BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFF036L17

Length=551
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

gb|ABB55368.1|  Aux/IAA protein-like                                  83.2    1e-15   Solanum tuberosum [potatoes]
ref|NP_001275473.1|  Aux/IAA protein                                  82.8    1e-15   Solanum tuberosum [potatoes]
ref|XP_002509993.1|  Auxin-responsive protein IAA19, putative         82.0    3e-15   
ref|XP_010320058.1|  PREDICTED: auxin-responsive protein (Aux/IAA...  81.3    5e-15   
ref|NP_001265888.1|  auxin-responsive protein (Aux/IAA)               81.3    5e-15   
emb|CAD10639.1|  IAA9 protein                                         78.2    5e-14   Nicotiana tabacum [American tobacco]
ref|XP_009608764.1|  PREDICTED: auxin-responsive protein IAA8-like    78.2    5e-14   Nicotiana tomentosiformis
ref|XP_009789143.1|  PREDICTED: auxin-responsive protein IAA8-like    77.8    7e-14   Nicotiana sylvestris
ref|XP_008339000.1|  PREDICTED: auxin-responsive protein IAA8-lik...  76.6    2e-13   
ref|XP_008338995.1|  PREDICTED: auxin-responsive protein IAA9-lik...  76.6    2e-13   
ref|XP_009366395.1|  PREDICTED: auxin-responsive protein IAA8-like    76.3    3e-13   Pyrus x bretschneideri [bai li]
gb|KJB58782.1|  hypothetical protein B456_009G226000                  75.9    3e-13   Gossypium raimondii
ref|XP_007018336.1|  Aux/IAA protein isoform 1                        76.3    4e-13   
emb|CAJ13716.1|  auxin induced protein                                74.3    4e-13   Capsicum chinense [bonnet pepper]
gb|KJB58777.1|  hypothetical protein B456_009G226000                  75.9    4e-13   Gossypium raimondii
gb|KJB58781.1|  hypothetical protein B456_009G226000                  75.9    5e-13   Gossypium raimondii
ref|XP_007225723.1|  hypothetical protein PRUPE_ppa006744mg           73.6    1e-12   
emb|CAC84706.1|  aux/IAA protein                                      74.3    2e-12   Populus tremula x Populus tremuloides
ref|XP_011016963.1|  PREDICTED: auxin-responsive protein IAA9-like    73.6    3e-12   Populus euphratica
ref|XP_008219180.1|  PREDICTED: auxin-responsive protein IAA8-like    73.6    3e-12   Prunus mume [ume]
emb|CAN77436.1|  hypothetical protein VITISV_007399                   73.2    3e-12   Vitis vinifera
ref|XP_007225727.1|  hypothetical protein PRUPE_ppa006744mg           73.6    4e-12   Prunus persica
ref|XP_007225724.1|  hypothetical protein PRUPE_ppa006744mg           73.2    4e-12   
ref|NP_001268170.1|  Aux/IAA protein                                  73.2    4e-12   Vitis vinifera
ref|XP_010664066.1|  PREDICTED: aux/IAA protein isoform X1            73.2    4e-12   Vitis vinifera
gb|KJB64034.1|  hypothetical protein B456_010G031600                  71.6    7e-12   Gossypium raimondii
gb|AAL92850.1|  Aux/IAA protein                                       72.0    1e-11   Vitis vinifera
gb|KJB64033.1|  hypothetical protein B456_010G031600                  71.6    1e-11   Gossypium raimondii
ref|NP_001280795.1|  auxin-responsive protein IAA8-like               72.0    1e-11   Malus domestica [apple tree]
ref|XP_008378626.1|  PREDICTED: auxin-responsive protein IAA8-like    71.6    1e-11   
ref|XP_002302351.1|  auxin-responsive family protein                  71.6    1e-11   Populus trichocarpa [western balsam poplar]
gb|AFZ78618.1|  hypothetical protein                                  71.6    1e-11   Populus tomentosa [Chinese white poplar]
gb|KHG13564.1|  Auxin-responsive IAA9 -like protein                   71.2    2e-11   Gossypium arboreum [tree cotton]
gb|AEI70507.1|  auxin-responsive protein                              71.2    2e-11   Gossypium hirsutum [American cotton]
gb|KJB64027.1|  hypothetical protein B456_010G031600                  71.2    2e-11   Gossypium raimondii
gb|KCW68554.1|  hypothetical protein EUGRSUZ_F02172                   68.6    1e-10   Eucalyptus grandis [rose gum]
gb|KCW68553.1|  hypothetical protein EUGRSUZ_F02172                   68.2    2e-10   Eucalyptus grandis [rose gum]
ref|XP_010061570.1|  PREDICTED: auxin-responsive protein IAA9-like    68.2    2e-10   Eucalyptus grandis [rose gum]
gb|KDP41528.1|  hypothetical protein JCGZ_15935                       67.4    4e-10   Jatropha curcas
gb|ACU23129.1|  unknown                                               65.1    5e-10   Glycine max [soybeans]
gb|EYU44548.1|  hypothetical protein MIMGU_mgv1a010252mg              66.2    7e-10   Erythranthe guttata [common monkey flower]
gb|EYU44549.1|  hypothetical protein MIMGU_mgv1a010252mg              66.2    7e-10   Erythranthe guttata [common monkey flower]
gb|KDP32156.1|  hypothetical protein JCGZ_12617                       66.6    8e-10   Jatropha curcas
ref|XP_007137671.1|  hypothetical protein PHAVU_009G146000g           65.9    1e-09   Phaseolus vulgaris [French bean]
ref|XP_011099452.1|  PREDICTED: auxin-responsive protein IAA9-like    65.1    3e-09   Sesamum indicum [beniseed]
ref|XP_003544843.1|  PREDICTED: auxin-responsive protein IAA9         64.7    3e-09   Glycine max [soybeans]
gb|AID60626.1|  auxin-responsive protein IAA8                         63.5    3e-09   Dimocarpus longan [longan]
ref|XP_003519213.1|  PREDICTED: auxin-responsive protein IAA9-like    63.9    7e-09   Glycine max [soybeans]
emb|CDP02673.1|  unnamed protein product                              63.9    7e-09   Coffea canephora [robusta coffee]
ref|XP_004299829.1|  PREDICTED: auxin-responsive protein IAA8-lik...  62.8    1e-08   Fragaria vesca subsp. vesca
ref|XP_008236708.1|  PREDICTED: auxin-responsive protein IAA9         62.8    2e-08   Prunus mume [ume]
ref|XP_007205358.1|  hypothetical protein PRUPE_ppa007194mg           62.8    2e-08   Prunus persica
ref|XP_010104556.1|  Auxin-responsive protein IAA9                    62.4    2e-08   
ref|NP_001267710.1|  auxin-responsive protein IAA9-like               62.0    3e-08   Cucumis sativus [cucumbers]
ref|XP_004509716.1|  PREDICTED: auxin-responsive protein IAA9-lik...  61.6    3e-08   
ref|XP_004509715.1|  PREDICTED: auxin-responsive protein IAA9-lik...  61.6    3e-08   Cicer arietinum [garbanzo]
gb|KDO81312.1|  hypothetical protein CISIN_1g017824mg                 59.7    4e-08   Citrus sinensis [apfelsine]
ref|XP_009344514.1|  PREDICTED: auxin-responsive protein IAA9         61.2    6e-08   Pyrus x bretschneideri [bai li]
gb|ADL36578.1|  ARF domain class transcription factor                 60.8    6e-08   Malus domestica [apple tree]
gb|KHN09036.1|  Auxin-responsive protein IAA8                         60.8    8e-08   Glycine soja [wild soybean]
ref|XP_006433732.1|  hypothetical protein CICLE_v10001479mg           60.5    8e-08   
gb|KDO81311.1|  hypothetical protein CISIN_1g017824mg                 60.1    9e-08   Citrus sinensis [apfelsine]
ref|XP_006433736.1|  hypothetical protein CICLE_v10001479mg           60.5    9e-08   Citrus clementina [clementine]
ref|XP_010105114.1|  Auxin-responsive protein IAA9                    60.5    1e-07   
gb|KDO81302.1|  hypothetical protein CISIN_1g017824mg                 60.1    1e-07   Citrus sinensis [apfelsine]
ref|XP_006472387.1|  PREDICTED: auxin-responsive protein IAA9-lik...  60.1    1e-07   Citrus sinensis [apfelsine]
gb|KDO81310.1|  hypothetical protein CISIN_1g017824mg                 59.7    1e-07   Citrus sinensis [apfelsine]
gb|KJB71171.1|  hypothetical protein B456_011G109000                  59.3    2e-07   Gossypium raimondii
gb|AAM12952.1|  auxin-regulated protein                               59.3    2e-07   Zinnia elegans [garden zinnia]
ref|XP_002528895.1|  transcription factor, putative                   59.3    2e-07   Ricinus communis
gb|KJB71166.1|  hypothetical protein B456_011G109000                  59.3    2e-07   Gossypium raimondii
ref|XP_003628839.1|  Indoleacetic acid-induced-like protein           59.3    2e-07   
gb|KJB71165.1|  hypothetical protein B456_011G109000                  58.9    3e-07   Gossypium raimondii
gb|KJB71172.1|  hypothetical protein B456_011G109000                  58.9    3e-07   Gossypium raimondii
gb|KHG08881.1|  Auxin-responsive IAA9 -like protein                   58.5    4e-07   Gossypium arboreum [tree cotton]
ref|XP_008444965.1|  PREDICTED: auxin-responsive protein IAA9-like    58.2    5e-07   Cucumis melo [Oriental melon]
gb|AFK49626.1|  unknown                                               58.2    6e-07   Medicago truncatula
gb|ACJ84551.1|  unknown                                               57.8    6e-07   Medicago truncatula
gb|EYU41350.1|  hypothetical protein MIMGU_mgv1a009380mg              57.8    7e-07   Erythranthe guttata [common monkey flower]
ref|XP_006426197.1|  hypothetical protein CICLE_v10025873mg           57.8    8e-07   Citrus clementina [clementine]
ref|XP_006466369.1|  PREDICTED: auxin-responsive protein IAA9-like    57.8    8e-07   Citrus sinensis [apfelsine]
ref|XP_007047688.1|  Transcription factor, putative isoform 2         57.0    1e-06   Theobroma cacao [chocolate]
ref|XP_007047687.1|  Transcription factor, putative isoform 1         57.0    1e-06   Theobroma cacao [chocolate]
ref|NP_001241389.1|  uncharacterized protein LOC100783314             56.6    2e-06   Glycine max [soybeans]
ref|XP_007047690.1|  Transcription factor, putative isoform 4         56.6    2e-06   
gb|KHN08222.1|  Auxin-responsive protein IAA8                         56.6    2e-06   Glycine soja [wild soybean]
ref|XP_003517136.1|  PREDICTED: auxin-responsive protein IAA9 iso...  56.2    2e-06   
emb|CDP00957.1|  unnamed protein product                              55.1    6e-06   Coffea canephora [robusta coffee]
ref|XP_010275504.1|  PREDICTED: auxin-responsive protein IAA9 iso...  54.7    8e-06   Nelumbo nucifera [Indian lotus]
ref|XP_010275505.1|  PREDICTED: auxin-responsive protein IAA9 iso...  54.7    8e-06   Nelumbo nucifera [Indian lotus]
gb|ACU19961.1|  unknown                                               53.1    2e-05   Glycine max [soybeans]
ref|XP_010275506.1|  PREDICTED: auxin-responsive protein IAA9 iso...  53.1    2e-05   Nelumbo nucifera [Indian lotus]
ref|XP_003531969.1|  PREDICTED: auxin-responsive protein IAA9-lik...  53.1    2e-05   Glycine max [soybeans]
ref|XP_003534264.1|  PREDICTED: auxin-responsive protein IAA9         53.1    2e-05   Glycine max [soybeans]
gb|KHN22187.1|  Auxin-responsive protein IAA9                         53.1    3e-05   Glycine soja [wild soybean]
ref|XP_006585902.1|  PREDICTED: auxin-responsive protein IAA9-lik...  53.1    3e-05   
gb|AFK43616.1|  unknown                                               51.2    4e-05   Lotus japonicus
ref|XP_004143431.1|  PREDICTED: auxin-responsive protein IAA9-like    52.4    5e-05   Cucumis sativus [cucumbers]
ref|XP_007158315.1|  hypothetical protein PHAVU_002G142500g           52.4    5e-05   Phaseolus vulgaris [French bean]
ref|XP_008440498.1|  PREDICTED: auxin-responsive protein IAA9-like    52.4    5e-05   Cucumis melo [Oriental melon]
gb|AGV54485.1|  auxin-responsive protein                              52.0    5e-05   Phaseolus vulgaris [French bean]
ref|XP_004288310.1|  PREDICTED: auxin-responsive protein IAA9         52.0    6e-05   Fragaria vesca subsp. vesca
ref|XP_004490496.1|  PREDICTED: auxin-responsive protein IAA9-like    51.6    9e-05   Cicer arietinum [garbanzo]
gb|ABD98054.1|  auxin-regulated protein                               51.2    1e-04   Striga asiatica [witchweed]
ref|XP_007156440.1|  hypothetical protein PHAVU_003G286200g           50.8    2e-04   Phaseolus vulgaris [French bean]
ref|XP_010254653.1|  PREDICTED: auxin-responsive protein IAA9-like    49.7    4e-04   Nelumbo nucifera [Indian lotus]
ref|XP_010518881.1|  PREDICTED: auxin-responsive protein IAA9-like    49.3    5e-04   Tarenaya hassleriana [spider flower]
ref|NP_001237053.1|  uncharacterized protein LOC100500373             47.8    8e-04   



>gb|ABB55368.1| Aux/IAA protein-like [Solanum tuberosum]
Length=349

 Score = 83.2 bits (204),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 60/81 (74%), Positives = 69/81 (85%), Gaps = 1/81 (1%)
 Frame = +3

Query  312  MSPPLLGVGED-GQSNVTHMASPISLDSVCQNGPELKEWNYMGLsdcssvdsstisstse  488
            MSPPLLGVGE+ GQSNVT +AS  SL S+C+ G  LKE NYMGLSDCSSVDS  IS++SE
Sbjct  1    MSPPLLGVGEEEGQSNVTLLASSTSLGSICKKGSALKERNYMGLSDCSSVDSCNISTSSE  60

Query  489  nnsGRGLNLRATELRLGLPGS  551
            +N+G GLNL+ATELRLGLPGS
Sbjct  61   DNNGCGLNLKATELRLGLPGS  81



>ref|NP_001275473.1| Aux/IAA protein [Solanum tuberosum]
 gb|AAM29182.1| Aux/IAA protein [Solanum tuberosum]
Length=349

 Score = 82.8 bits (203),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 60/81 (74%), Positives = 69/81 (85%), Gaps = 1/81 (1%)
 Frame = +3

Query  312  MSPPLLGVGED-GQSNVTHMASPISLDSVCQNGPELKEWNYMGLsdcssvdsstisstse  488
            MSPPLLGVGE+ GQSNVT +AS  SL S+C+ G  LKE NYMGLSDCSSVDS  IS++SE
Sbjct  1    MSPPLLGVGEEEGQSNVTLLASSTSLGSICKKGSALKERNYMGLSDCSSVDSCNISTSSE  60

Query  489  nnsGRGLNLRATELRLGLPGS  551
            +N+G GLNL+ATELRLGLPGS
Sbjct  61   DNNGCGLNLKATELRLGLPGS  81



>ref|XP_002509993.1| Auxin-responsive protein IAA19, putative [Ricinus communis]
 gb|EEF52180.1| Auxin-responsive protein IAA19, putative [Ricinus communis]
Length=374

 Score = 82.0 bits (201),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 56/80 (70%), Positives = 66/80 (83%), Gaps = 1/80 (1%)
 Frame = +3

Query  312  MSPPLLGVGEDGQSNVTHMASPISLDSVCQNGPELKEWNYMGLsdcssvdsstisstsen  491
            MSPPL+GV E+GQSNVT +AS  S +S+CQNG +LKE NYMGLSDCSSVDSS   S+S+ 
Sbjct  1    MSPPLIGVVEEGQSNVTVLASSTSAESICQNGSKLKERNYMGLSDCSSVDSSIAPSSSDE  60

Query  492  nsGRGLNLRATELRLGLPGS  551
            +  R LNL+ATELRLGLPGS
Sbjct  61   SKTR-LNLKATELRLGLPGS  79



>ref|XP_010320058.1| PREDICTED: auxin-responsive protein (Aux/IAA) isoform X1 [Solanum 
lycopersicum]
Length=349

 Score = 81.3 bits (199),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 60/81 (74%), Positives = 68/81 (84%), Gaps = 1/81 (1%)
 Frame = +3

Query  312  MSPPLLGVGED-GQSNVTHMASPISLDSVCQNGPELKEWNYMGLsdcssvdsstisstse  488
            MSPPLLGVGE+ GQSNVT +AS  SL S+C  G  LKE NYMGLSDCSSVDS  IS++SE
Sbjct  1    MSPPLLGVGEEEGQSNVTLLASSTSLGSICIKGSALKERNYMGLSDCSSVDSCNISTSSE  60

Query  489  nnsGRGLNLRATELRLGLPGS  551
            +N+G GLNL+ATELRLGLPGS
Sbjct  61   DNNGCGLNLKATELRLGLPGS  81



>ref|NP_001265888.1| auxin-responsive protein (Aux/IAA) [Solanum lycopersicum]
 gb|AAZ20313.1| AUX/IAA protein [Solanum lycopersicum]
 gb|ADN51993.1| entire [Solanum lycopersicum]
 gb|AEX00353.1| IAA9 [Solanum lycopersicum]
Length=349

 Score = 81.3 bits (199),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 60/81 (74%), Positives = 68/81 (84%), Gaps = 1/81 (1%)
 Frame = +3

Query  312  MSPPLLGVGED-GQSNVTHMASPISLDSVCQNGPELKEWNYMGLsdcssvdsstisstse  488
            MSPPLLGVGE+ GQSNVT +AS  SL S+C  G  LKE NYMGLSDCSSVDS  IS++SE
Sbjct  1    MSPPLLGVGEEEGQSNVTLLASSTSLGSICIKGSALKERNYMGLSDCSSVDSCNISTSSE  60

Query  489  nnsGRGLNLRATELRLGLPGS  551
            +N+G GLNL+ATELRLGLPGS
Sbjct  61   DNNGCGLNLKATELRLGLPGS  81



>emb|CAD10639.1| IAA9 protein [Nicotiana tabacum]
Length=346

 Score = 78.2 bits (191),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 59/81 (73%), Positives = 68/81 (84%), Gaps = 1/81 (1%)
 Frame = +3

Query  312  MSPPLLGV-GEDGQSNVTHMASPISLDSVCQNGPELKEWNYMGLsdcssvdsstisstse  488
            MSPPLL V  E+GQSNVT +AS  SL S+C+ G ELKE NYMGLSDCSSVDS TIS++SE
Sbjct  1    MSPPLLDVREEEGQSNVTLLASSASLGSICKKGSELKERNYMGLSDCSSVDSCTISTSSE  60

Query  489  nnsGRGLNLRATELRLGLPGS  551
            +N+  GLNL+ATELRLGLPGS
Sbjct  61   DNNACGLNLKATELRLGLPGS  81



>ref|XP_009608764.1| PREDICTED: auxin-responsive protein IAA8-like [Nicotiana tomentosiformis]
Length=346

 Score = 78.2 bits (191),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 59/81 (73%), Positives = 68/81 (84%), Gaps = 1/81 (1%)
 Frame = +3

Query  312  MSPPLLGV-GEDGQSNVTHMASPISLDSVCQNGPELKEWNYMGLsdcssvdsstisstse  488
            MSPPLL V  E+GQSNVT +AS  SL S+C+ G ELKE NYMGLSDCSSVDS TIS++SE
Sbjct  1    MSPPLLDVREEEGQSNVTLLASSASLGSICKKGSELKERNYMGLSDCSSVDSCTISTSSE  60

Query  489  nnsGRGLNLRATELRLGLPGS  551
            +N+  GLNL+ATELRLGLPGS
Sbjct  61   DNNACGLNLKATELRLGLPGS  81



>ref|XP_009789143.1| PREDICTED: auxin-responsive protein IAA8-like [Nicotiana sylvestris]
Length=346

 Score = 77.8 bits (190),  Expect = 7e-14, Method: Compositional matrix adjust.
 Identities = 58/81 (72%), Positives = 67/81 (83%), Gaps = 1/81 (1%)
 Frame = +3

Query  312  MSPPLLGV-GEDGQSNVTHMASPISLDSVCQNGPELKEWNYMGLsdcssvdsstisstse  488
            MSPPLL V  E+GQSNVT +AS  SL S+C+ G ELKE NYMGLSDCSSVDS TIS++S 
Sbjct  1    MSPPLLDVREEEGQSNVTLLASSASLGSICKKGSELKERNYMGLSDCSSVDSCTISTSSG  60

Query  489  nnsGRGLNLRATELRLGLPGS  551
            +N+  GLNL+ATELRLGLPGS
Sbjct  61   DNNACGLNLKATELRLGLPGS  81



>ref|XP_008339000.1| PREDICTED: auxin-responsive protein IAA8-like isoform X2 [Malus 
domestica]
Length=363

 Score = 76.6 bits (187),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 55/81 (68%), Positives = 67/81 (83%), Gaps = 2/81 (2%)
 Frame = +3

Query  312  MSPPLLGVGED-GQSNVTHMASPISLDSVCQNGPELKEWNYMGLsdcssvdsstisstse  488
            MSPPLLGVGE+ GQS+VT ++S  S++SVCQN  ELKE NYMGLSDCSSV SS +S+ S+
Sbjct  1    MSPPLLGVGEEEGQSDVTFLSSSGSMESVCQNSSELKEQNYMGLSDCSSVGSSNVSTASD  60

Query  489  nnsGRGLNLRATELRLGLPGS  551
             ++   LNL+ATELRLGLPGS
Sbjct  61   GSNS-SLNLKATELRLGLPGS  80



>ref|XP_008338995.1| PREDICTED: auxin-responsive protein IAA9-like isoform X1 [Malus 
domestica]
 ref|XP_008338996.1| PREDICTED: auxin-responsive protein IAA9-like isoform X1 [Malus 
domestica]
 ref|XP_008338997.1| PREDICTED: auxin-responsive protein IAA9-like isoform X1 [Malus 
domestica]
 ref|XP_008338999.1| PREDICTED: auxin-responsive protein IAA9-like isoform X1 [Malus 
domestica]
Length=366

 Score = 76.6 bits (187),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 55/81 (68%), Positives = 67/81 (83%), Gaps = 2/81 (2%)
 Frame = +3

Query  312  MSPPLLGVGED-GQSNVTHMASPISLDSVCQNGPELKEWNYMGLsdcssvdsstisstse  488
            MSPPLLGVGE+ GQS+VT ++S  S++SVCQN  ELKE NYMGLSDCSSV SS +S+ S+
Sbjct  1    MSPPLLGVGEEEGQSDVTFLSSSGSMESVCQNSSELKEQNYMGLSDCSSVGSSNVSTASD  60

Query  489  nnsGRGLNLRATELRLGLPGS  551
             ++   LNL+ATELRLGLPGS
Sbjct  61   GSNS-SLNLKATELRLGLPGS  80



>ref|XP_009366395.1| PREDICTED: auxin-responsive protein IAA8-like [Pyrus x bretschneideri]
 ref|XP_009366396.1| PREDICTED: auxin-responsive protein IAA8-like [Pyrus x bretschneideri]
Length=363

 Score = 76.3 bits (186),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 55/81 (68%), Positives = 66/81 (81%), Gaps = 2/81 (2%)
 Frame = +3

Query  312  MSPPLLGVGED-GQSNVTHMASPISLDSVCQNGPELKEWNYMGLsdcssvdsstisstse  488
            MSPPLLGVGE+ GQS+VT ++S  S++SVCQN  ELKE NYMGLSDCSSV SS +S+ S+
Sbjct  1    MSPPLLGVGEEEGQSDVTFLSSSGSMESVCQNSLELKEQNYMGLSDCSSVGSSKVSTASD  60

Query  489  nnsGRGLNLRATELRLGLPGS  551
             +    LNL+ATELRLGLPGS
Sbjct  61   GSKS-SLNLKATELRLGLPGS  80



>gb|KJB58782.1| hypothetical protein B456_009G226000 [Gossypium raimondii]
 gb|KJB58783.1| hypothetical protein B456_009G226000 [Gossypium raimondii]
Length=334

 Score = 75.9 bits (185),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 47/80 (59%), Positives = 56/80 (70%), Gaps = 1/80 (1%)
 Frame = +3

Query  312  MSPPLLGVGEDGQSNVTHMASPISLDSVCQNGPELKEWNYMGLsdcssvdsstisstsen  491
            MSPPLLGV E GQ+NVT + S  S+DSVCQN  ELKE NYMGL    S    ++ +   +
Sbjct  1    MSPPLLGVEEGGQNNVTLLGSSGSIDSVCQNNAELKERNYMGL-SDCSSIDCSVVTLGSD  59

Query  492  nsGRGLNLRATELRLGLPGS  551
            +S   LNL+ATELRLGLPGS
Sbjct  60   DSNVSLNLKATELRLGLPGS  79



>ref|XP_007018336.1| Aux/IAA protein isoform 1 [Theobroma cacao]
 ref|XP_007018337.1| Aux/IAA protein isoform 1 [Theobroma cacao]
 gb|EOY15561.1| Aux/IAA protein isoform 1 [Theobroma cacao]
 gb|EOY15562.1| Aux/IAA protein isoform 1 [Theobroma cacao]
Length=368

 Score = 76.3 bits (186),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 59/81 (73%), Positives = 64/81 (79%), Gaps = 2/81 (2%)
 Frame = +3

Query  312  MSPPLLGVGEDG-QSNVTHMASPISLDSVCQNGPELKEWNYMGLsdcssvdsstisstse  488
            MSPPLLGV E+G QSNVT + S  S+DSVCQN  ELKE NYMGLSDCSSVDSS  S  SE
Sbjct  1    MSPPLLGVEEEGGQSNVTCLGSSGSMDSVCQNSAELKERNYMGLSDCSSVDSSVGSPVSE  60

Query  489  nnsGRGLNLRATELRLGLPGS  551
             + G  LNL+ATELRLGLPGS
Sbjct  61   ESKG-NLNLKATELRLGLPGS  80



>emb|CAJ13716.1| auxin induced protein [Capsicum chinense]
Length=210

 Score = 74.3 bits (181),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 60/81 (74%), Positives = 68/81 (84%), Gaps = 1/81 (1%)
 Frame = +3

Query  312  MSPPLLGVGED-GQSNVTHMASPISLDSVCQNGPELKEWNYMGLsdcssvdsstisstse  488
            MSPPLLGVGE+ GQSNVT + S  SL S+CQ G  LKE NYMGLSDCSSVDS  IS++SE
Sbjct  1    MSPPLLGVGEEEGQSNVTLLGSSSSLGSICQKGLALKERNYMGLSDCSSVDSCNISTSSE  60

Query  489  nnsGRGLNLRATELRLGLPGS  551
            +N+G GLNL+ATELRLGLPGS
Sbjct  61   DNNGVGLNLKATELRLGLPGS  81



>gb|KJB58777.1| hypothetical protein B456_009G226000 [Gossypium raimondii]
 gb|KJB58778.1| hypothetical protein B456_009G226000 [Gossypium raimondii]
 gb|KJB58779.1| hypothetical protein B456_009G226000 [Gossypium raimondii]
 gb|KJB58780.1| hypothetical protein B456_009G226000 [Gossypium raimondii]
Length=367

 Score = 75.9 bits (185),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 47/80 (59%), Positives = 56/80 (70%), Gaps = 1/80 (1%)
 Frame = +3

Query  312  MSPPLLGVGEDGQSNVTHMASPISLDSVCQNGPELKEWNYMGLsdcssvdsstisstsen  491
            MSPPLLGV E GQ+NVT + S  S+DSVCQN  ELKE NYMGL    S    ++ +   +
Sbjct  1    MSPPLLGVEEGGQNNVTLLGSSGSIDSVCQNNAELKERNYMGL-SDCSSIDCSVVTLGSD  59

Query  492  nsGRGLNLRATELRLGLPGS  551
            +S   LNL+ATELRLGLPGS
Sbjct  60   DSNVSLNLKATELRLGLPGS  79



>gb|KJB58781.1| hypothetical protein B456_009G226000 [Gossypium raimondii]
Length=368

 Score = 75.9 bits (185),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 47/80 (59%), Positives = 56/80 (70%), Gaps = 1/80 (1%)
 Frame = +3

Query  312  MSPPLLGVGEDGQSNVTHMASPISLDSVCQNGPELKEWNYMGLsdcssvdsstisstsen  491
            MSPPLLGV E GQ+NVT + S  S+DSVCQN  ELKE NYMGL    S    ++ +   +
Sbjct  1    MSPPLLGVEEGGQNNVTLLGSSGSIDSVCQNNAELKERNYMGL-SDCSSIDCSVVTLGSD  59

Query  492  nsGRGLNLRATELRLGLPGS  551
            +S   LNL+ATELRLGLPGS
Sbjct  60   DSNVSLNLKATELRLGLPGS  79



>ref|XP_007225723.1| hypothetical protein PRUPE_ppa006744mg [Prunus persica]
 gb|EMJ26922.1| hypothetical protein PRUPE_ppa006744mg [Prunus persica]
Length=293

 Score = 73.6 bits (179),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 53/82 (65%), Positives = 65/82 (79%), Gaps = 3/82 (4%)
 Frame = +3

Query  312  MSPPLLGVGED--GQSNVTHMASPISLDSVCQNGPELKEWNYMGLsdcssvdsstissts  485
            MSPPLLGVGE+  G S+VT ++S +S++SVC N  ELKE NYMGLSDCSSVDSS +S+ S
Sbjct  1    MSPPLLGVGEEEEGHSDVTLLSSSVSMESVCHNSSELKERNYMGLSDCSSVDSSKVSTVS  60

Query  486  ennsGRGLNLRATELRLGLPGS  551
              +    LNL+AT+LRLGLPGS
Sbjct  61   GGSKN-SLNLKATDLRLGLPGS  81



>emb|CAC84706.1| aux/IAA protein [Populus tremula x Populus tremuloides]
Length=365

 Score = 74.3 bits (181),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 57/81 (70%), Positives = 64/81 (79%), Gaps = 2/81 (2%)
 Frame = +3

Query  312  MSPPLLGV-GEDGQSNVTHMASPISLDSVCQNGPELKEWNYMGLsdcssvdsstisstse  488
            MSPPLLGV  E+GQSNVT +ASP S +S C NG ELKE NYMGLSDCSSVDSS +S+ S+
Sbjct  1    MSPPLLGVVEEEGQSNVTLLASPASAESACLNGLELKERNYMGLSDCSSVDSSAVSAASD  60

Query  489  nnsGRGLNLRATELRLGLPGS  551
                  LNL+ATELRLGLPGS
Sbjct  61   ERKA-SLNLKATELRLGLPGS  80



>ref|XP_011016963.1| PREDICTED: auxin-responsive protein IAA9-like [Populus euphratica]
Length=366

 Score = 73.6 bits (179),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 56/81 (69%), Positives = 64/81 (79%), Gaps = 2/81 (2%)
 Frame = +3

Query  312  MSPPLLGV-GEDGQSNVTHMASPISLDSVCQNGPELKEWNYMGLsdcssvdsstisstse  488
            MSPPLLGV  E+GQSNVT ++SP+S +S C NG ELKE NYMGLSDCSSVDSS +S+ S 
Sbjct  1    MSPPLLGVVEEEGQSNVTLLSSPVSAESACLNGLELKERNYMGLSDCSSVDSSAVSAASN  60

Query  489  nnsGRGLNLRATELRLGLPGS  551
                  LNL+ATELRLGLPGS
Sbjct  61   ERKT-SLNLKATELRLGLPGS  80



>ref|XP_008219180.1| PREDICTED: auxin-responsive protein IAA8-like [Prunus mume]
 ref|XP_008219181.1| PREDICTED: auxin-responsive protein IAA8-like [Prunus mume]
Length=366

 Score = 73.6 bits (179),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 53/82 (65%), Positives = 65/82 (79%), Gaps = 3/82 (4%)
 Frame = +3

Query  312  MSPPLLGVGED--GQSNVTHMASPISLDSVCQNGPELKEWNYMGLsdcssvdsstissts  485
            MSPPLLGVGE+  G S+VT ++S +S++SVC N  ELKE NYMGLSDCSSVDSS +S+ S
Sbjct  1    MSPPLLGVGEEEEGHSDVTLLSSSVSMESVCHNSSELKERNYMGLSDCSSVDSSKVSTVS  60

Query  486  ennsGRGLNLRATELRLGLPGS  551
              +    LNL+AT+LRLGLPGS
Sbjct  61   GGSKS-SLNLKATDLRLGLPGS  81



>emb|CAN77436.1| hypothetical protein VITISV_007399 [Vitis vinifera]
Length=359

 Score = 73.2 bits (178),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 57/81 (70%), Positives = 65/81 (80%), Gaps = 2/81 (2%)
 Frame = +3

Query  312  MSPPLLGVGED-GQSNVTHMASPISLDSVCQNGPELKEWNYMGLsdcssvdsstisstse  488
            MSPPLLGVGE+ GQSNVT +AS  S++SVCQ    LKE NYMGLS+CSSVDSS IS+ S+
Sbjct  1    MSPPLLGVGEEEGQSNVTILASSASMESVCQISSGLKERNYMGLSECSSVDSSAISTDSD  60

Query  489  nnsGRGLNLRATELRLGLPGS  551
             N    LNL+ATELRLGLPGS
Sbjct  61   GNKS-SLNLKATELRLGLPGS  80



>ref|XP_007225727.1| hypothetical protein PRUPE_ppa006744mg [Prunus persica]
 gb|EMJ26926.1| hypothetical protein PRUPE_ppa006744mg [Prunus persica]
Length=397

 Score = 73.6 bits (179),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 53/82 (65%), Positives = 65/82 (79%), Gaps = 3/82 (4%)
 Frame = +3

Query  312  MSPPLLGVGED--GQSNVTHMASPISLDSVCQNGPELKEWNYMGLsdcssvdsstissts  485
            MSPPLLGVGE+  G S+VT ++S +S++SVC N  ELKE NYMGLSDCSSVDSS +S+ S
Sbjct  1    MSPPLLGVGEEEEGHSDVTLLSSSVSMESVCHNSSELKERNYMGLSDCSSVDSSKVSTVS  60

Query  486  ennsGRGLNLRATELRLGLPGS  551
              +    LNL+AT+LRLGLPGS
Sbjct  61   GGSKN-SLNLKATDLRLGLPGS  81



>ref|XP_007225724.1| hypothetical protein PRUPE_ppa006744mg [Prunus persica]
 ref|XP_007225725.1| hypothetical protein PRUPE_ppa006744mg [Prunus persica]
 ref|XP_007225726.1| hypothetical protein PRUPE_ppa006744mg [Prunus persica]
 gb|EMJ26923.1| hypothetical protein PRUPE_ppa006744mg [Prunus persica]
 gb|EMJ26924.1| hypothetical protein PRUPE_ppa006744mg [Prunus persica]
 gb|EMJ26925.1| hypothetical protein PRUPE_ppa006744mg [Prunus persica]
Length=366

 Score = 73.2 bits (178),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 53/82 (65%), Positives = 65/82 (79%), Gaps = 3/82 (4%)
 Frame = +3

Query  312  MSPPLLGVGED--GQSNVTHMASPISLDSVCQNGPELKEWNYMGLsdcssvdsstissts  485
            MSPPLLGVGE+  G S+VT ++S +S++SVC N  ELKE NYMGLSDCSSVDSS +S+ S
Sbjct  1    MSPPLLGVGEEEEGHSDVTLLSSSVSMESVCHNSSELKERNYMGLSDCSSVDSSKVSTVS  60

Query  486  ennsGRGLNLRATELRLGLPGS  551
              +    LNL+AT+LRLGLPGS
Sbjct  61   GGSKN-SLNLKATDLRLGLPGS  81



>ref|NP_001268170.1| Aux/IAA protein [Vitis vinifera]
 gb|AEV89794.1| indole-3-acetic acid-induced protein 4 [Vitis vinifera]
Length=359

 Score = 73.2 bits (178),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 57/81 (70%), Positives = 65/81 (80%), Gaps = 2/81 (2%)
 Frame = +3

Query  312  MSPPLLGVGED-GQSNVTHMASPISLDSVCQNGPELKEWNYMGLsdcssvdsstisstse  488
            MSPPLLGVGE+ GQSNVT +AS  S++SVCQ    LKE NYMGLS+CSSVDSS IS+ S+
Sbjct  1    MSPPLLGVGEEEGQSNVTILASSASMESVCQISSGLKERNYMGLSECSSVDSSAISTDSD  60

Query  489  nnsGRGLNLRATELRLGLPGS  551
             N    LNL+ATELRLGLPGS
Sbjct  61   GNKS-SLNLKATELRLGLPGS  80



>ref|XP_010664066.1| PREDICTED: aux/IAA protein isoform X1 [Vitis vinifera]
 ref|XP_010664068.1| PREDICTED: aux/IAA protein isoform X1 [Vitis vinifera]
 ref|XP_010664069.1| PREDICTED: aux/IAA protein isoform X1 [Vitis vinifera]
 gb|ADR80320.1| indole-3-acetic acid-induced protein 9 [Vitis vinifera]
Length=359

 Score = 73.2 bits (178),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 57/81 (70%), Positives = 65/81 (80%), Gaps = 2/81 (2%)
 Frame = +3

Query  312  MSPPLLGVGED-GQSNVTHMASPISLDSVCQNGPELKEWNYMGLsdcssvdsstisstse  488
            MSPPLLGVGE+ GQSNVT +AS  S++SVCQ    LKE NYMGLS+CSSVDSS IS+ S+
Sbjct  1    MSPPLLGVGEEEGQSNVTILASSASMESVCQISSGLKERNYMGLSECSSVDSSAISTDSD  60

Query  489  nnsGRGLNLRATELRLGLPGS  551
             N    LNL+ATELRLGLPGS
Sbjct  61   GNKS-SLNLKATELRLGLPGS  80



>gb|KJB64034.1| hypothetical protein B456_010G031600 [Gossypium raimondii]
 gb|KJB64035.1| hypothetical protein B456_010G031600 [Gossypium raimondii]
Length=303

 Score = 71.6 bits (174),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 56/80 (70%), Positives = 61/80 (76%), Gaps = 2/80 (3%)
 Frame = +3

Query  312  MSPPLLGVGEDG-QSNVTHMASPISLDSVCQNGPELKEWNYMGLsdcssvdsstisstse  488
            MSPPLLGV E+G QSNVT + S  S++SVCQN  ELKE NYMGLSDCSSVDSS  S  SE
Sbjct  1    MSPPLLGVEEEGIQSNVTLLGSSGSMESVCQNSAELKERNYMGLSDCSSVDSSVFSPPSE  60

Query  489  nnsGRGLNLRATELRLGLPG  548
                  LNL+ATELRLGLPG
Sbjct  61   ERKA-SLNLKATELRLGLPG  79



>gb|AAL92850.1| Aux/IAA protein [Vitis vinifera]
Length=359

 Score = 72.0 bits (175),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 56/80 (70%), Positives = 64/80 (80%), Gaps = 2/80 (3%)
 Frame = +3

Query  312  MSPPLLGVGED-GQSNVTHMASPISLDSVCQNGPELKEWNYMGLsdcssvdsstisstse  488
            MSPPLLGVGE+ GQSNVT +AS  S++SVCQ    LKE NYMGLS+CSSVDSS IS+ S+
Sbjct  1    MSPPLLGVGEEEGQSNVTILASSASMESVCQISSGLKERNYMGLSECSSVDSSAISTDSD  60

Query  489  nnsGRGLNLRATELRLGLPG  548
             N    LNL+ATELRLGLPG
Sbjct  61   GNKS-SLNLKATELRLGLPG  79



>gb|KJB64033.1| hypothetical protein B456_010G031600 [Gossypium raimondii]
Length=330

 Score = 71.6 bits (174),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 56/80 (70%), Positives = 61/80 (76%), Gaps = 2/80 (3%)
 Frame = +3

Query  312  MSPPLLGVGEDG-QSNVTHMASPISLDSVCQNGPELKEWNYMGLsdcssvdsstisstse  488
            MSPPLLGV E+G QSNVT + S  S++SVCQN  ELKE NYMGLSDCSSVDSS  S  SE
Sbjct  1    MSPPLLGVEEEGIQSNVTLLGSSGSMESVCQNSAELKERNYMGLSDCSSVDSSVFSPPSE  60

Query  489  nnsGRGLNLRATELRLGLPG  548
                  LNL+ATELRLGLPG
Sbjct  61   ERKA-SLNLKATELRLGLPG  79



>ref|NP_001280795.1| auxin-responsive protein IAA8-like [Malus domestica]
 gb|ADL36582.1| ARF domain class transcription factor [Malus domestica]
Length=363

 Score = 72.0 bits (175),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 55/81 (68%), Positives = 66/81 (81%), Gaps = 2/81 (2%)
 Frame = +3

Query  312  MSPPLLGVGED-GQSNVTHMASPISLDSVCQNGPELKEWNYMGLsdcssvdsstisstse  488
            MSPPLLGV E+ GQS+VT +AS  S++SVCQN  ELKE NYMGLSDCSSVDSS +S+ S+
Sbjct  1    MSPPLLGVDEEEGQSDVTLLASSGSMESVCQNSLELKERNYMGLSDCSSVDSSKVSAVSD  60

Query  489  nnsGRGLNLRATELRLGLPGS  551
             +    L+L+ATELRLGLPGS
Sbjct  61   GSRS-SLHLKATELRLGLPGS  80



>ref|XP_008378626.1| PREDICTED: auxin-responsive protein IAA8-like [Malus domestica]
 ref|XP_008378627.1| PREDICTED: auxin-responsive protein IAA8-like [Malus domestica]
Length=363

 Score = 71.6 bits (174),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 55/81 (68%), Positives = 66/81 (81%), Gaps = 2/81 (2%)
 Frame = +3

Query  312  MSPPLLGVGED-GQSNVTHMASPISLDSVCQNGPELKEWNYMGLsdcssvdsstisstse  488
            MSPPLLGV E+ GQS+VT +AS  S++SVCQN  ELKE NYMGLSDCSSVDSS +S+ S+
Sbjct  1    MSPPLLGVDEEEGQSDVTLLASSGSMESVCQNSLELKERNYMGLSDCSSVDSSKVSAVSD  60

Query  489  nnsGRGLNLRATELRLGLPGS  551
             +    L+L+ATELRLGLPGS
Sbjct  61   GSXS-SLHLKATELRLGLPGS  80



>ref|XP_002302351.1| auxin-responsive family protein [Populus trichocarpa]
 gb|ABK95187.1| unknown [Populus trichocarpa]
 gb|EEE81624.1| auxin-responsive family protein [Populus trichocarpa]
Length=366

 Score = 71.6 bits (174),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 56/81 (69%), Positives = 63/81 (78%), Gaps = 2/81 (2%)
 Frame = +3

Query  312  MSPPLLGV-GEDGQSNVTHMASPISLDSVCQNGPELKEWNYMGLsdcssvdsstisstse  488
            MSPPLLGV  E+G SNVT +ASP S +S C NG ELKE NYMGLSDCSSVDSS +S+ S+
Sbjct  1    MSPPLLGVVEEEGHSNVTLLASPASAESACLNGLELKERNYMGLSDCSSVDSSAVSAASD  60

Query  489  nnsGRGLNLRATELRLGLPGS  551
                  LNL+ATELRLGLPGS
Sbjct  61   ERKT-SLNLKATELRLGLPGS  80



>gb|AFZ78618.1| hypothetical protein [Populus tomentosa]
Length=365

 Score = 71.6 bits (174),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 56/81 (69%), Positives = 63/81 (78%), Gaps = 2/81 (2%)
 Frame = +3

Query  312  MSPPLLGV-GEDGQSNVTHMASPISLDSVCQNGPELKEWNYMGLsdcssvdsstisstse  488
            MSPPLLGV  E+G SNVT +ASP S +S C NG ELKE NYMGLSDCSSVDSS +S+ S+
Sbjct  1    MSPPLLGVVEEEGHSNVTLLASPASAESACLNGLELKERNYMGLSDCSSVDSSAVSAASD  60

Query  489  nnsGRGLNLRATELRLGLPGS  551
                  LNL+ATELRLGLPGS
Sbjct  61   ERKT-SLNLKATELRLGLPGS  80



>gb|KHG13564.1| Auxin-responsive IAA9 -like protein [Gossypium arboreum]
Length=357

 Score = 71.2 bits (173),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 56/80 (70%), Positives = 61/80 (76%), Gaps = 2/80 (3%)
 Frame = +3

Query  312  MSPPLLGVGEDG-QSNVTHMASPISLDSVCQNGPELKEWNYMGLsdcssvdsstisstse  488
            MSPPLLGV E+G QSNVT + S  S++SVCQN  ELKE NYMGLSDCSSVDSS  S  SE
Sbjct  1    MSPPLLGVEEEGVQSNVTLLGSSGSMESVCQNSAELKERNYMGLSDCSSVDSSVFSPPSE  60

Query  489  nnsGRGLNLRATELRLGLPG  548
                  LNL+ATELRLGLPG
Sbjct  61   ERKA-SLNLKATELRLGLPG  79



>gb|AEI70507.1| auxin-responsive protein [Gossypium hirsutum]
Length=357

 Score = 71.2 bits (173),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 56/80 (70%), Positives = 61/80 (76%), Gaps = 2/80 (3%)
 Frame = +3

Query  312  MSPPLLGVGEDG-QSNVTHMASPISLDSVCQNGPELKEWNYMGLsdcssvdsstisstse  488
            MSPPLLGV E+G QSNVT + S  S++SVCQN  ELKE NYMGLSDCSSVDSS  S  SE
Sbjct  1    MSPPLLGVEEEGVQSNVTLLGSSGSMESVCQNSAELKERNYMGLSDCSSVDSSVFSPPSE  60

Query  489  nnsGRGLNLRATELRLGLPG  548
                  LNL+ATELRLGLPG
Sbjct  61   ERKA-SLNLKATELRLGLPG  79



>gb|KJB64027.1| hypothetical protein B456_010G031600 [Gossypium raimondii]
 gb|KJB64028.1| hypothetical protein B456_010G031600 [Gossypium raimondii]
 gb|KJB64029.1| hypothetical protein B456_010G031600 [Gossypium raimondii]
 gb|KJB64030.1| hypothetical protein B456_010G031600 [Gossypium raimondii]
 gb|KJB64031.1| hypothetical protein B456_010G031600 [Gossypium raimondii]
 gb|KJB64032.1| hypothetical protein B456_010G031600 [Gossypium raimondii]
Length=357

 Score = 71.2 bits (173),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 56/80 (70%), Positives = 61/80 (76%), Gaps = 2/80 (3%)
 Frame = +3

Query  312  MSPPLLGVGEDG-QSNVTHMASPISLDSVCQNGPELKEWNYMGLsdcssvdsstisstse  488
            MSPPLLGV E+G QSNVT + S  S++SVCQN  ELKE NYMGLSDCSSVDSS  S  SE
Sbjct  1    MSPPLLGVEEEGIQSNVTLLGSSGSMESVCQNSAELKERNYMGLSDCSSVDSSVFSPPSE  60

Query  489  nnsGRGLNLRATELRLGLPG  548
                  LNL+ATELRLGLPG
Sbjct  61   ERKA-SLNLKATELRLGLPG  79



>gb|KCW68554.1| hypothetical protein EUGRSUZ_F02172 [Eucalyptus grandis]
 gb|KCW68555.1| hypothetical protein EUGRSUZ_F02172 [Eucalyptus grandis]
Length=321

 Score = 68.6 bits (166),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 51/81 (63%), Positives = 57/81 (70%), Gaps = 3/81 (4%)
 Frame = +3

Query  312  MSPPLLGVGEDG-QSNVTHMASPISLDSVCQNGPELKEWNYMGLsdcssvdsstisstse  488
            MSPPLL VGE+  +SNVT +ASP SL SVCQN  ELKE NYMG+ D  S D S I +  +
Sbjct  1    MSPPLLSVGEEECESNVTLLASPSSLGSVCQNA-ELKERNYMGMGDHPSADGSVIPNAFD  59

Query  489  nnsGRGLNLRATELRLGLPGS  551
                  LNLRATELRLGLPGS
Sbjct  60   GCK-ITLNLRATELRLGLPGS  79



>gb|KCW68553.1| hypothetical protein EUGRSUZ_F02172 [Eucalyptus grandis]
Length=330

 Score = 68.2 bits (165),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 51/81 (63%), Positives = 57/81 (70%), Gaps = 3/81 (4%)
 Frame = +3

Query  312  MSPPLLGVGEDG-QSNVTHMASPISLDSVCQNGPELKEWNYMGLsdcssvdsstisstse  488
            MSPPLL VGE+  +SNVT +ASP SL SVCQN  ELKE NYMG+ D  S D S I +  +
Sbjct  1    MSPPLLSVGEEECESNVTLLASPSSLGSVCQNA-ELKERNYMGMGDHPSADGSVIPNAFD  59

Query  489  nnsGRGLNLRATELRLGLPGS  551
                  LNLRATELRLGLPGS
Sbjct  60   GCK-ITLNLRATELRLGLPGS  79



>ref|XP_010061570.1| PREDICTED: auxin-responsive protein IAA9-like [Eucalyptus grandis]
 ref|XP_010061571.1| PREDICTED: auxin-responsive protein IAA9-like [Eucalyptus grandis]
 gb|KCW68552.1| hypothetical protein EUGRSUZ_F02172 [Eucalyptus grandis]
Length=359

 Score = 68.2 bits (165),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 51/81 (63%), Positives = 57/81 (70%), Gaps = 3/81 (4%)
 Frame = +3

Query  312  MSPPLLGVGEDG-QSNVTHMASPISLDSVCQNGPELKEWNYMGLsdcssvdsstisstse  488
            MSPPLL VGE+  +SNVT +ASP SL SVCQN  ELKE NYMG+ D  S D S I +  +
Sbjct  1    MSPPLLSVGEEECESNVTLLASPSSLGSVCQNA-ELKERNYMGMGDHPSADGSVIPNAFD  59

Query  489  nnsGRGLNLRATELRLGLPGS  551
                  LNLRATELRLGLPGS
Sbjct  60   GCK-ITLNLRATELRLGLPGS  79



>gb|KDP41528.1| hypothetical protein JCGZ_15935 [Jatropha curcas]
Length=368

 Score = 67.4 bits (163),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 54/81 (67%), Positives = 61/81 (75%), Gaps = 2/81 (2%)
 Frame = +3

Query  312  MSPPLLG-VGEDGQSNVTHMASPISLDSVCQNGPELKEWNYMGLsdcssvdsstisstse  488
            MS PLLG V E+GQSNVT +AS  S +S CQ G EL+E NYMGLSDCSSVDSS I +  +
Sbjct  1    MSSPLLGAVEEEGQSNVTLLASSTSAESTCQTGSELRERNYMGLSDCSSVDSSVIPAACD  60

Query  489  nnsGRGLNLRATELRLGLPGS  551
             N  R L L+ATELRLGLPGS
Sbjct  61   QNKTR-LILKATELRLGLPGS  80



>gb|ACU23129.1| unknown [Glycine max]
Length=210

 Score = 65.1 bits (157),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 52/81 (64%), Positives = 62/81 (77%), Gaps = 4/81 (5%)
 Frame = +3

Query  312  MSPPLLGVGED-GQSNVTHM-ASPISLDSVCQNGPELKEWNYMGLsdcssvdsstissts  485
            MS PLLG+GE+ GQSNVT + +S + ++SVC N  +LKE NYMGLSDCSSVDSS  S + 
Sbjct  1    MSKPLLGIGEEEGQSNVTLLVSSSVIMESVCLNSSKLKERNYMGLSDCSSVDSSAPSFSD  60

Query  486  ennsGRGLNLRATELRLGLPG  548
            E  S   LNL+ATELRLGLPG
Sbjct  61   ETKS--NLNLKATELRLGLPG  79



>gb|EYU44548.1| hypothetical protein MIMGU_mgv1a010252mg [Erythranthe guttata]
Length=318

 Score = 66.2 bits (160),  Expect = 7e-10, Method: Compositional matrix adjust.
 Identities = 50/80 (63%), Positives = 57/80 (71%), Gaps = 0/80 (0%)
 Frame = +3

Query  312  MSPPLLGVGEDGQSNVTHMASPISLDSVCQNGPELKEWNYMGLsdcssvdsstisstsen  491
            MSPPLLG+    Q+NV+ MAS  S D V QN   LKE NY+GLSDCSSVDSST+  T   
Sbjct  1    MSPPLLGIEGHNQANVSPMASSSSTDCVSQNVSCLKERNYLGLSDCSSVDSSTVMLTVPA  60

Query  492  nsGRGLNLRATELRLGLPGS  551
            +    LNL+ATELRLGLPGS
Sbjct  61   DPKSNLNLKATELRLGLPGS  80



>gb|EYU44549.1| hypothetical protein MIMGU_mgv1a010252mg [Erythranthe guttata]
Length=306

 Score = 66.2 bits (160),  Expect = 7e-10, Method: Compositional matrix adjust.
 Identities = 50/80 (63%), Positives = 57/80 (71%), Gaps = 0/80 (0%)
 Frame = +3

Query  312  MSPPLLGVGEDGQSNVTHMASPISLDSVCQNGPELKEWNYMGLsdcssvdsstisstsen  491
            MSPPLLG+    Q+NV+ MAS  S D V QN   LKE NY+GLSDCSSVDSST+  T   
Sbjct  1    MSPPLLGIEGHNQANVSPMASSSSTDCVSQNVSCLKERNYLGLSDCSSVDSSTVMLTVPA  60

Query  492  nsGRGLNLRATELRLGLPGS  551
            +    LNL+ATELRLGLPGS
Sbjct  61   DPKSNLNLKATELRLGLPGS  80



>gb|KDP32156.1| hypothetical protein JCGZ_12617 [Jatropha curcas]
Length=380

 Score = 66.6 bits (161),  Expect = 8e-10, Method: Compositional matrix adjust.
 Identities = 50/80 (63%), Positives = 61/80 (76%), Gaps = 1/80 (1%)
 Frame = +3

Query  312  MSPPLLGVGEDGQSNVTHMASPISLDSVCQNGPELKEWNYMGLsdcssvdsstisstsen  491
            MSPPLLGV E+G++NV+ +AS  S+D + QNG  L E NY+GLSDCSSVDSS + S S+ 
Sbjct  1    MSPPLLGVEEEGENNVSLVASSPSIDCISQNGCGLTERNYLGLSDCSSVDSSAVPSLSKE  60

Query  492  nsGRGLNLRATELRLGLPGS  551
                 LNL+ATELRLGLPGS
Sbjct  61   TKN-NLNLKATELRLGLPGS  79



>ref|XP_007137671.1| hypothetical protein PHAVU_009G146000g [Phaseolus vulgaris]
 ref|XP_007137672.1| hypothetical protein PHAVU_009G146000g [Phaseolus vulgaris]
 gb|ESW09665.1| hypothetical protein PHAVU_009G146000g [Phaseolus vulgaris]
 gb|ESW09666.1| hypothetical protein PHAVU_009G146000g [Phaseolus vulgaris]
Length=366

 Score = 65.9 bits (159),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 52/81 (64%), Positives = 62/81 (77%), Gaps = 3/81 (4%)
 Frame = +3

Query  312  MSPPLLGVGEDGQSNVTHM-ASPISLDSVCQNGPELKEWNYMGLsdcssvdsstisstse  488
            MSPPLLG+GE+G+SNVT + +S  +++SVC    ELKE NYMGLSDCSSVDSS  S + E
Sbjct  1    MSPPLLGIGEEGKSNVTLLVSSSTTMESVCLKTLELKERNYMGLSDCSSVDSSVPSVSEE  60

Query  489  nnsGRGLNLRATELRLGLPGS  551
              S   LNL+ATEL LGLPGS
Sbjct  61   TKS--NLNLKATELTLGLPGS  79



>ref|XP_011099452.1| PREDICTED: auxin-responsive protein IAA9-like [Sesamum indicum]
Length=359

 Score = 65.1 bits (157),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 54/80 (68%), Positives = 60/80 (75%), Gaps = 1/80 (1%)
 Frame = +3

Query  312  MSPPLLGVGEDGQSNVTHMASPISLDSVCQNGPELKEWNYMGLsdcssvdsstisstsen  491
            MSPPLLGV    Q NV+ MAS  S+D+V QNG  LKE NY+GLSDCSSVDSS +SS  E 
Sbjct  1    MSPPLLGVEGQDQCNVSLMASSASVDTVSQNGLGLKERNYLGLSDCSSVDSSGVSSVPEE  60

Query  492  nsGRGLNLRATELRLGLPGS  551
            N    LNL+ATELRLGLPGS
Sbjct  61   NKN-NLNLKATELRLGLPGS  79



>ref|XP_003544843.1| PREDICTED: auxin-responsive protein IAA9 [Glycine max]
 gb|KHN39979.1| Auxin-responsive protein IAA9 [Glycine soja]
Length=367

 Score = 64.7 bits (156),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 52/81 (64%), Positives = 62/81 (77%), Gaps = 4/81 (5%)
 Frame = +3

Query  312  MSPPLLGVGED-GQSNVTHM-ASPISLDSVCQNGPELKEWNYMGLsdcssvdsstissts  485
            MS PLLG+GE+ GQSNVT + +S + ++SVC N  +LKE NYMGLSDCSSVDSS  S + 
Sbjct  1    MSKPLLGIGEEEGQSNVTLLVSSSVIMESVCLNSSKLKERNYMGLSDCSSVDSSAPSFSD  60

Query  486  ennsGRGLNLRATELRLGLPG  548
            E  S   LNL+ATELRLGLPG
Sbjct  61   ETKS--NLNLKATELRLGLPG  79



>gb|AID60626.1| auxin-responsive protein IAA8 [Dimocarpus longan]
Length=257

 Score = 63.5 bits (153),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 58/83 (70%), Positives = 64/83 (77%), Gaps = 3/83 (4%)
 Frame = +3

Query  312  MSPPLLGVGED--GQSNVTHMASPISLDSVCQNGPELKEWNYMGLsdcssvdsstissts  485
            MSPPLLGV E+    SNVT +AS  SLDS+CQN PELKE NYMGLSDCSSVDSS IS+ S
Sbjct  1    MSPPLLGVEEEEGHPSNVTLLASSSSLDSICQNNPELKERNYMGLSDCSSVDSSVISNLS  60

Query  486  ennsGR-GLNLRATELRLGLPGS  551
                 +  LNL+ATELRLGLPGS
Sbjct  61   NETKSKSSLNLKATELRLGLPGS  83



>ref|XP_003519213.1| PREDICTED: auxin-responsive protein IAA9-like [Glycine max]
 gb|KHN26175.1| Auxin-responsive protein IAA9 [Glycine soja]
Length=366

 Score = 63.9 bits (154),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 52/82 (63%), Positives = 62/82 (76%), Gaps = 4/82 (5%)
 Frame = +3

Query  312  MSPPLLGVGED-GQSNVTHM-ASPISLDSVCQNGPELKEWNYMGLsdcssvdsstissts  485
            MS PLLG+ E+ GQSNVT + +S  +++SVC N  +LKE NYMGLSDCSSVDSS  S + 
Sbjct  1    MSKPLLGIAEEEGQSNVTLLVSSSATMESVCLNSSKLKERNYMGLSDCSSVDSSAPSFSD  60

Query  486  ennsGRGLNLRATELRLGLPGS  551
            E  S   LNL+ATELRLGLPGS
Sbjct  61   ETKSN--LNLKATELRLGLPGS  80



>emb|CDP02673.1| unnamed protein product [Coffea canephora]
Length=374

 Score = 63.9 bits (154),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 45/80 (56%), Positives = 55/80 (69%), Gaps = 2/80 (3%)
 Frame = +3

Query  312  MSPPLLGVGEDGQSNVTHMASPISLDSVCQNGPELKEWNYMGLsdcssvdsstisstsen  491
            MSPPLLG+  +GQ NV+ MAS  S+D V  NG  LKE NY+GLSD S   +S  + + E 
Sbjct  1    MSPPLLGIEGEGQGNVSVMASSKSVDCVSNNGLGLKERNYLGLSDSSEESTSMSTVSKEK  60

Query  492  nsGRGLNLRATELRLGLPGS  551
             S   LNL+AT+LRLGLPGS
Sbjct  61   KS--SLNLKATDLRLGLPGS  78



>ref|XP_004299829.1| PREDICTED: auxin-responsive protein IAA8-like isoform X1 [Fragaria 
vesca subsp. vesca]
Length=356

 Score = 62.8 bits (151),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 50/81 (62%), Positives = 59/81 (73%), Gaps = 3/81 (4%)
 Frame = +3

Query  312  MSPPLLGVGED-GQSNVTHMASPISLDSVCQNGPELKEWNYMGLsdcssvdsstisstse  488
            MS P +G GE+ G S+VT ++S +S+DSVC N  +LKE NYMGLSDCSSVDSS  S    
Sbjct  1    MSQPQVGAGEEEGSSDVTALSSSLSMDSVCPNSSDLKERNYMGLSDCSSVDSSKGSDVDG  60

Query  489  nnsGRGLNLRATELRLGLPGS  551
            + S   LNL ATELRLGLPGS
Sbjct  61   SKS--RLNLMATELRLGLPGS  79



>ref|XP_008236708.1| PREDICTED: auxin-responsive protein IAA9 [Prunus mume]
 ref|XP_008236714.1| PREDICTED: auxin-responsive protein IAA9 [Prunus mume]
 ref|XP_008236721.1| PREDICTED: auxin-responsive protein IAA9 [Prunus mume]
 ref|XP_008236728.1| PREDICTED: auxin-responsive protein IAA9 [Prunus mume]
Length=378

 Score = 62.8 bits (151),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 52/80 (65%), Positives = 61/80 (76%), Gaps = 1/80 (1%)
 Frame = +3

Query  312  MSPPLLGVGEDGQSNVTHMASPISLDSVCQNGPELKEWNYMGLsdcssvdsstisstsen  491
            MSPPLLG  E+GQSN + +AS  S+D +  NG  LKE NY+GLSDCSSVDSST+SS SE 
Sbjct  1    MSPPLLGGEEEGQSNGSMVASSRSMDCISHNGSGLKERNYLGLSDCSSVDSSTVSSLSEE  60

Query  492  nsGRGLNLRATELRLGLPGS  551
               + LN +ATELRLGLPGS
Sbjct  61   KKNK-LNFQATELRLGLPGS  79



>ref|XP_007205358.1| hypothetical protein PRUPE_ppa007194mg [Prunus persica]
 ref|XP_007205359.1| hypothetical protein PRUPE_ppa007194mg [Prunus persica]
 gb|EMJ06557.1| hypothetical protein PRUPE_ppa007194mg [Prunus persica]
 gb|EMJ06558.1| hypothetical protein PRUPE_ppa007194mg [Prunus persica]
Length=378

 Score = 62.8 bits (151),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 52/80 (65%), Positives = 61/80 (76%), Gaps = 1/80 (1%)
 Frame = +3

Query  312  MSPPLLGVGEDGQSNVTHMASPISLDSVCQNGPELKEWNYMGLsdcssvdsstisstsen  491
            MSPPLLG  E+GQSN + +AS  S+D +  NG  LKE NY+GLSDCSSVDSST+SS SE 
Sbjct  1    MSPPLLGGEEEGQSNGSMVASSRSMDCISHNGSGLKERNYLGLSDCSSVDSSTVSSLSEE  60

Query  492  nsGRGLNLRATELRLGLPGS  551
               + LN +ATELRLGLPGS
Sbjct  61   KKNK-LNFQATELRLGLPGS  79



>ref|XP_010104556.1| Auxin-responsive protein IAA9 [Morus notabilis]
 gb|EXC01157.1| Auxin-responsive protein IAA9 [Morus notabilis]
Length=378

 Score = 62.4 bits (150),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 52/81 (64%), Positives = 59/81 (73%), Gaps = 8/81 (10%)
 Frame = +3

Query  312  MSPPLLGVGED-GQSNVTHMASPISLDSVCQNGPELKEWNYMGLsdcssvdsstisstse  488
            MSPPL GVGED GQSNVT + S  S++S      ELKE NYMGLSDCSS D S +S  S+
Sbjct  1    MSPPLHGVGEDEGQSNVTVLTSSPSMES------ELKERNYMGLSDCSSGDCSVVSPASD  54

Query  489  nnsGRGLNLRATELRLGLPGS  551
             +  R LNL+ATELRLGLPGS
Sbjct  55   ESK-RTLNLKATELRLGLPGS  74



>ref|NP_001267710.1| auxin-responsive protein IAA9-like [Cucumis sativus]
 dbj|BAA85821.1| Aux/IAA protein [Cucumis sativus]
 gb|KGN62776.1| hypothetical protein Csa_2G372720 [Cucumis sativus]
Length=355

 Score = 62.0 bits (149),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 48/82 (59%), Positives = 58/82 (71%), Gaps = 3/82 (4%)
 Frame = +3

Query  312  MSPPLLGVGE--DGQSNVTHMASPISLDSVCQNGPELKEWNYMGLsdcssvdsstissts  485
            MSPPLL VGE  + +SNVT +AS  S++SV  N  E +E NYMGLSD SS DS   ++ S
Sbjct  1    MSPPLLDVGEVEESRSNVTLLASSNSMESVSPNNLEFEERNYMGLSDSSSEDSCMTATKS  60

Query  486  ennsGRGLNLRATELRLGLPGS  551
            + N    LNL+ATELRLGLPGS
Sbjct  61   DGNKP-SLNLKATELRLGLPGS  81



>ref|XP_004509716.1| PREDICTED: auxin-responsive protein IAA9-like isoform X2 [Cicer 
arietinum]
Length=326

 Score = 61.6 bits (148),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 52/82 (63%), Positives = 59/82 (72%), Gaps = 3/82 (4%)
 Frame = +3

Query  312  MSPPLLGVGEDGQSNVTHMAS--PISLDSVCQNGPELKEWNYMGLsdcssvdsstissts  485
            MSPPLL   E+ QSN + +AS  P SLD   QNG  LKE NY+GLSDCSSVDSST+ S S
Sbjct  1    MSPPLLVTEEERQSNTSTVASASPQSLDCFSQNGAGLKERNYLGLSDCSSVDSSTVPSLS  60

Query  486  ennsGRGLNLRATELRLGLPGS  551
            +      LNL+ATELRLGLPGS
Sbjct  61   DEKK-ENLNLKATELRLGLPGS  81



>ref|XP_004509715.1| PREDICTED: auxin-responsive protein IAA9-like isoform X1 [Cicer 
arietinum]
Length=353

 Score = 61.6 bits (148),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 52/82 (63%), Positives = 59/82 (72%), Gaps = 3/82 (4%)
 Frame = +3

Query  312  MSPPLLGVGEDGQSNVTHMAS--PISLDSVCQNGPELKEWNYMGLsdcssvdsstissts  485
            MSPPLL   E+ QSN + +AS  P SLD   QNG  LKE NY+GLSDCSSVDSST+ S S
Sbjct  1    MSPPLLVTEEERQSNTSTVASASPQSLDCFSQNGAGLKERNYLGLSDCSSVDSSTVPSLS  60

Query  486  ennsGRGLNLRATELRLGLPGS  551
            +      LNL+ATELRLGLPGS
Sbjct  61   DEKK-ENLNLKATELRLGLPGS  81



>gb|KDO81312.1| hypothetical protein CISIN_1g017824mg [Citrus sinensis]
Length=210

 Score = 59.7 bits (143),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 46/78 (59%), Positives = 55/78 (71%), Gaps = 0/78 (0%)
 Frame = +3

Query  318  PPLLGVGEDGQSNVTHMASPISLDSVCQNGPELKEWNYMGLsdcssvdsstisstsenns  497
            PP +G  + G  NV  +ASP S+ SVCQ    +KE NYMGLSD SS+DSS +SS S  +S
Sbjct  4    PPAVGEEKRGPGNVNLLASPASMGSVCQKSSVIKERNYMGLSDSSSMDSSVVSSVSGESS  63

Query  498  GRGLNLRATELRLGLPGS  551
               LNL+ATELRLGLPGS
Sbjct  64   KSSLNLKATELRLGLPGS  81



>ref|XP_009344514.1| PREDICTED: auxin-responsive protein IAA9 [Pyrus x bretschneideri]
 ref|XP_009344515.1| PREDICTED: auxin-responsive protein IAA9 [Pyrus x bretschneideri]
 ref|XP_009344516.1| PREDICTED: auxin-responsive protein IAA9 [Pyrus x bretschneideri]
Length=373

 Score = 61.2 bits (147),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 50/80 (63%), Positives = 59/80 (74%), Gaps = 1/80 (1%)
 Frame = +3

Query  312  MSPPLLGVGEDGQSNVTHMASPISLDSVCQNGPELKEWNYMGLsdcssvdsstisstsen  491
            MSPPLLG  E+GQSN + +A   S+D +  NG  LKE NY+GLSDCSSVDSST+S+ SE 
Sbjct  1    MSPPLLGGEEEGQSNGSMVAFSRSMDCISHNGSGLKERNYLGLSDCSSVDSSTVSNLSEG  60

Query  492  nsGRGLNLRATELRLGLPGS  551
                 LN +ATELRLGLPGS
Sbjct  61   TK-NNLNFKATELRLGLPGS  79



>gb|ADL36578.1| ARF domain class transcription factor [Malus domestica]
Length=373

 Score = 60.8 bits (146),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 50/80 (63%), Positives = 59/80 (74%), Gaps = 1/80 (1%)
 Frame = +3

Query  312  MSPPLLGVGEDGQSNVTHMASPISLDSVCQNGPELKEWNYMGLsdcssvdsstisstsen  491
            MSPPLLG  E+GQSN + +A   S+D + QN   LKE NY+GLSDCSSVDSST+S+ SE 
Sbjct  1    MSPPLLGGEEEGQSNGSMVAFSRSMDCISQNSSGLKERNYLGLSDCSSVDSSTVSNLSEG  60

Query  492  nsGRGLNLRATELRLGLPGS  551
                 LN +ATELRLGLPGS
Sbjct  61   TK-NNLNFKATELRLGLPGS  79



>gb|KHN09036.1| Auxin-responsive protein IAA8 [Glycine soja]
Length=361

 Score = 60.8 bits (146),  Expect = 8e-08, Method: Compositional matrix adjust.
 Identities = 50/82 (61%), Positives = 61/82 (74%), Gaps = 4/82 (5%)
 Frame = +3

Query  312  MSPPLLGVGED-GQSNVTHM-ASPISLDSVCQNGPELKEWNYMGLsdcssvdsstissts  485
            MSPP+L +GE+ G+SNVT + +S  +++SVC    E KE NYMGLSDCSSVDSS  S + 
Sbjct  1    MSPPVLSIGEEEGKSNVTLLVSSSTTMESVCLKSLEFKERNYMGLSDCSSVDSSVPSFSE  60

Query  486  ennsGRGLNLRATELRLGLPGS  551
            E  S   LNL+ATELRLGLPGS
Sbjct  61   ETKSN--LNLKATELRLGLPGS  80



>ref|XP_006433732.1| hypothetical protein CICLE_v10001479mg [Citrus clementina]
 ref|XP_006433733.1| hypothetical protein CICLE_v10001479mg [Citrus clementina]
 ref|XP_006433734.1| hypothetical protein CICLE_v10001479mg [Citrus clementina]
 ref|XP_006433735.1| hypothetical protein CICLE_v10001479mg [Citrus clementina]
 ref|XP_006433737.1| hypothetical protein CICLE_v10001479mg [Citrus clementina]
 ref|XP_006433738.1| hypothetical protein CICLE_v10001479mg [Citrus clementina]
 ref|XP_006433739.1| hypothetical protein CICLE_v10001479mg [Citrus clementina]
 ref|XP_006433740.1| hypothetical protein CICLE_v10001479mg [Citrus clementina]
 gb|ESR46972.1| hypothetical protein CICLE_v10001479mg [Citrus clementina]
 gb|ESR46973.1| hypothetical protein CICLE_v10001479mg [Citrus clementina]
 gb|ESR46974.1| hypothetical protein CICLE_v10001479mg [Citrus clementina]
 gb|ESR46975.1| hypothetical protein CICLE_v10001479mg [Citrus clementina]
 gb|ESR46977.1| hypothetical protein CICLE_v10001479mg [Citrus clementina]
 gb|ESR46978.1| hypothetical protein CICLE_v10001479mg [Citrus clementina]
 gb|ESR46979.1| hypothetical protein CICLE_v10001479mg [Citrus clementina]
 gb|ESR46980.1| hypothetical protein CICLE_v10001479mg [Citrus clementina]
Length=365

 Score = 60.5 bits (145),  Expect = 8e-08, Method: Compositional matrix adjust.
 Identities = 51/82 (62%), Positives = 59/82 (72%), Gaps = 3/82 (4%)
 Frame = +3

Query  312  MSPPLLGVGED--GQSNVTHMASPISLDSVCQNGPELKEWNYMGLsdcssvdsstissts  485
            MSPP  GVGE+  G  NV  +ASP S+ SVCQ    +KE NYMGLSD SS+DSS +SS S
Sbjct  1    MSPPP-GVGEEKRGPGNVNLLASPASMGSVCQKSSVIKERNYMGLSDSSSMDSSVVSSVS  59

Query  486  ennsGRGLNLRATELRLGLPGS  551
              +S   LNL+ATELRLGLPGS
Sbjct  60   GESSKSSLNLKATELRLGLPGS  81



>gb|KDO81311.1| hypothetical protein CISIN_1g017824mg [Citrus sinensis]
Length=288

 Score = 60.1 bits (144),  Expect = 9e-08, Method: Compositional matrix adjust.
 Identities = 46/78 (59%), Positives = 55/78 (71%), Gaps = 0/78 (0%)
 Frame = +3

Query  318  PPLLGVGEDGQSNVTHMASPISLDSVCQNGPELKEWNYMGLsdcssvdsstisstsenns  497
            PP +G  + G  NV  +ASP S+ SVCQ    +KE NYMGLSD SS+DSS +SS S  +S
Sbjct  4    PPAVGEEKRGPGNVNLLASPASMGSVCQKSSVIKERNYMGLSDSSSMDSSVVSSVSGESS  63

Query  498  GRGLNLRATELRLGLPGS  551
               LNL+ATELRLGLPGS
Sbjct  64   KSSLNLKATELRLGLPGS  81



>ref|XP_006433736.1| hypothetical protein CICLE_v10001479mg [Citrus clementina]
 gb|ESR46976.1| hypothetical protein CICLE_v10001479mg [Citrus clementina]
Length=383

 Score = 60.5 bits (145),  Expect = 9e-08, Method: Compositional matrix adjust.
 Identities = 51/82 (62%), Positives = 59/82 (72%), Gaps = 3/82 (4%)
 Frame = +3

Query  312  MSPPLLGVGED--GQSNVTHMASPISLDSVCQNGPELKEWNYMGLsdcssvdsstissts  485
            MSPP  GVGE+  G  NV  +ASP S+ SVCQ    +KE NYMGLSD SS+DSS +SS S
Sbjct  1    MSPPP-GVGEEKRGPGNVNLLASPASMGSVCQKSSVIKERNYMGLSDSSSMDSSVVSSVS  59

Query  486  ennsGRGLNLRATELRLGLPGS  551
              +S   LNL+ATELRLGLPGS
Sbjct  60   GESSKSSLNLKATELRLGLPGS  81



>ref|XP_010105114.1| Auxin-responsive protein IAA9 [Morus notabilis]
 gb|EXC03899.1| Auxin-responsive protein IAA9 [Morus notabilis]
Length=378

 Score = 60.5 bits (145),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 51/80 (64%), Positives = 61/80 (76%), Gaps = 3/80 (4%)
 Frame = +3

Query  312  MSPPLLGVGEDGQSNVTHMASPISLDSVCQNGPELKEWNYMGLsdcssvdsstisstsen  491
            MSPPLLG  E+G S++  +AS  ++D + QNG  LKEWNY+GLSDCSSVDSS +SS SE 
Sbjct  1    MSPPLLGGEEEGHSSL--VASSPTIDCISQNGSGLKEWNYLGLSDCSSVDSSAVSSLSEE  58

Query  492  nsGRGLNLRATELRLGLPGS  551
            N    LN +ATELRLGLPGS
Sbjct  59   NK-NNLNFKATELRLGLPGS  77



>gb|KDO81302.1| hypothetical protein CISIN_1g017824mg [Citrus sinensis]
 gb|KDO81303.1| hypothetical protein CISIN_1g017824mg [Citrus sinensis]
 gb|KDO81304.1| hypothetical protein CISIN_1g017824mg [Citrus sinensis]
 gb|KDO81305.1| hypothetical protein CISIN_1g017824mg [Citrus sinensis]
 gb|KDO81306.1| hypothetical protein CISIN_1g017824mg [Citrus sinensis]
 gb|KDO81307.1| hypothetical protein CISIN_1g017824mg [Citrus sinensis]
 gb|KDO81308.1| hypothetical protein CISIN_1g017824mg [Citrus sinensis]
 gb|KDO81309.1| hypothetical protein CISIN_1g017824mg [Citrus sinensis]
Length=365

 Score = 60.1 bits (144),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 46/78 (59%), Positives = 55/78 (71%), Gaps = 0/78 (0%)
 Frame = +3

Query  318  PPLLGVGEDGQSNVTHMASPISLDSVCQNGPELKEWNYMGLsdcssvdsstisstsenns  497
            PP +G  + G  NV  +ASP S+ SVCQ    +KE NYMGLSD SS+DSS +SS S  +S
Sbjct  4    PPAVGEEKRGPGNVNLLASPASMGSVCQKSSVIKERNYMGLSDSSSMDSSVVSSVSGESS  63

Query  498  GRGLNLRATELRLGLPGS  551
               LNL+ATELRLGLPGS
Sbjct  64   KSSLNLKATELRLGLPGS  81



>ref|XP_006472387.1| PREDICTED: auxin-responsive protein IAA9-like isoform X1 [Citrus 
sinensis]
 ref|XP_006472388.1| PREDICTED: auxin-responsive protein IAA9-like isoform X2 [Citrus 
sinensis]
 ref|XP_006472389.1| PREDICTED: auxin-responsive protein IAA9-like isoform X3 [Citrus 
sinensis]
 ref|XP_006472390.1| PREDICTED: auxin-responsive protein IAA9-like isoform X4 [Citrus 
sinensis]
Length=365

 Score = 60.1 bits (144),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 46/78 (59%), Positives = 55/78 (71%), Gaps = 0/78 (0%)
 Frame = +3

Query  318  PPLLGVGEDGQSNVTHMASPISLDSVCQNGPELKEWNYMGLsdcssvdsstisstsenns  497
            PP +G  + G  NV  +ASP S+ SVCQ    +KE NYMGLSD SS+DSS +SS S  +S
Sbjct  4    PPAVGEEKRGPGNVNLLASPASMGSVCQKSSVIKERNYMGLSDSSSMDSSVVSSVSGESS  63

Query  498  GRGLNLRATELRLGLPGS  551
               LNL+ATELRLGLPGS
Sbjct  64   KSSLNLKATELRLGLPGS  81



>gb|KDO81310.1| hypothetical protein CISIN_1g017824mg [Citrus sinensis]
Length=333

 Score = 59.7 bits (143),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 46/78 (59%), Positives = 55/78 (71%), Gaps = 0/78 (0%)
 Frame = +3

Query  318  PPLLGVGEDGQSNVTHMASPISLDSVCQNGPELKEWNYMGLsdcssvdsstisstsenns  497
            PP +G  + G  NV  +ASP S+ SVCQ    +KE NYMGLSD SS+DSS +SS S  +S
Sbjct  4    PPAVGEEKRGPGNVNLLASPASMGSVCQKSSVIKERNYMGLSDSSSMDSSVVSSVSGESS  63

Query  498  GRGLNLRATELRLGLPGS  551
               LNL+ATELRLGLPGS
Sbjct  64   KSSLNLKATELRLGLPGS  81



>gb|KJB71171.1| hypothetical protein B456_011G109000 [Gossypium raimondii]
Length=289

 Score = 59.3 bits (142),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 45/80 (56%), Positives = 57/80 (71%), Gaps = 8/80 (10%)
 Frame = +3

Query  312  MSPPLLGVGEDGQSNVTHMASPISLDSVCQNGPELKEWNYMGLsdcssvdsstisstsen  491
            MSP LLGV E+GQ   T ++SP S++ + QNG  ++EWNY+GLSD  SVDSS +   +  
Sbjct  1    MSPLLLGVEEEGQ---TRVSSP-SVECISQNGLGIREWNYLGLSDFCSVDSSGVPDDN--  54

Query  492  nsGRGLNLRATELRLGLPGS  551
              G  LNL+ATELRLGLPGS
Sbjct  55   --GNNLNLKATELRLGLPGS  72



>gb|AAM12952.1| auxin-regulated protein [Zinnia violacea]
Length=351

 Score = 59.3 bits (142),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 46/80 (58%), Positives = 55/80 (69%), Gaps = 1/80 (1%)
 Frame = +3

Query  312  MSPPLLGVGEDGQSNVTHMASPISLDSVCQNGPELKEWNYMGLsdcssvdsstisstsen  491
            M PPLLGV  DG  NV+ M S  +++S+ Q   EL E NY+GLSDCSS DS+ +S  SE 
Sbjct  1    MPPPLLGVEGDGLGNVSLMTSASTMESIFQKNAELTERNYLGLSDCSSFDSTAVSGISEV  60

Query  492  nsGRGLNLRATELRLGLPGS  551
                 LNL+ATELRLGLPGS
Sbjct  61   KRN-NLNLKATELRLGLPGS  79



>ref|XP_002528895.1| transcription factor, putative [Ricinus communis]
 gb|EEF33475.1| transcription factor, putative [Ricinus communis]
Length=382

 Score = 59.3 bits (142),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 53/80 (66%), Positives = 62/80 (78%), Gaps = 1/80 (1%)
 Frame = +3

Query  312  MSPPLLGVGEDGQSNVTHMASPISLDSVCQNGPELKEWNYMGLsdcssvdsstisstsen  491
            MSPPLLGV + GQS V+ +AS  S+D + QNG  LKE NY+GLSDCSSVDSS + S SE 
Sbjct  1    MSPPLLGVEDGGQSKVSLVASSPSVDCISQNGCRLKERNYLGLSDCSSVDSSAVPSLSEE  60

Query  492  nsGRGLNLRATELRLGLPGS  551
            N+   LNL+ATELRLGLPGS
Sbjct  61   NN-NNLNLKATELRLGLPGS  79



>gb|KJB71166.1| hypothetical protein B456_011G109000 [Gossypium raimondii]
 gb|KJB71167.1| hypothetical protein B456_011G109000 [Gossypium raimondii]
 gb|KJB71168.1| hypothetical protein B456_011G109000 [Gossypium raimondii]
 gb|KJB71169.1| hypothetical protein B456_011G109000 [Gossypium raimondii]
Length=351

 Score = 59.3 bits (142),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 45/80 (56%), Positives = 57/80 (71%), Gaps = 8/80 (10%)
 Frame = +3

Query  312  MSPPLLGVGEDGQSNVTHMASPISLDSVCQNGPELKEWNYMGLsdcssvdsstisstsen  491
            MSP LLGV E+GQ   T ++SP S++ + QNG  ++EWNY+GLSD  SVDSS +   +  
Sbjct  1    MSPLLLGVEEEGQ---TRVSSP-SVECISQNGLGIREWNYLGLSDFCSVDSSGVPDDN--  54

Query  492  nsGRGLNLRATELRLGLPGS  551
              G  LNL+ATELRLGLPGS
Sbjct  55   --GNNLNLKATELRLGLPGS  72



>ref|XP_003628839.1| Indoleacetic acid-induced-like protein [Medicago truncatula]
 gb|AET03315.1| auxin-responsive AUX/IAA family protein [Medicago truncatula]
Length=356

 Score = 59.3 bits (142),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 52/83 (63%), Positives = 59/83 (71%), Gaps = 3/83 (4%)
 Frame = +3

Query  309  LMSPPLLGVGEDGQSNVTHMAS--PISLDSVCQNGPELKEWNYMGLsdcssvdsstisst  482
            LMSPPLL   E+GQSN + +AS  P SLD   Q    LKE NY+GLSDCSSVDSST+ S 
Sbjct  8    LMSPPLLLPEEEGQSNPSTVASASPQSLDRFSQTAAGLKERNYLGLSDCSSVDSSTVPSL  67

Query  483  sennsGRGLNLRATELRLGLPGS  551
            S+      LNL+ATELRLGLPGS
Sbjct  68   SDEKK-ENLNLKATELRLGLPGS  89



>gb|KJB71165.1| hypothetical protein B456_011G109000 [Gossypium raimondii]
 gb|KJB71170.1| hypothetical protein B456_011G109000 [Gossypium raimondii]
Length=352

 Score = 58.9 bits (141),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 45/80 (56%), Positives = 57/80 (71%), Gaps = 8/80 (10%)
 Frame = +3

Query  312  MSPPLLGVGEDGQSNVTHMASPISLDSVCQNGPELKEWNYMGLsdcssvdsstisstsen  491
            MSP LLGV E+GQ   T ++SP S++ + QNG  ++EWNY+GLSD  SVDSS +   +  
Sbjct  1    MSPLLLGVEEEGQ---TRVSSP-SVECISQNGLGIREWNYLGLSDFCSVDSSGVPDDN--  54

Query  492  nsGRGLNLRATELRLGLPGS  551
              G  LNL+ATELRLGLPGS
Sbjct  55   --GNNLNLKATELRLGLPGS  72



>gb|KJB71172.1| hypothetical protein B456_011G109000 [Gossypium raimondii]
Length=344

 Score = 58.9 bits (141),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 45/80 (56%), Positives = 57/80 (71%), Gaps = 8/80 (10%)
 Frame = +3

Query  312  MSPPLLGVGEDGQSNVTHMASPISLDSVCQNGPELKEWNYMGLsdcssvdsstisstsen  491
            MSP LLGV E+GQ   T ++SP S++ + QNG  ++EWNY+GLSD  SVDSS +   +  
Sbjct  1    MSPLLLGVEEEGQ---TRVSSP-SVECISQNGLGIREWNYLGLSDFCSVDSSGVPDDN--  54

Query  492  nsGRGLNLRATELRLGLPGS  551
              G  LNL+ATELRLGLPGS
Sbjct  55   --GNNLNLKATELRLGLPGS  72



>gb|KHG08881.1| Auxin-responsive IAA9 -like protein [Gossypium arboreum]
Length=351

 Score = 58.5 bits (140),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 46/80 (58%), Positives = 57/80 (71%), Gaps = 8/80 (10%)
 Frame = +3

Query  312  MSPPLLGVGEDGQSNVTHMASPISLDSVCQNGPELKEWNYMGLsdcssvdsstisstsen  491
            MSPPLLGV E+GQS V   +SP S++ + QNG  ++E NY+GLSD  SVDSS +   +  
Sbjct  1    MSPPLLGVEEEGQSRV---SSP-SVECISQNGLGIRERNYLGLSDFCSVDSSGVPDDN--  54

Query  492  nsGRGLNLRATELRLGLPGS  551
              G  LNL+ATELRLGLPGS
Sbjct  55   --GNNLNLKATELRLGLPGS  72



>ref|XP_008444965.1| PREDICTED: auxin-responsive protein IAA9-like [Cucumis melo]
Length=355

 Score = 58.2 bits (139),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 47/82 (57%), Positives = 57/82 (70%), Gaps = 3/82 (4%)
 Frame = +3

Query  312  MSPPLLGVGE--DGQSNVTHMASPISLDSVCQNGPELKEWNYMGLsdcssvdsstissts  485
            MSPPLL VGE  + +SNVT +AS  S++SV  N    +E NYMGLSD SS DS   ++ S
Sbjct  1    MSPPLLDVGEVEESRSNVTLLASSNSMESVSPNNLGFEERNYMGLSDSSSEDSCMTATKS  60

Query  486  ennsGRGLNLRATELRLGLPGS  551
            + N    LNL+ATELRLGLPGS
Sbjct  61   DGNKP-SLNLKATELRLGLPGS  81



>gb|AFK49626.1| unknown [Medicago truncatula]
Length=348

 Score = 58.2 bits (139),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 51/82 (62%), Positives = 58/82 (71%), Gaps = 3/82 (4%)
 Frame = +3

Query  312  MSPPLLGVGEDGQSNVTHMAS--PISLDSVCQNGPELKEWNYMGLsdcssvdsstissts  485
            MSPPLL   E+GQSN + +AS  P SLD   Q    LKE NY+GLSDCSSVDSST+ S S
Sbjct  1    MSPPLLLPEEEGQSNPSTVASASPQSLDRFSQTAAGLKERNYLGLSDCSSVDSSTVPSLS  60

Query  486  ennsGRGLNLRATELRLGLPGS  551
            +      LNL+ATELRLGLPGS
Sbjct  61   DEKK-ENLNLKATELRLGLPGS  81



>gb|ACJ84551.1| unknown [Medicago truncatula]
Length=348

 Score = 57.8 bits (138),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 51/82 (62%), Positives = 58/82 (71%), Gaps = 3/82 (4%)
 Frame = +3

Query  312  MSPPLLGVGEDGQSNVTHMAS--PISLDSVCQNGPELKEWNYMGLsdcssvdsstissts  485
            MSPPLL   E+GQSN + +AS  P SLD   Q    LKE NY+GLSDCSSVDSST+ S S
Sbjct  1    MSPPLLLPEEEGQSNPSTVASASPQSLDRFSQTAAGLKERNYLGLSDCSSVDSSTVPSLS  60

Query  486  ennsGRGLNLRATELRLGLPGS  551
            +      LNL+ATELRLGLPGS
Sbjct  61   DEKK-ENLNLKATELRLGLPGS  81



>gb|EYU41350.1| hypothetical protein MIMGU_mgv1a009380mg [Erythranthe guttata]
Length=344

 Score = 57.8 bits (138),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 44/75 (59%), Positives = 51/75 (68%), Gaps = 0/75 (0%)
 Frame = +3

Query  327  LGVGEDGQSNVTHMASPISLDSVCQNGPELKEWNYMGLsdcssvdsstisstsennsGRG  506
            LGV    Q NV+ MAS  S D + QNG  LKE NY+GLSDCSSVDSS +S  ++      
Sbjct  6    LGVEGQSQCNVSLMASSASADCITQNGSSLKERNYLGLSDCSSVDSSAVSCGADTEIKSN  65

Query  507  LNLRATELRLGLPGS  551
            LNL+ATEL LGLPGS
Sbjct  66   LNLKATELTLGLPGS  80



>ref|XP_006426197.1| hypothetical protein CICLE_v10025873mg [Citrus clementina]
 ref|XP_006426198.1| hypothetical protein CICLE_v10025873mg [Citrus clementina]
 gb|ESR39437.1| hypothetical protein CICLE_v10025873mg [Citrus clementina]
 gb|ESR39438.1| hypothetical protein CICLE_v10025873mg [Citrus clementina]
Length=376

 Score = 57.8 bits (138),  Expect = 8e-07, Method: Compositional matrix adjust.
 Identities = 53/81 (65%), Positives = 61/81 (75%), Gaps = 3/81 (4%)
 Frame = +3

Query  312  MSPPLL-GVGEDGQSNVTHMASPISLDSVCQNGPELKEWNYMGLsdcssvdsstisstse  488
            MSPPLL GV E+GQSNV+ MAS  S D + QN   L+E NY+GLSDCSSVDSS  SS   
Sbjct  1    MSPPLLLGVEEEGQSNVSLMASSPS-DCISQNVSGLQERNYLGLSDCSSVDSSAASSLPV  59

Query  489  nnsGRGLNLRATELRLGLPGS  551
            +N  + LNL+ATELRLGLPGS
Sbjct  60   DNKNK-LNLKATELRLGLPGS  79



>ref|XP_006466369.1| PREDICTED: auxin-responsive protein IAA9-like [Citrus sinensis]
 gb|KDO78726.1| hypothetical protein CISIN_1g017170mg [Citrus sinensis]
Length=376

 Score = 57.8 bits (138),  Expect = 8e-07, Method: Compositional matrix adjust.
 Identities = 53/81 (65%), Positives = 61/81 (75%), Gaps = 3/81 (4%)
 Frame = +3

Query  312  MSPPLL-GVGEDGQSNVTHMASPISLDSVCQNGPELKEWNYMGLsdcssvdsstisstse  488
            MSPPLL GV E+GQSNV+ MAS  S D + QN   L+E NY+GLSDCSSVDSS  SS   
Sbjct  1    MSPPLLLGVEEEGQSNVSLMASSPS-DCISQNVSGLQERNYLGLSDCSSVDSSAASSLPV  59

Query  489  nnsGRGLNLRATELRLGLPGS  551
            +N  + LNL+ATELRLGLPGS
Sbjct  60   DNKNK-LNLKATELRLGLPGS  79



>ref|XP_007047688.1| Transcription factor, putative isoform 2 [Theobroma cacao]
 gb|EOX91845.1| Transcription factor, putative isoform 2 [Theobroma cacao]
Length=374

 Score = 57.0 bits (136),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 54/80 (68%), Positives = 62/80 (78%), Gaps = 5/80 (6%)
 Frame = +3

Query  312  MSPPLLGVGEDGQSNVTHMASPISLDSVCQNGPELKEWNYMGLsdcssvdsstisstsen  491
            MS PLLGV E+GQSNV+   SP S D + QNG  LKE NY+GLSDCSSVDSS +SS +E+
Sbjct  1    MSQPLLGVEEEGQSNVS---SP-SDDCISQNGLGLKERNYLGLSDCSSVDSSGVSSLTED  56

Query  492  nsGRGLNLRATELRLGLPGS  551
            N    LNL+ATELRLGLPGS
Sbjct  57   NKNN-LNLKATELRLGLPGS  75



>ref|XP_007047687.1| Transcription factor, putative isoform 1 [Theobroma cacao]
 gb|EOX91844.1| Transcription factor, putative isoform 1 [Theobroma cacao]
Length=376

 Score = 57.0 bits (136),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 54/80 (68%), Positives = 62/80 (78%), Gaps = 5/80 (6%)
 Frame = +3

Query  312  MSPPLLGVGEDGQSNVTHMASPISLDSVCQNGPELKEWNYMGLsdcssvdsstisstsen  491
            MS PLLGV E+GQSNV+   SP S D + QNG  LKE NY+GLSDCSSVDSS +SS +E+
Sbjct  1    MSQPLLGVEEEGQSNVS---SP-SDDCISQNGLGLKERNYLGLSDCSSVDSSGVSSLTED  56

Query  492  nsGRGLNLRATELRLGLPGS  551
            N    LNL+ATELRLGLPGS
Sbjct  57   NKNN-LNLKATELRLGLPGS  75



>ref|NP_001241389.1| uncharacterized protein LOC100783314 [Glycine max]
 ref|XP_006577803.1| PREDICTED: uncharacterized protein LOC100783314 isoform X1 [Glycine 
max]
 gb|ACU23462.1| unknown [Glycine max]
Length=360

 Score = 56.6 bits (135),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 49/82 (60%), Positives = 60/82 (73%), Gaps = 4/82 (5%)
 Frame = +3

Query  312  MSPPLLGVGED-GQSNVTHM-ASPISLDSVCQNGPELKEWNYMGLsdcssvdsstissts  485
            MSPP+L +GE+ G+SNVT + +S  +++SVC    E KE NYMG SDCSSVDSS  S + 
Sbjct  1    MSPPVLSMGEEEGKSNVTLLGSSSTAMESVCLKSLEFKERNYMGSSDCSSVDSSVPSFSE  60

Query  486  ennsGRGLNLRATELRLGLPGS  551
            E  S   LNL+ATELRLGLPGS
Sbjct  61   ECKSN--LNLKATELRLGLPGS  80



>ref|XP_007047690.1| Transcription factor, putative isoform 4 [Theobroma cacao]
 gb|EOX91847.1| Transcription factor, putative isoform 4 [Theobroma cacao]
Length=372

 Score = 56.6 bits (135),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 54/80 (68%), Positives = 62/80 (78%), Gaps = 5/80 (6%)
 Frame = +3

Query  312  MSPPLLGVGEDGQSNVTHMASPISLDSVCQNGPELKEWNYMGLsdcssvdsstisstsen  491
            MS PLLGV E+GQSNV+   SP S D + QNG  LKE NY+GLSDCSSVDSS +SS +E+
Sbjct  1    MSQPLLGVEEEGQSNVS---SP-SDDCISQNGLGLKERNYLGLSDCSSVDSSGVSSLTED  56

Query  492  nsGRGLNLRATELRLGLPGS  551
            N    LNL+ATELRLGLPGS
Sbjct  57   NKNN-LNLKATELRLGLPGS  75



>gb|KHN08222.1| Auxin-responsive protein IAA8 [Glycine soja]
Length=360

 Score = 56.6 bits (135),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 49/82 (60%), Positives = 60/82 (73%), Gaps = 4/82 (5%)
 Frame = +3

Query  312  MSPPLLGVGED-GQSNVTHM-ASPISLDSVCQNGPELKEWNYMGLsdcssvdsstissts  485
            MSPP+L +GE+ G+SNVT + +S  +++SVC    E KE NYMG SDCSSVDSS  S + 
Sbjct  1    MSPPVLSMGEEEGKSNVTLLGSSSTAMESVCLKSLEFKERNYMGSSDCSSVDSSVPSFSE  60

Query  486  ennsGRGLNLRATELRLGLPGS  551
            E  S   LNL+ATELRLGLPGS
Sbjct  61   ECKSN--LNLKATELRLGLPGS  80



>ref|XP_003517136.1| PREDICTED: auxin-responsive protein IAA9 isoform X1 [Glycine 
max]
 ref|XP_006572983.1| PREDICTED: auxin-responsive protein IAA9 isoform X2 [Glycine 
max]
Length=359

 Score = 56.2 bits (134),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 46/85 (54%), Positives = 57/85 (67%), Gaps = 4/85 (5%)
 Frame = +3

Query  309  LMSPPLLGVGEDGQSNVTHMA---SPISLDSVCQNGPELKEWNYMGLsdcssvdsstiss  479
            +MSPP +   E+G+SNV+      S  SLD   QNG  LKE NY+GLSDCSSVDSS  + 
Sbjct  1    MMSPPAVVTEEEGRSNVSSTVASGSSQSLDRFSQNGAGLKERNYLGLSDCSSVDSSASTV  60

Query  480  tsennsGR-GLNLRATELRLGLPGS  551
             S  +  +  +NL+ATELRLGLPGS
Sbjct  61   PSLCDEKKENMNLKATELRLGLPGS  85



>emb|CDP00957.1| unnamed protein product [Coffea canephora]
Length=366

 Score = 55.1 bits (131),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 56/81 (69%), Positives = 64/81 (79%), Gaps = 1/81 (1%)
 Frame = +3

Query  312  MSPPLLGVGED-GQSNVTHMASPISLDSVCQNGPELKEWNYMGLsdcssvdsstisstse  488
            MS PLLGVGE+ GQSNV+ + S  SLDS  QNG   KE NYMGLS+CSSVDSSTIS+ S 
Sbjct  1    MSTPLLGVGEEEGQSNVSLLTSSSSLDSSRQNGSVFKERNYMGLSECSSVDSSTISNISG  60

Query  489  nnsGRGLNLRATELRLGLPGS  551
             ++G  LNL+ATELRLGLPGS
Sbjct  61   GSNGSCLNLKATELRLGLPGS  81



>ref|XP_010275504.1| PREDICTED: auxin-responsive protein IAA9 isoform X1 [Nelumbo 
nucifera]
Length=410

 Score = 54.7 bits (130),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 58/81 (72%), Positives = 64/81 (79%), Gaps = 3/81 (4%)
 Frame = +3

Query  309  LMSPPLLGVGEDGQSNVTHMASPISLDSVCQNGPELKEWNYMGLsdcssvdsstisstse  488
            LMSPPLLGVGE GQSNV+ ++S  S+D  CQNG  LKE NYMGLSDCSSVDSS IS  +E
Sbjct  22   LMSPPLLGVGE-GQSNVSVVSS-PSVDGSCQNGSGLKERNYMGLSDCSSVDSSAISGLAE  79

Query  489  nnsGRGLNLRATELRLGLPGS  551
             N    LNL+ATELRLGLPGS
Sbjct  80   ENKS-SLNLKATELRLGLPGS  99



>ref|XP_010275505.1| PREDICTED: auxin-responsive protein IAA9 isoform X2 [Nelumbo 
nucifera]
Length=409

 Score = 54.7 bits (130),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 58/81 (72%), Positives = 64/81 (79%), Gaps = 3/81 (4%)
 Frame = +3

Query  309  LMSPPLLGVGEDGQSNVTHMASPISLDSVCQNGPELKEWNYMGLsdcssvdsstisstse  488
            LMSPPLLGVGE GQSNV+ ++S  S+D  CQNG  LKE NYMGLSDCSSVDSS IS  +E
Sbjct  21   LMSPPLLGVGE-GQSNVSVVSS-PSVDGSCQNGSGLKERNYMGLSDCSSVDSSAISGLAE  78

Query  489  nnsGRGLNLRATELRLGLPGS  551
             N    LNL+ATELRLGLPGS
Sbjct  79   ENKS-SLNLKATELRLGLPGS  98



>gb|ACU19961.1| unknown [Glycine max]
Length=235

 Score = 53.1 bits (126),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 44/80 (55%), Positives = 53/80 (66%), Gaps = 2/80 (3%)
 Frame = +3

Query  312  MSPPLLGVGEDGQSNVTHMASPISLDSVCQNGPELKEWNYMGLsdcssvdsstisstsen  491
            MSPP L   E+G+S V   +S  SLD   QNG  LKE NY+GLSDCSSVDS   +  S  
Sbjct  1    MSPPTLVTEEEGRSTVASDSS-QSLDCFSQNGAGLKERNYLGLSDCSSVDSCASTVPSLC  59

Query  492  nsGR-GLNLRATELRLGLPG  548
            +  +  +NL+ATELRLGLPG
Sbjct  60   DEKKENMNLKATELRLGLPG  79



>ref|XP_010275506.1| PREDICTED: auxin-responsive protein IAA9 isoform X3 [Nelumbo 
nucifera]
 ref|XP_010275507.1| PREDICTED: auxin-responsive protein IAA9 isoform X3 [Nelumbo 
nucifera]
Length=388

 Score = 53.1 bits (126),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 57/80 (71%), Positives = 63/80 (79%), Gaps = 3/80 (4%)
 Frame = +3

Query  312  MSPPLLGVGEDGQSNVTHMASPISLDSVCQNGPELKEWNYMGLsdcssvdsstisstsen  491
            MSPPLLGVGE GQSNV+ ++S  S+D  CQNG  LKE NYMGLSDCSSVDSS IS  +E 
Sbjct  1    MSPPLLGVGE-GQSNVSVVSS-PSVDGSCQNGSGLKERNYMGLSDCSSVDSSAISGLAEE  58

Query  492  nsGRGLNLRATELRLGLPGS  551
            N    LNL+ATELRLGLPGS
Sbjct  59   NKS-SLNLKATELRLGLPGS  77



>ref|XP_003531969.1| PREDICTED: auxin-responsive protein IAA9-like isoform X1 [Glycine 
max]
 ref|XP_006585901.1| PREDICTED: auxin-responsive protein IAA9-like isoform X2 [Glycine 
max]
Length=350

 Score = 53.1 bits (126),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 50/83 (60%), Positives = 56/83 (67%), Gaps = 4/83 (5%)
 Frame = +3

Query  312  MSPPLLGVGED-GQSNVTHMASPISLDSVCQ--NGPELKEWNYMGLsdcssvdsstisst  482
            MSPPLL   ED GQSN + +AS  S  S C   N   LKE NY+GLSDCSSVDSS + S 
Sbjct  1    MSPPLLVTEEDEGQSNASMVASASSPSSECFTLNEARLKERNYLGLSDCSSVDSSIVPSL  60

Query  483  sennsGRGLNLRATELRLGLPGS  551
            S+      LNL+ATELRLGLPGS
Sbjct  61   SDEKK-ENLNLKATELRLGLPGS  82



>ref|XP_003534264.1| PREDICTED: auxin-responsive protein IAA9 [Glycine max]
 gb|KHN38914.1| Auxin-responsive protein IAA8 [Glycine soja]
Length=354

 Score = 53.1 bits (126),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 44/80 (55%), Positives = 53/80 (66%), Gaps = 2/80 (3%)
 Frame = +3

Query  312  MSPPLLGVGEDGQSNVTHMASPISLDSVCQNGPELKEWNYMGLsdcssvdsstisstsen  491
            MSPP L   E+G+S V   +S  SLD   QNG  LKE NY+GLSDCSSVDS   +  S  
Sbjct  1    MSPPTLVTEEEGRSTVASDSSQ-SLDCFSQNGAGLKERNYLGLSDCSSVDSCASTVPSLC  59

Query  492  nsGR-GLNLRATELRLGLPG  548
            +  +  +NL+ATELRLGLPG
Sbjct  60   DEKKENMNLKATELRLGLPG  79



>gb|KHN22187.1| Auxin-responsive protein IAA9 [Glycine soja]
Length=350

 Score = 53.1 bits (126),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 50/83 (60%), Positives = 56/83 (67%), Gaps = 4/83 (5%)
 Frame = +3

Query  312  MSPPLLGVGED-GQSNVTHMASPISLDSVCQ--NGPELKEWNYMGLsdcssvdsstisst  482
            MSPPLL   ED GQSN + +AS  S  S C   N   LKE NY+GLSDCSSVDSS + S 
Sbjct  1    MSPPLLVTEEDEGQSNASMVASASSPSSECFTLNEARLKERNYLGLSDCSSVDSSIVPSL  60

Query  483  sennsGRGLNLRATELRLGLPGS  551
            S+      LNL+ATELRLGLPGS
Sbjct  61   SDEKK-ENLNLKATELRLGLPGS  82



>ref|XP_006585902.1| PREDICTED: auxin-responsive protein IAA9-like isoform X3 [Glycine 
max]
Length=348

 Score = 53.1 bits (126),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 50/83 (60%), Positives = 56/83 (67%), Gaps = 4/83 (5%)
 Frame = +3

Query  312  MSPPLLGVGED-GQSNVTHMASPISLDSVCQ--NGPELKEWNYMGLsdcssvdsstisst  482
            MSPPLL   ED GQSN + +AS  S  S C   N   LKE NY+GLSDCSSVDSS + S 
Sbjct  1    MSPPLLVTEEDEGQSNASMVASASSPSSECFTLNEARLKERNYLGLSDCSSVDSSIVPSL  60

Query  483  sennsGRGLNLRATELRLGLPGS  551
            S+      LNL+ATELRLGLPGS
Sbjct  61   SDEKK-ENLNLKATELRLGLPGS  82



>gb|AFK43616.1| unknown [Lotus japonicus]
Length=180

 Score = 51.2 bits (121),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 44/83 (53%), Positives = 57/83 (69%), Gaps = 3/83 (4%)
 Frame = +3

Query  312  MSPPLLGVG-EDGQSNVTHMASPISL-DSVCQNGPELKEWNYMGLsdcssvdsstissts  485
            MS P LGVG E+G+SNV+ + S  +  +SVC NG +LKE+NYMGLS   S   S+    S
Sbjct  1    MSLPRLGVGDEEGESNVSLLVSSSATGESVCLNGSKLKEFNYMGLSSDCSSVDSSAPLPS  60

Query  486  ennsGRG-LNLRATELRLGLPGS  551
             ++  +  LNL+ATELRLGLPGS
Sbjct  61   FSDESKSNLNLKATELRLGLPGS  83



>ref|XP_004143431.1| PREDICTED: auxin-responsive protein IAA9-like [Cucumis sativus]
 ref|XP_004160925.1| PREDICTED: auxin-responsive protein IAA9-like [Cucumis sativus]
 gb|KGN48671.1| ARF domain class transcription factor [Cucumis sativus]
Length=380

 Score = 52.4 bits (124),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 45/80 (56%), Positives = 55/80 (69%), Gaps = 1/80 (1%)
 Frame = +3

Query  312  MSPPLLGVGEDGQSNVTHMASPISLDSVCQNGPELKEWNYMGLsdcssvdsstisstsen  491
            MSPPLL   E+   NV  +A+  S+D   QNG + +E NY+ LS CSSVDSS +S+ SE 
Sbjct  1    MSPPLLNSVEEALGNVPVVAASPSMDCHSQNGTKFRERNYLRLSPCSSVDSSAVSNLSEE  60

Query  492  nsGRGLNLRATELRLGLPGS  551
            N    LNL+ATELRLGLPGS
Sbjct  61   NKS-NLNLKATELRLGLPGS  79



>ref|XP_007158315.1| hypothetical protein PHAVU_002G142500g [Phaseolus vulgaris]
 ref|XP_007158316.1| hypothetical protein PHAVU_002G142500g [Phaseolus vulgaris]
 gb|AGV54410.1| auxin-responsive protein IAA8 [Phaseolus vulgaris]
 gb|ESW30309.1| hypothetical protein PHAVU_002G142500g [Phaseolus vulgaris]
 gb|ESW30310.1| hypothetical protein PHAVU_002G142500g [Phaseolus vulgaris]
Length=350

 Score = 52.4 bits (124),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 44/84 (52%), Positives = 52/84 (62%), Gaps = 4/84 (5%)
 Frame = +3

Query  312  MSPPLLGVGEDGQSNVTHM---ASPISLDSVCQNGPELKEWNYMGLsdcssvdsstisst  482
            MSPP +   EDG S V+      S  SLD   QNG  LKE NY+GLSDCSSVDS   +  
Sbjct  1    MSPPAVVTEEDGLSKVSSTLASGSSQSLDCFSQNGAGLKERNYLGLSDCSSVDSCASTVP  60

Query  483  sennsGR-GLNLRATELRLGLPGS  551
               +  +  +NL+ATELRLGLPGS
Sbjct  61   GLGDEKKENMNLKATELRLGLPGS  84



>ref|XP_008440498.1| PREDICTED: auxin-responsive protein IAA9-like [Cucumis melo]
 ref|XP_008440499.1| PREDICTED: auxin-responsive protein IAA9-like [Cucumis melo]
Length=377

 Score = 52.4 bits (124),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 45/80 (56%), Positives = 55/80 (69%), Gaps = 1/80 (1%)
 Frame = +3

Query  312  MSPPLLGVGEDGQSNVTHMASPISLDSVCQNGPELKEWNYMGLsdcssvdsstisstsen  491
            MSPPLL   E+   NV  +A+  S+D   QNG + +E NY+ LS CSSVDSS +S+ SE 
Sbjct  1    MSPPLLNSVEEALGNVPVVAASPSMDCHSQNGTKFRERNYLRLSPCSSVDSSAVSNLSEE  60

Query  492  nsGRGLNLRATELRLGLPGS  551
            N    LNL+ATELRLGLPGS
Sbjct  61   NKS-NLNLKATELRLGLPGS  79



>gb|AGV54485.1| auxin-responsive protein [Phaseolus vulgaris]
Length=352

 Score = 52.0 bits (123),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 44/84 (52%), Positives = 52/84 (62%), Gaps = 4/84 (5%)
 Frame = +3

Query  312  MSPPLLGVGEDGQSNVTHM---ASPISLDSVCQNGPELKEWNYMGLsdcssvdsstisst  482
            MSPP +   EDG S V+      S  SLD   QNG  LKE NY+GLSDCSSVDS   +  
Sbjct  1    MSPPAVVTEEDGLSKVSSTLASGSSQSLDCFSQNGAGLKERNYLGLSDCSSVDSCASTVP  60

Query  483  sennsGR-GLNLRATELRLGLPGS  551
               +  +  +NL+ATELRLGLPGS
Sbjct  61   GLGDEKKENMNLKATELRLGLPGS  84



>ref|XP_004288310.1| PREDICTED: auxin-responsive protein IAA9 [Fragaria vesca subsp. 
vesca]
 ref|XP_011466548.1| PREDICTED: auxin-responsive protein IAA9 [Fragaria vesca subsp. 
vesca]
Length=370

 Score = 52.0 bits (123),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 48/80 (60%), Positives = 59/80 (74%), Gaps = 1/80 (1%)
 Frame = +3

Query  312  MSPPLLGVGEDGQSNVTHMASPISLDSVCQNGPELKEWNYMGLsdcssvdsstisstsen  491
            MSPPLLG   +G+SN + +A   S++ + QN   LKE NY+GLSDCSSVDSST+SS SE 
Sbjct  1    MSPPLLGGEGEGKSNGSMVACSPSMEMIPQNSSGLKERNYLGLSDCSSVDSSTVSSLSEE  60

Query  492  nsGRGLNLRATELRLGLPGS  551
            N  +  N +ATELRLGLPGS
Sbjct  61   NKSK-FNFKATELRLGLPGS  79



>ref|XP_004490496.1| PREDICTED: auxin-responsive protein IAA9-like [Cicer arietinum]
Length=362

 Score = 51.6 bits (122),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 42/87 (48%), Positives = 57/87 (66%), Gaps = 7/87 (8%)
 Frame = +3

Query  312  MSPPLLGVG-EDGQSNVTHM-ASPISLDSVCQN--GPELKEWNYMGLsdcssvdsstis-  476
            MS P LG+G E+G+SNVT + +S  +++SVC N    + KE+NYMGLS  SS  S   S 
Sbjct  1    MSLPRLGIGDEEGESNVTLLVSSSTTMESVCLNVSKSKPKEFNYMGLSCDSSSSSVESSV  60

Query  477  --stsennsGRGLNLRATELRLGLPGS  551
               +  + +   LNL+ATELRLG+PGS
Sbjct  61   PIQSFSDETKSNLNLKATELRLGIPGS  87



>gb|ABD98054.1| auxin-regulated protein [Striga asiatica]
Length=305

 Score = 51.2 bits (121),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 46/80 (58%), Positives = 54/80 (68%), Gaps = 1/80 (1%)
 Frame = +3

Query  312  MSPPLLGVGEDGQSNVTHMASPISLDSVCQNGPELKEWNYMGLsdcssvdsstisstsen  491
            M+PP  G+    Q N   MAS  S D + QN   LKE NY+GLSDCSSVDSST+SS+ + 
Sbjct  1    MTPPFSGIEGQNQFNAHLMASSSSADCITQNTLGLKERNYLGLSDCSSVDSSTVSSSPDE  60

Query  492  nsGRGLNLRATELRLGLPGS  551
                 LNL+ATELRLGLPGS
Sbjct  61   GK-TNLNLKATELRLGLPGS  79



>ref|XP_007156440.1| hypothetical protein PHAVU_003G286200g [Phaseolus vulgaris]
 gb|ESW28434.1| hypothetical protein PHAVU_003G286200g [Phaseolus vulgaris]
Length=348

 Score = 50.8 bits (120),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 45/82 (55%), Positives = 55/82 (67%), Gaps = 4/82 (5%)
 Frame = +3

Query  312  MSPPLLGVGEDGQSNVTHMASPISLDSVCQNGPE--LKEWNYMGLsdcssvdsstissts  485
            MSPPLL   ++GQSN + +AS  S    C +  E   KE NY+G SDCSSV+SST+ S S
Sbjct  1    MSPPLLVTEDEGQSNASMVASASSPSMECFSPHEARFKERNYLGFSDCSSVESSTVPSLS  60

Query  486  ennsGRGLNLRATELRLGLPGS  551
                 + LNL+ATELRLGLPGS
Sbjct  61   NEK--KNLNLKATELRLGLPGS  80



>ref|XP_010254653.1| PREDICTED: auxin-responsive protein IAA9-like [Nelumbo nucifera]
Length=386

 Score = 49.7 bits (117),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 54/80 (68%), Positives = 58/80 (73%), Gaps = 2/80 (3%)
 Frame = +3

Query  312  MSPPLLGVGEDGQSNVTHMASPISLDSVCQNGPELKEWNYMGLsdcssvdsstisstsen  491
            MSPPLL V E   SNVT + S  S+DS CQN   L+E NYMGLSDCSSVDSS IS  SE 
Sbjct  1    MSPPLLNVVER-PSNVTLVPSSPSVDSSCQNVSGLRERNYMGLSDCSSVDSSAISGLSEE  59

Query  492  nsGRGLNLRATELRLGLPGS  551
            N    LNL+ATELRLGLPGS
Sbjct  60   NKS-SLNLKATELRLGLPGS  78



>ref|XP_010518881.1| PREDICTED: auxin-responsive protein IAA9-like [Tarenaya hassleriana]
Length=312

 Score = 49.3 bits (116),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 40/81 (49%), Positives = 51/81 (63%), Gaps = 7/81 (9%)
 Frame = +3

Query  312  MSPPLLGVGEDGQSNVT-HMASPISLDSVCQNGPELKEWNYMGLsdcssvdsstisstse  488
            MSPP+  V E+ QSNV+   +SPIS + + +N   LKE NY+GLSDCSS           
Sbjct  1    MSPPIAEVEEELQSNVSVASSSPIS-ECLSRNTSGLKEHNYLGLSDCSSTLPDLSEDDKS  59

Query  489  nnsGRGLNLRATELRLGLPGS  551
                 G++L+ATELRLGLPGS
Sbjct  60   -----GISLKATELRLGLPGS  75



>ref|NP_001237053.1| uncharacterized protein LOC100500373 [Glycine max]
 gb|ACU15430.1| unknown [Glycine max]
Length=193

 Score = 47.8 bits (112),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 44/82 (54%), Positives = 55/82 (67%), Gaps = 3/82 (4%)
 Frame = +3

Query  312  MSPPLLGVGEDGQSNVTHMASPIS--LDSVCQNGPELKEWNYMGLsdcssvdsstissts  485
            MSPPLL   ++GQ + + +AS  S  L+    N    KE NY+GLSDCSSVDSST+ + S
Sbjct  1    MSPPLLVTEDEGQCHASMVASASSPSLNCFSLNEAGFKECNYLGLSDCSSVDSSTVPNLS  60

Query  486  ennsGRGLNLRATELRLGLPGS  551
            +      LNL+ATELRLGLPGS
Sbjct  61   DEKK-ENLNLKATELRLGLPGS  81



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 590079713720