13898.1| aquaporin 7 [Triticum aestivum]
Length=286

 Score =   220 bits (561),  Expect = 6e-68, Method: Compositional matrix adjust.
 Identities = 116/150 (77%), Positives = 131/150 (87%), Gaps = 3/150 (2%)
 Frame = +3

Query  63   MTKDVEAVPEQPAEFSAKDYHDPPPSPLIDFDELTKWSFYRAVIAEFIAtllflyvtvlt  242
            M KD+EA P Q  EFS KDY DPPP+P++DF+ELTKWS YRAVIAEF+ATLLFLY+TV T
Sbjct  1    MAKDIEAAP-QGGEFSTKDYSDPPPAPIVDFEELTKWSLYRAVIAEFVATLLFLYITVAT  59

Query  243  vIGYKHQTDPKAGGQD--CGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFL  416
            VIGYKHQ+DP     D  C GVGILGIAWAFGGMIF+LVYCTAG+SGGHINPAVTFGLFL
Sbjct  60   VIGYKHQSDPTVNTTDAACSGVGILGIAWAFGGMIFVLVYCTAGVSGGHINPAVTFGLFL  119

Query  417  ARKVTLPRAVLYMIAQCLGAICGVGVGEGF  506
            ARKV+L RA+LY+IAQCLGAICGVG+ +GF
Sbjct  120  ARKVSLIRALLYIIAQCLGAICGVGLVKGF  149



>gb|KJB62460.1| hypothetical protein B456_009G418100 [Gossypium raimondii]
Length=202

 Score =   218 bits (554),  Expect = 7e-68, Method: Compositional matrix adjust.
 Identities = 118/150 (79%), Positives = 127/150 (85%), Gaps = 4/150 (3%)
 Frame = +3

Query  63   MTKDVEAVPEQPAEFSAKDYHDPPPSPLIDFDELTKWSFYRAVIAEFIAtllflyvtvlt  242
            M KD+E       EF AKDYHDPPP+PL+D  EL KWSFYRAVIAEFIATLLFLY+TVLT
Sbjct  1    MAKDIEV----GGEFQAKDYHDPPPAPLVDAQELAKWSFYRAVIAEFIATLLFLYITVLT  56

Query  243  vIGYKHQTDPKAGGQDCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLAR  422
            VIGYK QTDP  GG+DCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLAR
Sbjct  57   VIGYKTQTDPAKGGEDCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLAR  116

Query  423  KVTLPRAVLYMIAQCLGAICGVGVGEGFPE  512
            KV+L RA+ YM AQCLGAICG G+ + F  
Sbjct  117  KVSLVRAIFYMGAQCLGAICGCGLVKAFQN  146



>emb|CAB45651.1| putative plasma membrane intrinsic protein [Pisum sativum]
Length=285

 Score =   220 bits (560),  Expect = 8e-68, Method: Compositional matrix adjust.
 Identities = 115/150 (77%), Positives = 129/150 (86%), Gaps = 2/150 (1%)
 Frame = +3

Query  63   MTKDVEAVPEQPAEFSAKDYHDPPPSPLIDFDELTKWSFYRAVIAEFIAtllflyvtvlt  242
            M KDVE   ++  E+SAKDY DPPP+PLID DELTKWSFYRA+IAEF+ATLLFLYVT+LT
Sbjct  1    MAKDVEV--QEQGEYSAKDYQDPPPAPLIDLDELTKWSFYRALIAEFVATLLFLYVTILT  58

Query  243  vIGYKHQTDPKAGGQDCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLAR  422
            +IGY HQTD  AGG DC GVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLF+ R
Sbjct  59   IIGYSHQTDANAGGTDCDGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFVGR  118

Query  423  KVTLPRAVLYMIAQCLGAICGVGVGEGFPE  512
            KV+L RAV YM AQC GA+CG G+ +GF +
Sbjct  119  KVSLLRAVFYMAAQCAGAVCGTGLAKGFQK  148



>ref|XP_008785285.1| PREDICTED: aquaporin PIP2-4 [Phoenix dactylifera]
Length=287

 Score =   220 bits (560),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 121/152 (80%), Positives = 131/152 (86%), Gaps = 3/152 (2%)
 Frame = +3

Query  63   MTKDVEAVPEQPAEFSAKDYHDPPPSPLIDFDELTKWSFYRAVIAEFIAtllflyvtvlt  242
            M KDVEA  E   EF+AKDY DPPP+PLID +ELTKWS YRAVIAEFIATLLFLY+TV T
Sbjct  1    MGKDVEAAAEA-GEFTAKDYTDPPPAPLIDAEELTKWSLYRAVIAEFIATLLFLYITVAT  59

Query  243  vIGYKHQTDPKAGGQD--CGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFL  416
            VIGYKHQ+D   GG D  C GVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFL
Sbjct  60   VIGYKHQSDANVGGADAACSGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFL  119

Query  417  ARKVTLPRAVLYMIAQCLGAICGVGVGEGFPE  512
            ARKV+L RA+LYMIAQCLGAICG G+ +GF +
Sbjct  120  ARKVSLIRALLYMIAQCLGAICGAGLVKGFQK  151



>gb|KHN05685.1| Aquaporin PIP2-7 [Glycine soja]
Length=286

 Score =   220 bits (560),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 118/150 (79%), Positives = 131/150 (87%), Gaps = 1/150 (1%)
 Frame = +3

Query  63   MTKDVEAVPEQPAEFSAKDYHDPPPSPLIDFDELTKWSFYRAVIAEFIAtllflyvtvlt  242
            M KDVE V EQ  E+SAKDYHDPPP+PL D +ELT+WSFYRA+IAEFIATLLFLYVTVLT
Sbjct  1    MAKDVE-VQEQGGEYSAKDYHDPPPAPLFDPEELTQWSFYRALIAEFIATLLFLYVTVLT  59

Query  243  vIGYKHQTDPKAGGQDCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLAR  422
            +IGYK QTD   GG +C GVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFL R
Sbjct  60   IIGYKRQTDTTVGGTECDGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLGR  119

Query  423  KVTLPRAVLYMIAQCLGAICGVGVGEGFPE  512
            KV+L RA+LYM+AQC GAICG G+ +GF +
Sbjct  120  KVSLIRALLYMVAQCAGAICGTGLAKGFQK  149



>gb|EAY86778.1| hypothetical protein OsI_08158 [Oryza sativa Indica Group]
Length=288

 Score =   220 bits (560),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 119/150 (79%), Positives = 129/150 (86%), Gaps = 2/150 (1%)
 Frame = +3

Query  63   MTKDVEAVPEQPAEFSAKDYHDPPPSPLIDFDELTKWSFYRAVIAEFIAtllflyvtvlt  242
            M KD+EA   +  EFSAKDY DPPP+PLID +ELTKWS YRAVIAEFIATLLFLY+TV T
Sbjct  1    MAKDIEASAPEGGEFSAKDYTDPPPAPLIDVEELTKWSLYRAVIAEFIATLLFLYITVAT  60

Query  243  vIGYKHQTDPKAGGQD--CGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFL  416
            VIGYKHQ+D      D  C GVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFL
Sbjct  61   VIGYKHQSDATVNTTDAACSGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFL  120

Query  417  ARKVTLPRAVLYMIAQCLGAICGVGVGEGF  506
            ARKV+L RAVLY+IAQCLGAICGVG+ +GF
Sbjct  121  ARKVSLIRAVLYIIAQCLGAICGVGLVKGF  150



>ref|NP_001047491.1| Os02g0629200 [Oryza sativa Japonica Group]
 sp|Q6K215.1|PIP22_ORYSJ RecName: Full=Probable aquaporin PIP2-2; AltName: Full=OsPIP2;2; 
AltName: Full=Plasma membrane intrinsic protein 2-2 [Oryza 
sativa Japonica Group]
 dbj|BAD23735.1| putative plasma membrane integral protein [Oryza sativa Japonica 
Group]
 dbj|BAF09405.1| Os02g0629200 [Oryza sativa Japonica Group]
 dbj|BAG88109.1| unnamed protein product [Oryza sativa Japonica Group]
Length=288

 Score =   220 bits (560),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 119/150 (79%), Positives = 129/150 (86%), Gaps = 2/150 (1%)
 Frame = +3

Query  63   MTKDVEAVPEQPAEFSAKDYHDPPPSPLIDFDELTKWSFYRAVIAEFIAtllflyvtvlt  242
            M KD+EA   +  EFSAKDY DPPP+PLID +ELTKWS YRAVIAEFIATLLFLY+TV T
Sbjct  1    MAKDIEASAPEGGEFSAKDYTDPPPAPLIDVEELTKWSLYRAVIAEFIATLLFLYITVAT  60

Query  243  vIGYKHQTDPKAGGQD--CGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFL  416
            VIGYKHQ+D      D  C GVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFL
Sbjct  61   VIGYKHQSDATVNTTDAACSGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFL  120

Query  417  ARKVTLPRAVLYMIAQCLGAICGVGVGEGF  506
            ARKV+L RAVLY+IAQCLGAICGVG+ +GF
Sbjct  121  ARKVSLIRAVLYIIAQCLGAICGVGLVKGF  150



>ref|XP_002877918.1| hypothetical protein ARALYDRAFT_485715 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH54177.1| hypothetical protein ARALYDRAFT_485715 [Arabidopsis lyrata subsp. 
lyrata]
Length=287

 Score =   220 bits (560),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 119/148 (80%), Positives = 130/148 (88%), Gaps = 2/148 (1%)
 Frame = +3

Query  63   MTKDVEAVPEQPAEFSAKDYHDPPPSPLIDFDELTKWSFYRAVIAEFIAtllflyvtvlt  242
            M KDVEAVP +   F  +DYHDPPP+P ID  EL KWSFYRAVIAEF+ATLLFLY+TVLT
Sbjct  1    MAKDVEAVPGE--GFQTRDYHDPPPAPFIDGAELKKWSFYRAVIAEFVATLLFLYITVLT  58

Query  243  vIGYKHQTDPKAGGQDCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLAR  422
            VIGYK Q+D  AGG DCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLAR
Sbjct  59   VIGYKIQSDTTAGGVDCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLAR  118

Query  423  KVTLPRAVLYMIAQCLGAICGVGVGEGF  506
            KV+LPRA+LY++AQCLGAICGVG  + F
Sbjct  119  KVSLPRAILYIVAQCLGAICGVGFVKAF  146



>gb|AAC17529.1| aquaporin 2 [Samanea saman]
Length=287

 Score =   219 bits (559),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 119/150 (79%), Positives = 132/150 (88%), Gaps = 2/150 (1%)
 Frame = +3

Query  63   MTKDVEAVPEQPAEFSAKDYHDPPPSPLIDFDELTKWSFYRAVIAEFIAtllflyvtvlt  242
            M KDVE    +   +SAKDYHDPPP+PLID +EL KWSFYRA+IAEFIATLLFLY+TVLT
Sbjct  1    MAKDVEV--AERGSYSAKDYHDPPPAPLIDAEELGKWSFYRALIAEFIATLLFLYITVLT  58

Query  243  vIGYKHQTDPKAGGQDCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLAR  422
            VIGYK Q+D KAGG  CGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLAR
Sbjct  59   VIGYKSQSDTKAGGDVCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLAR  118

Query  423  KVTLPRAVLYMIAQCLGAICGVGVGEGFPE  512
            KV+L RA+LYM+AQCLGAICGVG+ + F +
Sbjct  119  KVSLIRAILYMVAQCLGAICGVGLVKAFQK  148



>ref|XP_006424576.1| hypothetical protein CICLE_v10028975mg [Citrus clementina]
 ref|XP_006488095.1| PREDICTED: aquaporin PIP2-1-like [Citrus sinensis]
 gb|ESR37816.1| hypothetical protein CICLE_v10028975mg [Citrus clementina]
 gb|KDO73274.1| hypothetical protein CISIN_1g022966mg [Citrus sinensis]
Length=289

 Score =   219 bits (559),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 121/152 (80%), Positives = 129/152 (85%), Gaps = 2/152 (1%)
 Frame = +3

Query  63   MTKDVEAVPEQPA--EFSAKDYHDPPPSPLIDFDELTKWSFYRAVIAEFIAtllflyvtv  236
            M KDVE   +Q    EFSAKDYHDPPP+PLIDF+EL KWSFYRAVIAEFIATLLFLYVTV
Sbjct  1    MGKDVEVAEQQGGGGEFSAKDYHDPPPAPLIDFEELGKWSFYRAVIAEFIATLLFLYVTV  60

Query  237  ltvIGYKHQTDPKAGGQDCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFL  416
            LTVIGYK QTDP      CGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFL
Sbjct  61   LTVIGYKSQTDPNLNTDQCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFL  120

Query  417  ARKVTLPRAVLYMIAQCLGAICGVGVGEGFPE  512
             RKV+L RA+LYM+AQCLGAICG G  + F +
Sbjct  121  GRKVSLIRALLYMVAQCLGAICGCGFVKAFQK  152



>ref|XP_003538174.1| PREDICTED: aquaporin PIP2-7 [Glycine max]
Length=286

 Score =   219 bits (559),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 118/150 (79%), Positives = 131/150 (87%), Gaps = 1/150 (1%)
 Frame = +3

Query  63   MTKDVEAVPEQPAEFSAKDYHDPPPSPLIDFDELTKWSFYRAVIAEFIAtllflyvtvlt  242
            M KDVE V EQ  E+SAKDYHDPPP+PL D +ELT+WSFYRA+IAEFIATLLFLYVTVLT
Sbjct  1    MAKDVE-VQEQGGEYSAKDYHDPPPAPLFDPEELTQWSFYRALIAEFIATLLFLYVTVLT  59

Query  243  vIGYKHQTDPKAGGQDCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLAR  422
            +IGYK QTD   GG +C GVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFL R
Sbjct  60   IIGYKRQTDATLGGTECDGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLGR  119

Query  423  KVTLPRAVLYMIAQCLGAICGVGVGEGFPE  512
            KV+L RA+LYM+AQC GAICG G+ +GF +
Sbjct  120  KVSLIRALLYMVAQCAGAICGTGLAKGFQK  149



>ref|XP_008791535.1| PREDICTED: aquaporin PIP2-4-like [Phoenix dactylifera]
Length=287

 Score =   219 bits (559),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 120/152 (79%), Positives = 129/152 (85%), Gaps = 3/152 (2%)
 Frame = +3

Query  63   MTKDVEAVPEQPAEFSAKDYHDPPPSPLIDFDELTKWSFYRAVIAEFIAtllflyvtvlt  242
            M KDVEA  E   EF+AKDY DPPP+PLID +ELT WS YRAVIAEFIATLLFLY+TV T
Sbjct  1    MGKDVEAAAEA-GEFTAKDYMDPPPAPLIDVEELTTWSLYRAVIAEFIATLLFLYITVAT  59

Query  243  vIGYKHQTDPKAGGQD--CGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFL  416
            VIGYKHQ+DP   G D  C GVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFL
Sbjct  60   VIGYKHQSDPNVNGTDAACSGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFL  119

Query  417  ARKVTLPRAVLYMIAQCLGAICGVGVGEGFPE  512
            ARKV+L RA+LYMIAQCLGAICG G+  GF +
Sbjct  120  ARKVSLIRALLYMIAQCLGAICGAGLVRGFQK  151



>ref|XP_006291609.1| hypothetical protein CARUB_v10017763mg [Capsella rubella]
 gb|EOA24507.1| hypothetical protein CARUB_v10017763mg [Capsella rubella]
Length=287

 Score =   219 bits (559),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 120/148 (81%), Positives = 129/148 (87%), Gaps = 2/148 (1%)
 Frame = +3

Query  63   MTKDVEAVPEQPAEFSAKDYHDPPPSPLIDFDELTKWSFYRAVIAEFIAtllflyvtvlt  242
            M KDVE VP +   F  +DY DPPP+P  D  ELTKWSFYRAVIAEF+ATLLFLY+TVLT
Sbjct  1    MAKDVETVPGE--GFQTRDYQDPPPAPFFDGAELTKWSFYRAVIAEFVATLLFLYITVLT  58

Query  243  vIGYKHQTDPKAGGQDCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLAR  422
            VIGYK Q+D KAGG DCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLAR
Sbjct  59   VIGYKLQSDLKAGGDDCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLAR  118

Query  423  KVTLPRAVLYMIAQCLGAICGVGVGEGF  506
            KV+LPRAVLY+IAQCLGAICGVG  + F
Sbjct  119  KVSLPRAVLYIIAQCLGAICGVGFVKAF  146



>gb|EMT09900.1| Putative aquaporin PIP2-2 [Aegilops tauschii]
Length=315

 Score =   220 bits (561),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 116/150 (77%), Positives = 131/150 (87%), Gaps = 3/150 (2%)
 Frame = +3

Query  63   MTKDVEAVPEQPAEFSAKDYHDPPPSPLIDFDELTKWSFYRAVIAEFIAtllflyvtvlt  242
            M KD+EA P Q  EFS KDY DPPP+P++DF+ELTKWS YRAVIAEF+ATLLFLY+TV T
Sbjct  1    MAKDIEAAP-QGGEFSTKDYSDPPPAPIVDFEELTKWSLYRAVIAEFVATLLFLYITVAT  59

Query  243  vIGYKHQTDPKAGGQD--CGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFL  416
            VIGYKHQ+DP     D  C GVGILGIAWAFGGMIF+LVYCTAG+SGGHINPAVTFGLFL
Sbjct  60   VIGYKHQSDPTVNTTDAACSGVGILGIAWAFGGMIFVLVYCTAGVSGGHINPAVTFGLFL  119

Query  417  ARKVTLPRAVLYMIAQCLGAICGVGVGEGF  506
            ARKV+L RA+LY+IAQCLGAICGVG+ +GF
Sbjct  120  ARKVSLIRALLYIIAQCLGAICGVGLVKGF  149



>gb|KHN38765.1| Aquaporin PIP2-7 [Glycine soja]
Length=286

 Score =   219 bits (559),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 118/150 (79%), Positives = 131/150 (87%), Gaps = 1/150 (1%)
 Frame = +3

Query  63   MTKDVEAVPEQPAEFSAKDYHDPPPSPLIDFDELTKWSFYRAVIAEFIAtllflyvtvlt  242
            M KDVE V EQ  E+SAKDYHDPPP+PL D +ELT+WSFYRA+IAEFIATLLFLYVTVLT
Sbjct  1    MAKDVE-VQEQGGEYSAKDYHDPPPAPLFDPEELTQWSFYRALIAEFIATLLFLYVTVLT  59

Query  243  vIGYKHQTDPKAGGQDCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLAR  422
            +IGYK QTD   GG +C GVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFL R
Sbjct  60   IIGYKRQTDATLGGTECDGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLGR  119

Query  423  KVTLPRAVLYMIAQCLGAICGVGVGEGFPE  512
            KV+L RA+LYM+AQC GAICG G+ +GF +
Sbjct  120  KVSLIRALLYMVAQCAGAICGTGLAKGFQK  149



>gb|KJB16797.1| hypothetical protein B456_002G2484002, partial [Gossypium raimondii]
Length=142

 Score =   214 bits (545),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 116/144 (81%), Positives = 124/144 (86%), Gaps = 4/144 (3%)
 Frame = +3

Query  63   MTKDVEAVPEQPAEFSAKDYHDPPPSPLIDFDELTKWSFYRAVIAEFIAtllflyvtvlt  242
            M KDVE       EF AKDYHDPPP+P +D  ELT+WSFYRA+IAEFIATLLFLY+TVLT
Sbjct  1    MAKDVEV----GGEFQAKDYHDPPPAPFVDAQELTQWSFYRAIIAEFIATLLFLYITVLT  56

Query  243  vIGYKHQTDPKAGGQDCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLAR  422
            VIGYK Q DP  GGQDC GVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLAR
Sbjct  57   VIGYKSQVDPDKGGQDCDGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLAR  116

Query  423  KVTLPRAVLYMIAQCLGAICGVGV  494
            KV+L RA+LYM AQCLGAICG G+
Sbjct  117  KVSLVRAILYMAAQCLGAICGCGL  140



>gb|AFH36337.1| aquaporin PIP2;2 [Quercus petraea]
Length=285

 Score =   219 bits (558),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 118/150 (79%), Positives = 131/150 (87%), Gaps = 2/150 (1%)
 Frame = +3

Query  63   MTKDVEAVPEQPAEFSAKDYHDPPPSPLIDFDELTKWSFYRAVIAEFIAtllflyvtvlt  242
            M KDVE    +  E+SAKDYHDPPP+PLID +ELT+WSFYRA+IAEFIATLLFLY+TVLT
Sbjct  1    MAKDVEV--AERGEYSAKDYHDPPPAPLIDPEELTQWSFYRALIAEFIATLLFLYITVLT  58

Query  243  vIGYKHQTDPKAGGQDCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLAR  422
            VIGYK QTDP      CGGVGILGIAWAFGGMIF+LVYCTAGISGGHINPAVTFGLFLAR
Sbjct  59   VIGYKSQTDPLKNADQCGGVGILGIAWAFGGMIFVLVYCTAGISGGHINPAVTFGLFLAR  118

Query  423  KVTLPRAVLYMIAQCLGAICGVGVGEGFPE  512
            KV+L RAVLYM+AQCLGAICGVG+ + F +
Sbjct  119  KVSLIRAVLYMVAQCLGAICGVGLVKAFQK  148



>dbj|BAA23744.1| HvPIP2;1 [Hordeum vulgare subsp. vulgare]
Length=286

 Score =   219 bits (558),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 115/150 (77%), Positives = 131/150 (87%), Gaps = 3/150 (2%)
 Frame = +3

Query  63   MTKDVEAVPEQPAEFSAKDYHDPPPSPLIDFDELTKWSFYRAVIAEFIAtllflyvtvlt  242
            M KD+EA P Q  EFS+KDY DPPP+P++DF+ELTKWS YRAVIAEF+ATLLFLY+TV T
Sbjct  1    MAKDIEAAP-QGGEFSSKDYSDPPPAPIVDFEELTKWSLYRAVIAEFVATLLFLYITVAT  59

Query  243  vIGYKHQTDPKAGGQD--CGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFL  416
            VIGYKHQ+DP     D  C GVG LGIAWAFGGMIF+LVYCTAG+SGGHINPAVTFGLFL
Sbjct  60   VIGYKHQSDPTVNTTDAACSGVGTLGIAWAFGGMIFVLVYCTAGVSGGHINPAVTFGLFL  119

Query  417  ARKVTLPRAVLYMIAQCLGAICGVGVGEGF  506
            ARKV+L RA+LY+IAQCLGAICGVG+ +GF
Sbjct  120  ARKVSLIRALLYIIAQCLGAICGVGLVKGF  149



>gb|KHG00060.1| putative aquaporin PIP2-2 [Gossypium arboreum]
Length=289

 Score =   219 bits (558),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 119/152 (78%), Positives = 132/152 (87%), Gaps = 2/152 (1%)
 Frame = +3

Query  63   MTKDVEAVPEQPAEFSAKDYHDPPPSPLIDFDELTKWSFYRAVIAEFIAtllflyvtvlt  242
            MTKD+E   ++  EFSAKDYHDPPP+PLID +ELTKWSFYRAVIAEFIATLLFLYVTVLT
Sbjct  1    MTKDIETAEQRGGEFSAKDYHDPPPAPLIDAEELTKWSFYRAVIAEFIATLLFLYVTVLT  60

Query  243  vIGYKHQTDPKAG--GQDCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFL  416
            VIGYK QTDP       DCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLF+
Sbjct  61   VIGYKVQTDPAKNTVDPDCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFV  120

Query  417  ARKVTLPRAVLYMIAQCLGAICGVGVGEGFPE  512
             RKV+L RA++YM+AQCLGAICG G+ + F +
Sbjct  121  GRKVSLIRALMYMVAQCLGAICGCGLVKAFQK  152



>gb|KJB56128.1| hypothetical protein B456_009G107200 [Gossypium raimondii]
Length=289

 Score =   218 bits (556),  Expect = 4e-67, Method: Compositional matrix adjust.
 Identities = 119/152 (78%), Positives = 131/152 (86%), Gaps = 2/152 (1%)
 Frame = +3

Query  63   MTKDVEAVPEQPAEFSAKDYHDPPPSPLIDFDELTKWSFYRAVIAEFIAtllflyvtvlt  242
            MTKD+E   +   EFSAKDYHDPPP+PLID +ELTKWSFYRAVIAEFIATLLFLYVTVLT
Sbjct  1    MTKDIETAEQHGGEFSAKDYHDPPPAPLIDAEELTKWSFYRAVIAEFIATLLFLYVTVLT  60

Query  243  vIGYKHQTDPKAG--GQDCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFL  416
            VIGYK QTDP       DCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLF+
Sbjct  61   VIGYKVQTDPAKNTVDPDCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFV  120

Query  417  ARKVTLPRAVLYMIAQCLGAICGVGVGEGFPE  512
             RKV+L RA++YM+AQCLGAICG G+ + F +
Sbjct  121  GRKVSLIRALMYMVAQCLGAICGCGLVKAFQK  152



>ref|XP_007143702.1| hypothetical protein PHAVU_007G094600g [Phaseolus vulgaris]
 gb|AGV54658.1| aquaporin PIP2 [Phaseolus vulgaris]
 gb|ESW15696.1| hypothetical protein PHAVU_007G094600g [Phaseolus vulgaris]
Length=287

 Score =   218 bits (556),  Expect = 4e-67, Method: Compositional matrix adjust.
 Identities = 118/150 (79%), Positives = 131/150 (87%), Gaps = 2/150 (1%)
 Frame = +3

Query  63   MTKDVEAVPEQPAEFSAKDYHDPPPSPLIDFDELTKWSFYRAVIAEFIAtllflyvtvlt  242
            M KDVE    +   FS KDYHDPPP+PLID +ELTKWSFYRA+IAEFIATLLFLY+TVLT
Sbjct  1    MAKDVEV--TERGSFSGKDYHDPPPAPLIDTEELTKWSFYRALIAEFIATLLFLYITVLT  58

Query  243  vIGYKHQTDPKAGGQDCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLAR  422
            VIGYKHQ+D K  G  CGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLAR
Sbjct  59   VIGYKHQSDLKDHGDACGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLAR  118

Query  423  KVTLPRAVLYMIAQCLGAICGVGVGEGFPE  512
            KV+L RA++YM+AQCLGAICGVG+ + F +
Sbjct  119  KVSLIRAIMYMVAQCLGAICGVGLVKAFQK  148



>ref|XP_010426989.1| PREDICTED: aquaporin PIP2-1 [Camelina sativa]
Length=287

 Score =   218 bits (555),  Expect = 5e-67, Method: Compositional matrix adjust.
 Identities = 120/148 (81%), Positives = 129/148 (87%), Gaps = 2/148 (1%)
 Frame = +3

Query  63   MTKDVEAVPEQPAEFSAKDYHDPPPSPLIDFDELTKWSFYRAVIAEFIAtllflyvtvlt  242
            M KDVEAVP +   F  +DY DPPP+P  D  EL KWSFYRAVIAEF+ATLLFLY+TVLT
Sbjct  1    MAKDVEAVPGE--GFQTRDYQDPPPAPFFDGAELKKWSFYRAVIAEFVATLLFLYITVLT  58

Query  243  vIGYKHQTDPKAGGQDCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLAR  422
            VIGYK Q+D KAGG DCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLAR
Sbjct  59   VIGYKIQSDVKAGGVDCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLAR  118

Query  423  KVTLPRAVLYMIAQCLGAICGVGVGEGF  506
            KV+LPRAVLY+IAQCLGAICGVG  + F
Sbjct  119  KVSLPRAVLYIIAQCLGAICGVGFVKAF  146



>ref|XP_010920406.1| PREDICTED: aquaporin PIP2-4 isoform X2 [Elaeis guineensis]
Length=238

 Score =   216 bits (551),  Expect = 5e-67, Method: Compositional matrix adjust.
 Identities = 118/152 (78%), Positives = 131/152 (86%), Gaps = 6/152 (4%)
 Frame = +3

Query  63   MTKDVEAVPEQPAEFSAKDYHDPPPSPLIDFDELTKWSFYRAVIAEFIAtllflyvtvlt  242
            M KD+EA     AEF+AKDY DPPP+PL+D +ELTKWS YRAVIAEFIATLLFLY+TV T
Sbjct  1    MRKDMEA----GAEFTAKDYTDPPPAPLVDAEELTKWSLYRAVIAEFIATLLFLYITVAT  56

Query  243  vIGYKHQTDPKAGGQD--CGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFL  416
            VIGYKHQ+DP   G D  C GVGILGIAWAFGGMIF+LVYCTAGISGGHINPAVTFGLFL
Sbjct  57   VIGYKHQSDPNVSGPDAACNGVGILGIAWAFGGMIFVLVYCTAGISGGHINPAVTFGLFL  116

Query  417  ARKVTLPRAVLYMIAQCLGAICGVGVGEGFPE  512
            ARKV+L RA+LYMIAQCLGAICGVG+ + F +
Sbjct  117  ARKVSLIRALLYMIAQCLGAICGVGLVKAFQK  148



>gb|KJB36606.1| hypothetical protein B456_006G166800 [Gossypium raimondii]
Length=203

 Score =   215 bits (548),  Expect = 5e-67, Method: Compositional matrix adjust.
 Identities = 117/150 (78%), Positives = 127/150 (85%), Gaps = 4/150 (3%)
 Frame = +3

Query  63   MTKDVEAVPEQPAEFSAKDYHDPPPSPLIDFDELTKWSFYRAVIAEFIAtllflyvtvlt  242
            M KDVE       EF AKDYHDPPP+PL+D +ELTKWSFYRAVIAEFIATLLFLY+TVLT
Sbjct  1    MAKDVEV----GGEFQAKDYHDPPPAPLVDGEELTKWSFYRAVIAEFIATLLFLYITVLT  56

Query  243  vIGYKHQTDPKAGGQDCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLAR  422
            VIGYK Q DP  G  +CGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLAR
Sbjct  57   VIGYKSQVDPDKGSDECGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLAR  116

Query  423  KVTLPRAVLYMIAQCLGAICGVGVGEGFPE  512
            KV+L RA+ YM AQCLGAICG G+ + F +
Sbjct  117  KVSLVRAIFYMAAQCLGAICGCGLVKAFQK  146



>gb|ABK60195.2| PIP2 protein [Gossypium hirsutum]
Length=285

 Score =   218 bits (555),  Expect = 6e-67, Method: Compositional matrix adjust.
 Identities = 117/150 (78%), Positives = 127/150 (85%), Gaps = 4/150 (3%)
 Frame = +3

Query  63   MTKDVEAVPEQPAEFSAKDYHDPPPSPLIDFDELTKWSFYRAVIAEFIAtllflyvtvlt  242
            M KDVE       EF AKDYHDPPP+PL+D  ELT+WSFYRA+IAEFIA LLFLY+TVLT
Sbjct  1    MAKDVEV----GGEFQAKDYHDPPPAPLVDAQELTQWSFYRAIIAEFIAALLFLYITVLT  56

Query  243  vIGYKHQTDPKAGGQDCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLAR  422
            VIGYK Q DP  GGQDC GVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLAR
Sbjct  57   VIGYKSQVDPDKGGQDCDGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLAR  116

Query  423  KVTLPRAVLYMIAQCLGAICGVGVGEGFPE  512
            KV+L RA+LYM AQCLGAICG G+ + F +
Sbjct  117  KVSLVRAILYMAAQCLGAICGCGLVKAFQK  146



>ref|XP_010920407.1| PREDICTED: probable aquaporin PIP2-2 [Elaeis guineensis]
Length=287

 Score =   218 bits (555),  Expect = 6e-67, Method: Compositional matrix adjust.
 Identities = 120/152 (79%), Positives = 130/152 (86%), Gaps = 3/152 (2%)
 Frame = +3

Query  63   MTKDVEAVPEQPAEFSAKDYHDPPPSPLIDFDELTKWSFYRAVIAEFIAtllflyvtvlt  242
            M KDVEA  E   EF+AKDY DPPP+ LID +E+ KWS YRAVIAEFIATLLFLY+TV T
Sbjct  1    MGKDVEAAAEG-GEFTAKDYTDPPPAALIDAEEMIKWSLYRAVIAEFIATLLFLYITVAT  59

Query  243  vIGYKHQTDPKAGGQD--CGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFL  416
            VIGYKHQ+DP  GG D  C GVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFL
Sbjct  60   VIGYKHQSDPNVGGADAACSGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFL  119

Query  417  ARKVTLPRAVLYMIAQCLGAICGVGVGEGFPE  512
            ARKV+L RA+LYMIAQCLGAICGVG+ +GF  
Sbjct  120  ARKVSLVRALLYMIAQCLGAICGVGLVKGFQR  151



>gb|KJB11821.1| hypothetical protein B456_002G2484001 [Gossypium raimondii]
Length=285

 Score =   218 bits (555),  Expect = 6e-67, Method: Compositional matrix adjust.
 Identities = 118/150 (79%), Positives = 128/150 (85%), Gaps = 4/150 (3%)
 Frame = +3

Query  63   MTKDVEAVPEQPAEFSAKDYHDPPPSPLIDFDELTKWSFYRAVIAEFIAtllflyvtvlt  242
            M KDVE       EF AKDYHDPPP+PL+D  ELT+WSFYRA+IAEFIATLLFLY+TVLT
Sbjct  1    MAKDVEV----GGEFQAKDYHDPPPAPLVDAQELTQWSFYRAIIAEFIATLLFLYITVLT  56

Query  243  vIGYKHQTDPKAGGQDCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLAR  422
            VIGYK Q DP  GGQDC GVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLAR
Sbjct  57   VIGYKSQVDPDKGGQDCDGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLAR  116

Query  423  KVTLPRAVLYMIAQCLGAICGVGVGEGFPE  512
            KV+L RA+LYM AQCLGAICG G+ + F +
Sbjct  117  KVSLVRAILYMAAQCLGAICGCGLVKAFQK  146



>ref|XP_003606383.1| Aquaporin PIP2-7 [Medicago truncatula]
 gb|AES88580.1| major intrinsic protein (MIP) family transporter [Medicago truncatula]
 gb|AFK45158.1| unknown [Medicago truncatula]
Length=285

 Score =   218 bits (555),  Expect = 6e-67, Method: Compositional matrix adjust.
 Identities = 116/150 (77%), Positives = 130/150 (87%), Gaps = 2/150 (1%)
 Frame = +3

Query  63   MTKDVEAVPEQPAEFSAKDYHDPPPSPLIDFDELTKWSFYRAVIAEFIAtllflyvtvlt  242
            M KDVE   ++  E+SAKDY DPPP+PLID +ELTKWSFYRA+IAEF+ATLLFLYVTVLT
Sbjct  1    MAKDVEV--QEQGEYSAKDYQDPPPAPLIDVEELTKWSFYRALIAEFVATLLFLYVTVLT  58

Query  243  vIGYKHQTDPKAGGQDCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLAR  422
            +IGY HQ+DPKAGG DC GVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLF+ R
Sbjct  59   IIGYSHQSDPKAGGTDCDGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFVGR  118

Query  423  KVTLPRAVLYMIAQCLGAICGVGVGEGFPE  512
            KV+L RAV YM AQ  GAICG G+ +GF +
Sbjct  119  KVSLIRAVFYMAAQSAGAICGTGLAKGFQK  148



>gb|AIA83106.1| putative aquaporin PIP2 [Citrus trifoliata]
Length=292

 Score =   218 bits (555),  Expect = 6e-67, Method: Compositional matrix adjust.
 Identities = 121/155 (78%), Positives = 128/155 (83%), Gaps = 5/155 (3%)
 Frame = +3

Query  63   MTKDVEAVPEQPA-----EFSAKDYHDPPPSPLIDFDELTKWSFYRAVIAEFIAtllfly  227
            M KDVE   +Q       EFSAKDYHD PP+PLIDFDEL KWSFYRAVIAEFIATLLFLY
Sbjct  1    MGKDVEVAEQQGGGGGGGEFSAKDYHDSPPAPLIDFDELGKWSFYRAVIAEFIATLLFLY  60

Query  228  vtvltvIGYKHQTDPKAGGQDCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFG  407
            VTVLTVIGYK QTDP      CGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFG
Sbjct  61   VTVLTVIGYKSQTDPTLNTDQCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFG  120

Query  408  LFLARKVTLPRAVLYMIAQCLGAICGVGVGEGFPE  512
            LFL RKV+L RA+LYM+AQCLGAICG G  + F +
Sbjct  121  LFLGRKVSLIRALLYMVAQCLGAICGCGFVKAFQK  155



>gb|AHG32324.1| PIP2-3 [Pisum sativum]
Length=287

 Score =   218 bits (555),  Expect = 6e-67, Method: Compositional matrix adjust.
 Identities = 119/150 (79%), Positives = 131/150 (87%), Gaps = 2/150 (1%)
 Frame = +3

Query  63   MTKDVEAVPEQPAEFSAKDYHDPPPSPLIDFDELTKWSFYRAVIAEFIAtllflyvtvlt  242
            M KDVE    +   FS KDYHDPPP+PLID +ELTKWSFYRA+IAEFIATLLFLYVTVLT
Sbjct  1    MAKDVEV--AERGSFSNKDYHDPPPAPLIDAEELTKWSFYRALIAEFIATLLFLYVTVLT  58

Query  243  vIGYKHQTDPKAGGQDCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLAR  422
            VIGY  QTD KAGG +CGGVGILGIAWAFGGMIF+LVYCTAGISGGHINPAVTFGLFLAR
Sbjct  59   VIGYSIQTDVKAGGDECGGVGILGIAWAFGGMIFVLVYCTAGISGGHINPAVTFGLFLAR  118

Query  423  KVTLPRAVLYMIAQCLGAICGVGVGEGFPE  512
            KV+L RAV+YM+AQ LGAICGVG+ + F +
Sbjct  119  KVSLIRAVMYMVAQSLGAICGVGLVKAFQK  148



>gb|AGD98714.1| aquaporin protein 11 [Camellia sinensis]
Length=287

 Score =   218 bits (554),  Expect = 7e-67, Method: Compositional matrix adjust.
 Identities = 116/148 (78%), Positives = 127/148 (86%), Gaps = 0/148 (0%)
 Frame = +3

Query  63   MTKDVEAVPEQPAEFSAKDYHDPPPSPLIDFDELTKWSFYRAVIAEFIAtllflyvtvlt  242
            M K+VE       EFSAKDYHDPPP+PL+D  ELTKWSFYRA+IAEFIATLLFLY+TVLT
Sbjct  1    MAKEVEETVVTEQEFSAKDYHDPPPAPLVDAVELTKWSFYRAIIAEFIATLLFLYITVLT  60

Query  243  vIGYKHQTDPKAGGQDCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLAR  422
            VIGYK QTDP      CGGVGILGIAWAFGGMIF+LVYCTAGISGGHINPAVTFGLFLAR
Sbjct  61   VIGYKSQTDPIKNADQCGGVGILGIAWAFGGMIFVLVYCTAGISGGHINPAVTFGLFLAR  120

Query  423  KVTLPRAVLYMIAQCLGAICGVGVGEGF  506
            KV+L RA+LYM+AQC GAICGVG+ + F
Sbjct  121  KVSLIRALLYMVAQCSGAICGVGLVKAF  148



>gb|KHG29841.1| putative aquaporin PIP2-2 [Gossypium arboreum]
Length=291

 Score =   218 bits (555),  Expect = 7e-67, Method: Compositional matrix adjust.
 Identities = 121/154 (79%), Positives = 131/154 (85%), Gaps = 4/154 (3%)
 Frame = +3

Query  63   MTKDVEAVPEQP--AEFSAKDYHDPPPSPLIDFDELTKWSFYRAVIAEFIAtllflyvtv  236
            MTKD+E   EQ   AEFSAKDYHDPPP+PLID +ELTKWS YRA IAEFIATLLFLYVTV
Sbjct  1    MTKDIETTAEQGGGAEFSAKDYHDPPPAPLIDMEELTKWSLYRAAIAEFIATLLFLYVTV  60

Query  237  ltvIGYKHQTDP--KAGGQDCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGL  410
            LTVIGYK QTDP       DCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGL
Sbjct  61   LTVIGYKVQTDPVKNTNDPDCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGL  120

Query  411  FLARKVTLPRAVLYMIAQCLGAICGVGVGEGFPE  512
            F+ RKV+L RA+LYM+AQCLGAICG G+ + F +
Sbjct  121  FVGRKVSLIRALLYMVAQCLGAICGCGLVKAFQK  154



>gb|AEH76326.1| plasma membrane intrinsic protein 2A [Camelina sativa]
Length=287

 Score =   218 bits (554),  Expect = 7e-67, Method: Compositional matrix adjust.
 Identities = 120/148 (81%), Positives = 129/148 (87%), Gaps = 2/148 (1%)
 Frame = +3

Query  63   MTKDVEAVPEQPAEFSAKDYHDPPPSPLIDFDELTKWSFYRAVIAEFIAtllflyvtvlt  242
            M KDVEAVP +   F  +DY DPPP+P  D  EL KWSFYRAVIAEF+ATLLFLY+TVLT
Sbjct  1    MAKDVEAVPGE--GFQTRDYQDPPPAPFFDGAELKKWSFYRAVIAEFVATLLFLYITVLT  58

Query  243  vIGYKHQTDPKAGGQDCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLAR  422
            VIGYK Q+D KAGG DCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLAR
Sbjct  59   VIGYKIQSDVKAGGFDCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLAR  118

Query  423  KVTLPRAVLYMIAQCLGAICGVGVGEGF  506
            KV+LPRAVLY+IAQCLGAICGVG  + F
Sbjct  119  KVSLPRAVLYIIAQCLGAICGVGFVKAF  146



>gb|KJB62459.1| hypothetical protein B456_009G418100 [Gossypium raimondii]
Length=285

 Score =   217 bits (553),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 118/150 (79%), Positives = 127/150 (85%), Gaps = 4/150 (3%)
 Frame = +3

Query  63   MTKDVEAVPEQPAEFSAKDYHDPPPSPLIDFDELTKWSFYRAVIAEFIAtllflyvtvlt  242
            M KD+E       EF AKDYHDPPP+PL+D  EL KWSFYRAVIAEFIATLLFLY+TVLT
Sbjct  1    MAKDIEV----GGEFQAKDYHDPPPAPLVDAQELAKWSFYRAVIAEFIATLLFLYITVLT  56

Query  243  vIGYKHQTDPKAGGQDCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLAR  422
            VIGYK QTDP  GG+DCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLAR
Sbjct  57   VIGYKTQTDPAKGGEDCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLAR  116

Query  423  KVTLPRAVLYMIAQCLGAICGVGVGEGFPE  512
            KV+L RA+ YM AQCLGAICG G+ + F  
Sbjct  117  KVSLVRAIFYMGAQCLGAICGCGLVKAFQN  146



>ref|XP_003536353.1| PREDICTED: aquaporin PIP2-1-like isoform 1 [Glycine max]
 gb|KHN17135.1| Aquaporin PIP2-2 [Glycine soja]
Length=287

 Score =   217 bits (553),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 117/150 (78%), Positives = 130/150 (87%), Gaps = 2/150 (1%)
 Frame = +3

Query  63   MTKDVEAVPEQPAEFSAKDYHDPPPSPLIDFDELTKWSFYRAVIAEFIAtllflyvtvlt  242
            M KDVE    +   FS KDY DPPP+PLID +ELTKWSFYRA+IAEFIATLLFLY+TVLT
Sbjct  1    MAKDVEV--AERGSFSGKDYQDPPPAPLIDAEELTKWSFYRALIAEFIATLLFLYITVLT  58

Query  243  vIGYKHQTDPKAGGQDCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLAR  422
            VIGY HQTD K  G+ CGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLAR
Sbjct  59   VIGYNHQTDLKENGEICGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLAR  118

Query  423  KVTLPRAVLYMIAQCLGAICGVGVGEGFPE  512
            KV+L RA++YM+AQCLGAICGVG+ + F +
Sbjct  119  KVSLIRAIMYMVAQCLGAICGVGLVKAFQK  148



>gb|ABK60196.1| PIP2 protein [Gossypium hirsutum]
Length=286

 Score =   217 bits (553),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 118/150 (79%), Positives = 127/150 (85%), Gaps = 4/150 (3%)
 Frame = +3

Query  63   MTKDVEAVPEQPAEFSAKDYHDPPPSPLIDFDELTKWSFYRAVIAEFIAtllflyvtvlt  242
            M KD+E       EF AKDYHDPPP+PL+D  EL KWSFYRAVIAEFIATLLFLY+TVLT
Sbjct  1    MAKDIEV----GGEFQAKDYHDPPPAPLVDAQELAKWSFYRAVIAEFIATLLFLYITVLT  56

Query  243  vIGYKHQTDPKAGGQDCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLAR  422
            VIGYK QTDP  GG+DCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLAR
Sbjct  57   VIGYKTQTDPAKGGEDCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLAR  116

Query  423  KVTLPRAVLYMIAQCLGAICGVGVGEGFPE  512
            KV+L RA+ YM AQCLGAICG G+ + F  
Sbjct  117  KVSLVRAIFYMGAQCLGAICGCGLVKAFQN  146



>gb|AFK35635.1| unknown [Medicago truncatula]
Length=162

 Score =   213 bits (542),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 117/148 (79%), Positives = 128/148 (86%), Gaps = 2/148 (1%)
 Frame = +3

Query  63   MTKDVEAVPEQPAEFSAKDYHDPPPSPLIDFDELTKWSFYRAVIAEFIAtllflyvtvlt  242
            M KDVE    +   FS KDYHDPPP+PLID +ELTKWSFYRA+IAEFIATLLFLYVTVLT
Sbjct  1    MAKDVEV--AERGSFSNKDYHDPPPAPLIDAEELTKWSFYRALIAEFIATLLFLYVTVLT  58

Query  243  vIGYKHQTDPKAGGQDCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLAR  422
            VIGY  QTD KAGG  CGGVGILGIAWAFGGMIF+LVYC AGISGGHINPAVTFGLFLAR
Sbjct  59   VIGYSIQTDVKAGGDACGGVGILGIAWAFGGMIFVLVYCIAGISGGHINPAVTFGLFLAR  118

Query  423  KVTLPRAVLYMIAQCLGAICGVGVGEGF  506
            KV+L RA++YM+AQCLGAI GVG+ + F
Sbjct  119  KVSLIRAIMYMVAQCLGAIAGVGLVKAF  146



>gb|AEC45513.1| plasma membrane intrinsic protein [Hevea brasiliensis]
Length=278

 Score =   217 bits (552),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 118/150 (79%), Positives = 127/150 (85%), Gaps = 1/150 (1%)
 Frame = +3

Query  63   MTKDVEAVPEQPAEFSAKDYHDPPPSPLIDFDELTKWSFYRAVIAEFIAtllflyvtvlt  242
            M KDVE V E P EFSAKDYHDPPP+PLID +EL KWS YRA+IAEFIATLLFLY TVLT
Sbjct  1    MAKDVE-VAENPGEFSAKDYHDPPPAPLIDVEELGKWSLYRALIAEFIATLLFLYNTVLT  59

Query  243  vIGYKHQTDPKAGGQDCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLAR  422
            VIGYK QTDP      CGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVT GLFL R
Sbjct  60   VIGYKSQTDPLKNADVCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTLGLFLGR  119

Query  423  KVTLPRAVLYMIAQCLGAICGVGVGEGFPE  512
            KV+L RA+LYM+AQCLGAICG G+ + F +
Sbjct  120  KVSLIRALLYMVAQCLGAICGCGLVKAFQK  149



>ref|NP_190910.1| aquaporin PIP2-1 [Arabidopsis thaliana]
 ref|NP_001030851.1| aquaporin PIP2-1 [Arabidopsis thaliana]
 sp|P43286.1|PIP21_ARATH RecName: Full=Aquaporin PIP2-1; AltName: Full=Plasma membrane 
intrinsic protein 2-1; Short=AtPIP2;1; AltName: Full=Plasma 
membrane intrinsic protein 2a; Short=PIP2a; Contains: RecName: 
Full=Aquaporin PIP2-1, N-terminally processed [Arabidopsis 
thaliana]
 gb|AAL16195.1|AF428426_1 AT3g53420/F4P12_120 [Arabidopsis thaliana]
 emb|CAA53477.1| plasma membrane intrinsic protein 2a [Arabidopsis thaliana]
 emb|CAB67649.1| plasma membrane intrinsic protein 2a [Arabidopsis thaliana]
 gb|AAK62634.1| AT3g53420/F4P12_120 [Arabidopsis thaliana]
 gb|AAK73268.1| plasma membrane intrinsic protein 2a [Arabidopsis thaliana]
 gb|AAL06973.1| AT3g53420/F4P12_120 [Arabidopsis thaliana]
 gb|AAL62366.1| plasma membrane intrinsic protein 2a [Arabidopsis thaliana]
 gb|AAM65406.1| plasma membrane intrinsic protein 2a [Arabidopsis thaliana]
 gb|AEE79083.1| aquaporin PIP2-1 [Arabidopsis thaliana]
 gb|AEE79084.1| aquaporin PIP2-1 [Arabidopsis thaliana]
Length=287

 Score =   217 bits (553),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 119/148 (80%), Positives = 129/148 (87%), Gaps = 2/148 (1%)
 Frame = +3

Query  63   MTKDVEAVPEQPAEFSAKDYHDPPPSPLIDFDELTKWSFYRAVIAEFIAtllflyvtvlt  242
            M KDVEAVP +   F  +DY DPPP+P ID  EL KWSFYRAVIAEF+ATLLFLY+TVLT
Sbjct  1    MAKDVEAVPGE--GFQTRDYQDPPPAPFIDGAELKKWSFYRAVIAEFVATLLFLYITVLT  58

Query  243  vIGYKHQTDPKAGGQDCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLAR  422
            VIGYK Q+D  AGG DCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLAR
Sbjct  59   VIGYKIQSDTDAGGVDCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLAR  118

Query  423  KVTLPRAVLYMIAQCLGAICGVGVGEGF  506
            KV+LPRA+LY+IAQCLGAICGVG  + F
Sbjct  119  KVSLPRALLYIIAQCLGAICGVGFVKAF  146



>ref|XP_002530280.1| Aquaporin PIP2.1, putative [Ricinus communis]
 gb|EEF32087.1| Aquaporin PIP2.1, putative [Ricinus communis]
Length=287

 Score =   217 bits (553),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 117/150 (78%), Positives = 126/150 (84%), Gaps = 0/150 (0%)
 Frame = +3

Query  63   MTKDVEAVPEQPAEFSAKDYHDPPPSPLIDFDELTKWSFYRAVIAEFIAtllflyvtvlt  242
            M KDVE       EFSAKDYHDPPP+PLID DEL KWSFYRA+IAEFIATLLFLY+TVLT
Sbjct  1    MAKDVEVAEATGGEFSAKDYHDPPPAPLIDVDELGKWSFYRALIAEFIATLLFLYITVLT  60

Query  243  vIGYKHQTDPKAGGQDCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLAR  422
            VIGYK QTDP      CGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFL R
Sbjct  61   VIGYKSQTDPDKNADACGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLGR  120

Query  423  KVTLPRAVLYMIAQCLGAICGVGVGEGFPE  512
            KV+L RA+ YM+AQCLGAICG G+ + F +
Sbjct  121  KVSLIRALGYMVAQCLGAICGCGLVKAFQK  150



>gb|AAB67868.1| plasma membrane major intrinsic protein 1 [Beta vulgaris]
Length=288

 Score =   217 bits (553),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 118/149 (79%), Positives = 130/149 (87%), Gaps = 1/149 (1%)
 Frame = +3

Query  63   MTKDVEAVPEQPA-EFSAKDYHDPPPSPLIDFDELTKWSFYRAVIAEFIAtllflyvtvl  239
            MTKDVEAV EQ   EFS KDYHDPPP+PLID +EL KWSFYRA+IAEF+ATLLFLYVTVL
Sbjct  1    MTKDVEAVSEQQQPEFSTKDYHDPPPAPLIDMEELKKWSFYRAIIAEFVATLLFLYVTVL  60

Query  240  tvIGYKHQTDPKAGGQDCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLA  419
            TVIG+    D + GG++C GVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLA
Sbjct  61   TVIGHFRSADLENGGENCTGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLA  120

Query  420  RKVTLPRAVLYMIAQCLGAICGVGVGEGF  506
            RKV+L RA+ YM+AQCLGAICGVG  + F
Sbjct  121  RKVSLIRALAYMVAQCLGAICGVGFVKAF  149



>ref|XP_010504105.1| PREDICTED: aquaporin PIP2-1-like [Camelina sativa]
 ref|XP_010515832.1| PREDICTED: aquaporin PIP2-1-like [Camelina sativa]
Length=287

 Score =   217 bits (552),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 119/148 (80%), Positives = 128/148 (86%), Gaps = 2/148 (1%)
 Frame = +3

Query  63   MTKDVEAVPEQPAEFSAKDYHDPPPSPLIDFDELTKWSFYRAVIAEFIAtllflyvtvlt  242
            M KDVE VP +   F  +DY DPPP+P  D  EL KWSFYRAVIAEF+ATLLFLY+TVLT
Sbjct  1    MAKDVETVPGE--GFQTRDYQDPPPAPFFDGAELKKWSFYRAVIAEFVATLLFLYITVLT  58

Query  243  vIGYKHQTDPKAGGQDCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLAR  422
            VIGYK Q+D KAGG DCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLAR
Sbjct  59   VIGYKIQSDVKAGGVDCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLAR  118

Query  423  KVTLPRAVLYMIAQCLGAICGVGVGEGF  506
            KV+LPRAVLY+IAQCLGAICGVG  + F
Sbjct  119  KVSLPRAVLYIIAQCLGAICGVGFVKAF  146



>ref|XP_006403691.1| hypothetical protein EUTSA_v10010598mg [Eutrema salsugineum]
 gb|ESQ45144.1| hypothetical protein EUTSA_v10010598mg [Eutrema salsugineum]
Length=287

 Score =   217 bits (552),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 118/148 (80%), Positives = 129/148 (87%), Gaps = 2/148 (1%)
 Frame = +3

Query  63   MTKDVEAVPEQPAEFSAKDYHDPPPSPLIDFDELTKWSFYRAVIAEFIAtllflyvtvlt  242
            M KDVEAVP +   F  +DY DPPP+PL D +ELTKWSFYRAVIAEF+ATLLFLY+TVLT
Sbjct  1    MAKDVEAVPGE--GFQTRDYQDPPPAPLFDPEELTKWSFYRAVIAEFVATLLFLYITVLT  58

Query  243  vIGYKHQTDPKAGGQDCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLAR  422
            VIGYK Q+D  AGG DCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGL LAR
Sbjct  59   VIGYKIQSDTTAGGVDCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLLLAR  118

Query  423  KVTLPRAVLYMIAQCLGAICGVGVGEGF  506
            KV+L RA+LYM+AQCLGAICGVG  + F
Sbjct  119  KVSLVRAILYMVAQCLGAICGVGFVKAF  146



>ref|XP_010264685.1| PREDICTED: aquaporin PIP2-1-like [Nelumbo nucifera]
Length=287

 Score =   217 bits (552),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 119/150 (79%), Positives = 130/150 (87%), Gaps = 2/150 (1%)
 Frame = +3

Query  63   MTKDVEAVPEQPAEFSAKDYHDPPPSPLIDFDELTKWSFYRAVIAEFIAtllflyvtvlt  242
            M KDVE    +   FSAKDYHDPPP+PLID  ELTKWSFYRA+IAEFIATLLFLY+TVLT
Sbjct  1    MGKDVEV--AEHGHFSAKDYHDPPPTPLIDAVELTKWSFYRALIAEFIATLLFLYITVLT  58

Query  243  vIGYKHQTDPKAGGQDCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLAR  422
            VIGY+ QTD    G DC GVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLAR
Sbjct  59   VIGYRSQTDQAHNGGDCEGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLAR  118

Query  423  KVTLPRAVLYMIAQCLGAICGVGVGEGFPE  512
            KV+L RAV+YM+AQCLGAICGVG+ +GF +
Sbjct  119  KVSLIRAVMYMVAQCLGAICGVGLVKGFQK  148



>ref|XP_003540176.1| PREDICTED: aquaporin PIP2-7 [Glycine max]
 gb|KHN11201.1| Aquaporin PIP2-7 [Glycine soja]
Length=287

 Score =   216 bits (551),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 119/151 (79%), Positives = 130/151 (86%), Gaps = 2/151 (1%)
 Frame = +3

Query  63   MTKDVEAVPEQPAEFSAKDYHDPPPSPLIDFDELTKWSFYRAVIAEFIAtllflyvtvlt  242
            M KDVE V EQ  E+SAKDYHDPPP+PLID DELTKWS YRA IAEFIATLLFLY+TVLT
Sbjct  1    MAKDVEQVTEQ-GEYSAKDYHDPPPAPLIDPDELTKWSLYRAAIAEFIATLLFLYITVLT  59

Query  243  vIGYKHQTDPKA-GGQDCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLA  419
            +IGYK Q+D K  G  +C GVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFL 
Sbjct  60   IIGYKRQSDTKIPGNTECDGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLG  119

Query  420  RKVTLPRAVLYMIAQCLGAICGVGVGEGFPE  512
            RKV+L RA+LYMIAQC GAICG G+ +GF +
Sbjct  120  RKVSLVRALLYMIAQCAGAICGAGLAKGFQK  150



>ref|NP_001237286.1| PIP2,2 [Glycine max]
 gb|AAX86046.1| PIP2,2 [Glycine max]
Length=287

 Score =   216 bits (551),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 119/151 (79%), Positives = 130/151 (86%), Gaps = 2/151 (1%)
 Frame = +3

Query  63   MTKDVEAVPEQPAEFSAKDYHDPPPSPLIDFDELTKWSFYRAVIAEFIAtllflyvtvlt  242
            M KDVE V EQ  E+SAKDYHDPPP+PLID DELTKWS YRA IAEFIATLLFLY+TVLT
Sbjct  1    MAKDVEQVTEQ-GEYSAKDYHDPPPAPLIDPDELTKWSLYRAAIAEFIATLLFLYITVLT  59

Query  243  vIGYKHQTDPKA-GGQDCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLA  419
            +IGYK Q+D K  G  +C GVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFL 
Sbjct  60   IIGYKRQSDTKIPGNTECDGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLG  119

Query  420  RKVTLPRAVLYMIAQCLGAICGVGVGEGFPE  512
            RKV+L RA+LYMIAQC GAICG G+ +GF +
Sbjct  120  RKVSLVRALLYMIAQCAGAICGAGLAKGFQK  150



>gb|ACU19125.1| unknown [Glycine max]
Length=287

 Score =   216 bits (551),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 119/151 (79%), Positives = 130/151 (86%), Gaps = 2/151 (1%)
 Frame = +3

Query  63   MTKDVEAVPEQPAEFSAKDYHDPPPSPLIDFDELTKWSFYRAVIAEFIAtllflyvtvlt  242
            M KDVE V EQ  E+SAKDYHDPPP+PLID DELTKWS YRA IAEFIATLLFLY+TVLT
Sbjct  1    MAKDVEQVTEQ-GEYSAKDYHDPPPAPLIDPDELTKWSLYRAAIAEFIATLLFLYITVLT  59

Query  243  vIGYKHQTDPKA-GGQDCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLA  419
            +IGYK Q+D K  G  +C GVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFL 
Sbjct  60   IIGYKRQSDTKIPGNTECDGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLG  119

Query  420  RKVTLPRAVLYMIAQCLGAICGVGVGEGFPE  512
            RKV+L RA+LYMIAQC GAICG G+ +GF +
Sbjct  120  RKVSLVRALLYMIAQCAGAICGAGLAKGFQK  150



>ref|XP_009628968.1| PREDICTED: probable aquaporin PIP2-1 [Nicotiana tomentosiformis]
 tpg|DAA64679.1| TPA_exp: aquaporin PIP2 5 [Nicotiana tabacum]
Length=283

 Score =   216 bits (551),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 119/148 (80%), Positives = 129/148 (87%), Gaps = 4/148 (3%)
 Frame = +3

Query  63   MTKDVEAVPEQPAEFSAKDYHDPPPSPLIDFDELTKWSFYRAVIAEFIAtllflyvtvlt  242
            M KDVEA      EFSAKDY DPPP+PLIDF+EL +WSFYRA IAEFIATLLFLYVTVLT
Sbjct  1    MGKDVEAA----TEFSAKDYTDPPPAPLIDFEELKQWSFYRAAIAEFIATLLFLYVTVLT  56

Query  243  vIGYKHQTDPKAGGQDCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLAR  422
            VIGYKHQ+D  A G  CGGVGILGIAWAFGGMIF+LVYCTAGISGGHINPAVTFGLFLAR
Sbjct  57   VIGYKHQSDVDANGDVCGGVGILGIAWAFGGMIFVLVYCTAGISGGHINPAVTFGLFLAR  116

Query  423  KVTLPRAVLYMIAQCLGAICGVGVGEGF  506
            KV+L RA++YM+AQCLGAICGVG  + F
Sbjct  117  KVSLIRALVYMVAQCLGAICGVGFVKAF  144



>ref|NP_001105639.1| aquaporin PIP2-7 [Zea mays]
 sp|Q9ATM4.1|PIP27_MAIZE RecName: Full=Aquaporin PIP2-7; AltName: Full=Plasma membrane 
intrinsic protein 2-7; AltName: Full=ZmPIP2-7; AltName: Full=ZmPIP2;7 
[Zea mays]
 gb|AAK26763.1| plasma membrane integral protein ZmPIP2-7 [Zea mays]
 gb|ACU23788.1| unknown [Glycine max]
 gb|KHN21518.1| Aquaporin PIP2-7 [Glycine soja]
Length=287

 Score =   216 bits (551),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 119/151 (79%), Positives = 130/151 (86%), Gaps = 2/151 (1%)
 Frame = +3

Query  63   MTKDVEAVPEQPAEFSAKDYHDPPPSPLIDFDELTKWSFYRAVIAEFIAtllflyvtvlt  242
            M KDVE V EQ  E+SAKDYHDPPP+PLID DELTKWS YRA IAEFIATLLFLY+TVLT
Sbjct  1    MAKDVEQVTEQ-GEYSAKDYHDPPPAPLIDPDELTKWSLYRAAIAEFIATLLFLYITVLT  59

Query  243  vIGYKHQTDPKA-GGQDCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLA  419
            +IGYK Q+D K  G  +C GVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFL 
Sbjct  60   IIGYKRQSDTKIPGNTECDGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLG  119

Query  420  RKVTLPRAVLYMIAQCLGAICGVGVGEGFPE  512
            RKV+L RA+LYMIAQC GAICG G+ +GF +
Sbjct  120  RKVSLVRALLYMIAQCAGAICGAGLAKGFQK  150



>ref|XP_010920405.1| PREDICTED: aquaporin PIP2-4 isoform X1 [Elaeis guineensis]
Length=285

 Score =   216 bits (550),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 118/152 (78%), Positives = 131/152 (86%), Gaps = 6/152 (4%)
 Frame = +3

Query  63   MTKDVEAVPEQPAEFSAKDYHDPPPSPLIDFDELTKWSFYRAVIAEFIAtllflyvtvlt  242
            M KD+EA     AEF+AKDY DPPP+PL+D +ELTKWS YRAVIAEFIATLLFLY+TV T
Sbjct  1    MRKDMEA----GAEFTAKDYTDPPPAPLVDAEELTKWSLYRAVIAEFIATLLFLYITVAT  56

Query  243  vIGYKHQTDPKAGGQD--CGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFL  416
            VIGYKHQ+DP   G D  C GVGILGIAWAFGGMIF+LVYCTAGISGGHINPAVTFGLFL
Sbjct  57   VIGYKHQSDPNVSGPDAACNGVGILGIAWAFGGMIFVLVYCTAGISGGHINPAVTFGLFL  116

Query  417  ARKVTLPRAVLYMIAQCLGAICGVGVGEGFPE  512
            ARKV+L RA+LYMIAQCLGAICGVG+ + F +
Sbjct  117  ARKVSLIRALLYMIAQCLGAICGVGLVKAFQK  148



>emb|CAA53478.1| plasma membrane intrinsic protein 2b [Arabidopsis thaliana]
Length=285

 Score =   216 bits (550),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 118/148 (80%), Positives = 126/148 (85%), Gaps = 4/148 (3%)
 Frame = +3

Query  63   MTKDVEAVPEQPAEFSAKDYHDPPPSPLIDFDELTKWSFYRAVIAEFIAtllflyvtvlt  242
            M KDVE     P  F  +DY DPPP+P  D DELTKWS YRAVIAEF+ATLLFLY+TVLT
Sbjct  1    MAKDVEG----PEGFQTRDYEDPPPTPFFDADELTKWSLYRAVIAEFVATLLFLYITVLT  56

Query  243  vIGYKHQTDPKAGGQDCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLAR  422
            VIGYK Q+D KAGG DCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLAR
Sbjct  57   VIGYKIQSDTKAGGVDCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLAR  116

Query  423  KVTLPRAVLYMIAQCLGAICGVGVGEGF  506
            KV+L RAVLYM+AQCLGAICGVG  + F
Sbjct  117  KVSLIRAVLYMVAQCLGAICGVGFRQSF  144



>ref|XP_010934344.1| PREDICTED: aquaporin PIP2-4-like [Elaeis guineensis]
Length=282

 Score =   216 bits (550),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 120/152 (79%), Positives = 130/152 (86%), Gaps = 8/152 (5%)
 Frame = +3

Query  63   MTKDVEAVPEQPAEFSAKDYHDPPPSPLIDFDELTKWSFYRAVIAEFIAtllflyvtvlt  242
            M KDVEA      EF+AKDY DPPP+PLID +EL KWS YRAVIAEFIATLLFLY+TV T
Sbjct  1    MGKDVEA------EFTAKDYTDPPPAPLIDAEELAKWSLYRAVIAEFIATLLFLYITVAT  54

Query  243  vIGYKHQTDPKAGGQD--CGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFL  416
            VIGYKHQ+DP  GG D  C GVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFL
Sbjct  55   VIGYKHQSDPNVGGADAACSGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFL  114

Query  417  ARKVTLPRAVLYMIAQCLGAICGVGVGEGFPE  512
            ARKV+L RA+LYMIAQCLGAICGVG+ + F +
Sbjct  115  ARKVSLIRALLYMIAQCLGAICGVGLVKSFQK  146



>gb|AAO39007.1| plasma intrinsic protein 2,1 [Juglans regia]
Length=287

 Score =   216 bits (550),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 116/150 (77%), Positives = 129/150 (86%), Gaps = 2/150 (1%)
 Frame = +3

Query  63   MTKDVEAVPEQPAEFSAKDYHDPPPSPLIDFDELTKWSFYRAVIAEFIAtllflyvtvlt  242
            M KD+EA  +    FSAKDYHDPPP+PLID +E T+WSFYRA+IAEFIATLLFLY+TVLT
Sbjct  1    MAKDIEAAGQ--GGFSAKDYHDPPPAPLIDAEEFTQWSFYRAIIAEFIATLLFLYITVLT  58

Query  243  vIGYKHQTDPKAGGQDCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLAR  422
            VIGYK QTD   GG DCGGVGILGIAWAFGGMIF+LVYCTAGISGGHINPAVTFGLFLAR
Sbjct  59   VIGYKSQTDKAKGGDDCGGVGILGIAWAFGGMIFVLVYCTAGISGGHINPAVTFGLFLAR  118

Query  423  KVTLPRAVLYMIAQCLGAICGVGVGEGFPE  512
            KV+L RAV YM AQCLGA+CG G+ + F +
Sbjct  119  KVSLVRAVFYMAAQCLGAVCGCGLVKAFQK  148



>gb|AAO39008.1| plasma intrinsic protein 2,2 [Juglans regia]
Length=287

 Score =   216 bits (550),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 116/150 (77%), Positives = 129/150 (86%), Gaps = 2/150 (1%)
 Frame = +3

Query  63   MTKDVEAVPEQPAEFSAKDYHDPPPSPLIDFDELTKWSFYRAVIAEFIAtllflyvtvlt  242
            M KD+EA  +    FSAKDYHDPPP+PLID +E T+WSFYRA+IAEFIATLLFLY+TVLT
Sbjct  1    MAKDIEAAGQ--GGFSAKDYHDPPPAPLIDAEEFTQWSFYRAIIAEFIATLLFLYITVLT  58

Query  243  vIGYKHQTDPKAGGQDCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLAR  422
            VIGYK QTD   GG DCGGVGILGIAWAFGGMIF+LVYCTAGISGGHINPAVTFGLFLAR
Sbjct  59   VIGYKSQTDKAKGGDDCGGVGILGIAWAFGGMIFVLVYCTAGISGGHINPAVTFGLFLAR  118

Query  423  KVTLPRAVLYMIAQCLGAICGVGVGEGFPE  512
            KV+L RAV YM AQCLGA+CG G+ + F +
Sbjct  119  KVSLVRAVFYMAAQCLGAVCGCGLVKAFQK  148



>ref|XP_009794928.1| PREDICTED: LOW QUALITY PROTEIN: probable aquaporin PIP2-1 [Nicotiana 
sylvestris]
Length=282

 Score =   216 bits (549),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 118/148 (80%), Positives = 128/148 (86%), Gaps = 4/148 (3%)
 Frame = +3

Query  63   MTKDVEAVPEQPAEFSAKDYHDPPPSPLIDFDELTKWSFYRAVIAEFIAtllflyvtvlt  242
            M KDVEA      EFSAKDY DPPP+PLIDF+EL +WSFYRA IAEFIATLLFLYVTV T
Sbjct  1    MGKDVEAA----TEFSAKDYTDPPPAPLIDFEELKQWSFYRAAIAEFIATLLFLYVTVFT  56

Query  243  vIGYKHQTDPKAGGQDCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLAR  422
            VIGYKHQ+D  A G  CGGVGILGIAWAFGGMIF+LVYCTAGISGGHINPAVTFGLFLAR
Sbjct  57   VIGYKHQSDVDANGDVCGGVGILGIAWAFGGMIFVLVYCTAGISGGHINPAVTFGLFLAR  116

Query  423  KVTLPRAVLYMIAQCLGAICGVGVGEGF  506
            KV+L RA++YM+AQCLGAICGVG  + F
Sbjct  117  KVSLIRALVYMVAQCLGAICGVGFVKAF  144



>gb|ACU00104.1| plasma membrane intrinsic protein PIP2.2 [Populus trichocarpa 
x Populus deltoides]
Length=285

 Score =   216 bits (549),  Expect = 4e-66, Method: Compositional matrix adjust.
 Identities = 115/150 (77%), Positives = 130/150 (87%), Gaps = 4/150 (3%)
 Frame = +3

Query  63   MTKDVEAVPEQPAEFSAKDYHDPPPSPLIDFDELTKWSFYRAVIAEFIAtllflyvtvlt  242
            M KD+E       EFSAKDYHDPPP+PLID +E+T+WSFYRA+IAEF+ATLLFLY+TVLT
Sbjct  1    MGKDIEV----GGEFSAKDYHDPPPAPLIDAEEITQWSFYRAIIAEFVATLLFLYITVLT  56

Query  243  vIGYKHQTDPKAGGQDCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLAR  422
            VIGYK QTD    G +CGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLAR
Sbjct  57   VIGYKSQTDVNKNGDECGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLAR  116

Query  423  KVTLPRAVLYMIAQCLGAICGVGVGEGFPE  512
            KV+L RA+LYM+AQCLGAICG G+ + F +
Sbjct  117  KVSLVRAILYMVAQCLGAICGCGLVKAFQK  146



>gb|KHG30776.1| Aquaporin PIP2-2 -like protein [Gossypium arboreum]
Length=285

 Score =   216 bits (549),  Expect = 4e-66, Method: Compositional matrix adjust.
 Identities = 117/150 (78%), Positives = 127/150 (85%), Gaps = 4/150 (3%)
 Frame = +3

Query  63   MTKDVEAVPEQPAEFSAKDYHDPPPSPLIDFDELTKWSFYRAVIAEFIAtllflyvtvlt  242
            M KDVE       EF AKDYHDPPP+PL+D  ELT+WSFYRA+IAEFIATLLFLY+TVLT
Sbjct  1    MAKDVEV----GGEFQAKDYHDPPPAPLVDAQELTQWSFYRAIIAEFIATLLFLYITVLT  56

Query  243  vIGYKHQTDPKAGGQDCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLAR  422
            VIGYK Q DP  G QDC GVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLAR
Sbjct  57   VIGYKSQVDPDKGSQDCDGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLAR  116

Query  423  KVTLPRAVLYMIAQCLGAICGVGVGEGFPE  512
            KV+L RA+LYM AQCLGAICG G+ + F +
Sbjct  117  KVSLVRAILYMAAQCLGAICGCGLVKAFQK  146



>ref|NP_001234625.1| aquaporin [Solanum lycopersicum]
 gb|ADU34070.1| aquaporin [Solanum lycopersicum]
 dbj|BAO18627.1| plasmamembrane intrinsic protein 2;4 [Solanum lycopersicum]
Length=280

 Score =   215 bits (548),  Expect = 4e-66, Method: Compositional matrix adjust.
 Identities = 118/148 (80%), Positives = 129/148 (87%), Gaps = 7/148 (5%)
 Frame = +3

Query  63   MTKDVEAVPEQPAEFSAKDYHDPPPSPLIDFDELTKWSFYRAVIAEFIAtllflyvtvlt  242
            MTK+V        +FSAKDY DPPP+PL+DF+EL +WSFYRA+IAEFIATLLFLYVT+LT
Sbjct  1    MTKEVT-------DFSAKDYTDPPPAPLVDFEELRQWSFYRAIIAEFIATLLFLYVTILT  53

Query  243  vIGYKHQTDPKAGGQDCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLAR  422
            VIGYKHQ D  AGG  CGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLAR
Sbjct  54   VIGYKHQADVDAGGDVCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLAR  113

Query  423  KVTLPRAVLYMIAQCLGAICGVGVGEGF  506
            KV+L RAVLYM+AQCLGAICGVG  + F
Sbjct  114  KVSLIRAVLYMVAQCLGAICGVGFVKAF  141



>emb|CDY56697.1| BnaCnng31040D [Brassica napus]
Length=287

 Score =   216 bits (549),  Expect = 5e-66, Method: Compositional matrix adjust.
 Identities = 118/148 (80%), Positives = 128/148 (86%), Gaps = 2/148 (1%)
 Frame = +3

Query  63   MTKDVEAVPEQPAEFSAKDYHDPPPSPLIDFDELTKWSFYRAVIAEFIAtllflyvtvlt  242
            M KDVEAV  +   F  +DY DPPP+PL D +ELTKWSFYRAVIAEF+ATLLFLY+TVLT
Sbjct  1    MAKDVEAVSGE--GFQTRDYQDPPPAPLFDPEELTKWSFYRAVIAEFVATLLFLYITVLT  58

Query  243  vIGYKHQTDPKAGGQDCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLAR  422
            VIGYK QTD  AGG DCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGL LAR
Sbjct  59   VIGYKIQTDSTAGGVDCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLLLAR  118

Query  423  KVTLPRAVLYMIAQCLGAICGVGVGEGF  506
            KV+L RA+LYM+AQCLGAICGVG  + F
Sbjct  119  KVSLVRAILYMVAQCLGAICGVGFVKAF  146



>gb|EYU42155.1| hypothetical protein MIMGU_mgv1a011301mg [Erythranthe guttata]
Length=286

 Score =   215 bits (548),  Expect = 5e-66, Method: Compositional matrix adjust.
 Identities = 120/150 (80%), Positives = 130/150 (87%), Gaps = 1/150 (1%)
 Frame = +3

Query  63   MTKDVEAVPEQPAEFSAKDYHDPPPSPLIDFDELTKWSFYRAVIAEFIAtllflyvtvlt  242
            M KDVE   + PA FSAKDYHDPPP+PL D  ELT+WSFYRA+IAEFIATLLFLYVTVLT
Sbjct  1    MAKDVECA-DPPAGFSAKDYHDPPPAPLFDCGELTQWSFYRALIAEFIATLLFLYVTVLT  59

Query  243  vIGYKHQTDPKAGGQDCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLAR  422
            VIGYK Q+D   GG  CGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFL R
Sbjct  60   VIGYKVQSDAVHGGDQCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLGR  119

Query  423  KVTLPRAVLYMIAQCLGAICGVGVGEGFPE  512
            KV+L RAVLYM+AQCLGAICGVG+ + F +
Sbjct  120  KVSLIRAVLYMVAQCLGAICGVGLVKAFQK  149



>tpg|DAA33865.1| TPA_inf: aquaporin PIP2;10 [Gossypium hirsutum]
Length=271

 Score =   215 bits (547),  Expect = 5e-66, Method: Compositional matrix adjust.
 Identities = 120/154 (78%), Positives = 130/154 (84%), Gaps = 4/154 (3%)
 Frame = +3

Query  63   MTKDVEAVPEQP--AEFSAKDYHDPPPSPLIDFDELTKWSFYRAVIAEFIAtllflyvtv  236
            MTKD+E   EQ   AEFSAKDY DPPP+PLID +ELTKWS YRA IAEFIATLLFLYVTV
Sbjct  1    MTKDIETTAEQGGGAEFSAKDYQDPPPAPLIDLEELTKWSLYRAAIAEFIATLLFLYVTV  60

Query  237  ltvIGYKHQTDP--KAGGQDCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGL  410
            LTVIGYK QTDP       DCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGL
Sbjct  61   LTVIGYKVQTDPVKNTVDPDCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGL  120

Query  411  FLARKVTLPRAVLYMIAQCLGAICGVGVGEGFPE  512
            F+ RKV+L RA+LYM+AQCLGAICG G+ + F +
Sbjct  121  FVGRKVSLIRALLYMVAQCLGAICGCGLVKAFQK  154



>ref|XP_002322877.1| major intrinsic protein 1 [Populus trichocarpa]
 gb|ABK93143.1| unknown [Populus trichocarpa]
 gb|ABK94547.1| unknown [Populus trichocarpa]
 gb|EEF04638.1| major intrinsic protein 1 [Populus trichocarpa]
Length=285

 Score =   215 bits (548),  Expect = 5e-66, Method: Compositional matrix adjust.
 Identities = 115/150 (77%), Positives = 130/150 (87%), Gaps = 4/150 (3%)
 Frame = +3

Query  63   MTKDVEAVPEQPAEFSAKDYHDPPPSPLIDFDELTKWSFYRAVIAEFIAtllflyvtvlt  242
            M KD+E       EFSAKDYHDPPP+PLID +E+T+WSFYRA+IAEF+ATLLFLY+TVLT
Sbjct  1    MGKDIEV----GGEFSAKDYHDPPPAPLIDAEEITQWSFYRAIIAEFVATLLFLYITVLT  56

Query  243  vIGYKHQTDPKAGGQDCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLAR  422
            VIGYK QTD    G +CGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLAR
Sbjct  57   VIGYKSQTDVNKNGDECGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLAR  116

Query  423  KVTLPRAVLYMIAQCLGAICGVGVGEGFPE  512
            KV+L RA+LYM+AQCLGAICG G+ + F +
Sbjct  117  KVSLVRAILYMVAQCLGAICGCGLVKAFQK  146



>ref|NP_181254.1| aquaporin PIP2-2 [Arabidopsis thaliana]
 sp|P43287.2|PIP22_ARATH RecName: Full=Aquaporin PIP2-2; AltName: Full=Plasma membrane 
intrinsic protein 2-2; Short=AtPIP2;2; AltName: Full=Plasma 
membrane intrinsic protein 2b; Short=PIP2b; AltName: Full=TMP2b; 
Contains: RecName: Full=Aquaporin PIP2-2, N-terminally 
processed [Arabidopsis thaliana]
 gb|AAD18142.1| aquaporin (plasma membrane intrinsic protein 2B) [Arabidopsis 
thaliana]
 gb|AEC09362.1| aquaporin PIP2-2 [Arabidopsis thaliana]
Length=285

 Score =   215 bits (548),  Expect = 6e-66, Method: Compositional matrix adjust.
 Identities = 118/148 (80%), Positives = 126/148 (85%), Gaps = 4/148 (3%)
 Frame = +3

Query  63   MTKDVEAVPEQPAEFSAKDYHDPPPSPLIDFDELTKWSFYRAVIAEFIAtllflyvtvlt  242
            M KDVE     P  F  +DY DPPP+P  D DELTKWS YRAVIAEF+ATLLFLY+TVLT
Sbjct  1    MAKDVEG----PEGFQTRDYEDPPPTPFFDADELTKWSLYRAVIAEFVATLLFLYITVLT  56

Query  243  vIGYKHQTDPKAGGQDCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLAR  422
            VIGYK Q+D KAGG DCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLAR
Sbjct  57   VIGYKIQSDTKAGGVDCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLAR  116

Query  423  KVTLPRAVLYMIAQCLGAICGVGVGEGF  506
            KV+L RAVLYM+AQCLGAICGVG  + F
Sbjct  117  KVSLIRAVLYMVAQCLGAICGVGFVKAF  144



>ref|NP_001240039.1| uncharacterized protein LOC100782155 [Glycine max]
 gb|ACU23140.1| unknown [Glycine max]
 gb|KHN32778.1| Aquaporin PIP2-2 [Glycine soja]
Length=285

 Score =   215 bits (548),  Expect = 6e-66, Method: Compositional matrix adjust.
 Identities = 113/137 (82%), Positives = 127/137 (93%), Gaps = 0/137 (0%)
 Frame = +3

Query  102  EFSAKDYHDPPPSPLIDFDELTKWSFYRAVIAEFIAtllflyvtvltvIGYKHQTDPKAG  281
             FSAKDYHDPPP+PLID +ELT+WSFYRA+IAEFIAT+LFLY+TVLTVIGYK Q+D KAG
Sbjct  10   SFSAKDYHDPPPAPLIDAEELTQWSFYRALIAEFIATMLFLYITVLTVIGYKSQSDVKAG  69

Query  282  GQDCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARKVTLPRAVLYMIA  461
            G  CGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARKV+L RA++YM+A
Sbjct  70   GDVCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARKVSLIRAIMYMVA  129

Query  462  QCLGAICGVGVGEGFPE  512
            QCLGAICGVG+ + F +
Sbjct  130  QCLGAICGVGLVKAFQK  146



>gb|KHN00691.1| Aquaporin PIP2-2 [Glycine soja]
Length=285

 Score =   215 bits (547),  Expect = 7e-66, Method: Compositional matrix adjust.
 Identities = 114/137 (83%), Positives = 127/137 (93%), Gaps = 0/137 (0%)
 Frame = +3

Query  102  EFSAKDYHDPPPSPLIDFDELTKWSFYRAVIAEFIAtllflyvtvltvIGYKHQTDPKAG  281
             FSAKDYHDPPP+PLID +ELT+WSFYRA+IAEFIATLLFLY+TVLTVIGYK Q+D KAG
Sbjct  10   SFSAKDYHDPPPAPLIDAEELTQWSFYRALIAEFIATLLFLYITVLTVIGYKSQSDVKAG  69

Query  282  GQDCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARKVTLPRAVLYMIA  461
            G  CGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARKV+L RA++YM+A
Sbjct  70   GDVCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARKVSLIRAIMYMVA  129

Query  462  QCLGAICGVGVGEGFPE  512
            QCLGAICGVG+ + F +
Sbjct  130  QCLGAICGVGLVKAFQK  146



>gb|KDP44053.1| hypothetical protein JCGZ_05520 [Jatropha curcas]
Length=286

 Score =   215 bits (547),  Expect = 8e-66, Method: Compositional matrix adjust.
 Identities = 118/150 (79%), Positives = 127/150 (85%), Gaps = 1/150 (1%)
 Frame = +3

Query  63   MTKDVEAVPEQPAEFSAKDYHDPPPSPLIDFDELTKWSFYRAVIAEFIAtllflyvtvlt  242
            M KDVE V E   EFS KDYHDPPP+PLID DEL +WSFYRA+IAEFIATLLFLY+TVLT
Sbjct  1    MAKDVE-VAEPTGEFSGKDYHDPPPAPLIDMDELGQWSFYRALIAEFIATLLFLYITVLT  59

Query  243  vIGYKHQTDPKAGGQDCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLAR  422
            VIGYK QTDP      CGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFL R
Sbjct  60   VIGYKSQTDPNKNADACGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLGR  119

Query  423  KVTLPRAVLYMIAQCLGAICGVGVGEGFPE  512
            KV+L RA+ YMIAQCLGAICG G+ + F +
Sbjct  120  KVSLIRALGYMIAQCLGAICGCGLVKAFQK  149



>ref|XP_004976254.1| PREDICTED: aquaporin PIP2-5-like [Setaria italica]
Length=290

 Score =   215 bits (548),  Expect = 8e-66, Method: Compositional matrix adjust.
 Identities = 116/151 (77%), Positives = 131/151 (87%), Gaps = 3/151 (2%)
 Frame = +3

Query  63   MTKDVEAVPE-QPAEFSAKDYHDPPPSPLIDFDELTKWSFYRAVIAEFIAtllflyvtvl  239
            M KD+EA    +  E++AKDY DPPP+PLID +ELTKWS YRAVIAEF+ATLLFLY+TV 
Sbjct  1    MAKDIEAAAAPEGGEYTAKDYSDPPPAPLIDAEELTKWSLYRAVIAEFVATLLFLYITVA  60

Query  240  tvIGYKHQTDPKAGGQD--CGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLF  413
            TVIGYKHQTD  A G D  CGGVGILGIAWAFGGMIFILVYCTAG+SGGHINPAVT GLF
Sbjct  61   TVIGYKHQTDAAASGPDAACGGVGILGIAWAFGGMIFILVYCTAGVSGGHINPAVTLGLF  120

Query  414  LARKVTLPRAVLYMIAQCLGAICGVGVGEGF  506
            LARKV+L RA+LY++AQCLGAICGVG+ +GF
Sbjct  121  LARKVSLVRALLYIVAQCLGAICGVGLVKGF  151



>ref|XP_007151871.1| hypothetical protein PHAVU_004G082600g [Phaseolus vulgaris]
 gb|ESW23865.1| hypothetical protein PHAVU_004G082600g [Phaseolus vulgaris]
Length=285

 Score =   215 bits (547),  Expect = 8e-66, Method: Compositional matrix adjust.
 Identities = 114/137 (83%), Positives = 126/137 (92%), Gaps = 0/137 (0%)
 Frame = +3

Query  102  EFSAKDYHDPPPSPLIDFDELTKWSFYRAVIAEFIAtllflyvtvltvIGYKHQTDPKAG  281
             FSAKDYHDPPP+PLID  ELT+WSFYRA+IAEFIATLLFLY+TVLTVIGYK Q+D KAG
Sbjct  10   SFSAKDYHDPPPAPLIDAQELTQWSFYRALIAEFIATLLFLYITVLTVIGYKSQSDAKAG  69

Query  282  GQDCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARKVTLPRAVLYMIA  461
            G  CGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARKV+L RA++YM+A
Sbjct  70   GDLCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARKVSLIRAIMYMVA  129

Query  462  QCLGAICGVGVGEGFPE  512
            QCLGAICGVG+ + F +
Sbjct  130  QCLGAICGVGLVKAFQK  146



>ref|NP_001235204.1| Pip1 protein [Glycine max]
 gb|AAA69490.1| putative water channel protein; plasmalemma intrinsic protein; 
similar to Arabidopsis Pip2a gene product, PIR Accession Number 
S44084 [Glycine max]
Length=285

 Score =   215 bits (547),  Expect = 9e-66, Method: Compositional matrix adjust.
 Identities = 114/137 (83%), Positives = 127/137 (93%), Gaps = 0/137 (0%)
 Frame = +3

Query  102  EFSAKDYHDPPPSPLIDFDELTKWSFYRAVIAEFIAtllflyvtvltvIGYKHQTDPKAG  281
             FSAKDYHDPPP+PLID +ELT+WSFYRA+IAEFIATLLFLY+TVLTVIGYK Q+D KAG
Sbjct  10   SFSAKDYHDPPPAPLIDAEELTQWSFYRALIAEFIATLLFLYITVLTVIGYKSQSDVKAG  69

Query  282  GQDCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARKVTLPRAVLYMIA  461
            G  CGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARKV+L RA++YM+A
Sbjct  70   GDVCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARKVSLIRAIMYMVA  129

Query  462  QCLGAICGVGVGEGFPE  512
            QCLGAICGVG+ + F +
Sbjct  130  QCLGAICGVGLVKAFQK  146



>gb|AFK47442.1| unknown [Medicago truncatula]
Length=287

 Score =   215 bits (547),  Expect = 9e-66, Method: Compositional matrix adjust.
 Identities = 118/148 (80%), Positives = 129/148 (87%), Gaps = 2/148 (1%)
 Frame = +3

Query  63   MTKDVEAVPEQPAEFSAKDYHDPPPSPLIDFDELTKWSFYRAVIAEFIAtllflyvtvlt  242
            M KDVE    +   FS KDYHDPPP+PLID +ELTKWSFYRA+IAEFIATLLFLYVTVLT
Sbjct  1    MAKDVEV--AERGSFSNKDYHDPPPAPLIDAEELTKWSFYRALIAEFIATLLFLYVTVLT  58

Query  243  vIGYKHQTDPKAGGQDCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLAR  422
            VIGY  QTD KAGG  CGGVGILGIAWAFGGMIF+LVYCTAGISGGHINPAVTFGLFLAR
Sbjct  59   VIGYSIQTDVKAGGDACGGVGILGIAWAFGGMIFVLVYCTAGISGGHINPAVTFGLFLAR  118

Query  423  KVTLPRAVLYMIAQCLGAICGVGVGEGF  506
            KV+L RA++YM+AQCLGAI GVG+ + F
Sbjct  119  KVSLIRAIMYMVAQCLGAIAGVGLVKAF  146



>gb|KHG10662.1| Aquaporin PIP2-1 -like protein [Gossypium arboreum]
 gb|KJB36605.1| hypothetical protein B456_006G166800 [Gossypium raimondii]
 gb|KJB36607.1| hypothetical protein B456_006G166800 [Gossypium raimondii]
Length=285

 Score =   215 bits (547),  Expect = 9e-66, Method: Compositional matrix adjust.
 Identities = 117/150 (78%), Positives = 127/150 (85%), Gaps = 4/150 (3%)
 Frame = +3

Query  63   MTKDVEAVPEQPAEFSAKDYHDPPPSPLIDFDELTKWSFYRAVIAEFIAtllflyvtvlt  242
            M KDVE       EF AKDYHDPPP+PL+D +ELTKWSFYRAVIAEFIATLLFLY+TVLT
Sbjct  1    MAKDVEV----GGEFQAKDYHDPPPAPLVDGEELTKWSFYRAVIAEFIATLLFLYITVLT  56

Query  243  vIGYKHQTDPKAGGQDCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLAR  422
            VIGYK Q DP  G  +CGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLAR
Sbjct  57   VIGYKSQVDPDKGSDECGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLAR  116

Query  423  KVTLPRAVLYMIAQCLGAICGVGVGEGFPE  512
            KV+L RA+ YM AQCLGAICG G+ + F +
Sbjct  117  KVSLVRAIFYMAAQCLGAICGCGLVKAFQK  146



>gb|KDP44363.1| hypothetical protein JCGZ_20043 [Jatropha curcas]
Length=285

 Score =   215 bits (547),  Expect = 9e-66, Method: Compositional matrix adjust.
 Identities = 117/148 (79%), Positives = 127/148 (86%), Gaps = 4/148 (3%)
 Frame = +3

Query  63   MTKDVEAVPEQPAEFSAKDYHDPPPSPLIDFDELTKWSFYRAVIAEFIAtllflyvtvlt  242
            M KDV     +   FSAKDYHDPPP+PLID +ELTKWSFYRA+IAEFIATLLFLY+TVLT
Sbjct  1    MVKDVA----EQGSFSAKDYHDPPPAPLIDAEELTKWSFYRALIAEFIATLLFLYITVLT  56

Query  243  vIGYKHQTDPKAGGQDCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLAR  422
            VIGYK QTDP      CGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLAR
Sbjct  57   VIGYKSQTDPAKNADSCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLAR  116

Query  423  KVTLPRAVLYMIAQCLGAICGVGVGEGF  506
            KV+L RAV+YM+AQ LGAICGVG+ + F
Sbjct  117  KVSLVRAVMYMVAQSLGAICGVGLVKAF  144



>ref|NP_001289999.1| aquaporin PIP2-1 [Beta vulgaris subsp. vulgaris]
 gb|ACT22630.1| plasma membrane intrinsic protein PIP2;2 [Beta vulgaris subsp. 
vulgaris]
Length=288

 Score =   215 bits (547),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 117/149 (79%), Positives = 129/149 (87%), Gaps = 1/149 (1%)
 Frame = +3

Query  63   MTKDVEAVPEQPA-EFSAKDYHDPPPSPLIDFDELTKWSFYRAVIAEFIAtllflyvtvl  239
            MTKDVEAV EQ   EFS KDYHDPPP+PLID +EL KWSFYRA+IAEF+ATLLFLYVTVL
Sbjct  1    MTKDVEAVSEQQQPEFSTKDYHDPPPAPLIDMEELKKWSFYRAIIAEFVATLLFLYVTVL  60

Query  240  tvIGYKHQTDPKAGGQDCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLA  419
            TVIG+    D + GG++C GVGILGIAWAFGGMIFILVYCTAGISGGHINPAVT GLFLA
Sbjct  61   TVIGHFRSADLENGGENCTGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTIGLFLA  120

Query  420  RKVTLPRAVLYMIAQCLGAICGVGVGEGF  506
            RKV+L RA+ YM+AQCLGAICGVG  + F
Sbjct  121  RKVSLIRALAYMVAQCLGAICGVGFVKAF  149



>ref|XP_008791536.1| PREDICTED: aquaporin PIP2-4-like [Phoenix dactylifera]
Length=288

 Score =   215 bits (547),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 118/152 (78%), Positives = 130/152 (86%), Gaps = 5/152 (3%)
 Frame = +3

Query  63   MTKDVEAVPEQPAEFSAKDYHDPPPSPLIDFDELTKWSFYRAVIAEFIAtllflyvtvlt  242
            M KD+EA     A F+AKDY DPPP+PLID +ELTKWS YRAVIAEF+ATLLFLY+TV T
Sbjct  1    MGKDMEA---GAAGFTAKDYTDPPPAPLIDAEELTKWSLYRAVIAEFVATLLFLYITVAT  57

Query  243  vIGYKHQTDPKAGGQD--CGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFL  416
            VIGYKHQ+DP   G D  C GVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFL
Sbjct  58   VIGYKHQSDPNVNGTDAACSGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFL  117

Query  417  ARKVTLPRAVLYMIAQCLGAICGVGVGEGFPE  512
            ARKV+L RA+LYMIAQCLGAICG G+ +GF +
Sbjct  118  ARKVSLIRALLYMIAQCLGAICGAGLVKGFQK  149



>ref|XP_002519539.1| Aquaporin PIP2.2, putative [Ricinus communis]
 gb|EEF42953.1| Aquaporin PIP2.2, putative [Ricinus communis]
Length=288

 Score =   215 bits (547),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 118/150 (79%), Positives = 127/150 (85%), Gaps = 1/150 (1%)
 Frame = +3

Query  63   MTKDVEAVPEQPAEFSAKDYHDPPPSPLIDFDELTKWSFYRAVIAEFIAtllflyvtvlt  242
            M KDVE V     EF AKDYHDPPP+PLID +ELTKWSFYRA+IAEFIATLLFLY+TVLT
Sbjct  1    MGKDVE-VGGHGGEFHAKDYHDPPPAPLIDAEELTKWSFYRAIIAEFIATLLFLYITVLT  59

Query  243  vIGYKHQTDPKAGGQDCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLAR  422
            VIGYK QTDP      CGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLAR
Sbjct  60   VIGYKSQTDPAKNADACGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLAR  119

Query  423  KVTLPRAVLYMIAQCLGAICGVGVGEGFPE  512
            KV+L RA++YM AQCLGAICG G+ + F  
Sbjct  120  KVSLVRAIMYMAAQCLGAICGCGLVKAFQR  149



>gb|ABU94631.1| putative aquaporin PIP2;3 [Phaseolus vulgaris]
Length=287

 Score =   214 bits (546),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 117/150 (78%), Positives = 130/150 (87%), Gaps = 2/150 (1%)
 Frame = +3

Query  63   MTKDVEAVPEQPAEFSAKDYHDPPPSPLIDFDELTKWSFYRAVIAEFIAtllflyvtvlt  242
            M KDVE    +   FS KDYHDPPP+PLID +ELTKWSFYRA+IAEFIATLLFLY+TVLT
Sbjct  1    MAKDVEV--TERGSFSGKDYHDPPPAPLIDTEELTKWSFYRALIAEFIATLLFLYITVLT  58

Query  243  vIGYKHQTDPKAGGQDCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLAR  422
            VIGYKHQ+D K  G  CGGVGILGIAWAFGGMIFILVY TAGISGGHINPAVTFGLFLAR
Sbjct  59   VIGYKHQSDLKDHGDACGGVGILGIAWAFGGMIFILVYWTAGISGGHINPAVTFGLFLAR  118

Query  423  KVTLPRAVLYMIAQCLGAICGVGVGEGFPE  512
            KV+L RA++YM+AQCLGAICGVG+ + F +
Sbjct  119  KVSLIRAIMYMVAQCLGAICGVGLVKAFQK  148



>gb|AIG92831.1| aquaporin PIP2 [Chrysanthemum x morifolium]
Length=285

 Score =   214 bits (545),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 118/150 (79%), Positives = 129/150 (86%), Gaps = 4/150 (3%)
 Frame = +3

Query  63   MTKDVEAVPEQPAEFSAKDYHDPPPSPLIDFDELTKWSFYRAVIAEFIAtllflyvtvlt  242
            MTKDV   PEQ   FSAKDYHDPPP+PLID  EL KWSFYRA+IAEFIATLLFLY+TVLT
Sbjct  1    MTKDV---PEQ-GSFSAKDYHDPPPAPLIDPGELAKWSFYRALIAEFIATLLFLYITVLT  56

Query  243  vIGYKHQTDPKAGGQDCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLAR  422
            VIGYK  TDP      CGGVGILGIAWAFGGMIF+LVYCTAGISGGHINPAVTFGLFLAR
Sbjct  57   VIGYKSTTDPALNADQCGGVGILGIAWAFGGMIFVLVYCTAGISGGHINPAVTFGLFLAR  116

Query  423  KVTLPRAVLYMIAQCLGAICGVGVGEGFPE  512
            KV+L RA++YM+AQCLGAICGVG+ + F +
Sbjct  117  KVSLIRAIMYMVAQCLGAICGVGLVKAFNK  146



>ref|XP_003518297.1| PREDICTED: aquaporin PIP2-2-like [Glycine max]
Length=285

 Score =   214 bits (545),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 113/137 (82%), Positives = 127/137 (93%), Gaps = 0/137 (0%)
 Frame = +3

Query  102  EFSAKDYHDPPPSPLIDFDELTKWSFYRAVIAEFIAtllflyvtvltvIGYKHQTDPKAG  281
             FSAKDYHDPPP+PLID +ELT+WSFYRA+IAEFIATLLFLY+TVLTVIGYK Q+D KAG
Sbjct  10   SFSAKDYHDPPPAPLIDAEELTQWSFYRALIAEFIATLLFLYITVLTVIGYKSQSDVKAG  69

Query  282  GQDCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARKVTLPRAVLYMIA  461
            G  CGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARKV+L RA++YM+A
Sbjct  70   GDVCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARKVSLIRAIMYMVA  129

Query  462  QCLGAICGVGVGEGFPE  512
            QCLGA+CGVG+ + F +
Sbjct  130  QCLGAMCGVGLVKAFQK  146



>ref|XP_003548071.1| PREDICTED: aquaporin PIP2-2-like [Glycine max]
Length=285

 Score =   214 bits (545),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 112/137 (82%), Positives = 127/137 (93%), Gaps = 0/137 (0%)
 Frame = +3

Query  102  EFSAKDYHDPPPSPLIDFDELTKWSFYRAVIAEFIAtllflyvtvltvIGYKHQTDPKAG  281
             F+AKDYHDPPP+PLID +ELT+WSFYRA+IAEFIAT+LFLY+TVLTVIGYK Q+D KAG
Sbjct  10   SFAAKDYHDPPPAPLIDAEELTQWSFYRALIAEFIATMLFLYITVLTVIGYKSQSDVKAG  69

Query  282  GQDCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARKVTLPRAVLYMIA  461
            G  CGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARKV+L RA++YM+A
Sbjct  70   GDVCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARKVSLIRAIMYMVA  129

Query  462  QCLGAICGVGVGEGFPE  512
            QCLGAICGVG+ + F +
Sbjct  130  QCLGAICGVGLVKAFQK  146



>ref|XP_007151872.1| hypothetical protein PHAVU_004G082700g [Phaseolus vulgaris]
 gb|ESW23866.1| hypothetical protein PHAVU_004G082700g [Phaseolus vulgaris]
Length=285

 Score =   214 bits (545),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 114/137 (83%), Positives = 126/137 (92%), Gaps = 0/137 (0%)
 Frame = +3

Query  102  EFSAKDYHDPPPSPLIDFDELTKWSFYRAVIAEFIAtllflyvtvltvIGYKHQTDPKAG  281
             FSAKDYHDPPP+PLID  ELT+WSFYRA+IAEFIATLLFLY+TVLTVIGYK Q+D KAG
Sbjct  10   SFSAKDYHDPPPAPLIDAQELTQWSFYRALIAEFIATLLFLYITVLTVIGYKSQSDVKAG  69

Query  282  GQDCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARKVTLPRAVLYMIA  461
            G  CGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARKV+L RA++YM+A
Sbjct  70   GDLCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARKVSLIRAIMYMVA  129

Query  462  QCLGAICGVGVGEGFPE  512
            QCLGAICGVG+ + F +
Sbjct  130  QCLGAICGVGLVKAFQK  146



>gb|KJB20285.1| hypothetical protein B456_003G141600 [Gossypium raimondii]
Length=320

 Score =   215 bits (548),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 125/169 (74%), Positives = 135/169 (80%), Gaps = 6/169 (4%)
 Frame = +3

Query  18   HSRKYPFSSLISLAAMTKDVEAVPEQP--AEFSAKDYHDPPPSPLIDFDELTKWSFYRAV  191
            HS    F SL     MTKD+E   EQ   AEFSAKDY DPPP+PLID +ELTKWS YRA 
Sbjct  17   HSLNEHFHSLKH--NMTKDIETTAEQGGGAEFSAKDYQDPPPAPLIDLEELTKWSLYRAA  74

Query  192  IAEFIAtllflyvtvltvIGYKHQTDPKAG--GQDCGGVGILGIAWAFGGMIFILVYCTA  365
            IAEFIATLLFLYVTVLTVIGYK QTDP       DCGGVGILGIAWAFGGMIFILVYCTA
Sbjct  75   IAEFIATLLFLYVTVLTVIGYKVQTDPVKNTVDPDCGGVGILGIAWAFGGMIFILVYCTA  134

Query  366  GISGGHINPAVTFGLFLARKVTLPRAVLYMIAQCLGAICGVGVGEGFPE  512
            GISGGHINPAVTFGLF+ RKV+L RA+LYM+AQCLGAICG G+ + F +
Sbjct  135  GISGGHINPAVTFGLFVGRKVSLIRALLYMVAQCLGAICGCGLVKAFQK  183



>ref|XP_011015478.1| PREDICTED: aquaporin PIP2-2-like [Populus euphratica]
Length=285

 Score =   214 bits (545),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 114/150 (76%), Positives = 129/150 (86%), Gaps = 4/150 (3%)
 Frame = +3

Query  63   MTKDVEAVPEQPAEFSAKDYHDPPPSPLIDFDELTKWSFYRAVIAEFIAtllflyvtvlt  242
            M KD+E       EFSAKDYHDPPP+PLID +E+T+WSFYRA+IAEF+ATLLFLY+TVLT
Sbjct  1    MGKDIEV----GGEFSAKDYHDPPPAPLIDAEEITQWSFYRAIIAEFVATLLFLYITVLT  56

Query  243  vIGYKHQTDPKAGGQDCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLAR  422
            VIGYK QTD    G  CGGVGILGIAWAFGGMIF+LVYCTAGISGGHINPAVTFGLFLAR
Sbjct  57   VIGYKSQTDVNKNGDQCGGVGILGIAWAFGGMIFVLVYCTAGISGGHINPAVTFGLFLAR  116

Query  423  KVTLPRAVLYMIAQCLGAICGVGVGEGFPE  512
            KV+L RA+LYM+AQCLGAICG G+ + F +
Sbjct  117  KVSLVRAILYMVAQCLGAICGCGLVKAFQK  146



>ref|XP_009116034.1| PREDICTED: aquaporin PIP2-1 [Brassica rapa]
 gb|AAD39373.1|AF118382_1 plasma membrane intrinsic protein 1 [Brassica napus]
 emb|CDX78177.1| BnaA09g33720D [Brassica napus]
Length=287

 Score =   214 bits (545),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 118/148 (80%), Positives = 127/148 (86%), Gaps = 2/148 (1%)
 Frame = +3

Query  63   MTKDVEAVPEQPAEFSAKDYHDPPPSPLIDFDELTKWSFYRAVIAEFIAtllflyvtvlt  242
            M KDVEAV  +   F  +DY DPPP+PL D  ELTKWSFYRAVIAEF+ATLLFLY+TVLT
Sbjct  1    MAKDVEAVSGE--GFQTRDYQDPPPAPLFDPAELTKWSFYRAVIAEFVATLLFLYITVLT  58

Query  243  vIGYKHQTDPKAGGQDCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLAR  422
            VIGYK QTD  AGG DCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGL LAR
Sbjct  59   VIGYKIQTDSTAGGVDCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLLLAR  118

Query  423  KVTLPRAVLYMIAQCLGAICGVGVGEGF  506
            KV+L RA+LYM+AQCLGAICGVG  + F
Sbjct  119  KVSLVRAILYMVAQCLGAICGVGFVKAF  146



>dbj|BAA32778.1| Plasma membrane aquaporin (PAQ2) [Raphanus sativus]
Length=287

 Score =   214 bits (545),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 117/148 (79%), Positives = 128/148 (86%), Gaps = 2/148 (1%)
 Frame = +3

Query  63   MTKDVEAVPEQPAEFSAKDYHDPPPSPLIDFDELTKWSFYRAVIAEFIAtllflyvtvlt  242
            M KDVEAV  +   F  +DY DPPP+PL D +ELTKWSFYRAVIAEF+ATLLFLY+TVLT
Sbjct  1    MAKDVEAVSGE--GFQTRDYQDPPPAPLFDPEELTKWSFYRAVIAEFVATLLFLYITVLT  58

Query  243  vIGYKHQTDPKAGGQDCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLAR  422
            VIGYK +TD  AGG DCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGL LAR
Sbjct  59   VIGYKIETDSTAGGVDCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLLLAR  118

Query  423  KVTLPRAVLYMIAQCLGAICGVGVGEGF  506
            KV+L RA+LYM+AQCLGAICGVG  + F
Sbjct  119  KVSLVRAILYMVAQCLGAICGVGFVKAF  146



>gb|EYU36189.1| hypothetical protein MIMGU_mgv1a011437mg [Erythranthe guttata]
Length=282

 Score =   213 bits (543),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 118/150 (79%), Positives = 131/150 (87%), Gaps = 5/150 (3%)
 Frame = +3

Query  63   MTKDVEAVPEQPAEFSAKDYHDPPPSPLIDFDELTKWSFYRAVIAEFIAtllflyvtvlt  242
            M K+VE   E  AEF+AKDYHDPPP+PLID+DELTKWSFYRA+IAEFIATLLFLY+TVLT
Sbjct  1    MAKEVECA-EPAAEFAAKDYHDPPPAPLIDYDELTKWSFYRALIAEFIATLLFLYITVLT  59

Query  243  vIGYKHQTDPKAGGQDCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLAR  422
            VIGYK Q++       CGGVGILGIAWAFGGMIF+LVYCTAGISGGHINPAVTFGLFLAR
Sbjct  60   VIGYKSQSEY----DQCGGVGILGIAWAFGGMIFVLVYCTAGISGGHINPAVTFGLFLAR  115

Query  423  KVTLPRAVLYMIAQCLGAICGVGVGEGFPE  512
            KV+L RAVLYM+AQCLGAICGVG  + F +
Sbjct  116  KVSLIRAVLYMVAQCLGAICGVGFVKAFQK  145



>gb|ACU21481.1| unknown [Glycine max]
Length=287

 Score =   214 bits (544),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 118/151 (78%), Positives = 129/151 (85%), Gaps = 2/151 (1%)
 Frame = +3

Query  63   MTKDVEAVPEQPAEFSAKDYHDPPPSPLIDFDELTKWSFYRAVIAEFIAtllflyvtvlt  242
            M KDVE V EQ  E+SAKDYHDPPP+PLI  DELTKWS YRA IAEFIATLLFLY+TVLT
Sbjct  1    MAKDVEQVTEQ-GEYSAKDYHDPPPAPLIHPDELTKWSLYRAAIAEFIATLLFLYITVLT  59

Query  243  vIGYKHQTDPKA-GGQDCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLA  419
            +IGYK Q+D K  G  +C GVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFL 
Sbjct  60   IIGYKRQSDTKIPGNTECDGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLG  119

Query  420  RKVTLPRAVLYMIAQCLGAICGVGVGEGFPE  512
            RKV+L RA+LYMIAQC GAICG G+ +GF +
Sbjct  120  RKVSLVRALLYMIAQCAGAICGAGLAKGFQK  150



>ref|XP_006294744.1| hypothetical protein CARUB_v10023789mg [Capsella rubella]
 gb|EOA27642.1| hypothetical protein CARUB_v10023789mg [Capsella rubella]
Length=285

 Score =   213 bits (543),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 118/148 (80%), Positives = 125/148 (84%), Gaps = 4/148 (3%)
 Frame = +3

Query  63   MTKDVEAVPEQPAEFSAKDYHDPPPSPLIDFDELTKWSFYRAVIAEFIAtllflyvtvlt  242
            M KDVE     P  F  +DY DPPP+P  D DELTKWS YRAVIAEF+ATLLFLYVTVLT
Sbjct  1    MAKDVEG----PEGFQTRDYEDPPPTPFFDADELTKWSLYRAVIAEFVATLLFLYVTVLT  56

Query  243  vIGYKHQTDPKAGGQDCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLAR  422
            VIGYK Q+D  AGG DCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLAR
Sbjct  57   VIGYKIQSDTTAGGVDCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLAR  116

Query  423  KVTLPRAVLYMIAQCLGAICGVGVGEGF  506
            KV+L RAVLYM+AQCLGAICGVG  + F
Sbjct  117  KVSLIRAVLYMVAQCLGAICGVGFVKAF  144



>ref|NP_181255.1| aquaporin PIP2-3 [Arabidopsis thaliana]
 sp|P30302.1|PIP23_ARATH RecName: Full=Aquaporin PIP2-3; AltName: Full=Plasma membrane 
intrinsic protein 2-3; Short=AtPIP2;3; AltName: Full=Plasma 
membrane intrinsic protein 2c; Short=PIP2c; AltName: Full=RD28-PIP; 
AltName: Full=TMP2C; AltName: Full=Water stress-induced 
tonoplast intrinsic protein; Short=WSI-TIP; Contains: RecName: 
Full=Aquaporin PIP2-3, N-terminally processed [Arabidopsis 
thaliana]
 dbj|BAA02520.1| transmembrane channel protein [Arabidopsis thaliana]
 gb|AAD18141.1| aquaporin (plasma membrane intrinsic protein 2C) [Arabidopsis 
thaliana]
 gb|AAL36385.1| putative aquaporin, plasma membrane intrinsic protein 2C [Arabidopsis 
thaliana]
 gb|AAM20335.1| putative aquaporin protein [Arabidopsis thaliana]
 gb|AEC09363.1| aquaporin PIP2-3 [Arabidopsis thaliana]
 prf||1905411A transmembrane channel
Length=285

 Score =   213 bits (543),  Expect = 4e-65, Method: Compositional matrix adjust.
 Identities = 118/148 (80%), Positives = 126/148 (85%), Gaps = 4/148 (3%)
 Frame = +3

Query  63   MTKDVEAVPEQPAEFSAKDYHDPPPSPLIDFDELTKWSFYRAVIAEFIAtllflyvtvlt  242
            M KDVE     P  F  +DY DPPP+P  D +ELTKWS YRAVIAEF+ATLLFLYVTVLT
Sbjct  1    MAKDVEG----PDGFQTRDYEDPPPTPFFDAEELTKWSLYRAVIAEFVATLLFLYVTVLT  56

Query  243  vIGYKHQTDPKAGGQDCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLAR  422
            VIGYK Q+D KAGG DCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLAR
Sbjct  57   VIGYKIQSDTKAGGVDCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLAR  116

Query  423  KVTLPRAVLYMIAQCLGAICGVGVGEGF  506
            KV+L RAVLYM+AQCLGAICGVG  + F
Sbjct  117  KVSLIRAVLYMVAQCLGAICGVGFVKAF  144



>emb|CDX74983.1| BnaA05g07290D [Brassica napus]
Length=197

 Score =   210 bits (535),  Expect = 4e-65, Method: Compositional matrix adjust.
 Identities = 115/148 (78%), Positives = 126/148 (85%), Gaps = 4/148 (3%)
 Frame = +3

Query  63   MTKDVEAVPEQPAEFSAKDYHDPPPSPLIDFDELTKWSFYRAVIAEFIAtllflyvtvlt  242
            M KDVE        F+A+DY DPPP+P  D +ELTKWS YRAVIAEF+ATLLFLYVTVLT
Sbjct  1    MAKDVEGAEG----FAARDYEDPPPTPFFDAEELTKWSLYRAVIAEFVATLLFLYVTVLT  56

Query  243  vIGYKHQTDPKAGGQDCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLAR  422
            VIGYK  +D KAGG +CGGVGILGI+WAFGGMIFILVYCTAGISGGHINPAVTFGLFLAR
Sbjct  57   VIGYKISSDTKAGGDECGGVGILGISWAFGGMIFILVYCTAGISGGHINPAVTFGLFLAR  116

Query  423  KVTLPRAVLYMIAQCLGAICGVGVGEGF  506
            KV+L RAVLYM+AQCLGAICGVG  + F
Sbjct  117  KVSLIRAVLYMVAQCLGAICGVGFVKAF  144



>gb|ACU20229.1| unknown [Glycine max]
Length=285

 Score =   213 bits (542),  Expect = 4e-65, Method: Compositional matrix adjust.
 Identities = 113/137 (82%), Positives = 126/137 (92%), Gaps = 0/137 (0%)
 Frame = +3

Query  102  EFSAKDYHDPPPSPLIDFDELTKWSFYRAVIAEFIAtllflyvtvltvIGYKHQTDPKAG  281
             FSAKDYHDPPP+PLID +ELT+WS YRA+IAEFIATLLFLY+TVLTVIGYK Q+D KAG
Sbjct  10   SFSAKDYHDPPPAPLIDAEELTQWSLYRALIAEFIATLLFLYITVLTVIGYKSQSDVKAG  69

Query  282  GQDCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARKVTLPRAVLYMIA  461
            G  CGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARKV+L RA++YM+A
Sbjct  70   GDVCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARKVSLIRAIMYMVA  129

Query  462  QCLGAICGVGVGEGFPE  512
            QCLGAICGVG+ + F +
Sbjct  130  QCLGAICGVGLVKAFQK  146



>gb|AIA83104.1| putative aquaporin PIP2 [Citrus sinensis x Citrus trifoliata]
Length=290

 Score =   213 bits (542),  Expect = 5e-65, Method: Compositional matrix adjust.
 Identities = 118/153 (77%), Positives = 126/153 (82%), Gaps = 3/153 (2%)
 Frame = +3

Query  63   MTKDVEAVPEQPAE---FSAKDYHDPPPSPLIDFDELTKWSFYRAVIAEFIAtllflyvt  233
            M KDVE   +Q      FSAKDYHDPPP+PLIDF+EL KWSFYRAVIAEFIATL FLYVT
Sbjct  1    MGKDVEVAEQQGGGGGEFSAKDYHDPPPAPLIDFEELGKWSFYRAVIAEFIATLSFLYVT  60

Query  234  vltvIGYKHQTDPKAGGQDCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLF  413
            VLT IGYK QTDP      CGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLF
Sbjct  61   VLTAIGYKSQTDPTLNTDQCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLF  120

Query  414  LARKVTLPRAVLYMIAQCLGAICGVGVGEGFPE  512
            L RKV+L RA+LYM+AQCLGAICG G  + F +
Sbjct  121  LGRKVSLIRALLYMVAQCLGAICGCGFVKAFQK  153



>emb|CDY13298.1| BnaC06g14590D [Brassica napus]
Length=287

 Score =   213 bits (542),  Expect = 5e-65, Method: Compositional matrix adjust.
 Identities = 117/148 (79%), Positives = 128/148 (86%), Gaps = 2/148 (1%)
 Frame = +3

Query  63   MTKDVEAVPEQPAEFSAKDYHDPPPSPLIDFDELTKWSFYRAVIAEFIAtllflyvtvlt  242
            M KDVEAV  +   F ++DY DPPP+PL D +ELTKWSFYRAVIAEF+ATLLFLY+TVLT
Sbjct  1    MAKDVEAVAGE--GFQSRDYQDPPPAPLFDPEELTKWSFYRAVIAEFVATLLFLYITVLT  58

Query  243  vIGYKHQTDPKAGGQDCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLAR  422
            VI YK QTD  AGG DCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGL LAR
Sbjct  59   VICYKIQTDSTAGGVDCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLLLAR  118

Query  423  KVTLPRAVLYMIAQCLGAICGVGVGEGF  506
            KV+L RA+LYM+AQCLGAICGVG  + F
Sbjct  119  KVSLVRAILYMVAQCLGAICGVGFVQAF  146



>gb|EMS56715.1| putative aquaporin PIP2-2 [Triticum urartu]
Length=341

 Score =   214 bits (546),  Expect = 6e-65, Method: Compositional matrix adjust.
 Identities = 114/150 (76%), Positives = 129/150 (86%), Gaps = 3/150 (2%)
 Frame = +3

Query  63   MTKDVEAVPEQPAEFSAKDYHDPPPSPLIDFDELTKWSFYRAVIAEFIAtllflyvtvlt  242
            M KD+EA P Q  EFS K Y  PPP+P++DF+ELTKWS YRAVIAEF+ATLLFLY+TV T
Sbjct  1    MAKDIEAAP-QGGEFSTKSYAAPPPAPIVDFEELTKWSLYRAVIAEFVATLLFLYITVAT  59

Query  243  vIGYKHQTDPKAGGQD--CGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFL  416
            VIGYKHQ+DP     D  C GVGILGIAWAFGGMIF+LVYCTAG+SGGHINPAVTFGLFL
Sbjct  60   VIGYKHQSDPTVNTTDAACSGVGILGIAWAFGGMIFVLVYCTAGVSGGHINPAVTFGLFL  119

Query  417  ARKVTLPRAVLYMIAQCLGAICGVGVGEGF  506
            ARKV+L RA+LY+IAQCLGAICGVG+ +GF
Sbjct  120  ARKVSLIRALLYIIAQCLGAICGVGLVKGF  149



>gb|ACJ85173.1| unknown [Medicago truncatula]
Length=287

 Score =   212 bits (540),  Expect = 9e-65, Method: Compositional matrix adjust.
 Identities = 117/148 (79%), Positives = 128/148 (86%), Gaps = 2/148 (1%)
 Frame = +3

Query  63   MTKDVEAVPEQPAEFSAKDYHDPPPSPLIDFDELTKWSFYRAVIAEFIAtllflyvtvlt  242
            M KDVE    +   FS KDYHDPPP+PLID +ELTKWSFYRA+IAEFIATLLFLYVTVLT
Sbjct  1    MAKDVEV--AERGSFSNKDYHDPPPAPLIDAEELTKWSFYRALIAEFIATLLFLYVTVLT  58

Query  243  vIGYKHQTDPKAGGQDCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLAR  422
            VIGY  QTD KAGG  CGGVGILGIAWAFGGMIF+LVYC AGISGGHINPAVTFGLFLAR
Sbjct  59   VIGYSIQTDVKAGGDACGGVGILGIAWAFGGMIFVLVYCIAGISGGHINPAVTFGLFLAR  118

Query  423  KVTLPRAVLYMIAQCLGAICGVGVGEGF  506
            KV+L RA++YM+AQCLGAI GVG+ + F
Sbjct  119  KVSLIRAIMYMVAQCLGAIAGVGLVKAF  146



>ref|XP_010505293.1| PREDICTED: aquaporin PIP2-2 [Camelina sativa]
 ref|XP_010509372.1| PREDICTED: aquaporin PIP2-2 [Camelina sativa]
Length=285

 Score =   212 bits (540),  Expect = 9e-65, Method: Compositional matrix adjust.
 Identities = 117/148 (79%), Positives = 126/148 (85%), Gaps = 4/148 (3%)
 Frame = +3

Query  63   MTKDVEAVPEQPAEFSAKDYHDPPPSPLIDFDELTKWSFYRAVIAEFIAtllflyvtvlt  242
            M KDVE     P  F ++DY DPPP+P  D +ELTKWS YRAVIAEF+ATLLFLYVTVLT
Sbjct  1    MAKDVEG----PEGFQSRDYEDPPPTPFFDAEELTKWSLYRAVIAEFVATLLFLYVTVLT  56

Query  243  vIGYKHQTDPKAGGQDCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLAR  422
            VIGYK Q+D  AGG DCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLAR
Sbjct  57   VIGYKIQSDTTAGGVDCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLAR  116

Query  423  KVTLPRAVLYMIAQCLGAICGVGVGEGF  506
            KV+L RAVLYM+AQCLGAICGVG  + F
Sbjct  117  KVSLIRAVLYMVAQCLGAICGVGFVKAF  144



>gb|ABC69040.1| aquaporin PIP2-1 [Rhododendron catawbiense]
Length=281

 Score =   212 bits (540),  Expect = 9e-65, Method: Compositional matrix adjust.
 Identities = 122/152 (80%), Positives = 133/152 (88%), Gaps = 10/152 (7%)
 Frame = +3

Query  63   MTKDVEAVPEQPAEFSAKDYHDPPPSPLIDFDELTKWSFYRAVIAEFIAtllflyvtvlt  242
            M+KDVE V EQPA +SAKDYHDPPP+ LID +EL KWSFYRAVIAEFIATLLFLY+TVLT
Sbjct  1    MSKDVE-VAEQPA-YSAKDYHDPPPARLIDMEELIKWSFYRAVIAEFIATLLFLYITVLT  58

Query  243  vIGYKHQT--DPKAGGQDCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFL  416
            VIGYK QT  DP      CGGVGILGIAWAFGGMIF+LVYCTAGISGGHINPAVTFGLFL
Sbjct  59   VIGYKSQTTTDP------CGGVGILGIAWAFGGMIFVLVYCTAGISGGHINPAVTFGLFL  112

Query  417  ARKVTLPRAVLYMIAQCLGAICGVGVGEGFPE  512
            ARKV+L RAVLYM+AQCLGAICGVG+ + F +
Sbjct  113  ARKVSLFRAVLYMVAQCLGAICGVGLVKAFQK  144



>ref|XP_010516975.1| PREDICTED: aquaporin PIP2-2-like [Camelina sativa]
Length=285

 Score =   212 bits (540),  Expect = 9e-65, Method: Compositional matrix adjust.
 Identities = 117/148 (79%), Positives = 126/148 (85%), Gaps = 4/148 (3%)
 Frame = +3

Query  63   MTKDVEAVPEQPAEFSAKDYHDPPPSPLIDFDELTKWSFYRAVIAEFIAtllflyvtvlt  242
            M KDVE     P  F ++DY DPPP+P  D +ELTKWS YRAVIAEF+ATLLFLYVTVLT
Sbjct  1    MAKDVEG----PEGFQSRDYEDPPPTPFFDAEELTKWSLYRAVIAEFVATLLFLYVTVLT  56

Query  243  vIGYKHQTDPKAGGQDCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLAR  422
            VIGYK Q+D  AGG DCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLAR
Sbjct  57   VIGYKIQSDTTAGGVDCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLAR  116

Query  423  KVTLPRAVLYMIAQCLGAICGVGVGEGF  506
            KV+L RAVLYM+AQCLGAICGVG  + F
Sbjct  117  KVSLIRAVLYMVAQCLGAICGVGFVKAF  144



>gb|AIK66515.1| putative aquaporin [Vitis vinifera]
Length=284

 Score =   212 bits (540),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 119/148 (80%), Positives = 129/148 (87%), Gaps = 5/148 (3%)
 Frame = +3

Query  63   MTKDVEAVPEQPAEFSAKDYHDPPPSPLIDFDELTKWSFYRAVIAEFIAtllflyvtvlt  242
            MTKDVE    +   FSAKDYHDPPP+PL D  ELTKWSFYRA+IAEFIATLLFLY+TVLT
Sbjct  1    MTKDVEV--AEHGSFSAKDYHDPPPAPLFDSVELTKWSFYRALIAEFIATLLFLYITVLT  58

Query  243  vIGYKHQTDPKAGGQDCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLAR  422
            VIGYK QT   AGG  CGGVGILGIAW+FGGMIFILVYCTAGISGGHINPAVTFGLFLAR
Sbjct  59   VIGYKSQT---AGGDPCGGVGILGIAWSFGGMIFILVYCTAGISGGHINPAVTFGLFLAR  115

Query  423  KVTLPRAVLYMIAQCLGAICGVGVGEGF  506
            KV+L RA+LYM+AQCLGAICGVG+ + F
Sbjct  116  KVSLIRAILYMVAQCLGAICGVGLVKAF  143



>emb|CAN75442.1| hypothetical protein VITISV_019657 [Vitis vinifera]
Length=284

 Score =   212 bits (540),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 119/148 (80%), Positives = 129/148 (87%), Gaps = 5/148 (3%)
 Frame = +3

Query  63   MTKDVEAVPEQPAEFSAKDYHDPPPSPLIDFDELTKWSFYRAVIAEFIAtllflyvtvlt  242
            MTKDVE    +   FSAKDYHDPPP+PL D  ELTKWSFYRA+IAEFIATLLFLY+TVLT
Sbjct  1    MTKDVEV--AEHGSFSAKDYHDPPPAPLFDSVELTKWSFYRALIAEFIATLLFLYITVLT  58

Query  243  vIGYKHQTDPKAGGQDCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLAR  422
            VIGYK QT   AGG  CGGVGILGIAW+FGGMIFILVYCTAGISGGHINPAVTFGLFLAR
Sbjct  59   VIGYKSQT---AGGDPCGGVGILGIAWSFGGMIFILVYCTAGISGGHINPAVTFGLFLAR  115

Query  423  KVTLPRAVLYMIAQCLGAICGVGVGEGF  506
            KV+L RA+LYM+AQCLGAICGVG+ + F
Sbjct  116  KVSLIRAILYMVAQCLGAICGVGLVKAF  143



>ref|NP_001267922.1| aquaporin-like [Vitis vinifera]
 gb|ABN14353.1| aquaporin PIP2;4 [Vitis vinifera]
Length=284

 Score =   212 bits (540),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 119/148 (80%), Positives = 129/148 (87%), Gaps = 5/148 (3%)
 Frame = +3

Query  63   MTKDVEAVPEQPAEFSAKDYHDPPPSPLIDFDELTKWSFYRAVIAEFIAtllflyvtvlt  242
            MTKDVE    +   FSAKDYHDPPP+PL D  ELTKWSFYRA+IAEFIATLLFLY+TVLT
Sbjct  1    MTKDVEV--AEHGSFSAKDYHDPPPAPLFDSVELTKWSFYRALIAEFIATLLFLYITVLT  58

Query  243  vIGYKHQTDPKAGGQDCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLAR  422
            VIGYK QT   AGG  CGGVGILGIAW+FGGMIFILVYCTAGISGGHINPAVTFGLFLAR
Sbjct  59   VIGYKSQT---AGGDPCGGVGILGIAWSFGGMIFILVYCTAGISGGHINPAVTFGLFLAR  115

Query  423  KVTLPRAVLYMIAQCLGAICGVGVGEGF  506
            KV+L RA+LYM+AQCLGAICGVG+ + F
Sbjct  116  KVSLIRAILYMVAQCLGAICGVGLVKAF  143



>gb|AAV69744.1| aquaporin [Vitis vinifera]
Length=284

 Score =   212 bits (540),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 119/148 (80%), Positives = 129/148 (87%), Gaps = 5/148 (3%)
 Frame = +3

Query  63   MTKDVEAVPEQPAEFSAKDYHDPPPSPLIDFDELTKWSFYRAVIAEFIAtllflyvtvlt  242
            MTKDVE    +   FSAKDYHDPPP+PL D  ELTKWSFYRA+IAEFIATLLFLY+TVLT
Sbjct  1    MTKDVEV--AEHGSFSAKDYHDPPPAPLFDSVELTKWSFYRALIAEFIATLLFLYITVLT  58

Query  243  vIGYKHQTDPKAGGQDCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLAR  422
            VIGYK QT   AGG  CGGVGILGIAW+FGGMIFILVYCTAGISGGHINPAVTFGLFLAR
Sbjct  59   VIGYKSQT---AGGDPCGGVGILGIAWSFGGMIFILVYCTAGISGGHINPAVTFGLFLAR  115

Query  423  KVTLPRAVLYMIAQCLGAICGVGVGEGF  506
            KV+L RA+LYM+AQCLGAICGVG+ + F
Sbjct  116  KVSLIRAILYMVAQCLGAICGVGLVKAF  143



>ref|XP_011048549.1| PREDICTED: aquaporin PIP2-1-like [Populus euphratica]
 ref|XP_011048550.1| PREDICTED: aquaporin PIP2-1-like [Populus euphratica]
 ref|XP_011048551.1| PREDICTED: aquaporin PIP2-1-like [Populus euphratica]
Length=285

 Score =   212 bits (540),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 114/150 (76%), Positives = 127/150 (85%), Gaps = 4/150 (3%)
 Frame = +3

Query  63   MTKDVEAVPEQPAEFSAKDYHDPPPSPLIDFDELTKWSFYRAVIAEFIAtllflyvtvlt  242
            M KD+E       EFSAKDYHDPPP+PLID +ELT+WS YRA+IAEFIATLLFLY+TVLT
Sbjct  1    MGKDIEV----GGEFSAKDYHDPPPAPLIDAEELTQWSLYRAIIAEFIATLLFLYITVLT  56

Query  243  vIGYKHQTDPKAGGQDCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLAR  422
            VIGYK Q D    G  CGGVGILGIAWAFGGMIF+LVYCTAGISGGHINPAVTFGLFLAR
Sbjct  57   VIGYKSQIDTTKNGDQCGGVGILGIAWAFGGMIFVLVYCTAGISGGHINPAVTFGLFLAR  116

Query  423  KVTLPRAVLYMIAQCLGAICGVGVGEGFPE  512
            KV+L RA+LYM+AQCLGAICG G+ + F +
Sbjct  117  KVSLVRAILYMVAQCLGAICGCGLVKAFQK  146



>gb|ABH09326.1| putative aquaporin [Vitis vinifera]
Length=284

 Score =   212 bits (540),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 119/148 (80%), Positives = 129/148 (87%), Gaps = 5/148 (3%)
 Frame = +3

Query  63   MTKDVEAVPEQPAEFSAKDYHDPPPSPLIDFDELTKWSFYRAVIAEFIAtllflyvtvlt  242
            MTKDVE    +   FSAKDYHDPPP+PL D  ELTKWSFYRA+IAEFIATLLFLY+TVLT
Sbjct  1    MTKDVEV--AEHGSFSAKDYHDPPPAPLFDSVELTKWSFYRALIAEFIATLLFLYITVLT  58

Query  243  vIGYKHQTDPKAGGQDCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLAR  422
            VIGYK QT   AGG  CGGVGILGIAW+FGGMIFILVYCTAGISGGHINPAVTFGLFLAR
Sbjct  59   VIGYKSQT---AGGDPCGGVGILGIAWSFGGMIFILVYCTAGISGGHINPAVTFGLFLAR  115

Query  423  KVTLPRAVLYMIAQCLGAICGVGVGEGF  506
            KV+L RA+LYM+AQCLGAICGVG+ + F
Sbjct  116  KVSLIRAILYMVAQCLGAICGVGLVKAF  143



>gb|KCW49751.1| hypothetical protein EUGRSUZ_K03244 [Eucalyptus grandis]
Length=258

 Score =   211 bits (537),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 109/150 (73%), Positives = 125/150 (83%), Gaps = 0/150 (0%)
 Frame = +3

Query  63   MTKDVEAVPEQPAEFSAKDYHDPPPSPLIDFDELTKWSFYRAVIAEFIAtllflyvtvlt  242
            M KD E V +Q  EF  KDY DPPP+PL+D +EL KWSFYRAVIAEF+ATLLFLY+TVLT
Sbjct  1    MAKDDEVVEQQGGEFHGKDYRDPPPAPLVDAEELVKWSFYRAVIAEFVATLLFLYITVLT  60

Query  243  vIGYKHQTDPKAGGQDCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLAR  422
            VIGY  Q+D   GG  C GVG+LGIAWAFGGMIF+LVYCTAGISGGHINPAVTFGLFLAR
Sbjct  61   VIGYSRQSDTTHGGDQCDGVGLLGIAWAFGGMIFVLVYCTAGISGGHINPAVTFGLFLAR  120

Query  423  KVTLPRAVLYMIAQCLGAICGVGVGEGFPE  512
            +V+L RA+LYM+AQCLGA+CG G+ + F  
Sbjct  121  RVSLVRAILYMVAQCLGAVCGCGLVKAFQR  150



>ref|XP_006381453.1| hypothetical protein POPTR_0006s12980g [Populus trichocarpa]
 gb|ABK96511.1| unknown [Populus trichocarpa x Populus deltoides]
 gb|ERP59250.1| hypothetical protein POPTR_0006s12980g [Populus trichocarpa]
Length=285

 Score =   212 bits (539),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 115/150 (77%), Positives = 127/150 (85%), Gaps = 4/150 (3%)
 Frame = +3

Query  63   MTKDVEAVPEQPAEFSAKDYHDPPPSPLIDFDELTKWSFYRAVIAEFIAtllflyvtvlt  242
            M KD+E       EFSAKDYHDPPP+PLID +ELT+WS YRA+IAEFIATLLFLY+TVLT
Sbjct  1    MGKDIEV----GGEFSAKDYHDPPPAPLIDAEELTQWSLYRAIIAEFIATLLFLYITVLT  56

Query  243  vIGYKHQTDPKAGGQDCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLAR  422
            VIGYK QTD       CGGVGILGIAWAFGGMIF+LVYCTAGISGGHINPAVTFGLFLAR
Sbjct  57   VIGYKSQTDTTKNSDACGGVGILGIAWAFGGMIFVLVYCTAGISGGHINPAVTFGLFLAR  116

Query  423  KVTLPRAVLYMIAQCLGAICGVGVGEGFPE  512
            KV+L RAVLYM+AQCLGAICG G+ + F +
Sbjct  117  KVSLVRAVLYMVAQCLGAICGCGLVKAFQK  146



>ref|XP_002881493.1| hypothetical protein ARALYDRAFT_482707 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH57752.1| hypothetical protein ARALYDRAFT_482707 [Arabidopsis lyrata subsp. 
lyrata]
Length=285

 Score =   212 bits (539),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 117/148 (79%), Positives = 125/148 (84%), Gaps = 4/148 (3%)
 Frame = +3

Query  63   MTKDVEAVPEQPAEFSAKDYHDPPPSPLIDFDELTKWSFYRAVIAEFIAtllflyvtvlt  242
            M KDVE     P  F  +DY DPPP+P  D +ELTKWS YRAVIAEF+ATLLFLYVTVLT
Sbjct  1    MAKDVEG----PEGFQTRDYEDPPPTPFFDAEELTKWSLYRAVIAEFVATLLFLYVTVLT  56

Query  243  vIGYKHQTDPKAGGQDCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLAR  422
            VIGYK Q+D  AGG DCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLAR
Sbjct  57   VIGYKIQSDKTAGGVDCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLAR  116

Query  423  KVTLPRAVLYMIAQCLGAICGVGVGEGF  506
            KV+L RAVLYM+AQCLGAICGVG  + F
Sbjct  117  KVSLIRAVLYMVAQCLGAICGVGFVKAF  144



>gb|AAF71816.1|AF141642_1 putative aquaporin PIP2-1 [Vitis cinerea var. helleri x Vitis 
rupestris]
Length=284

 Score =   212 bits (539),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 119/148 (80%), Positives = 129/148 (87%), Gaps = 5/148 (3%)
 Frame = +3

Query  63   MTKDVEAVPEQPAEFSAKDYHDPPPSPLIDFDELTKWSFYRAVIAEFIAtllflyvtvlt  242
            MTKDVE    +   FSAKDYHDPPP+PL D  ELTKWSFYRA+IAEFIATLLFLY+TVLT
Sbjct  1    MTKDVEV--AEHGSFSAKDYHDPPPAPLFDSVELTKWSFYRALIAEFIATLLFLYITVLT  58

Query  243  vIGYKHQTDPKAGGQDCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLAR  422
            VIGYK QT   AGG  CGGVGILGIAW+FGGMIFILVYCTAGISGGHINPAVTFGLFLAR
Sbjct  59   VIGYKSQT---AGGDPCGGVGILGIAWSFGGMIFILVYCTAGISGGHINPAVTFGLFLAR  115

Query  423  KVTLPRAVLYMIAQCLGAICGVGVGEGF  506
            KV+L RA+LYM+AQCLGAICGVG+ + F
Sbjct  116  KVSLIRAILYMVAQCLGAICGVGLVKAF  143



>ref|XP_010529747.1| PREDICTED: aquaporin PIP2-2-like [Tarenaya hassleriana]
Length=288

 Score =   212 bits (539),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 117/148 (79%), Positives = 127/148 (86%), Gaps = 1/148 (1%)
 Frame = +3

Query  63   MTKDVEAVPEQPAEFSAKDYHDPPPSPLIDFDELTKWSFYRAVIAEFIAtllflyvtvlt  242
            M KDVE        F A+DY DPPP+ L+D +ELT+WSFYRAVIAEFIATLLFLY+TVLT
Sbjct  1    MAKDVEGGVAGEG-FPARDYTDPPPAALVDAEELTRWSFYRAVIAEFIATLLFLYITVLT  59

Query  243  vIGYKHQTDPKAGGQDCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLAR  422
            VIGYK QTD KAGG DCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGL L R
Sbjct  60   VIGYKSQTDTKAGGDDCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLLLGR  119

Query  423  KVTLPRAVLYMIAQCLGAICGVGVGEGF  506
            KVTL RA+LYM+AQCLGAICGVG+ + F
Sbjct  120  KVTLVRALLYMVAQCLGAICGVGLVKAF  147



>ref|XP_002446796.1| hypothetical protein SORBIDRAFT_06g022840 [Sorghum bicolor]
 gb|EES11124.1| hypothetical protein SORBIDRAFT_06g022840 [Sorghum bicolor]
Length=292

 Score =   212 bits (539),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 115/153 (75%), Positives = 131/153 (86%), Gaps = 5/153 (3%)
 Frame = +3

Query  63   MTKDVEAVPEQPA---EFSAKDYHDPPPSPLIDFDELTKWSFYRAVIAEFIAtllflyvt  233
            M KD+EA         E++AKDY DPPP+PL+D +ELTKWS YRAVIAEF+ATLLFLY+T
Sbjct  1    MAKDIEAAAAAHGGGGEYTAKDYSDPPPAPLVDAEELTKWSLYRAVIAEFVATLLFLYIT  60

Query  234  vltvIGYKHQTDPKAGGQD--CGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFG  407
            V TVIGYKHQTD  + G D  CGGVGILGIAWAFGGMIFILVYCTAG+SGGHINPAVTFG
Sbjct  61   VATVIGYKHQTDASSSGPDAACGGVGILGIAWAFGGMIFILVYCTAGVSGGHINPAVTFG  120

Query  408  LFLARKVTLPRAVLYMIAQCLGAICGVGVGEGF  506
            LFLARKV+L RA+LY++AQCLGAICGVG+ +GF
Sbjct  121  LFLARKVSLVRALLYIVAQCLGAICGVGLVKGF  153



>ref|XP_009381972.1| PREDICTED: probable aquaporin PIP2-2 [Musa acuminata subsp. malaccensis]
Length=287

 Score =   211 bits (538),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 117/152 (77%), Positives = 131/152 (86%), Gaps = 4/152 (3%)
 Frame = +3

Query  63   MTKDVEAVPEQPAEFSAKDYHDPPPSPLIDFDELTKWSFYRAVIAEFIAtllflyvtvlt  242
            M KD+E V EQ  E++AKDY DPPP+PL+D +ELTKWS YRA IAEFIAT+LFLYVTVLT
Sbjct  1    MAKDIE-VAEQ-GEYTAKDYTDPPPAPLVDVEELTKWSLYRAAIAEFIATMLFLYVTVLT  58

Query  243  vIGYKHQTDPKAGGQD--CGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFL  416
            VIGYKHQ+DP     D  C GVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFL
Sbjct  59   VIGYKHQSDPNVNPTDAACSGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFL  118

Query  417  ARKVTLPRAVLYMIAQCLGAICGVGVGEGFPE  512
            ARKV+L RA LY++AQCLGAICGVG+ +GF +
Sbjct  119  ARKVSLVRAFLYIVAQCLGAICGVGLVKGFQK  150



>gb|KHG06004.1| Aquaporin PIP2-2 -like protein [Gossypium arboreum]
Length=285

 Score =   211 bits (538),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 113/141 (80%), Positives = 121/141 (86%), Gaps = 0/141 (0%)
 Frame = +3

Query  90   EQPAEFSAKDYHDPPPSPLIDFDELTKWSFYRAVIAEFIAtllflyvtvltvIGYKHQTD  269
            E   EF AKDYHDPPP+PL+D  EL KWSFYRAVIAEFIATL FLY+TVLTVIGYK QTD
Sbjct  6    EVGGEFQAKDYHDPPPAPLVDAQELAKWSFYRAVIAEFIATLFFLYITVLTVIGYKTQTD  65

Query  270  PKAGGQDCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARKVTLPRAVL  449
               GG+DCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARKV+L RA+ 
Sbjct  66   LAKGGEDCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARKVSLVRAIF  125

Query  450  YMIAQCLGAICGVGVGEGFPE  512
            YM AQCLGAICG G+ + F  
Sbjct  126  YMGAQCLGAICGCGLVKAFQN  146



>gb|ACX37450.1| plasma membrane intrinsic protein [Hevea brasiliensis]
Length=288

 Score =   211 bits (538),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 116/150 (77%), Positives = 127/150 (85%), Gaps = 1/150 (1%)
 Frame = +3

Query  63   MTKDVEAVPEQPAEFSAKDYHDPPPSPLIDFDELTKWSFYRAVIAEFIAtllflyvtvlt  242
            M KDVE V  Q  EF AKDY+DPPP+PLID +E T+WSFYRA+IAEFIATLLFLY+TVLT
Sbjct  1    MAKDVE-VGGQGGEFQAKDYNDPPPAPLIDAEEFTQWSFYRAIIAEFIATLLFLYITVLT  59

Query  243  vIGYKHQTDPKAGGQDCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLAR  422
            VIGYK QTDP      CGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVT GLFLAR
Sbjct  60   VIGYKSQTDPAKNADPCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTLGLFLAR  119

Query  423  KVTLPRAVLYMIAQCLGAICGVGVGEGFPE  512
            KV+L RA+LYM AQCLGAICG G+ + F +
Sbjct  120  KVSLVRAILYMAAQCLGAICGCGLVKAFQK  149



>dbj|BAE06148.1| PIP aquaporin isoform [Hordeum vulgare]
Length=290

 Score =   211 bits (538),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 115/151 (76%), Positives = 128/151 (85%), Gaps = 4/151 (3%)
 Frame = +3

Query  63   MTKDVEAVPEQPAEFSAKDYHDPPPSPLIDFDELTKWSFYRAVIAEFIAtllflyvtvlt  242
            M KD+EA P    E++AKDY DPPP+PL D +ELTKWS YRAVIAEF+ATLLFLY+TV T
Sbjct  1    MAKDIEAAPPG-GEYAAKDYSDPPPAPLFDAEELTKWSLYRAVIAEFVATLLFLYITVAT  59

Query  243  vIGYKHQTDP---KAGGQDCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLF  413
            VIGYKHQ DP    A    C GVGILGIAWAFGGMIF+LVYCTAG+SGGHINPAVTFGLF
Sbjct  60   VIGYKHQADPAGPNAADAACSGVGILGIAWAFGGMIFVLVYCTAGVSGGHINPAVTFGLF  119

Query  414  LARKVTLPRAVLYMIAQCLGAICGVGVGEGF  506
            LARKV+L RAVLY+IAQCLGAICGVG+ +GF
Sbjct  120  LARKVSLVRAVLYIIAQCLGAICGVGLVKGF  150



>gb|AHB33479.1| plasma intrinsic protein 2-3 [Cucumis sativus]
 gb|KGN48149.1| hypothetical protein Csa_6G445140 [Cucumis sativus]
Length=284

 Score =   211 bits (537),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 113/152 (74%), Positives = 130/152 (86%), Gaps = 5/152 (3%)
 Frame = +3

Query  63   MTKDVEAVPEQPAEFSAKDYHDPPPSPLIDFDELTKWSFYRAVIAEFIAtllflyvtvlt  242
            M+KD+EA       F+ KDY DPPP+PLID +ELT+WSFYRA+IAEF+ATLLFLYVTVLT
Sbjct  1    MSKDLEA-----GGFAVKDYQDPPPAPLIDAEELTQWSFYRAIIAEFVATLLFLYVTVLT  55

Query  243  vIGYKHQTDPKAGGQDCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLAR  422
            VIGY  Q+D K GGQ CGGVGILGIAWAFGGMIF+LVYCTAGISGGHINPAVTFGLFLAR
Sbjct  56   VIGYSSQSDTKNGGQICGGVGILGIAWAFGGMIFVLVYCTAGISGGHINPAVTFGLFLAR  115

Query  423  KVTLPRAVLYMIAQCLGAICGVGVGEGFPEVI  518
            KV+L RA+LYM+AQCLGAICG  + + F + +
Sbjct  116  KVSLTRAILYMVAQCLGAICGCALVKSFQKAL  147



>gb|AAY22203.1| putative aquaporin [Phaseolus vulgaris]
Length=285

 Score =   211 bits (537),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 115/150 (77%), Positives = 130/150 (87%), Gaps = 2/150 (1%)
 Frame = +3

Query  63   MTKDVEAVPEQPAEFSAKDYHDPPPSPLIDFDELTKWSFYRAVIAEFIAtllflyvtvlt  242
            M KDVE V EQ  E++AKDY DPPP+PL D +ELT+WSFYRA+IAEFIATLLFLYVTVLT
Sbjct  1    MAKDVE-VQEQ-GEYAAKDYQDPPPAPLFDPEELTQWSFYRALIAEFIATLLFLYVTVLT  58

Query  243  vIGYKHQTDPKAGGQDCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLAR  422
            +IGYK QTD   GG +C GVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFL R
Sbjct  59   IIGYKRQTDANVGGTECDGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLGR  118

Query  423  KVTLPRAVLYMIAQCLGAICGVGVGEGFPE  512
            KV+L RA+LY++AQC GAICG G+ +GF +
Sbjct  119  KVSLIRALLYIVAQCAGAICGTGLAKGFQK  148



>ref|XP_007132257.1| hypothetical protein PHAVU_011G079300g [Phaseolus vulgaris]
 gb|ESW04251.1| hypothetical protein PHAVU_011G079300g [Phaseolus vulgaris]
Length=285

 Score =   211 bits (537),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 115/150 (77%), Positives = 130/150 (87%), Gaps = 2/150 (1%)
 Frame = +3

Query  63   MTKDVEAVPEQPAEFSAKDYHDPPPSPLIDFDELTKWSFYRAVIAEFIAtllflyvtvlt  242
            M KDVE V EQ  E++AKDY DPPP+PL D +ELT+WSFYRA+IAEFIATLLFLYVTVLT
Sbjct  1    MAKDVE-VQEQ-GEYAAKDYQDPPPAPLFDPEELTQWSFYRALIAEFIATLLFLYVTVLT  58

Query  243  vIGYKHQTDPKAGGQDCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLAR  422
            +IGYK QTD   GG +C GVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFL R
Sbjct  59   IIGYKRQTDANVGGTECDGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLGR  118

Query  423  KVTLPRAVLYMIAQCLGAICGVGVGEGFPE  512
            KV+L RA+LY++AQC GAICG G+ +GF +
Sbjct  119  KVSLIRALLYIVAQCAGAICGTGLAKGFQK  148



>gb|KDP29110.1| hypothetical protein JCGZ_16499 [Jatropha curcas]
Length=284

 Score =   211 bits (537),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 115/150 (77%), Positives = 126/150 (84%), Gaps = 5/150 (3%)
 Frame = +3

Query  63   MTKDVEAVPEQPAEFSAKDYHDPPPSPLIDFDELTKWSFYRAVIAEFIAtllflyvtvlt  242
            M KDVE       +F AKDYHDPPP+PLID +E T+WSFYRA+IAEFIATLLFLY+TVLT
Sbjct  1    MGKDVEG-----GDFQAKDYHDPPPAPLIDAEEFTQWSFYRAIIAEFIATLLFLYITVLT  55

Query  243  vIGYKHQTDPKAGGQDCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLAR  422
            VIGYK QTDP      CGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLAR
Sbjct  56   VIGYKSQTDPSKNSDACGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLAR  115

Query  423  KVTLPRAVLYMIAQCLGAICGVGVGEGFPE  512
            KV+L RA+LYM AQCLGAICG G+ + F +
Sbjct  116  KVSLVRAILYMAAQCLGAICGCGLVKAFQK  145



>gb|AHA84284.1| prolactin-inducible protein [Phaseolus vulgaris]
Length=285

 Score =   211 bits (537),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 115/150 (77%), Positives = 130/150 (87%), Gaps = 2/150 (1%)
 Frame = +3

Query  63   MTKDVEAVPEQPAEFSAKDYHDPPPSPLIDFDELTKWSFYRAVIAEFIAtllflyvtvlt  242
            M KDVE V EQ  E++AKDY DPPP+PL D +ELT+WSFYRA+IAEFIATLLFLYVTVLT
Sbjct  1    MAKDVE-VQEQ-GEYAAKDYQDPPPAPLFDPEELTQWSFYRALIAEFIATLLFLYVTVLT  58

Query  243  vIGYKHQTDPKAGGQDCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLAR  422
            +IGYK QTD   GG +C GVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFL R
Sbjct  59   IIGYKRQTDANVGGTECDGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLGR  118

Query  423  KVTLPRAVLYMIAQCLGAICGVGVGEGFPE  512
            KV+L RA+LY++AQC GAICG G+ +GF +
Sbjct  119  KVSLIRALLYIVAQCAGAICGTGLAKGFQK  148



>ref|XP_006410896.1| hypothetical protein EUTSA_v10017874mg [Eutrema salsugineum]
 gb|ESQ52349.1| hypothetical protein EUTSA_v10017874mg [Eutrema salsugineum]
Length=284

 Score =   211 bits (537),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 117/148 (79%), Positives = 126/148 (85%), Gaps = 5/148 (3%)
 Frame = +3

Query  63   MTKDVEAVPEQPAEFSAKDYHDPPPSPLIDFDELTKWSFYRAVIAEFIAtllflyvtvlt  242
            M KDVE        F+A+DY DPPP+P  D +ELTKWS YRAVIAEF+ATLLFLYVTVLT
Sbjct  1    MAKDVEG-----EGFTARDYEDPPPTPFFDAEELTKWSLYRAVIAEFVATLLFLYVTVLT  55

Query  243  vIGYKHQTDPKAGGQDCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLAR  422
            VIGYK Q+D  AGG DCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLAR
Sbjct  56   VIGYKIQSDTAAGGVDCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLAR  115

Query  423  KVTLPRAVLYMIAQCLGAICGVGVGEGF  506
            KV+L RAVLYM+AQCLGAICGVG  + F
Sbjct  116  KVSLIRAVLYMVAQCLGAICGVGFVKAF  143



>ref|XP_011048552.1| PREDICTED: aquaporin PIP2-2-like [Populus euphratica]
Length=285

 Score =   211 bits (537),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 113/150 (75%), Positives = 127/150 (85%), Gaps = 4/150 (3%)
 Frame = +3

Query  63   MTKDVEAVPEQPAEFSAKDYHDPPPSPLIDFDELTKWSFYRAVIAEFIAtllflyvtvlt  242
            M KD+E       EF+AKDYHDPPP+PLID +ELT+WS YRA+IAEFIATLLFLY+TVLT
Sbjct  1    MGKDIEV----GGEFNAKDYHDPPPAPLIDAEELTQWSLYRAIIAEFIATLLFLYITVLT  56

Query  243  vIGYKHQTDPKAGGQDCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLAR  422
            VIGYK Q D    G  CGGVGILGIAWAFGGMIF+LVYCTAGISGGHINPAVTFGLFLAR
Sbjct  57   VIGYKSQIDTTKNGDQCGGVGILGIAWAFGGMIFVLVYCTAGISGGHINPAVTFGLFLAR  116

Query  423  KVTLPRAVLYMIAQCLGAICGVGVGEGFPE  512
            KV+L RA+LYM+AQCLGAICG G+ + F +
Sbjct  117  KVSLVRAILYMVAQCLGAICGCGLVKAFQK  146



>ref|XP_010037961.1| PREDICTED: probable aquaporin PIP2-2 [Eucalyptus grandis]
 gb|KCW49750.1| hypothetical protein EUGRSUZ_K03244 [Eucalyptus grandis]
Length=289

 Score =   211 bits (537),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 109/150 (73%), Positives = 125/150 (83%), Gaps = 0/150 (0%)
 Frame = +3

Query  63   MTKDVEAVPEQPAEFSAKDYHDPPPSPLIDFDELTKWSFYRAVIAEFIAtllflyvtvlt  242
            M KD E V +Q  EF  KDY DPPP+PL+D +EL KWSFYRAVIAEF+ATLLFLY+TVLT
Sbjct  1    MAKDDEVVEQQGGEFHGKDYRDPPPAPLVDAEELVKWSFYRAVIAEFVATLLFLYITVLT  60

Query  243  vIGYKHQTDPKAGGQDCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLAR  422
            VIGY  Q+D   GG  C GVG+LGIAWAFGGMIF+LVYCTAGISGGHINPAVTFGLFLAR
Sbjct  61   VIGYSRQSDTTHGGDQCDGVGLLGIAWAFGGMIFVLVYCTAGISGGHINPAVTFGLFLAR  120

Query  423  KVTLPRAVLYMIAQCLGAICGVGVGEGFPE  512
            +V+L RA+LYM+AQCLGA+CG G+ + F  
Sbjct  121  RVSLVRAILYMVAQCLGAVCGCGLVKAFQR  150



>ref|XP_004496281.1| PREDICTED: aquaporin PIP2-1-like [Cicer arietinum]
Length=287

 Score =   211 bits (537),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 116/148 (78%), Positives = 128/148 (86%), Gaps = 2/148 (1%)
 Frame = +3

Query  63   MTKDVEAVPEQPAEFSAKDYHDPPPSPLIDFDELTKWSFYRAVIAEFIAtllflyvtvlt  242
            M K+VE    +   FS KDYHDPPP+P ID  ELTKWSFYRA+IAEFIATLLFLYVTVLT
Sbjct  1    MAKNVEV--AERGSFSNKDYHDPPPAPFIDAAELTKWSFYRALIAEFIATLLFLYVTVLT  58

Query  243  vIGYKHQTDPKAGGQDCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLAR  422
            VIGY  QTD KAGG  CGGVGILGIAWAFGGMIF+LVYCTAGISGGHINPAVTFGLFLAR
Sbjct  59   VIGYSIQTDIKAGGDVCGGVGILGIAWAFGGMIFVLVYCTAGISGGHINPAVTFGLFLAR  118

Query  423  KVTLPRAVLYMIAQCLGAICGVGVGEGF  506
            KV+L RA++Y++AQCLGAICGVG+ + F
Sbjct  119  KVSLIRAIMYIVAQCLGAICGVGLVKAF  146



>emb|CAB46351.1| major intrinsic protein 2 [Solanum tuberosum]
Length=286

 Score =   211 bits (536),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 116/148 (78%), Positives = 128/148 (86%), Gaps = 1/148 (1%)
 Frame = +3

Query  63   MTKDVEAVPEQPAEFSAKDYHDPPPSPLIDFDELTKWSFYRAVIAEFIAtllflyvtvlt  242
            MTK+VEAV EQ AE+S KDY DPPP+PLIDF+ELTKWS YRAVIA+FIATLLFLY+TVL 
Sbjct  1    MTKEVEAVHEQAAEYSRKDYTDPPPAPLIDFEELTKWSLYRAVIADFIATLLFLYITVLI  60

Query  243  vIGYKHQTDPKAGGQDCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLAR  422
            VIGY  +   K     CGGVG+LGIAWAFGGMIF+LVYCTAGISGGHINPAVTFGLFLAR
Sbjct  61   VIGYNIKPMLKPA-SVCGGVGLLGIAWAFGGMIFVLVYCTAGISGGHINPAVTFGLFLAR  119

Query  423  KVTLPRAVLYMIAQCLGAICGVGVGEGF  506
            KV+L RAVLYM+AQCLGAICGVG  + F
Sbjct  120  KVSLIRAVLYMVAQCLGAICGVGFVKAF  147



>ref|XP_006381455.1| hypothetical protein POPTR_0006s13000g [Populus trichocarpa]
 gb|ABK94847.1| unknown [Populus trichocarpa]
 gb|ERP59252.1| hypothetical protein POPTR_0006s13000g [Populus trichocarpa]
Length=285

 Score =   211 bits (536),  Expect = 4e-64, Method: Compositional matrix adjust.
 Identities = 115/150 (77%), Positives = 126/150 (84%), Gaps = 4/150 (3%)
 Frame = +3

Query  63   MTKDVEAVPEQPAEFSAKDYHDPPPSPLIDFDELTKWSFYRAVIAEFIAtllflyvtvlt  242
            M KDVE       EF AKDYHDPPP+PLID +ELT+WS YRA+IAEFIATLLFLY+TVLT
Sbjct  1    MGKDVEV----RGEFIAKDYHDPPPAPLIDAEELTQWSLYRAIIAEFIATLLFLYITVLT  56

Query  243  vIGYKHQTDPKAGGQDCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLAR  422
            VIGYK QTD       CGGVGILGIAWAFGGMIF+LVYCTAGISGGHINPAVTFGLFLAR
Sbjct  57   VIGYKSQTDTTKNSDACGGVGILGIAWAFGGMIFVLVYCTAGISGGHINPAVTFGLFLAR  116

Query  423  KVTLPRAVLYMIAQCLGAICGVGVGEGFPE  512
            KV+L RAVLYM+AQCLGAICG G+ + F +
Sbjct  117  KVSLVRAVLYMVAQCLGAICGCGLVKAFQK  146



>ref|NP_001105616.1| aquaporin PIP2-5 [Zea mays]
 sp|Q9XF58.1|PIP25_MAIZE RecName: Full=Aquaporin PIP2-5; AltName: Full=Plasma membrane 
intrinsic protein 2-5; AltName: Full=ZmPIP2-5; AltName: Full=ZmPIP2;5; 
AltName: Full=ZmPIP2a [Zea mays]
 gb|AAD28761.1| plasma membrane intrinsic protein [Zea mays]
 gb|AAO86708.1| aquaporin [Zea mays]
 tpg|DAA36903.1| TPA: plasma membrane intrinsic protein2 [Zea mays]
Length=285

 Score =   211 bits (536),  Expect = 4e-64, Method: Compositional matrix adjust.
 Identities = 114/150 (76%), Positives = 128/150 (85%), Gaps = 6/150 (4%)
 Frame = +3

Query  63   MTKDVEAVPEQPAEFSAKDYHDPPPSPLIDFDELTKWSFYRAVIAEFIAtllflyvtvlt  242
            M KD+EA     A    KDY DPPP+PL+D +ELTKWS YRAVIAEF+ATLLFLY+TV T
Sbjct  1    MAKDIEAA----AAHEGKDYSDPPPAPLVDAEELTKWSLYRAVIAEFVATLLFLYITVAT  56

Query  243  vIGYKHQTDPKAGGQD--CGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFL  416
            VIGYKHQTD  A G D  CGGVG+LGIAWAFGGMIFILVYCTAG+SGGHINPAVTFGLFL
Sbjct  57   VIGYKHQTDAAASGPDAACGGVGVLGIAWAFGGMIFILVYCTAGVSGGHINPAVTFGLFL  116

Query  417  ARKVTLPRAVLYMIAQCLGAICGVGVGEGF  506
            ARKV+L RA+LY++AQCLGAICGVG+ +GF
Sbjct  117  ARKVSLVRALLYIVAQCLGAICGVGLVKGF  146



>gb|AHK05706.1| plasma membrane intrinsic protein PIP2;3 [Hevea brasiliensis]
Length=285

 Score =   211 bits (536),  Expect = 4e-64, Method: Compositional matrix adjust.
 Identities = 116/148 (78%), Positives = 125/148 (84%), Gaps = 4/148 (3%)
 Frame = +3

Query  63   MTKDVEAVPEQPAEFSAKDYHDPPPSPLIDFDELTKWSFYRAVIAEFIAtllflyvtvlt  242
            M KDV     +   F AKDYHDPPP+PLID  ELTKWSFYRA+IAEFIATLLFLY+TVLT
Sbjct  1    MVKDVT----EQGSFPAKDYHDPPPAPLIDAVELTKWSFYRALIAEFIATLLFLYITVLT  56

Query  243  vIGYKHQTDPKAGGQDCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLAR  422
            VIGYK QTDP      CGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLAR
Sbjct  57   VIGYKSQTDPAKNADSCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLAR  116

Query  423  KVTLPRAVLYMIAQCLGAICGVGVGEGF  506
            KV+L RAV+YM+AQCLGAI GVG+ + F
Sbjct  117  KVSLVRAVMYMVAQCLGAIAGVGLVKAF  144



>dbj|BAF33069.1| aquaporin [Hordeum vulgare]
 dbj|BAJ85080.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAK07275.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=290

 Score =   211 bits (536),  Expect = 4e-64, Method: Compositional matrix adjust.
 Identities = 115/151 (76%), Positives = 127/151 (84%), Gaps = 4/151 (3%)
 Frame = +3

Query  63   MTKDVEAVPEQPAEFSAKDYHDPPPSPLIDFDELTKWSFYRAVIAEFIAtllflyvtvlt  242
            M KD+EA P    E+ AKDY DPPP+PL D +ELTKWS YRAVIAEF+ATLLFLY+TV T
Sbjct  1    MAKDIEAAPPG-GEYGAKDYSDPPPAPLFDAEELTKWSLYRAVIAEFVATLLFLYITVAT  59

Query  243  vIGYKHQTDP---KAGGQDCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLF  413
            VIGYKHQ DP    A    C GVGILGIAWAFGGMIF+LVYCTAG+SGGHINPAVTFGLF
Sbjct  60   VIGYKHQADPAGPNAADAACSGVGILGIAWAFGGMIFVLVYCTAGVSGGHINPAVTFGLF  119

Query  414  LARKVTLPRAVLYMIAQCLGAICGVGVGEGF  506
            LARKV+L RAVLY+IAQCLGAICGVG+ +GF
Sbjct  120  LARKVSLVRAVLYIIAQCLGAICGVGLVKGF  150



>gb|AAM61438.1| aquaporin (plasma membrane intrinsic protein 2C) [Arabidopsis 
thaliana]
Length=285

 Score =   211 bits (536),  Expect = 4e-64, Method: Compositional matrix adjust.
 Identities = 117/148 (79%), Positives = 125/148 (84%), Gaps = 4/148 (3%)
 Frame = +3

Query  63   MTKDVEAVPEQPAEFSAKDYHDPPPSPLIDFDELTKWSFYRAVIAEFIAtllflyvtvlt  242
            M KDVE        F  +DY DPPP+P  D +ELTKWS YRAVIAEF+ATLLFLYVTVLT
Sbjct  1    MAKDVEG----SDGFQTRDYEDPPPTPFFDAEELTKWSLYRAVIAEFVATLLFLYVTVLT  56

Query  243  vIGYKHQTDPKAGGQDCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLAR  422
            VIGYK Q+D KAGG DCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLAR
Sbjct  57   VIGYKIQSDTKAGGVDCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLAR  116

Query  423  KVTLPRAVLYMIAQCLGAICGVGVGEGF  506
            KV+L RAVLYM+AQCLGAICGVG  + F
Sbjct  117  KVSLIRAVLYMVAQCLGAICGVGFVKAF  144



>emb|CDP06739.1| unnamed protein product [Coffea canephora]
Length=287

 Score =   211 bits (536),  Expect = 5e-64, Method: Compositional matrix adjust.
 Identities = 113/150 (75%), Positives = 126/150 (84%), Gaps = 0/150 (0%)
 Frame = +3

Query  63   MTKDVEAVPEQPAEFSAKDYHDPPPSPLIDFDELTKWSFYRAVIAEFIAtllflyvtvlt  242
            M KD+E        + AKDY DPPP+PL+D +ELT+WSFYRA+IAEFIATLLFLY+TVLT
Sbjct  1    MAKDIEVGGNTHEHYGAKDYQDPPPAPLVDPEELTQWSFYRAIIAEFIATLLFLYITVLT  60

Query  243  vIGYKHQTDPKAGGQDCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLAR  422
            VIGYK Q+D KA G  CGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFL R
Sbjct  61   VIGYKSQSDTKANGDICGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLGR  120

Query  423  KVTLPRAVLYMIAQCLGAICGVGVGEGFPE  512
            KV+L RAVLYM+AQCLGAICG G+ + F  
Sbjct  121  KVSLVRAVLYMVAQCLGAICGCGLVKAFQR  150



>ref|XP_009398603.1| PREDICTED: probable aquaporin PIP2-2 [Musa acuminata subsp. malaccensis]
Length=288

 Score =   210 bits (535),  Expect = 5e-64, Method: Compositional matrix adjust.
 Identities = 115/152 (76%), Positives = 127/152 (84%), Gaps = 3/152 (2%)
 Frame = +3

Query  63   MTKDVEAVPEQPAEFSAKDYHDPPPSPLIDFDELTKWSFYRAVIAEFIAtllflyvtvlt  242
            M KDVEA      E++ KDY DPPP+PL D++ELTKWS YRA IAEFIAT+LFLYVTV T
Sbjct  1    MAKDVEAAAGH-GEYAVKDYTDPPPAPLFDWEELTKWSLYRAAIAEFIATMLFLYVTVAT  59

Query  243  vIGYKHQTDPKAGGQD--CGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFL  416
            VIGYKHQ+DP     D  C GVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFL
Sbjct  60   VIGYKHQSDPNVNPTDAACSGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFL  119

Query  417  ARKVTLPRAVLYMIAQCLGAICGVGVGEGFPE  512
            ARKV+L RA+LYMI QCLGAICGVG+ +GF +
Sbjct  120  ARKVSLIRALLYMIGQCLGAICGVGLVKGFQK  151



>ref|XP_004156296.1| PREDICTED: aquaporin PIP2-2-like [Cucumis sativus]
Length=284

 Score =   210 bits (535),  Expect = 5e-64, Method: Compositional matrix adjust.
 Identities = 113/152 (74%), Positives = 130/152 (86%), Gaps = 5/152 (3%)
 Frame = +3

Query  63   MTKDVEAVPEQPAEFSAKDYHDPPPSPLIDFDELTKWSFYRAVIAEFIAtllflyvtvlt  242
            M+KD+EA       F+ KDY DPPP+PLID +ELT+WSFYRA+IAEF+ATLLFLYVTVLT
Sbjct  1    MSKDLEA-----GGFAVKDYQDPPPAPLIDAEELTQWSFYRAIIAEFVATLLFLYVTVLT  55

Query  243  vIGYKHQTDPKAGGQDCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLAR  422
            VIGY  Q+D K GGQ CGGVGILGIAWAFGGMIF+LVYCTAGISGGHINPAVTFGLFLAR
Sbjct  56   VIGYSSQSDTKNGGQICGGVGILGIAWAFGGMIFVLVYCTAGISGGHINPAVTFGLFLAR  115

Query  423  KVTLPRAVLYMIAQCLGAICGVGVGEGFPEVI  518
            KV+L RA+LYM+AQCLGAICG  + + F + +
Sbjct  116  KVSLIRAILYMVAQCLGAICGCALVKSFQKAL  147



>gb|ABI96813.1| plasma membrane intrinsic protein [Triticum aestivum]
Length=290

 Score =   210 bits (535),  Expect = 5e-64, Method: Compositional matrix adjust.
 Identities = 114/151 (75%), Positives = 128/151 (85%), Gaps = 4/151 (3%)
 Frame = +3

Query  63   MTKDVEAVPEQPAEFSAKDYHDPPPSPLIDFDELTKWSFYRAVIAEFIAtllflyvtvlt  242
            M KD+EA P    E++AKDY DPPP+PL D +ELTKWS YRAVIAEF+ATLLFLY+TV T
Sbjct  1    MAKDIEAAPPG-GEYAAKDYSDPPPAPLFDAEELTKWSLYRAVIAEFVATLLFLYITVAT  59

Query  243  vIGYKHQTDP---KAGGQDCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLF  413
            VIGYKHQ DP    A    C GVGILGIAWAFGGMIF+LVYCTAG+SGGHINPAVTFGLF
Sbjct  60   VIGYKHQADPAGPNAADAACSGVGILGIAWAFGGMIFVLVYCTAGVSGGHINPAVTFGLF  119

Query  414  LARKVTLPRAVLYMIAQCLGAICGVGVGEGF  506
            LARKV+L RA+LY+IAQCLGAICGVG+ +GF
Sbjct  120  LARKVSLVRALLYIIAQCLGAICGVGLVKGF  150



>ref|XP_004304427.1| PREDICTED: aquaporin PIP2-1-like [Fragaria vesca subsp. vesca]
Length=287

 Score =   210 bits (535),  Expect = 5e-64, Method: Compositional matrix adjust.
 Identities = 114/152 (75%), Positives = 129/152 (85%), Gaps = 2/152 (1%)
 Frame = +3

Query  63   MTKDVEAVPEQPAEFSAKDYHDPPPSPLIDFDELTKWSFYRAVIAEFIAtllflyvtvlt  242
            M KD+E  P+    FSAKDY+DPPP+PLID +E  KWSFYRA+IAEFIATLLFLY+TVLT
Sbjct  1    MGKDIEVGPQ--GGFSAKDYNDPPPTPLIDAEEFGKWSFYRAIIAEFIATLLFLYITVLT  58

Query  243  vIGYKHQTDPKAGGQDCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLAR  422
            VIGYK Q+D   GG  CGGVGILGIAWAFGGMIF+LVYCTAGISGGHINPAVTFGLFLAR
Sbjct  59   VIGYKSQSDTLKGGDQCGGVGILGIAWAFGGMIFVLVYCTAGISGGHINPAVTFGLFLAR  118

Query  423  KVTLPRAVLYMIAQCLGAICGVGVGEGFPEVI  518
            KV+LPRAVLY++AQ LGAICG G+ + F   +
Sbjct  119  KVSLPRAVLYIVAQSLGAICGCGLVKSFQSAL  150



>emb|CAH60724.1| putative plasma membrane intrinsic protein [Populus tremula x 
Populus tremuloides]
Length=285

 Score =   210 bits (535),  Expect = 6e-64, Method: Compositional matrix adjust.
 Identities = 114/150 (76%), Positives = 127/150 (85%), Gaps = 4/150 (3%)
 Frame = +3

Query  63   MTKDVEAVPEQPAEFSAKDYHDPPPSPLIDFDELTKWSFYRAVIAEFIAtllflyvtvlt  242
            M KD+E       EF AKDYHDPPP+PLID +ELT+WS YRAVIAEFIATLLFLY+TVLT
Sbjct  1    MGKDIEV----GGEFIAKDYHDPPPAPLIDAEELTQWSLYRAVIAEFIATLLFLYITVLT  56

Query  243  vIGYKHQTDPKAGGQDCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLAR  422
            VIGYK QTD    G  CGGVG+LGIAWAFGGMIF+LVYCTAGISGGHINPAVTFGLFLAR
Sbjct  57   VIGYKSQTDTAKNGDVCGGVGVLGIAWAFGGMIFVLVYCTAGISGGHINPAVTFGLFLAR  116

Query  423  KVTLPRAVLYMIAQCLGAICGVGVGEGFPE  512
            KV+L RA+LYM+AQCLGAICG G+ + F +
Sbjct  117  KVSLVRAILYMVAQCLGAICGCGLVKAFQK  146



>gb|AHW81492.1| ECFP-tagged plasma membrane intrinsic protein 2a [Cloning vector 
pBullet-pm-n]
 gb|AHW81510.1| ECFP-tagged plasma membrane intrinsic protein 2a [Cloning vector 
pBullet-pm-c]
Length=531

 Score =   217 bits (552),  Expect = 6e-64, Method: Compositional matrix adjust.
 Identities = 119/148 (80%), Positives = 129/148 (87%), Gaps = 2/148 (1%)
 Frame = +3

Query  63   MTKDVEAVPEQPAEFSAKDYHDPPPSPLIDFDELTKWSFYRAVIAEFIAtllflyvtvlt  242
            M KDVEAVP +   F  +DY DPPP+P ID  EL KWSFYRAVIAEF+ATLLFLY+TVLT
Sbjct  1    MAKDVEAVPGE--GFQTRDYQDPPPAPFIDGAELKKWSFYRAVIAEFVATLLFLYITVLT  58

Query  243  vIGYKHQTDPKAGGQDCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLAR  422
            VIGYK Q+D  AGG DCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLAR
Sbjct  59   VIGYKIQSDTDAGGVDCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLAR  118

Query  423  KVTLPRAVLYMIAQCLGAICGVGVGEGF  506
            KV+LPRA+LY+IAQCLGAICGVG  + F
Sbjct  119  KVSLPRALLYIIAQCLGAICGVGFVKAF  146



>ref|XP_008449253.1| PREDICTED: aquaporin PIP2-2-like isoform X3 [Cucumis melo]
Length=284

 Score =   210 bits (534),  Expect = 7e-64, Method: Compositional matrix adjust.
 Identities = 113/152 (74%), Positives = 130/152 (86%), Gaps = 5/152 (3%)
 Frame = +3

Query  63   MTKDVEAVPEQPAEFSAKDYHDPPPSPLIDFDELTKWSFYRAVIAEFIAtllflyvtvlt  242
            M+KD+EA       F+ KDY DPPP+PLID +ELT+WSFYRA+IAEF+ATLLFLYVTVLT
Sbjct  1    MSKDLEA-----GGFAVKDYQDPPPAPLIDAEELTQWSFYRAIIAEFVATLLFLYVTVLT  55

Query  243  vIGYKHQTDPKAGGQDCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLAR  422
            VIGY  Q+D K+GGQ CGGVGILGIAWAFGGMIF+LVYCTAGISGGHINPAVTFGLFLAR
Sbjct  56   VIGYSSQSDTKSGGQICGGVGILGIAWAFGGMIFVLVYCTAGISGGHINPAVTFGLFLAR  115

Query  423  KVTLPRAVLYMIAQCLGAICGVGVGEGFPEVI  518
            KV+L RA+LYM AQCLGAICG  + + F + +
Sbjct  116  KVSLIRAILYMAAQCLGAICGCALVKSFQKAL  147



>ref|XP_006410897.1| hypothetical protein EUTSA_v10017041mg [Eutrema salsugineum]
 gb|ESQ52350.1| hypothetical protein EUTSA_v10017041mg [Eutrema salsugineum]
Length=285

 Score =   210 bits (534),  Expect = 7e-64, Method: Compositional matrix adjust.
 Identities = 117/148 (79%), Positives = 125/148 (84%), Gaps = 4/148 (3%)
 Frame = +3

Query  63   MTKDVEAVPEQPAEFSAKDYHDPPPSPLIDFDELTKWSFYRAVIAEFIAtllflyvtvlt  242
            M KDVE     PA    +DY DPPP+P  D +ELTKWS YRAVIAEF+ATLLFLYVTVLT
Sbjct  1    MAKDVEGAEGFPA----RDYEDPPPTPFFDAEELTKWSLYRAVIAEFVATLLFLYVTVLT  56

Query  243  vIGYKHQTDPKAGGQDCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLAR  422
            VIGYK Q+D  AGG DCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLAR
Sbjct  57   VIGYKIQSDTTAGGVDCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLAR  116

Query  423  KVTLPRAVLYMIAQCLGAICGVGVGEGF  506
            KV+L RAVLYM+AQCLGAICGVG  + F
Sbjct  117  KVSLIRAVLYMVAQCLGAICGVGFVKAF  144



>ref|XP_007016740.1| Plasma membrane intrinsic protein 2,4 [Theobroma cacao]
 gb|EOY34359.1| Plasma membrane intrinsic protein 2,4 [Theobroma cacao]
Length=289

 Score =   210 bits (535),  Expect = 7e-64, Method: Compositional matrix adjust.
 Identities = 115/152 (76%), Positives = 128/152 (84%), Gaps = 2/152 (1%)
 Frame = +3

Query  63   MTKDVEAVPEQPAEFSAKDYHDPPPSPLIDFDELTKWSFYRAVIAEFIAtllflyvtvlt  242
            M K+VE   +   EFSAKDYHDPPP+PLID +EL KWSFYRA+IAEFIATLLFLYV+VLT
Sbjct  1    MAKEVETAEQGGGEFSAKDYHDPPPAPLIDAEELFKWSFYRALIAEFIATLLFLYVSVLT  60

Query  243  vIGYKHQTD--PKAGGQDCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFL  416
            VIGYK QTD        DCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFL
Sbjct  61   VIGYKVQTDTLKNTVDADCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFL  120

Query  417  ARKVTLPRAVLYMIAQCLGAICGVGVGEGFPE  512
             RKV+L RA++YM+AQCLGAICG G+ + F +
Sbjct  121  GRKVSLIRAIMYMVAQCLGAICGCGLVKAFQK  152



>dbj|BAD90699.1| plasma membrane intrinsic protein 2;3 [Mimosa pudica]
Length=288

 Score =   210 bits (534),  Expect = 8e-64, Method: Compositional matrix adjust.
 Identities = 117/151 (77%), Positives = 130/151 (86%), Gaps = 3/151 (2%)
 Frame = +3

Query  63   MTKDVEAVPEQPAEFSAKDYHDPPPSPLIDFDELTKWSFYRAVIAEFIAtllflyvtvlt  242
            M KDVE    +   +SAKDYHDPPP+PLID +EL KWSFYRA+IAEFIATLLFLY+TVLT
Sbjct  1    MAKDVEV--AERGSYSAKDYHDPPPAPLIDAEELGKWSFYRALIAEFIATLLFLYITVLT  58

Query  243  vIGYKHQTDPK-AGGQDCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLA  419
            VIGYK QTD   A G  CGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLA
Sbjct  59   VIGYKSQTDTTVATGDVCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLA  118

Query  420  RKVTLPRAVLYMIAQCLGAICGVGVGEGFPE  512
            RKV+L RA+LY++AQCLGAICGVG+ + F +
Sbjct  119  RKVSLIRAILYIVAQCLGAICGVGLVKAFQK  149



>gb|KEH39328.1| major intrinsic protein (MIP) family transporter [Medicago truncatula]
Length=268

 Score =   209 bits (532),  Expect = 9e-64, Method: Compositional matrix adjust.
 Identities = 113/149 (76%), Positives = 126/149 (85%), Gaps = 2/149 (1%)
 Frame = +3

Query  63   MTKDVEAVPEQPAEFSAKDYHDPPPSPLIDFDELTKWSFYRAVIAEFIAtllflyvtvlt  242
            M KDVE V EQ  EFSAKDY DPPP+PL D DELTKWS YRAVIAEF+ATLLFLY+TVLT
Sbjct  1    MGKDVE-VQEQGGEFSAKDYQDPPPAPLFDLDELTKWSLYRAVIAEFVATLLFLYITVLT  59

Query  243  vIGYKHQTDPK-AGGQDCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLA  419
            +IGY  Q+D    G  +C GVG+LGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLF+ 
Sbjct  60   IIGYSRQSDTTIKGNTECDGVGVLGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFVG  119

Query  420  RKVTLPRAVLYMIAQCLGAICGVGVGEGF  506
            RKV+L RA LY++AQCLGAICG G+ +GF
Sbjct  120  RKVSLIRAFLYIVAQCLGAICGAGLAKGF  148



>dbj|BAB40143.1| plasma membrane intrinsic protein 2-2 [Pyrus communis]
Length=287

 Score =   210 bits (534),  Expect = 9e-64, Method: Compositional matrix adjust.
 Identities = 115/150 (77%), Positives = 126/150 (84%), Gaps = 2/150 (1%)
 Frame = +3

Query  63   MTKDVEAVPEQPAEFSAKDYHDPPPSPLIDFDELTKWSFYRAVIAEFIAtllflyvtvlt  242
            M KD+E    +   FSAKDYHDPPP+PLID  ELTKWSFYRA+IAEF+ATLLFLYVTVLT
Sbjct  1    MAKDMEV--AERGSFSAKDYHDPPPAPLIDAAELTKWSFYRALIAEFVATLLFLYVTVLT  58

Query  243  vIGYKHQTDPKAGGQDCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLAR  422
            VIGYK QTDP      CGGVGILGIAWAFGGMIF+LVYCTAGISGGHINPAVTFGLFLAR
Sbjct  59   VIGYKSQTDPAVNADACGGVGILGIAWAFGGMIFVLVYCTAGISGGHINPAVTFGLFLAR  118

Query  423  KVTLPRAVLYMIAQCLGAICGVGVGEGFPE  512
            KV+L RAVLYM+AQ LGAI GV + + F +
Sbjct  119  KVSLVRAVLYMVAQSLGAIAGVALVKAFQK  148



>gb|KHG08488.1| putative aquaporin PIP2-2 [Gossypium arboreum]
Length=285

 Score =   209 bits (533),  Expect = 9e-64, Method: Compositional matrix adjust.
 Identities = 118/152 (78%), Positives = 129/152 (85%), Gaps = 5/152 (3%)
 Frame = +3

Query  63   MTKDVEAVPEQPAEFSAKDYHDPPPSPLIDFDELTKWSFYRAVIAEFIAtllflyvtvlt  242
            M KD+E+  EQ    S KDYHDPPP+PLID +ELTKWSFYRAVIAEFIATLLFLYVTVLT
Sbjct  1    MGKDIESSVEQ---VSGKDYHDPPPAPLIDAEELTKWSFYRAVIAEFIATLLFLYVTVLT  57

Query  243  vIGYKHQTDP--KAGGQDCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFL  416
            VIGYK QTDP       DCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFL
Sbjct  58   VIGYKVQTDPLKNTVDPDCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFL  117

Query  417  ARKVTLPRAVLYMIAQCLGAICGVGVGEGFPE  512
             RKV+L RA++YM+AQCLGAICG G+ + F +
Sbjct  118  GRKVSLIRAIMYMVAQCLGAICGCGLVKAFQK  149



>ref|XP_007027328.1| Plasma membrane intrinsic protein 2 [Theobroma cacao]
 gb|EOY07830.1| Plasma membrane intrinsic protein 2 [Theobroma cacao]
Length=283

 Score =   209 bits (533),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 115/150 (77%), Positives = 128/150 (85%), Gaps = 6/150 (4%)
 Frame = +3

Query  63   MTKDVEAVPEQPAEFSAKDYHDPPPSPLIDFDELTKWSFYRAVIAEFIAtllflyvtvlt  242
            M KD+E       +F AKDYHDPPP+PL+D +ELTKWSFYRA+IAEFIATLLFLY+TVLT
Sbjct  1    MAKDIEV----GGQFQAKDYHDPPPAPLVDAEELTKWSFYRAIIAEFIATLLFLYITVLT  56

Query  243  vIGYKHQTDPKAGGQDCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLAR  422
            VIGYK Q D   GG +CGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLAR
Sbjct  57   VIGYKSQIDK--GGDECGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLAR  114

Query  423  KVTLPRAVLYMIAQCLGAICGVGVGEGFPE  512
            KV+L RA+LYM AQCLGAICG G+ + F +
Sbjct  115  KVSLVRAILYMAAQCLGAICGCGLVKAFQK  144



>ref|XP_008365039.1| PREDICTED: probable aquaporin PIP2-5 [Malus domestica]
Length=287

 Score =   209 bits (533),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 115/150 (77%), Positives = 126/150 (84%), Gaps = 2/150 (1%)
 Frame = +3

Query  63   MTKDVEAVPEQPAEFSAKDYHDPPPSPLIDFDELTKWSFYRAVIAEFIAtllflyvtvlt  242
            M KD+E    +   FSAKDYHDPPP+PLID  ELTKWSFYRA+IAEF+ATLLFLYVTVLT
Sbjct  1    MAKDMEV--AERGSFSAKDYHDPPPAPLIDSAELTKWSFYRALIAEFVATLLFLYVTVLT  58

Query  243  vIGYKHQTDPKAGGQDCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLAR  422
            VIGYK QTDP      CGGVGILGIAWAFGGMIF+LVYCTAGISGGHINPAVTFGLFLAR
Sbjct  59   VIGYKSQTDPATNADACGGVGILGIAWAFGGMIFVLVYCTAGISGGHINPAVTFGLFLAR  118

Query  423  KVTLPRAVLYMIAQCLGAICGVGVGEGFPE  512
            KV+L RAVLYM+AQ LGAI GV + + F +
Sbjct  119  KVSLVRAVLYMVAQSLGAIAGVALVKAFQK  148



>ref|XP_010509371.1| PREDICTED: aquaporin PIP2-2-like [Camelina sativa]
Length=285

 Score =   209 bits (533),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 116/148 (78%), Positives = 125/148 (84%), Gaps = 4/148 (3%)
 Frame = +3

Query  63   MTKDVEAVPEQPAEFSAKDYHDPPPSPLIDFDELTKWSFYRAVIAEFIAtllflyvtvlt  242
            M KDVE        + A+DY DPPP+P  D +ELTKWS YRAVIAEF+ATLLFLYVTVLT
Sbjct  1    MAKDVEGAEG----YQARDYEDPPPTPFFDAEELTKWSLYRAVIAEFVATLLFLYVTVLT  56

Query  243  vIGYKHQTDPKAGGQDCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLAR  422
            VIGYK Q+D  AGG DCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLAR
Sbjct  57   VIGYKIQSDTTAGGVDCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLAR  116

Query  423  KVTLPRAVLYMIAQCLGAICGVGVGEGF  506
            KV+L RAVLYM+AQCLGAICGVG  + F
Sbjct  117  KVSLIRAVLYMVAQCLGAICGVGFVKAF  144



>ref|XP_010516976.1| PREDICTED: aquaporin PIP2-2-like [Camelina sativa]
Length=285

 Score =   209 bits (533),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 117/148 (79%), Positives = 124/148 (84%), Gaps = 4/148 (3%)
 Frame = +3

Query  63   MTKDVEAVPEQPAEFSAKDYHDPPPSPLIDFDELTKWSFYRAVIAEFIAtllflyvtvlt  242
            M K VE        + A+DY DPPP+P  D DELTKWS YRAVIAEF+ATLLFLYVTVLT
Sbjct  1    MAKGVEGAEG----YQARDYEDPPPTPFFDADELTKWSLYRAVIAEFVATLLFLYVTVLT  56

Query  243  vIGYKHQTDPKAGGQDCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLAR  422
            VIGYK Q+D  AGG DCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLAR
Sbjct  57   VIGYKIQSDTTAGGVDCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLAR  116

Query  423  KVTLPRAVLYMIAQCLGAICGVGVGEGF  506
            KVTL RAVLYM+AQCLGAICGVG  + F
Sbjct  117  KVTLIRAVLYMVAQCLGAICGVGFVKAF  144



>gb|ACU00103.1| plasma membrane intrinsic protein PIP2.1 [Populus trichocarpa 
x Populus deltoides]
Length=285

 Score =   209 bits (533),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 114/150 (76%), Positives = 126/150 (84%), Gaps = 4/150 (3%)
 Frame = +3

Query  63   MTKDVEAVPEQPAEFSAKDYHDPPPSPLIDFDELTKWSFYRAVIAEFIAtllflyvtvlt  242
            M KD+E       EF AKDYHDPPP+PLID +ELT+WS YRA+IAEFIATLLFLY+TVLT
Sbjct  1    MGKDIEV----GREFIAKDYHDPPPAPLIDAEELTQWSLYRAIIAEFIATLLFLYITVLT  56

Query  243  vIGYKHQTDPKAGGQDCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLAR  422
            VIGYK QTD       CGGVGILGIAWAFGGMIF+LVYCTAGISGGHINPAVTFGLFLAR
Sbjct  57   VIGYKSQTDTTKNSDACGGVGILGIAWAFGGMIFVLVYCTAGISGGHINPAVTFGLFLAR  116

Query  423  KVTLPRAVLYMIAQCLGAICGVGVGEGFPE  512
            KV+L RAVLYM+AQCLGAICG G+ + F +
Sbjct  117  KVSLVRAVLYMVAQCLGAICGCGLVKAFQK  146



>ref|XP_009345382.1| PREDICTED: probable aquaporin PIP2-5 [Pyrus x bretschneideri]
Length=287

 Score =   209 bits (532),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 115/150 (77%), Positives = 126/150 (84%), Gaps = 2/150 (1%)
 Frame = +3

Query  63   MTKDVEAVPEQPAEFSAKDYHDPPPSPLIDFDELTKWSFYRAVIAEFIAtllflyvtvlt  242
            M KD+E    +   FSAKDYHDPPP+PLID  ELTKWSFYRA+IAEF+ATLLFLYVTVLT
Sbjct  1    MAKDMEV--AERGSFSAKDYHDPPPAPLIDAAELTKWSFYRALIAEFVATLLFLYVTVLT  58

Query  243  vIGYKHQTDPKAGGQDCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLAR  422
            VIGYK QTDP      CGGVGILGIAWAFGGMIF+LVYCTAGISGGHINPAVTFGLFLAR
Sbjct  59   VIGYKSQTDPAVNADACGGVGILGIAWAFGGMIFVLVYCTAGISGGHINPAVTFGLFLAR  118

Query  423  KVTLPRAVLYMIAQCLGAICGVGVGEGFPE  512
            KV+L RAVLYM+AQ LGAI GV + + F +
Sbjct  119  KVSLVRAVLYMVAQSLGAIAGVALVKAFQK  148



>emb|CDX91341.1| BnaC04g08090D [Brassica napus]
Length=285

 Score =   209 bits (532),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 115/148 (78%), Positives = 126/148 (85%), Gaps = 4/148 (3%)
 Frame = +3

Query  63   MTKDVEAVPEQPAEFSAKDYHDPPPSPLIDFDELTKWSFYRAVIAEFIAtllflyvtvlt  242
            M KDVE        F+A+DY DPPP+P  D +ELTKWS YRAVIAEF+ATLLFLYVTVLT
Sbjct  1    MAKDVEGAEG----FAARDYEDPPPTPFFDAEELTKWSLYRAVIAEFVATLLFLYVTVLT  56

Query  243  vIGYKHQTDPKAGGQDCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLAR  422
            VIGYK  +D KAGG +CGGVGILGI+WAFGGMIFILVYCTAGISGGHINPAVTFGLFLAR
Sbjct  57   VIGYKISSDTKAGGDECGGVGILGISWAFGGMIFILVYCTAGISGGHINPAVTFGLFLAR  116

Query  423  KVTLPRAVLYMIAQCLGAICGVGVGEGF  506
            KV+L RAVLYM+AQCLGAICGVG  + F
Sbjct  117  KVSLIRAVLYMVAQCLGAICGVGFVKAF  144



>ref|XP_003556232.1| PREDICTED: aquaporin PIP2-1-like [Glycine max]
 gb|KHN00839.1| Putative aquaporin PIP2-5 [Glycine soja]
Length=284

 Score =   209 bits (532),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 116/150 (77%), Positives = 128/150 (85%), Gaps = 5/150 (3%)
 Frame = +3

Query  63   MTKDVEAVPEQPAEFSAKDYHDPPPSPLIDFDELTKWSFYRAVIAEFIAtllflyvtvlt  242
            M KDVE    +   FS KDY DPPP+PLID +ELTKWSFYRA+IAEFIATLLFLY+TVLT
Sbjct  1    MAKDVEV--AERGSFSGKDYQDPPPAPLIDAEELTKWSFYRALIAEFIATLLFLYITVLT  58

Query  243  vIGYKHQTDPKAGGQDCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLAR  422
            VIGYKHQTD       CGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLAR
Sbjct  59   VIGYKHQTDH---ADACGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLAR  115

Query  423  KVTLPRAVLYMIAQCLGAICGVGVGEGFPE  512
            KV+L RA++YM+AQCLGAICGVG+ + F +
Sbjct  116  KVSLIRAIMYMVAQCLGAICGVGLVKAFQK  145



>gb|KJB21561.1| hypothetical protein B456_004G001400 [Gossypium raimondii]
Length=285

 Score =   209 bits (532),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 118/152 (78%), Positives = 129/152 (85%), Gaps = 5/152 (3%)
 Frame = +3

Query  63   MTKDVEAVPEQPAEFSAKDYHDPPPSPLIDFDELTKWSFYRAVIAEFIAtllflyvtvlt  242
            M KD+E+  EQ    S KDYHDPPP+PLID +ELTKWSFYRAVIAEFIATLLFLYVTVLT
Sbjct  1    MGKDIESSVEQG---SGKDYHDPPPAPLIDAEELTKWSFYRAVIAEFIATLLFLYVTVLT  57

Query  243  vIGYKHQTDP--KAGGQDCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFL  416
            VIGYK QTDP       DCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFL
Sbjct  58   VIGYKVQTDPLKNTVDPDCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFL  117

Query  417  ARKVTLPRAVLYMIAQCLGAICGVGVGEGFPE  512
             RKV+L RA++YM+AQCLGAICG G+ + F +
Sbjct  118  GRKVSLIRAIMYMVAQCLGAICGCGLVKAFQK  149



>gb|AHA84128.1| plasma membrane integral protein ZmPIP2-7 [Phaseolus vulgaris]
Length=287

 Score =   209 bits (532),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 115/151 (76%), Positives = 126/151 (83%), Gaps = 2/151 (1%)
 Frame = +3

Query  63   MTKDVEAVPEQPAEFSAKDYHDPPPSPLIDFDELTKWSFYRAVIAEFIAtllflyvtvlt  242
            M KDVE V EQP E+SAKDYHDPPP+PL D DELTKWS YRA IAEFIATLLFLY+TVLT
Sbjct  1    MAKDVEQVTEQP-EYSAKDYHDPPPAPLFDPDELTKWSLYRAAIAEFIATLLFLYITVLT  59

Query  243  vIGYKHQTDPKA-GGQDCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLA  419
            +IGYK QTD    G  +C GVGILGIAWAFGGMIFILVYCTAGISGGHINPAVT GLFL 
Sbjct  60   IIGYKRQTDTSIPGNTECDGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTLGLFLG  119

Query  420  RKVTLPRAVLYMIAQCLGAICGVGVGEGFPE  512
            RKV+L RA+LY++AQC GAI G G+ E F +
Sbjct  120  RKVSLVRALLYIVAQCAGAISGAGLAEAFQK  150



>ref|XP_009143524.1| PREDICTED: aquaporin PIP2-2 [Brassica rapa]
Length=285

 Score =   209 bits (532),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 115/148 (78%), Positives = 126/148 (85%), Gaps = 4/148 (3%)
 Frame = +3

Query  63   MTKDVEAVPEQPAEFSAKDYHDPPPSPLIDFDELTKWSFYRAVIAEFIAtllflyvtvlt  242
            M KDVE        F+A+DY DPPP+P  D +ELTKWS YRAVIAEF+ATLLFLYVTVLT
Sbjct  1    MAKDVEGAEG----FAARDYEDPPPTPFFDAEELTKWSLYRAVIAEFVATLLFLYVTVLT  56

Query  243  vIGYKHQTDPKAGGQDCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLAR  422
            VIGYK  +D KAGG +CGGVGILGI+WAFGGMIFILVYCTAGISGGHINPAVTFGLFLAR
Sbjct  57   VIGYKISSDTKAGGDECGGVGILGISWAFGGMIFILVYCTAGISGGHINPAVTFGLFLAR  116

Query  423  KVTLPRAVLYMIAQCLGAICGVGVGEGF  506
            KV+L RAVLYM+AQCLGAICGVG  + F
Sbjct  117  KVSLVRAVLYMVAQCLGAICGVGFVKAF  144



>gb|AGC24024.1| plasma membrane intrinsic protein 1 [Lilium hybrid cultivar]
Length=288

 Score =   209 bits (532),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 116/152 (76%), Positives = 127/152 (84%), Gaps = 3/152 (2%)
 Frame = +3

Query  63   MTKDVEAVPEQPAEFSAKDYHDPPPSPLIDFDELTKWSFYRAVIAEFIAtllflyvtvlt  242
            M KD+EA      EF AKDY DPPP+P +   ELTKWSFYRA+IAEF+ATLLFLY+TV T
Sbjct  1    MAKDIEAA-AGAGEFPAKDYTDPPPAPFLGIGELTKWSFYRALIAEFVATLLFLYITVAT  59

Query  243  vIGYKHQTDPKAG--GQDCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFL  416
            VIGYKHQ+D   G    DC GVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFL
Sbjct  60   VIGYKHQSDTTLGTPNADCEGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFL  119

Query  417  ARKVTLPRAVLYMIAQCLGAICGVGVGEGFPE  512
            ARKV+L RAVLYMIAQCLGAICGVG+ +GF +
Sbjct  120  ARKVSLIRAVLYMIAQCLGAICGVGLVKGFQK  151



>ref|XP_003597235.1| Aquaporin PIP2-7 [Medicago truncatula]
 gb|AES67486.1| major intrinsic protein (MIP) family transporter [Medicago truncatula]
Length=287

 Score =   209 bits (531),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 113/149 (76%), Positives = 126/149 (85%), Gaps = 2/149 (1%)
 Frame = +3

Query  63   MTKDVEAVPEQPAEFSAKDYHDPPPSPLIDFDELTKWSFYRAVIAEFIAtllflyvtvlt  242
            M KDVE V EQ  EFSAKDY DPPP+PL D DELTKWS YRAVIAEF+ATLLFLY+TVLT
Sbjct  1    MGKDVE-VQEQGGEFSAKDYQDPPPAPLFDLDELTKWSLYRAVIAEFVATLLFLYITVLT  59

Query  243  vIGYKHQTDPK-AGGQDCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLA  419
            +IGY  Q+D    G  +C GVG+LGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLF+ 
Sbjct  60   IIGYSRQSDTTIKGNTECDGVGVLGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFVG  119

Query  420  RKVTLPRAVLYMIAQCLGAICGVGVGEGF  506
            RKV+L RA LY++AQCLGAICG G+ +GF
Sbjct  120  RKVSLIRAFLYIVAQCLGAICGAGLAKGF  148



>ref|XP_010043748.1| PREDICTED: probable aquaporin PIP2-4 [Eucalyptus grandis]
 gb|KCW85737.1| hypothetical protein EUGRSUZ_B02499 [Eucalyptus grandis]
Length=284

 Score =   209 bits (531),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 113/148 (76%), Positives = 128/148 (86%), Gaps = 3/148 (2%)
 Frame = +3

Query  63   MTKDVEAVPEQPAEFSAKDYHDPPPSPLIDFDELTKWSFYRAVIAEFIAtllflyvtvlt  242
            M KD+E    QP   +A+DY DPPP+PL+D +EL KWSFYRA+IAEFIAT+LFLY+TVLT
Sbjct  1    MGKDLEG--AQP-PLAARDYQDPPPAPLVDPEELGKWSFYRALIAEFIATMLFLYITVLT  57

Query  243  vIGYKHQTDPKAGGQDCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLAR  422
            VIGYK QTDP   G DCGGVGILGIAWAFGGMIF+LVYCTAGISGGHINPAVTFGLFLAR
Sbjct  58   VIGYKSQTDPTMNGSDCGGVGILGIAWAFGGMIFVLVYCTAGISGGHINPAVTFGLFLAR  117

Query  423  KVTLPRAVLYMIAQCLGAICGVGVGEGF  506
            KV+L RAV+YM+AQCLGAICG G+ + F
Sbjct  118  KVSLVRAVMYMVAQCLGAICGCGLVKAF  145



>gb|AFH36338.1| aquaporin PIP2;3 [Quercus petraea]
Length=286

 Score =   209 bits (531),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 116/148 (78%), Positives = 125/148 (84%), Gaps = 4/148 (3%)
 Frame = +3

Query  63   MTKDVEAVPEQPAEFSAKDYHDPPPSPLIDFDELTKWSFYRAVIAEFIAtllflyvtvlt  242
            MTKDV     +   F AKDYHDPPP+PL D  ELTKWSFYRA+IAEF+ATLLFLYVTVLT
Sbjct  1    MTKDVA----EHGSFPAKDYHDPPPAPLFDPVELTKWSFYRALIAEFVATLLFLYVTVLT  56

Query  243  vIGYKHQTDPKAGGQDCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLAR  422
            VIGYK Q DP   G  CGGVGILGIAWAFGGMIF+LVYCTAGISGGHINPAVTFGLFLAR
Sbjct  57   VIGYKSQIDPALKGDACGGVGILGIAWAFGGMIFVLVYCTAGISGGHINPAVTFGLFLAR  116

Query  423  KVTLPRAVLYMIAQCLGAICGVGVGEGF  506
            KV+L RAVLYM+AQCLGAICGV + + F
Sbjct  117  KVSLIRAVLYMVAQCLGAICGVALVKAF  144



>gb|ADJ67992.1| aquaporin [Fragaria x ananassa]
Length=285

 Score =   209 bits (531),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 116/150 (77%), Positives = 126/150 (84%), Gaps = 2/150 (1%)
 Frame = +3

Query  63   MTKDVEAVPEQPAEFSAKDYHDPPPSPLIDFDELTKWSFYRAVIAEFIAtllflyvtvlt  242
            M KDVE    +   FSAKDYHDPPP+PL D  ELTKWSFYRAVIAEFIATLLFLY+TVLT
Sbjct  1    MAKDVEV--AERGSFSAKDYHDPPPAPLFDSVELTKWSFYRAVIAEFIATLLFLYITVLT  58

Query  243  vIGYKHQTDPKAGGQDCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLAR  422
            VIGYK Q D   GG  CGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLAR
Sbjct  59   VIGYKSQIDADLGGDACGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLAR  118

Query  423  KVTLPRAVLYMIAQCLGAICGVGVGEGFPE  512
            KV+L RAV+Y++AQ LGAI GVG+ + F +
Sbjct  119  KVSLVRAVMYIVAQSLGAIAGVGLVKAFQK  148



>gb|ACZ06859.1| plasma membrane intrinsic protein [Glycine soja]
Length=284

 Score =   209 bits (531),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 115/150 (77%), Positives = 128/150 (85%), Gaps = 5/150 (3%)
 Frame = +3

Query  63   MTKDVEAVPEQPAEFSAKDYHDPPPSPLIDFDELTKWSFYRAVIAEFIAtllflyvtvlt  242
            M KD+E    +   FS KDY DPPP+PLID +ELTKWSFYRA+IAEFIATLLFLY+TVLT
Sbjct  1    MAKDIEV--AERGSFSGKDYQDPPPAPLIDAEELTKWSFYRALIAEFIATLLFLYITVLT  58

Query  243  vIGYKHQTDPKAGGQDCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLAR  422
            VIGYKHQTD       CGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLAR
Sbjct  59   VIGYKHQTDH---ADACGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLAR  115

Query  423  KVTLPRAVLYMIAQCLGAICGVGVGEGFPE  512
            KV+L RA++YM+AQCLGAICGVG+ + F +
Sbjct  116  KVSLIRAIMYMVAQCLGAICGVGLVKAFQK  145



>gb|ABB88840.1| aquaporin [Stevia rebaudiana]
Length=281

 Score =   208 bits (530),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 113/131 (86%), Positives = 120/131 (92%), Gaps = 0/131 (0%)
 Frame = +3

Query  114  KDYHDPPPSPLIDFDELTKWSFYRAVIAEFIAtllflyvtvltvIGYKHQTDPKAGGQDC  293
            KDYHDPPP+PLID +ELTKWSFYRAVIAEFIATLLFLYVTVLTVIGYK QTDP      C
Sbjct  12   KDYHDPPPAPLIDGEELTKWSFYRAVIAEFIATLLFLYVTVLTVIGYKSQTDPNLNTDQC  71

Query  294  GGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARKVTLPRAVLYMIAQCLG  473
            GGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARKV+L RA+LYM+AQCLG
Sbjct  72   GGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARKVSLIRALLYMVAQCLG  131

Query  474  AICGVGVGEGF  506
            AICGVG+ + F
Sbjct  132  AICGVGLVKAF  142



>ref|XP_004143245.1| PREDICTED: aquaporin PIP2-2-like [Cucumis sativus]
Length=284

 Score =   209 bits (531),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 112/152 (74%), Positives = 129/152 (85%), Gaps = 5/152 (3%)
 Frame = +3

Query  63   MTKDVEAVPEQPAEFSAKDYHDPPPSPLIDFDELTKWSFYRAVIAEFIAtllflyvtvlt  242
            M+KD+EA       F+ KDY DPPP+PLID +ELT+WSFYRA+IAEF+ATLLFLYVTVLT
Sbjct  1    MSKDLEA-----GGFAVKDYQDPPPAPLIDAEELTQWSFYRAIIAEFVATLLFLYVTVLT  55

Query  243  vIGYKHQTDPKAGGQDCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLAR  422
            VIGY  Q+D K GGQ CGGVGILGIAWAFGGMIF+LVYCTAGISG HINPAVTFGLFLAR
Sbjct  56   VIGYSSQSDTKNGGQICGGVGILGIAWAFGGMIFVLVYCTAGISGDHINPAVTFGLFLAR  115

Query  423  KVTLPRAVLYMIAQCLGAICGVGVGEGFPEVI  518
            KV+L RA+LYM+AQCLGAICG  + + F + +
Sbjct  116  KVSLTRAILYMVAQCLGAICGCALVKSFQKAL  147



>ref|XP_011041003.1| PREDICTED: probable aquaporin PIP2-5 [Populus euphratica]
Length=285

 Score =   208 bits (530),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 115/150 (77%), Positives = 127/150 (85%), Gaps = 4/150 (3%)
 Frame = +3

Query  63   MTKDVEAVPEQPAEFSAKDYHDPPPSPLIDFDELTKWSFYRAVIAEFIAtllflyvtvlt  242
            M KD+E    +   FSAKDYHDPPP+PL D  ELTKWSFYRA+IAEFIATLLFLY+TVLT
Sbjct  1    MAKDMEV--AEAGSFSAKDYHDPPPAPLFDAKELTKWSFYRALIAEFIATLLFLYITVLT  58

Query  243  vIGYKHQTDPKAGGQDCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLAR  422
            VIGYK Q D  A    CGGVGILGIAWAFGGMIF+LVYCTAGISGGHINPAVTFGLFLAR
Sbjct  59   VIGYKSQIDGNA--DSCGGVGILGIAWAFGGMIFVLVYCTAGISGGHINPAVTFGLFLAR  116

Query  423  KVTLPRAVLYMIAQCLGAICGVGVGEGFPE  512
            KV+L RAV+YM+AQCLGAICGVG+ + F +
Sbjct  117  KVSLIRAVMYMVAQCLGAICGVGLVKAFQK  146



>ref|NP_001268056.1| aquaporin PIP2 [Vitis vinifera]
 gb|ABC84558.1| aquaporin PIP2 [Vitis vinifera]
Length=280

 Score =   208 bits (530),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 116/148 (78%), Positives = 128/148 (86%), Gaps = 7/148 (5%)
 Frame = +3

Query  63   MTKDVEAVPEQPAEFSAKDYHDPPPSPLIDFDELTKWSFYRAVIAEFIAtllflyvtvlt  242
            MTKDVE   +   EFS KDYHDPPP+PLID DELT+WS YRA+IAEFIATLLFLY+TVLT
Sbjct  1    MTKDVETSGQ---EFSNKDYHDPPPAPLIDPDELTQWSLYRAIIAEFIATLLFLYITVLT  57

Query  243  vIGYKHQTDPKAGGQDCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLAR  422
            VIGYK Q+D       CGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLAR
Sbjct  58   VIGYKSQSDT----DPCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLAR  113

Query  423  KVTLPRAVLYMIAQCLGAICGVGVGEGF  506
            KV+L RA++YMIAQCLGA+CGVG+ + F
Sbjct  114  KVSLVRALMYMIAQCLGAVCGVGLVKAF  141



>ref|XP_009133124.1| PREDICTED: aquaporin PIP2-2-like [Brassica rapa]
 gb|AAD39374.1|AF118383_1 plasma membrane intrinsic protein 2 [Brassica napus]
 emb|CDY46758.1| BnaA03g17020D [Brassica napus]
Length=283

 Score =   208 bits (530),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 115/148 (78%), Positives = 125/148 (84%), Gaps = 4/148 (3%)
 Frame = +3

Query  63   MTKDVEAVPEQPAEFSAKDYHDPPPSPLIDFDELTKWSFYRAVIAEFIAtllflyvtvlt  242
            M KDVE         +A+DY DPPP+P  D +ELTKWS YRAVIAEF+ATLLFLYVTVLT
Sbjct  1    MAKDVEGAEG----VTARDYEDPPPTPFFDAEELTKWSLYRAVIAEFVATLLFLYVTVLT  56

Query  243  vIGYKHQTDPKAGGQDCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLAR  422
            VIGYK  +D KAGG DCGGVGILGI+WAFGGMIFILVYCTAGISGGHINPAVTFGLFLAR
Sbjct  57   VIGYKISSDTKAGGDDCGGVGILGISWAFGGMIFILVYCTAGISGGHINPAVTFGLFLAR  116

Query  423  KVTLPRAVLYMIAQCLGAICGVGVGEGF  506
            KV+L RAVLYM+AQCLGAICGVG  + F
Sbjct  117  KVSLVRAVLYMVAQCLGAICGVGFVKAF  144



>ref|XP_007218772.1| hypothetical protein PRUPE_ppa009540mg [Prunus persica]
 gb|EMJ19971.1| hypothetical protein PRUPE_ppa009540mg [Prunus persica]
Length=287

 Score =   208 bits (530),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 116/150 (77%), Positives = 124/150 (83%), Gaps = 2/150 (1%)
 Frame = +3

Query  63   MTKDVEAVPEQPAEFSAKDYHDPPPSPLIDFDELTKWSFYRAVIAEFIAtllflyvtvlt  242
            M KDVE    +   FSAKDYHDPPP+PL D  ELTKWSFYRA+IAEFIATLLFLYVTVLT
Sbjct  1    MAKDVEV--AERGSFSAKDYHDPPPAPLFDAVELTKWSFYRALIAEFIATLLFLYVTVLT  58

Query  243  vIGYKHQTDPKAGGQDCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLAR  422
            VIGYK QTD       CGGVGILGIAWAFGGMIF+LVYCTAGISGGHINPAVTFGLFLAR
Sbjct  59   VIGYKSQTDTTVNADACGGVGILGIAWAFGGMIFVLVYCTAGISGGHINPAVTFGLFLAR  118

Query  423  KVTLPRAVLYMIAQCLGAICGVGVGEGFPE  512
            KV+L RAVLYM+AQ LGAI GV + + F E
Sbjct  119  KVSLVRAVLYMVAQSLGAIAGVALVKAFQE  148



>ref|XP_002316367.1| putative aquaporin family protein [Populus trichocarpa]
 gb|ABK92446.1| unknown [Populus trichocarpa]
 gb|EEF02538.1| putative aquaporin family protein [Populus trichocarpa]
Length=285

 Score =   208 bits (530),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 115/150 (77%), Positives = 127/150 (85%), Gaps = 4/150 (3%)
 Frame = +3

Query  63   MTKDVEAVPEQPAEFSAKDYHDPPPSPLIDFDELTKWSFYRAVIAEFIAtllflyvtvlt  242
            M KD+E    +   FSAKDYHDPPP+PL D  ELTKWSFYRA+IAEFIATLLFLY+TVLT
Sbjct  1    MAKDMEV--AEAGSFSAKDYHDPPPAPLFDAKELTKWSFYRALIAEFIATLLFLYITVLT  58

Query  243  vIGYKHQTDPKAGGQDCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLAR  422
            VIGYK Q D  A    CGGVGILGIAWAFGGMIF+LVYCTAGISGGHINPAVTFGLFLAR
Sbjct  59   VIGYKSQIDGSA--DSCGGVGILGIAWAFGGMIFVLVYCTAGISGGHINPAVTFGLFLAR  116

Query  423  KVTLPRAVLYMIAQCLGAICGVGVGEGFPE  512
            KV+L RAV+YM+AQCLGAICGVG+ + F +
Sbjct  117  KVSLIRAVMYMVAQCLGAICGVGLVKAFQK  146



>ref|XP_010505294.1| PREDICTED: aquaporin PIP2-2-like [Camelina sativa]
Length=285

 Score =   208 bits (529),  Expect = 4e-63, Method: Compositional matrix adjust.
 Identities = 116/148 (78%), Positives = 124/148 (84%), Gaps = 4/148 (3%)
 Frame = +3

Query  63   MTKDVEAVPEQPAEFSAKDYHDPPPSPLIDFDELTKWSFYRAVIAEFIAtllflyvtvlt  242
            M K VE        + A+DY DPPP+P  D DELTKWS YRAVIAEF+ATLLFLYVTVLT
Sbjct  1    MAKGVEGAEG----YQARDYEDPPPTPFFDADELTKWSLYRAVIAEFVATLLFLYVTVLT  56

Query  243  vIGYKHQTDPKAGGQDCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLAR  422
            VIGYK Q+D  AGG DCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLAR
Sbjct  57   VIGYKIQSDTTAGGVDCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLAR  116

Query  423  KVTLPRAVLYMIAQCLGAICGVGVGEGF  506
            KV+L RAVLYM+AQCLGAICGVG  + F
Sbjct  117  KVSLIRAVLYMVAQCLGAICGVGFVKAF  144



>ref|XP_009387242.1| PREDICTED: aquaporin PIP2-5 [Musa acuminata subsp. malaccensis]
Length=286

 Score =   208 bits (529),  Expect = 4e-63, Method: Compositional matrix adjust.
 Identities = 114/150 (76%), Positives = 125/150 (83%), Gaps = 4/150 (3%)
 Frame = +3

Query  63   MTKDVEAVPEQPAEFSAKDYHDPPPSPLIDFDELTKWSFYRAVIAEFIAtllflyvtvlt  242
            M KDVEA      E+  KDY DPPP PL+D +ELTKWS YRA IAEF+AT+LFLYVTV T
Sbjct  1    MAKDVEAGGR--GEYGGKDYSDPPPEPLVDAEELTKWSLYRAAIAEFVATMLFLYVTVAT  58

Query  243  vIGYKHQTDPKAGGQD--CGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFL  416
            VIGYKHQ+DP     D  C GVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFL
Sbjct  59   VIGYKHQSDPAVNPTDAACSGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFL  118

Query  417  ARKVTLPRAVLYMIAQCLGAICGVGVGEGF  506
            ARK++L RA+LYMIAQCLGAICGVG+ +GF
Sbjct  119  ARKISLVRALLYMIAQCLGAICGVGLVKGF  148



>ref|XP_009614931.1| PREDICTED: aquaporin PIP2-1-like [Nicotiana tomentosiformis]
 tpg|DAA64676.1| TPA_exp: aquaporin PIP2 3b [Nicotiana tabacum]
Length=285

 Score =   208 bits (529),  Expect = 4e-63, Method: Compositional matrix adjust.
 Identities = 113/150 (75%), Positives = 128/150 (85%), Gaps = 2/150 (1%)
 Frame = +3

Query  63   MTKDVEAVPEQPAEFSAKDYHDPPPSPLIDFDELTKWSFYRAVIAEFIAtllflyvtvlt  242
            M KD+E   +Q A    KDY DPPP+PLID +EL KWSFYRA+IAEFIATLLFLY+TVLT
Sbjct  1    MAKDIEYGTDQYAP--NKDYQDPPPAPLIDAEELGKWSFYRAIIAEFIATLLFLYITVLT  58

Query  243  vIGYKHQTDPKAGGQDCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLAR  422
            VIGYK Q+D K  G +CGGVGILGIAWAFGGMIF+LVYCTAGISGGHINPAVTFGLFLAR
Sbjct  59   VIGYKSQSDTKHNGDECGGVGILGIAWAFGGMIFVLVYCTAGISGGHINPAVTFGLFLAR  118

Query  423  KVTLPRAVLYMIAQCLGAICGVGVGEGFPE  512
            K++L RAV+YMIAQCLGAICG G+ + F +
Sbjct  119  KISLARAVMYMIAQCLGAICGCGLVKAFQK  148



>dbj|BAB40141.1| plasma membrane intrinsic protein 2-1 [Pyrus communis]
Length=281

 Score =   208 bits (529),  Expect = 4e-63, Method: Compositional matrix adjust.
 Identities = 115/150 (77%), Positives = 129/150 (86%), Gaps = 6/150 (4%)
 Frame = +3

Query  63   MTKDVEAVPEQPAEFSAKDYHDPPPSPLIDFDELTKWSFYRAVIAEFIAtllflyvtvlt  242
            M KDVE    +  EF+AKDYHDPPP+PL D +ELTKWSFYRA+IAEFIATLLFLY+TVLT
Sbjct  1    MAKDVEV--AEHGEFAAKDYHDPPPTPLFDAEELTKWSFYRALIAEFIATLLFLYITVLT  58

Query  243  vIGYKHQTDPKAGGQDCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLAR  422
            VIGYK Q++       CGGVGILGIAWAFGGMIF+LVYCTAGISGGHINPAVTFGLFLAR
Sbjct  59   VIGYKSQSE----ADQCGGVGILGIAWAFGGMIFVLVYCTAGISGGHINPAVTFGLFLAR  114

Query  423  KVTLPRAVLYMIAQCLGAICGVGVGEGFPE  512
            KV+L RAVLY+IAQCLGAICGVG+ + F +
Sbjct  115  KVSLIRAVLYIIAQCLGAICGVGLVKAFQK  144



>ref|XP_009413716.1| PREDICTED: probable aquaporin PIP2-3 isoform X2 [Musa acuminata 
subsp. malaccensis]
Length=271

 Score =   207 bits (528),  Expect = 4e-63, Method: Compositional matrix adjust.
 Identities = 113/152 (74%), Positives = 124/152 (82%), Gaps = 4/152 (3%)
 Frame = +3

Query  63   MTKDVEAVPEQPAEFSAKDYHDPPPSPLIDFDELTKWSFYRAVIAEFIAtllflyvtvlt  242
            M KD E       E+  KDY DPPP+PLID +ELTKWS YRA IAEF+AT+LFLYVTV T
Sbjct  1    MAKDTEVAGR--GEYGGKDYTDPPPAPLIDAEELTKWSLYRAAIAEFVATMLFLYVTVAT  58

Query  243  vIGYKHQTDPKAGGQD--CGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFL  416
            VIGYKHQ+DP     D  C GVGILGIAWAFGGMIFILVYCTAGISGGHINPAVT GLFL
Sbjct  59   VIGYKHQSDPNVNPADAACSGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTLGLFL  118

Query  417  ARKVTLPRAVLYMIAQCLGAICGVGVGEGFPE  512
            ARKV+L RA+LYM+AQCLGAICGVG+ +GF E
Sbjct  119  ARKVSLVRALLYMVAQCLGAICGVGLVKGFQE  150



>ref|XP_009335091.1| PREDICTED: probable aquaporin PIP2-2 [Pyrus x bretschneideri]
Length=281

 Score =   207 bits (528),  Expect = 5e-63, Method: Compositional matrix adjust.
 Identities = 115/150 (77%), Positives = 129/150 (86%), Gaps = 6/150 (4%)
 Frame = +3

Query  63   MTKDVEAVPEQPAEFSAKDYHDPPPSPLIDFDELTKWSFYRAVIAEFIAtllflyvtvlt  242
            M KDVE    +  EF+AKDYHDPPP+PL D +ELTKWSFYRA+IAEFIATLLFLY+TVLT
Sbjct  1    MAKDVEGA--EHGEFAAKDYHDPPPTPLFDAEELTKWSFYRALIAEFIATLLFLYITVLT  58

Query  243  vIGYKHQTDPKAGGQDCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLAR  422
            VIGYK Q++       CGGVGILGIAWAFGGMIF+LVYCTAGISGGHINPAVTFGLFLAR
Sbjct  59   VIGYKSQSE----ADQCGGVGILGIAWAFGGMIFVLVYCTAGISGGHINPAVTFGLFLAR  114

Query  423  KVTLPRAVLYMIAQCLGAICGVGVGEGFPE  512
            KV+L RAVLY+IAQCLGAICGVG+ + F +
Sbjct  115  KVSLIRAVLYIIAQCLGAICGVGLVKAFQK  144



>gb|AAD31846.1|AF133530_1 water channel protein MipH [Mesembryanthemum crystallinum]
Length=291

 Score =   208 bits (529),  Expect = 5e-63, Method: Compositional matrix adjust.
 Identities = 115/150 (77%), Positives = 127/150 (85%), Gaps = 3/150 (2%)
 Frame = +3

Query  63   MTKDVEAVPEQPAEFSAKDYHDPPPSPLIDFDELTKWSFYRAVIAEFIAtllflyvtvlt  242
            M KD E    +  +  AKDY DPPPSPL D +ELTKWSFYRA+IAEFIATLLFLY+TVLT
Sbjct  1    MAKDFETGGGEVRDV-AKDYQDPPPSPLFDMEELTKWSFYRALIAEFIATLLFLYITVLT  59

Query  243  vIGYKHQTDPKAGGQD--CGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFL  416
            VIGYKHQ+DP   G D  CGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFL
Sbjct  60   VIGYKHQSDPLVSGADAGCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFL  119

Query  417  ARKVTLPRAVLYMIAQCLGAICGVGVGEGF  506
            ARK++L RA++YM+AQCLGAICGVG  + F
Sbjct  120  ARKLSLIRAIMYMVAQCLGAICGVGFVKAF  149



>gb|AGD98708.1| aquaporin protein 5 [Camellia sinensis]
Length=285

 Score =   207 bits (528),  Expect = 5e-63, Method: Compositional matrix adjust.
 Identities = 113/150 (75%), Positives = 127/150 (85%), Gaps = 2/150 (1%)
 Frame = +3

Query  63   MTKDVEAVPEQPAEFSAKDYHDPPPSPLIDFDELTKWSFYRAVIAEFIAtllflyvtvlt  242
            M KD+  V EQ   +SAKDY DPPP+PLID +ELTKWSFYRA+IAEFIATLLFLY+T+LT
Sbjct  1    MAKDM-GVAEQ-GSYSAKDYQDPPPAPLIDAEELTKWSFYRALIAEFIATLLFLYITILT  58

Query  243  vIGYKHQTDPKAGGQDCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLAR  422
            VIGYK Q DP      CGGVGILGIAWAFGGMIF+LVYCTAGISGGHINPAVTFGLFLAR
Sbjct  59   VIGYKSQVDPVKNADQCGGVGILGIAWAFGGMIFVLVYCTAGISGGHINPAVTFGLFLAR  118

Query  423  KVTLPRAVLYMIAQCLGAICGVGVGEGFPE  512
            KV+L RAV+Y++AQCLGAICGV + + F  
Sbjct  119  KVSLIRAVMYIVAQCLGAICGVALVKAFQR  148



>ref|XP_009792249.1| PREDICTED: aquaporin PIP2-1-like [Nicotiana sylvestris]
 tpg|DAA64675.1| TPA_exp: aquaporin PIP2 3a [Nicotiana tabacum]
Length=285

 Score =   207 bits (528),  Expect = 6e-63, Method: Compositional matrix adjust.
 Identities = 112/150 (75%), Positives = 128/150 (85%), Gaps = 2/150 (1%)
 Frame = +3

Query  63   MTKDVEAVPEQPAEFSAKDYHDPPPSPLIDFDELTKWSFYRAVIAEFIAtllflyvtvlt  242
            M KD+E   +Q A    KDY DPPP+PLID +EL KWSFYRA++AEFIATLLFLY+TVLT
Sbjct  1    MAKDIEYGTDQYAP--NKDYQDPPPAPLIDAEELGKWSFYRAIVAEFIATLLFLYITVLT  58

Query  243  vIGYKHQTDPKAGGQDCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLAR  422
            VIGYK Q+D K  G +CGGVGILGIAWAFGGMIF+LVYCTAGISGGHINPAVTFGLFLAR
Sbjct  59   VIGYKSQSDTKHNGDECGGVGILGIAWAFGGMIFVLVYCTAGISGGHINPAVTFGLFLAR  118

Query  423  KVTLPRAVLYMIAQCLGAICGVGVGEGFPE  512
            K++L RAV+YMIAQCLGAICG G+ + F +
Sbjct  119  KISLARAVMYMIAQCLGAICGCGLVKAFQK  148



>gb|AGG39693.1| aquaporin protein AQU15 [Camellia sinensis]
 gb|AGG39694.1| aquaporin protein AQU16 [Camellia sinensis]
Length=287

 Score =   207 bits (528),  Expect = 6e-63, Method: Compositional matrix adjust.
 Identities = 113/148 (76%), Positives = 127/148 (86%), Gaps = 2/148 (1%)
 Frame = +3

Query  63   MTKDVEAVPEQPAEFSAKDYHDPPPSPLIDFDELTKWSFYRAVIAEFIAtllflyvtvlt  242
            M KD+  V EQ   +SAKDY DPPP+PLID +ELTKWSFYRA+IAEFIATLLFLY+T+LT
Sbjct  1    MAKDM-GVAEQ-GSYSAKDYQDPPPAPLIDAEELTKWSFYRALIAEFIATLLFLYITILT  58

Query  243  vIGYKHQTDPKAGGQDCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLAR  422
            VIGYK Q DP      CGGVGILGIAWAFGGMIF+LVYCTAGISGGHINPAVTFGLFLAR
Sbjct  59   VIGYKSQVDPVKNADQCGGVGILGIAWAFGGMIFVLVYCTAGISGGHINPAVTFGLFLAR  118

Query  423  KVTLPRAVLYMIAQCLGAICGVGVGEGF  506
            KV+L RAV+Y++AQCLGAICGV + + F
Sbjct  119  KVSLIRAVMYIVAQCLGAICGVALVKAF  146



>dbj|BAA92261.1| Plasma membrane aquaporin 2c [Raphanus sativus]
Length=283

 Score =   207 bits (528),  Expect = 6e-63, Method: Compositional matrix adjust.
 Identities = 114/148 (77%), Positives = 125/148 (84%), Gaps = 4/148 (3%)
 Frame = +3

Query  63   MTKDVEAVPEQPAEFSAKDYHDPPPSPLIDFDELTKWSFYRAVIAEFIAtllflyvtvlt  242
            M KDVE         +A+DY DPPP+P  D +ELTKWS YRAVIAEF+ATLLFLY+TVLT
Sbjct  1    MAKDVEGAEG----VTARDYEDPPPTPFFDAEELTKWSLYRAVIAEFVATLLFLYITVLT  56

Query  243  vIGYKHQTDPKAGGQDCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLAR  422
            VIGYK  +D KAGG +CGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLAR
Sbjct  57   VIGYKISSDTKAGGDECGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLAR  116

Query  423  KVTLPRAVLYMIAQCLGAICGVGVGEGF  506
            KV+L RAVLYM+AQCLGAICGVG  + F
Sbjct  117  KVSLVRAVLYMVAQCLGAICGVGFVKAF  144



>gb|ACR56613.1| plasma intrinsic protein 2;3 [Juglans regia]
Length=284

 Score =   207 bits (528),  Expect = 6e-63, Method: Compositional matrix adjust.
 Identities = 119/151 (79%), Positives = 131/151 (87%), Gaps = 5/151 (3%)
 Frame = +3

Query  63   MTKDVEAVPEQPAEFSAKDYHDPPPSPLIDFDELTKWSFYRAVIAEFIAtllflyvtvlt  242
            M KDVE   +   E+SAKDY DPPP+PLID +ELTKWSFYRA+IAEFIATLLFLY+TVLT
Sbjct  1    MGKDVEGAEQ--GEYSAKDYQDPPPAPLIDPEELTKWSFYRALIAEFIATLLFLYITVLT  58

Query  243  vIGYKHQTD-PKAGGQDCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLA  419
            VIGYK Q+  P A   DC GVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLA
Sbjct  59   VIGYKVQSSAPDA--DDCAGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLA  116

Query  420  RKVTLPRAVLYMIAQCLGAICGVGVGEGFPE  512
            RKV+L RAVLYM+AQCLGAICGVG+ +GF +
Sbjct  117  RKVSLIRAVLYMVAQCLGAICGVGLVKGFQK  147



>ref|XP_009413714.1| PREDICTED: aquaporin PIP2-4-like isoform X1 [Musa acuminata subsp. 
malaccensis]
Length=287

 Score =   207 bits (528),  Expect = 7e-63, Method: Compositional matrix adjust.
 Identities = 113/152 (74%), Positives = 124/152 (82%), Gaps = 4/152 (3%)
 Frame = +3

Query  63   MTKDVEAVPEQPAEFSAKDYHDPPPSPLIDFDELTKWSFYRAVIAEFIAtllflyvtvlt  242
            M KD E       E+  KDY DPPP+PLID +ELTKWS YRA IAEF+AT+LFLYVTV T
Sbjct  1    MAKDTEVAGR--GEYGGKDYTDPPPAPLIDAEELTKWSLYRAAIAEFVATMLFLYVTVAT  58

Query  243  vIGYKHQTDPKAGGQD--CGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFL  416
            VIGYKHQ+DP     D  C GVGILGIAWAFGGMIFILVYCTAGISGGHINPAVT GLFL
Sbjct  59   VIGYKHQSDPNVNPADAACSGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTLGLFL  118

Query  417  ARKVTLPRAVLYMIAQCLGAICGVGVGEGFPE  512
            ARKV+L RA+LYM+AQCLGAICGVG+ +GF E
Sbjct  119  ARKVSLVRALLYMVAQCLGAICGVGLVKGFQE  150



>ref|XP_009133125.1| PREDICTED: aquaporin PIP2-2-like [Brassica rapa]
Length=285

 Score =   207 bits (528),  Expect = 7e-63, Method: Compositional matrix adjust.
 Identities = 114/148 (77%), Positives = 125/148 (84%), Gaps = 4/148 (3%)
 Frame = +3

Query  63   MTKDVEAVPEQPAEFSAKDYHDPPPSPLIDFDELTKWSFYRAVIAEFIAtllflyvtvlt  242
            M KDVE        F+A+DY DPPP+P  D +ELT+WS YRAVIAEF+ATLLFLYVTVLT
Sbjct  1    MAKDVEGAEG----FAARDYQDPPPTPFFDAEELTRWSLYRAVIAEFVATLLFLYVTVLT  56

Query  243  vIGYKHQTDPKAGGQDCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLAR  422
            VIGYK  +D  AGG +CGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLAR
Sbjct  57   VIGYKISSDTTAGGVECGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLAR  116

Query  423  KVTLPRAVLYMIAQCLGAICGVGVGEGF  506
            KVTL RA+LYM+AQCLGAICGVG  + F
Sbjct  117  KVTLVRALLYMVAQCLGAICGVGFVKAF  144



>ref|XP_007150204.1| hypothetical protein PHAVU_005G135300g [Phaseolus vulgaris]
 gb|ESW22198.1| hypothetical protein PHAVU_005G135300g [Phaseolus vulgaris]
Length=287

 Score =   207 bits (528),  Expect = 7e-63, Method: Compositional matrix adjust.
 Identities = 114/151 (75%), Positives = 126/151 (83%), Gaps = 2/151 (1%)
 Frame = +3

Query  63   MTKDVEAVPEQPAEFSAKDYHDPPPSPLIDFDELTKWSFYRAVIAEFIAtllflyvtvlt  242
            M KDVE V EQP E+SAKDYHDPPP+PL D DELTKWS YRA IAEFIATLLFLY+TVLT
Sbjct  1    MAKDVEQVTEQP-EYSAKDYHDPPPAPLFDPDELTKWSLYRAAIAEFIATLLFLYITVLT  59

Query  243  vIGYKHQTDPKA-GGQDCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLA  419
            +IGYK QTD    G  +C GVGILGIAWAFGGMIFILVYCTAGISGGHINPAVT GLFL 
Sbjct  60   IIGYKRQTDTSIPGNTECDGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTLGLFLG  119

Query  420  RKVTLPRAVLYMIAQCLGAICGVGVGEGFPE  512
            RKV+L RA+LY++AQC GAI G G+ + F +
Sbjct  120  RKVSLVRALLYIVAQCAGAISGAGLAKAFQK  150



>ref|XP_004487111.1| PREDICTED: aquaporin PIP2-7-like [Cicer arietinum]
Length=287

 Score =   207 bits (528),  Expect = 7e-63, Method: Compositional matrix adjust.
 Identities = 115/151 (76%), Positives = 127/151 (84%), Gaps = 2/151 (1%)
 Frame = +3

Query  63   MTKDVEAVPEQPAEFSAKDYHDPPPSPLIDFDELTKWSFYRAVIAEFIAtllflyvtvlt  242
            M KDVE V EQ  E+SAKDY DPPP+PL D  ELTKWS YRAVIAEFIATLLFLY+TVLT
Sbjct  1    MGKDVE-VQEQGGEYSAKDYQDPPPAPLFDPAELTKWSLYRAVIAEFIATLLFLYITVLT  59

Query  243  vIGYKHQTDPK-AGGQDCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLA  419
            +IGY  QTD    G  +C GVG+LGIAWAFGGMIF+LVYCTAGISGGHINPAVTFGLFL 
Sbjct  60   IIGYSRQTDTTITGNTECDGVGVLGIAWAFGGMIFVLVYCTAGISGGHINPAVTFGLFLG  119

Query  420  RKVTLPRAVLYMIAQCLGAICGVGVGEGFPE  512
            RKV+L RAVLY+IAQCLGAICG G+ +GF +
Sbjct  120  RKVSLIRAVLYIIAQCLGAICGAGLAKGFQK  150



>gb|ABI96814.1| plasma membrane intrinsic protein [Triticum aestivum]
Length=290

 Score =   207 bits (528),  Expect = 8e-63, Method: Compositional matrix adjust.
 Identities = 113/151 (75%), Positives = 127/151 (84%), Gaps = 4/151 (3%)
 Frame = +3

Query  63   MTKDVEAVPEQPAEFSAKDYHDPPPSPLIDFDELTKWSFYRAVIAEFIAtllflyvtvlt  242
            M KD+EA P     ++AKDY DPPP+PL D +ELTKWS YRAVIAEF+ATLLFLY+TV T
Sbjct  1    MAKDIEAAPPG-GGYAAKDYSDPPPAPLFDAEELTKWSLYRAVIAEFVATLLFLYITVAT  59

Query  243  vIGYKHQTDP---KAGGQDCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLF  413
            VIGYKHQ DP    A    C GVGILGIAWAFGGMIF+LVYCTAG+SGGHINPAVTFGLF
Sbjct  60   VIGYKHQADPAGPNAADAACSGVGILGIAWAFGGMIFVLVYCTAGVSGGHINPAVTFGLF  119

Query  414  LARKVTLPRAVLYMIAQCLGAICGVGVGEGF  506
            LARKV+L RA+LY+IAQCLGAICGVG+ +GF
Sbjct  120  LARKVSLVRALLYIIAQCLGAICGVGLVKGF  150



>gb|AFB83068.1| plasma intrinsic protein PIP2.2 [Helianthemum almeriense]
Length=281

 Score =   207 bits (527),  Expect = 9e-63, Method: Compositional matrix adjust.
 Identities = 114/150 (76%), Positives = 127/150 (85%), Gaps = 7/150 (5%)
 Frame = +3

Query  63   MTKDVEAVPEQPAEFSAKDYHDPPPSPLIDFDELTKWSFYRAVIAEFIAtllflyvtvlt  242
            M K+ EA      EF AKDYHDPPP+PL D +EL KWSFYRA+IAEFIATLLFLY+TVLT
Sbjct  1    MAKEAEAA----GEFRAKDYHDPPPAPLFDAEELGKWSFYRAIIAEFIATLLFLYITVLT  56

Query  243  vIGYKHQTDPKAGGQDCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLAR  422
            VIGYK Q D   GG +CGGVGILGIAWAFGGMIF+LVYCTAGISGGHINPAVTFGLFLAR
Sbjct  57   VIGYKSQID---GGDECGGVGILGIAWAFGGMIFVLVYCTAGISGGHINPAVTFGLFLAR  113

Query  423  KVTLPRAVLYMIAQCLGAICGVGVGEGFPE  512
            KV+L RA+LYM+AQCLGAICG G+ + F +
Sbjct  114  KVSLVRAILYMVAQCLGAICGCGLVKAFQK  143



>gb|AAL32127.1| aquaporin [Medicago truncatula]
Length=287

 Score =   207 bits (527),  Expect = 9e-63, Method: Compositional matrix adjust.
 Identities = 112/149 (75%), Positives = 125/149 (84%), Gaps = 2/149 (1%)
 Frame = +3

Query  63   MTKDVEAVPEQPAEFSAKDYHDPPPSPLIDFDELTKWSFYRAVIAEFIAtllflyvtvlt  242
            M KDVE   EQ  EFSAKDY DPPP+PL D DELTKWS YRAVIAEF+ATLLFLY+TVLT
Sbjct  1    MGKDVEG-QEQGGEFSAKDYQDPPPAPLFDLDELTKWSLYRAVIAEFVATLLFLYITVLT  59

Query  243  vIGYKHQTDPK-AGGQDCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLA  419
            +IGY  Q+D    G  +C GVG+LGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLF+ 
Sbjct  60   IIGYSRQSDTTIKGNTECDGVGVLGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFVG  119

Query  420  RKVTLPRAVLYMIAQCLGAICGVGVGEGF  506
            RKV+L RA LY++AQCLGAICG G+ +GF
Sbjct  120  RKVSLIRAFLYIVAQCLGAICGAGLAKGF  148



>gb|ACU24483.1| unknown [Glycine max]
Length=284

 Score =   207 bits (527),  Expect = 9e-63, Method: Compositional matrix adjust.
 Identities = 115/150 (77%), Positives = 127/150 (85%), Gaps = 5/150 (3%)
 Frame = +3

Query  63   MTKDVEAVPEQPAEFSAKDYHDPPPSPLIDFDELTKWSFYRAVIAEFIAtllflyvtvlt  242
            M KDVE    +   FS KDY DPPP+PLID +ELTKWSFYRA+IAEFIATLLFLY+TVLT
Sbjct  1    MAKDVEV--AERGSFSGKDYQDPPPAPLIDAEELTKWSFYRALIAEFIATLLFLYITVLT  58

Query  243  vIGYKHQTDPKAGGQDCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLAR  422
            VIGYKHQTD       CGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLAR
Sbjct  59   VIGYKHQTDH---ADACGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLAR  115

Query  423  KVTLPRAVLYMIAQCLGAICGVGVGEGFPE  512
            KV+L RA++YM+AQCL AICGVG+ + F +
Sbjct  116  KVSLIRAIMYMVAQCLSAICGVGLVKAFQK  145



>gb|AGD98707.1| aquaporin protein 4 [Camellia sinensis]
Length=287

 Score =   207 bits (527),  Expect = 9e-63, Method: Compositional matrix adjust.
 Identities = 114/148 (77%), Positives = 126/148 (85%), Gaps = 2/148 (1%)
 Frame = +3

Query  63   MTKDVEAVPEQPAEFSAKDYHDPPPSPLIDFDELTKWSFYRAVIAEFIAtllflyvtvlt  242
            M KD+  V EQ   +SAKDY DPPP+PLID +ELTKWSFYRA+IAEFIATLLFLY+T+LT
Sbjct  1    MAKDM-GVAEQ-GSYSAKDYQDPPPAPLIDAEELTKWSFYRALIAEFIATLLFLYITILT  58

Query  243  vIGYKHQTDPKAGGQDCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLAR  422
            VIGYK Q DP      CGGVGILGIAWAFGGMIF+LVYCTAGISGGHINPAVTFGLFLAR
Sbjct  59   VIGYKSQVDPVKNADQCGGVGILGIAWAFGGMIFVLVYCTAGISGGHINPAVTFGLFLAR  118

Query  423  KVTLPRAVLYMIAQCLGAICGVGVGEGF  506
            KV+L RA LYM+AQCLGAICGV + + F
Sbjct  119  KVSLIRAGLYMVAQCLGAICGVALVKAF  146



>ref|NP_001280185.1| aquaporin PIP2-2 [Prunus mume]
 dbj|BAE48656.1| aquaporin [Prunus mume]
Length=281

 Score =   207 bits (526),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 114/150 (76%), Positives = 128/150 (85%), Gaps = 6/150 (4%)
 Frame = +3

Query  63   MTKDVEAVPEQPAEFSAKDYHDPPPSPLIDFDELTKWSFYRAVIAEFIAtllflyvtvlt  242
            M KDVE    +  EF+AKDYHDPPP+P  D +ELTKWSFYRA+IAEF+ATLLFLY+TVLT
Sbjct  1    MAKDVEGA--EHGEFAAKDYHDPPPTPFFDAEELTKWSFYRALIAEFVATLLFLYITVLT  58

Query  243  vIGYKHQTDPKAGGQDCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLAR  422
            VIGYK Q+     G  CGGVGILGIAWAFGGMIF+LVYCTAGISGGHINPAVTFGLFLAR
Sbjct  59   VIGYKSQSS----GDQCGGVGILGIAWAFGGMIFVLVYCTAGISGGHINPAVTFGLFLAR  114

Query  423  KVTLPRAVLYMIAQCLGAICGVGVGEGFPE  512
            KV+LPRAVLY+IAQ LGAICGVG+ + F +
Sbjct  115  KVSLPRAVLYIIAQSLGAICGVGLVKAFQK  144



>gb|ACM50914.1| aquaporin [Medicago falcata]
Length=287

 Score =   207 bits (526),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 112/149 (75%), Positives = 126/149 (85%), Gaps = 2/149 (1%)
 Frame = +3

Query  63   MTKDVEAVPEQPAEFSAKDYHDPPPSPLIDFDELTKWSFYRAVIAEFIAtllflyvtvlt  242
            M KDVE V EQ AEF+AKDY DPPP+PL D DELTKWS YRAVIAEF+ATLLFLY+TVLT
Sbjct  1    MGKDVE-VQEQGAEFTAKDYQDPPPAPLFDTDELTKWSLYRAVIAEFVATLLFLYITVLT  59

Query  243  vIGYKHQTDPK-AGGQDCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLA  419
            +IGY  Q+D    G  +C GVG+LGIAWAFGGMIFILVYCTAGISGGHINPAVTFGL + 
Sbjct  60   IIGYSRQSDTSIEGNTECDGVGVLGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLLVG  119

Query  420  RKVTLPRAVLYMIAQCLGAICGVGVGEGF  506
            RKV+L RA LY++AQCLGAICG G+ +GF
Sbjct  120  RKVSLIRAFLYIVAQCLGAICGAGLAKGF  148



>ref|XP_006846771.1| hypothetical protein AMTR_s00148p00023270 [Amborella trichopoda]
 gb|ERN08352.1| hypothetical protein AMTR_s00148p00023270 [Amborella trichopoda]
Length=283

 Score =   207 bits (526),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 116/148 (78%), Positives = 128/148 (86%), Gaps = 6/148 (4%)
 Frame = +3

Query  63   MTKDVEAVPEQPAEFSAKDYHDPPPSPLIDFDELTKWSFYRAVIAEFIAtllflyvtvlt  242
            M KDVE V EQP EF+AKDY DPPP+ LID +ELTKWSFYRA+IAEFIATLLFLYVTV T
Sbjct  1    MGKDVE-VSEQP-EFTAKDYTDPPPAALIDLEELTKWSFYRALIAEFIATLLFLYVTVAT  58

Query  243  vIGYKHQTDPKAGGQDCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLAR  422
            VIGYK  ++       C GVG+LGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLAR
Sbjct  59   VIGYKRVSE----ADQCDGVGVLGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLAR  114

Query  423  KVTLPRAVLYMIAQCLGAICGVGVGEGF  506
            KV+L RAV+YM+AQCLGAICGVG+ +GF
Sbjct  115  KVSLIRAVMYMVAQCLGAICGVGLVKGF  142



>ref|XP_009624885.1| PREDICTED: aquaporin PIP2-1-like [Nicotiana tomentosiformis]
Length=291

 Score =   207 bits (526),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 112/150 (75%), Positives = 127/150 (85%), Gaps = 4/150 (3%)
 Frame = +3

Query  63   MTKDVEAVPEQPAEFSAKDYHDPPPSPLIDFDELTKWSFYRAVIAEFIAtllflyvtvlt  242
            M KD E       E++ KDY DPPP+PLID +EL KWSFYRA+IAEFIATLLFLY+TVLT
Sbjct  9    MAKDTEV----GTEYAPKDYQDPPPAPLIDPEELGKWSFYRAIIAEFIATLLFLYITVLT  64

Query  243  vIGYKHQTDPKAGGQDCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLAR  422
            VIGYK QTDP   G+ CGGVGILGIAWAFGGMIF+LVYCTAGISGGHINPAVTFGLFLAR
Sbjct  65   VIGYKSQTDPDHKGEQCGGVGILGIAWAFGGMIFVLVYCTAGISGGHINPAVTFGLFLAR  124

Query  423  KVTLPRAVLYMIAQCLGAICGVGVGEGFPE  512
            KV+L RA++YM+AQCLGAICG G+ + F +
Sbjct  125  KVSLVRAIMYMLAQCLGAICGCGLVKAFQK  154



>ref|XP_003625627.1| Aquaporin PIP2-1 [Medicago truncatula]
 gb|ABD32807.1| Major intrinsic protein [Medicago truncatula]
 gb|AES81845.1| major intrinsic protein (MIP) family transporter [Medicago truncatula]
Length=287

 Score =   207 bits (526),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 113/150 (75%), Positives = 126/150 (84%), Gaps = 2/150 (1%)
 Frame = +3

Query  63   MTKDVEAVPEQPAEFSAKDYHDPPPSPLIDFDELTKWSFYRAVIAEFIAtllflyvtvlt  242
            M KD+EA P+       KDYHDPPP+PL D  EL +WSFYRA+IAEF+ATLLFLYVTVLT
Sbjct  1    MAKDIEAEPQ--GGVPHKDYHDPPPAPLFDTAELGQWSFYRALIAEFVATLLFLYVTVLT  58

Query  243  vIGYKHQTDPKAGGQDCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLAR  422
            VIGY  QTDP   G +C GVGILGIAWAFGGMIF+LVYCTAGISGGHINPAVTFGLFLAR
Sbjct  59   VIGYNAQTDPAHNGTNCDGVGILGIAWAFGGMIFVLVYCTAGISGGHINPAVTFGLFLAR  118

Query  423  KVTLPRAVLYMIAQCLGAICGVGVGEGFPE  512
            KV+L RAVLYM+AQCLGAICGVG+ + F +
Sbjct  119  KVSLIRAVLYMVAQCLGAICGVGLVKAFQK  148



>gb|ABO69705.2| aquaporin PIP2 [Prunus humilis]
Length=281

 Score =   206 bits (525),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 114/150 (76%), Positives = 128/150 (85%), Gaps = 6/150 (4%)
 Frame = +3

Query  63   MTKDVEAVPEQPAEFSAKDYHDPPPSPLIDFDELTKWSFYRAVIAEFIAtllflyvtvlt  242
            M KDVE    +  EF+AKDYHDPPP+P  D +ELTKWSFYRA+IAEF+ATLLFLYVTVLT
Sbjct  1    MAKDVEGA--EHGEFAAKDYHDPPPTPFFDAEELTKWSFYRALIAEFVATLLFLYVTVLT  58

Query  243  vIGYKHQTDPKAGGQDCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLAR  422
            VIGYK Q+     G  CGGVGILGIAWAFGGMIF+LVYCTAGISGGHINPAVTFGLFLAR
Sbjct  59   VIGYKSQSS----GDQCGGVGILGIAWAFGGMIFVLVYCTAGISGGHINPAVTFGLFLAR  114

Query  423  KVTLPRAVLYMIAQCLGAICGVGVGEGFPE  512
            KV+LPRAVLY++AQ LGAICGVG+ + F +
Sbjct  115  KVSLPRAVLYIVAQSLGAICGVGLVKAFQK  144



>ref|XP_004304426.1| PREDICTED: aquaporin PIP2-1-like [Fragaria vesca subsp. vesca]
Length=284

 Score =   206 bits (525),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 111/152 (73%), Positives = 127/152 (84%), Gaps = 5/152 (3%)
 Frame = +3

Query  63   MTKDVEAVPEQPAEFSAKDYHDPPPSPLIDFDELTKWSFYRAVIAEFIAtllflyvtvlt  242
            M +D+E        F+AKDY DPPP+PLID +E  KWSFYRA+IAEF+ATLLFLY+TVLT
Sbjct  1    MGRDIEV-----GGFAAKDYQDPPPTPLIDPEEFGKWSFYRAIIAEFVATLLFLYITVLT  55

Query  243  vIGYKHQTDPKAGGQDCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLAR  422
            VIGYK Q+D   GG  CGGVGILGIAWAFGGMIF+LVYCTAGISGGHINPAVTFGLFLAR
Sbjct  56   VIGYKSQSDTLKGGDQCGGVGILGIAWAFGGMIFVLVYCTAGISGGHINPAVTFGLFLAR  115

Query  423  KVTLPRAVLYMIAQCLGAICGVGVGEGFPEVI  518
            KV+LPRAVLY++AQCLGAICG G+ + F   +
Sbjct  116  KVSLPRAVLYIVAQCLGAICGCGLVKSFQSAL  147



>gb|AFK33316.1| unknown [Medicago truncatula]
Length=287

 Score =   206 bits (525),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 113/150 (75%), Positives = 126/150 (84%), Gaps = 2/150 (1%)
 Frame = +3

Query  63   MTKDVEAVPEQPAEFSAKDYHDPPPSPLIDFDELTKWSFYRAVIAEFIAtllflyvtvlt  242
            M KD+EA P+       KDYHDPPP+PL D  EL +WSFYRA+IAEF+ATLLFLYVTVLT
Sbjct  1    MAKDIEAEPQ--GGVPHKDYHDPPPAPLFDTAELGQWSFYRALIAEFVATLLFLYVTVLT  58

Query  243  vIGYKHQTDPKAGGQDCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLAR  422
            VIGY  QTDP   G +C GVGILGIAWAFGGMIF+LVYCTAGISGGHINPAVTFGLFLAR
Sbjct  59   VIGYNAQTDPAHNGTNCDGVGILGIAWAFGGMIFVLVYCTAGISGGHINPAVTFGLFLAR  118

Query  423  KVTLPRAVLYMIAQCLGAICGVGVGEGFPE  512
            KV+L RAVLYM+AQCLGAICGVG+ + F +
Sbjct  119  KVSLIRAVLYMVAQCLGAICGVGLVKAFQK  148



>ref|XP_011031744.1| PREDICTED: probable aquaporin PIP2-5 [Populus euphratica]
Length=285

 Score =   206 bits (525),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 113/150 (75%), Positives = 127/150 (85%), Gaps = 4/150 (3%)
 Frame = +3

Query  63   MTKDVEAVPEQPAEFSAKDYHDPPPSPLIDFDELTKWSFYRAVIAEFIAtllflyvtvlt  242
            M KD+E    +   FSAKDY DPPP+PLID +ELTKWSFYRA+IAEFIAT+LFLY+TVLT
Sbjct  1    MAKDIEV--AEAGSFSAKDYQDPPPAPLIDAEELTKWSFYRALIAEFIATMLFLYITVLT  58

Query  243  vIGYKHQTDPKAGGQDCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLAR  422
            VIGYK Q D  A    C GVGILGIAWAFGGMIF+LVYCTAGISGGHINPAVTFGLFLAR
Sbjct  59   VIGYKSQIDGNA--DPCNGVGILGIAWAFGGMIFVLVYCTAGISGGHINPAVTFGLFLAR  116

Query  423  KVTLPRAVLYMIAQCLGAICGVGVGEGFPE  512
            KV+L RAV+YM+AQCLGAICGVG+ + F +
Sbjct  117  KVSLIRAVMYMVAQCLGAICGVGLVKAFQK  146



>ref|XP_010483715.1| PREDICTED: probable aquaporin PIP2-4 [Camelina sativa]
Length=286

 Score =   206 bits (525),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 112/148 (76%), Positives = 127/148 (86%), Gaps = 1/148 (1%)
 Frame = +3

Query  63   MTKDVEAVPEQPAEFSAKDYHDPPPSPLIDFDELTKWSFYRAVIAEFIAtllflyvtvlt  242
            M KD++ V E  A  +A+DY DPPP+PL+D +EL KWS YRAVIAEF+ATLLFLYV+VLT
Sbjct  1    MAKDLD-VQEGGAPAAARDYADPPPAPLLDMEELRKWSLYRAVIAEFVATLLFLYVSVLT  59

Query  243  vIGYKHQTDPKAGGQDCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLAR  422
            VIGYK QTD  AGG DCGGVGILGIAWAFGGMIF+LVYCTAGISGGHINPAVT GLFLAR
Sbjct  60   VIGYKAQTDANAGGVDCGGVGILGIAWAFGGMIFVLVYCTAGISGGHINPAVTMGLFLAR  119

Query  423  KVTLPRAVLYMIAQCLGAICGVGVGEGF  506
            KV+L R VLY++AQCLGAICG G+ + F
Sbjct  120  KVSLVRTVLYIVAQCLGAICGCGLVKAF  147



>ref|XP_010689549.1| PREDICTED: aquaporin PIP2-1-like [Beta vulgaris subsp. vulgaris]
Length=274

 Score =   206 bits (524),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 113/149 (76%), Positives = 126/149 (85%), Gaps = 1/149 (1%)
 Frame = +3

Query  63   MTKDVEAVP-EQPAEFSAKDYHDPPPSPLIDFDELTKWSFYRAVIAEFIAtllflyvtvl  239
            MTKDVEAV  +Q  EF   DYHDPPP+PLID +EL KW FYRA+IAEF+ATLLFLYVT+L
Sbjct  1    MTKDVEAVSVQQQPEFLDIDYHDPPPAPLIDMEELKKWPFYRAIIAEFVATLLFLYVTIL  60

Query  240  tvIGYKHQTDPKAGGQDCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLA  419
            TVIG+   +D  AGG+ CGGVGILGIAW FGGMIFILVYCTA ISGGHINPAVTFGLFLA
Sbjct  61   TVIGHSRNSDLGAGGKSCGGVGILGIAWTFGGMIFILVYCTAPISGGHINPAVTFGLFLA  120

Query  420  RKVTLPRAVLYMIAQCLGAICGVGVGEGF  506
            RKV+L RA+ YM+AQCLGAICGVG  + F
Sbjct  121  RKVSLIRALAYMVAQCLGAICGVGFVKAF  149



>ref|XP_002532756.1| Aquaporin PIP2.1, putative [Ricinus communis]
 gb|EEF29633.1| Aquaporin PIP2.1, putative [Ricinus communis]
Length=283

 Score =   206 bits (525),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 115/148 (78%), Positives = 128/148 (86%), Gaps = 6/148 (4%)
 Frame = +3

Query  63   MTKDVEAVPEQPAEFSAKDYHDPPPSPLIDFDELTKWSFYRAVIAEFIAtllflyvtvlt  242
            M KD+E     P  FSAKDYHDPPP+PLID  ELTKWSFYRA+IAEFIATLLFLY+TVLT
Sbjct  1    MVKDMEVGERGP--FSAKDYHDPPPAPLIDAVELTKWSFYRALIAEFIATLLFLYITVLT  58

Query  243  vIGYKHQTDPKAGGQDCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLAR  422
            VIGYK Q++  +    CGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLAR
Sbjct  59   VIGYKSQSESDS----CGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLAR  114

Query  423  KVTLPRAVLYMIAQCLGAICGVGVGEGF  506
            KV+L RA++YM+AQCLGAICGVG+ + F
Sbjct  115  KVSLVRAIMYMVAQCLGAICGVGLVKAF  142



>gb|ACJ85211.1| unknown [Medicago truncatula]
Length=259

 Score =   206 bits (523),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 113/150 (75%), Positives = 126/150 (84%), Gaps = 2/150 (1%)
 Frame = +3

Query  63   MTKDVEAVPEQPAEFSAKDYHDPPPSPLIDFDELTKWSFYRAVIAEFIAtllflyvtvlt  242
            M KD+EA P+       KDYHDPPP+PL D  EL +WSFYRA+IAEF+ATLLFLYVTVLT
Sbjct  1    MAKDIEAEPQ--GGVPHKDYHDPPPAPLFDTAELGQWSFYRALIAEFVATLLFLYVTVLT  58

Query  243  vIGYKHQTDPKAGGQDCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLAR  422
            VIGY  QTDP   G +C GVGILGIAWAFGGMIF+LVYCTAGISGGHINPAVTFGLFLAR
Sbjct  59   VIGYNAQTDPAHNGTNCDGVGILGIAWAFGGMIFVLVYCTAGISGGHINPAVTFGLFLAR  118

Query  423  KVTLPRAVLYMIAQCLGAICGVGVGEGFPE  512
            KV+L RAVLYM+AQCLGAICGVG+ + F +
Sbjct  119  KVSLIRAVLYMVAQCLGAICGVGLVKAFQK  148



>emb|CDX91340.1| BnaC04g08100D [Brassica napus]
Length=285

 Score =   206 bits (525),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 113/148 (76%), Positives = 126/148 (85%), Gaps = 4/148 (3%)
 Frame = +3

Query  63   MTKDVEAVPEQPAEFSAKDYHDPPPSPLIDFDELTKWSFYRAVIAEFIAtllflyvtvlt  242
            M K+VE        F+++DY DPPP+P  D +ELTKWS YRAVIAEF+ATLLFLYVTVLT
Sbjct  1    MAKEVEGAEG----FASRDYEDPPPTPFFDAEELTKWSLYRAVIAEFVATLLFLYVTVLT  56

Query  243  vIGYKHQTDPKAGGQDCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLAR  422
            VIGYK  +D KAGG +CGGVGILGI+WAFGGMIFILVYCTAGISGGHINPAVTFGLFLAR
Sbjct  57   VIGYKISSDTKAGGDECGGVGILGISWAFGGMIFILVYCTAGISGGHINPAVTFGLFLAR  116

Query  423  KVTLPRAVLYMIAQCLGAICGVGVGEGF  506
            KV+L RAVLYM+AQCLGAICGVG  + F
Sbjct  117  KVSLVRAVLYMVAQCLGAICGVGFVKAF  144



>ref|XP_008233329.1| PREDICTED: probable aquaporin PIP2-5 [Prunus mume]
Length=287

 Score =   206 bits (525),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 115/150 (77%), Positives = 124/150 (83%), Gaps = 2/150 (1%)
 Frame = +3

Query  63   MTKDVEAVPEQPAEFSAKDYHDPPPSPLIDFDELTKWSFYRAVIAEFIAtllflyvtvlt  242
            M KDVE    +   FSAKDYHDPPP+PL D  ELTKWSFYRA+IAEFIATLLFLYVTVLT
Sbjct  1    MAKDVEV--AERGSFSAKDYHDPPPAPLFDAVELTKWSFYRALIAEFIATLLFLYVTVLT  58

Query  243  vIGYKHQTDPKAGGQDCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLAR  422
            VIGYK QTD       CGGVGILGIAWAFGGMIF+LVYCTAGISGGHINPAVTFGLFLAR
Sbjct  59   VIGYKSQTDTAVNADACGGVGILGIAWAFGGMIFVLVYCTAGISGGHINPAVTFGLFLAR  118

Query  423  KVTLPRAVLYMIAQCLGAICGVGVGEGFPE  512
            KV+L RAVLYM+AQ LGAI GV + + F +
Sbjct  119  KVSLVRAVLYMVAQSLGAIAGVALVKAFQK  148



>ref|XP_008385311.1| PREDICTED: probable aquaporin PIP2-2 [Malus domestica]
Length=281

 Score =   206 bits (524),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 114/150 (76%), Positives = 128/150 (85%), Gaps = 6/150 (4%)
 Frame = +3

Query  63   MTKDVEAVPEQPAEFSAKDYHDPPPSPLIDFDELTKWSFYRAVIAEFIAtllflyvtvlt  242
            M KDVE    +  EF+ KDYHDPPP+PL D +ELTKWSFYRA+IAEFIATLLFLY+TVLT
Sbjct  1    MAKDVEGA--EHGEFATKDYHDPPPTPLFDAEELTKWSFYRALIAEFIATLLFLYITVLT  58

Query  243  vIGYKHQTDPKAGGQDCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLAR  422
            VIGYK Q++       CGGVGILGIAWAFGGMIF+LVYCTAGISGGHINPAVTFGLFLAR
Sbjct  59   VIGYKSQSE----ADQCGGVGILGIAWAFGGMIFVLVYCTAGISGGHINPAVTFGLFLAR  114

Query  423  KVTLPRAVLYMIAQCLGAICGVGVGEGFPE  512
            KV+L RAVLY+IAQCLGAICGVG+ + F +
Sbjct  115  KVSLIRAVLYIIAQCLGAICGVGLVKAFQK  144



>dbj|BAA92260.1| Plasma membrane aquaporin 2b [Raphanus sativus]
Length=283

 Score =   206 bits (524),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 113/148 (76%), Positives = 125/148 (84%), Gaps = 4/148 (3%)
 Frame = +3

Query  63   MTKDVEAVPEQPAEFSAKDYHDPPPSPLIDFDELTKWSFYRAVIAEFIAtllflyvtvlt  242
            M K+VE        F+ +DY DPPP+P  D +ELTKWS YRAVIAEF+ATLLFLYVTVLT
Sbjct  1    MAKEVEGAEG----FATRDYEDPPPTPFFDAEELTKWSLYRAVIAEFVATLLFLYVTVLT  56

Query  243  vIGYKHQTDPKAGGQDCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLAR  422
            VIGYK  +D KAGG +CGGVGILGI+WAFGGMIFILVYCTAGISGGHINPAVTFGLFLAR
Sbjct  57   VIGYKISSDTKAGGDECGGVGILGISWAFGGMIFILVYCTAGISGGHINPAVTFGLFLAR  116

Query  423  KVTLPRAVLYMIAQCLGAICGVGVGEGF  506
            KV+L RAVLYM+AQCLGAICGVG  + F
Sbjct  117  KVSLVRAVLYMVAQCLGAICGVGFVKAF  144



>emb|CAC82712.1| major intrinsic protein 1 [Populus tremula x Populus tremuloides]
 emb|CAH60722.1| putative plasma membrane intrinsic protein [Populus tremula x 
Populus tremuloides]
Length=285

 Score =   206 bits (524),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 112/150 (75%), Positives = 127/150 (85%), Gaps = 4/150 (3%)
 Frame = +3

Query  63   MTKDVEAVPEQPAEFSAKDYHDPPPSPLIDFDELTKWSFYRAVIAEFIAtllflyvtvlt  242
            M KD E       E SAKDYHDPPP+PLID +E+T+WSFYRA+IAEF+ATLLFLY+TVLT
Sbjct  1    MGKDFEG----GGELSAKDYHDPPPAPLIDAEEITQWSFYRAIIAEFVATLLFLYITVLT  56

Query  243  vIGYKHQTDPKAGGQDCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLAR  422
            VIGYK+QTD    G +CGGVGILGIAWAFGGM FILVYCTAGISG HINPAVTFGLFLAR
Sbjct  57   VIGYKNQTDVHKNGHECGGVGILGIAWAFGGMNFILVYCTAGISGRHINPAVTFGLFLAR  116

Query  423  KVTLPRAVLYMIAQCLGAICGVGVGEGFPE  512
            KV+L RA+LYM+AQCL AICG G+ + FP+
Sbjct  117  KVSLVRAILYMVAQCLWAICGCGLVKAFPK  146



>ref|XP_006400824.1| hypothetical protein EUTSA_v10014299mg [Eutrema salsugineum]
 gb|ESQ42277.1| hypothetical protein EUTSA_v10014299mg [Eutrema salsugineum]
Length=285

 Score =   206 bits (524),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 109/148 (74%), Positives = 126/148 (85%), Gaps = 2/148 (1%)
 Frame = +3

Query  63   MTKDVEAVPEQPAEFSAKDYHDPPPSPLIDFDELTKWSFYRAVIAEFIAtllflyvtvlt  242
            M KD+E   ++    +A+DY DPPP+PL+D +EL KWS YRAVIAEF+ATLLFLYV++LT
Sbjct  1    MAKDLEV--QEGGATAARDYADPPPAPLLDMEELRKWSLYRAVIAEFVATLLFLYVSILT  58

Query  243  vIGYKHQTDPKAGGQDCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLAR  422
            VIGYK QTD  AGG DCGGVGILGIAWAFGGMIF+LVYCTAG+SGGHINPAVTFGLFLAR
Sbjct  59   VIGYKAQTDASAGGVDCGGVGILGIAWAFGGMIFVLVYCTAGVSGGHINPAVTFGLFLAR  118

Query  423  KVTLPRAVLYMIAQCLGAICGVGVGEGF  506
            KV+L R VLY++AQCLGAICG G  + F
Sbjct  119  KVSLVRTVLYIVAQCLGAICGCGFVKAF  146



>ref|XP_010098191.1| Aquaporin PIP2-7 [Morus notabilis]
 gb|EXB74647.1| Aquaporin PIP2-7 [Morus notabilis]
Length=281

 Score =   206 bits (524),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 115/148 (78%), Positives = 128/148 (86%), Gaps = 6/148 (4%)
 Frame = +3

Query  63   MTKDVEAVPEQPAEFSAKDYHDPPPSPLIDFDELTKWSFYRAVIAEFIAtllflyvtvlt  242
            M KDVE V  +  EF AKDYHDPPP+PLID +ELT+WSFYRA+IAEFIATLLFLYVT+LT
Sbjct  1    MAKDVEVV--EGGEFQAKDYHDPPPAPLIDPEELTQWSFYRALIAEFIATLLFLYVTILT  58

Query  243  vIGYKHQTDPKAGGQDCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLAR  422
            VIGYK Q+       +CGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLAR
Sbjct  59   VIGYKSQS----ATDECGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLAR  114

Query  423  KVTLPRAVLYMIAQCLGAICGVGVGEGF  506
            KV+L RAVLY++AQCLGAICG G+ + F
Sbjct  115  KVSLVRAVLYIVAQCLGAICGTGLVKAF  142



>ref|XP_004291577.1| PREDICTED: aquaporin PIP2-2 [Fragaria vesca subsp. vesca]
Length=281

 Score =   206 bits (524),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 115/152 (76%), Positives = 128/152 (84%), Gaps = 6/152 (4%)
 Frame = +3

Query  63   MTKDVEAVPEQPAEFSAKDYHDPPPSPLIDFDELTKWSFYRAVIAEFIAtllflyvtvlt  242
            M KDVE    +  EF+AKDYHDPPP+PL D DELTKWSFYRAVIAEFIATLLFLY+TVLT
Sbjct  1    MAKDVEG--AEHGEFAAKDYHDPPPTPLFDADELTKWSFYRAVIAEFIATLLFLYITVLT  58

Query  243  vIGYKHQTDPKAGGQDCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLAR  422
            VIGYK Q+        CGGVGILGIAWAFGGMIF+LVYCTAGISGGHINPAVTFGLFLAR
Sbjct  59   VIGYKSQS----ATDQCGGVGILGIAWAFGGMIFVLVYCTAGISGGHINPAVTFGLFLAR  114

Query  423  KVTLPRAVLYMIAQCLGAICGVGVGEGFPEVI  518
            KV+L RAVLY++AQ LGAICGVG+ + F + +
Sbjct  115  KVSLLRAVLYIVAQSLGAICGVGLVKAFQKTL  146



>gb|EYU39575.1| hypothetical protein MIMGU_mgv1a011441mg [Erythranthe guttata]
Length=281

 Score =   206 bits (523),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 114/148 (77%), Positives = 125/148 (84%), Gaps = 8/148 (5%)
 Frame = +3

Query  63   MTKDVEAVPEQPAEFSAKDYHDPPPSPLIDFDELTKWSFYRAVIAEFIAtllflyvtvlt  242
            M KDV     +   F AKDYHDPPP+PLID +ELTKWSFYRAVIAEFIATLLFLY+TV T
Sbjct  1    MAKDVA----EQGSFGAKDYHDPPPAPLIDAEELTKWSFYRAVIAEFIATLLFLYITVAT  56

Query  243  vIGYKHQTDPKAGGQDCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLAR  422
            VIGYK Q    A   +CGGVGILGIAWAFGGMIF+LVYCTAGISGGHINPAVTFGLFLAR
Sbjct  57   VIGYKSQ----AAVDECGGVGILGIAWAFGGMIFVLVYCTAGISGGHINPAVTFGLFLAR  112

Query  423  KVTLPRAVLYMIAQCLGAICGVGVGEGF  506
            KV+L RAV+YM+AQCLGAICGVG+ + F
Sbjct  113  KVSLVRAVMYMVAQCLGAICGVGLVKAF  140



>emb|CDX10333.1| aquaporin [Coffea arabica]
Length=288

 Score =   206 bits (524),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 112/150 (75%), Positives = 126/150 (84%), Gaps = 2/150 (1%)
 Frame = +3

Query  63   MTKDVEAVPEQPAEFSAKDYHDPPPSPLIDFDELTKWSFYRAVIAEFIAtllflyvtvlt  242
            M KD+  V E    F+ KDYHDPPP+PLID +ELTKWSF+RA+IAEFIATLLFLY+TVLT
Sbjct  1    MAKDM-GVAEH-GSFTTKDYHDPPPAPLIDLEELTKWSFFRAIIAEFIATLLFLYITVLT  58

Query  243  vIGYKHQTDPKAGGQDCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLAR  422
            VIGYK Q D    G  CGGVGILGIAWAFGGMIF+LVYCTAGISGGHINPAVTFGLFLAR
Sbjct  59   VIGYKSQIDVAHQGDQCGGVGILGIAWAFGGMIFVLVYCTAGISGGHINPAVTFGLFLAR  118

Query  423  KVTLPRAVLYMIAQCLGAICGVGVGEGFPE  512
            KV+L RA+ YM+AQC+GAICGVG+ + F  
Sbjct  119  KVSLTRALAYMVAQCVGAICGVGLVKAFQR  148



>gb|AEY75242.1| plasma membrane intrinsic protein [Malus hupehensis]
Length=287

 Score =   206 bits (523),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 113/150 (75%), Positives = 125/150 (83%), Gaps = 2/150 (1%)
 Frame = +3

Query  63   MTKDVEAVPEQPAEFSAKDYHDPPPSPLIDFDELTKWSFYRAVIAEFIAtllflyvtvlt  242
            M KD+E    +   FSAKDY DPPP+PLID  ELTKWSFYRA+IAEF+ATLLFLYVTVLT
Sbjct  1    MAKDMEV--GERGSFSAKDYQDPPPAPLIDAAELTKWSFYRALIAEFVATLLFLYVTVLT  58

Query  243  vIGYKHQTDPKAGGQDCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLAR  422
            VIGYK QTDP      CGGVGILGIAWAFGGMIF+LVYCTAGISGGHINPAVTFGLFLAR
Sbjct  59   VIGYKSQTDPATNADACGGVGILGIAWAFGGMIFVLVYCTAGISGGHINPAVTFGLFLAR  118

Query  423  KVTLPRAVLYMIAQCLGAICGVGVGEGFPE  512
            KV+L RAV+YM+AQ LGAI GV + + F +
Sbjct  119  KVSLVRAVMYMVAQSLGAIAGVALVKAFQK  148



>gb|ABK93567.1| unknown [Populus trichocarpa]
Length=285

 Score =   206 bits (523),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 114/150 (76%), Positives = 126/150 (84%), Gaps = 4/150 (3%)
 Frame = +3

Query  63   MTKDVEAVPEQPAEFSAKDYHDPPPSPLIDFDELTKWSFYRAVIAEFIAtllflyvtvlt  242
            M KD+E    +   FSAKDYHDPPP+ L D  ELTKWSFYRA+IAEFIATLLFLY+TVLT
Sbjct  1    MAKDMEV--AEAGSFSAKDYHDPPPAQLFDAKELTKWSFYRALIAEFIATLLFLYITVLT  58

Query  243  vIGYKHQTDPKAGGQDCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLAR  422
            VIGYK Q D  A    CGGVGILGIAWAFGGMIF+LVYCTAGISGGHINPAVTFGLFLAR
Sbjct  59   VIGYKSQIDGSA--DSCGGVGILGIAWAFGGMIFVLVYCTAGISGGHINPAVTFGLFLAR  116

Query  423  KVTLPRAVLYMIAQCLGAICGVGVGEGFPE  512
            KV+L RAV+YM+AQCLGAICGVG+ + F +
Sbjct  117  KVSLIRAVMYMVAQCLGAICGVGLVKAFQK  146



>tpg|DAA64674.1| TPA_exp: aquaporin PIP2 2 [Nicotiana tabacum]
Length=283

 Score =   206 bits (523),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 111/150 (74%), Positives = 127/150 (85%), Gaps = 4/150 (3%)
 Frame = +3

Query  63   MTKDVEAVPEQPAEFSAKDYHDPPPSPLIDFDELTKWSFYRAVIAEFIAtllflyvtvlt  242
            M KD+E       E++ KDY DPPP+PLID +EL KWSFYRA+IAEFIATLLFLY+TVLT
Sbjct  1    MGKDIEV----GTEYAPKDYQDPPPAPLIDPEELGKWSFYRAIIAEFIATLLFLYITVLT  56

Query  243  vIGYKHQTDPKAGGQDCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLAR  422
            VIGYK Q DP   G+ CGGVGILGIAWAFGGMIF+LVYCTAGISGGHINPAVTFGLFLAR
Sbjct  57   VIGYKSQIDPDHNGEQCGGVGILGIAWAFGGMIFVLVYCTAGISGGHINPAVTFGLFLAR  116

Query  423  KVTLPRAVLYMIAQCLGAICGVGVGEGFPE  512
            KV+L RA++YM+AQCLGAICG G+ + F +
Sbjct  117  KVSLVRAIMYMLAQCLGAICGCGLVKAFQK  146



>ref|XP_009131906.1| PREDICTED: probable aquaporin PIP2-4 [Brassica rapa]
Length=285

 Score =   206 bits (523),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 109/148 (74%), Positives = 125/148 (84%), Gaps = 2/148 (1%)
 Frame = +3

Query  63   MTKDVEAVPEQPAEFSAKDYHDPPPSPLIDFDELTKWSFYRAVIAEFIAtllflyvtvlt  242
            M KD+E   ++    +A+DY DPPP+PL D +EL KWS YRAVIAEF+ATLLFLYV++LT
Sbjct  1    MAKDLEV--QEGGAMAARDYQDPPPAPLFDMEELGKWSLYRAVIAEFVATLLFLYVSILT  58

Query  243  vIGYKHQTDPKAGGQDCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLAR  422
            VIGYK QTD  AGG DCGGVGILGIAWAFGGMIF+LVYCTAGISGGHINPAVT GLFLAR
Sbjct  59   VIGYKAQTDANAGGVDCGGVGILGIAWAFGGMIFVLVYCTAGISGGHINPAVTVGLFLAR  118

Query  423  KVTLPRAVLYMIAQCLGAICGVGVGEGF  506
            KV+L R VLY++AQCLGAICG G+ + F
Sbjct  119  KVSLVRTVLYIVAQCLGAICGCGLVKAF  146



>ref|XP_009760326.1| PREDICTED: aquaporin PIP2-1-like [Nicotiana sylvestris]
Length=283

 Score =   206 bits (523),  Expect = 4e-62, Method: Compositional matrix adjust.
 Identities = 111/150 (74%), Positives = 127/150 (85%), Gaps = 4/150 (3%)
 Frame = +3

Query  63   MTKDVEAVPEQPAEFSAKDYHDPPPSPLIDFDELTKWSFYRAVIAEFIAtllflyvtvlt  242
            M KD+E       E++ KDY DPPP+PLID +EL KWSFYRA+IAEFIATLLFLY+TVLT
Sbjct  1    MGKDIEV----GTEYAPKDYQDPPPAPLIDPEELGKWSFYRAIIAEFIATLLFLYITVLT  56

Query  243  vIGYKHQTDPKAGGQDCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLAR  422
            VIGYK Q DP   G+ CGGVGILGIAWAFGGMIF+LVYCTAGISGGHINPAVTFGLFLAR
Sbjct  57   VIGYKSQIDPDHNGEQCGGVGILGIAWAFGGMIFVLVYCTAGISGGHINPAVTFGLFLAR  116

Query  423  KVTLPRAVLYMIAQCLGAICGVGVGEGFPE  512
            KV+L RA++YM+AQCLGAICG G+ + F +
Sbjct  117  KVSLVRAIMYMLAQCLGAICGCGLVKAFQK  146



>ref|XP_009126591.1| PREDICTED: probable aquaporin PIP2-4 [Brassica rapa]
Length=283

 Score =   205 bits (522),  Expect = 4e-62, Method: Compositional matrix adjust.
 Identities = 113/148 (76%), Positives = 126/148 (85%), Gaps = 4/148 (3%)
 Frame = +3

Query  63   MTKDVEAVPEQPAEFSAKDYHDPPPSPLIDFDELTKWSFYRAVIAEFIAtllflyvtvlt  242
            M KD+E V E  A   A+DY DPPP+PL D +EL KWS YRAVIAEF+ATLLFLYV++LT
Sbjct  1    MAKDLE-VQEGRA---ARDYQDPPPAPLFDMEELGKWSLYRAVIAEFVATLLFLYVSILT  56

Query  243  vIGYKHQTDPKAGGQDCGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLAR  422
            VIGYK QTD  AGG DCGGVGILGIAWAFGGMIF+LVYCTAGISGGHINPAVTFGLFLAR
Sbjct  57   VIGYKAQTDASAGGADCGGVGILGIAWAFGGMIFVLVYCTAGISGGHINPAVTFGLFLAR  116

Query  423  KVTLPRAVLYMIAQCLGAICGVGVGEGF  506
            KV+L R VLY++AQCLGAICG G+ + F
Sbjct  117  KVSLVRTVLYIVAQCLGAICGCGLVKAF  144



>ref|XP_004956113.1| PREDICTED: aquaporin PIP2-1-like [Setaria italica]
Length=289

 Score =   206 bits (523),  Expect = 4e-62, Method: Compositional matrix adjust.
 Identities = 112/136 (82%), Positives = 122/136 (90%), Gaps = 1/136 (1%)
 Frame = +3

Query  102  EFSAKDYHDPPPSPLIDFDELTKWSFYRAVIAEFIAtllflyvtvltvIGYKHQTDPKAG  281
            EF+AKDY DPPP+PLID  EL  WS YRAVIAEFIATLLFLY+TVLTVIGYKHQTDP   
Sbjct  15   EFAAKDYTDPPPAPLIDAAELGSWSLYRAVIAEFIATLLFLYITVLTVIGYKHQTDPNVA  74

Query  282  GQD-CGGVGILGIAWAFGGMIFILVYCTAGISGGHINPAVTFGLFLARKVTLPRAVLYMI  458
            G D CGGVGILGIAWAFGGMIF+LVYCTAGISGGHINPAVTFGLFLARKV+L RA+LY++
Sbjct  75   GTDACGGVGILGIAWAFGGMIFVLVYCTAGISGGHINPAVTFGLFLARKVSLVRALLYIV  134

Query  459  AQCLGAICGVGVGEGF  506
            AQCLGAICGVG+ + F
Sbjct  135  AQCLGAICGVGLVKAF  150



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 644970849880