BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFF036K04

Length=525
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009617293.1|  PREDICTED: uncharacterized protein LOC104109646    223   6e-68   Nicotiana tomentosiformis
ref|XP_009771440.1|  PREDICTED: uncharacterized protein LOC104221976    220   5e-67   Nicotiana sylvestris
ref|XP_004245192.1|  PREDICTED: uncharacterized protein LOC101262737    217   6e-66   Solanum lycopersicum
ref|XP_006364278.1|  PREDICTED: uncharacterized protein LOC102598357    217   7e-66   Solanum tuberosum [potatoes]
ref|XP_011085499.1|  PREDICTED: uncharacterized protein LOC105167438    213   2e-64   Sesamum indicum [beniseed]
emb|CDP04798.1|  unnamed protein product                                212   6e-64   Coffea canephora [robusta coffee]
ref|XP_011081926.1|  PREDICTED: uncharacterized protein LOC105164832    209   1e-62   Sesamum indicum [beniseed]
gb|KFK25408.1|  hypothetical protein AALP_AA8G110600                    202   3e-60   Arabis alpina [alpine rockcress]
gb|EPS73289.1|  hypothetical protein M569_01466                         201   5e-60   Genlisea aurea
ref|XP_009345289.1|  PREDICTED: uncharacterized protein LOC103937097    201   1e-59   Pyrus x bretschneideri [bai li]
ref|XP_004291483.1|  PREDICTED: uncharacterized protein LOC101294330    201   1e-59   Fragaria vesca subsp. vesca
ref|XP_009334778.1|  PREDICTED: uncharacterized protein LOC103927565    201   1e-59   Pyrus x bretschneideri [bai li]
ref|XP_010110340.1|  GTP-binding nuclear protein                        206   1e-59   
ref|XP_008394047.1|  PREDICTED: uncharacterized protein LOC103456171    201   2e-59   
ref|XP_010048243.1|  PREDICTED: uncharacterized protein LOC104437065    201   2e-59   Eucalyptus grandis [rose gum]
ref|XP_010918669.1|  PREDICTED: uncharacterized protein LOC105042950    200   2e-59   Elaeis guineensis
emb|CBI20999.3|  unnamed protein product                                196   3e-59   Vitis vinifera
ref|XP_010249980.1|  PREDICTED: uncharacterized protein LOC104592350    198   1e-58   Nelumbo nucifera [Indian lotus]
gb|KDP33619.1|  hypothetical protein JCGZ_07190                         198   1e-58   Jatropha curcas
ref|XP_007223355.1|  hypothetical protein PRUPE_ppa007452mg             198   2e-58   Prunus persica
emb|CDX91217.1|  BnaC02g03800D                                          198   2e-58   
ref|XP_006287989.1|  hypothetical protein CARUB_v10001222mg             198   2e-58   Capsella rubella
ref|XP_008775036.1|  PREDICTED: uncharacterized protein LOC103695476    198   2e-58   Phoenix dactylifera
ref|XP_010491872.1|  PREDICTED: uncharacterized protein LOC104769372    197   3e-58   Camelina sativa [gold-of-pleasure]
ref|XP_010419712.1|  PREDICTED: uncharacterized protein LOC104705408    197   3e-58   Camelina sativa [gold-of-pleasure]
emb|CDX85713.1|  BnaA02g01000D                                          197   4e-58   
ref|XP_002284962.1|  PREDICTED: uncharacterized protein LOC100252479    197   4e-58   Vitis vinifera
ref|XP_008378299.1|  PREDICTED: uncharacterized protein LOC103441403    196   5e-58   
ref|XP_010254319.1|  PREDICTED: uncharacterized protein LOC104595325    197   5e-58   Nelumbo nucifera [Indian lotus]
ref|XP_008219896.1|  PREDICTED: uncharacterized protein LOC103320060    197   6e-58   Prunus mume [ume]
emb|CDX97108.1|  BnaC09g45170D                                          197   6e-58   
ref|XP_009125805.1|  PREDICTED: uncharacterized protein LOC103850771    196   7e-58   Brassica rapa
ref|XP_009389493.1|  PREDICTED: uncharacterized protein LOC103976040    196   7e-58   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_006399646.1|  hypothetical protein EUTSA_v10013887mg             196   8e-58   Eutrema salsugineum [saltwater cress]
gb|KHG19965.1|  putative e3 ubiquitin-protein ligase hul4               196   2e-57   Gossypium arboreum [tree cotton]
gb|AAN31807.1|  unknown protein                                         195   2e-57   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010453190.1|  PREDICTED: uncharacterized protein LOC104735158    195   2e-57   Camelina sativa [gold-of-pleasure]
ref|NP_196703.1|  uncharacterized protein                               195   2e-57   Arabidopsis thaliana [mouse-ear cress]
gb|AAM63507.1|  unknown                                                 195   2e-57   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009121952.1|  PREDICTED: uncharacterized protein LOC103846721    195   3e-57   Brassica rapa
ref|XP_002871473.1|  hypothetical protein ARALYDRAFT_487977             194   4e-57   
ref|XP_008445161.1|  PREDICTED: uncharacterized protein LOC103488281    196   4e-57   
gb|KJB07802.1|  hypothetical protein B456_001G045200                    195   4e-57   Gossypium raimondii
gb|KJB80693.1|  hypothetical protein B456_013G110800                    194   6e-57   Gossypium raimondii
gb|EYU21948.1|  hypothetical protein MIMGU_mgv1a0096341mg               192   1e-56   Erythranthe guttata [common monkey flower]
gb|KJB07801.1|  hypothetical protein B456_001G045200                    193   1e-56   Gossypium raimondii
ref|XP_007013814.1|  Uncharacterized protein isoform 2                  193   1e-56   Theobroma cacao [chocolate]
ref|XP_011019761.1|  PREDICTED: uncharacterized protein LOC105122382    193   1e-56   Populus euphratica
ref|XP_002515557.1|  conserved hypothetical protein                     193   1e-56   
ref|XP_004138737.1|  PREDICTED: uncharacterized protein LOC101219952    193   2e-56   Cucumis sativus [cucumbers]
ref|XP_009401767.1|  PREDICTED: uncharacterized protein LOC103985700    192   2e-56   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_007013813.1|  Uncharacterized protein isoform 1                  194   2e-56   
ref|XP_006399647.1|  hypothetical protein EUTSA_v10013887mg             192   2e-56   
gb|KHG29602.1|  Allergen Act d 3                                        192   3e-56   Gossypium arboreum [tree cotton]
gb|ABK94923.1|  unknown                                                 191   7e-56   Populus trichocarpa [western balsam poplar]
gb|AAM61720.1|  unknown                                                 191   8e-56   Arabidopsis thaliana [mouse-ear cress]
ref|NP_197928.1|  UF642 l-GalL-responsive protein 1                     191   8e-56   Arabidopsis thaliana [mouse-ear cress]
ref|XP_011019764.1|  PREDICTED: uncharacterized protein LOC105122387    191   8e-56   Populus euphratica
gb|AAL06839.1|  AT5g25460/F18G18_200                                    191   8e-56   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002872166.1|  hypothetical protein ARALYDRAFT_910605             190   2e-55   Arabidopsis lyrata subsp. lyrata
ref|XP_010421395.1|  PREDICTED: uncharacterized protein LOC104706866    190   2e-55   Camelina sativa [gold-of-pleasure]
ref|XP_010454874.1|  PREDICTED: uncharacterized protein LOC104736571    190   2e-55   Camelina sativa [gold-of-pleasure]
ref|XP_009151074.1|  PREDICTED: uncharacterized protein LOC103874406    190   2e-55   Brassica rapa
ref|XP_002308647.2|  hypothetical protein POPTR_0006s26630g             191   3e-55   
ref|XP_011026488.1|  PREDICTED: uncharacterized protein LOC105127071    189   3e-55   Populus euphratica
ref|XP_006287976.1|  hypothetical protein CARUB_v10001211mg             189   3e-55   Capsella rubella
ref|XP_006450498.1|  hypothetical protein CICLE_v10008711mg             189   6e-55   Citrus clementina [clementine]
ref|XP_010670694.1|  PREDICTED: uncharacterized protein LOC104887687    189   6e-55   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_006483312.1|  PREDICTED: uncharacterized protein LOC102608149    189   7e-55   Citrus sinensis [apfelsine]
ref|XP_006394799.1|  hypothetical protein EUTSA_v10004442mg             189   8e-55   Eutrema salsugineum [saltwater cress]
emb|CDX69757.1|  BnaA10g21060D                                          197   1e-54   
gb|KFK27809.1|  hypothetical protein AALP_AA8G432300                    188   1e-54   Arabis alpina [alpine rockcress]
ref|XP_002324280.2|  hypothetical protein POPTR_0018s01390g             189   1e-54   
ref|XP_003569339.1|  PREDICTED: uncharacterized protein LOC100821501    188   2e-54   Brachypodium distachyon [annual false brome]
ref|XP_010493802.1|  PREDICTED: uncharacterized protein LOC104771027    187   3e-54   Camelina sativa [gold-of-pleasure]
ref|XP_009129962.1|  PREDICTED: uncharacterized protein LOC103854751    186   5e-54   Brassica rapa
ref|XP_009407651.1|  PREDICTED: uncharacterized protein LOC103990295    186   7e-54   Musa acuminata subsp. malaccensis [pisang utan]
emb|CDY19801.1|  BnaA09g04540D                                          185   2e-53   Brassica napus [oilseed rape]
ref|XP_007217604.1|  hypothetical protein PRUPE_ppa018156mg             185   3e-53   Prunus persica
ref|XP_010541619.1|  PREDICTED: uncharacterized protein LOC104815031    184   4e-53   Tarenaya hassleriana [spider flower]
ref|XP_010539514.1|  PREDICTED: uncharacterized protein LOC104813570    184   5e-53   Tarenaya hassleriana [spider flower]
gb|AFK49528.1|  unknown                                                 179   7e-53   Medicago truncatula
ref|XP_009125963.1|  PREDICTED: uncharacterized protein LOC103850912    182   2e-52   Brassica rapa
gb|ACU22840.1|  unknown                                                 177   2e-52   Glycine max [soybeans]
ref|XP_002517567.1|  conserved hypothetical protein                     183   2e-52   Ricinus communis
emb|CDY54909.1|  BnaC02g48660D                                          181   2e-52   Brassica napus [oilseed rape]
ref|XP_010519935.1|  PREDICTED: uncharacterized protein LOC104799224    181   6e-52   Tarenaya hassleriana [spider flower]
ref|XP_008228640.1|  PREDICTED: uncharacterized protein LOC103328032    181   8e-52   Prunus mume [ume]
ref|XP_006427179.1|  hypothetical protein CICLE_v10025880mg             181   9e-52   Citrus clementina [clementine]
ref|XP_010914930.1|  PREDICTED: uncharacterized protein LOC105040204    180   1e-51   Elaeis guineensis
emb|CDX68849.1|  BnaC01g06040D                                          180   1e-51   
gb|AES58962.2|  plant/F18G18-200 protein                                180   1e-51   Medicago truncatula
ref|XP_004969140.1|  PREDICTED: uncharacterized protein LOC101755969    180   1e-51   Setaria italica
ref|XP_010526203.1|  PREDICTED: uncharacterized protein LOC104803829    180   2e-51   Tarenaya hassleriana [spider flower]
ref|XP_007161233.1|  hypothetical protein PHAVU_001G053100g             180   2e-51   Phaseolus vulgaris [French bean]
gb|ACU17881.1|  unknown                                                 177   2e-51   Glycine max [soybeans]
ref|NP_001053188.1|  Os04g0494600                                       180   2e-51   
ref|XP_007023946.1|  Uncharacterized protein TCM_028364                 180   2e-51   Theobroma cacao [chocolate]
ref|XP_006465391.1|  PREDICTED: uncharacterized protein LOC102618171    180   2e-51   Citrus sinensis [apfelsine]
gb|EAY74932.1|  hypothetical protein OsI_02826                          179   2e-51   Oryza sativa Indica Group [Indian rice]
emb|CAE01676.2|  OSJNBb0091E11.17                                       179   2e-51   Oryza sativa Japonica Group [Japonica rice]
dbj|BAB21293.1|  unknown protein                                        179   3e-51   Oryza sativa Japonica Group [Japonica rice]
gb|EMT06486.1|  hypothetical protein F775_26416                         179   3e-51   
ref|XP_011040006.1|  PREDICTED: uncharacterized protein LOC105136392    180   3e-51   Populus euphratica
ref|NP_001043549.2|  Os01g0611000                                       180   3e-51   
gb|ACJ84308.1|  unknown                                                 179   3e-51   Medicago truncatula
ref|NP_001053189.1|  Os04g0494800                                       179   3e-51   
ref|XP_010654739.1|  PREDICTED: uncharacterized protein LOC100261739    179   3e-51   Vitis vinifera
gb|EAY94676.1|  hypothetical protein OsI_16455                          179   3e-51   Oryza sativa Indica Group [Indian rice]
ref|XP_002303263.1|  hypothetical protein POPTR_0003s05850g             179   3e-51   
ref|XP_010432718.1|  PREDICTED: uncharacterized protein LOC104716937    179   3e-51   Camelina sativa [gold-of-pleasure]
gb|KHG10708.1|  Allergen Act d 3                                        179   4e-51   Gossypium arboreum [tree cotton]
emb|CAH67292.1|  OSIGBa0103O01.10                                       179   4e-51   Oryza sativa [red rice]
ref|XP_004978106.1|  PREDICTED: uncharacterized protein LOC101761311    179   4e-51   Setaria italica
ref|XP_008362680.1|  PREDICTED: uncharacterized protein LOC103426358    179   4e-51   
ref|XP_002455939.1|  hypothetical protein SORBIDRAFT_03g027650          179   5e-51   
gb|AAB41813.1|  unknown protein                                         179   5e-51   Medicago sativa [alfalfa]
ref|XP_010445004.1|  PREDICTED: uncharacterized protein LOC104727612    177   5e-51   
gb|KJB68131.1|  hypothetical protein B456_010G227400                    179   5e-51   Gossypium raimondii
gb|KJB80694.1|  hypothetical protein B456_013G110800                    177   6e-51   Gossypium raimondii
ref|XP_004498654.1|  PREDICTED: uncharacterized protein LOC101508759    178   8e-51   Cicer arietinum [garbanzo]
ref|XP_006652463.1|  PREDICTED: uncharacterized protein LOC102714172    178   8e-51   Oryza brachyantha
ref|XP_011466736.1|  PREDICTED: uncharacterized protein LOC101306...    178   8e-51   Fragaria vesca subsp. vesca
emb|CBI36253.3|  unnamed protein product                                179   9e-51   Vitis vinifera
gb|KHN44154.1|  hypothetical protein glysoja_031815                     178   9e-51   Glycine soja [wild soybean]
dbj|BAK03627.1|  predicted protein                                      178   1e-50   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_002446725.1|  hypothetical protein SORBIDRAFT_06g021290          177   2e-50   
dbj|BAE98407.1|  hypothetical protein                                   177   2e-50   Arabidopsis thaliana [mouse-ear cress]
ref|XP_004486698.1|  PREDICTED: uncharacterized protein LOC101495368    177   2e-50   Cicer arietinum [garbanzo]
ref|NP_567894.1|  uncharacterized protein                               177   2e-50   Arabidopsis thaliana [mouse-ear cress]
ref|XP_003526423.1|  PREDICTED: uncharacterized protein LOC100801917    177   2e-50   
tpg|DAA37152.1|  TPA: hypothetical protein ZEAMMB73_071426              177   3e-50   
ref|XP_002867243.1|  hypothetical protein ARALYDRAFT_913203             177   3e-50   Arabidopsis lyrata subsp. lyrata
ref|XP_010447383.1|  PREDICTED: uncharacterized protein LOC104730027    177   3e-50   Camelina sativa [gold-of-pleasure]
ref|XP_006389772.1|  hypothetical protein EUTSA_v10018730mg             177   3e-50   Eutrema salsugineum [saltwater cress]
ref|XP_003597843.1|  hypothetical protein MTR_2g103170                  177   3e-50   Medicago truncatula
ref|XP_006646088.1|  PREDICTED: uncharacterized protein LOC102706903    174   5e-50   
gb|ACG40327.1|  hypothetical protein                                    176   6e-50   Zea mays [maize]
ref|XP_008672703.1|  PREDICTED: hypothetical protein isoform X1         176   6e-50   Zea mays [maize]
ref|XP_003544618.1|  PREDICTED: uncharacterized protein LOC100776765    176   6e-50   Glycine max [soybeans]
ref|XP_010061944.1|  PREDICTED: uncharacterized protein LOC104449472    176   6e-50   Eucalyptus grandis [rose gum]
gb|KDO52908.1|  hypothetical protein CISIN_1g0399092mg                  174   7e-50   Citrus sinensis [apfelsine]
ref|NP_001173996.1|  Os04g0494950                                       171   8e-50   
gb|KFK42429.1|  hypothetical protein AALP_AA2G255100                    175   9e-50   Arabis alpina [alpine rockcress]
ref|XP_006301335.1|  hypothetical protein CARUB_v10021745mg             176   9e-50   Capsella rubella
ref|XP_008792101.1|  PREDICTED: uncharacterized protein LOC103708794    175   1e-49   Phoenix dactylifera
gb|KDP37140.1|  hypothetical protein JCGZ_06196                         175   1e-49   Jatropha curcas
ref|XP_002298115.2|  hypothetical protein POPTR_0001s17430g             176   1e-49   Populus trichocarpa [western balsam poplar]
emb|CAH67378.1|  OSIGBa0159F11.2                                        175   1e-49   Oryza sativa [red rice]
ref|XP_009333642.1|  PREDICTED: uncharacterized protein LOC103926567    175   1e-49   Pyrus x bretschneideri [bai li]
gb|KJB70568.1|  hypothetical protein B456_011G080100                    175   1e-49   Gossypium raimondii
ref|XP_006653557.1|  PREDICTED: uncharacterized protein LOC102718925    175   1e-49   
gb|EMT04285.1|  hypothetical protein F775_14657                         175   2e-49   
ref|XP_008669227.1|  PREDICTED: uncharacterized protein LOC103646275    175   2e-49   Zea mays [maize]
ref|XP_006601137.1|  PREDICTED: uncharacterized protein LOC100813...    174   2e-49   
gb|KHG06895.1|  Agmatine deiminase                                      174   2e-49   Gossypium arboreum [tree cotton]
ref|XP_008377611.1|  PREDICTED: uncharacterized protein LOC103440696    174   2e-49   Malus domestica [apple tree]
gb|KHN06654.1|  hypothetical protein glysoja_037506                     174   3e-49   Glycine soja [wild soybean]
ref|XP_009104452.1|  PREDICTED: uncharacterized protein LOC103830427    175   3e-49   Brassica rapa
ref|XP_010048991.1|  PREDICTED: uncharacterized protein LOC104437692    173   3e-49   Eucalyptus grandis [rose gum]
ref|XP_002887838.1|  hypothetical protein ARALYDRAFT_340195             174   4e-49   Arabidopsis lyrata subsp. lyrata
emb|CDY39990.1|  BnaC06g40680D                                          173   4e-49   Brassica napus [oilseed rape]
gb|EMS63052.1|  hypothetical protein TRIUR3_01733                       174   4e-49   Triticum urartu
ref|XP_002446724.1|  hypothetical protein SORBIDRAFT_06g021280          174   5e-49   Sorghum bicolor [broomcorn]
gb|EAZ31211.1|  hypothetical protein OsJ_15311                          171   5e-49   Oryza sativa Japonica Group [Japonica rice]
tpg|DAA37149.1|  TPA: hypothetical protein ZEAMMB73_398073              173   7e-49   
ref|XP_008669229.1|  PREDICTED: uncharacterized protein LOC103646276    173   8e-49   Zea mays [maize]
ref|XP_006581022.1|  PREDICTED: uncharacterized protein LOC100802...    173   8e-49   
ref|XP_010417734.1|  PREDICTED: uncharacterized protein LOC104703420    173   9e-49   Camelina sativa [gold-of-pleasure]
ref|XP_010472958.1|  PREDICTED: uncharacterized protein LOC104752499    173   9e-49   Camelina sativa [gold-of-pleasure]
ref|XP_008347484.1|  PREDICTED: uncharacterized protein LOC103410579    173   1e-48   Malus domestica [apple tree]
ref|XP_010429991.1|  PREDICTED: uncharacterized protein LOC104714356    172   1e-48   Camelina sativa [gold-of-pleasure]
ref|XP_011035644.1|  PREDICTED: uncharacterized protein LOC105133377    172   1e-48   Populus euphratica
gb|EMS58461.1|  hypothetical protein TRIUR3_29087                       172   1e-48   Triticum urartu
gb|ABK26874.1|  unknown                                                 166   2e-48   Picea sitchensis
ref|XP_009348421.1|  PREDICTED: uncharacterized protein LOC103940075    171   4e-48   Pyrus x bretschneideri [bai li]
ref|XP_006841925.1|  hypothetical protein AMTR_s00042p00185900          170   4e-48   
ref|NP_001145978.1|  hypothetical protein                               172   5e-48   Zea mays [maize]
gb|KHG21630.1|  Adenosylhomocysteinase                                  171   5e-48   Gossypium arboreum [tree cotton]
ref|NP_001053190.1|  Os04g0494900                                       171   5e-48   
emb|CAD41548.2|  OSJNBb0091E11.18                                       171   6e-48   Oryza sativa Japonica Group [Japonica rice]
emb|CAH67377.1|  OSIGBa0159F11.1                                        171   7e-48   Oryza sativa [red rice]
emb|CDX87297.1|  BnaA07g35760D                                          170   7e-48   
ref|XP_006653558.1|  PREDICTED: uncharacterized protein LOC102719203    171   8e-48   Oryza brachyantha
ref|NP_001242447.1|  uncharacterized protein LOC100802444 precursor     170   9e-48   Glycine max [soybeans]
emb|CAE01677.2|  OSJNBb0091E11.19                                       170   9e-48   Oryza sativa Japonica Group [Japonica rice]
ref|XP_003581385.1|  PREDICTED: uncharacterized protein LOC100824265    170   1e-47   Brachypodium distachyon [annual false brome]
ref|NP_178141.1|  protein DUF642 L-GALL RESPONSIVE GENE 1               170   1e-47   Arabidopsis thaliana [mouse-ear cress]
emb|CDY57694.1|  BnaA07g38340D                                          170   1e-47   Brassica napus [oilseed rape]
gb|EYU21602.1|  hypothetical protein MIMGU_mgv1a008411mg                170   1e-47   Erythranthe guttata [common monkey flower]
ref|XP_004976082.1|  PREDICTED: uncharacterized protein LOC101765204    170   2e-47   Setaria italica
emb|CDY54317.1|  BnaC06g43150D                                          169   2e-47   Brassica napus [oilseed rape]
ref|XP_011072257.1|  PREDICTED: uncharacterized protein LOC105157546    170   2e-47   
ref|XP_002446727.1|  hypothetical protein SORBIDRAFT_06g021310          169   3e-47   
ref|XP_003531698.1|  PREDICTED: uncharacterized protein LOC100779277    168   5e-47   Glycine max [soybeans]
gb|KHN47787.1|  hypothetical protein glysoja_029205                     168   6e-47   Glycine soja [wild soybean]
ref|XP_006285882.1|  hypothetical protein CARUB_v10007385mg             167   8e-47   
dbj|BAJ96954.1|  predicted protein                                      167   1e-46   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_002446728.1|  hypothetical protein SORBIDRAFT_06g021320          167   2e-46   
gb|EEE61252.1|  hypothetical protein OsJ_15312                          171   2e-46   Oryza sativa Japonica Group [Japonica rice]
gb|KHN07098.1|  hypothetical protein glysoja_023281                     164   9e-46   Glycine soja [wild soybean]
ref|XP_003580051.1|  PREDICTED: uncharacterized protein LOC100841904    165   1e-45   Brachypodium distachyon [annual false brome]
gb|AGV54541.1|  hypothetical protein                                    164   3e-45   Phaseolus vulgaris [French bean]
ref|XP_004978107.1|  PREDICTED: uncharacterized protein LOC101761699    163   5e-45   Setaria italica
ref|XP_011081171.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...    163   7e-45   Sesamum indicum [beniseed]
gb|EYU24667.1|  hypothetical protein MIMGU_mgv1a008541mg                162   8e-45   Erythranthe guttata [common monkey flower]
ref|XP_004978108.1|  PREDICTED: uncharacterized protein LOC101762525    162   9e-45   
gb|ABR13280.1|  unknown protein                                         156   1e-44   Prunus dulcis [sweet almond]
ref|XP_006412472.1|  hypothetical protein EUTSA_v10025706mg             160   3e-44   
ref|NP_001140426.1|  hypothetical protein precursor                     160   5e-44   Zea mays [maize]
emb|CAA22573.1|  putative protein                                       159   9e-44   Arabidopsis thaliana [mouse-ear cress]
ref|XP_011466738.1|  PREDICTED: uncharacterized protein LOC101306...    159   1e-43   Fragaria vesca subsp. vesca
ref|XP_004241713.1|  PREDICTED: uncharacterized protein LOC101268115    159   2e-43   Solanum lycopersicum
ref|XP_002453515.1|  hypothetical protein SORBIDRAFT_04g007160          159   2e-43   
ref|XP_002446726.1|  hypothetical protein SORBIDRAFT_06g021300          159   2e-43   Sorghum bicolor [broomcorn]
ref|XP_006356190.1|  PREDICTED: uncharacterized protein LOC102589576    159   2e-43   Solanum tuberosum [potatoes]
ref|XP_004951511.1|  PREDICTED: uncharacterized protein LOC101755979    158   3e-43   Setaria italica
gb|KHN07099.1|  hypothetical protein glysoja_023282                     157   6e-43   Glycine soja [wild soybean]
dbj|BAJ97095.1|  predicted protein                                      157   6e-43   Hordeum vulgare subsp. vulgare [two-rowed barley]
dbj|BAK03126.1|  predicted protein                                      157   7e-43   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_009591297.1|  PREDICTED: uncharacterized protein LOC104088341    157   9e-43   Nicotiana tomentosiformis
ref|XP_010088264.1|  hypothetical protein L484_005140                   157   2e-42   Morus notabilis
ref|XP_010092662.1|  hypothetical protein L484_019736                   152   2e-42   Morus notabilis
gb|EMT04284.1|  hypothetical protein F775_14656                         156   2e-42   
ref|XP_003581384.1|  PREDICTED: uncharacterized protein LOC100823957    157   2e-42   Brachypodium distachyon [annual false brome]
emb|CDO98108.1|  unnamed protein product                                156   2e-42   Coffea canephora [robusta coffee]
ref|XP_009778816.1|  PREDICTED: uncharacterized protein LOC104228110    156   3e-42   Nicotiana sylvestris
ref|XP_009758146.1|  PREDICTED: uncharacterized protein LOC104210873    155   4e-42   Nicotiana sylvestris
gb|EMT19274.1|  hypothetical protein F775_14136                         155   4e-42   
ref|XP_009590498.1|  PREDICTED: uncharacterized protein LOC104087663    155   4e-42   Nicotiana tomentosiformis
ref|XP_004976081.1|  PREDICTED: uncharacterized protein LOC101764801    155   7e-42   Setaria italica
gb|EMS51274.1|  hypothetical protein TRIUR3_06873                       154   1e-41   Triticum urartu
ref|XP_004235717.1|  PREDICTED: uncharacterized protein LOC101252763    154   2e-41   Solanum lycopersicum
gb|ABK24630.1|  unknown                                                 154   2e-41   Picea sitchensis
ref|XP_006826721.1|  hypothetical protein AMTR_s00264p00012960          153   3e-41   
gb|KJB70569.1|  hypothetical protein B456_011G080100                    152   4e-41   Gossypium raimondii
ref|XP_009764126.1|  PREDICTED: uncharacterized protein LOC104215887    152   9e-41   Nicotiana sylvestris
gb|ACN40837.1|  unknown                                                 152   1e-40   Picea sitchensis
ref|NP_001141282.1|  hypothetical protein precursor                     151   2e-40   Zea mays [maize]
ref|XP_006341715.1|  PREDICTED: uncharacterized protein LOC102601890    150   3e-40   
ref|XP_008363312.1|  PREDICTED: uncharacterized protein LOC103427013    150   5e-40   
ref|XP_004307221.1|  PREDICTED: uncharacterized protein LOC101292742    149   8e-40   Fragaria vesca subsp. vesca
ref|XP_009598172.1|  PREDICTED: uncharacterized protein LOC104094024    149   1e-39   Nicotiana tomentosiformis
ref|XP_003588711.1|  hypothetical protein MTR_1g011800                  148   1e-39   
ref|XP_008364711.1|  PREDICTED: uncharacterized protein LOC103428382    149   1e-39   
ref|XP_008375195.1|  PREDICTED: uncharacterized protein LOC103438421    149   2e-39   Malus domestica [apple tree]
ref|XP_008669230.1|  PREDICTED: uncharacterized protein LOC103646278    149   2e-39   Zea mays [maize]
ref|XP_007218160.1|  hypothetical protein PRUPE_ppa007461mg             148   2e-39   Prunus persica
ref|XP_006346648.1|  PREDICTED: uncharacterized protein LOC102598480    147   4e-39   
ref|XP_004252488.1|  PREDICTED: uncharacterized protein LOC101250580    147   5e-39   Solanum lycopersicum
ref|XP_003581666.1|  PREDICTED: uncharacterized protein LOC100833858    147   6e-39   Brachypodium distachyon [annual false brome]
ref|XP_009354784.1|  PREDICTED: uncharacterized protein LOC103945912    147   7e-39   Pyrus x bretschneideri [bai li]
ref|XP_008231461.1|  PREDICTED: uncharacterized protein LOC103330638    147   1e-38   Prunus mume [ume]
gb|EMT25742.1|  hypothetical protein F775_05959                         145   3e-38   
ref|XP_002517797.1|  conserved hypothetical protein                     144   5e-38   Ricinus communis
gb|EMS51275.1|  hypothetical protein TRIUR3_06876                       144   7e-38   Triticum urartu
gb|KDP43556.1|  hypothetical protein JCGZ_16843                         144   9e-38   Jatropha curcas
gb|EEE56530.1|  hypothetical protein OsJ_05823                          144   1e-37   Oryza sativa Japonica Group [Japonica rice]
gb|EEC72709.1|  hypothetical protein OsI_06304                          144   1e-37   Oryza sativa Indica Group [Indian rice]
ref|XP_010067858.1|  PREDICTED: uncharacterized protein LOC104454644    143   1e-37   Eucalyptus grandis [rose gum]
ref|XP_004149718.1|  PREDICTED: uncharacterized protein LOC101216438    143   1e-37   Cucumis sativus [cucumbers]
ref|XP_006410597.1|  hypothetical protein EUTSA_v10016749mg             143   2e-37   Eutrema salsugineum [saltwater cress]
ref|XP_002446723.1|  hypothetical protein SORBIDRAFT_06g021270          143   2e-37   
ref|XP_006407770.1|  hypothetical protein EUTSA_v10020990mg             142   2e-37   Eutrema salsugineum [saltwater cress]
dbj|BAJ94417.1|  predicted protein                                      143   2e-37   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_010257158.1|  PREDICTED: uncharacterized protein LOC104597378    142   3e-37   Nelumbo nucifera [Indian lotus]
ref|XP_003581665.1|  PREDICTED: uncharacterized protein LOC100833550    142   4e-37   Brachypodium distachyon [annual false brome]
emb|CDO98109.1|  unnamed protein product                                141   6e-37   Coffea canephora [robusta coffee]
gb|KFK36341.1|  hypothetical protein AALP_AA4G110000                    142   6e-37   Arabis alpina [alpine rockcress]
ref|XP_009143769.1|  PREDICTED: uncharacterized protein LOC103867448    142   8e-37   Brassica rapa
emb|CDX84311.1|  BnaC04g10730D                                          142   8e-37   
emb|CDY17255.1|  BnaA05g09330D                                          142   8e-37   Brassica napus [oilseed rape]
ref|XP_009396509.1|  PREDICTED: uncharacterized protein LOC103981490    141   1e-36   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_011091660.1|  PREDICTED: uncharacterized protein LOC105172024    141   1e-36   Sesamum indicum [beniseed]
ref|XP_011096549.1|  PREDICTED: uncharacterized protein LOC105175704    141   1e-36   Sesamum indicum [beniseed]
ref|XP_008461812.1|  PREDICTED: uncharacterized protein LOC103500323    140   1e-36   Cucumis melo [Oriental melon]
ref|XP_006294334.1|  hypothetical protein CARUB_v10023341mg             141   2e-36   Capsella rubella
ref|XP_004233117.1|  PREDICTED: uncharacterized protein LOC101246207    140   2e-36   
gb|EYU43266.1|  hypothetical protein MIMGU_mgv1a007866mg                140   2e-36   Erythranthe guttata [common monkey flower]
ref|XP_010257157.1|  PREDICTED: uncharacterized protein LOC104597377    140   2e-36   
ref|XP_009123974.1|  PREDICTED: uncharacterized protein LOC103848900    140   2e-36   
ref|XP_010461096.1|  PREDICTED: uncharacterized protein LOC104741840    140   2e-36   
ref|XP_009147007.1|  PREDICTED: uncharacterized protein LOC103870618    140   3e-36   
emb|CDY28002.1|  BnaC05g44040D                                          139   3e-36   
ref|XP_011085252.1|  PREDICTED: uncharacterized protein LOC105167296    140   3e-36   
ref|XP_010241207.1|  PREDICTED: uncharacterized protein LOC104585883    139   4e-36   
ref|XP_006352963.1|  PREDICTED: uncharacterized protein LOC102582541    140   4e-36   
ref|NP_001046247.2|  Os02g0205200                                       139   5e-36   
emb|CDY22149.1|  BnaC01g39520D                                          139   6e-36   
ref|XP_010464451.1|  PREDICTED: uncharacterized protein LOC104744998    139   6e-36   
ref|XP_009418805.1|  PREDICTED: uncharacterized protein LOC103998920    139   6e-36   
ref|XP_006297975.1|  hypothetical protein CARUB_v10014019mg             139   7e-36   
ref|XP_010056890.1|  PREDICTED: uncharacterized protein LOC104444833    139   7e-36   
ref|XP_010486384.1|  PREDICTED: uncharacterized protein LOC104764532    139   8e-36   
ref|XP_010673134.1|  PREDICTED: uncharacterized protein LOC104889574    138   1e-35   
ref|NP_180998.1|  uncharacterized protein                               139   1e-35   
ref|XP_002881340.1|  hypothetical protein ARALYDRAFT_902536             139   1e-35   
ref|NP_001053191.2|  Os04g0495000                                       138   1e-35   
gb|EAY94679.1|  hypothetical protein OsI_16458                          138   1e-35   
ref|XP_003580050.1|  PREDICTED: uncharacterized protein LOC100841598    138   1e-35   
ref|XP_010534242.1|  PREDICTED: uncharacterized protein LOC104809851    138   1e-35   
gb|EYU20209.1|  hypothetical protein MIMGU_mgv1a008620mg                138   2e-35   
ref|XP_009394197.1|  PREDICTED: uncharacterized protein LOC103979736    139   2e-35   
ref|XP_009630913.1|  PREDICTED: uncharacterized protein LOC104120779    137   3e-35   
ref|XP_009788467.1|  PREDICTED: uncharacterized protein LOC104236274    137   3e-35   
ref|XP_010509742.1|  PREDICTED: uncharacterized protein LOC104786108    137   3e-35   
ref|XP_004229647.1|  PREDICTED: uncharacterized protein LOC101251618    137   3e-35   
ref|XP_009603034.1|  PREDICTED: uncharacterized protein LOC104098081    137   3e-35   
gb|EYU33356.1|  hypothetical protein MIMGU_mgv1a007799mg                137   4e-35   
ref|NP_566328.1|  germination-related protein                           137   4e-35   
ref|XP_002313314.1|  hypothetical protein POPTR_0009s06370g             137   4e-35   
gb|KDP37968.1|  hypothetical protein JCGZ_04611                         137   4e-35   
ref|XP_007147896.1|  hypothetical protein PHAVU_006G164100g             137   4e-35   
ref|XP_011025472.1|  PREDICTED: uncharacterized protein LOC105126334    137   4e-35   
ref|XP_011087959.1|  PREDICTED: uncharacterized protein LOC105169285    137   4e-35   
ref|XP_004134601.1|  PREDICTED: uncharacterized protein LOC101220961    137   5e-35   
ref|XP_006845336.1|  hypothetical protein AMTR_s00141p00085330          136   5e-35   
emb|CDM84231.1|  unnamed protein product                                137   6e-35   
ref|XP_006489949.1|  PREDICTED: uncharacterized protein LOC102629059    136   7e-35   
emb|CDP19178.1|  unnamed protein product                                136   8e-35   
ref|XP_010937268.1|  PREDICTED: uncharacterized protein LOC105056672    136   8e-35   
gb|KDO42201.1|  hypothetical protein CISIN_1g045875mg                   132   9e-35   
ref|XP_010691193.1|  PREDICTED: uncharacterized protein LOC104904598    135   1e-34   
ref|XP_008439641.1|  PREDICTED: uncharacterized protein LOC103484373    136   1e-34   
gb|AGV54803.1|  hypothetical protein                                    135   1e-34   
gb|AGV54847.1|  hypothetical protein                                    135   1e-34   
ref|XP_009758716.1|  PREDICTED: uncharacterized protein LOC104211372    135   1e-34   
ref|XP_010504912.1|  PREDICTED: uncharacterized protein LOC104781...    135   2e-34   
ref|XP_008776092.1|  PREDICTED: uncharacterized protein LOC103696299    135   2e-34   
ref|XP_003542933.1|  PREDICTED: uncharacterized protein LOC100788675    135   2e-34   
ref|XP_008792993.1|  PREDICTED: uncharacterized protein LOC103709448    135   2e-34   
emb|CDP07813.1|  unnamed protein product                                135   2e-34   
gb|EMT29323.1|  hypothetical protein F775_30539                         135   2e-34   
ref|XP_006467477.1|  PREDICTED: uncharacterized protein LOC102617...    135   2e-34   
ref|XP_006449683.1|  hypothetical protein CICLE_v10015527mg             135   2e-34   
ref|XP_002276894.1|  PREDICTED: uncharacterized protein LOC100258445    134   3e-34   
ref|XP_002275370.1|  PREDICTED: uncharacterized protein LOC100253669    135   3e-34   
ref|XP_003546086.1|  PREDICTED: uncharacterized protein LOC100807088    135   3e-34   
emb|CBI30867.3|  unnamed protein product                                135   3e-34   
ref|XP_010516598.1|  PREDICTED: uncharacterized protein LOC104792204    135   3e-34   
ref|XP_006439076.1|  hypothetical protein CICLE_v10031881mg             134   3e-34   
ref|XP_010279657.1|  PREDICTED: uncharacterized protein LOC104613510    134   4e-34   
ref|XP_004293568.1|  PREDICTED: uncharacterized protein LOC101302531    134   4e-34   
ref|NP_001044289.1|  Os01g0756600                                       134   5e-34   
ref|XP_006644728.1|  PREDICTED: uncharacterized protein LOC102722258    134   6e-34   
ref|XP_006421409.1|  hypothetical protein CICLE_v10005198mg             134   6e-34   
gb|AFK48735.1|  unknown                                                 134   6e-34   
ref|XP_006489938.1|  PREDICTED: uncharacterized protein LOC102625022    134   6e-34   
ref|XP_011015145.1|  PREDICTED: uncharacterized protein LOC105118803    134   7e-34   
ref|XP_002317331.2|  hypothetical protein POPTR_0011s08980g             134   7e-34   
ref|XP_002283940.2|  PREDICTED: uncharacterized protein LOC100257236    133   9e-34   
ref|XP_010275001.1|  PREDICTED: uncharacterized protein LOC104610185    133   1e-33   
gb|KDO53673.1|  hypothetical protein CISIN_1g017355mg                   133   1e-33   
ref|XP_010241208.1|  PREDICTED: uncharacterized protein LOC104585885    133   1e-33   
ref|XP_002456374.1|  hypothetical protein SORBIDRAFT_03g034960          133   1e-33   
ref|XP_006467478.1|  PREDICTED: uncharacterized protein LOC102617...    133   1e-33   
ref|XP_002519690.1|  conserved hypothetical protein                     133   2e-33   
gb|EMS50963.1|  hypothetical protein TRIUR3_30516                       134   2e-33   
ref|XP_003569841.1|  PREDICTED: uncharacterized protein LOC100844886    132   2e-33   
gb|ACF86181.1|  unknown                                                 132   2e-33   
ref|XP_007052493.1|  F17A17.37 protein                                  132   3e-33   
ref|NP_001143645.1|  hypothetical protein precursor                     132   3e-33   
gb|ACG32132.1|  hypothetical protein                                    132   3e-33   
ref|XP_006845348.1|  hypothetical protein AMTR_s00141p00103540          132   3e-33   
ref|XP_010097437.1|  hypothetical protein L484_003208                   132   3e-33   
gb|EYU20746.1|  hypothetical protein MIMGU_mgv1a008437mg                132   3e-33   
ref|XP_007213876.1|  hypothetical protein PRUPE_ppa006814mg             132   3e-33   
ref|XP_002299934.2|  hypothetical protein POPTR_0001s27110g             131   5e-33   
gb|AFK49395.1|  unknown                                                 131   5e-33   
ref|XP_011047367.1|  PREDICTED: uncharacterized protein LOC105141733    131   5e-33   
ref|XP_011013325.1|  PREDICTED: uncharacterized protein LOC105117377    131   5e-33   
ref|XP_010549485.1|  PREDICTED: uncharacterized protein LOC104820646    132   5e-33   
ref|XP_006345424.1|  PREDICTED: uncharacterized protein LOC102582371    131   5e-33   
ref|XP_008371603.1|  PREDICTED: uncharacterized protein LOC103434995    131   6e-33   
ref|XP_003593943.1|  hypothetical protein MTR_2g019600                  131   6e-33   
ref|XP_004970002.1|  PREDICTED: uncharacterized protein LOC101758272    131   7e-33   
ref|XP_010057181.1|  PREDICTED: uncharacterized protein LOC104445070    130   7e-33   
ref|XP_011016219.1|  PREDICTED: uncharacterized protein LOC105119742    130   7e-33   
ref|XP_010673132.1|  PREDICTED: uncharacterized protein LOC104889572    130   8e-33   
gb|KDO78161.1|  hypothetical protein CISIN_1g0159862mg                  130   8e-33   
ref|XP_009360881.1|  PREDICTED: uncharacterized protein LOC103951270    130   9e-33   
ref|XP_008663355.1|  PREDICTED: uncharacterized protein LOC103641799    131   9e-33   
gb|KHN47316.1|  hypothetical protein glysoja_020184                     130   9e-33   
ref|XP_010919817.1|  PREDICTED: uncharacterized protein LOC105043799    130   1e-32   
ref|XP_010665821.1|  PREDICTED: uncharacterized protein LOC104883071    130   1e-32   
ref|XP_011078904.1|  PREDICTED: uncharacterized protein LOC105162545    130   1e-32   
gb|EEC71507.1|  hypothetical protein OsI_03789                          131   2e-32   
ref|XP_004486030.1|  PREDICTED: uncharacterized protein LOC101488455    130   2e-32   
ref|XP_010460777.1|  PREDICTED: uncharacterized protein LOC104741589    130   3e-32   
emb|CAN80832.1|  hypothetical protein VITISV_002505                     132   3e-32   
ref|XP_007028767.1|  F17A17.37 protein                                  129   3e-32   
ref|XP_010504914.1|  PREDICTED: uncharacterized protein LOC104781...    129   3e-32   
ref|XP_008383561.1|  PREDICTED: uncharacterized protein LOC103446251    129   3e-32   
tpg|DAA57583.1|  TPA: hypothetical protein ZEAMMB73_913803              129   4e-32   
ref|XP_006415525.1|  hypothetical protein EUTSA_v10007784mg             129   4e-32   
ref|XP_006368102.1|  PREDICTED: uncharacterized protein LOC102603851    125   5e-32   
gb|EPS66859.1|  hypothetical protein M569_07917                         129   6e-32   
ref|XP_003593942.1|  Glutamate-gated kainate-type ion channel rec...    130   6e-32   
ref|XP_010478373.1|  PREDICTED: uncharacterized protein LOC104757341    129   6e-32   
ref|XP_010540565.1|  PREDICTED: uncharacterized protein LOC104814294    128   7e-32   
ref|XP_006421407.1|  hypothetical protein CICLE_v10006613mg             127   8e-32   
ref|XP_010499517.1|  PREDICTED: uncharacterized protein LOC104777028    128   8e-32   
gb|KJB24990.1|  hypothetical protein B456_004G171200                    128   8e-32   
ref|XP_002532070.1|  conserved hypothetical protein                     128   9e-32   
ref|XP_010911072.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...    128   1e-31   
gb|KHG12815.1|  DNA-directed RNA polymerase subunit beta''              127   1e-31   
ref|XP_008225474.1|  PREDICTED: uncharacterized protein LOC103325117    127   2e-31   
gb|EPS66311.1|  hypothetical protein M569_08463                         126   2e-31   
emb|CDY26302.1|  BnaA09g26530D                                          127   2e-31   
ref|XP_010554835.1|  PREDICTED: uncharacterized protein LOC104824444    127   2e-31   
ref|XP_006307659.1|  hypothetical protein CARUB_v10009287mg             127   2e-31   
ref|XP_010673133.1|  PREDICTED: uncharacterized protein LOC104889573    126   3e-31   
gb|KJB24991.1|  hypothetical protein B456_004G171200                    127   3e-31   
ref|NP_564344.1|  uncharacterized protein                               126   4e-31   
ref|XP_009379646.1|  PREDICTED: uncharacterized protein LOC103968043    127   4e-31   
ref|XP_009115202.1|  PREDICTED: uncharacterized protein LOC103840445    126   5e-31   
ref|XP_002308027.2|  hypothetical protein POPTR_0006s04880g             125   7e-31   
gb|AAK74007.1|  At1g29980/T1P2_9                                        122   7e-31   
ref|XP_008245331.1|  PREDICTED: uncharacterized protein LOC103343457    125   8e-31   
gb|KJB36028.1|  hypothetical protein B456_006G137000                    124   1e-30   
gb|EEC73302.1|  hypothetical protein OsI_07475                          122   1e-30   
gb|KJB36031.1|  hypothetical protein B456_006G137000                    125   1e-30   
ref|NP_973938.1|  uncharacterized protein                               124   1e-30   
ref|XP_006350194.1|  PREDICTED: uncharacterized protein LOC102578783    124   1e-30   
gb|ACN30906.1|  unknown                                                 124   1e-30   
gb|KHG07966.1|  Imidazolonepropionase                                   124   2e-30   
ref|XP_011033339.1|  PREDICTED: uncharacterized protein LOC105131855    123   3e-30   
ref|XP_002322719.1|  hypothetical protein POPTR_0016s05640g             123   3e-30   
ref|XP_008812841.1|  PREDICTED: uncharacterized protein LOC103723648    124   4e-30   
gb|KDP26060.1|  hypothetical protein JCGZ_21093                         123   4e-30   
ref|XP_010695068.1|  PREDICTED: uncharacterized protein LOC104907775    123   4e-30   
ref|XP_010672845.1|  PREDICTED: uncharacterized protein LOC104889...    123   4e-30   
ref|XP_010672846.1|  PREDICTED: uncharacterized protein LOC104889...    123   5e-30   
ref|XP_008392232.1|  PREDICTED: uncharacterized protein LOC103454416    123   5e-30   
ref|XP_002893594.1|  predicted protein                                  122   8e-30   
ref|NP_001172996.1|  Os02g0527500                                       122   1e-29   
ref|XP_010508668.1|  PREDICTED: uncharacterized protein LOC104785200    122   1e-29   
ref|XP_009142778.1|  PREDICTED: uncharacterized protein LOC103866588    122   1e-29   
ref|XP_010505974.1|  PREDICTED: uncharacterized protein LOC104782672    122   1e-29   
ref|XP_004236613.1|  PREDICTED: uncharacterized protein LOC101245049    122   1e-29   
ref|XP_010517673.1|  PREDICTED: uncharacterized protein LOC104793095    122   1e-29   
ref|XP_011048055.1|  PREDICTED: uncharacterized protein LOC105142230    121   2e-29   
ref|XP_010110985.1|  hypothetical protein L484_021680                   122   2e-29   
ref|XP_007201993.1|  hypothetical protein PRUPE_ppa024647mg             121   3e-29   
ref|XP_006411450.1|  hypothetical protein EUTSA_v10016825mg             121   3e-29   
ref|XP_006411448.1|  hypothetical protein EUTSA_v10016810mg             120   4e-29   
emb|CDY06908.1|  BnaA04g24070D                                          120   4e-29   
ref|XP_009775467.1|  PREDICTED: uncharacterized protein LOC104225390    120   4e-29   
ref|XP_006296392.1|  hypothetical protein CARUB_v10025565mg             120   4e-29   
ref|XP_002308942.2|  hypothetical protein POPTR_0006s04890g             120   5e-29   
ref|NP_181712.1|  uncharacterized protein                               120   5e-29   
ref|XP_002881800.1|  hypothetical protein ARALYDRAFT_483262             120   5e-29   
ref|XP_006294452.1|  hypothetical protein CARUB_v10023465mg             120   6e-29   
ref|XP_010546243.1|  PREDICTED: uncharacterized protein LOC104818346    119   8e-29   
ref|XP_009355498.1|  PREDICTED: uncharacterized protein LOC103946508    119   9e-29   
dbj|BAD52536.1|  unknown protein                                        118   1e-28   
emb|CDY14785.1|  BnaC04g47820D                                          119   1e-28   
ref|XP_009142006.1|  PREDICTED: uncharacterized protein LOC103865900    119   1e-28   
gb|KJB69808.1|  hypothetical protein B456_011G043300                    119   2e-28   
gb|KHN11697.1|  hypothetical protein glysoja_006150                     119   2e-28   
ref|XP_003534397.1|  PREDICTED: uncharacterized protein LOC100812299    119   2e-28   
ref|XP_004499913.1|  PREDICTED: uncharacterized protein LOC101495888    119   2e-28   
ref|XP_010508665.1|  PREDICTED: uncharacterized protein LOC104785...    118   2e-28   
ref|XP_010517674.1|  PREDICTED: uncharacterized protein LOC104793096    118   2e-28   
emb|CDX79912.1|  BnaA05g02440D                                          119   2e-28   
ref|XP_010505975.1|  PREDICTED: uncharacterized protein LOC104782673    118   2e-28   
ref|XP_009142779.1|  PREDICTED: uncharacterized protein LOC103866589    118   3e-28   
ref|XP_010508664.1|  PREDICTED: uncharacterized protein LOC104785...    118   3e-28   
ref|XP_004236614.1|  PREDICTED: uncharacterized protein LOC101245348    118   4e-28   
ref|NP_181711.1|  uncharacterized protein                               117   4e-28   
gb|KHG21629.1|  GTPase Der                                              116   5e-28   
ref|XP_006350197.1|  PREDICTED: uncharacterized protein LOC102579762    117   5e-28   
gb|KEH17090.1|  DUF642 family protein                                   117   6e-28   
emb|CDY48765.1|  BnaC04g02180D                                          117   7e-28   
gb|EMT25156.1|  hypothetical protein F775_26385                         117   7e-28   
gb|KHG28355.1|  putative metabolite transport                           117   7e-28   
gb|EMS62745.1|  hypothetical protein TRIUR3_16982                       116   8e-28   
ref|XP_008460770.1|  PREDICTED: uncharacterized protein LOC103499530    117   8e-28   
ref|XP_004981346.1|  PREDICTED: uncharacterized protein LOC101768647    117   9e-28   
ref|XP_009355525.1|  PREDICTED: uncharacterized protein LOC103946533    116   1e-27   
dbj|BAJ89665.1|  predicted protein                                      116   1e-27   
gb|AGV54565.1|  hypothetical protein                                    116   1e-27   
gb|AES87990.2|  DUF642 family protein                                   116   1e-27   
gb|AFK39561.1|  unknown                                                 116   2e-27   
ref|XP_003605793.1|  hypothetical protein MTR_4g039720                  116   2e-27   
ref|XP_007025094.1|  Uncharacterized protein TCM_029497                 117   2e-27   
ref|XP_003564086.1|  PREDICTED: uncharacterized protein LOC100845370    116   2e-27   
ref|NP_974254.1|  germination-related protein                           115   2e-27   
ref|XP_002882567.1|  hypothetical protein ARALYDRAFT_478145             115   2e-27   
gb|KJB57253.1|  hypothetical protein B456_009G155400                    116   2e-27   
gb|KJB57254.1|  hypothetical protein B456_009G155400                    116   2e-27   
ref|XP_009587019.1|  PREDICTED: uncharacterized protein LOC104084774    116   2e-27   
gb|KHG06200.1|  Periplasmic nitrate reductase                           116   2e-27   
emb|CDP21696.1|  unnamed protein product                                115   2e-27   
ref|NP_001051644.1|  Os03g0807700                                       116   2e-27   
ref|XP_002466246.1|  hypothetical protein SORBIDRAFT_01g004270          115   2e-27   
ref|XP_003605789.1|  hypothetical protein MTR_4g039680                  115   3e-27   
ref|XP_007148907.1|  hypothetical protein PHAVU_005G024100g             115   3e-27   
gb|KHN45084.1|  hypothetical protein glysoja_040000                     115   3e-27   
tpg|DAA52069.1|  TPA: hypothetical protein ZEAMMB73_133538              115   4e-27   



>ref|XP_009617293.1| PREDICTED: uncharacterized protein LOC104109646 [Nicotiana tomentosiformis]
Length=373

 Score =   223 bits (567),  Expect = 6e-68, Method: Compositional matrix adjust.
 Identities = 99/128 (77%), Positives = 115/128 (90%), Gaps = 0/128 (0%)
 Frame = +1

Query  142  TDGLLVNGNFEAPVKKTDLNGTIVTRHDAVPGWTVTGFVEYIQAGQKQGDMQLVVPEGFA  321
            TDGLL NGNFE P+ K DLNGT+V +H+A+P W+++GFVEYI+AGQKQGDM LVVPEG+A
Sbjct  27   TDGLLKNGNFEMPLAKADLNGTVVLKHNAIPEWSISGFVEYIKAGQKQGDMLLVVPEGYA  86

Query  322  AVRLGNEASIKQTLNVSKGMYYSITFCAARTCAQEERLNITVAPDSGVLPIQTLYSINGW  501
            AVRLGNEASIKQ LNV+KGMYYS+TF AARTCAQEER+N++V PD GVLPIQTLYS +GW
Sbjct  87   AVRLGNEASIKQVLNVTKGMYYSLTFSAARTCAQEERINVSVTPDFGVLPIQTLYSSSGW  146

Query  502  DCYAWAFQ  525
            D YAWAFQ
Sbjct  147  DSYAWAFQ  154



>ref|XP_009771440.1| PREDICTED: uncharacterized protein LOC104221976 [Nicotiana sylvestris]
Length=373

 Score =   220 bits (561),  Expect = 5e-67, Method: Compositional matrix adjust.
 Identities = 98/128 (77%), Positives = 115/128 (90%), Gaps = 0/128 (0%)
 Frame = +1

Query  142  TDGLLVNGNFEAPVKKTDLNGTIVTRHDAVPGWTVTGFVEYIQAGQKQGDMQLVVPEGFA  321
            TDGLL NGNFE P+ K +LNGT+V +H+A+P W+++GFVEYI+AGQKQGDM LVVPEG+A
Sbjct  27   TDGLLKNGNFEMPLAKGNLNGTVVLKHNAIPEWSISGFVEYIKAGQKQGDMLLVVPEGYA  86

Query  322  AVRLGNEASIKQTLNVSKGMYYSITFCAARTCAQEERLNITVAPDSGVLPIQTLYSINGW  501
            AVRLGNEASIKQ LNV+KGMYYS+TF AARTCAQEER+N++V PD GVLPIQTLYS +GW
Sbjct  87   AVRLGNEASIKQVLNVTKGMYYSLTFSAARTCAQEERINVSVTPDFGVLPIQTLYSSSGW  146

Query  502  DCYAWAFQ  525
            D YAWAFQ
Sbjct  147  DSYAWAFQ  154



>ref|XP_004245192.1| PREDICTED: uncharacterized protein LOC101262737 [Solanum lycopersicum]
Length=371

 Score =   217 bits (553),  Expect = 6e-66, Method: Compositional matrix adjust.
 Identities = 98/127 (77%), Positives = 112/127 (88%), Gaps = 0/127 (0%)
 Frame = +1

Query  145  DGLLVNGNFEAPVKKTDLNGTIVTRHDAVPGWTVTGFVEYIQAGQKQGDMQLVVPEGFAA  324
            DGLL NGNFE P  K DLNGT V +H+A+P W+++GFVEYI+AGQKQGDM LVVPEG+AA
Sbjct  26   DGLLKNGNFEMPPSKADLNGTEVLKHNAIPEWSISGFVEYIKAGQKQGDMLLVVPEGYAA  85

Query  325  VRLGNEASIKQTLNVSKGMYYSITFCAARTCAQEERLNITVAPDSGVLPIQTLYSINGWD  504
            VRLGNEASIKQ LNV+KGMYYS+TF AARTCAQEER+N++V PD GVLPIQTLYS +GWD
Sbjct  86   VRLGNEASIKQILNVTKGMYYSLTFSAARTCAQEERINVSVTPDFGVLPIQTLYSSSGWD  145

Query  505  CYAWAFQ  525
             YAWAFQ
Sbjct  146  SYAWAFQ  152



>ref|XP_006364278.1| PREDICTED: uncharacterized protein LOC102598357 [Solanum tuberosum]
Length=371

 Score =   217 bits (553),  Expect = 7e-66, Method: Compositional matrix adjust.
 Identities = 98/127 (77%), Positives = 112/127 (88%), Gaps = 0/127 (0%)
 Frame = +1

Query  145  DGLLVNGNFEAPVKKTDLNGTIVTRHDAVPGWTVTGFVEYIQAGQKQGDMQLVVPEGFAA  324
            DGLL NGNFE P  K DLNGT V +H+A+P W+++GFVEYI+AGQKQGDM LVVPEG+AA
Sbjct  26   DGLLKNGNFEIPPSKADLNGTEVLKHNAIPEWSISGFVEYIKAGQKQGDMLLVVPEGYAA  85

Query  325  VRLGNEASIKQTLNVSKGMYYSITFCAARTCAQEERLNITVAPDSGVLPIQTLYSINGWD  504
            VRLGNEASIKQ LNV+KGMYYS+TF AARTCAQEER+N++V PD GVLPIQTLYS +GWD
Sbjct  86   VRLGNEASIKQILNVTKGMYYSLTFSAARTCAQEERINVSVTPDFGVLPIQTLYSSSGWD  145

Query  505  CYAWAFQ  525
             YAWAFQ
Sbjct  146  SYAWAFQ  152



>ref|XP_011085499.1| PREDICTED: uncharacterized protein LOC105167438 [Sesamum indicum]
Length=369

 Score =   213 bits (543),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 100/127 (79%), Positives = 112/127 (88%), Gaps = 0/127 (0%)
 Frame = +1

Query  145  DGLLVNGNFEAPVKKTDLNGTIVTRHDAVPGWTVTGFVEYIQAGQKQGDMQLVVPEGFAA  324
            DGLL NGNFE   K ++LNGTIV + +A+P W V+GFVEYI+AGQKQGDM LVVPEG+AA
Sbjct  24   DGLLDNGNFEQAPKASELNGTIVLKPNAIPKWRVSGFVEYIKAGQKQGDMLLVVPEGYAA  83

Query  325  VRLGNEASIKQTLNVSKGMYYSITFCAARTCAQEERLNITVAPDSGVLPIQTLYSINGWD  504
            VRLGNEASIKQ+LNVSKGMYYS+TF AARTCAQEERLN++VAP  GVLPIQTLYS NGWD
Sbjct  84   VRLGNEASIKQSLNVSKGMYYSLTFSAARTCAQEERLNVSVAPGFGVLPIQTLYSSNGWD  143

Query  505  CYAWAFQ  525
             YAWAFQ
Sbjct  144  SYAWAFQ  150



>emb|CDP04798.1| unnamed protein product [Coffea canephora]
Length=371

 Score =   212 bits (540),  Expect = 6e-64, Method: Compositional matrix adjust.
 Identities = 97/127 (76%), Positives = 111/127 (87%), Gaps = 0/127 (0%)
 Frame = +1

Query  145  DGLLVNGNFEAPVKKTDLNGTIVTRHDAVPGWTVTGFVEYIQAGQKQGDMQLVVPEGFAA  324
            DGL+ NGNFE   K +DLNGT+V R +AVPGW  +GFVEYI+AGQKQGDM LVVPEG AA
Sbjct  26   DGLMENGNFEIAPKDSDLNGTVVLRQNAVPGWITSGFVEYIKAGQKQGDMILVVPEGHAA  85

Query  325  VRLGNEASIKQTLNVSKGMYYSITFCAARTCAQEERLNITVAPDSGVLPIQTLYSINGWD  504
            +RLGNEASIKQ +NV+KGMYYSITF AARTCAQEE+LN++VAPD GVLP+QTLYS +GWD
Sbjct  86   IRLGNEASIKQKINVTKGMYYSITFSAARTCAQEEQLNVSVAPDFGVLPMQTLYSSSGWD  145

Query  505  CYAWAFQ  525
             YAWAFQ
Sbjct  146  SYAWAFQ  152



>ref|XP_011081926.1| PREDICTED: uncharacterized protein LOC105164832 [Sesamum indicum]
Length=405

 Score =   209 bits (533),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 96/127 (76%), Positives = 111/127 (87%), Gaps = 0/127 (0%)
 Frame = +1

Query  145  DGLLVNGNFEAPVKKTDLNGTIVTRHDAVPGWTVTGFVEYIQAGQKQGDMQLVVPEGFAA  324
            DGLL NGNFE   K ++LNGTIV +  AVP W ++GFVEYI+AGQKQGDM LVVPEG+AA
Sbjct  60   DGLLDNGNFEQAPKSSELNGTIVLKPHAVPKWQISGFVEYIKAGQKQGDMLLVVPEGYAA  119

Query  325  VRLGNEASIKQTLNVSKGMYYSITFCAARTCAQEERLNITVAPDSGVLPIQTLYSINGWD  504
            VRLGNEASIKQ +NV+KGM+YS+TF AARTCAQEER+N++VAPD GVLPIQTLYS NGWD
Sbjct  120  VRLGNEASIKQLINVTKGMFYSLTFSAARTCAQEERVNVSVAPDYGVLPIQTLYSSNGWD  179

Query  505  CYAWAFQ  525
             YAWAF+
Sbjct  180  SYAWAFR  186



>gb|KFK25408.1| hypothetical protein AALP_AA8G110600 [Arabis alpina]
Length=367

 Score =   202 bits (515),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 94/128 (73%), Positives = 110/128 (86%), Gaps = 0/128 (0%)
 Frame = +1

Query  142  TDGLLVNGNFEAPVKKTDLNGTIVTRHDAVPGWTVTGFVEYIQAGQKQGDMQLVVPEGFA  321
            TDG+L NG+FE   K +D+ GT V + +A+P W VTGFVEYI++GQKQGDM LVVP G  
Sbjct  25   TDGMLPNGDFELGPKPSDIKGTKVLKKNAIPSWEVTGFVEYIKSGQKQGDMLLVVPAGKF  84

Query  322  AVRLGNEASIKQTLNVSKGMYYSITFCAARTCAQEERLNITVAPDSGVLPIQTLYSINGW  501
            AVRLGNEASIKQTLNV+KGMYYS+TF AARTCAQ+ERLNI+VAPDSGV+PIQT+YS +GW
Sbjct  85   AVRLGNEASIKQTLNVTKGMYYSLTFSAARTCAQDERLNISVAPDSGVIPIQTVYSSSGW  144

Query  502  DCYAWAFQ  525
            D YAWAFQ
Sbjct  145  DLYAWAFQ  152



>gb|EPS73289.1| hypothetical protein M569_01466, partial [Genlisea aurea]
Length=348

 Score =   201 bits (512),  Expect = 5e-60, Method: Compositional matrix adjust.
 Identities = 90/126 (71%), Positives = 108/126 (86%), Gaps = 0/126 (0%)
 Frame = +1

Query  148  GLLVNGNFEAPVKKTDLNGTIVTRHDAVPGWTVTGFVEYIQAGQKQGDMQLVVPEGFAAV  327
            G L NGNFE P    DLNG+++    A+P W ++GFVEYI+AGQKQGDM LVVPEG+AA+
Sbjct  5    GPLDNGNFEQPPDPKDLNGSVIKTRYAIPKWEISGFVEYIKAGQKQGDMLLVVPEGYAAI  64

Query  328  RLGNEASIKQTLNVSKGMYYSITFCAARTCAQEERLNITVAPDSGVLPIQTLYSINGWDC  507
            RLGNEASIKQ+LNV+ G+YYS+TF AARTCAQEE+LNI+VAPD+GVLP+QTLYS NGWD 
Sbjct  65   RLGNEASIKQSLNVTPGLYYSLTFSAARTCAQEEKLNISVAPDNGVLPVQTLYSSNGWDS  124

Query  508  YAWAFQ  525
            YAWAF+
Sbjct  125  YAWAFR  130



>ref|XP_009345289.1| PREDICTED: uncharacterized protein LOC103937097 [Pyrus x bretschneideri]
Length=369

 Score =   201 bits (511),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 92/127 (72%), Positives = 107/127 (84%), Gaps = 0/127 (0%)
 Frame = +1

Query  145  DGLLVNGNFEAPVKKTDLNGTIVTRHDAVPGWTVTGFVEYIQAGQKQGDMQLVVPEGFAA  324
            DG L NGNFE P K +D+ G+ V    A+P W ++GFVEYI++GQKQGDM LVVPEG  A
Sbjct  28   DGYLENGNFELPPKPSDIKGSEVIGRYAIPKWEISGFVEYIKSGQKQGDMLLVVPEGAYA  87

Query  325  VRLGNEASIKQTLNVSKGMYYSITFCAARTCAQEERLNITVAPDSGVLPIQTLYSINGWD  504
            VRLGNEASIKQ++ V+KG+YYSITF AARTCAQEERLN++VAPDSGVLPIQT+YS NGWD
Sbjct  88   VRLGNEASIKQSIKVTKGLYYSITFSAARTCAQEERLNVSVAPDSGVLPIQTVYSSNGWD  147

Query  505  CYAWAFQ  525
             YAWAFQ
Sbjct  148  SYAWAFQ  154



>ref|XP_004291483.1| PREDICTED: uncharacterized protein LOC101294330 [Fragaria vesca 
subsp. vesca]
Length=368

 Score =   201 bits (511),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 95/127 (75%), Positives = 106/127 (83%), Gaps = 0/127 (0%)
 Frame = +1

Query  145  DGLLVNGNFEAPVKKTDLNGTIVTRHDAVPGWTVTGFVEYIQAGQKQGDMQLVVPEGFAA  324
            DG L NGNFE   K +DL GT V    A+P W ++GFVEYI++GQKQGDM LVVPEG  A
Sbjct  25   DGYLENGNFELAPKPSDLKGTEVIGRYAIPKWEISGFVEYIKSGQKQGDMLLVVPEGAYA  84

Query  325  VRLGNEASIKQTLNVSKGMYYSITFCAARTCAQEERLNITVAPDSGVLPIQTLYSINGWD  504
            VRLGNEASIKQ +NV+KG+YYSITF AARTCAQEERLNI+VAPDSGVLPIQT+YS NGWD
Sbjct  85   VRLGNEASIKQRINVTKGLYYSITFSAARTCAQEERLNISVAPDSGVLPIQTVYSSNGWD  144

Query  505  CYAWAFQ  525
             YAWAFQ
Sbjct  145  SYAWAFQ  151



>ref|XP_009334778.1| PREDICTED: uncharacterized protein LOC103927565 [Pyrus x bretschneideri]
Length=365

 Score =   201 bits (510),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 92/127 (72%), Positives = 107/127 (84%), Gaps = 0/127 (0%)
 Frame = +1

Query  145  DGLLVNGNFEAPVKKTDLNGTIVTRHDAVPGWTVTGFVEYIQAGQKQGDMQLVVPEGFAA  324
            DG L NGNFE P K +D+ G+ V    A+P W ++GFVEYI++GQKQGDM LVVPEG  A
Sbjct  24   DGYLENGNFELPPKPSDIKGSEVIGRYAIPKWEISGFVEYIKSGQKQGDMLLVVPEGAYA  83

Query  325  VRLGNEASIKQTLNVSKGMYYSITFCAARTCAQEERLNITVAPDSGVLPIQTLYSINGWD  504
            VRLGNEASIKQ++ V+KG+YYSITF AARTCAQEERLN++VAPDSGVLPIQT+YS NGWD
Sbjct  84   VRLGNEASIKQSIKVTKGLYYSITFSAARTCAQEERLNVSVAPDSGVLPIQTVYSSNGWD  143

Query  505  CYAWAFQ  525
             YAWAFQ
Sbjct  144  SYAWAFQ  150



>ref|XP_010110340.1| GTP-binding nuclear protein [Morus notabilis]
 gb|EXC26027.1| GTP-binding nuclear protein [Morus notabilis]
Length=573

 Score =   206 bits (523),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 94/126 (75%), Positives = 107/126 (85%), Gaps = 0/126 (0%)
 Frame = +1

Query  145  DGLLVNGNFEAPVKKTDLNGTIVTRHDAVPGWTVTGFVEYIQAGQKQGDMQLVVPEGFAA  324
            DGLL NGNFE   K +DLNGT V    A+P W ++GFVEYI+AGQKQGDM LVVPEG  A
Sbjct  23   DGLLENGNFELAPKASDLNGTEVKGRYAIPEWEISGFVEYIKAGQKQGDMLLVVPEGACA  82

Query  325  VRLGNEASIKQTLNVSKGMYYSITFCAARTCAQEERLNITVAPDSGVLPIQTLYSINGWD  504
            VRLGNEASIKQ LNV+KGM+Y++TFCAARTCAQEERLN++V PDSG+LPIQTLY  NGWD
Sbjct  83   VRLGNEASIKQRLNVTKGMFYALTFCAARTCAQEERLNVSVPPDSGLLPIQTLYGSNGWD  142

Query  505  CYAWAF  522
            CY+WAF
Sbjct  143  CYSWAF  148



>ref|XP_008394047.1| PREDICTED: uncharacterized protein LOC103456171 [Malus domestica]
Length=365

 Score =   201 bits (510),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 91/127 (72%), Positives = 107/127 (84%), Gaps = 0/127 (0%)
 Frame = +1

Query  145  DGLLVNGNFEAPVKKTDLNGTIVTRHDAVPGWTVTGFVEYIQAGQKQGDMQLVVPEGFAA  324
            DG L NGNFE P K +D+ G+ V    A+P W ++GFVEYI++GQKQGDM LVVP+G  A
Sbjct  24   DGYLENGNFELPPKPSDIKGSEVIGRYAIPKWEISGFVEYIKSGQKQGDMLLVVPZGAYA  83

Query  325  VRLGNEASIKQTLNVSKGMYYSITFCAARTCAQEERLNITVAPDSGVLPIQTLYSINGWD  504
            VRLGNEASIKQ++ V+KG+YYSITF AARTCAQEERLN++VAPDSGVLPIQT+YS NGWD
Sbjct  84   VRLGNEASIKQSIKVTKGLYYSITFSAARTCAQEERLNVSVAPDSGVLPIQTVYSSNGWD  143

Query  505  CYAWAFQ  525
             YAWAFQ
Sbjct  144  SYAWAFQ  150



>ref|XP_010048243.1| PREDICTED: uncharacterized protein LOC104437065 [Eucalyptus grandis]
 gb|KCW80448.1| hypothetical protein EUGRSUZ_C01791 [Eucalyptus grandis]
Length=369

 Score =   201 bits (510),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 94/127 (74%), Positives = 106/127 (83%), Gaps = 0/127 (0%)
 Frame = +1

Query  145  DGLLVNGNFEAPVKKTDLNGTIVTRHDAVPGWTVTGFVEYIQAGQKQGDMQLVVPEGFAA  324
            DGL+ NGNFE   K +D+ GT+V    A+P W ++GFVEYI++GQKQGDM LVVPEG  A
Sbjct  25   DGLVPNGNFELAPKPSDMKGTVVIGKYAIPKWEISGFVEYIKSGQKQGDMLLVVPEGAFA  84

Query  325  VRLGNEASIKQTLNVSKGMYYSITFCAARTCAQEERLNITVAPDSGVLPIQTLYSINGWD  504
            VRLGNEASIKQ L V KGMYYSITF AARTCAQEE+LNI+VAPDSGVLP+QTLYS NGWD
Sbjct  85   VRLGNEASIKQRLRVQKGMYYSITFSAARTCAQEEKLNISVAPDSGVLPMQTLYSSNGWD  144

Query  505  CYAWAFQ  525
             YAWAFQ
Sbjct  145  SYAWAFQ  151



>ref|XP_010918669.1| PREDICTED: uncharacterized protein LOC105042950 [Elaeis guineensis]
Length=370

 Score =   200 bits (509),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 91/128 (71%), Positives = 106/128 (83%), Gaps = 0/128 (0%)
 Frame = +1

Query  142  TDGLLVNGNFEAPVKKTDLNGTIVTRHDAVPGWTVTGFVEYIQAGQKQGDMQLVVPEGFA  321
            TDGLL NGNFE    ++ LNGT VT   A+P W ++G VEYI++G KQGDM L VPEG  
Sbjct  23   TDGLLPNGNFEKGPSRSQLNGTQVTSRYAIPEWEISGVVEYIESGHKQGDMLLPVPEGVY  82

Query  322  AVRLGNEASIKQTLNVSKGMYYSITFCAARTCAQEERLNITVAPDSGVLPIQTLYSINGW  501
            AVRLGNEAS+KQ L V+KGMYYSITFCAARTCAQEERLN++V PDSGVLP+QT+YS +GW
Sbjct  83   AVRLGNEASVKQNLKVTKGMYYSITFCAARTCAQEERLNVSVTPDSGVLPMQTMYSSSGW  142

Query  502  DCYAWAFQ  525
            DCYAWAF+
Sbjct  143  DCYAWAFK  150



>emb|CBI20999.3| unnamed protein product [Vitis vinifera]
Length=239

 Score =   196 bits (498),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 95/128 (74%), Positives = 104/128 (81%), Gaps = 0/128 (0%)
 Frame = +1

Query  142  TDGLLVNGNFEAPVKKTDLNGTIVTRHDAVPGWTVTGFVEYIQAGQKQGDMQLVVPEGFA  321
            TDGLL NGNFE   K +D+ GT V    A+P W  +GF+EYI+AGQKQGDM LVVPEG  
Sbjct  22   TDGLLPNGNFELGPKPSDMKGTEVIGPHAIPEWETSGFIEYIKAGQKQGDMLLVVPEGAF  81

Query  322  AVRLGNEASIKQTLNVSKGMYYSITFCAARTCAQEERLNITVAPDSGVLPIQTLYSINGW  501
            AVRLGNEASIKQ + V KGMYYSITF AARTCAQEERLNI+VAPD GVLP+QTLYS NGW
Sbjct  82   AVRLGNEASIKQRVKVIKGMYYSITFSAARTCAQEERLNISVAPDWGVLPMQTLYSSNGW  141

Query  502  DCYAWAFQ  525
            D YAWAFQ
Sbjct  142  DSYAWAFQ  149



>ref|XP_010249980.1| PREDICTED: uncharacterized protein LOC104592350 [Nelumbo nucifera]
Length=369

 Score =   198 bits (504),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 92/127 (72%), Positives = 106/127 (83%), Gaps = 0/127 (0%)
 Frame = +1

Query  145  DGLLVNGNFEAPVKKTDLNGTIVTRHDAVPGWTVTGFVEYIQAGQKQGDMQLVVPEGFAA  324
            DGLL NGNFE   K + + GT+VT   A+P W +TG+VEYI++GQKQGDM LVVPEG  A
Sbjct  25   DGLLPNGNFEYGPKPSQMKGTLVTDAHAIPEWELTGYVEYIKSGQKQGDMLLVVPEGAYA  84

Query  325  VRLGNEASIKQTLNVSKGMYYSITFCAARTCAQEERLNITVAPDSGVLPIQTLYSINGWD  504
            VRLGNEASIKQ + V KGMYYSITF AARTCAQEERLN++VAPDSG+LP+QT+YS NGWD
Sbjct  85   VRLGNEASIKQKVKVIKGMYYSITFSAARTCAQEERLNVSVAPDSGILPMQTMYSSNGWD  144

Query  505  CYAWAFQ  525
             YAWAFQ
Sbjct  145  SYAWAFQ  151



>gb|KDP33619.1| hypothetical protein JCGZ_07190 [Jatropha curcas]
Length=364

 Score =   198 bits (504),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 93/127 (73%), Positives = 106/127 (83%), Gaps = 0/127 (0%)
 Frame = +1

Query  145  DGLLVNGNFEAPVKKTDLNGTIVTRHDAVPGWTVTGFVEYIQAGQKQGDMQLVVPEGFAA  324
            DGL+ NGNFE   K++DLNGT V    A+P W ++GFVEYI++GQKQGDM LVVPEG  A
Sbjct  23   DGLIENGNFELGPKQSDLNGTKVLGRYAIPRWEISGFVEYIKSGQKQGDMLLVVPEGAYA  82

Query  325  VRLGNEASIKQTLNVSKGMYYSITFCAARTCAQEERLNITVAPDSGVLPIQTLYSINGWD  504
            VRLGNEASIKQ L V KGMYYSITF AARTCAQEE LN++V+PDSGVLP+QT+YS NGWD
Sbjct  83   VRLGNEASIKQKLKVIKGMYYSITFSAARTCAQEEALNVSVSPDSGVLPMQTMYSSNGWD  142

Query  505  CYAWAFQ  525
             YAWAFQ
Sbjct  143  SYAWAFQ  149



>ref|XP_007223355.1| hypothetical protein PRUPE_ppa007452mg [Prunus persica]
 gb|EMJ24554.1| hypothetical protein PRUPE_ppa007452mg [Prunus persica]
Length=367

 Score =   198 bits (504),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 93/127 (73%), Positives = 105/127 (83%), Gaps = 0/127 (0%)
 Frame = +1

Query  145  DGLLVNGNFEAPVKKTDLNGTIVTRHDAVPGWTVTGFVEYIQAGQKQGDMQLVVPEGFAA  324
            DG L NGNFE   K +D+ GT V    A+P W ++GFVEYI++GQKQGDM LVVPEG  A
Sbjct  24   DGYLENGNFEEAPKPSDIRGTEVIGRYAIPKWEISGFVEYIKSGQKQGDMLLVVPEGAYA  83

Query  325  VRLGNEASIKQTLNVSKGMYYSITFCAARTCAQEERLNITVAPDSGVLPIQTLYSINGWD  504
            VRLGNEASIKQ + V+KG+YYSITF AARTCAQEERLNI+VAPDSGVLPIQT+YS NGWD
Sbjct  84   VRLGNEASIKQRIKVTKGLYYSITFSAARTCAQEERLNISVAPDSGVLPIQTVYSSNGWD  143

Query  505  CYAWAFQ  525
             YAWAFQ
Sbjct  144  SYAWAFQ  150



>emb|CDX91217.1| BnaC02g03800D [Brassica napus]
Length=366

 Score =   198 bits (503),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 92/127 (72%), Positives = 107/127 (84%), Gaps = 0/127 (0%)
 Frame = +1

Query  145  DGLLVNGNFEAPVKKTDLNGTIVTRHDAVPGWTVTGFVEYIQAGQKQGDMQLVVPEGFAA  324
            DG+L NG+FE   K +D+ GT V   +A+P W +TGFVEYIQ+GQKQGDM LVVP G  A
Sbjct  25   DGMLPNGDFELGPKPSDMKGTQVINKNAIPSWELTGFVEYIQSGQKQGDMLLVVPAGKFA  84

Query  325  VRLGNEASIKQTLNVSKGMYYSITFCAARTCAQEERLNITVAPDSGVLPIQTLYSINGWD  504
            VRLGNEASIKQ LNV+KGMYYS+TF AARTCAQ+ERLNI+VAPDSGV+PIQT+YS +GWD
Sbjct  85   VRLGNEASIKQRLNVTKGMYYSLTFSAARTCAQDERLNISVAPDSGVIPIQTVYSSSGWD  144

Query  505  CYAWAFQ  525
             YAWAFQ
Sbjct  145  LYAWAFQ  151



>ref|XP_006287989.1| hypothetical protein CARUB_v10001222mg [Capsella rubella]
 gb|EOA20887.1| hypothetical protein CARUB_v10001222mg [Capsella rubella]
Length=367

 Score =   198 bits (503),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 92/128 (72%), Positives = 108/128 (84%), Gaps = 0/128 (0%)
 Frame = +1

Query  142  TDGLLVNGNFEAPVKKTDLNGTIVTRHDAVPGWTVTGFVEYIQAGQKQGDMQLVVPEGFA  321
            TDG+L NG+FE   K +DL GT V   +A+P W ++GFVEYI++GQKQGDM LVVP G  
Sbjct  25   TDGMLPNGDFELGPKPSDLKGTQVISKNAIPSWELSGFVEYIKSGQKQGDMLLVVPAGKF  84

Query  322  AVRLGNEASIKQTLNVSKGMYYSITFCAARTCAQEERLNITVAPDSGVLPIQTLYSINGW  501
            AVRLGNEASIKQ LNV+KGMYYS+TF AARTCAQ+ERLNI+VAPDSGV+PIQT+YS +GW
Sbjct  85   AVRLGNEASIKQRLNVTKGMYYSLTFSAARTCAQDERLNISVAPDSGVIPIQTVYSSSGW  144

Query  502  DCYAWAFQ  525
            D YAWAFQ
Sbjct  145  DLYAWAFQ  152



>ref|XP_008775036.1| PREDICTED: uncharacterized protein LOC103695476 [Phoenix dactylifera]
Length=376

 Score =   198 bits (503),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 91/125 (73%), Positives = 103/125 (82%), Gaps = 0/125 (0%)
 Frame = +1

Query  151  LLVNGNFEAPVKKTDLNGTIVTRHDAVPGWTVTGFVEYIQAGQKQGDMQLVVPEGFAAVR  330
            LL NGNFE    ++ LNGT V    A+P W +TGFVEYI++G KQGDM L VPEG  AVR
Sbjct  32   LLPNGNFEKGPSRSQLNGTQVIGRYAIPEWEITGFVEYIESGHKQGDMLLPVPEGVHAVR  91

Query  331  LGNEASIKQTLNVSKGMYYSITFCAARTCAQEERLNITVAPDSGVLPIQTLYSINGWDCY  510
            LGNEASIKQ L V+KGMYYSITFCAARTCAQEERLN++V PDSGVLP+QT+YS +GWDCY
Sbjct  92   LGNEASIKQKLKVTKGMYYSITFCAARTCAQEERLNVSVTPDSGVLPMQTMYSSSGWDCY  151

Query  511  AWAFQ  525
            AWAFQ
Sbjct  152  AWAFQ  156



>ref|XP_010491872.1| PREDICTED: uncharacterized protein LOC104769372 [Camelina sativa]
Length=367

 Score =   197 bits (502),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 91/128 (71%), Positives = 108/128 (84%), Gaps = 0/128 (0%)
 Frame = +1

Query  142  TDGLLVNGNFEAPVKKTDLNGTIVTRHDAVPGWTVTGFVEYIQAGQKQGDMQLVVPEGFA  321
            TDG+L NG+FE   K +D+ GT V   +A+P W ++GFVEYI++GQKQGDM LVVP G  
Sbjct  25   TDGMLPNGDFELGPKPSDMKGTRVINKNAIPSWELSGFVEYIKSGQKQGDMLLVVPAGKF  84

Query  322  AVRLGNEASIKQTLNVSKGMYYSITFCAARTCAQEERLNITVAPDSGVLPIQTLYSINGW  501
            AVRLGNEASIKQ LNV+KGMYYS+TF AARTCAQ+ERLNI+VAPDSGV+PIQT+YS +GW
Sbjct  85   AVRLGNEASIKQRLNVTKGMYYSLTFSAARTCAQDERLNISVAPDSGVIPIQTVYSSSGW  144

Query  502  DCYAWAFQ  525
            D YAWAFQ
Sbjct  145  DLYAWAFQ  152



>ref|XP_010419712.1| PREDICTED: uncharacterized protein LOC104705408 [Camelina sativa]
Length=367

 Score =   197 bits (501),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 91/128 (71%), Positives = 108/128 (84%), Gaps = 0/128 (0%)
 Frame = +1

Query  142  TDGLLVNGNFEAPVKKTDLNGTIVTRHDAVPGWTVTGFVEYIQAGQKQGDMQLVVPEGFA  321
            TDG+L NG+FE   K +D+ GT V   +A+P W ++GFVEYI++GQKQGDM LVVP G  
Sbjct  25   TDGMLPNGDFELGPKPSDMKGTRVINKNAIPSWELSGFVEYIKSGQKQGDMLLVVPAGKF  84

Query  322  AVRLGNEASIKQTLNVSKGMYYSITFCAARTCAQEERLNITVAPDSGVLPIQTLYSINGW  501
            AVRLGNEASIKQ LNV+KGMYYS+TF AARTCAQ+ERLNI+VAPDSGV+PIQT+YS +GW
Sbjct  85   AVRLGNEASIKQRLNVTKGMYYSLTFSAARTCAQDERLNISVAPDSGVIPIQTVYSSSGW  144

Query  502  DCYAWAFQ  525
            D YAWAFQ
Sbjct  145  DLYAWAFQ  152



>emb|CDX85713.1| BnaA02g01000D [Brassica napus]
Length=366

 Score =   197 bits (501),  Expect = 4e-58, Method: Compositional matrix adjust.
 Identities = 91/127 (72%), Positives = 107/127 (84%), Gaps = 0/127 (0%)
 Frame = +1

Query  145  DGLLVNGNFEAPVKKTDLNGTIVTRHDAVPGWTVTGFVEYIQAGQKQGDMQLVVPEGFAA  324
            DG+L NG+FE   K  D+ GT V + +A+P W +TGFVEYI++GQKQGDM LVVP G  A
Sbjct  25   DGMLPNGDFELGPKPADMKGTQVIKKNAIPSWELTGFVEYIKSGQKQGDMLLVVPAGKFA  84

Query  325  VRLGNEASIKQTLNVSKGMYYSITFCAARTCAQEERLNITVAPDSGVLPIQTLYSINGWD  504
            VRLGNEASIKQ LNV+KGMYYS+TF AARTCAQ+ERLNI+VAPDSGV+PIQT+YS +GWD
Sbjct  85   VRLGNEASIKQRLNVTKGMYYSLTFSAARTCAQDERLNISVAPDSGVIPIQTVYSSSGWD  144

Query  505  CYAWAFQ  525
             YAWAFQ
Sbjct  145  LYAWAFQ  151



>ref|XP_002284962.1| PREDICTED: uncharacterized protein LOC100252479 [Vitis vinifera]
Length=368

 Score =   197 bits (501),  Expect = 4e-58, Method: Compositional matrix adjust.
 Identities = 95/128 (74%), Positives = 104/128 (81%), Gaps = 0/128 (0%)
 Frame = +1

Query  142  TDGLLVNGNFEAPVKKTDLNGTIVTRHDAVPGWTVTGFVEYIQAGQKQGDMQLVVPEGFA  321
            TDGLL NGNFE   K +D+ GT V    A+P W  +GF+EYI+AGQKQGDM LVVPEG  
Sbjct  22   TDGLLPNGNFELGPKPSDMKGTEVIGPHAIPEWETSGFIEYIKAGQKQGDMLLVVPEGAF  81

Query  322  AVRLGNEASIKQTLNVSKGMYYSITFCAARTCAQEERLNITVAPDSGVLPIQTLYSINGW  501
            AVRLGNEASIKQ + V KGMYYSITF AARTCAQEERLNI+VAPD GVLP+QTLYS NGW
Sbjct  82   AVRLGNEASIKQRVKVIKGMYYSITFSAARTCAQEERLNISVAPDWGVLPMQTLYSSNGW  141

Query  502  DCYAWAFQ  525
            D YAWAFQ
Sbjct  142  DSYAWAFQ  149



>ref|XP_008378299.1| PREDICTED: uncharacterized protein LOC103441403, partial [Malus 
domestica]
Length=345

 Score =   196 bits (499),  Expect = 5e-58, Method: Compositional matrix adjust.
 Identities = 92/126 (73%), Positives = 104/126 (83%), Gaps = 0/126 (0%)
 Frame = +1

Query  148  GLLVNGNFEAPVKKTDLNGTIVTRHDAVPGWTVTGFVEYIQAGQKQGDMQLVVPEGFAAV  327
            G L NGNFE P K +DL G+ V    A+P W ++GFVEYI++GQKQGDM LVVPEG  AV
Sbjct  5    GYLENGNFELPPKPSDLKGSEVIGRYAIPKWEISGFVEYIKSGQKQGDMLLVVPEGAYAV  64

Query  328  RLGNEASIKQTLNVSKGMYYSITFCAARTCAQEERLNITVAPDSGVLPIQTLYSINGWDC  507
            RLGNEA IKQ++ V KG+YYSITF AARTCAQEERLNI+VAPDSGVLPIQT+YS NGWD 
Sbjct  65   RLGNEALIKQSIKVIKGLYYSITFSAARTCAQEERLNISVAPDSGVLPIQTVYSSNGWDS  124

Query  508  YAWAFQ  525
            YAWAFQ
Sbjct  125  YAWAFQ  130



>ref|XP_010254319.1| PREDICTED: uncharacterized protein LOC104595325 [Nelumbo nucifera]
 ref|XP_010254320.1| PREDICTED: uncharacterized protein LOC104595325 [Nelumbo nucifera]
Length=370

 Score =   197 bits (500),  Expect = 5e-58, Method: Compositional matrix adjust.
 Identities = 92/127 (72%), Positives = 104/127 (82%), Gaps = 0/127 (0%)
 Frame = +1

Query  145  DGLLVNGNFEAPVKKTDLNGTIVTRHDAVPGWTVTGFVEYIQAGQKQGDMQLVVPEGFAA  324
            DGLL NG+FE   K +D+ GT+V    A+P W ++GFVEYI+AGQKQGDM LVVP G  A
Sbjct  26   DGLLPNGDFEYGPKPSDMKGTVVINRHAIPEWELSGFVEYIKAGQKQGDMLLVVPAGEFA  85

Query  325  VRLGNEASIKQTLNVSKGMYYSITFCAARTCAQEERLNITVAPDSGVLPIQTLYSINGWD  504
            VRLGNEASIKQ + V KGMYYSITF AARTCAQEERLN++VAPDSG+LPIQT YS NGWD
Sbjct  86   VRLGNEASIKQKVKVIKGMYYSITFSAARTCAQEERLNVSVAPDSGILPIQTTYSSNGWD  145

Query  505  CYAWAFQ  525
             YAWAFQ
Sbjct  146  SYAWAFQ  152



>ref|XP_008219896.1| PREDICTED: uncharacterized protein LOC103320060 [Prunus mume]
Length=367

 Score =   197 bits (500),  Expect = 6e-58, Method: Compositional matrix adjust.
 Identities = 92/127 (72%), Positives = 104/127 (82%), Gaps = 0/127 (0%)
 Frame = +1

Query  145  DGLLVNGNFEAPVKKTDLNGTIVTRHDAVPGWTVTGFVEYIQAGQKQGDMQLVVPEGFAA  324
            DG L NGNFE   K +D+ GT V    A+P W ++GFVEYI++G KQGDM LVVPEG  A
Sbjct  24   DGYLENGNFEEAPKPSDIRGTEVIGRYAIPKWEISGFVEYIKSGHKQGDMLLVVPEGAYA  83

Query  325  VRLGNEASIKQTLNVSKGMYYSITFCAARTCAQEERLNITVAPDSGVLPIQTLYSINGWD  504
            VRLGNEASIKQ + V+KG+YYSITF AARTCAQEERLNI+VAPDSGVLPIQT+YS NGWD
Sbjct  84   VRLGNEASIKQRIKVTKGLYYSITFSAARTCAQEERLNISVAPDSGVLPIQTVYSSNGWD  143

Query  505  CYAWAFQ  525
             YAWAFQ
Sbjct  144  SYAWAFQ  150



>emb|CDX97108.1| BnaC09g45170D [Brassica napus]
Length=366

 Score =   197 bits (500),  Expect = 6e-58, Method: Compositional matrix adjust.
 Identities = 90/127 (71%), Positives = 106/127 (83%), Gaps = 0/127 (0%)
 Frame = +1

Query  145  DGLLVNGNFEAPVKKTDLNGTIVTRHDAVPGWTVTGFVEYIQAGQKQGDMQLVVPEGFAA  324
            DG+L NG FE   K +D+ GT V   +A+P W ++GF+EYI++GQKQGDM LVVP G  A
Sbjct  25   DGMLPNGGFERGPKPSDMKGTRVINKNAIPNWELSGFIEYIKSGQKQGDMLLVVPAGKFA  84

Query  325  VRLGNEASIKQTLNVSKGMYYSITFCAARTCAQEERLNITVAPDSGVLPIQTLYSINGWD  504
            VRLGNEASIKQ +NV+KGMYYS+TF AARTCAQ+ERLNI+VAPDSGV+PIQTLYS NGWD
Sbjct  85   VRLGNEASIKQRINVTKGMYYSLTFSAARTCAQDERLNISVAPDSGVIPIQTLYSSNGWD  144

Query  505  CYAWAFQ  525
             YAWAFQ
Sbjct  145  LYAWAFQ  151



>ref|XP_009125805.1| PREDICTED: uncharacterized protein LOC103850771 [Brassica rapa]
Length=366

 Score =   196 bits (499),  Expect = 7e-58, Method: Compositional matrix adjust.
 Identities = 91/127 (72%), Positives = 107/127 (84%), Gaps = 0/127 (0%)
 Frame = +1

Query  145  DGLLVNGNFEAPVKKTDLNGTIVTRHDAVPGWTVTGFVEYIQAGQKQGDMQLVVPEGFAA  324
            DG+L NG+FE   K +D+ GT V   +A+P W +TGFVEYI++GQKQGDM LVVP G  A
Sbjct  25   DGMLPNGDFELGPKPSDMKGTQVINKNAIPSWELTGFVEYIKSGQKQGDMLLVVPAGKFA  84

Query  325  VRLGNEASIKQTLNVSKGMYYSITFCAARTCAQEERLNITVAPDSGVLPIQTLYSINGWD  504
            VRLGNEASIKQ LNV+KGMYYS+TF AARTCAQ+ERLNI+VAPDSGV+PIQT+YS +GWD
Sbjct  85   VRLGNEASIKQRLNVTKGMYYSLTFSAARTCAQDERLNISVAPDSGVIPIQTVYSSSGWD  144

Query  505  CYAWAFQ  525
             YAWAFQ
Sbjct  145  LYAWAFQ  151



>ref|XP_009389493.1| PREDICTED: uncharacterized protein LOC103976040 [Musa acuminata 
subsp. malaccensis]
Length=369

 Score =   196 bits (499),  Expect = 7e-58, Method: Compositional matrix adjust.
 Identities = 92/128 (72%), Positives = 104/128 (81%), Gaps = 0/128 (0%)
 Frame = +1

Query  142  TDGLLVNGNFEAPVKKTDLNGTIVTRHDAVPGWTVTGFVEYIQAGQKQGDMQLVVPEGFA  321
            TDGLL NGNFEA  K +DLNGT V    A+P W ++GFVEYI++G KQGDM LVVPEG  
Sbjct  25   TDGLLPNGNFEAKPKASDLNGTQVMSRYAIPQWEISGFVEYIESGHKQGDMLLVVPEGAY  84

Query  322  AVRLGNEASIKQTLNVSKGMYYSITFCAARTCAQEERLNITVAPDSGVLPIQTLYSINGW  501
            AVRLGNEASIKQ L V KGMYYSITF AARTCAQ+ERLN++V PDSG+LPIQT Y  +GW
Sbjct  85   AVRLGNEASIKQKLKVVKGMYYSITFSAARTCAQDERLNVSVTPDSGLLPIQTTYGSDGW  144

Query  502  DCYAWAFQ  525
            D YAWAF+
Sbjct  145  DSYAWAFR  152



>ref|XP_006399646.1| hypothetical protein EUTSA_v10013887mg [Eutrema salsugineum]
 gb|ESQ41099.1| hypothetical protein EUTSA_v10013887mg [Eutrema salsugineum]
Length=366

 Score =   196 bits (499),  Expect = 8e-58, Method: Compositional matrix adjust.
 Identities = 91/127 (72%), Positives = 106/127 (83%), Gaps = 0/127 (0%)
 Frame = +1

Query  145  DGLLVNGNFEAPVKKTDLNGTIVTRHDAVPGWTVTGFVEYIQAGQKQGDMQLVVPEGFAA  324
            DG+L NG+FE   K +D+ GT V    A+P W ++GFVEYI++GQKQGDM LVVP G  A
Sbjct  25   DGMLPNGDFERGPKPSDMKGTQVINKKALPSWELSGFVEYIKSGQKQGDMLLVVPAGKFA  84

Query  325  VRLGNEASIKQTLNVSKGMYYSITFCAARTCAQEERLNITVAPDSGVLPIQTLYSINGWD  504
            VRLGNEASIKQ LNV+KGMYYS+TF AARTCAQ+ERLNI+VAPDSGV+PIQT+YS NGWD
Sbjct  85   VRLGNEASIKQRLNVTKGMYYSLTFSAARTCAQDERLNISVAPDSGVIPIQTVYSSNGWD  144

Query  505  CYAWAFQ  525
             YAWAFQ
Sbjct  145  LYAWAFQ  151



>gb|KHG19965.1| putative e3 ubiquitin-protein ligase hul4 [Gossypium arboreum]
Length=377

 Score =   196 bits (497),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 93/127 (73%), Positives = 104/127 (82%), Gaps = 0/127 (0%)
 Frame = +1

Query  145  DGLLVNGNFEAPVKKTDLNGTIVTRHDAVPGWTVTGFVEYIQAGQKQGDMQLVVPEGFAA  324
            DGLL NGNFE     T++ GT+V    A+PGW   GFVEYI++GQKQGDM LVVPEG  A
Sbjct  33   DGLLENGNFENAPNATNMKGTVVVGRYAIPGWVNEGFVEYIKSGQKQGDMLLVVPEGAYA  92

Query  325  VRLGNEASIKQTLNVSKGMYYSITFCAARTCAQEERLNITVAPDSGVLPIQTLYSINGWD  504
            VRLGNEASIKQ + V KGMYYSITF AARTCAQEERLN+TVAPDSGVLPIQT+YS +GWD
Sbjct  93   VRLGNEASIKQKIKVIKGMYYSITFSAARTCAQEERLNVTVAPDSGVLPIQTVYSSSGWD  152

Query  505  CYAWAFQ  525
             YAWAF+
Sbjct  153  NYAWAFK  159



>gb|AAN31807.1| unknown protein [Arabidopsis thaliana]
Length=366

 Score =   195 bits (496),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 89/128 (70%), Positives = 107/128 (84%), Gaps = 0/128 (0%)
 Frame = +1

Query  142  TDGLLVNGNFEAPVKKTDLNGTIVTRHDAVPGWTVTGFVEYIQAGQKQGDMQLVVPEGFA  321
            +DG+L NG+FE   K +D+ GT V    A+P W ++GFVEYI++GQKQGDM LVVP G  
Sbjct  24   SDGMLPNGDFELGPKPSDMKGTQVINKKAIPSWELSGFVEYIKSGQKQGDMLLVVPAGKF  83

Query  322  AVRLGNEASIKQTLNVSKGMYYSITFCAARTCAQEERLNITVAPDSGVLPIQTLYSINGW  501
            A+RLGNEASIKQ LNV+KGMYYS+TF AARTCAQ+ERLNI+VAPDSGV+PIQT+YS +GW
Sbjct  84   AIRLGNEASIKQRLNVTKGMYYSLTFSAARTCAQDERLNISVAPDSGVIPIQTVYSSSGW  143

Query  502  DCYAWAFQ  525
            D YAWAFQ
Sbjct  144  DLYAWAFQ  151



>ref|XP_010453190.1| PREDICTED: uncharacterized protein LOC104735158 [Camelina sativa]
Length=367

 Score =   195 bits (496),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 90/128 (70%), Positives = 107/128 (84%), Gaps = 0/128 (0%)
 Frame = +1

Query  142  TDGLLVNGNFEAPVKKTDLNGTIVTRHDAVPGWTVTGFVEYIQAGQKQGDMQLVVPEGFA  321
            TD +L NG+FE   K +D+ GT V   +A+P W ++GFVEYI++GQKQGDM LVVP G  
Sbjct  25   TDAMLPNGDFELGPKPSDMKGTRVINKNAIPSWELSGFVEYIKSGQKQGDMLLVVPAGKF  84

Query  322  AVRLGNEASIKQTLNVSKGMYYSITFCAARTCAQEERLNITVAPDSGVLPIQTLYSINGW  501
            AVRLGNEASIKQ LNV+KGMYYS+TF AARTCAQ+ERLNI+VAPDSGV+PIQT+YS +GW
Sbjct  85   AVRLGNEASIKQRLNVTKGMYYSLTFSAARTCAQDERLNISVAPDSGVIPIQTVYSSSGW  144

Query  502  DCYAWAFQ  525
            D YAWAFQ
Sbjct  145  DLYAWAFQ  152



>ref|NP_196703.1| uncharacterized protein [Arabidopsis thaliana]
 emb|CAB87702.1| putative protein [Arabidopsis thaliana]
 gb|AAK76721.1| unknown protein [Arabidopsis thaliana]
 gb|AAM20000.1| unknown protein [Arabidopsis thaliana]
 gb|AED91677.1| uncharacterized protein AT5G11420 [Arabidopsis thaliana]
Length=366

 Score =   195 bits (496),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 89/128 (70%), Positives = 107/128 (84%), Gaps = 0/128 (0%)
 Frame = +1

Query  142  TDGLLVNGNFEAPVKKTDLNGTIVTRHDAVPGWTVTGFVEYIQAGQKQGDMQLVVPEGFA  321
            +DG+L NG+FE   K +D+ GT V    A+P W ++GFVEYI++GQKQGDM LVVP G  
Sbjct  24   SDGMLPNGDFELGPKPSDMKGTQVINKKAIPSWELSGFVEYIKSGQKQGDMLLVVPAGKF  83

Query  322  AVRLGNEASIKQTLNVSKGMYYSITFCAARTCAQEERLNITVAPDSGVLPIQTLYSINGW  501
            A+RLGNEASIKQ LNV+KGMYYS+TF AARTCAQ+ERLNI+VAPDSGV+PIQT+YS +GW
Sbjct  84   AIRLGNEASIKQRLNVTKGMYYSLTFSAARTCAQDERLNISVAPDSGVIPIQTVYSSSGW  143

Query  502  DCYAWAFQ  525
            D YAWAFQ
Sbjct  144  DLYAWAFQ  151



>gb|AAM63507.1| unknown [Arabidopsis thaliana]
Length=366

 Score =   195 bits (496),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 89/128 (70%), Positives = 107/128 (84%), Gaps = 0/128 (0%)
 Frame = +1

Query  142  TDGLLVNGNFEAPVKKTDLNGTIVTRHDAVPGWTVTGFVEYIQAGQKQGDMQLVVPEGFA  321
            +DG+L NG+FE   K +D+ GT V    A+P W ++GFVEYI++GQKQGDM LVVP G  
Sbjct  24   SDGMLPNGDFELGPKPSDMKGTQVINKKAIPSWELSGFVEYIKSGQKQGDMLLVVPAGKF  83

Query  322  AVRLGNEASIKQTLNVSKGMYYSITFCAARTCAQEERLNITVAPDSGVLPIQTLYSINGW  501
            A+RLGNEASIKQ LNV+KGMYYS+TF AARTCAQ+ERLNI+VAPDSGV+PIQT+YS +GW
Sbjct  84   AIRLGNEASIKQRLNVTKGMYYSLTFSAARTCAQDERLNISVAPDSGVIPIQTVYSSSGW  143

Query  502  DCYAWAFQ  525
            D YAWAFQ
Sbjct  144  DLYAWAFQ  151



>ref|XP_009121952.1| PREDICTED: uncharacterized protein LOC103846721 [Brassica rapa]
Length=366

 Score =   195 bits (495),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 90/127 (71%), Positives = 105/127 (83%), Gaps = 0/127 (0%)
 Frame = +1

Query  145  DGLLVNGNFEAPVKKTDLNGTIVTRHDAVPGWTVTGFVEYIQAGQKQGDMQLVVPEGFAA  324
            DG+L NG FE   K +DL GT V   +A+P W ++GF+EYI++GQKQGDM LVVP G  A
Sbjct  25   DGMLPNGGFERGPKPSDLKGTRVINKNAIPNWELSGFIEYIKSGQKQGDMLLVVPAGKFA  84

Query  325  VRLGNEASIKQTLNVSKGMYYSITFCAARTCAQEERLNITVAPDSGVLPIQTLYSINGWD  504
            VRLGNEASIKQ +NV+KGMYYS+TF AARTCAQ+ERLNI+VAPDSGV+PIQTLYS NGWD
Sbjct  85   VRLGNEASIKQRVNVTKGMYYSLTFSAARTCAQDERLNISVAPDSGVIPIQTLYSSNGWD  144

Query  505  CYAWAFQ  525
             YAWA Q
Sbjct  145  LYAWALQ  151



>ref|XP_002871473.1| hypothetical protein ARALYDRAFT_487977 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH47732.1| hypothetical protein ARALYDRAFT_487977 [Arabidopsis lyrata subsp. 
lyrata]
Length=366

 Score =   194 bits (494),  Expect = 4e-57, Method: Compositional matrix adjust.
 Identities = 88/128 (69%), Positives = 108/128 (84%), Gaps = 0/128 (0%)
 Frame = +1

Query  142  TDGLLVNGNFEAPVKKTDLNGTIVTRHDAVPGWTVTGFVEYIQAGQKQGDMQLVVPEGFA  321
            +DG++ NG+FE   K +D+ GT V   +A+P W ++GFVEYI++GQKQGDM LVVP G  
Sbjct  24   SDGMVPNGDFELGPKPSDMKGTQVINKNAIPSWELSGFVEYIKSGQKQGDMLLVVPAGKF  83

Query  322  AVRLGNEASIKQTLNVSKGMYYSITFCAARTCAQEERLNITVAPDSGVLPIQTLYSINGW  501
            A+RLGNEASIKQ LNV+KGMYYS+TF AARTCAQ+ERLNI+VAPDSGV+PIQT+YS +GW
Sbjct  84   AIRLGNEASIKQRLNVTKGMYYSLTFSAARTCAQDERLNISVAPDSGVIPIQTVYSSSGW  143

Query  502  DCYAWAFQ  525
            D YAWAFQ
Sbjct  144  DLYAWAFQ  151



>ref|XP_008445161.1| PREDICTED: uncharacterized protein LOC103488281 [Cucumis melo]
Length=422

 Score =   196 bits (498),  Expect = 4e-57, Method: Compositional matrix adjust.
 Identities = 91/128 (71%), Positives = 105/128 (82%), Gaps = 0/128 (0%)
 Frame = +1

Query  142  TDGLLVNGNFEAPVKKTDLNGTIVTRHDAVPGWTVTGFVEYIQAGQKQGDMQLVVPEGFA  321
             DG L NG+FE   K +D+NGT+V    A+P W ++GFVEYI++GQKQGDM LVVPEG  
Sbjct  78   VDGYLPNGDFERGPKASDMNGTVVKGPYAIPEWEISGFVEYIKSGQKQGDMLLVVPEGAF  137

Query  322  AVRLGNEASIKQTLNVSKGMYYSITFCAARTCAQEERLNITVAPDSGVLPIQTLYSINGW  501
            AVRLGNEASIKQ + V KG+YYSITF AARTCAQEERLNI+VAPD GVLP+QTLY+ NGW
Sbjct  138  AVRLGNEASIKQKIKVVKGLYYSITFSAARTCAQEERLNISVAPDWGVLPMQTLYNSNGW  197

Query  502  DCYAWAFQ  525
            D YAWAFQ
Sbjct  198  DLYAWAFQ  205



>gb|KJB07802.1| hypothetical protein B456_001G045200 [Gossypium raimondii]
Length=377

 Score =   195 bits (495),  Expect = 4e-57, Method: Compositional matrix adjust.
 Identities = 92/127 (72%), Positives = 104/127 (82%), Gaps = 0/127 (0%)
 Frame = +1

Query  145  DGLLVNGNFEAPVKKTDLNGTIVTRHDAVPGWTVTGFVEYIQAGQKQGDMQLVVPEGFAA  324
            DGLL NGNFE     T++ GT+V    ++PGW   GFVEYI++GQKQGDM LVVPEG  A
Sbjct  33   DGLLENGNFENAPNATNMKGTVVVGRYSIPGWVNEGFVEYIKSGQKQGDMLLVVPEGAYA  92

Query  325  VRLGNEASIKQTLNVSKGMYYSITFCAARTCAQEERLNITVAPDSGVLPIQTLYSINGWD  504
            VRLGNEASIKQ + V KGMYYSITF AARTCAQEERLN+TVAPDSGVLPIQT+YS +GWD
Sbjct  93   VRLGNEASIKQKIKVIKGMYYSITFSAARTCAQEERLNVTVAPDSGVLPIQTVYSSSGWD  152

Query  505  CYAWAFQ  525
             YAWAF+
Sbjct  153  NYAWAFK  159



>gb|KJB80693.1| hypothetical protein B456_013G110800 [Gossypium raimondii]
Length=369

 Score =   194 bits (493),  Expect = 6e-57, Method: Compositional matrix adjust.
 Identities = 91/127 (72%), Positives = 104/127 (82%), Gaps = 0/127 (0%)
 Frame = +1

Query  145  DGLLVNGNFEAPVKKTDLNGTIVTRHDAVPGWTVTGFVEYIQAGQKQGDMQLVVPEGFAA  324
            DGLL NGNFE     +++ GT+V    A+PGW   GFVEYI++GQKQGDM LVVPEG  A
Sbjct  28   DGLLDNGNFEQAPNASNMKGTVVVGRYAIPGWVNEGFVEYIKSGQKQGDMLLVVPEGAYA  87

Query  325  VRLGNEASIKQTLNVSKGMYYSITFCAARTCAQEERLNITVAPDSGVLPIQTLYSINGWD  504
            VRLGNEASIKQ + V KGMYYSITF AARTCAQEERLN+TVAPDSGV+PIQT+YS +GWD
Sbjct  88   VRLGNEASIKQEIKVVKGMYYSITFSAARTCAQEERLNVTVAPDSGVMPIQTVYSSSGWD  147

Query  505  CYAWAFQ  525
             YAWAF+
Sbjct  148  NYAWAFK  154



>gb|EYU21948.1| hypothetical protein MIMGU_mgv1a0096341mg [Erythranthe guttata]
Length=336

 Score =   192 bits (489),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 87/113 (77%), Positives = 101/113 (89%), Gaps = 0/113 (0%)
 Frame = +1

Query  187  KTDLNGTIVTRHDAVPGWTVTGFVEYIQAGQKQGDMQLVVPEGFAAVRLGNEASIKQTLN  366
            K+DLNGTIV +  A+P W ++GFVEYI+AGQKQGDM LVVPEG+AAVRLGNEAS+KQ +N
Sbjct  5    KSDLNGTIVLKPHAIPKWQISGFVEYIKAGQKQGDMLLVVPEGYAAVRLGNEASVKQYVN  64

Query  367  VSKGMYYSITFCAARTCAQEERLNITVAPDSGVLPIQTLYSINGWDCYAWAFQ  525
            V+KGMYYSITF AARTCAQEE +N++VAPD GVLPIQTLYS NGWD YAWAF+
Sbjct  65   VTKGMYYSITFSAARTCAQEEMVNVSVAPDFGVLPIQTLYSSNGWDSYAWAFR  117



>gb|KJB07801.1| hypothetical protein B456_001G045200 [Gossypium raimondii]
Length=372

 Score =   193 bits (491),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 91/128 (71%), Positives = 105/128 (82%), Gaps = 0/128 (0%)
 Frame = +1

Query  142  TDGLLVNGNFEAPVKKTDLNGTIVTRHDAVPGWTVTGFVEYIQAGQKQGDMQLVVPEGFA  321
            ++GLL NGNFE     T++ GT+V    ++PGW   GFVEYI++GQKQGDM LVVPEG  
Sbjct  27   SNGLLENGNFENAPNATNMKGTVVVGRYSIPGWVNEGFVEYIKSGQKQGDMLLVVPEGAY  86

Query  322  AVRLGNEASIKQTLNVSKGMYYSITFCAARTCAQEERLNITVAPDSGVLPIQTLYSINGW  501
            AVRLGNEASIKQ + V KGMYYSITF AARTCAQEERLN+TVAPDSGVLPIQT+YS +GW
Sbjct  87   AVRLGNEASIKQKIKVIKGMYYSITFSAARTCAQEERLNVTVAPDSGVLPIQTVYSSSGW  146

Query  502  DCYAWAFQ  525
            D YAWAF+
Sbjct  147  DNYAWAFK  154



>ref|XP_007013814.1| Uncharacterized protein isoform 2 [Theobroma cacao]
 gb|EOY31433.1| Uncharacterized protein isoform 2 [Theobroma cacao]
Length=375

 Score =   193 bits (491),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 91/127 (72%), Positives = 103/127 (81%), Gaps = 0/127 (0%)
 Frame = +1

Query  145  DGLLVNGNFEAPVKKTDLNGTIVTRHDAVPGWTVTGFVEYIQAGQKQGDMQLVVPEGFAA  324
            DGLL NGNFE     T++ GT+V    A+PGW   GFVEYI++GQKQGDM LVVPEG  A
Sbjct  34   DGLLDNGNFERAPNATNMKGTVVVGRYAIPGWINEGFVEYIKSGQKQGDMLLVVPEGAYA  93

Query  325  VRLGNEASIKQTLNVSKGMYYSITFCAARTCAQEERLNITVAPDSGVLPIQTLYSINGWD  504
            VRLGN+ASIKQ + V  G+YYSITF AARTCAQEERLN+TVAPDSGVLPIQT+YS NGWD
Sbjct  94   VRLGNDASIKQAIKVIVGLYYSITFSAARTCAQEERLNVTVAPDSGVLPIQTVYSSNGWD  153

Query  505  CYAWAFQ  525
             YAWAF+
Sbjct  154  SYAWAFK  160



>ref|XP_011019761.1| PREDICTED: uncharacterized protein LOC105122382 [Populus euphratica]
Length=365

 Score =   193 bits (490),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 90/127 (71%), Positives = 105/127 (83%), Gaps = 0/127 (0%)
 Frame = +1

Query  145  DGLLVNGNFEAPVKKTDLNGTIVTRHDAVPGWTVTGFVEYIQAGQKQGDMQLVVPEGFAA  324
            DGL+ NGNFE   K +DL GT +    A+P W ++GFVEYI+AGQKQGDM LVVPEG  A
Sbjct  24   DGLVENGNFEVGPKPSDLKGTEMIGRYALPKWEISGFVEYIKAGQKQGDMLLVVPEGAYA  83

Query  325  VRLGNEASIKQTLNVSKGMYYSITFCAARTCAQEERLNITVAPDSGVLPIQTLYSINGWD  504
            VRLGNEASIKQ LNV+KGMYYSITF AARTCAQEE LNI+++P+ GVLP+QT+YS NGWD
Sbjct  84   VRLGNEASIKQVLNVTKGMYYSITFSAARTCAQEEELNISISPEWGVLPMQTMYSSNGWD  143

Query  505  CYAWAFQ  525
             YAWAF+
Sbjct  144  SYAWAFK  150



>ref|XP_002515557.1| conserved hypothetical protein [Ricinus communis]
 emb|CAB02653.1| unknown [Ricinus communis]
 gb|EEF47006.1| conserved hypothetical protein [Ricinus communis]
Length=364

 Score =   193 bits (490),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 89/127 (70%), Positives = 105/127 (83%), Gaps = 0/127 (0%)
 Frame = +1

Query  145  DGLLVNGNFEAPVKKTDLNGTIVTRHDAVPGWTVTGFVEYIQAGQKQGDMQLVVPEGFAA  324
            DGL+ NGNFE   K +D+ GT V   +A+P W ++GFVEYI++GQKQGDM LVVPEG  A
Sbjct  23   DGLVKNGNFELAPKPSDMKGTQVIGKNAIPEWEISGFVEYIKSGQKQGDMLLVVPEGAYA  82

Query  325  VRLGNEASIKQTLNVSKGMYYSITFCAARTCAQEERLNITVAPDSGVLPIQTLYSINGWD  504
            VRLGNEASIKQ + V KGMYYSITF AARTCAQEE+LN++V+PD GVLP+QT+YS NGWD
Sbjct  83   VRLGNEASIKQRMRVIKGMYYSITFSAARTCAQEEKLNVSVSPDWGVLPMQTMYSSNGWD  142

Query  505  CYAWAFQ  525
             YAWAFQ
Sbjct  143  SYAWAFQ  149



>ref|XP_004138737.1| PREDICTED: uncharacterized protein LOC101219952 [Cucumis sativus]
 ref|XP_004164530.1| PREDICTED: uncharacterized protein LOC101227825 [Cucumis sativus]
 gb|KGN62919.1| hypothetical protein Csa_2G379990 [Cucumis sativus]
Length=368

 Score =   193 bits (490),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 90/128 (70%), Positives = 104/128 (81%), Gaps = 0/128 (0%)
 Frame = +1

Query  142  TDGLLVNGNFEAPVKKTDLNGTIVTRHDAVPGWTVTGFVEYIQAGQKQGDMQLVVPEGFA  321
             DG L NG+FE     +D+NGT+V    A+P W ++GFVEYI++GQKQGDM LVVPEG  
Sbjct  24   VDGYLPNGDFERGPNASDMNGTVVKGPYAIPEWEISGFVEYIKSGQKQGDMLLVVPEGAF  83

Query  322  AVRLGNEASIKQTLNVSKGMYYSITFCAARTCAQEERLNITVAPDSGVLPIQTLYSINGW  501
            AVRLGNEASIKQ + V KG+YYSITF AARTCAQEERLNI+VAPD GVLP+QTLY+ NGW
Sbjct  84   AVRLGNEASIKQKIKVVKGLYYSITFSAARTCAQEERLNISVAPDWGVLPMQTLYNSNGW  143

Query  502  DCYAWAFQ  525
            D YAWAFQ
Sbjct  144  DLYAWAFQ  151



>ref|XP_009401767.1| PREDICTED: uncharacterized protein LOC103985700 [Musa acuminata 
subsp. malaccensis]
Length=368

 Score =   192 bits (489),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 90/128 (70%), Positives = 104/128 (81%), Gaps = 0/128 (0%)
 Frame = +1

Query  142  TDGLLVNGNFEAPVKKTDLNGTIVTRHDAVPGWTVTGFVEYIQAGQKQGDMQLVVPEGFA  321
            TDGLL NGNFEA  K +++NGT V    A+P W ++GFVEYI++G KQGDM LVVPEG  
Sbjct  23   TDGLLPNGNFEATPKASEMNGTQVLGRYAIPQWEISGFVEYIESGHKQGDMLLVVPEGAY  82

Query  322  AVRLGNEASIKQTLNVSKGMYYSITFCAARTCAQEERLNITVAPDSGVLPIQTLYSINGW  501
            AVRLGNEASIKQ L V KGMYYSITF AARTCAQ+ERLN++V PDSG+LPIQT+Y   GW
Sbjct  83   AVRLGNEASIKQKLTVVKGMYYSITFSAARTCAQDERLNVSVTPDSGMLPIQTMYGSVGW  142

Query  502  DCYAWAFQ  525
            D YAWAF+
Sbjct  143  DSYAWAFR  150



>ref|XP_007013813.1| Uncharacterized protein isoform 1 [Theobroma cacao]
 gb|EOY31432.1| Uncharacterized protein isoform 1 [Theobroma cacao]
Length=412

 Score =   194 bits (492),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 91/127 (72%), Positives = 103/127 (81%), Gaps = 0/127 (0%)
 Frame = +1

Query  145  DGLLVNGNFEAPVKKTDLNGTIVTRHDAVPGWTVTGFVEYIQAGQKQGDMQLVVPEGFAA  324
            DGLL NGNFE     T++ GT+V    A+PGW   GFVEYI++GQKQGDM LVVPEG  A
Sbjct  71   DGLLDNGNFERAPNATNMKGTVVVGRYAIPGWINEGFVEYIKSGQKQGDMLLVVPEGAYA  130

Query  325  VRLGNEASIKQTLNVSKGMYYSITFCAARTCAQEERLNITVAPDSGVLPIQTLYSINGWD  504
            VRLGN+ASIKQ + V  G+YYSITF AARTCAQEERLN+TVAPDSGVLPIQT+YS NGWD
Sbjct  131  VRLGNDASIKQAIKVIVGLYYSITFSAARTCAQEERLNVTVAPDSGVLPIQTVYSSNGWD  190

Query  505  CYAWAFQ  525
             YAWAF+
Sbjct  191  SYAWAFK  197



>ref|XP_006399647.1| hypothetical protein EUTSA_v10013887mg [Eutrema salsugineum]
 gb|ESQ41100.1| hypothetical protein EUTSA_v10013887mg [Eutrema salsugineum]
Length=340

 Score =   192 bits (487),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 89/125 (71%), Positives = 104/125 (83%), Gaps = 0/125 (0%)
 Frame = +1

Query  151  LLVNGNFEAPVKKTDLNGTIVTRHDAVPGWTVTGFVEYIQAGQKQGDMQLVVPEGFAAVR  330
            +L NG+FE   K +D+ GT V    A+P W ++GFVEYI++GQKQGDM LVVP G  AVR
Sbjct  1    MLPNGDFERGPKPSDMKGTQVINKKALPSWELSGFVEYIKSGQKQGDMLLVVPAGKFAVR  60

Query  331  LGNEASIKQTLNVSKGMYYSITFCAARTCAQEERLNITVAPDSGVLPIQTLYSINGWDCY  510
            LGNEASIKQ LNV+KGMYYS+TF AARTCAQ+ERLNI+VAPDSGV+PIQT+YS NGWD Y
Sbjct  61   LGNEASIKQRLNVTKGMYYSLTFSAARTCAQDERLNISVAPDSGVIPIQTVYSSNGWDLY  120

Query  511  AWAFQ  525
            AWAFQ
Sbjct  121  AWAFQ  125



>gb|KHG29602.1| Allergen Act d 3 [Gossypium arboreum]
Length=369

 Score =   192 bits (488),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 90/127 (71%), Positives = 104/127 (82%), Gaps = 0/127 (0%)
 Frame = +1

Query  145  DGLLVNGNFEAPVKKTDLNGTIVTRHDAVPGWTVTGFVEYIQAGQKQGDMQLVVPEGFAA  324
            +GLL NGNFE     +++ GT+V    A+PGW   GFVEYI++GQKQGDM LVVPEG  A
Sbjct  28   EGLLDNGNFEQAPNASNMKGTVVVGRYAIPGWVNEGFVEYIKSGQKQGDMLLVVPEGAYA  87

Query  325  VRLGNEASIKQTLNVSKGMYYSITFCAARTCAQEERLNITVAPDSGVLPIQTLYSINGWD  504
            VRLGNEASIKQ + V KGMYYSITF AARTCAQEERLN+TVAPDSGV+PIQT+YS +GWD
Sbjct  88   VRLGNEASIKQEIKVVKGMYYSITFSAARTCAQEERLNVTVAPDSGVMPIQTVYSSSGWD  147

Query  505  CYAWAFQ  525
             YAWAF+
Sbjct  148  NYAWAFK  154



>gb|ABK94923.1| unknown [Populus trichocarpa]
Length=365

 Score =   191 bits (486),  Expect = 7e-56, Method: Compositional matrix adjust.
 Identities = 89/127 (70%), Positives = 105/127 (83%), Gaps = 0/127 (0%)
 Frame = +1

Query  145  DGLLVNGNFEAPVKKTDLNGTIVTRHDAVPGWTVTGFVEYIQAGQKQGDMQLVVPEGFAA  324
            DGL+ NGNFE   K ++L GT +    A+P W ++GFVEYI+AGQKQGDM LVVPEG  A
Sbjct  24   DGLVENGNFEVGPKPSELKGTEMIGRYALPKWEISGFVEYIKAGQKQGDMLLVVPEGAYA  83

Query  325  VRLGNEASIKQTLNVSKGMYYSITFCAARTCAQEERLNITVAPDSGVLPIQTLYSINGWD  504
            VRLGNEASIKQ LNV+KGMYYSITF AARTCAQEE LNI+++P+ GVLP+QT+YS NGWD
Sbjct  84   VRLGNEASIKQVLNVTKGMYYSITFSAARTCAQEEELNISISPEWGVLPMQTMYSSNGWD  143

Query  505  CYAWAFQ  525
             YAWAF+
Sbjct  144  SYAWAFK  150



>gb|AAM61720.1| unknown [Arabidopsis thaliana]
Length=369

 Score =   191 bits (486),  Expect = 8e-56, Method: Compositional matrix adjust.
 Identities = 89/127 (70%), Positives = 103/127 (81%), Gaps = 0/127 (0%)
 Frame = +1

Query  145  DGLLVNGNFEAPVKKTDLNGTIVTRHDAVPGWTVTGFVEYIQAGQKQGDMQLVVPEGFAA  324
            DG+L NG+FE   K +D+ GT +    A+P W VTGFVEYI++G KQGDM LVVP G  A
Sbjct  28   DGMLPNGDFELGPKPSDMKGTEILNKLAIPNWEVTGFVEYIKSGHKQGDMLLVVPAGKFA  87

Query  325  VRLGNEASIKQTLNVSKGMYYSITFCAARTCAQEERLNITVAPDSGVLPIQTLYSINGWD  504
            VRLGNEASIKQ L V KGMYYS+TF AARTCAQ+ERLNI+VAPDSGV+PIQT+YS +GWD
Sbjct  88   VRLGNEASIKQRLKVVKGMYYSLTFSAARTCAQDERLNISVAPDSGVIPIQTVYSSSGWD  147

Query  505  CYAWAFQ  525
             YAWAFQ
Sbjct  148  LYAWAFQ  154



>ref|NP_197928.1| UF642 l-GalL-responsive protein 1 [Arabidopsis thaliana]
 gb|AAK62407.1|AF386962_1 Unknown protein [Arabidopsis thaliana]
 gb|AAP37805.1| At5g25460 [Arabidopsis thaliana]
 gb|AED93446.1| uncharacterized protein AT5G25460 [Arabidopsis thaliana]
Length=369

 Score =   191 bits (485),  Expect = 8e-56, Method: Compositional matrix adjust.
 Identities = 89/127 (70%), Positives = 103/127 (81%), Gaps = 0/127 (0%)
 Frame = +1

Query  145  DGLLVNGNFEAPVKKTDLNGTIVTRHDAVPGWTVTGFVEYIQAGQKQGDMQLVVPEGFAA  324
            DG+L NG+FE   K +D+ GT +    A+P W VTGFVEYI++G KQGDM LVVP G  A
Sbjct  28   DGMLPNGDFELGPKPSDMKGTEILNKLAIPNWEVTGFVEYIKSGHKQGDMLLVVPAGKFA  87

Query  325  VRLGNEASIKQTLNVSKGMYYSITFCAARTCAQEERLNITVAPDSGVLPIQTLYSINGWD  504
            VRLGNEASIKQ L V KGMYYS+TF AARTCAQ+ERLNI+VAPDSGV+PIQT+YS +GWD
Sbjct  88   VRLGNEASIKQRLKVVKGMYYSLTFSAARTCAQDERLNISVAPDSGVIPIQTVYSSSGWD  147

Query  505  CYAWAFQ  525
             YAWAFQ
Sbjct  148  LYAWAFQ  154



>ref|XP_011019764.1| PREDICTED: uncharacterized protein LOC105122387 [Populus euphratica]
Length=343

 Score =   191 bits (484),  Expect = 8e-56, Method: Compositional matrix adjust.
 Identities = 89/126 (71%), Positives = 104/126 (83%), Gaps = 0/126 (0%)
 Frame = +1

Query  148  GLLVNGNFEAPVKKTDLNGTIVTRHDAVPGWTVTGFVEYIQAGQKQGDMQLVVPEGFAAV  327
            GL+ NGNFE   K +DL GT +    A+P W ++GFVEYI+AGQKQGDM LVVPEG  AV
Sbjct  3    GLVENGNFEVGPKPSDLKGTEMIGRYALPKWEISGFVEYIKAGQKQGDMLLVVPEGAYAV  62

Query  328  RLGNEASIKQTLNVSKGMYYSITFCAARTCAQEERLNITVAPDSGVLPIQTLYSINGWDC  507
            RLGNEASIKQ LNV+KGMYYSITF AARTCAQEE LNI+++P+ GVLP+QT+YS NGWD 
Sbjct  63   RLGNEASIKQVLNVTKGMYYSITFSAARTCAQEEELNISISPEWGVLPMQTMYSSNGWDS  122

Query  508  YAWAFQ  525
            YAWAF+
Sbjct  123  YAWAFK  128



>gb|AAL06839.1| AT5g25460/F18G18_200 [Arabidopsis thaliana]
Length=369

 Score =   191 bits (485),  Expect = 8e-56, Method: Compositional matrix adjust.
 Identities = 89/127 (70%), Positives = 103/127 (81%), Gaps = 0/127 (0%)
 Frame = +1

Query  145  DGLLVNGNFEAPVKKTDLNGTIVTRHDAVPGWTVTGFVEYIQAGQKQGDMQLVVPEGFAA  324
            DG+L NG+FE   K +D+ GT +    A+P W VTGFVEYI++G KQGDM LVVP G  A
Sbjct  28   DGMLPNGDFELGPKPSDMKGTEILNKLAIPNWEVTGFVEYIKSGHKQGDMLLVVPAGKFA  87

Query  325  VRLGNEASIKQTLNVSKGMYYSITFCAARTCAQEERLNITVAPDSGVLPIQTLYSINGWD  504
            VRLGNEASIKQ L V KGMYYS+TF AARTCAQ+ERLNI+VAPDSGV+PIQT+YS +GWD
Sbjct  88   VRLGNEASIKQRLKVVKGMYYSLTFSAARTCAQDERLNISVAPDSGVIPIQTVYSSSGWD  147

Query  505  CYAWAFQ  525
             YAWAFQ
Sbjct  148  LYAWAFQ  154



>ref|XP_002872166.1| hypothetical protein ARALYDRAFT_910605 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH48425.1| hypothetical protein ARALYDRAFT_910605 [Arabidopsis lyrata subsp. 
lyrata]
Length=369

 Score =   190 bits (483),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 88/127 (69%), Positives = 103/127 (81%), Gaps = 0/127 (0%)
 Frame = +1

Query  145  DGLLVNGNFEAPVKKTDLNGTIVTRHDAVPGWTVTGFVEYIQAGQKQGDMQLVVPEGFAA  324
            DG+L NG+FE   K +D+ GT +    A+P W VTGFVEYI++G KQGDM LVVP G  A
Sbjct  28   DGMLPNGDFELGPKPSDMKGTEILNKLAIPNWEVTGFVEYIKSGHKQGDMLLVVPAGKFA  87

Query  325  VRLGNEASIKQTLNVSKGMYYSITFCAARTCAQEERLNITVAPDSGVLPIQTLYSINGWD  504
            VRLGNEASIKQ L V KGMYYS+TF AARTCAQ+ERLNI+VAPDSGV+P+QT+YS +GWD
Sbjct  88   VRLGNEASIKQRLKVVKGMYYSLTFSAARTCAQDERLNISVAPDSGVIPVQTVYSSSGWD  147

Query  505  CYAWAFQ  525
             YAWAFQ
Sbjct  148  LYAWAFQ  154



>ref|XP_010421395.1| PREDICTED: uncharacterized protein LOC104706866 [Camelina sativa]
Length=369

 Score =   190 bits (483),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 89/127 (70%), Positives = 103/127 (81%), Gaps = 0/127 (0%)
 Frame = +1

Query  145  DGLLVNGNFEAPVKKTDLNGTIVTRHDAVPGWTVTGFVEYIQAGQKQGDMQLVVPEGFAA  324
            DG+L NG+FE   K +D+ GT V    A+P W VTGFVEYI++G KQGDM LVVP G  A
Sbjct  28   DGILPNGDFELGPKPSDMKGTEVVNKLAIPNWEVTGFVEYIKSGHKQGDMLLVVPAGKFA  87

Query  325  VRLGNEASIKQTLNVSKGMYYSITFCAARTCAQEERLNITVAPDSGVLPIQTLYSINGWD  504
            VRLGNEASIKQ L V KGMYYS+TF AARTCAQ+ERLNI+V+PDSGV+PIQT+YS +GWD
Sbjct  88   VRLGNEASIKQRLRVVKGMYYSLTFSAARTCAQDERLNISVSPDSGVIPIQTVYSSSGWD  147

Query  505  CYAWAFQ  525
             YAWAFQ
Sbjct  148  LYAWAFQ  154



>ref|XP_010454874.1| PREDICTED: uncharacterized protein LOC104736571 [Camelina sativa]
Length=369

 Score =   190 bits (483),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 89/127 (70%), Positives = 103/127 (81%), Gaps = 0/127 (0%)
 Frame = +1

Query  145  DGLLVNGNFEAPVKKTDLNGTIVTRHDAVPGWTVTGFVEYIQAGQKQGDMQLVVPEGFAA  324
            DG+L NG+FE   K +D+ GT V    A+P W VTGFVEYI++G KQGDM LVVP G  A
Sbjct  28   DGILPNGDFELGPKPSDMKGTEVVNKLAIPNWEVTGFVEYIKSGHKQGDMLLVVPAGKFA  87

Query  325  VRLGNEASIKQTLNVSKGMYYSITFCAARTCAQEERLNITVAPDSGVLPIQTLYSINGWD  504
            VRLGNEASIKQ L V KGMYYS+TF AARTCAQ+ERLNI+V+PDSGV+PIQT+YS +GWD
Sbjct  88   VRLGNEASIKQRLRVVKGMYYSLTFSAARTCAQDERLNISVSPDSGVIPIQTVYSSSGWD  147

Query  505  CYAWAFQ  525
             YAWAFQ
Sbjct  148  LYAWAFQ  154



>ref|XP_009151074.1| PREDICTED: uncharacterized protein LOC103874406 [Brassica rapa]
 emb|CDX88180.1| BnaA06g27710D [Brassica napus]
 emb|CDX80511.1| BnaC07g29330D [Brassica napus]
Length=367

 Score =   190 bits (482),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 89/127 (70%), Positives = 102/127 (80%), Gaps = 0/127 (0%)
 Frame = +1

Query  145  DGLLVNGNFEAPVKKTDLNGTIVTRHDAVPGWTVTGFVEYIQAGQKQGDMQLVVPEGFAA  324
            DG+L NG+FE   K +D+ GT V    A+P W VTGFVEYI +G KQGDM LVVP G  A
Sbjct  26   DGILPNGDFELGPKPSDMKGTEVINKMAIPNWEVTGFVEYISSGHKQGDMLLVVPAGKFA  85

Query  325  VRLGNEASIKQTLNVSKGMYYSITFCAARTCAQEERLNITVAPDSGVLPIQTLYSINGWD  504
            VRLGNEASIKQ L V KGMYYS+TF AARTCAQ+ERLNI+VAPDSGV+P+QT+YS +GWD
Sbjct  86   VRLGNEASIKQRLKVVKGMYYSLTFSAARTCAQDERLNISVAPDSGVIPVQTVYSSSGWD  145

Query  505  CYAWAFQ  525
             YAWAFQ
Sbjct  146  LYAWAFQ  152



>ref|XP_002308647.2| hypothetical protein POPTR_0006s26630g [Populus trichocarpa]
 gb|EEE92170.2| hypothetical protein POPTR_0006s26630g [Populus trichocarpa]
Length=415

 Score =   191 bits (485),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 89/127 (70%), Positives = 105/127 (83%), Gaps = 0/127 (0%)
 Frame = +1

Query  145  DGLLVNGNFEAPVKKTDLNGTIVTRHDAVPGWTVTGFVEYIQAGQKQGDMQLVVPEGFAA  324
            DGL+ NGNFE   K ++L GT +    A+P W ++GFVEYI+AGQKQGDM LVVPEG  A
Sbjct  74   DGLVENGNFEVGPKPSELKGTEMIGRYALPKWEISGFVEYIKAGQKQGDMLLVVPEGAYA  133

Query  325  VRLGNEASIKQTLNVSKGMYYSITFCAARTCAQEERLNITVAPDSGVLPIQTLYSINGWD  504
            VRLGNEASIKQ LNV+KGMYYSITF AARTCAQEE LNI+++P+ GVLP+QT+YS NGWD
Sbjct  134  VRLGNEASIKQVLNVTKGMYYSITFSAARTCAQEEELNISISPEWGVLPMQTMYSSNGWD  193

Query  505  CYAWAFQ  525
             YAWAF+
Sbjct  194  SYAWAFK  200



>ref|XP_011026488.1| PREDICTED: uncharacterized protein LOC105127071 [Populus euphratica]
Length=366

 Score =   189 bits (481),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 88/127 (69%), Positives = 106/127 (83%), Gaps = 0/127 (0%)
 Frame = +1

Query  145  DGLLVNGNFEAPVKKTDLNGTIVTRHDAVPGWTVTGFVEYIQAGQKQGDMQLVVPEGFAA  324
            +GL+ NGNFE   +++D+ GT +    A+P W ++GFVEYI+AGQKQGDM LVVPEG  A
Sbjct  25   EGLVENGNFENSPRQSDMKGTQMIGRYALPNWEISGFVEYIKAGQKQGDMLLVVPEGAYA  84

Query  325  VRLGNEASIKQTLNVSKGMYYSITFCAARTCAQEERLNITVAPDSGVLPIQTLYSINGWD  504
            VRLGNEASIKQ LN++KGMYYSITF AARTCAQEE LNI+V+P+ GVLP+QTLYS NGWD
Sbjct  85   VRLGNEASIKQRLNLTKGMYYSITFSAARTCAQEETLNISVSPEWGVLPMQTLYSSNGWD  144

Query  505  CYAWAFQ  525
             YAWAF+
Sbjct  145  SYAWAFK  151



>ref|XP_006287976.1| hypothetical protein CARUB_v10001211mg [Capsella rubella]
 gb|EOA20874.1| hypothetical protein CARUB_v10001211mg [Capsella rubella]
Length=370

 Score =   189 bits (481),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 88/127 (69%), Positives = 103/127 (81%), Gaps = 0/127 (0%)
 Frame = +1

Query  145  DGLLVNGNFEAPVKKTDLNGTIVTRHDAVPGWTVTGFVEYIQAGQKQGDMQLVVPEGFAA  324
            DG+L NG+FE   K +D+ GT V    A+P W V+GFVEYI++G KQGDM LVVP G  A
Sbjct  29   DGMLPNGDFELGPKPSDMKGTEVLNKLAIPNWEVSGFVEYIKSGHKQGDMLLVVPAGKFA  88

Query  325  VRLGNEASIKQTLNVSKGMYYSITFCAARTCAQEERLNITVAPDSGVLPIQTLYSINGWD  504
            VRLGNEASIKQ L V KGMYYS+TF AARTCAQ+ERLNI+VAPDSGV+P+QT+YS +GWD
Sbjct  89   VRLGNEASIKQRLKVVKGMYYSLTFSAARTCAQDERLNISVAPDSGVIPVQTVYSSSGWD  148

Query  505  CYAWAFQ  525
             YAWAFQ
Sbjct  149  LYAWAFQ  155



>ref|XP_006450498.1| hypothetical protein CICLE_v10008711mg [Citrus clementina]
 gb|ESR63738.1| hypothetical protein CICLE_v10008711mg [Citrus clementina]
 gb|KDO61660.1| hypothetical protein CISIN_1g017767mg [Citrus sinensis]
Length=366

 Score =   189 bits (479),  Expect = 6e-55, Method: Compositional matrix adjust.
 Identities = 89/128 (70%), Positives = 104/128 (81%), Gaps = 0/128 (0%)
 Frame = +1

Query  142  TDGLLVNGNFEAPVKKTDLNGTIVTRHDAVPGWTVTGFVEYIQAGQKQGDMQLVVPEGFA  321
            TDGLL NGNFE   + +D+NGT+V    A+P W ++GFVEYI++GQKQGDM LVVPEG  
Sbjct  23   TDGLLPNGNFELGPRPSDMNGTVVLGRYAIPSWEISGFVEYIRSGQKQGDMLLVVPEGAF  82

Query  322  AVRLGNEASIKQTLNVSKGMYYSITFCAARTCAQEERLNITVAPDSGVLPIQTLYSINGW  501
            AVRLGNEAS+KQ + V KG YYSI+F  ARTCAQEE LNI+VAP+ GVLP+QTLYS NGW
Sbjct  83   AVRLGNEASVKQRIKVIKGNYYSISFNFARTCAQEESLNISVAPEWGVLPLQTLYSSNGW  142

Query  502  DCYAWAFQ  525
            D YAWAFQ
Sbjct  143  DTYAWAFQ  150



>ref|XP_010670694.1| PREDICTED: uncharacterized protein LOC104887687 [Beta vulgaris 
subsp. vulgaris]
Length=367

 Score =   189 bits (479),  Expect = 6e-55, Method: Compositional matrix adjust.
 Identities = 86/127 (68%), Positives = 105/127 (83%), Gaps = 0/127 (0%)
 Frame = +1

Query  142  TDGLLVNGNFEAPVKKTDLNGTIVTRHDAVPGWTVTGFVEYIQAGQKQGDMQLVVPEGFA  321
            TDGLL NG+FE   K +D+ G+ V    A+P W ++GFVEYI++GQKQGDM LVVPEG  
Sbjct  25   TDGLLPNGDFEKGPKPSDMKGSEVLNRHAIPNWELSGFVEYIKSGQKQGDMLLVVPEGAF  84

Query  322  AVRLGNEASIKQTLNVSKGMYYSITFCAARTCAQEERLNITVAPDSGVLPIQTLYSINGW  501
            AVRLGNEASIKQ ++V+KGM Y+ITFCAARTCAQEE+LN++V P+ GVLP+QTLYS +GW
Sbjct  85   AVRLGNEASIKQRVSVTKGMNYAITFCAARTCAQEEQLNVSVTPEWGVLPMQTLYSSSGW  144

Query  502  DCYAWAF  522
            DCYAW F
Sbjct  145  DCYAWGF  151



>ref|XP_006483312.1| PREDICTED: uncharacterized protein LOC102608149 [Citrus sinensis]
Length=366

 Score =   189 bits (479),  Expect = 7e-55, Method: Compositional matrix adjust.
 Identities = 89/128 (70%), Positives = 104/128 (81%), Gaps = 0/128 (0%)
 Frame = +1

Query  142  TDGLLVNGNFEAPVKKTDLNGTIVTRHDAVPGWTVTGFVEYIQAGQKQGDMQLVVPEGFA  321
            TDGLL NGNFE   + +D+NGT+V    A+P W ++GFVEYI++GQKQGDM LVVPEG  
Sbjct  23   TDGLLPNGNFELGPRPSDMNGTVVLGRYAIPSWEISGFVEYIRSGQKQGDMLLVVPEGAF  82

Query  322  AVRLGNEASIKQTLNVSKGMYYSITFCAARTCAQEERLNITVAPDSGVLPIQTLYSINGW  501
            AVRLGNEAS+KQ + V KG YYSI+F  ARTCAQEE LNI+VAP+ GVLP+QTLYS NGW
Sbjct  83   AVRLGNEASVKQRIKVIKGNYYSISFNFARTCAQEESLNISVAPEWGVLPLQTLYSSNGW  142

Query  502  DCYAWAFQ  525
            D YAWAFQ
Sbjct  143  DTYAWAFQ  150



>ref|XP_006394799.1| hypothetical protein EUTSA_v10004442mg [Eutrema salsugineum]
 gb|ESQ32085.1| hypothetical protein EUTSA_v10004442mg [Eutrema salsugineum]
Length=367

 Score =   189 bits (479),  Expect = 8e-55, Method: Compositional matrix adjust.
 Identities = 88/127 (69%), Positives = 102/127 (80%), Gaps = 0/127 (0%)
 Frame = +1

Query  145  DGLLVNGNFEAPVKKTDLNGTIVTRHDAVPGWTVTGFVEYIQAGQKQGDMQLVVPEGFAA  324
            DG+L NG+FE   K +D+ GT V    A+P W VTGFVEYI +G KQGDM LVVP G  A
Sbjct  26   DGMLPNGDFELGPKPSDMKGTEVLNKMAIPKWEVTGFVEYISSGHKQGDMLLVVPAGKFA  85

Query  325  VRLGNEASIKQTLNVSKGMYYSITFCAARTCAQEERLNITVAPDSGVLPIQTLYSINGWD  504
            VRLGNEASIKQ L V KGMYYS+TF AARTCAQ+ERLNI+V+PDSGV+P+QT+YS +GWD
Sbjct  86   VRLGNEASIKQRLKVVKGMYYSLTFSAARTCAQDERLNISVSPDSGVIPVQTVYSSSGWD  145

Query  505  CYAWAFQ  525
             YAWAFQ
Sbjct  146  LYAWAFQ  152



>emb|CDX69757.1| BnaA10g21060D [Brassica napus]
Length=1312

 Score =   197 bits (502),  Expect = 1e-54, Method: Composition-based stats.
 Identities = 91/127 (72%), Positives = 106/127 (83%), Gaps = 0/127 (0%)
 Frame = +1

Query  145  DGLLVNGNFEAPVKKTDLNGTIVTRHDAVPGWTVTGFVEYIQAGQKQGDMQLVVPEGFAA  324
            DG+L NG FE   K +DL GT V   +A+P W ++GF+EYI++GQKQGDM LVVP G  A
Sbjct  25   DGMLPNGGFERGPKPSDLKGTRVINKNAIPNWELSGFIEYIKSGQKQGDMLLVVPAGKFA  84

Query  325  VRLGNEASIKQTLNVSKGMYYSITFCAARTCAQEERLNITVAPDSGVLPIQTLYSINGWD  504
            VRLGNEASIKQ +NV+KGMYYS+TF AARTCAQ+ERLNI+VAPDSGV+PIQTLYS NGWD
Sbjct  85   VRLGNEASIKQRVNVTKGMYYSLTFSAARTCAQDERLNISVAPDSGVIPIQTLYSSNGWD  144

Query  505  CYAWAFQ  525
             YAWAFQ
Sbjct  145  LYAWAFQ  151



>gb|KFK27809.1| hypothetical protein AALP_AA8G432300 [Arabis alpina]
Length=370

 Score =   188 bits (478),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 87/127 (69%), Positives = 103/127 (81%), Gaps = 0/127 (0%)
 Frame = +1

Query  145  DGLLVNGNFEAPVKKTDLNGTIVTRHDAVPGWTVTGFVEYIQAGQKQGDMQLVVPEGFAA  324
            DG+L NG+FE   K++D+ GT V    A+P W V+GFVEYI +G KQGDM LVVP G  A
Sbjct  29   DGMLPNGDFELGPKQSDMKGTEVLNKLAIPNWEVSGFVEYISSGHKQGDMILVVPAGKFA  88

Query  325  VRLGNEASIKQTLNVSKGMYYSITFCAARTCAQEERLNITVAPDSGVLPIQTLYSINGWD  504
            VRLGNEASIKQ L V KGMYYS+TF AARTCAQ+ERLNI+V+PDSGV+P+QT+YS +GWD
Sbjct  89   VRLGNEASIKQRLKVVKGMYYSLTFSAARTCAQDERLNISVSPDSGVIPVQTVYSSSGWD  148

Query  505  CYAWAFQ  525
             YAWAFQ
Sbjct  149  LYAWAFQ  155



>ref|XP_002324280.2| hypothetical protein POPTR_0018s01390g [Populus trichocarpa]
 gb|EEF02845.2| hypothetical protein POPTR_0018s01390g [Populus trichocarpa]
Length=398

 Score =   189 bits (479),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 87/127 (69%), Positives = 106/127 (83%), Gaps = 0/127 (0%)
 Frame = +1

Query  145  DGLLVNGNFEAPVKKTDLNGTIVTRHDAVPGWTVTGFVEYIQAGQKQGDMQLVVPEGFAA  324
            +GL+ NGNFE   K++D+ GT +    A+P W ++GFVEYI+AGQKQGDM LVVPEG  A
Sbjct  57   EGLVENGNFELSPKQSDMKGTQMIGRYALPKWEISGFVEYIKAGQKQGDMLLVVPEGAYA  116

Query  325  VRLGNEASIKQTLNVSKGMYYSITFCAARTCAQEERLNITVAPDSGVLPIQTLYSINGWD  504
            +RLGNEASIKQ LN++KGMYYSITF AARTCAQEE LNI+V+P+ GVLP+QT+YS NGWD
Sbjct  117  IRLGNEASIKQRLNLTKGMYYSITFSAARTCAQEETLNISVSPEWGVLPMQTMYSSNGWD  176

Query  505  CYAWAFQ  525
             YAWAF+
Sbjct  177  SYAWAFK  183



>ref|XP_003569339.1| PREDICTED: uncharacterized protein LOC100821501 [Brachypodium 
distachyon]
Length=370

 Score =   188 bits (477),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 88/129 (68%), Positives = 106/129 (82%), Gaps = 1/129 (1%)
 Frame = +1

Query  142  TDGLLVNGNFEAPVKKTDL-NGTIVTRHDAVPGWTVTGFVEYIQAGQKQGDMQLVVPEGF  318
            TDGLL NGNFEA   KTDL NGT+V   +A+P W  +GFVEYI++G KQGDM LVVP+G 
Sbjct  21   TDGLLPNGNFEAGPPKTDLVNGTVVKGGNAIPNWETSGFVEYIESGHKQGDMLLVVPQGA  80

Query  319  AAVRLGNEASIKQTLNVSKGMYYSITFCAARTCAQEERLNITVAPDSGVLPIQTLYSING  498
             AVRLGNEASI+Q L V++G YY+ITF AARTCAQ ER+NI+V+P+SGVLP+QT+Y  NG
Sbjct  81   HAVRLGNEASIRQKLAVARGSYYAITFSAARTCAQAERINISVSPESGVLPMQTIYGSNG  140

Query  499  WDCYAWAFQ  525
            WD YAWAF+
Sbjct  141  WDSYAWAFK  149



>ref|XP_010493802.1| PREDICTED: uncharacterized protein LOC104771027 [Camelina sativa]
Length=370

 Score =   187 bits (475),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 88/127 (69%), Positives = 102/127 (80%), Gaps = 0/127 (0%)
 Frame = +1

Query  145  DGLLVNGNFEAPVKKTDLNGTIVTRHDAVPGWTVTGFVEYIQAGQKQGDMQLVVPEGFAA  324
            DG+L NG+FE   K +D+ GT V    A+P W VTGFVEYI++G KQGDM LVVP G  A
Sbjct  29   DGILPNGDFELGPKPSDMKGTEVVNKLAIPNWEVTGFVEYIKSGHKQGDMLLVVPAGKFA  88

Query  325  VRLGNEASIKQTLNVSKGMYYSITFCAARTCAQEERLNITVAPDSGVLPIQTLYSINGWD  504
            VRLGNEASIKQ L V KGMYYS+TF AARTCAQ+E LNI+V+PDSGV+PIQT+YS +GWD
Sbjct  89   VRLGNEASIKQRLRVVKGMYYSLTFSAARTCAQDEMLNISVSPDSGVIPIQTVYSSSGWD  148

Query  505  CYAWAFQ  525
             YAWAFQ
Sbjct  149  LYAWAFQ  155



>ref|XP_009129962.1| PREDICTED: uncharacterized protein LOC103854751 [Brassica rapa]
 emb|CDY05493.1| BnaA02g31980D [Brassica napus]
Length=366

 Score =   186 bits (473),  Expect = 5e-54, Method: Compositional matrix adjust.
 Identities = 87/127 (69%), Positives = 101/127 (80%), Gaps = 0/127 (0%)
 Frame = +1

Query  145  DGLLVNGNFEAPVKKTDLNGTIVTRHDAVPGWTVTGFVEYIQAGQKQGDMQLVVPEGFAA  324
            DG+L NG+FE   K +D+ GT V    A+P W VTGFVEYI +G  QGDM LVVP G  A
Sbjct  26   DGMLPNGDFELGPKPSDMKGTEVLNKMAIPNWEVTGFVEYISSGHTQGDMLLVVPAGKFA  85

Query  325  VRLGNEASIKQTLNVSKGMYYSITFCAARTCAQEERLNITVAPDSGVLPIQTLYSINGWD  504
            VRLGNEASIKQ L V KGMYYS+TF AARTCAQ+ERLNI+VAPDSGV+P+QT+YS +GWD
Sbjct  86   VRLGNEASIKQRLKVVKGMYYSLTFSAARTCAQDERLNISVAPDSGVIPVQTVYSSSGWD  145

Query  505  CYAWAFQ  525
             Y+WAFQ
Sbjct  146  LYSWAFQ  152



>ref|XP_009407651.1| PREDICTED: uncharacterized protein LOC103990295 [Musa acuminata 
subsp. malaccensis]
Length=367

 Score =   186 bits (472),  Expect = 7e-54, Method: Compositional matrix adjust.
 Identities = 88/127 (69%), Positives = 103/127 (81%), Gaps = 0/127 (0%)
 Frame = +1

Query  142  TDGLLVNGNFEAPVKKTDLNGTIVTRHDAVPGWTVTGFVEYIQAGQKQGDMQLVVPEGFA  321
            TDGLL NGNFE   K   L GT V   DA+P W +TGFVEYIQ GQKQGDM LVVPEG  
Sbjct  22   TDGLLPNGNFEQGPKPWQLKGTKVAGRDAIPRWQITGFVEYIQWGQKQGDMLLVVPEGSY  81

Query  322  AVRLGNEASIKQTLNVSKGMYYSITFCAARTCAQEERLNITVAPDSGVLPIQTLYSINGW  501
            AVRLGN+ASIKQ++ V+KG+ YS+TF AARTCAQEERLN++ +P+SGVLP+QT+YS NGW
Sbjct  82   AVRLGNDASIKQSVKVTKGVRYSLTFSAARTCAQEERLNVSASPESGVLPMQTMYSSNGW  141

Query  502  DCYAWAF  522
            D YAWA+
Sbjct  142  DSYAWAW  148



>emb|CDY19801.1| BnaA09g04540D [Brassica napus]
Length=370

 Score =   185 bits (469),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 89/129 (69%), Positives = 102/129 (79%), Gaps = 2/129 (2%)
 Frame = +1

Query  145  DGLLVNGNFEAPVKKTDLNGTIVTRHDAVPGWTVTGFVEYIQA--GQKQGDMQLVVPEGF  318
            DG+L NG+FE   K +D+ GT V    A+P W VTGFVEYI +  G KQGDM LVVP G 
Sbjct  27   DGILPNGDFELGPKPSDIKGTEVLNKMAIPNWEVTGFVEYISSASGHKQGDMLLVVPAGK  86

Query  319  AAVRLGNEASIKQTLNVSKGMYYSITFCAARTCAQEERLNITVAPDSGVLPIQTLYSING  498
             AVRLGNEASIKQ L V KGMYYS+TF AARTCAQ+ERLNI+VAPDSGV+P+QT+YS +G
Sbjct  87   FAVRLGNEASIKQRLKVVKGMYYSLTFSAARTCAQDERLNISVAPDSGVIPVQTVYSSSG  146

Query  499  WDCYAWAFQ  525
            WD YAWAFQ
Sbjct  147  WDLYAWAFQ  155



>ref|XP_007217604.1| hypothetical protein PRUPE_ppa018156mg [Prunus persica]
 gb|EMJ18803.1| hypothetical protein PRUPE_ppa018156mg [Prunus persica]
Length=375

 Score =   185 bits (469),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 86/132 (65%), Positives = 105/132 (80%), Gaps = 5/132 (4%)
 Frame = +1

Query  142  TDGLLVNGNFEAPVKKTDLNGTIVTRHDAVPGWTVTGFVEYIQAGQKQGDMQLVVPEGFA  321
            TDGLL NGNFE   KK+DL GT+VT+ +A+P W V+G+VEYI++GQKQGDM LVVPEG  
Sbjct  26   TDGLLPNGNFEYGPKKSDLKGTVVTQPNAIPNWEVSGYVEYIKSGQKQGDMLLVVPEGGF  85

Query  322  AVRLGNEASIKQTLNVSKGMYYSITFCAARTCAQEERLNITVAP-----DSGVLPIQTLY  486
            AVRLGNEASIKQ + V+KG +YS+TF AARTC QEE LN++++P     D G+ PIQT+Y
Sbjct  86   AVRLGNEASIKQKIKVTKGRFYSVTFSAARTCGQEETLNVSISPNLEKNDWGIFPIQTMY  145

Query  487  SINGWDCYAWAF  522
            S NGWD YAW F
Sbjct  146  SSNGWDSYAWGF  157



>ref|XP_010541619.1| PREDICTED: uncharacterized protein LOC104815031 [Tarenaya hassleriana]
Length=364

 Score =   184 bits (467),  Expect = 4e-53, Method: Compositional matrix adjust.
 Identities = 85/127 (67%), Positives = 101/127 (80%), Gaps = 0/127 (0%)
 Frame = +1

Query  145  DGLLVNGNFEAPVKKTDLNGTIVTRHDAVPGWTVTGFVEYIQAGQKQGDMQLVVPEGFAA  324
            DG+L NG+FE   K +D+ GT V    A+P W ++GFVEYI++GQKQGDM LVVP G  A
Sbjct  23   DGMLPNGDFELGPKPSDMKGTQVINRSAIPNWELSGFVEYIKSGQKQGDMLLVVPAGKFA  82

Query  325  VRLGNEASIKQTLNVSKGMYYSITFCAARTCAQEERLNITVAPDSGVLPIQTLYSINGWD  504
            +RLGNEASIKQ L + KGMYYS+TF AARTCAQ+ERLNI+ APD GV+PIQT+YS  GWD
Sbjct  83   IRLGNEASIKQRLRLIKGMYYSLTFSAARTCAQDERLNISAAPDWGVIPIQTVYSSYGWD  142

Query  505  CYAWAFQ  525
             YAWAFQ
Sbjct  143  LYAWAFQ  149



>ref|XP_010539514.1| PREDICTED: uncharacterized protein LOC104813570 [Tarenaya hassleriana]
Length=365

 Score =   184 bits (466),  Expect = 5e-53, Method: Compositional matrix adjust.
 Identities = 84/127 (66%), Positives = 102/127 (80%), Gaps = 0/127 (0%)
 Frame = +1

Query  145  DGLLVNGNFEAPVKKTDLNGTIVTRHDAVPGWTVTGFVEYIQAGQKQGDMQLVVPEGFAA  324
            DGLL NGNFE   K + L G +VT   A+P W ++G+VEYI+AGQ QGDM LVVPEG +A
Sbjct  22   DGLLPNGNFELGPKSSQLKGVLVTDRAAIPKWEISGYVEYIKAGQTQGDMLLVVPEGSSA  81

Query  325  VRLGNEASIKQTLNVSKGMYYSITFCAARTCAQEERLNITVAPDSGVLPIQTLYSINGWD  504
            VRLGNEASI+Q ++V  G +YSITF AARTCAQEERLNI+V  +SG++PIQT+YS NGWD
Sbjct  82   VRLGNEASIRQKISVRTGQFYSITFSAARTCAQEERLNISVTHESGIIPIQTMYSSNGWD  141

Query  505  CYAWAFQ  525
             YAWAF+
Sbjct  142  SYAWAFK  148



>gb|AFK49528.1| unknown [Medicago truncatula]
Length=204

 Score =   179 bits (453),  Expect = 7e-53, Method: Compositional matrix adjust.
 Identities = 84/128 (66%), Positives = 103/128 (80%), Gaps = 1/128 (1%)
 Frame = +1

Query  145  DGLLVNGNFEAPVKKTDLNGTIVTR-HDAVPGWTVTGFVEYIQAGQKQGDMQLVVPEGFA  321
            DGL+ NGNFE   K T+L GT+VT   +++P W ++G VEY+++GQKQGDM LVVPEG  
Sbjct  34   DGLVANGNFELGPKPTELKGTVVTGGKNSIPEWEISGLVEYVKSGQKQGDMLLVVPEGAY  93

Query  322  AVRLGNEASIKQTLNVSKGMYYSITFCAARTCAQEERLNITVAPDSGVLPIQTLYSINGW  501
            AVRLGNEASIKQ + V KGMYYSITF  ARTCAQEER+NI+VAPD GV+PIQTLY+ +GW
Sbjct  94   AVRLGNEASIKQRIKVIKGMYYSITFMVARTCAQEERINISVAPDFGVIPIQTLYTSSGW  153

Query  502  DCYAWAFQ  525
            D  A+ F+
Sbjct  154  DPIAYGFK  161



>ref|XP_009125963.1| PREDICTED: uncharacterized protein LOC103850912 [Brassica rapa]
 emb|CDX75247.1| BnaA01g04550D [Brassica napus]
Length=365

 Score =   182 bits (463),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 84/127 (66%), Positives = 100/127 (79%), Gaps = 0/127 (0%)
 Frame = +1

Query  145  DGLLVNGNFEAPVKKTDLNGTIVTRHDAVPGWTVTGFVEYIQAGQKQGDMQLVVPEGFAA  324
            DGLL NG+FE     TD+ GT V    A+P W ++GFVEYI +G KQGDM LVVP+G  A
Sbjct  24   DGLLPNGDFELGPHHTDMKGTQVMNKTAIPSWELSGFVEYIPSGHKQGDMILVVPKGAFA  83

Query  325  VRLGNEASIKQTLNVSKGMYYSITFCAARTCAQEERLNITVAPDSGVLPIQTLYSINGWD  504
            VRLGNEASIKQ +NV KG YYSITF AARTCAQ+ERLN++VAP  GV+PIQT+YS +GWD
Sbjct  84   VRLGNEASIKQKINVKKGSYYSITFSAARTCAQDERLNVSVAPHHGVMPIQTVYSSSGWD  143

Query  505  CYAWAFQ  525
             Y+WAF+
Sbjct  144  LYSWAFK  150



>gb|ACU22840.1| unknown [Glycine max]
Length=199

 Score =   177 bits (450),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 84/133 (63%), Positives = 103/133 (77%), Gaps = 5/133 (4%)
 Frame = +1

Query  142  TDGLLVNGNFEAPVKKTDLNGTIVTRHDAVPGWTVTGFVEYIQAGQKQGDMQLVVPEGFA  321
            TDGLL NGNFE   K + L G++VT HDA+P WT++GFVEYI++GQKQGDM LVVPEG  
Sbjct  24   TDGLLPNGNFEQGPKPSQLKGSVVTGHDAIPNWTISGFVEYIKSGQKQGDMLLVVPEGDY  83

Query  322  AVRLGNEASIKQTLNVSKGMYYSITFCAARTCAQEERLNITVAP-----DSGVLPIQTLY  486
            AVRLGNEASIKQ L + KG +YSITF AARTCAQEE+LN++V P     D G++PIQT+Y
Sbjct  84   AVRLGNEASIKQKLKLIKGSFYSITFSAARTCAQEEKLNVSVVPTTEKRDWGIIPIQTMY  143

Query  487  SINGWDCYAWAFQ  525
              NGW+ +   F+
Sbjct  144  GSNGWESFTCGFR  156



>ref|XP_002517567.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF44731.1| conserved hypothetical protein [Ricinus communis]
Length=378

 Score =   183 bits (464),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 87/133 (65%), Positives = 105/133 (79%), Gaps = 5/133 (4%)
 Frame = +1

Query  142  TDGLLVNGNFEAPVKKTDLNGTIVTRHDAVPGWTVTGFVEYIQAGQKQGDMQLVVPEGFA  321
            TDGLL NGNFE   K   L GT+VT  +A+P W ++G+VEYI++GQKQGDM LVVP G  
Sbjct  27   TDGLLPNGNFEYGPKPWQLKGTVVTAKNAIPNWEISGYVEYIKSGQKQGDMLLVVPSGAF  86

Query  322  AVRLGNEASIKQTLNVSKGMYYSITFCAARTCAQEERLNITVAP-----DSGVLPIQTLY  486
            AVRLGNEASIKQ ++V+KG YYSITF  ARTCAQEE+LN++V+P     D G+LP+QT+Y
Sbjct  87   AVRLGNEASIKQKISVAKGSYYSITFNVARTCAQEEKLNVSVSPNIEQNDWGILPMQTMY  146

Query  487  SINGWDCYAWAFQ  525
            S NGWD YAWAFQ
Sbjct  147  SSNGWDSYAWAFQ  159



>emb|CDY54909.1| BnaC02g48660D [Brassica napus]
Length=339

 Score =   181 bits (460),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 84/125 (67%), Positives = 99/125 (79%), Gaps = 0/125 (0%)
 Frame = +1

Query  151  LLVNGNFEAPVKKTDLNGTIVTRHDAVPGWTVTGFVEYIQAGQKQGDMQLVVPEGFAAVR  330
            +L NG+FE   K +D+ GT V    A+P W +TGFVEYI +G  QGDM LVVP G  AVR
Sbjct  1    MLPNGDFELGPKPSDMKGTEVLNRMAIPNWEITGFVEYISSGHTQGDMLLVVPAGKFAVR  60

Query  331  LGNEASIKQTLNVSKGMYYSITFCAARTCAQEERLNITVAPDSGVLPIQTLYSINGWDCY  510
            LGNEASIKQ L V KGMYYS+TF AARTCAQ+ERLNI+VAPDSGV+P+QT+YS +GWD Y
Sbjct  61   LGNEASIKQRLKVVKGMYYSLTFSAARTCAQDERLNISVAPDSGVIPVQTVYSSSGWDLY  120

Query  511  AWAFQ  525
            +WAFQ
Sbjct  121  SWAFQ  125



>ref|XP_010519935.1| PREDICTED: uncharacterized protein LOC104799224 [Tarenaya hassleriana]
Length=365

 Score =   181 bits (459),  Expect = 6e-52, Method: Compositional matrix adjust.
 Identities = 85/127 (67%), Positives = 100/127 (79%), Gaps = 0/127 (0%)
 Frame = +1

Query  145  DGLLVNGNFEAPVKKTDLNGTIVTRHDAVPGWTVTGFVEYIQAGQKQGDMQLVVPEGFAA  324
            DG L NG+FE   K +D+ GT V    A+P W ++GFVEYI++GQKQGDM LVVP G  A
Sbjct  24   DGQLPNGDFELGPKPSDMKGTQVVNKTAIPNWELSGFVEYIKSGQKQGDMLLVVPAGKFA  83

Query  325  VRLGNEASIKQTLNVSKGMYYSITFCAARTCAQEERLNITVAPDSGVLPIQTLYSINGWD  504
            VRLGNEASIKQ L + KGMYYS+TF AARTCAQ+ERLNI+ +PD GV+PIQT+YS  GWD
Sbjct  84   VRLGNEASIKQRLRLVKGMYYSLTFSAARTCAQDERLNISASPDWGVIPIQTVYSSYGWD  143

Query  505  CYAWAFQ  525
             YAWAFQ
Sbjct  144  LYAWAFQ  150



>ref|XP_008228640.1| PREDICTED: uncharacterized protein LOC103328032 [Prunus mume]
Length=375

 Score =   181 bits (459),  Expect = 8e-52, Method: Compositional matrix adjust.
 Identities = 85/132 (64%), Positives = 103/132 (78%), Gaps = 5/132 (4%)
 Frame = +1

Query  142  TDGLLVNGNFEAPVKKTDLNGTIVTRHDAVPGWTVTGFVEYIQAGQKQGDMQLVVPEGFA  321
            TDGLL NGNFE   KK+DL GT+VT+ +A+P W V+G+VEYI++GQKQGDM LVVPEG  
Sbjct  26   TDGLLPNGNFEYGPKKSDLKGTVVTQPNAIPNWEVSGYVEYIKSGQKQGDMLLVVPEGGF  85

Query  322  AVRLGNEASIKQTLNVSKGMYYSITFCAARTCAQEERLNITVAP-----DSGVLPIQTLY  486
            AVRLG EASIKQ + V+KG +YS+TF AARTC QEE LN+++ P     D G+ PIQT+Y
Sbjct  86   AVRLGKEASIKQKIKVTKGRFYSVTFSAARTCGQEETLNLSINPNLEKNDWGIFPIQTMY  145

Query  487  SINGWDCYAWAF  522
            S NGWD YAW F
Sbjct  146  SSNGWDSYAWGF  157



>ref|XP_006427179.1| hypothetical protein CICLE_v10025880mg [Citrus clementina]
 gb|ESR40419.1| hypothetical protein CICLE_v10025880mg [Citrus clementina]
Length=374

 Score =   181 bits (458),  Expect = 9e-52, Method: Compositional matrix adjust.
 Identities = 82/132 (62%), Positives = 105/132 (80%), Gaps = 5/132 (4%)
 Frame = +1

Query  142  TDGLLVNGNFEAPVKKTDLNGTIVTRHDAVPGWTVTGFVEYIQAGQKQGDMQLVVPEGFA  321
            TDGLL NGNFE   K++ + GT+VT  +A+P W ++G+VEYI++G KQGDM L+VPEG  
Sbjct  22   TDGLLPNGNFEYGPKRSQMKGTVVTHPNAIPNWQISGYVEYIKSGHKQGDMLLIVPEGVF  81

Query  322  AVRLGNEASIKQTLNVSKGMYYSITFCAARTCAQEERLNITVAP-----DSGVLPIQTLY  486
            AVRLGNEASIKQ + V+KG +YS+TF AARTCAQEE+LN++V+P     D  +LP+QT+Y
Sbjct  82   AVRLGNEASIKQNIKVTKGRFYSMTFSAARTCAQEEKLNVSVSPNLETNDWAILPMQTMY  141

Query  487  SINGWDCYAWAF  522
            S NGWD YAWAF
Sbjct  142  SNNGWDSYAWAF  153



>ref|XP_010914930.1| PREDICTED: uncharacterized protein LOC105040204 [Elaeis guineensis]
Length=370

 Score =   180 bits (457),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 85/127 (67%), Positives = 100/127 (79%), Gaps = 0/127 (0%)
 Frame = +1

Query  142  TDGLLVNGNFEAPVKKTDLNGTIVTRHDAVPGWTVTGFVEYIQAGQKQGDMQLVVPEGFA  321
            TDGLL NGNFE     + L GT V   +A+P W ++G VEYI  G KQGDM LVVPEG  
Sbjct  22   TDGLLPNGNFELGPASSQLRGTEVIGRNAIPRWEISGTVEYIPWGHKQGDMLLVVPEGSY  81

Query  322  AVRLGNEASIKQTLNVSKGMYYSITFCAARTCAQEERLNITVAPDSGVLPIQTLYSINGW  501
            AVRLGNEASIKQ + V++GM YS+TF AARTCAQEERLN++VAP+SGVLP+QT+YS NGW
Sbjct  82   AVRLGNEASIKQRIKVTRGMRYSLTFSAARTCAQEERLNVSVAPESGVLPMQTMYSSNGW  141

Query  502  DCYAWAF  522
            D YAWA+
Sbjct  142  DSYAWAW  148



>emb|CDX68849.1| BnaC01g06040D [Brassica napus]
Length=365

 Score =   180 bits (457),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 83/127 (65%), Positives = 100/127 (79%), Gaps = 0/127 (0%)
 Frame = +1

Query  145  DGLLVNGNFEAPVKKTDLNGTIVTRHDAVPGWTVTGFVEYIQAGQKQGDMQLVVPEGFAA  324
            DGLL NG+FE     TD+ GT V    A+P W ++GFVEYI +G KQGDM LVVP+G  A
Sbjct  24   DGLLPNGDFELGPHHTDMKGTQVMNKTAIPSWELSGFVEYIPSGHKQGDMILVVPKGAFA  83

Query  325  VRLGNEASIKQTLNVSKGMYYSITFCAARTCAQEERLNITVAPDSGVLPIQTLYSINGWD  504
            VRLGNEASIKQ ++V KG YYSITF AARTCAQ+ERLN++VAP  GV+PIQT+YS +GWD
Sbjct  84   VRLGNEASIKQKISVKKGSYYSITFSAARTCAQDERLNVSVAPHHGVMPIQTVYSSSGWD  143

Query  505  CYAWAFQ  525
             Y+WAF+
Sbjct  144  LYSWAFK  150



>gb|AES58962.2| plant/F18G18-200 protein [Medicago truncatula]
Length=376

 Score =   180 bits (457),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 85/128 (66%), Positives = 103/128 (80%), Gaps = 1/128 (1%)
 Frame = +1

Query  145  DGLLVNGNFEAPVKKTDLNGTIVTR-HDAVPGWTVTGFVEYIQAGQKQGDMQLVVPEGFA  321
            DGL+ NGNFE   K T+L GT+VT   +++P W ++G VEYI++GQKQGDM LVVPEG  
Sbjct  34   DGLVANGNFELGPKPTELKGTVVTGGKNSIPEWEISGLVEYIKSGQKQGDMLLVVPEGAY  93

Query  322  AVRLGNEASIKQTLNVSKGMYYSITFCAARTCAQEERLNITVAPDSGVLPIQTLYSINGW  501
            AVRLGNEASIKQ + V KGMYYSITF  ARTCAQEER+NI+VAPD GV+PIQTLY+ +GW
Sbjct  94   AVRLGNEASIKQRIKVIKGMYYSITFMVARTCAQEERINISVAPDFGVIPIQTLYTSSGW  153

Query  502  DCYAWAFQ  525
            D  A+ F+
Sbjct  154  DPIAYGFK  161



>ref|XP_004969140.1| PREDICTED: uncharacterized protein LOC101755969 [Setaria italica]
Length=372

 Score =   180 bits (457),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 84/129 (65%), Positives = 103/129 (80%), Gaps = 1/129 (1%)
 Frame = +1

Query  142  TDGLLVNGNFE-APVKKTDLNGTIVTRHDAVPGWTVTGFVEYIQAGQKQGDMQLVVPEGF  318
            TDGLL NGNFE  P K   +NGT+V   +A+P W  +GFVEYI++G KQGDM LVVP+G 
Sbjct  22   TDGLLPNGNFEEGPPKSALVNGTVVRGANAIPLWETSGFVEYIESGHKQGDMLLVVPQGA  81

Query  319  AAVRLGNEASIKQTLNVSKGMYYSITFCAARTCAQEERLNITVAPDSGVLPIQTLYSING  498
             AVRLGNEASI+Q L V++G YY+ITF AARTCAQ ERLN++V+P+ GVLP+QT+Y  NG
Sbjct  82   HAVRLGNEASIRQRLAVTRGAYYAITFSAARTCAQAERLNVSVSPEWGVLPMQTIYGSNG  141

Query  499  WDCYAWAFQ  525
            WD YAWAF+
Sbjct  142  WDSYAWAFK  150



>ref|XP_010526203.1| PREDICTED: uncharacterized protein LOC104803829 [Tarenaya hassleriana]
Length=363

 Score =   180 bits (456),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 81/127 (64%), Positives = 101/127 (80%), Gaps = 0/127 (0%)
 Frame = +1

Query  145  DGLLVNGNFEAPVKKTDLNGTIVTRHDAVPGWTVTGFVEYIQAGQKQGDMQLVVPEGFAA  324
            DGLL NG+FE    ++D+ GT V    A+P W ++GFVEYI +G KQGDM LVVP+G  A
Sbjct  22   DGLLPNGDFEHGPSRSDMKGTQVMNSKAIPNWEISGFVEYIPSGHKQGDMLLVVPKGSFA  81

Query  325  VRLGNEASIKQTLNVSKGMYYSITFCAARTCAQEERLNITVAPDSGVLPIQTLYSINGWD  504
            VRLGNEASIKQ++ V+KG YY+ITF AARTCAQ+ERLN++ AP  GVLPIQT+YS +GWD
Sbjct  82   VRLGNEASIKQSVKVAKGSYYAITFSAARTCAQDERLNVSAAPHHGVLPIQTVYSSSGWD  141

Query  505  CYAWAFQ  525
             Y+WAF+
Sbjct  142  LYSWAFK  148



>ref|XP_007161233.1| hypothetical protein PHAVU_001G053100g [Phaseolus vulgaris]
 gb|ESW33227.1| hypothetical protein PHAVU_001G053100g [Phaseolus vulgaris]
Length=366

 Score =   180 bits (456),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 86/128 (67%), Positives = 102/128 (80%), Gaps = 1/128 (1%)
 Frame = +1

Query  145  DGLLVNGNFEAPVKKTDLNGTIVTR-HDAVPGWTVTGFVEYIQAGQKQGDMQLVVPEGFA  321
            DGL+ NGNFE   K +DL GT+V     ++P W ++GFVEYI++GQKQGDM LVVPEG  
Sbjct  24   DGLVANGNFELGPKASDLKGTVVVGGSKSIPEWEISGFVEYIKSGQKQGDMLLVVPEGAY  83

Query  322  AVRLGNEASIKQTLNVSKGMYYSITFCAARTCAQEERLNITVAPDSGVLPIQTLYSINGW  501
            AVRLGNEASIKQTL V KGMYYSITF  ARTCAQEER+NI+V PD GV+PIQTLY+ +GW
Sbjct  84   AVRLGNEASIKQTLKVMKGMYYSITFMVARTCAQEERINISVTPDWGVIPIQTLYTSSGW  143

Query  502  DCYAWAFQ  525
            D  A+ F+
Sbjct  144  DPIAFGFR  151



>gb|ACU17881.1| unknown [Glycine max]
Length=282

 Score =   177 bits (450),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 84/133 (63%), Positives = 103/133 (77%), Gaps = 5/133 (4%)
 Frame = +1

Query  142  TDGLLVNGNFEAPVKKTDLNGTIVTRHDAVPGWTVTGFVEYIQAGQKQGDMQLVVPEGFA  321
            TDGLL NGNFE   K + L G++VT HDA+P WT++GFVEYI++GQKQGDM LVVPEG  
Sbjct  24   TDGLLPNGNFEQGPKPSQLKGSVVTGHDAIPNWTISGFVEYIKSGQKQGDMLLVVPEGDY  83

Query  322  AVRLGNEASIKQTLNVSKGMYYSITFCAARTCAQEERLNITVAP-----DSGVLPIQTLY  486
            AVRLGNEASIKQ L + KG +YSITF AARTCAQEE+LN++V P     D G++PIQT+Y
Sbjct  84   AVRLGNEASIKQKLKLIKGSFYSITFSAARTCAQEEKLNVSVVPTTEKRDWGIIPIQTMY  143

Query  487  SINGWDCYAWAFQ  525
              NGW+ +   F+
Sbjct  144  GSNGWESFTCGFR  156



>ref|NP_001053188.1| Os04g0494600 [Oryza sativa Japonica Group]
 emb|CAD41544.2| OSJNBb0091E11.14 [Oryza sativa Japonica Group]
 dbj|BAF15102.1| Os04g0494600 [Oryza sativa Japonica Group]
 emb|CAH67289.1| OSIGBa0103O01.7 [Oryza sativa Indica Group]
 gb|EAY94693.1| hypothetical protein OsI_16470 [Oryza sativa Indica Group]
 gb|EAZ31209.1| hypothetical protein OsJ_15309 [Oryza sativa Japonica Group]
 dbj|BAG99074.1| unnamed protein product [Oryza sativa Japonica Group]
Length=377

 Score =   180 bits (457),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 85/129 (66%), Positives = 104/129 (81%), Gaps = 2/129 (2%)
 Frame = +1

Query  145  DGLLVNGNFEAPVKKTDLNGTIVTRHDAVPGWTVTGFVEYIQAGQKQGDMQLVVPEGFAA  324
            DGLL+NGNFE    K+ +NGT V    A+P W +TGFVEYI +GQKQGDM L VPEG  A
Sbjct  25   DGLLLNGNFEYQPSKSQMNGTRVMAEYAIPYWKITGFVEYISSGQKQGDMLLTVPEGAHA  84

Query  325  VRLGNEASIKQTLNVSKGMYYSITFCAARTCAQEERLNITVA--PDSGVLPIQTLYSING  498
            VRLGNEASI+Q ++V++GMYYSITF AARTCAQ E+LN++VA  P+SG LPIQT+Y+ +G
Sbjct  85   VRLGNEASIEQQISVTRGMYYSITFSAARTCAQSEKLNVSVAPGPESGELPIQTVYTSSG  144

Query  499  WDCYAWAFQ  525
            WD YAWAF+
Sbjct  145  WDSYAWAFK  153



>ref|XP_007023946.1| Uncharacterized protein TCM_028364 [Theobroma cacao]
 gb|EOY26568.1| Uncharacterized protein TCM_028364 [Theobroma cacao]
Length=372

 Score =   180 bits (456),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 84/132 (64%), Positives = 102/132 (77%), Gaps = 5/132 (4%)
 Frame = +1

Query  145  DGLLVNGNFEAPVKKTDLNGTIVTRHDAVPGWTVTGFVEYIQAGQKQGDMQLVVPEGFAA  324
            DGLL NGNFE   K +++ GT V    A+P W ++G VEYI++GQKQGDM L+VPEG  A
Sbjct  23   DGLLPNGNFEYGPKPSEMKGTKVVSPKAIPNWEISGVVEYIKSGQKQGDMLLIVPEGAFA  82

Query  325  VRLGNEASIKQTLNVSKGMYYSITFCAARTCAQEERLNITVAP-----DSGVLPIQTLYS  489
            VRLGN+A IKQT+ V KGM+YS+TF AARTCAQEERLN++V+P     D G+ PIQT+YS
Sbjct  83   VRLGNDALIKQTMKVIKGMFYSLTFSAARTCAQEERLNVSVSPNYEKNDYGLFPIQTMYS  142

Query  490  INGWDCYAWAFQ  525
             NGWD YAWAFQ
Sbjct  143  SNGWDSYAWAFQ  154



>ref|XP_006465391.1| PREDICTED: uncharacterized protein LOC102618171 [Citrus sinensis]
Length=374

 Score =   180 bits (456),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 82/132 (62%), Positives = 105/132 (80%), Gaps = 5/132 (4%)
 Frame = +1

Query  142  TDGLLVNGNFEAPVKKTDLNGTIVTRHDAVPGWTVTGFVEYIQAGQKQGDMQLVVPEGFA  321
            TDGLL NGNFE   K++ + GT+VT  +A+P W ++G+VEYI++G KQGDM L+VPEG  
Sbjct  22   TDGLLPNGNFEYGPKRSQMKGTVVTHPNAIPNWQISGYVEYIKSGHKQGDMLLIVPEGAF  81

Query  322  AVRLGNEASIKQTLNVSKGMYYSITFCAARTCAQEERLNITVAP-----DSGVLPIQTLY  486
            AVRLGNEASIKQ + V+KG +YS+TF AARTCAQEE+LN++V+P     D  +LP+QT+Y
Sbjct  82   AVRLGNEASIKQKIKVTKGRFYSMTFSAARTCAQEEKLNVSVSPNLETNDWAILPMQTMY  141

Query  487  SINGWDCYAWAF  522
            S NGWD YAWAF
Sbjct  142  SNNGWDSYAWAF  153



>gb|EAY74932.1| hypothetical protein OsI_02826 [Oryza sativa Indica Group]
Length=361

 Score =   179 bits (455),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 83/129 (64%), Positives = 103/129 (80%), Gaps = 1/129 (1%)
 Frame = +1

Query  142  TDGLLVNGNFEAPVKKTDL-NGTIVTRHDAVPGWTVTGFVEYIQAGQKQGDMQLVVPEGF  318
            TDGLL NGNFE    K+DL NGT+V   +A+P W  +GFVEYI++G KQGDM LVVP+G 
Sbjct  24   TDGLLPNGNFEEGPPKSDLVNGTVVRGANAIPRWETSGFVEYIESGHKQGDMLLVVPQGA  83

Query  319  AAVRLGNEASIKQTLNVSKGMYYSITFCAARTCAQEERLNITVAPDSGVLPIQTLYSING  498
             AVRLGNEASI+Q L V++G YY++TF AARTCAQ E+LN++V P+ GVLP+QT+Y  NG
Sbjct  84   HAVRLGNEASIRQRLAVTRGAYYAVTFSAARTCAQAEQLNVSVTPEWGVLPMQTIYGSNG  143

Query  499  WDCYAWAFQ  525
            WD YAWAF+
Sbjct  144  WDSYAWAFK  152



>emb|CAE01676.2| OSJNBb0091E11.17 [Oryza sativa Japonica Group]
 gb|EAZ31210.1| hypothetical protein OsJ_15310 [Oryza sativa Japonica Group]
Length=373

 Score =   179 bits (455),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 83/128 (65%), Positives = 102/128 (80%), Gaps = 0/128 (0%)
 Frame = +1

Query  142  TDGLLVNGNFEAPVKKTDLNGTIVTRHDAVPGWTVTGFVEYIQAGQKQGDMQLVVPEGFA  321
            TDGLL NGNFE    K+ +NGT VT   A+P W ++GFVEYI +GQKQGDM L VPEG  
Sbjct  27   TDGLLPNGNFEEAPDKSQMNGTRVTGRYAIPQWEISGFVEYIGSGQKQGDMLLPVPEGAY  86

Query  322  AVRLGNEASIKQTLNVSKGMYYSITFCAARTCAQEERLNITVAPDSGVLPIQTLYSINGW  501
            AVRLGNEASI+Q L +++GM+YSITF AARTCAQ E LNIT+ P+SG +PIQT+Y+ +GW
Sbjct  87   AVRLGNEASIQQRLTLTRGMHYSITFSAARTCAQSELLNITITPESGEIPIQTVYTSSGW  146

Query  502  DCYAWAFQ  525
            D Y+WAF+
Sbjct  147  DSYSWAFK  154



>dbj|BAB21293.1| unknown protein [Oryza sativa Japonica Group]
 dbj|BAB93263.1| unknown protein [Oryza sativa Japonica Group]
 gb|EAZ12659.1| hypothetical protein OsJ_02574 [Oryza sativa Japonica Group]
 dbj|BAG93001.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG87537.1| unnamed protein product [Oryza sativa Japonica Group]
Length=373

 Score =   179 bits (455),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 83/129 (64%), Positives = 104/129 (81%), Gaps = 1/129 (1%)
 Frame = +1

Query  142  TDGLLVNGNFEAPVKKTDL-NGTIVTRHDAVPGWTVTGFVEYIQAGQKQGDMQLVVPEGF  318
            TDGLL NGNFE    K+DL NGT+V   +A+P W  +GFVEYI++G KQGDM LVVP+G 
Sbjct  24   TDGLLPNGNFEEGPPKSDLVNGTVVRGANAIPRWETSGFVEYIESGHKQGDMLLVVPQGA  83

Query  319  AAVRLGNEASIKQTLNVSKGMYYSITFCAARTCAQEERLNITVAPDSGVLPIQTLYSING  498
             AVRLGNEASI+Q L V++G YY++TF AARTCAQ E+LN++V+P+ GVLP+QT+Y  NG
Sbjct  84   HAVRLGNEASIRQRLAVTRGAYYAVTFSAARTCAQAEQLNVSVSPEWGVLPMQTIYGSNG  143

Query  499  WDCYAWAFQ  525
            WD YAWAF+
Sbjct  144  WDSYAWAFK  152



>gb|EMT06486.1| hypothetical protein F775_26416 [Aegilops tauschii]
Length=370

 Score =   179 bits (455),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 83/129 (64%), Positives = 103/129 (80%), Gaps = 1/129 (1%)
 Frame = +1

Query  142  TDGLLVNGNFEA-PVKKTDLNGTIVTRHDAVPGWTVTGFVEYIQAGQKQGDMQLVVPEGF  318
            TDGLL NGNFE+ P K   +NGT+V    A+P W  +GFVEYI++G KQGDM LVVP+G 
Sbjct  21   TDGLLPNGNFESGPAKSELVNGTVVKGGKAIPKWETSGFVEYIESGHKQGDMLLVVPQGA  80

Query  319  AAVRLGNEASIKQTLNVSKGMYYSITFCAARTCAQEERLNITVAPDSGVLPIQTLYSING  498
             AVRLGN+ASI Q + V++G YY+ITF AARTCAQ ERLN++V+P+SGVLP+QT+Y  NG
Sbjct  81   YAVRLGNDASILQRIPVARGSYYAITFSAARTCAQAERLNVSVSPESGVLPMQTIYGSNG  140

Query  499  WDCYAWAFQ  525
            WD YAWAF+
Sbjct  141  WDSYAWAFK  149



>ref|XP_011040006.1| PREDICTED: uncharacterized protein LOC105136392 [Populus euphratica]
Length=396

 Score =   180 bits (457),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 81/133 (61%), Positives = 106/133 (80%), Gaps = 5/133 (4%)
 Frame = +1

Query  142  TDGLLVNGNFEAPVKKTDLNGTIVTRHDAVPGWTVTGFVEYIQAGQKQGDMQLVVPEGFA  321
            TDGLL NG+FE   K +++ GT+VT   A+P W ++GF+EYI++G KQGDM LVVP G  
Sbjct  44   TDGLLPNGDFEQGPKPSEMKGTVVTAKSAIPNWEISGFIEYIKSGHKQGDMVLVVPAGAY  103

Query  322  AVRLGNEASIKQTLNVSKGMYYSITFCAARTCAQEERLNITVAPDS-----GVLPIQTLY  486
            AVRLGNEASIKQ + V++G++YS+TF  ARTCAQEE+LN++V+P+S     G+LP+QT+Y
Sbjct  104  AVRLGNEASIKQRVKVTQGLFYSLTFNVARTCAQEEKLNVSVSPNSEPRDWGILPMQTMY  163

Query  487  SINGWDCYAWAFQ  525
            S NGWD YAWAFQ
Sbjct  164  SSNGWDAYAWAFQ  176



>ref|NP_001043549.2| Os01g0611000 [Oryza sativa Japonica Group]
 dbj|BAF05463.2| Os01g0611000, partial [Oryza sativa Japonica Group]
Length=399

 Score =   180 bits (457),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 83/129 (64%), Positives = 104/129 (81%), Gaps = 1/129 (1%)
 Frame = +1

Query  142  TDGLLVNGNFEAPVKKTDL-NGTIVTRHDAVPGWTVTGFVEYIQAGQKQGDMQLVVPEGF  318
            TDGLL NGNFE    K+DL NGT+V   +A+P W  +GFVEYI++G KQGDM LVVP+G 
Sbjct  50   TDGLLPNGNFEEGPPKSDLVNGTVVRGANAIPRWETSGFVEYIESGHKQGDMLLVVPQGA  109

Query  319  AAVRLGNEASIKQTLNVSKGMYYSITFCAARTCAQEERLNITVAPDSGVLPIQTLYSING  498
             AVRLGNEASI+Q L V++G YY++TF AARTCAQ E+LN++V+P+ GVLP+QT+Y  NG
Sbjct  110  HAVRLGNEASIRQRLAVTRGAYYAVTFSAARTCAQAEQLNVSVSPEWGVLPMQTIYGSNG  169

Query  499  WDCYAWAFQ  525
            WD YAWAF+
Sbjct  170  WDSYAWAFK  178



>gb|ACJ84308.1| unknown [Medicago truncatula]
Length=376

 Score =   179 bits (455),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 84/128 (66%), Positives = 103/128 (80%), Gaps = 1/128 (1%)
 Frame = +1

Query  145  DGLLVNGNFEAPVKKTDLNGTIVTR-HDAVPGWTVTGFVEYIQAGQKQGDMQLVVPEGFA  321
            DGL+ NGNFE   K T+L GT+VT   +++P W ++G VEY+++GQKQGDM LVVPEG  
Sbjct  34   DGLVANGNFELGPKPTELKGTVVTGGKNSIPEWEISGLVEYVKSGQKQGDMLLVVPEGAY  93

Query  322  AVRLGNEASIKQTLNVSKGMYYSITFCAARTCAQEERLNITVAPDSGVLPIQTLYSINGW  501
            AVRLGNEASIKQ + V KGMYYSITF  ARTCAQEER+NI+VAPD GV+PIQTLY+ +GW
Sbjct  94   AVRLGNEASIKQRIKVIKGMYYSITFMVARTCAQEERINISVAPDFGVIPIQTLYTSSGW  153

Query  502  DCYAWAFQ  525
            D  A+ F+
Sbjct  154  DPIAYGFK  161



>ref|NP_001053189.1| Os04g0494800 [Oryza sativa Japonica Group]
 dbj|BAF15103.1| Os04g0494800 [Oryza sativa Japonica Group]
Length=379

 Score =   179 bits (455),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 83/128 (65%), Positives = 102/128 (80%), Gaps = 0/128 (0%)
 Frame = +1

Query  142  TDGLLVNGNFEAPVKKTDLNGTIVTRHDAVPGWTVTGFVEYIQAGQKQGDMQLVVPEGFA  321
            TDGLL NGNFE    K+ +NGT VT   A+P W ++GFVEYI +GQKQGDM L VPEG  
Sbjct  33   TDGLLPNGNFEEAPDKSQMNGTRVTGRYAIPQWEISGFVEYIGSGQKQGDMLLPVPEGAY  92

Query  322  AVRLGNEASIKQTLNVSKGMYYSITFCAARTCAQEERLNITVAPDSGVLPIQTLYSINGW  501
            AVRLGNEASI+Q L +++GM+YSITF AARTCAQ E LNIT+ P+SG +PIQT+Y+ +GW
Sbjct  93   AVRLGNEASIQQRLTLTRGMHYSITFSAARTCAQSELLNITITPESGEIPIQTVYTSSGW  152

Query  502  DCYAWAFQ  525
            D Y+WAF+
Sbjct  153  DSYSWAFK  160



>ref|XP_010654739.1| PREDICTED: uncharacterized protein LOC100261739 [Vitis vinifera]
Length=372

 Score =   179 bits (455),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 86/133 (65%), Positives = 103/133 (77%), Gaps = 5/133 (4%)
 Frame = +1

Query  142  TDGLLVNGNFEAPVKKTDLNGTIVTRHDAVPGWTVTGFVEYIQAGQKQGDMQLVVPEGFA  321
            T+GLL NGNFE   K  ++ GT V    A+P W ++G+VEYI++GQKQGDM L+VPEG  
Sbjct  23   TNGLLPNGNFEYGPKPWEMKGTKVMASRAIPKWEISGYVEYIKSGQKQGDMLLIVPEGAY  82

Query  322  AVRLGNEASIKQTLNVSKGMYYSITFCAARTCAQEERLNITVAPDS-----GVLPIQTLY  486
            AVRLGNEASIKQ + V KGMYYSITF AARTCAQEE LN++VAP+S     G+LP+QT+Y
Sbjct  83   AVRLGNEASIKQKVKVVKGMYYSITFSAARTCAQEETLNVSVAPNSEANDWGMLPMQTMY  142

Query  487  SINGWDCYAWAFQ  525
            S NGWD YAW FQ
Sbjct  143  SSNGWDSYAWGFQ  155



>gb|EAY94676.1| hypothetical protein OsI_16455 [Oryza sativa Indica Group]
Length=379

 Score =   179 bits (455),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 83/128 (65%), Positives = 102/128 (80%), Gaps = 0/128 (0%)
 Frame = +1

Query  142  TDGLLVNGNFEAPVKKTDLNGTIVTRHDAVPGWTVTGFVEYIQAGQKQGDMQLVVPEGFA  321
            TDGLL NGNFE    K+ +NGT VT   A+P W ++GFVEYI +GQKQGDM L VPEG  
Sbjct  33   TDGLLPNGNFEEAPDKSQMNGTRVTGRYAIPQWEISGFVEYIGSGQKQGDMLLPVPEGAY  92

Query  322  AVRLGNEASIKQTLNVSKGMYYSITFCAARTCAQEERLNITVAPDSGVLPIQTLYSINGW  501
            AVRLGNEASI+Q L +++GM+YSITF AARTCAQ E LNIT+ P+SG +PIQT+Y+ +GW
Sbjct  93   AVRLGNEASIQQRLTLTRGMHYSITFSAARTCAQSELLNITITPESGEIPIQTVYTSSGW  152

Query  502  DCYAWAFQ  525
            D Y+WAF+
Sbjct  153  DSYSWAFK  160



>ref|XP_002303263.1| hypothetical protein POPTR_0003s05850g [Populus trichocarpa]
 gb|EEE78242.1| hypothetical protein POPTR_0003s05850g [Populus trichocarpa]
Length=374

 Score =   179 bits (455),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 80/133 (60%), Positives = 107/133 (80%), Gaps = 5/133 (4%)
 Frame = +1

Query  142  TDGLLVNGNFEAPVKKTDLNGTIVTRHDAVPGWTVTGFVEYIQAGQKQGDMQLVVPEGFA  321
            TDGLL NG+FE   + +++ GT+VT  +A+P W ++GF+EYI++G KQGDM LVVP G  
Sbjct  22   TDGLLPNGDFEQGPRPSEMKGTVVTAKNAIPNWEISGFIEYIKSGHKQGDMVLVVPAGAY  81

Query  322  AVRLGNEASIKQTLNVSKGMYYSITFCAARTCAQEERLNITVAPDS-----GVLPIQTLY  486
            AVRLGNEASIKQ + V++G++YS+TF  ARTCAQEE+LN++V+P+S     G+LP+QT+Y
Sbjct  82   AVRLGNEASIKQRVKVTQGLFYSLTFNVARTCAQEEKLNVSVSPNSEPRDWGILPMQTMY  141

Query  487  SINGWDCYAWAFQ  525
            S NGWD YAWAFQ
Sbjct  142  SSNGWDAYAWAFQ  154



>ref|XP_010432718.1| PREDICTED: uncharacterized protein LOC104716937 [Camelina sativa]
Length=365

 Score =   179 bits (454),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 82/127 (65%), Positives = 101/127 (80%), Gaps = 0/127 (0%)
 Frame = +1

Query  145  DGLLVNGNFEAPVKKTDLNGTIVTRHDAVPGWTVTGFVEYIQAGQKQGDMQLVVPEGFAA  324
            DGLL NG+FE   + +D+ GT V    A+P W ++GFVEYI +GQKQGDM LVVP+G  A
Sbjct  24   DGLLPNGDFELGPRHSDMKGTQVINKAAIPNWELSGFVEYIPSGQKQGDMILVVPKGAFA  83

Query  325  VRLGNEASIKQTLNVSKGMYYSITFCAARTCAQEERLNITVAPDSGVLPIQTLYSINGWD  504
            VRLGNEASIKQ ++V KG YYSITF AARTCAQ+ERLN++VAP   V+PIQT+YS +GWD
Sbjct  84   VRLGNEASIKQKISVKKGSYYSITFSAARTCAQDERLNVSVAPHHAVMPIQTVYSSSGWD  143

Query  505  CYAWAFQ  525
             Y+WAF+
Sbjct  144  LYSWAFK  150



>gb|KHG10708.1| Allergen Act d 3 [Gossypium arboreum]
Length=374

 Score =   179 bits (454),  Expect = 4e-51, Method: Compositional matrix adjust.
 Identities = 84/132 (64%), Positives = 102/132 (77%), Gaps = 5/132 (4%)
 Frame = +1

Query  145  DGLLVNGNFEAPVKKTDLNGTIVTRHDAVPGWTVTGFVEYIQAGQKQGDMQLVVPEGFAA  324
            DGLL NGNFE   K ++L GT V    A+P W ++G+VEYI++GQKQGDM L+VPEG  A
Sbjct  24   DGLLPNGNFEYGPKPSELKGTKVMSPKAIPNWEISGYVEYIKSGQKQGDMLLIVPEGGFA  83

Query  325  VRLGNEASIKQTLNVSKGMYYSITFCAARTCAQEERLNITVAP-----DSGVLPIQTLYS  489
            VRLGNEA IKQ + V KGM+YS+TF AARTCAQEE+LN++V+P     D G+ PIQT+YS
Sbjct  84   VRLGNEALIKQKIKVIKGMFYSLTFSAARTCAQEEKLNVSVSPNYEKNDFGLFPIQTMYS  143

Query  490  INGWDCYAWAFQ  525
             NGWD YAWAFQ
Sbjct  144  SNGWDSYAWAFQ  155



>emb|CAH67292.1| OSIGBa0103O01.10 [Oryza sativa Indica Group]
Length=373

 Score =   179 bits (454),  Expect = 4e-51, Method: Compositional matrix adjust.
 Identities = 83/128 (65%), Positives = 102/128 (80%), Gaps = 0/128 (0%)
 Frame = +1

Query  142  TDGLLVNGNFEAPVKKTDLNGTIVTRHDAVPGWTVTGFVEYIQAGQKQGDMQLVVPEGFA  321
            TDGLL NGNFE    K+ +NGT VT   A+P W ++GFVEYI +GQKQGDM L VPEG  
Sbjct  27   TDGLLPNGNFEEAPDKSQMNGTRVTGRYAIPQWEISGFVEYIGSGQKQGDMLLPVPEGAY  86

Query  322  AVRLGNEASIKQTLNVSKGMYYSITFCAARTCAQEERLNITVAPDSGVLPIQTLYSINGW  501
            AVRLGNEASI+Q L +++GM+YSITF AARTCAQ E LNIT+ P+SG +PIQT+Y+ +GW
Sbjct  87   AVRLGNEASIQQRLTLTRGMHYSITFSAARTCAQSELLNITITPESGEIPIQTVYTSSGW  146

Query  502  DCYAWAFQ  525
            D Y+WAF+
Sbjct  147  DSYSWAFK  154



>ref|XP_004978106.1| PREDICTED: uncharacterized protein LOC101761311 [Setaria italica]
Length=381

 Score =   179 bits (454),  Expect = 4e-51, Method: Compositional matrix adjust.
 Identities = 85/127 (67%), Positives = 98/127 (77%), Gaps = 0/127 (0%)
 Frame = +1

Query  145  DGLLVNGNFEAPVKKTDLNGTIVTRHDAVPGWTVTGFVEYIQAGQKQGDMQLVVPEGFAA  324
            DGLL NGNFE     + LNGT V    A+P W ++GFVEYI   QKQGDM L VPEG  A
Sbjct  34   DGLLPNGNFEEAPATSQLNGTRVMGRYAIPHWEISGFVEYIGPAQKQGDMILPVPEGAYA  93

Query  325  VRLGNEASIKQTLNVSKGMYYSITFCAARTCAQEERLNITVAPDSGVLPIQTLYSINGWD  504
            VRLGNEASI+Q LNV++  YYSITF AARTCAQ ERLN+TVAP+S VLPIQT+Y+ NGWD
Sbjct  94   VRLGNEASIRQLLNVTRKAYYSITFSAARTCAQAERLNVTVAPESDVLPIQTVYTANGWD  153

Query  505  CYAWAFQ  525
             Y+WAF+
Sbjct  154  SYSWAFK  160



>ref|XP_008362680.1| PREDICTED: uncharacterized protein LOC103426358 [Malus domestica]
Length=361

 Score =   179 bits (453),  Expect = 4e-51, Method: Compositional matrix adjust.
 Identities = 84/130 (65%), Positives = 101/130 (78%), Gaps = 5/130 (4%)
 Frame = +1

Query  148  GLLVNGNFEAPVKKTDLNGTIVTRHDAVPGWTVTGFVEYIQAGQKQGDMQLVVPEGFAAV  327
            GLL NGNFE   K+++L GT+VT   A+P W ++GFVEYI++GQKQGDM LVVPEG  AV
Sbjct  19   GLLPNGNFEYGPKQSELKGTVVTNPHAIPNWEISGFVEYIKSGQKQGDMLLVVPEGGFAV  78

Query  328  RLGNEASIKQTLNVSKGMYYSITFCAARTCAQEERLNITVAPD-----SGVLPIQTLYSI  492
            RLGNEASIKQ L V KG +YSITF AARTCAQEE LN+++ P+      G++PIQT+YS 
Sbjct  79   RLGNEASIKQKLKVKKGEFYSITFSAARTCAQEETLNVSITPNLEKRHRGIMPIQTMYSS  138

Query  493  NGWDCYAWAF  522
            NGWD YAW F
Sbjct  139  NGWDSYAWGF  148



>ref|XP_002455939.1| hypothetical protein SORBIDRAFT_03g027650 [Sorghum bicolor]
 gb|EES01059.1| hypothetical protein SORBIDRAFT_03g027650 [Sorghum bicolor]
Length=375

 Score =   179 bits (454),  Expect = 5e-51, Method: Compositional matrix adjust.
 Identities = 83/129 (64%), Positives = 103/129 (80%), Gaps = 1/129 (1%)
 Frame = +1

Query  142  TDGLLVNGNFE-APVKKTDLNGTIVTRHDAVPGWTVTGFVEYIQAGQKQGDMQLVVPEGF  318
            TDGLL NGNFE  P K   +NGT+V+  +A+P W  +GFVEYI++G KQGDM LVVP+G 
Sbjct  22   TDGLLPNGNFEDGPPKSALVNGTVVSGANAIPRWETSGFVEYIESGHKQGDMLLVVPQGA  81

Query  319  AAVRLGNEASIKQTLNVSKGMYYSITFCAARTCAQEERLNITVAPDSGVLPIQTLYSING  498
             AVRLGNEASI+Q L V++G YY+ITF AARTCAQ E LN++V+P+ GVLP+QT+Y  NG
Sbjct  82   HAVRLGNEASIRQRLAVARGAYYAITFSAARTCAQAEALNVSVSPEWGVLPMQTIYGSNG  141

Query  499  WDCYAWAFQ  525
            WD YAWAF+
Sbjct  142  WDSYAWAFK  150



>gb|AAB41813.1| unknown protein [Medicago sativa]
Length=375

 Score =   179 bits (454),  Expect = 5e-51, Method: Compositional matrix adjust.
 Identities = 84/128 (66%), Positives = 103/128 (80%), Gaps = 1/128 (1%)
 Frame = +1

Query  145  DGLLVNGNFEAPVKKTDLNGTIVTR-HDAVPGWTVTGFVEYIQAGQKQGDMQLVVPEGFA  321
            DGL+ NGNFE   K ++L GT+VT   +++P W ++G VEYI++GQKQGDM LVVPEG  
Sbjct  33   DGLVANGNFELGPKPSELKGTVVTGGKNSIPEWEISGLVEYIKSGQKQGDMLLVVPEGAY  92

Query  322  AVRLGNEASIKQTLNVSKGMYYSITFCAARTCAQEERLNITVAPDSGVLPIQTLYSINGW  501
            AVRLGNEASIKQ + V KGMYYSITF  ARTCAQEER+NI+VAPD GV+PIQTLY+ +GW
Sbjct  93   AVRLGNEASIKQRIKVIKGMYYSITFMVARTCAQEERINISVAPDFGVIPIQTLYTSSGW  152

Query  502  DCYAWAFQ  525
            D  A+ F+
Sbjct  153  DPIAYGFK  160



>ref|XP_010445004.1| PREDICTED: uncharacterized protein LOC104727612, partial [Camelina 
sativa]
Length=325

 Score =   177 bits (450),  Expect = 5e-51, Method: Compositional matrix adjust.
 Identities = 82/127 (65%), Positives = 100/127 (79%), Gaps = 0/127 (0%)
 Frame = +1

Query  145  DGLLVNGNFEAPVKKTDLNGTIVTRHDAVPGWTVTGFVEYIQAGQKQGDMQLVVPEGFAA  324
            DGLL NG+FE   + +D+ GT V    A+P W ++GFVEYI +GQKQGDM LVVP+G  A
Sbjct  24   DGLLPNGDFELGPRHSDMKGTQVINKAAIPNWELSGFVEYIPSGQKQGDMILVVPKGAFA  83

Query  325  VRLGNEASIKQTLNVSKGMYYSITFCAARTCAQEERLNITVAPDSGVLPIQTLYSINGWD  504
            VRLGNEASIKQ + V KG YYSITF AARTCAQ+ERLN++VAP   V+PIQT+YS +GWD
Sbjct  84   VRLGNEASIKQKIIVKKGSYYSITFSAARTCAQDERLNVSVAPHHAVMPIQTVYSSSGWD  143

Query  505  CYAWAFQ  525
             Y+WAF+
Sbjct  144  LYSWAFK  150



>gb|KJB68131.1| hypothetical protein B456_010G227400 [Gossypium raimondii]
Length=374

 Score =   179 bits (453),  Expect = 5e-51, Method: Compositional matrix adjust.
 Identities = 83/132 (63%), Positives = 102/132 (77%), Gaps = 5/132 (4%)
 Frame = +1

Query  145  DGLLVNGNFEAPVKKTDLNGTIVTRHDAVPGWTVTGFVEYIQAGQKQGDMQLVVPEGFAA  324
            DGLL NGNFE   K ++L GT V    A+P W ++G+VEYI++GQKQGDM L+VPEG  A
Sbjct  24   DGLLPNGNFEYGPKPSELKGTKVMSPKAIPNWEISGYVEYIKSGQKQGDMLLIVPEGGFA  83

Query  325  VRLGNEASIKQTLNVSKGMYYSITFCAARTCAQEERLNITVAP-----DSGVLPIQTLYS  489
            VRLGNEA IKQ + V KGM+YS+TF AARTCAQEE+LN++++P     D G+ PIQT+YS
Sbjct  84   VRLGNEALIKQKIKVIKGMFYSLTFSAARTCAQEEKLNVSISPNYEKNDFGLFPIQTMYS  143

Query  490  INGWDCYAWAFQ  525
             NGWD YAWAFQ
Sbjct  144  SNGWDSYAWAFQ  155



>gb|KJB80694.1| hypothetical protein B456_013G110800 [Gossypium raimondii]
Length=325

 Score =   177 bits (449),  Expect = 6e-51, Method: Compositional matrix adjust.
 Identities = 82/110 (75%), Positives = 93/110 (85%), Gaps = 0/110 (0%)
 Frame = +1

Query  196  LNGTIVTRHDAVPGWTVTGFVEYIQAGQKQGDMQLVVPEGFAAVRLGNEASIKQTLNVSK  375
            + GT+V    A+PGW   GFVEYI++GQKQGDM LVVPEG  AVRLGNEASIKQ + V K
Sbjct  1    MKGTVVVGRYAIPGWVNEGFVEYIKSGQKQGDMLLVVPEGAYAVRLGNEASIKQEIKVVK  60

Query  376  GMYYSITFCAARTCAQEERLNITVAPDSGVLPIQTLYSINGWDCYAWAFQ  525
            GMYYSITF AARTCAQEERLN+TVAPDSGV+PIQT+YS +GWD YAWAF+
Sbjct  61   GMYYSITFSAARTCAQEERLNVTVAPDSGVMPIQTVYSSSGWDNYAWAFK  110



>ref|XP_004498654.1| PREDICTED: uncharacterized protein LOC101508759 [Cicer arietinum]
Length=366

 Score =   178 bits (452),  Expect = 8e-51, Method: Compositional matrix adjust.
 Identities = 83/128 (65%), Positives = 102/128 (80%), Gaps = 1/128 (1%)
 Frame = +1

Query  145  DGLLVNGNFEAPVKKTDLNGTIVTR-HDAVPGWTVTGFVEYIQAGQKQGDMQLVVPEGFA  321
            DGL+ NGNFE   K +DL GT++T    A+P W ++GFVEYI++GQKQGDM LVVPEG  
Sbjct  24   DGLVANGNFELGPKASDLKGTVITGGKTAIPEWEISGFVEYIKSGQKQGDMLLVVPEGAY  83

Query  322  AVRLGNEASIKQTLNVSKGMYYSITFCAARTCAQEERLNITVAPDSGVLPIQTLYSINGW  501
            AVRLGNEASIKQ + V KGM+YSITF  ARTCAQEER+NI+VAPD G++PIQTLY+ +GW
Sbjct  84   AVRLGNEASIKQRIKVIKGMHYSITFMVARTCAQEERINISVAPDFGIIPIQTLYTSSGW  143

Query  502  DCYAWAFQ  525
            D   + F+
Sbjct  144  DPIGYGFK  151



>ref|XP_006652463.1| PREDICTED: uncharacterized protein LOC102714172 [Oryza brachyantha]
Length=378

 Score =   178 bits (452),  Expect = 8e-51, Method: Compositional matrix adjust.
 Identities = 86/129 (67%), Positives = 103/129 (80%), Gaps = 2/129 (2%)
 Frame = +1

Query  145  DGLLVNGNFEAPVKKTDLNGTIVTRHDAVPGWTVTGFVEYIQAGQKQGDMQLVVPEGFAA  324
            DGLL NGNFE    K+ +NGT V    A+P W VTGFVEYI +GQKQGDM L VPEG  A
Sbjct  26   DGLLQNGNFEYSPNKSQMNGTRVMGEYAIPYWKVTGFVEYIASGQKQGDMLLTVPEGAHA  85

Query  325  VRLGNEASIKQTLNVSKGMYYSITFCAARTCAQEERLNITVA--PDSGVLPIQTLYSING  498
            VRLGNEASI+Q ++V++GMYYSITF AARTCAQ E+LN++VA  P+SG LPIQT+Y+ +G
Sbjct  86   VRLGNEASIQQQISVTRGMYYSITFSAARTCAQSEKLNVSVAPGPESGELPIQTVYTSSG  145

Query  499  WDCYAWAFQ  525
            WD YAWAF+
Sbjct  146  WDSYAWAFK  154



>ref|XP_011466736.1| PREDICTED: uncharacterized protein LOC101306247 isoform X1 [Fragaria 
vesca subsp. vesca]
Length=373

 Score =   178 bits (452),  Expect = 8e-51, Method: Compositional matrix adjust.
 Identities = 84/132 (64%), Positives = 101/132 (77%), Gaps = 5/132 (4%)
 Frame = +1

Query  142  TDGLLVNGNFEAPVKKTDLNGTIVTRHDAVPGWTVTGFVEYIQAGQKQGDMQLVVPEGFA  321
            TDGLL NGNFE   K + + GT+VT H+A+P W  +G+VEYI++G KQGDM LVVPEG  
Sbjct  23   TDGLLPNGNFEYGPKPSQMKGTVVTAHNAIPNWETSGYVEYIKSGHKQGDMLLVVPEGGF  82

Query  322  AVRLGNEASIKQTLNVSKGMYYSITFCAARTCAQEERLNITVAP-----DSGVLPIQTLY  486
            A+RLGNEASIKQ + V+KG +Y+ITF AARTCAQEE LNI+V P     D G+LPIQT+Y
Sbjct  83   AIRLGNEASIKQKIKVTKGGFYAITFSAARTCAQEEILNISVNPNVEKQDFGILPIQTMY  142

Query  487  SINGWDCYAWAF  522
            S  GWD YAW F
Sbjct  143  SSTGWDSYAWGF  154



>emb|CBI36253.3| unnamed protein product [Vitis vinifera]
Length=405

 Score =   179 bits (454),  Expect = 9e-51, Method: Compositional matrix adjust.
 Identities = 86/133 (65%), Positives = 103/133 (77%), Gaps = 5/133 (4%)
 Frame = +1

Query  142  TDGLLVNGNFEAPVKKTDLNGTIVTRHDAVPGWTVTGFVEYIQAGQKQGDMQLVVPEGFA  321
            T+GLL NGNFE   K  ++ GT V    A+P W ++G+VEYI++GQKQGDM L+VPEG  
Sbjct  23   TNGLLPNGNFEYGPKPWEMKGTKVMASRAIPKWEISGYVEYIKSGQKQGDMLLIVPEGAY  82

Query  322  AVRLGNEASIKQTLNVSKGMYYSITFCAARTCAQEERLNITVAPDS-----GVLPIQTLY  486
            AVRLGNEASIKQ + V KGMYYSITF AARTCAQEE LN++VAP+S     G+LP+QT+Y
Sbjct  83   AVRLGNEASIKQKVKVVKGMYYSITFSAARTCAQEETLNVSVAPNSEANDWGMLPMQTMY  142

Query  487  SINGWDCYAWAFQ  525
            S NGWD YAW FQ
Sbjct  143  SSNGWDSYAWGFQ  155



>gb|KHN44154.1| hypothetical protein glysoja_031815 [Glycine soja]
Length=374

 Score =   178 bits (452),  Expect = 9e-51, Method: Compositional matrix adjust.
 Identities = 84/133 (63%), Positives = 103/133 (77%), Gaps = 5/133 (4%)
 Frame = +1

Query  142  TDGLLVNGNFEAPVKKTDLNGTIVTRHDAVPGWTVTGFVEYIQAGQKQGDMQLVVPEGFA  321
            TDGLL NGNFE   K + L G++VT HDA+P WT++GFVEYI++GQKQGDM LVVPEG  
Sbjct  24   TDGLLPNGNFEQGPKPSQLKGSVVTGHDAIPNWTISGFVEYIKSGQKQGDMLLVVPEGDY  83

Query  322  AVRLGNEASIKQTLNVSKGMYYSITFCAARTCAQEERLNITVAP-----DSGVLPIQTLY  486
            AVRLGNEASIKQ L + KG +YSITF AARTCAQEE+LN++V P     D G++PIQT+Y
Sbjct  84   AVRLGNEASIKQKLKLIKGSFYSITFSAARTCAQEEKLNVSVVPTTEKRDWGIIPIQTMY  143

Query  487  SINGWDCYAWAFQ  525
              NGW+ +   F+
Sbjct  144  GSNGWESFTCGFR  156



>dbj|BAK03627.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=371

 Score =   178 bits (451),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 82/129 (64%), Positives = 102/129 (79%), Gaps = 1/129 (1%)
 Frame = +1

Query  142  TDGLLVNGNFEA-PVKKTDLNGTIVTRHDAVPGWTVTGFVEYIQAGQKQGDMQLVVPEGF  318
            TDGLL NGNFE  P K   +NGT+V    A+P W  +GFVEYI++G KQGDM LVVP+G 
Sbjct  22   TDGLLPNGNFELDPAKSELVNGTVVKGGKAIPKWETSGFVEYIESGHKQGDMLLVVPQGA  81

Query  319  AAVRLGNEASIKQTLNVSKGMYYSITFCAARTCAQEERLNITVAPDSGVLPIQTLYSING  498
             AVRLGN+ASI Q + V++G YY++TF AARTCAQ ERLN++V+P+SGVLP+QT+Y  NG
Sbjct  82   YAVRLGNDASILQRIPVARGSYYAVTFSAARTCAQAERLNVSVSPESGVLPMQTIYGSNG  141

Query  499  WDCYAWAFQ  525
            WD YAWAF+
Sbjct  142  WDSYAWAFK  150



>ref|XP_002446725.1| hypothetical protein SORBIDRAFT_06g021290 [Sorghum bicolor]
 gb|EES11053.1| hypothetical protein SORBIDRAFT_06g021290 [Sorghum bicolor]
Length=374

 Score =   177 bits (450),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 84/127 (66%), Positives = 100/127 (79%), Gaps = 0/127 (0%)
 Frame = +1

Query  145  DGLLVNGNFEAPVKKTDLNGTIVTRHDAVPGWTVTGFVEYIQAGQKQGDMQLVVPEGFAA  324
            DGLL NGNFE    K++LNGT V   DA+P W ++GFVEYI  GQKQGDM L VPEG  A
Sbjct  26   DGLLPNGNFEEAPAKSELNGTRVKGRDAIPHWEISGFVEYIGPGQKQGDMILPVPEGAYA  85

Query  325  VRLGNEASIKQTLNVSKGMYYSITFCAARTCAQEERLNITVAPDSGVLPIQTLYSINGWD  504
            VRLGNEASI+Q L V++G  YS+TF AARTCAQ E+LN+TVA DS VLPIQT+Y+ +GWD
Sbjct  86   VRLGNEASIQQRLAVTQGARYSVTFSAARTCAQAEQLNVTVATDSDVLPIQTVYTSSGWD  145

Query  505  CYAWAFQ  525
             Y+WAF+
Sbjct  146  SYSWAFE  152



>dbj|BAE98407.1| hypothetical protein [Arabidopsis thaliana]
Length=365

 Score =   177 bits (448),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 81/127 (64%), Positives = 100/127 (79%), Gaps = 0/127 (0%)
 Frame = +1

Query  145  DGLLVNGNFEAPVKKTDLNGTIVTRHDAVPGWTVTGFVEYIQAGQKQGDMQLVVPEGFAA  324
            DGLL NG+FE   + +D+ GT V    A+P W ++GFVEYI +G KQGDM LVVP+G  A
Sbjct  24   DGLLPNGDFELGPRHSDMKGTQVINITAIPNWELSGFVEYIPSGHKQGDMILVVPKGAFA  83

Query  325  VRLGNEASIKQTLNVSKGMYYSITFCAARTCAQEERLNITVAPDSGVLPIQTLYSINGWD  504
            VRLGNEASIKQ ++V KG YYSITF AARTCAQ+ERLN++VAP   V+PIQT+YS +GWD
Sbjct  84   VRLGNEASIKQKISVKKGSYYSITFSAARTCAQDERLNVSVAPHHAVMPIQTVYSSSGWD  143

Query  505  CYAWAFQ  525
             Y+WAF+
Sbjct  144  LYSWAFK  150



>ref|XP_004486698.1| PREDICTED: uncharacterized protein LOC101495368 [Cicer arietinum]
Length=373

 Score =   177 bits (449),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 80/133 (60%), Positives = 104/133 (78%), Gaps = 5/133 (4%)
 Frame = +1

Query  142  TDGLLVNGNFEAPVKKTDLNGTIVTRHDAVPGWTVTGFVEYIQAGQKQGDMQLVVPEGFA  321
            TDGLL NG+FE   K ++L G++VT HD +P WT++GFVEYI++GQKQGDM L+VPEG  
Sbjct  22   TDGLLPNGDFEVGPKASELKGSVVTSHDGIPNWTISGFVEYIKSGQKQGDMLLIVPEGAY  81

Query  322  AVRLGNEASIKQTLNVSKGMYYSITFCAARTCAQEERLNITVAP-----DSGVLPIQTLY  486
            AVRLGNEA IKQ + ++KG +YSITF AARTCAQEE+LN++V P     D G++PIQT+Y
Sbjct  82   AVRLGNEAYIKQKVKLNKGSFYSITFSAARTCAQEEKLNVSVVPTTEKRDYGIIPIQTMY  141

Query  487  SINGWDCYAWAFQ  525
              NGW+ +A  F+
Sbjct  142  GSNGWESFACGFK  154



>ref|NP_567894.1| uncharacterized protein [Arabidopsis thaliana]
 ref|NP_974661.1| uncharacterized protein [Arabidopsis thaliana]
 gb|AAM65206.1| unknown [Arabidopsis thaliana]
 gb|ABF19001.1| At4g32460 [Arabidopsis thaliana]
 gb|AEE86063.1| uncharacterized protein AT4G32460 [Arabidopsis thaliana]
 gb|AEE86064.1| uncharacterized protein AT4G32460 [Arabidopsis thaliana]
Length=365

 Score =   177 bits (448),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 81/127 (64%), Positives = 100/127 (79%), Gaps = 0/127 (0%)
 Frame = +1

Query  145  DGLLVNGNFEAPVKKTDLNGTIVTRHDAVPGWTVTGFVEYIQAGQKQGDMQLVVPEGFAA  324
            DGLL NG+FE   + +D+ GT V    A+P W ++GFVEYI +G KQGDM LVVP+G  A
Sbjct  24   DGLLPNGDFELGPRHSDMKGTQVINITAIPNWELSGFVEYIPSGHKQGDMILVVPKGAFA  83

Query  325  VRLGNEASIKQTLNVSKGMYYSITFCAARTCAQEERLNITVAPDSGVLPIQTLYSINGWD  504
            VRLGNEASIKQ ++V KG YYSITF AARTCAQ+ERLN++VAP   V+PIQT+YS +GWD
Sbjct  84   VRLGNEASIKQKISVKKGSYYSITFSAARTCAQDERLNVSVAPHHAVMPIQTVYSSSGWD  143

Query  505  CYAWAFQ  525
             Y+WAF+
Sbjct  144  LYSWAFK  150



>ref|XP_003526423.1| PREDICTED: uncharacterized protein LOC100801917 [Glycine max]
Length=365

 Score =   177 bits (448),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 84/129 (65%), Positives = 100/129 (78%), Gaps = 1/129 (1%)
 Frame = +1

Query  142  TDGLLVNGNFEAPVKKTDLNGTIVTRH-DAVPGWTVTGFVEYIQAGQKQGDMQLVVPEGF  318
            TDG + N  FE   K  D+ GT+VT    A+PGW ++GF+EY+++GQKQGDM LVVP G 
Sbjct  20   TDGSIANAEFEFGPKPQDMKGTVVTGGPHAIPGWEISGFIEYLKSGQKQGDMLLVVPNGA  79

Query  319  AAVRLGNEASIKQTLNVSKGMYYSITFCAARTCAQEERLNITVAPDSGVLPIQTLYSING  498
             AVRLGN ASIKQ + V KGMYYSITF  ARTCAQEE+LN++VAPD  VLP+QTLYS NG
Sbjct  80   YAVRLGNGASIKQKIKVVKGMYYSITFMVARTCAQEEKLNVSVAPDWVVLPMQTLYSGNG  139

Query  499  WDCYAWAFQ  525
            WD YAW+FQ
Sbjct  140  WDAYAWSFQ  148



>tpg|DAA37152.1| TPA: hypothetical protein ZEAMMB73_071426 [Zea mays]
Length=379

 Score =   177 bits (449),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 84/127 (66%), Positives = 100/127 (79%), Gaps = 0/127 (0%)
 Frame = +1

Query  145  DGLLVNGNFEAPVKKTDLNGTIVTRHDAVPGWTVTGFVEYIQAGQKQGDMQLVVPEGFAA  324
            DGLL NGNFE    K+ LNGT V   +A+P W ++G+VEYI +GQKQGDM L VPEG  A
Sbjct  32   DGLLPNGNFEEAPPKSQLNGTRVMGRNAIPHWEISGYVEYIGSGQKQGDMLLPVPEGAYA  91

Query  325  VRLGNEASIKQTLNVSKGMYYSITFCAARTCAQEERLNITVAPDSGVLPIQTLYSINGWD  504
            VRLGNEASI+Q L V+ G  YSITF AARTCAQ E+LN+TVAP+S VLPIQT+Y+ +GWD
Sbjct  92   VRLGNEASIQQRLAVTPGARYSITFSAARTCAQAEQLNVTVAPESDVLPIQTVYTSSGWD  151

Query  505  CYAWAFQ  525
             Y+WAFQ
Sbjct  152  SYSWAFQ  158



>ref|XP_002867243.1| hypothetical protein ARALYDRAFT_913203 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH43502.1| hypothetical protein ARALYDRAFT_913203 [Arabidopsis lyrata subsp. 
lyrata]
Length=365

 Score =   177 bits (448),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 81/127 (64%), Positives = 100/127 (79%), Gaps = 0/127 (0%)
 Frame = +1

Query  145  DGLLVNGNFEAPVKKTDLNGTIVTRHDAVPGWTVTGFVEYIQAGQKQGDMQLVVPEGFAA  324
            DGLL NG+FE   + +D+ GT V    A+P W ++GFVEYI +G KQGDM LVVP+G  A
Sbjct  24   DGLLPNGDFELGPRHSDMKGTQVINITAIPNWELSGFVEYIPSGHKQGDMILVVPKGAFA  83

Query  325  VRLGNEASIKQTLNVSKGMYYSITFCAARTCAQEERLNITVAPDSGVLPIQTLYSINGWD  504
            VRLGNEASIKQ ++V KG YYSITF AARTCAQ+ERLN++VAP   V+PIQT+YS +GWD
Sbjct  84   VRLGNEASIKQKISVKKGSYYSITFSAARTCAQDERLNVSVAPHHAVMPIQTVYSSSGWD  143

Query  505  CYAWAFQ  525
             Y+WAF+
Sbjct  144  LYSWAFK  150



>ref|XP_010447383.1| PREDICTED: uncharacterized protein LOC104730027 [Camelina sativa]
Length=365

 Score =   177 bits (448),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 80/127 (63%), Positives = 101/127 (80%), Gaps = 0/127 (0%)
 Frame = +1

Query  145  DGLLVNGNFEAPVKKTDLNGTIVTRHDAVPGWTVTGFVEYIQAGQKQGDMQLVVPEGFAA  324
            DGLL NG+FE   + +D+ GT V    ++P W ++GFVEYI +G+KQGDM LVVP+G  A
Sbjct  24   DGLLPNGDFELGPRHSDMKGTQVINKTSIPNWELSGFVEYIPSGKKQGDMILVVPKGAFA  83

Query  325  VRLGNEASIKQTLNVSKGMYYSITFCAARTCAQEERLNITVAPDSGVLPIQTLYSINGWD  504
            VRLGNEASIKQ ++V KG YYSITF AARTCAQ+ERLN++VAP   V+PIQT+YS +GWD
Sbjct  84   VRLGNEASIKQKISVKKGSYYSITFSAARTCAQDERLNVSVAPHHAVMPIQTVYSSSGWD  143

Query  505  CYAWAFQ  525
             Y+WAF+
Sbjct  144  LYSWAFK  150



>ref|XP_006389772.1| hypothetical protein EUTSA_v10018730mg [Eutrema salsugineum]
 gb|ESQ27058.1| hypothetical protein EUTSA_v10018730mg [Eutrema salsugineum]
Length=372

 Score =   177 bits (448),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 83/127 (65%), Positives = 98/127 (77%), Gaps = 0/127 (0%)
 Frame = +1

Query  145  DGLLVNGNFEAPVKKTDLNGTIVTRHDAVPGWTVTGFVEYIQAGQKQGDMQLVVPEGFAA  324
            DGLL NGNFE   K + L G++V    AVP W +TG VEYI+AGQKQ DM LVVPEG +A
Sbjct  29   DGLLPNGNFEKGPKPSQLKGSVVKERSAVPNWDMTGLVEYIKAGQKQDDMVLVVPEGSSA  88

Query  325  VRLGNEASIKQTLNVSKGMYYSITFCAARTCAQEERLNITVAPDSGVLPIQTLYSINGWD  504
            VRLGNEASI Q ++V  G  YSITF AARTCAQ+ERLNI+V  +SGV+PIQTLY  +GWD
Sbjct  89   VRLGNEASISQKISVRSGRLYSITFSAARTCAQDERLNISVTHESGVIPIQTLYGSDGWD  148

Query  505  CYAWAFQ  525
             Y+WAF+
Sbjct  149  SYSWAFK  155



>ref|XP_003597843.1| hypothetical protein MTR_2g103170 [Medicago truncatula]
 gb|AES68094.1| plant/F18G18-200 protein [Medicago truncatula]
Length=373

 Score =   177 bits (448),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 83/133 (62%), Positives = 104/133 (78%), Gaps = 5/133 (4%)
 Frame = +1

Query  142  TDGLLVNGNFEAPVKKTDLNGTIVTRHDAVPGWTVTGFVEYIQAGQKQGDMQLVVPEGFA  321
            TDGLL NG+FE   K ++L GT+VT HDA+P WTV+G+VEYI++GQKQGDM LVVPEG  
Sbjct  22   TDGLLPNGDFEVGPKASNLKGTVVTTHDAIPNWTVSGYVEYIKSGQKQGDMLLVVPEGAY  81

Query  322  AVRLGNEASIKQTLNVSKGMYYSITFCAARTCAQEERLNITVAP-----DSGVLPIQTLY  486
            AVRLGNEA IKQ + ++KG  YSITF AARTCAQEE+LN++V P     D G++PIQT+Y
Sbjct  82   AVRLGNEAYIKQKVKLNKGSSYSITFSAARTCAQEEKLNVSVVPTSEKRDYGIIPIQTMY  141

Query  487  SINGWDCYAWAFQ  525
              NGW+ +A  F+
Sbjct  142  GSNGWESFACGFR  154



>ref|XP_006646088.1| PREDICTED: uncharacterized protein LOC102706903 [Oryza brachyantha]
Length=276

 Score =   174 bits (440),  Expect = 5e-50, Method: Compositional matrix adjust.
 Identities = 83/133 (62%), Positives = 104/133 (78%), Gaps = 5/133 (4%)
 Frame = +1

Query  142  TDG----LLVNGNFEAPVKKTDL-NGTIVTRHDAVPGWTVTGFVEYIQAGQKQGDMQLVV  306
            TDG    LL NGNFE    K+DL NGT+V   +A+P W  +GFVEYI++G KQGDM LVV
Sbjct  29   TDGIISWLLPNGNFEDGPPKSDLVNGTVVRGANAIPRWETSGFVEYIESGHKQGDMLLVV  88

Query  307  PEGFAAVRLGNEASIKQTLNVSKGMYYSITFCAARTCAQEERLNITVAPDSGVLPIQTLY  486
            P+G  AVRLGNEASI+Q L V++G YY++TF AARTCAQ ERLN++V+P+ GVLP+QT+Y
Sbjct  89   PQGAHAVRLGNEASIRQRLAVARGAYYAVTFSAARTCAQAERLNVSVSPEWGVLPMQTIY  148

Query  487  SINGWDCYAWAFQ  525
              +GWD YAWAF+
Sbjct  149  GSSGWDSYAWAFR  161



>gb|ACG40327.1| hypothetical protein [Zea mays]
Length=381

 Score =   176 bits (446),  Expect = 6e-50, Method: Compositional matrix adjust.
 Identities = 84/131 (64%), Positives = 103/131 (79%), Gaps = 3/131 (2%)
 Frame = +1

Query  142  TDGLLVNGNFE-APVKKTDLNGTIVTRHDAVPGWTVTGFVEYIQAGQKQGDMQLVVPEGF  318
            TDGLL NGNFE  P K   +NGT+V+   A+P W  +GFVEYI++G KQGDM LVVP+G 
Sbjct  24   TDGLLPNGNFEDGPPKSALVNGTVVSGAHAIPRWETSGFVEYIESGHKQGDMLLVVPQGA  83

Query  319  AAVRLGNEASIKQTLNVSKGMYYSITFCAARTCAQEE--RLNITVAPDSGVLPIQTLYSI  492
             AVRLGNEASI+Q L V++G YY+ITF AARTCAQ E  RLN++V+P+ GVLP+QT+Y  
Sbjct  84   HAVRLGNEASIRQRLAVARGAYYAITFSAARTCAQAERXRLNVSVSPEWGVLPMQTIYGS  143

Query  493  NGWDCYAWAFQ  525
            NGWD YAWAF+
Sbjct  144  NGWDSYAWAFK  154



>ref|XP_008672703.1| PREDICTED: hypothetical protein isoform X1 [Zea mays]
 gb|ACF84649.1| unknown [Zea mays]
 gb|ACF87605.1| unknown [Zea mays]
 gb|ACF87824.1| unknown [Zea mays]
 tpg|DAA58942.1| TPA: hypothetical protein ZEAMMB73_364218 [Zea mays]
Length=381

 Score =   176 bits (446),  Expect = 6e-50, Method: Compositional matrix adjust.
 Identities = 84/131 (64%), Positives = 103/131 (79%), Gaps = 3/131 (2%)
 Frame = +1

Query  142  TDGLLVNGNFE-APVKKTDLNGTIVTRHDAVPGWTVTGFVEYIQAGQKQGDMQLVVPEGF  318
            TDGLL NGNFE  P K   +NGT+V+   A+P W  +GFVEYI++G KQGDM LVVP+G 
Sbjct  24   TDGLLPNGNFEDGPPKSALVNGTVVSGAHAIPRWETSGFVEYIESGHKQGDMLLVVPQGA  83

Query  319  AAVRLGNEASIKQTLNVSKGMYYSITFCAARTCAQEE--RLNITVAPDSGVLPIQTLYSI  492
             AVRLGNEASI+Q L V++G YY+ITF AARTCAQ E  RLN++V+P+ GVLP+QT+Y  
Sbjct  84   HAVRLGNEASIRQRLAVARGAYYAITFSAARTCAQAERQRLNVSVSPEWGVLPMQTIYGS  143

Query  493  NGWDCYAWAFQ  525
            NGWD YAWAF+
Sbjct  144  NGWDSYAWAFK  154



>ref|XP_003544618.1| PREDICTED: uncharacterized protein LOC100776765 [Glycine max]
 gb|KHN05403.1| hypothetical protein glysoja_046455 [Glycine soja]
Length=366

 Score =   176 bits (445),  Expect = 6e-50, Method: Compositional matrix adjust.
 Identities = 85/129 (66%), Positives = 101/129 (78%), Gaps = 1/129 (1%)
 Frame = +1

Query  142  TDGLLVNGNFEAPVKKTDLNGTIVTR-HDAVPGWTVTGFVEYIQAGQKQGDMQLVVPEGF  318
            TDGL+ NGNFE   K + L GT+V     ++P W ++GFVEYI++GQKQGDM LVVPEG 
Sbjct  23   TDGLVANGNFELGPKPSALKGTVVIGGSHSIPEWEISGFVEYIKSGQKQGDMLLVVPEGA  82

Query  319  AAVRLGNEASIKQTLNVSKGMYYSITFCAARTCAQEERLNITVAPDSGVLPIQTLYSING  498
             AVRLGNEASIKQ + V KGMYYSITF  ARTCAQEERLNI+V PD GV+PIQTLY+ +G
Sbjct  83   YAVRLGNEASIKQRIKVIKGMYYSITFMVARTCAQEERLNISVTPDWGVIPIQTLYTSSG  142

Query  499  WDCYAWAFQ  525
            WD  A+ F+
Sbjct  143  WDPIAFGFK  151



>ref|XP_010061944.1| PREDICTED: uncharacterized protein LOC104449472 [Eucalyptus grandis]
 gb|KCW68990.1| hypothetical protein EUGRSUZ_F02553 [Eucalyptus grandis]
Length=372

 Score =   176 bits (446),  Expect = 6e-50, Method: Compositional matrix adjust.
 Identities = 81/132 (61%), Positives = 103/132 (78%), Gaps = 5/132 (4%)
 Frame = +1

Query  145  DGLLVNGNFEAPVKKTDLNGTIVTRHDAVPGWTVTGFVEYIQAGQKQGDMQLVVPEGFAA  324
            DGLL NG+FE   +++ L GT+VT   A+P W ++G+VEYI++GQKQGDM LVVPEG  A
Sbjct  23   DGLLPNGDFEKGPEQSQLKGTVVTSKTAIPKWGISGYVEYIKSGQKQGDMLLVVPEGEFA  82

Query  325  VRLGNEASIKQTLNVSKGMYYSITFCAARTCAQEERLNITVAP-----DSGVLPIQTLYS  489
            VRLGNEASIKQ + V KG +YS+TF AARTCAQEE+LN++V P     D G+LP+QT+YS
Sbjct  83   VRLGNEASIKQKVKVEKGTFYSVTFSAARTCAQEEKLNVSVTPNHEAHDWGILPMQTMYS  142

Query  490  INGWDCYAWAFQ  525
             NGWD Y W+F+
Sbjct  143  SNGWDSYCWSFR  154



>gb|KDO52908.1| hypothetical protein CISIN_1g0399092mg, partial [Citrus sinensis]
Length=315

 Score =   174 bits (442),  Expect = 7e-50, Method: Compositional matrix adjust.
 Identities = 79/129 (61%), Positives = 102/129 (79%), Gaps = 5/129 (4%)
 Frame = +1

Query  151  LLVNGNFEAPVKKTDLNGTIVTRHDAVPGWTVTGFVEYIQAGQKQGDMQLVVPEGFAAVR  330
            LL NGNFE   K++ + GT+VT  +A+P W ++G+VEYI++G KQGDM L+VPEG  AVR
Sbjct  1    LLPNGNFEYGPKRSQMKGTVVTHPNAIPNWQISGYVEYIKSGHKQGDMLLIVPEGVFAVR  60

Query  331  LGNEASIKQTLNVSKGMYYSITFCAARTCAQEERLNITVAP-----DSGVLPIQTLYSIN  495
            LGNEASIKQ + V+KG +YS+TF AARTCAQEE+LN++V+P     D  +LP+QT+YS N
Sbjct  61   LGNEASIKQNIKVTKGRFYSMTFSAARTCAQEEKLNVSVSPNLETNDWAILPMQTMYSNN  120

Query  496  GWDCYAWAF  522
            GWD YAWAF
Sbjct  121  GWDSYAWAF  129



>ref|NP_001173996.1| Os04g0494950 [Oryza sativa Japonica Group]
 dbj|BAH92724.1| Os04g0494950 [Oryza sativa Japonica Group]
Length=209

 Score =   171 bits (433),  Expect = 8e-50, Method: Compositional matrix adjust.
 Identities = 77/128 (60%), Positives = 102/128 (80%), Gaps = 0/128 (0%)
 Frame = +1

Query  142  TDGLLVNGNFEAPVKKTDLNGTIVTRHDAVPGWTVTGFVEYIQAGQKQGDMQLVVPEGFA  321
            TDGLL NGNFE    K+ LNGT+VT   A+  W ++GFVEYI++G ++ DM L VPEG  
Sbjct  27   TDGLLPNGNFEDGPDKSQLNGTVVTGRYAILNWEISGFVEYIESGHREQDMILAVPEGAR  86

Query  322  AVRLGNEASIKQTLNVSKGMYYSITFCAARTCAQEERLNITVAPDSGVLPIQTLYSINGW  501
            AVRLGN+A+I+Q L+V++  YYSITF AARTCAQ+E+LN++V P+ GVLPIQT+Y+ +GW
Sbjct  87   AVRLGNDATIRQRLSVTRRAYYSITFSAARTCAQKEKLNMSVTPEFGVLPIQTVYTSSGW  146

Query  502  DCYAWAFQ  525
            D Y+WAF+
Sbjct  147  DSYSWAFR  154



>gb|KFK42429.1| hypothetical protein AALP_AA2G255100 [Arabis alpina]
Length=368

 Score =   175 bits (444),  Expect = 9e-50, Method: Compositional matrix adjust.
 Identities = 82/127 (65%), Positives = 98/127 (77%), Gaps = 0/127 (0%)
 Frame = +1

Query  145  DGLLVNGNFEAPVKKTDLNGTIVTRHDAVPGWTVTGFVEYIQAGQKQGDMQLVVPEGFAA  324
            DGLL NGNFE   K + L G+I+    AVP W +TGFVEYI+AGQ+Q DM LVVPEG +A
Sbjct  26   DGLLPNGNFEMGPKPSQLKGSIIKGRTAVPNWDITGFVEYIKAGQRQEDMVLVVPEGASA  85

Query  325  VRLGNEASIKQTLNVSKGMYYSITFCAARTCAQEERLNITVAPDSGVLPIQTLYSINGWD  504
            VRLGNEASI Q + V  G  YSITF AARTCAQ+ERLNI+V  +SGV+PIQT+Y  +GWD
Sbjct  86   VRLGNEASISQKITVQSGRLYSITFSAARTCAQDERLNISVTHESGVIPIQTMYGSDGWD  145

Query  505  CYAWAFQ  525
             Y+WAF+
Sbjct  146  SYSWAFK  152



>ref|XP_006301335.1| hypothetical protein CARUB_v10021745mg [Capsella rubella]
 gb|EOA34233.1| hypothetical protein CARUB_v10021745mg [Capsella rubella]
Length=378

 Score =   176 bits (445),  Expect = 9e-50, Method: Compositional matrix adjust.
 Identities = 81/127 (64%), Positives = 99/127 (78%), Gaps = 0/127 (0%)
 Frame = +1

Query  145  DGLLVNGNFEAPVKKTDLNGTIVTRHDAVPGWTVTGFVEYIQAGQKQGDMQLVVPEGFAA  324
            DGLL NGNFE   K + L G++V    AVP W +TGFVEYI++GQKQ DM LVVP+G +A
Sbjct  35   DGLLPNGNFEMGPKPSQLKGSVVKERSAVPNWDITGFVEYIKSGQKQDDMVLVVPQGSSA  94

Query  325  VRLGNEASIKQTLNVSKGMYYSITFCAARTCAQEERLNITVAPDSGVLPIQTLYSINGWD  504
            VRLGNEAS+ Q ++V  G  YSITF AARTCAQEERLNI+V  +SGV+PIQT+Y  +GWD
Sbjct  95   VRLGNEASVSQKISVIPGRLYSITFSAARTCAQEERLNISVTHESGVIPIQTMYGSDGWD  154

Query  505  CYAWAFQ  525
             Y+WAF+
Sbjct  155  SYSWAFK  161



>ref|XP_008792101.1| PREDICTED: uncharacterized protein LOC103708794 [Phoenix dactylifera]
Length=371

 Score =   175 bits (444),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 82/128 (64%), Positives = 100/128 (78%), Gaps = 0/128 (0%)
 Frame = +1

Query  142  TDGLLVNGNFEAPVKKTDLNGTIVTRHDAVPGWTVTGFVEYIQAGQKQGDMQLVVPEGFA  321
            TDGLL NGNFE     + L GT V   +A+P W ++G VEYI  G KQGDM LVVPEG  
Sbjct  23   TDGLLPNGNFELGPASSKLRGTEVIGRNAIPRWEISGTVEYIPWGHKQGDMLLVVPEGSY  82

Query  322  AVRLGNEASIKQTLNVSKGMYYSITFCAARTCAQEERLNITVAPDSGVLPIQTLYSINGW  501
            AVRLGNEASIKQ + V++G+ YS+TF AARTCAQ+ERLN++VAP+SGV+P+QT+YS NGW
Sbjct  83   AVRLGNEASIKQRIKVTRGVRYSLTFSAARTCAQDERLNVSVAPESGVVPMQTMYSSNGW  142

Query  502  DCYAWAFQ  525
            D YAWA+ 
Sbjct  143  DSYAWAWN  150



>gb|KDP37140.1| hypothetical protein JCGZ_06196 [Jatropha curcas]
Length=375

 Score =   175 bits (444),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 83/133 (62%), Positives = 104/133 (78%), Gaps = 5/133 (4%)
 Frame = +1

Query  142  TDGLLVNGNFEAPVKKTDLNGTIVTRHDAVPGWTVTGFVEYIQAGQKQGDMQLVVPEGFA  321
            TDGLL NG+FE   K   + GT+VT  +A+P W ++G+VEYI++GQKQGDM LVVP G  
Sbjct  24   TDGLLPNGDFEHGPKPWQMKGTVVTAKNAIPNWEISGYVEYIKSGQKQGDMLLVVPGGAF  83

Query  322  AVRLGNEASIKQTLNVSKGMYYSITFCAARTCAQEERLNITVAP-----DSGVLPIQTLY  486
            AVRLGNEASIKQ ++V+K  YYSITF  ARTCAQEE+LN++V+P     D G+LP+QT+Y
Sbjct  84   AVRLGNEASIKQKISVTKDSYYSITFNVARTCAQEEKLNVSVSPNLEPKDWGILPMQTVY  143

Query  487  SINGWDCYAWAFQ  525
            S NGWD Y+WAFQ
Sbjct  144  SSNGWDSYSWAFQ  156



>ref|XP_002298115.2| hypothetical protein POPTR_0001s17430g [Populus trichocarpa]
 gb|EEE82920.2| hypothetical protein POPTR_0001s17430g [Populus trichocarpa]
Length=389

 Score =   176 bits (445),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 80/133 (60%), Positives = 105/133 (79%), Gaps = 5/133 (4%)
 Frame = +1

Query  142  TDGLLVNGNFEAPVKKTDLNGTIVTRHDAVPGWTVTGFVEYIQAGQKQGDMQLVVPEGFA  321
            TDGLL NG+FE   K +++ GT+VT  +A+P W ++GF+EYI++G KQGDM LVVP G  
Sbjct  38   TDGLLPNGDFEYGPKPSEMKGTVVTAKNAIPNWEISGFIEYIKSGHKQGDMLLVVPVGAY  97

Query  322  AVRLGNEASIKQTLNVSKGMYYSITFCAARTCAQEERLNITVAPDS-----GVLPIQTLY  486
            AVRLGNEASIKQ + V++G +YS+TF  ARTCAQEE+LN++V+P+S     G+LP+QT+Y
Sbjct  98   AVRLGNEASIKQKVKVTQGEFYSLTFNVARTCAQEEKLNLSVSPNSEPRDWGILPMQTMY  157

Query  487  SINGWDCYAWAFQ  525
            S NGWD YAWAF 
Sbjct  158  SSNGWDAYAWAFH  170



>emb|CAH67378.1| OSIGBa0159F11.2 [Oryza sativa Indica Group]
 emb|CAH67294.1| OSIGBa0103O01.12 [Oryza sativa Indica Group]
 gb|EAY94678.1| hypothetical protein OsI_16457 [Oryza sativa Indica Group]
Length=372

 Score =   175 bits (444),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 78/128 (61%), Positives = 103/128 (80%), Gaps = 0/128 (0%)
 Frame = +1

Query  142  TDGLLVNGNFEAPVKKTDLNGTIVTRHDAVPGWTVTGFVEYIQAGQKQGDMQLVVPEGFA  321
            TDGLL NGNFE    K+ LNGT+VT   A+P W ++GFVEYI++G ++ DM L VPEG  
Sbjct  27   TDGLLPNGNFEDGPDKSQLNGTVVTGRYAIPNWEISGFVEYIESGHREQDMILAVPEGAR  86

Query  322  AVRLGNEASIKQTLNVSKGMYYSITFCAARTCAQEERLNITVAPDSGVLPIQTLYSINGW  501
            AVRLGN+A+I+Q L+V++  YYSITF AARTCAQ+E+LN++V P+ GVLPIQT+Y+ +GW
Sbjct  87   AVRLGNDATIRQRLSVTRRAYYSITFSAARTCAQKEKLNVSVTPEFGVLPIQTVYTSSGW  146

Query  502  DCYAWAFQ  525
            D Y+WAF+
Sbjct  147  DSYSWAFR  154



>ref|XP_009333642.1| PREDICTED: uncharacterized protein LOC103926567 [Pyrus x bretschneideri]
Length=373

 Score =   175 bits (444),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 83/132 (63%), Positives = 101/132 (77%), Gaps = 5/132 (4%)
 Frame = +1

Query  142  TDGLLVNGNFEAPVKKTDLNGTIVTRHDAVPGWTVTGFVEYIQAGQKQGDMQLVVPEGFA  321
            TDGLL NGNFE   K+++L GT+VT   A+P W ++GFVEYI++GQKQGDM LVVPEG  
Sbjct  25   TDGLLPNGNFEYGPKQSELKGTVVTNPHAIPNWEISGFVEYIKSGQKQGDMLLVVPEGGF  84

Query  322  AVRLGNEASIKQTLNVSKGMYYSITFCAARTCAQEERLNITVAPDS-----GVLPIQTLY  486
            AVRLGNEA IKQ L V KG +YS+TF AARTCAQEE LN+++ P+      G++PIQT+Y
Sbjct  85   AVRLGNEALIKQKLKVKKGGFYSVTFSAARTCAQEETLNVSITPNLEKRHWGIMPIQTMY  144

Query  487  SINGWDCYAWAF  522
            S  GWD YAW F
Sbjct  145  SSIGWDSYAWGF  156



>gb|KJB70568.1| hypothetical protein B456_011G080100 [Gossypium raimondii]
Length=374

 Score =   175 bits (444),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 82/132 (62%), Positives = 99/132 (75%), Gaps = 5/132 (4%)
 Frame = +1

Query  145  DGLLVNGNFEAPVKKTDLNGTIVTRHDAVPGWTVTGFVEYIQAGQKQGDMQLVVPEGFAA  324
            DGLL NGNFE   K ++L GT V    A+P W ++G+VEYI++G KQGDM L+VPEG  A
Sbjct  24   DGLLPNGNFEYGPKASELEGTKVMSAKAIPNWEISGYVEYIKSGHKQGDMLLIVPEGAFA  83

Query  325  VRLGNEASIKQTLNVSKGMYYSITFCAARTCAQEERLNITVAP-----DSGVLPIQTLYS  489
            VRLGNEA IKQ + V KG +YS+TF  ARTCAQEERLN++V+P     D G+ PIQT+YS
Sbjct  84   VRLGNEALIKQKIEVVKGDFYSLTFSTARTCAQEERLNVSVSPNNEKNDFGLFPIQTMYS  143

Query  490  INGWDCYAWAFQ  525
             NGWD YAWAFQ
Sbjct  144  SNGWDSYAWAFQ  155



>ref|XP_006653557.1| PREDICTED: uncharacterized protein LOC102718925 [Oryza brachyantha]
Length=384

 Score =   175 bits (444),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 81/126 (64%), Positives = 101/126 (80%), Gaps = 0/126 (0%)
 Frame = +1

Query  148  GLLVNGNFEAPVKKTDLNGTIVTRHDAVPGWTVTGFVEYIQAGQKQGDMQLVVPEGFAAV  327
            GLL NGNFE    ++ +NGT VT   A+P W ++GFVEYI +GQKQGDM L VPEG  AV
Sbjct  27   GLLPNGNFEEAPDESQMNGTRVTGRYAIPKWEISGFVEYIGSGQKQGDMLLPVPEGAYAV  86

Query  328  RLGNEASIKQTLNVSKGMYYSITFCAARTCAQEERLNITVAPDSGVLPIQTLYSINGWDC  507
            RLGNEASI+Q L +++GM+YSITF AARTCAQ E LN+TV+P+SG LPIQT+Y+ +GWD 
Sbjct  87   RLGNEASIQQKLGLTRGMHYSITFSAARTCAQSEVLNVTVSPESGDLPIQTVYTSSGWDS  146

Query  508  YAWAFQ  525
            Y+WAF+
Sbjct  147  YSWAFK  152



>gb|EMT04285.1| hypothetical protein F775_14657 [Aegilops tauschii]
Length=375

 Score =   175 bits (443),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 78/128 (61%), Positives = 101/128 (79%), Gaps = 0/128 (0%)
 Frame = +1

Query  142  TDGLLVNGNFEAPVKKTDLNGTIVTRHDAVPGWTVTGFVEYIQAGQKQGDMQLVVPEGFA  321
            TDGLL NGNF+    K+ LNGT+V    ++P W ++GFVEYIQ+G +QG M + VPEG +
Sbjct  27   TDGLLPNGNFKDGPAKSQLNGTVVMGRHSIPNWEISGFVEYIQSGHQQGGMVVAVPEGAS  86

Query  322  AVRLGNEASIKQTLNVSKGMYYSITFCAARTCAQEERLNITVAPDSGVLPIQTLYSINGW  501
            AVRLGN+ASI+Q + V++  YYSITF AARTCAQ E+LN++VA DSGVLP+QT+YS  GW
Sbjct  87   AVRLGNDASIRQNIRVTRRAYYSITFSAARTCAQAEKLNVSVAADSGVLPVQTVYSSGGW  146

Query  502  DCYAWAFQ  525
            D Y+WAF+
Sbjct  147  DSYSWAFR  154



>ref|XP_008669227.1| PREDICTED: uncharacterized protein LOC103646275 [Zea mays]
 ref|XP_008669228.1| PREDICTED: uncharacterized protein LOC103646275 [Zea mays]
 tpg|DAA37148.1| TPA: hypothetical protein ZEAMMB73_528816 [Zea mays]
Length=380

 Score =   175 bits (443),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 83/128 (65%), Positives = 100/128 (78%), Gaps = 0/128 (0%)
 Frame = +1

Query  142  TDGLLVNGNFEAPVKKTDLNGTIVTRHDAVPGWTVTGFVEYIQAGQKQGDMQLVVPEGFA  321
            TDGLL NGNFE    K+DLNGT V   ++VP W + GFVEYI +GQKQ DM L VPEG  
Sbjct  41   TDGLLPNGNFELGPAKSDLNGTRVMNQNSVPNWEIFGFVEYIGSGQKQDDMILAVPEGAC  100

Query  322  AVRLGNEASIKQTLNVSKGMYYSITFCAARTCAQEERLNITVAPDSGVLPIQTLYSINGW  501
            AVRLGN+A+I+Q L V +   YSITFCAARTCAQ ERLN++VA +SGVLPIQT+Y+ +GW
Sbjct  101  AVRLGNDATIRQKLEVIRKTTYSITFCAARTCAQAERLNVSVAAESGVLPIQTVYTSSGW  160

Query  502  DCYAWAFQ  525
            D YA+AF+
Sbjct  161  DSYAYAFR  168



>ref|XP_006601137.1| PREDICTED: uncharacterized protein LOC100813910 isoform X1 [Glycine 
max]
 ref|XP_006601138.1| PREDICTED: uncharacterized protein LOC100813910 isoform X2 [Glycine 
max]
Length=366

 Score =   174 bits (442),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 84/128 (66%), Positives = 100/128 (78%), Gaps = 1/128 (1%)
 Frame = +1

Query  145  DGLLVNGNFEAPVKKTDLNGTIVTR-HDAVPGWTVTGFVEYIQAGQKQGDMQLVVPEGFA  321
            DGL+ NGNFE   K + L GT+V     ++P W ++GFVEYI++GQKQGDM LVVPEG  
Sbjct  24   DGLVANGNFELGPKPSALKGTVVVGGSHSIPEWEISGFVEYIKSGQKQGDMLLVVPEGAY  83

Query  322  AVRLGNEASIKQTLNVSKGMYYSITFCAARTCAQEERLNITVAPDSGVLPIQTLYSINGW  501
            AVRLGNEASIKQ + V KGMYYSITF  ARTCAQEERLNI+V PD GV+PIQTLY+ +GW
Sbjct  84   AVRLGNEASIKQRIKVIKGMYYSITFMVARTCAQEERLNISVTPDWGVIPIQTLYTSSGW  143

Query  502  DCYAWAFQ  525
            D  A+ F+
Sbjct  144  DPIAFGFK  151



>gb|KHG06895.1| Agmatine deiminase [Gossypium arboreum]
Length=374

 Score =   174 bits (442),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 82/132 (62%), Positives = 99/132 (75%), Gaps = 5/132 (4%)
 Frame = +1

Query  145  DGLLVNGNFEAPVKKTDLNGTIVTRHDAVPGWTVTGFVEYIQAGQKQGDMQLVVPEGFAA  324
            DGLL NGNFE   K ++L GT V    A+P W ++G+VEYI++G KQGDM L+VPEG  A
Sbjct  24   DGLLPNGNFEYGPKASELEGTKVMSAKAIPNWEISGYVEYIKSGHKQGDMLLIVPEGAFA  83

Query  325  VRLGNEASIKQTLNVSKGMYYSITFCAARTCAQEERLNITVAP-----DSGVLPIQTLYS  489
            VRLGNEA IKQ + V KG +YS+TF  ARTCAQEERLN++V+P     D G+ PIQT+YS
Sbjct  84   VRLGNEALIKQKVEVVKGDFYSLTFSTARTCAQEERLNVSVSPNNEKNDFGLFPIQTMYS  143

Query  490  INGWDCYAWAFQ  525
             NGWD YAWAFQ
Sbjct  144  SNGWDSYAWAFQ  155



>ref|XP_008377611.1| PREDICTED: uncharacterized protein LOC103440696 [Malus domestica]
Length=374

 Score =   174 bits (442),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 81/133 (61%), Positives = 101/133 (76%), Gaps = 5/133 (4%)
 Frame = +1

Query  142  TDGLLVNGNFEAPVKKTDLNGTIVTRHDAVPGWTVTGFVEYIQAGQKQGDMQLVVPEGFA  321
            TDGLL NGNFE   K ++L GT+VT  +A+P W ++GFVEYI++GQKQGDM L+VPEG  
Sbjct  25   TDGLLPNGNFEYGPKHSELKGTVVTNPNAIPNWEISGFVEYIKSGQKQGDMLLLVPEGGF  84

Query  322  AVRLGNEASIKQTLNVSKGMYYSITFCAARTCAQEERLNITVAP-----DSGVLPIQTLY  486
            AVRLG EA IKQ L ++KG +YS+TF A RTC QEE+LN++V P     D G++PIQT+Y
Sbjct  85   AVRLGKEALIKQKLKLTKGGFYSVTFTAGRTCGQEEKLNVSVNPNVEEKDWGIMPIQTMY  144

Query  487  SINGWDCYAWAFQ  525
            S NGWD YAW F 
Sbjct  145  SSNGWDSYAWGFN  157



>gb|KHN06654.1| hypothetical protein glysoja_037506 [Glycine soja]
Length=366

 Score =   174 bits (441),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 84/128 (66%), Positives = 100/128 (78%), Gaps = 1/128 (1%)
 Frame = +1

Query  145  DGLLVNGNFEAPVKKTDLNGTIVTR-HDAVPGWTVTGFVEYIQAGQKQGDMQLVVPEGFA  321
            DGL+ NGNFE   K + L GT+V     ++P W ++GFVEYI++GQKQGDM LVVPEG  
Sbjct  24   DGLVANGNFELGPKPSALKGTVVIGGSHSIPEWEISGFVEYIKSGQKQGDMLLVVPEGAY  83

Query  322  AVRLGNEASIKQTLNVSKGMYYSITFCAARTCAQEERLNITVAPDSGVLPIQTLYSINGW  501
            AVRLGNEASIKQ + V KGMYYSITF  ARTCAQEERLNI+V PD GV+PIQTLY+ +GW
Sbjct  84   AVRLGNEASIKQRIKVIKGMYYSITFMVARTCAQEERLNISVTPDWGVIPIQTLYTSSGW  143

Query  502  DCYAWAFQ  525
            D  A+ F+
Sbjct  144  DPIAFGFK  151



>ref|XP_009104452.1| PREDICTED: uncharacterized protein LOC103830427 [Brassica rapa]
Length=404

 Score =   175 bits (443),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 82/127 (65%), Positives = 99/127 (78%), Gaps = 0/127 (0%)
 Frame = +1

Query  145  DGLLVNGNFEAPVKKTDLNGTIVTRHDAVPGWTVTGFVEYIQAGQKQGDMQLVVPEGFAA  324
            DGLL NGNFE   K + L G++V   +AV  W +TGFVEYI+AGQKQ DM LVVPEG +A
Sbjct  26   DGLLPNGNFEIGPKPSQLKGSVVKERNAVAHWDMTGFVEYIKAGQKQDDMVLVVPEGSSA  85

Query  325  VRLGNEASIKQTLNVSKGMYYSITFCAARTCAQEERLNITVAPDSGVLPIQTLYSINGWD  504
            VRLGNEASI Q ++V  G  YSITF AARTCAQ+ERLNI+V  +SGV+PIQT+Y  +GWD
Sbjct  86   VRLGNEASISQKISVRSGRLYSITFSAARTCAQDERLNISVTHESGVIPIQTMYGSDGWD  145

Query  505  CYAWAFQ  525
             Y+WAF+
Sbjct  146  SYSWAFK  152



>ref|XP_010048991.1| PREDICTED: uncharacterized protein LOC104437692 [Eucalyptus grandis]
 gb|KCW81432.1| hypothetical protein EUGRSUZ_C02812 [Eucalyptus grandis]
Length=325

 Score =   173 bits (438),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 79/110 (72%), Positives = 93/110 (85%), Gaps = 0/110 (0%)
 Frame = +1

Query  196  LNGTIVTRHDAVPGWTVTGFVEYIQAGQKQGDMQLVVPEGFAAVRLGNEASIKQTLNVSK  375
            + GT+V    AVP W ++GFVEYI++GQKQGDM LVVP G  AVRLGNEASIKQ L V++
Sbjct  1    MRGTVVVGRYAVPKWEISGFVEYIKSGQKQGDMLLVVPAGAFAVRLGNEASIKQRLPVAR  60

Query  376  GMYYSITFCAARTCAQEERLNITVAPDSGVLPIQTLYSINGWDCYAWAFQ  525
            GMYYS+TF AARTCAQEE+LN++VAPD GVLP+QTLYS NGWD YAWAF+
Sbjct  61   GMYYSLTFSAARTCAQEEKLNVSVAPDWGVLPMQTLYSSNGWDSYAWAFR  110



>ref|XP_002887838.1| hypothetical protein ARALYDRAFT_340195 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH64097.1| hypothetical protein ARALYDRAFT_340195 [Arabidopsis lyrata subsp. 
lyrata]
Length=371

 Score =   174 bits (441),  Expect = 4e-49, Method: Compositional matrix adjust.
 Identities = 81/127 (64%), Positives = 99/127 (78%), Gaps = 0/127 (0%)
 Frame = +1

Query  145  DGLLVNGNFEAPVKKTDLNGTIVTRHDAVPGWTVTGFVEYIQAGQKQGDMQLVVPEGFAA  324
            DGLL NGNFE   K + L G++V    AVP W +TGFVEYI++GQKQ DM LVVP+G +A
Sbjct  28   DGLLPNGNFELGPKPSQLKGSVVKERTAVPNWDITGFVEYIKSGQKQDDMVLVVPQGSSA  87

Query  325  VRLGNEASIKQTLNVSKGMYYSITFCAARTCAQEERLNITVAPDSGVLPIQTLYSINGWD  504
            VRLGNEASI Q ++V  G  YSITF AARTCAQ+E+LNI+V  +SGV+PIQT+Y  +GWD
Sbjct  88   VRLGNEASISQKISVLPGRLYSITFSAARTCAQDEKLNISVTHESGVIPIQTMYGSDGWD  147

Query  505  CYAWAFQ  525
             YAWAF+
Sbjct  148  SYAWAFK  154



>emb|CDY39990.1| BnaC06g40680D [Brassica napus]
Length=341

 Score =   173 bits (438),  Expect = 4e-49, Method: Compositional matrix adjust.
 Identities = 82/129 (64%), Positives = 100/129 (78%), Gaps = 1/129 (1%)
 Frame = +1

Query  142  TDG-LLVNGNFEAPVKKTDLNGTIVTRHDAVPGWTVTGFVEYIQAGQKQGDMQLVVPEGF  318
            +DG LL NGNFE   K + L G+++    AVP W +TGFVEYI+AGQKQ DM LVVPEG 
Sbjct  25   SDGSLLANGNFEKGPKPSQLKGSVIKGRTAVPNWEITGFVEYIKAGQKQDDMVLVVPEGS  84

Query  319  AAVRLGNEASIKQTLNVSKGMYYSITFCAARTCAQEERLNITVAPDSGVLPIQTLYSING  498
            +AVRLGNEASI Q ++V  G  YSITF AARTCAQ+ERLNI+V  +SGV+PIQT+Y  +G
Sbjct  85   SAVRLGNEASISQKISVRSGRLYSITFSAARTCAQDERLNISVTHESGVIPIQTMYGSDG  144

Query  499  WDCYAWAFQ  525
            WD Y+WAF+
Sbjct  145  WDSYSWAFK  153



>gb|EMS63052.1| hypothetical protein TRIUR3_01733 [Triticum urartu]
Length=375

 Score =   174 bits (440),  Expect = 4e-49, Method: Compositional matrix adjust.
 Identities = 78/128 (61%), Positives = 100/128 (78%), Gaps = 0/128 (0%)
 Frame = +1

Query  142  TDGLLVNGNFEAPVKKTDLNGTIVTRHDAVPGWTVTGFVEYIQAGQKQGDMQLVVPEGFA  321
            TDGLL NGNF+    K+ LNGT+V    ++P W ++GFVEYIQ+G  Q DM + VPEG +
Sbjct  27   TDGLLPNGNFKDGPAKSQLNGTVVMGRHSIPNWEISGFVEYIQSGHTQDDMIVAVPEGAS  86

Query  322  AVRLGNEASIKQTLNVSKGMYYSITFCAARTCAQEERLNITVAPDSGVLPIQTLYSINGW  501
            AVRLGN+ASI+Q + V++  YYSITF AARTCAQ E+LN++VA DSGVLP+QT+YS  GW
Sbjct  87   AVRLGNDASIRQNIRVTRRAYYSITFSAARTCAQAEKLNVSVAADSGVLPVQTVYSSGGW  146

Query  502  DCYAWAFQ  525
            D Y+WAF+
Sbjct  147  DSYSWAFR  154



>ref|XP_002446724.1| hypothetical protein SORBIDRAFT_06g021280 [Sorghum bicolor]
 gb|EES11052.1| hypothetical protein SORBIDRAFT_06g021280 [Sorghum bicolor]
Length=379

 Score =   174 bits (440),  Expect = 5e-49, Method: Compositional matrix adjust.
 Identities = 80/127 (63%), Positives = 101/127 (80%), Gaps = 0/127 (0%)
 Frame = +1

Query  145  DGLLVNGNFEAPVKKTDLNGTIVTRHDAVPGWTVTGFVEYIQAGQKQGDMQLVVPEGFAA  324
            DGLL NGNFE    K+ L G+ V   +A+P W ++GFVEYI +GQKQGDM L VPEG  A
Sbjct  32   DGLLPNGNFEEAPPKSQLKGSRVMGRNAIPHWEISGFVEYIGSGQKQGDMLLPVPEGAYA  91

Query  325  VRLGNEASIKQTLNVSKGMYYSITFCAARTCAQEERLNITVAPDSGVLPIQTLYSINGWD  504
            VRLGNEASI+Q L +++G +YSITF AARTCAQ E+LN+TVAP+S +LPIQT+Y+ +GWD
Sbjct  92   VRLGNEASIQQRLALTQGAHYSITFSAARTCAQAEQLNVTVAPESDILPIQTVYTSSGWD  151

Query  505  CYAWAFQ  525
             Y+WAF+
Sbjct  152  SYSWAFK  158



>gb|EAZ31211.1| hypothetical protein OsJ_15311 [Oryza sativa Japonica Group]
Length=294

 Score =   171 bits (434),  Expect = 5e-49, Method: Compositional matrix adjust.
 Identities = 80/127 (63%), Positives = 98/127 (77%), Gaps = 0/127 (0%)
 Frame = +1

Query  145  DGLLVNGNFEAPVKKTDLNGTIVTRHDAVPGWTVTGFVEYIQAGQKQGDMQLVVPEGFAA  324
            DGLL NGNFE    K+ LNGT V    A+P W ++GFVEYI +GQ QGDM L VPEG  A
Sbjct  26   DGLLPNGNFEEAPDKSQLNGTRVIGRYAIPQWEISGFVEYIGSGQMQGDMLLPVPEGAYA  85

Query  325  VRLGNEASIKQTLNVSKGMYYSITFCAARTCAQEERLNITVAPDSGVLPIQTLYSINGWD  504
            VRLGNEASI+Q L +++GM+YS+TF AARTCAQ E LNITV P+ G +PIQT+Y+ +GWD
Sbjct  86   VRLGNEASIQQRLTLTRGMHYSVTFSAARTCAQSELLNITVTPEIGEVPIQTVYTSSGWD  145

Query  505  CYAWAFQ  525
             Y+WAF+
Sbjct  146  SYSWAFK  152



>tpg|DAA37149.1| TPA: hypothetical protein ZEAMMB73_398073 [Zea mays]
Length=382

 Score =   173 bits (439),  Expect = 7e-49, Method: Compositional matrix adjust.
 Identities = 81/128 (63%), Positives = 100/128 (78%), Gaps = 0/128 (0%)
 Frame = +1

Query  142  TDGLLVNGNFEAPVKKTDLNGTIVTRHDAVPGWTVTGFVEYIQAGQKQGDMQLVVPEGFA  321
            +DGLL NGNFE    K+DLNGT V   ++VP W + GFVEYI +GQKQ DM L VPEG  
Sbjct  29   SDGLLPNGNFELGPAKSDLNGTRVMNQNSVPNWEILGFVEYIGSGQKQDDMILPVPEGAC  88

Query  322  AVRLGNEASIKQTLNVSKGMYYSITFCAARTCAQEERLNITVAPDSGVLPIQTLYSINGW  501
            AVRLGN+A+I+Q LN+ +   YSITFCAARTCAQ ERL ++VA +SGVLPIQT+Y+ NGW
Sbjct  89   AVRLGNDATIRQNLNLIRETTYSITFCAARTCAQAERLKVSVAAESGVLPIQTVYTSNGW  148

Query  502  DCYAWAFQ  525
            D Y++AF+
Sbjct  149  DSYSYAFR  156



>ref|XP_008669229.1| PREDICTED: uncharacterized protein LOC103646276 [Zea mays]
Length=379

 Score =   173 bits (439),  Expect = 8e-49, Method: Compositional matrix adjust.
 Identities = 81/128 (63%), Positives = 100/128 (78%), Gaps = 0/128 (0%)
 Frame = +1

Query  142  TDGLLVNGNFEAPVKKTDLNGTIVTRHDAVPGWTVTGFVEYIQAGQKQGDMQLVVPEGFA  321
            +DGLL NGNFE    K+DLNGT V   ++VP W + GFVEYI +GQKQ DM L VPEG  
Sbjct  40   SDGLLPNGNFELGPAKSDLNGTRVMNQNSVPNWEILGFVEYIGSGQKQDDMILPVPEGAC  99

Query  322  AVRLGNEASIKQTLNVSKGMYYSITFCAARTCAQEERLNITVAPDSGVLPIQTLYSINGW  501
            AVRLGN+A+I+Q LN+ +   YSITFCAARTCAQ ERL ++VA +SGVLPIQT+Y+ NGW
Sbjct  100  AVRLGNDATIRQNLNLIRETTYSITFCAARTCAQAERLKVSVAAESGVLPIQTVYTSNGW  159

Query  502  DCYAWAFQ  525
            D Y++AF+
Sbjct  160  DSYSYAFR  167



>ref|XP_006581022.1| PREDICTED: uncharacterized protein LOC100802444 isoform X1 [Glycine 
max]
Length=372

 Score =   173 bits (438),  Expect = 8e-49, Method: Compositional matrix adjust.
 Identities = 81/129 (63%), Positives = 99/129 (77%), Gaps = 1/129 (1%)
 Frame = +1

Query  142  TDGLLVNGNFEAPVKKTDLNGTIVTR-HDAVPGWTVTGFVEYIQAGQKQGDMQLVVPEGF  318
            T G ++NG FE   K  D+ GT+VT    ++PGW ++GF+EYI++GQKQ DM LVVP G 
Sbjct  21   THGAVINGEFELGPKPQDMKGTVVTGGPHSIPGWEISGFIEYIKSGQKQDDMLLVVPNGA  80

Query  319  AAVRLGNEASIKQTLNVSKGMYYSITFCAARTCAQEERLNITVAPDSGVLPIQTLYSING  498
             AVRLGNEASIKQ L V KGMYYSITF  ARTCAQEE+LN++ APD  VLP+QT+Y  NG
Sbjct  81   YAVRLGNEASIKQNLKVVKGMYYSITFVVARTCAQEEKLNVSAAPDWVVLPMQTVYGGNG  140

Query  499  WDCYAWAFQ  525
            WD YAW+F+
Sbjct  141  WDAYAWSFR  149



>ref|XP_010417734.1| PREDICTED: uncharacterized protein LOC104703420 [Camelina sativa]
Length=369

 Score =   173 bits (438),  Expect = 9e-49, Method: Compositional matrix adjust.
 Identities = 80/127 (63%), Positives = 99/127 (78%), Gaps = 0/127 (0%)
 Frame = +1

Query  145  DGLLVNGNFEAPVKKTDLNGTIVTRHDAVPGWTVTGFVEYIQAGQKQGDMQLVVPEGFAA  324
            DGLL NGNFE   K + L G+++    AVP W +TGFVEYI++GQKQ DM LVVP+G +A
Sbjct  26   DGLLPNGNFELGPKLSQLKGSMIKERTAVPNWDITGFVEYIKSGQKQDDMVLVVPQGSSA  85

Query  325  VRLGNEASIKQTLNVSKGMYYSITFCAARTCAQEERLNITVAPDSGVLPIQTLYSINGWD  504
            VRLGNEASI Q ++V  G  YSITF AARTCAQ+ERLNI+V  +SGV+PIQT+Y  +GWD
Sbjct  86   VRLGNEASISQKISVIPGRLYSITFSAARTCAQDERLNISVTHESGVIPIQTMYGSDGWD  145

Query  505  CYAWAFQ  525
             Y+WAF+
Sbjct  146  SYSWAFK  152



>ref|XP_010472958.1| PREDICTED: uncharacterized protein LOC104752499 [Camelina sativa]
Length=369

 Score =   173 bits (438),  Expect = 9e-49, Method: Compositional matrix adjust.
 Identities = 80/127 (63%), Positives = 99/127 (78%), Gaps = 0/127 (0%)
 Frame = +1

Query  145  DGLLVNGNFEAPVKKTDLNGTIVTRHDAVPGWTVTGFVEYIQAGQKQGDMQLVVPEGFAA  324
            DGLL NGNFE   + + L G++V    AVP W +TGFVEYI++GQKQ DM LVVP+G +A
Sbjct  26   DGLLPNGNFELGPRPSQLKGSLVKERTAVPNWDITGFVEYIKSGQKQDDMVLVVPQGSSA  85

Query  325  VRLGNEASIKQTLNVSKGMYYSITFCAARTCAQEERLNITVAPDSGVLPIQTLYSINGWD  504
            VRLGNEASI Q ++V  G  YSITF AARTCAQ+ERLNI+V  +SGV+PIQT+Y  +GWD
Sbjct  86   VRLGNEASISQKISVIPGRLYSITFSAARTCAQDERLNISVTHESGVIPIQTMYGSDGWD  145

Query  505  CYAWAFQ  525
             Y+WAF+
Sbjct  146  SYSWAFK  152



>ref|XP_008347484.1| PREDICTED: uncharacterized protein LOC103410579 [Malus domestica]
Length=374

 Score =   173 bits (438),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 81/133 (61%), Positives = 101/133 (76%), Gaps = 5/133 (4%)
 Frame = +1

Query  142  TDGLLVNGNFEAPVKKTDLNGTIVTRHDAVPGWTVTGFVEYIQAGQKQGDMQLVVPEGFA  321
            TDGLL NGNFE   K+++L GT+VT   A+P W ++GFVEYI++GQKQGDM LVVPEG  
Sbjct  25   TDGLLPNGNFEYGPKQSELKGTVVTNPHAIPNWEISGFVEYIKSGQKQGDMVLVVPEGGF  84

Query  322  AVRLGNEASIKQTLNVSKGMYYSITFCAARTCAQEERLNITVAP-----DSGVLPIQTLY  486
            AV+LGNEA IKQ L ++KG +YS TF A+RTC QE +LN++V P     D G++PIQT+Y
Sbjct  85   AVKLGNEALIKQKLKLTKGSFYSTTFTASRTCGQEAKLNVSVNPNLEENDWGIMPIQTIY  144

Query  487  SINGWDCYAWAFQ  525
            S NGWD YAW F 
Sbjct  145  SCNGWDSYAWGFN  157



>ref|XP_010429991.1| PREDICTED: uncharacterized protein LOC104714356 [Camelina sativa]
Length=369

 Score =   172 bits (437),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 80/127 (63%), Positives = 99/127 (78%), Gaps = 0/127 (0%)
 Frame = +1

Query  145  DGLLVNGNFEAPVKKTDLNGTIVTRHDAVPGWTVTGFVEYIQAGQKQGDMQLVVPEGFAA  324
            DGLL NGNFE   + + L G++V    AVP W +TGFVEYI++GQKQ DM LVVP+G +A
Sbjct  26   DGLLPNGNFELGPRPSQLKGSLVKERTAVPDWDITGFVEYIKSGQKQDDMVLVVPQGSSA  85

Query  325  VRLGNEASIKQTLNVSKGMYYSITFCAARTCAQEERLNITVAPDSGVLPIQTLYSINGWD  504
            VRLGNEASI Q ++V  G  YSITF AARTCAQ+ERLNI+V  +SGV+PIQT+Y  +GWD
Sbjct  86   VRLGNEASISQKISVIPGRLYSITFSAARTCAQDERLNISVTHESGVIPIQTMYGSDGWD  145

Query  505  CYAWAFQ  525
             Y+WAF+
Sbjct  146  SYSWAFK  152



>ref|XP_011035644.1| PREDICTED: uncharacterized protein LOC105133377 [Populus euphratica]
Length=373

 Score =   172 bits (437),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 79/133 (59%), Positives = 104/133 (78%), Gaps = 5/133 (4%)
 Frame = +1

Query  142  TDGLLVNGNFEAPVKKTDLNGTIVTRHDAVPGWTVTGFVEYIQAGQKQGDMQLVVPEGFA  321
            TDGLL NG+FE   K +++ GT+VT  +A+P W ++GF+EYI++G KQGDM LVVP G  
Sbjct  22   TDGLLPNGDFEYGPKPSEMKGTVVTAKNAIPNWEISGFIEYIKSGHKQGDMLLVVPVGAY  81

Query  322  AVRLGNEASIKQTLNVSKGMYYSITFCAARTCAQEERLNITVAPDS-----GVLPIQTLY  486
            AVRLGNEASIKQ + V++G +YS+TF  ARTCAQEE+LN++V+ +S     G+LP+QT+Y
Sbjct  82   AVRLGNEASIKQKVKVTQGKFYSLTFNVARTCAQEEKLNLSVSSNSEPRDWGILPMQTMY  141

Query  487  SINGWDCYAWAFQ  525
            S NGWD YAWAF 
Sbjct  142  SSNGWDAYAWAFH  154



>gb|EMS58461.1| hypothetical protein TRIUR3_29087 [Triticum urartu]
Length=336

 Score =   172 bits (435),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 80/126 (63%), Positives = 99/126 (79%), Gaps = 1/126 (1%)
 Frame = +1

Query  151  LLVNGNFE-APVKKTDLNGTIVTRHDAVPGWTVTGFVEYIQAGQKQGDMQLVVPEGFAAV  327
            LL NGNFE  P K   +NGT+V    A+P W  +GFVEYI++G KQGDM LVVP+G  AV
Sbjct  20   LLPNGNFELGPAKSELVNGTVVKGGKAIPRWETSGFVEYIESGHKQGDMLLVVPQGAYAV  79

Query  328  RLGNEASIKQTLNVSKGMYYSITFCAARTCAQEERLNITVAPDSGVLPIQTLYSINGWDC  507
            RLGN+ASI Q + V++G YY+ITF AARTCAQ ERLN++V+P+SGVLP+QT+Y  NGWD 
Sbjct  80   RLGNDASILQRIPVARGSYYAITFSAARTCAQAERLNVSVSPESGVLPMQTIYGSNGWDS  139

Query  508  YAWAFQ  525
            YAWAF+
Sbjct  140  YAWAFK  145



>gb|ABK26874.1| unknown [Picea sitchensis]
Length=182

 Score =   166 bits (421),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 77/128 (60%), Positives = 96/128 (75%), Gaps = 0/128 (0%)
 Frame = +1

Query  142  TDGLLVNGNFEAPVKKTDLNGTIVTRHDAVPGWTVTGFVEYIQAGQKQGDMQLVVPEGFA  321
            +DGLL NG+FE   K  DL GT++   +++P W   GFVEYI +G  Q DM +VVPEG  
Sbjct  28   SDGLLPNGDFELAPKPKDLKGTVLLGRNSLPQWRTKGFVEYITSGHHQRDMLVVVPEGAH  87

Query  322  AVRLGNEASIKQTLNVSKGMYYSITFCAARTCAQEERLNITVAPDSGVLPIQTLYSINGW  501
            AVRLGNEASI Q++ V++G YYS+TF AARTCAQ ERLN++V P SG + IQTLYS NGW
Sbjct  88   AVRLGNEASISQSIKVTRGSYYSLTFSAARTCAQSERLNVSVPPFSGDISIQTLYSSNGW  147

Query  502  DCYAWAFQ  525
            D Y+WAF+
Sbjct  148  DAYSWAFR  155



>ref|XP_009348421.1| PREDICTED: uncharacterized protein LOC103940075 [Pyrus x bretschneideri]
Length=374

 Score =   171 bits (433),  Expect = 4e-48, Method: Compositional matrix adjust.
 Identities = 80/133 (60%), Positives = 99/133 (74%), Gaps = 5/133 (4%)
 Frame = +1

Query  142  TDGLLVNGNFEAPVKKTDLNGTIVTRHDAVPGWTVTGFVEYIQAGQKQGDMQLVVPEGFA  321
            TDGLL NGNFE   K ++L GT+VT  +A+P W ++GFVEYI++G+KQGDM LVVP G  
Sbjct  25   TDGLLPNGNFEYGPKHSELKGTVVTNPNAIPNWEISGFVEYIKSGKKQGDMLLVVPAGGF  84

Query  322  AVRLGNEASIKQTLNVSKGMYYSITFCAARTCAQEERLNITVAP-----DSGVLPIQTLY  486
            AVRLG EA IKQ L ++KG +YSITF   RTC QEE+LN++V P     D G++PIQT+Y
Sbjct  85   AVRLGKEALIKQKLKLTKGGFYSITFTGGRTCGQEEKLNVSVNPNVEKNDWGIIPIQTMY  144

Query  487  SINGWDCYAWAFQ  525
            S NGWD YAW F 
Sbjct  145  SCNGWDSYAWGFN  157



>ref|XP_006841925.1| hypothetical protein AMTR_s00042p00185900 [Amborella trichopoda]
 gb|ERN03600.1| hypothetical protein AMTR_s00042p00185900 [Amborella trichopoda]
Length=332

 Score =   170 bits (431),  Expect = 4e-48, Method: Compositional matrix adjust.
 Identities = 75/110 (68%), Positives = 91/110 (83%), Gaps = 0/110 (0%)
 Frame = +1

Query  196  LNGTIVTRHDAVPGWTVTGFVEYIQAGQKQGDMQLVVPEGFAAVRLGNEASIKQTLNVSK  375
            +NGT+V  H A+PGW + GFVEYI AG KQGDM LVVPEG  AVRLGNEA I+Q++ V+ 
Sbjct  1    MNGTVVRDHYAIPGWEIGGFVEYITAGHKQGDMLLVVPEGACAVRLGNEAYIRQSVAVAT  60

Query  376  GMYYSITFCAARTCAQEERLNITVAPDSGVLPIQTLYSINGWDCYAWAFQ  525
            GMYY+ITF AARTCAQEER+NITV P++ V P+QTLYS +GWD Y+WAF+
Sbjct  61   GMYYAITFSAARTCAQEERINITVPPETDVFPVQTLYSSSGWDSYSWAFK  110



>ref|NP_001145978.1| hypothetical protein [Zea mays]
 gb|ACL52972.1| unknown [Zea mays]
 tpg|DAA58943.1| TPA: hypothetical protein ZEAMMB73_364218 [Zea mays]
Length=428

 Score =   172 bits (436),  Expect = 5e-48, Method: Compositional matrix adjust.
 Identities = 82/129 (64%), Positives = 101/129 (78%), Gaps = 3/129 (2%)
 Frame = +1

Query  148  GLLVNGNFE-APVKKTDLNGTIVTRHDAVPGWTVTGFVEYIQAGQKQGDMQLVVPEGFAA  324
            GLL NGNFE  P K   +NGT+V+   A+P W  +GFVEYI++G KQGDM LVVP+G  A
Sbjct  73   GLLPNGNFEDGPPKSALVNGTVVSGAHAIPRWETSGFVEYIESGHKQGDMLLVVPQGAHA  132

Query  325  VRLGNEASIKQTLNVSKGMYYSITFCAARTCAQEE--RLNITVAPDSGVLPIQTLYSING  498
            VRLGNEASI+Q L V++G YY+ITF AARTCAQ E  RLN++V+P+ GVLP+QT+Y  NG
Sbjct  133  VRLGNEASIRQRLAVARGAYYAITFSAARTCAQAERQRLNVSVSPEWGVLPMQTIYGSNG  192

Query  499  WDCYAWAFQ  525
            WD YAWAF+
Sbjct  193  WDSYAWAFK  201



>gb|KHG21630.1| Adenosylhomocysteinase [Gossypium arboreum]
Length=374

 Score =   171 bits (433),  Expect = 5e-48, Method: Compositional matrix adjust.
 Identities = 80/132 (61%), Positives = 99/132 (75%), Gaps = 5/132 (4%)
 Frame = +1

Query  145  DGLLVNGNFEAPVKKTDLNGTIVTRHDAVPGWTVTGFVEYIQAGQKQGDMQLVVPEGFAA  324
            DGLL NGNFE   K ++L GT V    ++P W + G+VEYI++GQKQ DM L+VP+G  A
Sbjct  24   DGLLPNGNFEQGPKASELKGTKVMSGKSIPNWEICGYVEYIKSGQKQDDMLLIVPQGAFA  83

Query  325  VRLGNEASIKQTLNVSKGMYYSITFCAARTCAQEERLNITVAP-----DSGVLPIQTLYS  489
            VRLGN A IKQ + V K M+YS+TF A+RTCAQEERLN++V+P     DSG+ PIQT+YS
Sbjct  84   VRLGNGALIKQKIRVIKDMFYSLTFSASRTCAQEERLNVSVSPNNEQNDSGLFPIQTMYS  143

Query  490  INGWDCYAWAFQ  525
             NGWD YAWAFQ
Sbjct  144  SNGWDSYAWAFQ  155



>ref|NP_001053190.1| Os04g0494900 [Oryza sativa Japonica Group]
 dbj|BAF15104.1| Os04g0494900 [Oryza sativa Japonica Group]
 dbj|BAG93696.1| unnamed protein product [Oryza sativa Japonica Group]
Length=377

 Score =   171 bits (433),  Expect = 5e-48, Method: Compositional matrix adjust.
 Identities = 80/127 (63%), Positives = 98/127 (77%), Gaps = 0/127 (0%)
 Frame = +1

Query  145  DGLLVNGNFEAPVKKTDLNGTIVTRHDAVPGWTVTGFVEYIQAGQKQGDMQLVVPEGFAA  324
            DGLL NGNFE    K+ LNGT V    A+P W ++GFVEYI +GQ QGDM L VPEG  A
Sbjct  32   DGLLPNGNFEEAPDKSQLNGTRVIGRYAIPQWEISGFVEYIGSGQMQGDMLLPVPEGAYA  91

Query  325  VRLGNEASIKQTLNVSKGMYYSITFCAARTCAQEERLNITVAPDSGVLPIQTLYSINGWD  504
            VRLGNEASI+Q L +++GM+YS+TF AARTCAQ E LNITV P+ G +PIQT+Y+ +GWD
Sbjct  92   VRLGNEASIQQRLTLTRGMHYSVTFSAARTCAQSELLNITVTPEIGEVPIQTVYTSSGWD  151

Query  505  CYAWAFQ  525
             Y+WAF+
Sbjct  152  SYSWAFK  158



>emb|CAD41548.2| OSJNBb0091E11.18 [Oryza sativa Japonica Group]
Length=371

 Score =   171 bits (432),  Expect = 6e-48, Method: Compositional matrix adjust.
 Identities = 80/127 (63%), Positives = 98/127 (77%), Gaps = 0/127 (0%)
 Frame = +1

Query  145  DGLLVNGNFEAPVKKTDLNGTIVTRHDAVPGWTVTGFVEYIQAGQKQGDMQLVVPEGFAA  324
            DGLL NGNFE    K+ LNGT V    A+P W ++GFVEYI +GQ QGDM L VPEG  A
Sbjct  26   DGLLPNGNFEEAPDKSQLNGTRVIGRYAIPQWEISGFVEYIGSGQMQGDMLLPVPEGAYA  85

Query  325  VRLGNEASIKQTLNVSKGMYYSITFCAARTCAQEERLNITVAPDSGVLPIQTLYSINGWD  504
            VRLGNEASI+Q L +++GM+YS+TF AARTCAQ E LNITV P+ G +PIQT+Y+ +GWD
Sbjct  86   VRLGNEASIQQRLTLTRGMHYSVTFSAARTCAQSELLNITVTPEIGEVPIQTVYTSSGWD  145

Query  505  CYAWAFQ  525
             Y+WAF+
Sbjct  146  SYSWAFK  152



>emb|CAH67377.1| OSIGBa0159F11.1 [Oryza sativa Indica Group]
 emb|CAH67293.1| OSIGBa0103O01.11 [Oryza sativa Indica Group]
 gb|EAY94677.1| hypothetical protein OsI_16456 [Oryza sativa Indica Group]
Length=371

 Score =   171 bits (432),  Expect = 7e-48, Method: Compositional matrix adjust.
 Identities = 80/127 (63%), Positives = 98/127 (77%), Gaps = 0/127 (0%)
 Frame = +1

Query  145  DGLLVNGNFEAPVKKTDLNGTIVTRHDAVPGWTVTGFVEYIQAGQKQGDMQLVVPEGFAA  324
            DGLL NGNFE    K+ LNGT V    A+P W ++GFVEYI +GQ QGDM L VPEG  A
Sbjct  26   DGLLPNGNFEEAPDKSQLNGTRVIGRYAIPQWEISGFVEYIGSGQMQGDMLLPVPEGAYA  85

Query  325  VRLGNEASIKQTLNVSKGMYYSITFCAARTCAQEERLNITVAPDSGVLPIQTLYSINGWD  504
            VRLGNEASI+Q L +++GM+YS+TF AARTCAQ E LNITV P+ G +PIQT+Y+ +GWD
Sbjct  86   VRLGNEASIQQRLTLTRGMHYSVTFSAARTCAQSELLNITVTPEIGEVPIQTVYTSSGWD  145

Query  505  CYAWAFQ  525
             Y+WAF+
Sbjct  146  SYSWAFK  152



>emb|CDX87297.1| BnaA07g35760D [Brassica napus]
Length=342

 Score =   170 bits (430),  Expect = 7e-48, Method: Compositional matrix adjust.
 Identities = 81/129 (63%), Positives = 99/129 (77%), Gaps = 1/129 (1%)
 Frame = +1

Query  142  TDG-LLVNGNFEAPVKKTDLNGTIVTRHDAVPGWTVTGFVEYIQAGQKQGDMQLVVPEGF  318
            +DG LL NGNFE   K + L G++V    AVP W +TG VEYI+AGQKQ DM LVVPEG 
Sbjct  25   SDGSLLPNGNFEMGPKPSQLKGSVVKGRTAVPNWEITGLVEYIKAGQKQDDMVLVVPEGS  84

Query  319  AAVRLGNEASIKQTLNVSKGMYYSITFCAARTCAQEERLNITVAPDSGVLPIQTLYSING  498
            +AVRLGNEASI Q ++V  G  YS+TF AARTCAQ+ERLNI+V  +SGV+PIQT+Y  +G
Sbjct  85   SAVRLGNEASISQKISVRSGRLYSVTFSAARTCAQDERLNISVTHESGVIPIQTMYGSDG  144

Query  499  WDCYAWAFQ  525
            WD Y+WAF+
Sbjct  145  WDSYSWAFK  153



>ref|XP_006653558.1| PREDICTED: uncharacterized protein LOC102719203 [Oryza brachyantha]
Length=374

 Score =   171 bits (432),  Expect = 8e-48, Method: Compositional matrix adjust.
 Identities = 76/127 (60%), Positives = 101/127 (80%), Gaps = 0/127 (0%)
 Frame = +1

Query  145  DGLLVNGNFEAPVKKTDLNGTIVTRHDAVPGWTVTGFVEYIQAGQKQGDMQLVVPEGFAA  324
            DGLL NGNFE    K+ LNGT+VT   ++P W ++GFVEYI++G  + DM + VPEG  A
Sbjct  30   DGLLPNGNFEDGPDKSQLNGTVVTGRYSIPNWEISGFVEYIESGHNEKDMIVAVPEGARA  89

Query  325  VRLGNEASIKQTLNVSKGMYYSITFCAARTCAQEERLNITVAPDSGVLPIQTLYSINGWD  504
            VRLGN+A+I+Q L+V++  YYSITF AARTCAQ+ERLN++V P+ GVLPIQT+Y+ +GWD
Sbjct  90   VRLGNDATIRQKLSVTRRAYYSITFSAARTCAQKERLNVSVTPEFGVLPIQTVYTSSGWD  149

Query  505  CYAWAFQ  525
             Y+WAF+
Sbjct  150  SYSWAFK  156



>ref|NP_001242447.1| uncharacterized protein LOC100802444 precursor [Glycine max]
 gb|ACU22816.1| unknown [Glycine max]
Length=370

 Score =   170 bits (431),  Expect = 9e-48, Method: Compositional matrix adjust.
 Identities = 79/125 (63%), Positives = 97/125 (78%), Gaps = 1/125 (1%)
 Frame = +1

Query  154  LVNGNFEAPVKKTDLNGTIVTR-HDAVPGWTVTGFVEYIQAGQKQGDMQLVVPEGFAAVR  330
            ++NG FE   K  D+ GT+VT    ++PGW ++GF+EYI++GQKQ DM LVVP G  AVR
Sbjct  23   VINGEFELGPKPQDMKGTVVTGGPHSIPGWEISGFIEYIKSGQKQDDMLLVVPNGAYAVR  82

Query  331  LGNEASIKQTLNVSKGMYYSITFCAARTCAQEERLNITVAPDSGVLPIQTLYSINGWDCY  510
            LGNEASIKQ L V KGMYYSITF  ARTCAQEE+LN++ APD  VLP+QT+Y  NGWD Y
Sbjct  83   LGNEASIKQNLKVVKGMYYSITFVVARTCAQEEKLNVSAAPDWVVLPMQTVYGGNGWDAY  142

Query  511  AWAFQ  525
            AW+F+
Sbjct  143  AWSFR  147



>emb|CAE01677.2| OSJNBb0091E11.19 [Oryza sativa Japonica Group]
Length=372

 Score =   170 bits (431),  Expect = 9e-48, Method: Compositional matrix adjust.
 Identities = 77/128 (60%), Positives = 102/128 (80%), Gaps = 0/128 (0%)
 Frame = +1

Query  142  TDGLLVNGNFEAPVKKTDLNGTIVTRHDAVPGWTVTGFVEYIQAGQKQGDMQLVVPEGFA  321
            TDGLL NGNFE    K+ LNGT+VT   A+  W ++GFVEYI++G ++ DM L VPEG  
Sbjct  27   TDGLLPNGNFEDGPDKSQLNGTVVTGRYAILNWEISGFVEYIESGHREQDMILAVPEGAR  86

Query  322  AVRLGNEASIKQTLNVSKGMYYSITFCAARTCAQEERLNITVAPDSGVLPIQTLYSINGW  501
            AVRLGN+A+I+Q L+V++  YYSITF AARTCAQ+E+LN++V P+ GVLPIQT+Y+ +GW
Sbjct  87   AVRLGNDATIRQRLSVTRRAYYSITFSAARTCAQKEKLNMSVTPEFGVLPIQTVYTSSGW  146

Query  502  DCYAWAFQ  525
            D Y+WAF+
Sbjct  147  DSYSWAFR  154



>ref|XP_003581385.1| PREDICTED: uncharacterized protein LOC100824265 [Brachypodium 
distachyon]
Length=373

 Score =   170 bits (431),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 80/127 (63%), Positives = 101/127 (80%), Gaps = 0/127 (0%)
 Frame = +1

Query  145  DGLLVNGNFEAPVKKTDLNGTIVTRHDAVPGWTVTGFVEYIQAGQKQGDMQLVVPEGFAA  324
            DGLL NGNF+    K+ LNGTIV    ++P W V+GFVEYI +GQKQG+M L VPEG  A
Sbjct  26   DGLLPNGNFKDGPGKSQLNGTIVMGSHSIPFWEVSGFVEYIGSGQKQGEMILPVPEGACA  85

Query  325  VRLGNEASIKQTLNVSKGMYYSITFCAARTCAQEERLNITVAPDSGVLPIQTLYSINGWD  504
            VRLGN+ASI+Q L+V++  +YSITF AARTCAQ E+LN++VA DSG+LPIQT+Y+  GWD
Sbjct  86   VRLGNDASIRQKLSVTRRTFYSITFSAARTCAQAEKLNVSVASDSGLLPIQTVYASIGWD  145

Query  505  CYAWAFQ  525
             Y+WAF+
Sbjct  146  SYSWAFK  152



>ref|NP_178141.1| protein DUF642 L-GALL RESPONSIVE GENE 1 [Arabidopsis thaliana]
 gb|AAD55477.1|AC009322_17 Unknown protein [Arabidopsis thaliana]
 gb|ACD85595.1| At1g80240 [Arabidopsis thaliana]
 gb|AEE36374.1| uncharacterized protein AT1G80240 [Arabidopsis thaliana]
Length=370

 Score =   170 bits (430),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 78/127 (61%), Positives = 98/127 (77%), Gaps = 0/127 (0%)
 Frame = +1

Query  145  DGLLVNGNFEAPVKKTDLNGTIVTRHDAVPGWTVTGFVEYIQAGQKQGDMQLVVPEGFAA  324
            DGLL NGNFE   K + + G++V    AVP W + GFVE+I++GQKQ DM LVVP+G +A
Sbjct  27   DGLLPNGNFELGPKPSQMKGSVVKERTAVPNWNIIGFVEFIKSGQKQDDMVLVVPQGSSA  86

Query  325  VRLGNEASIKQTLNVSKGMYYSITFCAARTCAQEERLNITVAPDSGVLPIQTLYSINGWD  504
            VRLGNEASI Q ++V  G  YSITF AARTCAQ+ERLNI+V  +SGV+PIQT+Y  +GWD
Sbjct  87   VRLGNEASISQKISVLPGRLYSITFSAARTCAQDERLNISVTHESGVIPIQTMYGSDGWD  146

Query  505  CYAWAFQ  525
             Y+WAF+
Sbjct  147  SYSWAFK  153



>emb|CDY57694.1| BnaA07g38340D [Brassica napus]
Length=370

 Score =   170 bits (430),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 82/128 (64%), Positives = 99/128 (77%), Gaps = 1/128 (1%)
 Frame = +1

Query  145  DG-LLVNGNFEAPVKKTDLNGTIVTRHDAVPGWTVTGFVEYIQAGQKQGDMQLVVPEGFA  321
            DG LL NGNFE   K + L G++V   +AV  W +TGFVEYI+AGQKQ DM LVVPEG +
Sbjct  26   DGSLLPNGNFEIGPKPSQLKGSVVKERNAVAHWDMTGFVEYIKAGQKQDDMVLVVPEGSS  85

Query  322  AVRLGNEASIKQTLNVSKGMYYSITFCAARTCAQEERLNITVAPDSGVLPIQTLYSINGW  501
            AVRLGNEASI Q ++V  G  YSITF AARTCAQ+ERLNI+V  +SGV+PIQT+Y  +GW
Sbjct  86   AVRLGNEASISQKISVRSGRLYSITFSAARTCAQDERLNISVTHESGVIPIQTMYGSDGW  145

Query  502  DCYAWAFQ  525
            D Y+WAF+
Sbjct  146  DSYSWAFK  153



>gb|EYU21602.1| hypothetical protein MIMGU_mgv1a008411mg [Erythranthe guttata]
Length=374

 Score =   170 bits (430),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 83/133 (62%), Positives = 103/133 (77%), Gaps = 6/133 (5%)
 Frame = +1

Query  142  TDGLLVNGNFEAPVKKTDLNGTIVTRHDAVPGWTVTGFVEYIQAGQKQGDMQLVVPEGFA  321
            TDGLL NGNFE   K + L GT VT   ++P W V+G+VEYI++GQKQGDM LVVP+G A
Sbjct  23   TDGLLPNGNFEFGPKPSQLKGTKVTDPHSIPDWEVSGYVEYIKSGQKQGDMILVVPQGAA  82

Query  322  AVRLGNEASIK-QTLNVSKGMYYSITFCAARTCAQEERLNITVAP-----DSGVLPIQTL  483
            AVRLG+EASIK + + V  GM+YS++F AARTCAQEE+LN++ AP     D GVLPIQT+
Sbjct  83   AVRLGDEASIKTKRVKVINGMFYSVSFGAARTCAQEEKLNVSFAPNKEEKDWGVLPIQTV  142

Query  484  YSINGWDCYAWAF  522
            YS +GWDCY+W F
Sbjct  143  YSSDGWDCYSWGF  155



>ref|XP_004976082.1| PREDICTED: uncharacterized protein LOC101765204 [Setaria italica]
Length=375

 Score =   170 bits (430),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 78/128 (61%), Positives = 101/128 (79%), Gaps = 0/128 (0%)
 Frame = +1

Query  142  TDGLLVNGNFEAPVKKTDLNGTIVTRHDAVPGWTVTGFVEYIQAGQKQGDMQLVVPEGFA  321
            TDG+L NG+FE    K+ +NGT V   DA+P W + GFVEYI +GQ+Q DM L VPEG  
Sbjct  25   TDGILPNGHFEQGPDKSQMNGTRVMDPDAIPYWKIYGFVEYIGSGQQQDDMILPVPEGEQ  84

Query  322  AVRLGNEASIKQTLNVSKGMYYSITFCAARTCAQEERLNITVAPDSGVLPIQTLYSINGW  501
            AVRLGN+A+I+Q L+V++  YYSITF AARTCAQ E+LN++V P+SGVLPIQT+Y+ +GW
Sbjct  85   AVRLGNDATIRQQLDVTRHTYYSITFGAARTCAQAEKLNVSVTPESGVLPIQTVYTSSGW  144

Query  502  DCYAWAFQ  525
            D Y+WAF+
Sbjct  145  DSYSWAFK  152



>emb|CDY54317.1| BnaC06g43150D [Brassica napus]
Length=370

 Score =   169 bits (429),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 82/128 (64%), Positives = 99/128 (77%), Gaps = 1/128 (1%)
 Frame = +1

Query  145  DG-LLVNGNFEAPVKKTDLNGTIVTRHDAVPGWTVTGFVEYIQAGQKQGDMQLVVPEGFA  321
            DG LL NGNFE   K + L G++V   +AV  W +TGFVEYI+AGQKQ DM LVVPEG +
Sbjct  26   DGSLLPNGNFEIGPKPSQLKGSVVKERNAVAHWDMTGFVEYIKAGQKQDDMVLVVPEGSS  85

Query  322  AVRLGNEASIKQTLNVSKGMYYSITFCAARTCAQEERLNITVAPDSGVLPIQTLYSINGW  501
            AVRLGNEASI Q ++V  G  YSITF AARTCAQ+ERLNI+V  +SGV+PIQT+Y  +GW
Sbjct  86   AVRLGNEASISQKISVRSGRLYSITFSAARTCAQDERLNISVTHESGVIPIQTMYGSDGW  145

Query  502  DCYAWAFQ  525
            D Y+WAF+
Sbjct  146  DSYSWAFK  153



>ref|XP_011072257.1| PREDICTED: uncharacterized protein LOC105157546 [Sesamum indicum]
Length=401

 Score =   170 bits (430),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 79/132 (60%), Positives = 99/132 (75%), Gaps = 5/132 (4%)
 Frame = +1

Query  142  TDGLLVNGNFEAPVKKTDLNGTIVTRHDAVPGWTVTGFVEYIQAGQKQGDMQLVVPEGFA  321
            TDGLL NGNFE   K + + GT V    A+P W ++GFVEYI +G KQGDM LVVPEG +
Sbjct  51   TDGLLPNGNFEYGPKPSQMKGTKVIDPHAIPSWEISGFVEYITSGHKQGDMLLVVPEGAS  110

Query  322  AVRLGNEASIKQTLNVSKGMYYSITFCAARTCAQEERLNITVAP-----DSGVLPIQTLY  486
            AVRLG+EASIK  + V+ GM+YS++F AARTCAQEE+LN++V P     D G+LPIQT+Y
Sbjct  111  AVRLGDEASIKTKVKVTNGMFYSLSFSAARTCAQEEKLNVSVLPNKESKDWGILPIQTVY  170

Query  487  SINGWDCYAWAF  522
            S +GWD Y+W F
Sbjct  171  SSDGWDSYSWGF  182



>ref|XP_002446727.1| hypothetical protein SORBIDRAFT_06g021310 [Sorghum bicolor]
 gb|EES11055.1| hypothetical protein SORBIDRAFT_06g021310 [Sorghum bicolor]
Length=380

 Score =   169 bits (428),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 78/128 (61%), Positives = 103/128 (80%), Gaps = 0/128 (0%)
 Frame = +1

Query  142  TDGLLVNGNFEAPVKKTDLNGTIVTRHDAVPGWTVTGFVEYIQAGQKQGDMQLVVPEGFA  321
            TDGLL NGNFE    K+DLNGT V   +++P W ++GFVEYI +GQ+Q DM L VPEG  
Sbjct  29   TDGLLPNGNFEFGPAKSDLNGTRVMGQNSIPNWEISGFVEYIGSGQQQDDMILPVPEGAY  88

Query  322  AVRLGNEASIKQTLNVSKGMYYSITFCAARTCAQEERLNITVAPDSGVLPIQTLYSINGW  501
            AVRLGN+A+I+Q L+V++   YSITFCAARTCAQ E+LN++VA +SGVLP+QT+Y+ +GW
Sbjct  89   AVRLGNDATIRQKLSVNRKTTYSITFCAARTCAQAEQLNVSVAAESGVLPVQTVYTSSGW  148

Query  502  DCYAWAFQ  525
            D Y++AF+
Sbjct  149  DSYSYAFR  156



>ref|XP_003531698.1| PREDICTED: uncharacterized protein LOC100779277 [Glycine max]
Length=371

 Score =   168 bits (426),  Expect = 5e-47, Method: Compositional matrix adjust.
 Identities = 81/133 (61%), Positives = 100/133 (75%), Gaps = 5/133 (4%)
 Frame = +1

Query  142  TDGLLVNGNFEAPVKKTDLNGTIVTRHDAVPGWTVTGFVEYIQAGQKQGDMQLVVPEGFA  321
            TDGLL NG+FE   K ++L G+IVT  + +P WT++G VEYI++GQKQGDM LVVP G  
Sbjct  24   TDGLLPNGDFEVGPKPSELKGSIVTTPNGIPHWTISGMVEYIKSGQKQGDMVLVVPHGTY  83

Query  322  AVRLGNEASIKQTLNVSKGMYYSITFCAARTCAQEERLNITVAP-----DSGVLPIQTLY  486
            AVRLGNEASIKQ + V KGM+YS+TF A+RTCAQEE+LN++V P     D GV PIQT+Y
Sbjct  84   AVRLGNEASIKQKIQVVKGMFYSLTFSASRTCAQEEKLNVSVVPSNEKSDWGVFPIQTMY  143

Query  487  SINGWDCYAWAFQ  525
              NG D YA  F+
Sbjct  144  GSNGCDSYACGFR  156



>gb|KHN47787.1| hypothetical protein glysoja_029205 [Glycine soja]
Length=369

 Score =   168 bits (425),  Expect = 6e-47, Method: Compositional matrix adjust.
 Identities = 81/133 (61%), Positives = 100/133 (75%), Gaps = 5/133 (4%)
 Frame = +1

Query  142  TDGLLVNGNFEAPVKKTDLNGTIVTRHDAVPGWTVTGFVEYIQAGQKQGDMQLVVPEGFA  321
            TDGLL NG+FE   K ++L G+IVT  + +P WT++G VEYI++GQKQGDM LVVP G  
Sbjct  22   TDGLLPNGDFEVGPKPSELKGSIVTTPNGIPHWTISGMVEYIKSGQKQGDMVLVVPHGTY  81

Query  322  AVRLGNEASIKQTLNVSKGMYYSITFCAARTCAQEERLNITVAP-----DSGVLPIQTLY  486
            AVRLGNEASIKQ + V KGM+YS+TF A+RTCAQEE+LN++V P     D GV PIQT+Y
Sbjct  82   AVRLGNEASIKQKIQVVKGMFYSLTFSASRTCAQEEKLNVSVVPSNEKSDWGVFPIQTMY  141

Query  487  SINGWDCYAWAFQ  525
              NG D YA  F+
Sbjct  142  GSNGCDSYACGFR  154



>ref|XP_006285882.1| hypothetical protein CARUB_v10007385mg [Capsella rubella]
 gb|EOA18780.1| hypothetical protein CARUB_v10007385mg [Capsella rubella]
Length=354

 Score =   167 bits (423),  Expect = 8e-47, Method: Compositional matrix adjust.
 Identities = 78/120 (65%), Positives = 95/120 (79%), Gaps = 0/120 (0%)
 Frame = +1

Query  145  DGLLVNGNFEAPVKKTDLNGTIVTRHDAVPGWTVTGFVEYIQAGQKQGDMQLVVPEGFAA  324
            DGLL NG+FE   + +D+ GT V    A+P W ++GFVEYI +GQKQGDM LVVP+G  A
Sbjct  24   DGLLPNGDFELGPRHSDMKGTQVINKAAIPNWELSGFVEYIPSGQKQGDMILVVPKGAFA  83

Query  325  VRLGNEASIKQTLNVSKGMYYSITFCAARTCAQEERLNITVAPDSGVLPIQTLYSINGWD  504
            VRLGNEASIKQ ++V KG YYSITF AARTCAQ+ERLN++VAP   V+PIQT+YS +GWD
Sbjct  84   VRLGNEASIKQKISVKKGSYYSITFSAARTCAQDERLNVSVAPHHAVMPIQTVYSSSGWD  143



>dbj|BAJ96954.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=378

 Score =   167 bits (424),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 79/128 (62%), Positives = 100/128 (78%), Gaps = 0/128 (0%)
 Frame = +1

Query  142  TDGLLVNGNFEAPVKKTDLNGTIVTRHDAVPGWTVTGFVEYIQAGQKQGDMQLVVPEGFA  321
            TDG+L NGNFE    ++ ++GT VT   A+P W V G VEYI +GQKQGDM L VPEG  
Sbjct  31   TDGILPNGNFEEAPDRSQMDGTRVTGRYAIPRWEVCGCVEYICSGQKQGDMVLPVPEGAY  90

Query  322  AVRLGNEASIKQTLNVSKGMYYSITFCAARTCAQEERLNITVAPDSGVLPIQTLYSINGW  501
            A+RLGN+AS++Q L+V+ G +YSITF AARTCAQ ERLN+TVA +SG LPIQT+Y+ +GW
Sbjct  91   AMRLGNDASVQQQLSVTPGTHYSITFSAARTCAQAERLNVTVAAESGQLPIQTVYTSSGW  150

Query  502  DCYAWAFQ  525
            D Y+WAF+
Sbjct  151  DSYSWAFE  158



>ref|XP_002446728.1| hypothetical protein SORBIDRAFT_06g021320 [Sorghum bicolor]
 gb|EES11056.1| hypothetical protein SORBIDRAFT_06g021320 [Sorghum bicolor]
Length=371

 Score =   167 bits (422),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 75/128 (59%), Positives = 102/128 (80%), Gaps = 0/128 (0%)
 Frame = +1

Query  142  TDGLLVNGNFEAPVKKTDLNGTIVTRHDAVPGWTVTGFVEYIQAGQKQGDMQLVVPEGFA  321
            T+GLL NG+FE    K+++NGT V    ++P W ++GF+EYI++GQKQ DM L VPEG  
Sbjct  25   TEGLLPNGHFEQGPAKSEMNGTRVLGRYSIPHWEISGFLEYIESGQKQDDMLLQVPEGER  84

Query  322  AVRLGNEASIKQTLNVSKGMYYSITFCAARTCAQEERLNITVAPDSGVLPIQTLYSINGW  501
            AVRLGN+A+I+Q L V++  YYSITF A+RTCAQ E+LN++V P+SGVLPIQT+Y+ +GW
Sbjct  85   AVRLGNDATIQQQLAVTRHTYYSITFSASRTCAQAEKLNVSVTPESGVLPIQTVYTSSGW  144

Query  502  DCYAWAFQ  525
            D Y+WAF+
Sbjct  145  DSYSWAFK  152



>gb|EEE61252.1| hypothetical protein OsJ_15312 [Oryza sativa Japonica Group]
Length=626

 Score =   171 bits (432),  Expect = 2e-46, Method: Composition-based stats.
 Identities = 77/128 (60%), Positives = 102/128 (80%), Gaps = 0/128 (0%)
 Frame = +1

Query  142  TDGLLVNGNFEAPVKKTDLNGTIVTRHDAVPGWTVTGFVEYIQAGQKQGDMQLVVPEGFA  321
            TDGLL NGNFE    K+ LNGT+VT   A+  W ++GFVEYI++G ++ DM L VPEG  
Sbjct  27   TDGLLPNGNFEDGPDKSQLNGTVVTGRYAILNWEISGFVEYIESGHREQDMILAVPEGAR  86

Query  322  AVRLGNEASIKQTLNVSKGMYYSITFCAARTCAQEERLNITVAPDSGVLPIQTLYSINGW  501
            AVRLGN+A+I+Q L+V++  YYSITF AARTCAQ+E+LN++V P+ GVLPIQT+Y+ +GW
Sbjct  87   AVRLGNDATIRQRLSVTRRAYYSITFSAARTCAQKEKLNMSVTPEFGVLPIQTVYTSSGW  146

Query  502  DCYAWAFQ  525
            D Y+WAF+
Sbjct  147  DSYSWAFR  154


 Score =   139 bits (350),  Expect = 5e-35, Method: Composition-based stats.
 Identities = 60/100 (60%), Positives = 80/100 (80%), Gaps = 0/100 (0%)
 Frame = +1

Query  226  AVPGWTVTGFVEYIQAGQKQGDMQLVVPEGFAAVRLGNEASIKQTLNVSKGMYYSITFCA  405
            A P W ++GFVEYI +G K+ DM L VPEG  AVRLGN+A+I+Q ++V++ MYYS+TF A
Sbjct  305  AEPNWEISGFVEYIGSGHKEQDMILAVPEGAYAVRLGNDATIRQRISVTRHMYYSVTFSA  364

Query  406  ARTCAQEERLNITVAPDSGVLPIQTLYSINGWDCYAWAFQ  525
            ARTCAQ E+LN++V  + GVLPIQT+Y+  GWD Y+WAF+
Sbjct  365  ARTCAQAEKLNVSVTLEFGVLPIQTVYTSTGWDSYSWAFK  404



>gb|KHN07098.1| hypothetical protein glysoja_023281 [Glycine soja]
Length=328

 Score =   164 bits (415),  Expect = 9e-46, Method: Compositional matrix adjust.
 Identities = 76/111 (68%), Positives = 91/111 (82%), Gaps = 1/111 (1%)
 Frame = +1

Query  196  LNGTIVTRH-DAVPGWTVTGFVEYIQAGQKQGDMQLVVPEGFAAVRLGNEASIKQTLNVS  372
            + GT+VT    A+PGW ++GF+EY+++GQKQGDM LVVP G  AVRLGN ASIKQ + V 
Sbjct  1    MKGTVVTGGPHAIPGWEISGFIEYLKSGQKQGDMLLVVPNGAYAVRLGNGASIKQKIKVV  60

Query  373  KGMYYSITFCAARTCAQEERLNITVAPDSGVLPIQTLYSINGWDCYAWAFQ  525
            KGMYYSITF  ARTCAQEE+LN++VAPD  VLP+QTLYS NGWD YAW+FQ
Sbjct  61   KGMYYSITFMVARTCAQEEKLNVSVAPDWVVLPMQTLYSGNGWDAYAWSFQ  111



>ref|XP_003580051.1| PREDICTED: uncharacterized protein LOC100841904 [Brachypodium 
distachyon]
Length=373

 Score =   165 bits (417),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 74/128 (58%), Positives = 98/128 (77%), Gaps = 0/128 (0%)
 Frame = +1

Query  142  TDGLLVNGNFEAPVKKTDLNGTIVTRHDAVPGWTVTGFVEYIQAGQKQGDMQLVVPEGFA  321
            TDGLL NG F     K+ +NGT+VT   A+P W ++GFVEYI++G K+ DM L VP G  
Sbjct  25   TDGLLPNGRFSQGPDKSQMNGTVVTGKHAMPNWELSGFVEYIESGHKEADMLLAVPVGAN  84

Query  322  AVRLGNEASIKQTLNVSKGMYYSITFCAARTCAQEERLNITVAPDSGVLPIQTLYSINGW  501
            AVRLGN+A+I+Q L+V++  YYSITF AAR+CAQ E+LN++V P+ GVLPIQT+Y+  GW
Sbjct  85   AVRLGNDATIRQQLSVTRKAYYSITFVAARSCAQAEKLNVSVDPEFGVLPIQTVYTSTGW  144

Query  502  DCYAWAFQ  525
            D Y+WAF+
Sbjct  145  DSYSWAFK  152



>gb|AGV54541.1| hypothetical protein [Phaseolus vulgaris]
Length=376

 Score =   164 bits (414),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 75/133 (56%), Positives = 102/133 (77%), Gaps = 5/133 (4%)
 Frame = +1

Query  142  TDGLLVNGNFEAPVKKTDLNGTIVTRHDAVPGWTVTGFVEYIQAGQKQGDMQLVVPEGFA  321
            T+GLL NGNFE   K +++ G++V   +A+P WT+TG VEYI++GQKQGDM LVVPEG  
Sbjct  26   TNGLLPNGNFERGPKASEMKGSVVIGQNAIPNWTITGLVEYIKSGQKQGDMLLVVPEGDY  85

Query  322  AVRLGNEASIKQTLNVSKGMYYSITFCAARTCAQEERLNITVAP-----DSGVLPIQTLY  486
            AVRLG+EASIKQ + +++G +Y+ITF AARTCAQEE+LN++V P     D G++PIQT+Y
Sbjct  86   AVRLGDEASIKQKVKLNEGFFYAITFGAARTCAQEEKLNVSVVPTTEKRDWGIIPIQTMY  145

Query  487  SINGWDCYAWAFQ  525
              NGW+ +   F+
Sbjct  146  GSNGWESFTCGFR  158



>ref|XP_004978107.1| PREDICTED: uncharacterized protein LOC101761699 [Setaria italica]
Length=377

 Score =   163 bits (413),  Expect = 5e-45, Method: Compositional matrix adjust.
 Identities = 81/129 (63%), Positives = 100/129 (78%), Gaps = 2/129 (2%)
 Frame = +1

Query  145  DGLLVNGNFEAPVKKTDLNGTIVTRHDAVPGWTVTGFVEYIQAGQKQGD-MQLVVPEGFA  321
            DG L NG FE     + LNGT VTR DA+P W ++GFVEYIQ+GQ Q D M L VPEG  
Sbjct  28   DGPLPNGIFEQGPDASQLNGTRVTRQDAIPCWEISGFVEYIQSGQNQQDGMVLAVPEGAH  87

Query  322  AVRLGNEASIKQTL-NVSKGMYYSITFCAARTCAQEERLNITVAPDSGVLPIQTLYSING  498
            AVRLGN ASI+Q L N+++  YYSITF AARTCAQ E+LN++VAP+SGVLPIQT+Y+ +G
Sbjct  88   AVRLGNGASIRQQLTNLARRSYYSITFSAARTCAQAEQLNVSVAPESGVLPIQTVYTSSG  147

Query  499  WDCYAWAFQ  525
            WD Y++AF+
Sbjct  148  WDSYSYAFK  156



>ref|XP_011081171.1| PREDICTED: LOW QUALITY PROTEIN: uncharacterized protein LOC105164253 
[Sesamum indicum]
Length=373

 Score =   163 bits (412),  Expect = 7e-45, Method: Compositional matrix adjust.
 Identities = 75/131 (57%), Positives = 98/131 (75%), Gaps = 5/131 (4%)
 Frame = +1

Query  145  DGLLVNGNFEAPVKKTDLNGTIVTRHDAVPGWTVTGFVEYIQAGQKQGDMQLVVPEGFAA  324
            DG L NGNFE   K + + GT V    ++P W  +GFVEYI++GQKQGDM LVVPEG +A
Sbjct  21   DGQLPNGNFEFGPKPSQMKGTKVMDPHSIPHWETSGFVEYIKSGQKQGDMLLVVPEGASA  80

Query  325  VRLGNEASIKQTLNVSKGMYYSITFCAARTCAQEERLNITVAPDS-----GVLPIQTLYS  489
            VRLG+EASIK  + V  G++YS++F AARTCAQEE+LN++V+P+S     G+LP+QT+YS
Sbjct  81   VRLGDEASIKTKVKVKNGLFYSVSFSAARTCAQEEKLNVSVSPNSESMDWGILPMQTVYS  140

Query  490  INGWDCYAWAF  522
             +GWD Y W F
Sbjct  141  SDGWDSYCWGF  151



>gb|EYU24667.1| hypothetical protein MIMGU_mgv1a008541mg [Erythranthe guttata]
Length=370

 Score =   162 bits (411),  Expect = 8e-45, Method: Compositional matrix adjust.
 Identities = 75/132 (57%), Positives = 100/132 (76%), Gaps = 5/132 (4%)
 Frame = +1

Query  142  TDGLLVNGNFEAPVKKTDLNGTIVTRHDAVPGWTVTGFVEYIQAGQKQGDMQLVVPEGFA  321
            TDGLL NGNFE   K++++ GT V    ++P W  TGFVEYI++ QKQGDMQLVVPEG +
Sbjct  20   TDGLLPNGNFENGPKRSEMKGTRVINSRSIPFWETTGFVEYIKSTQKQGDMQLVVPEGNS  79

Query  322  AVRLGNEASIKQTLNVSKGMYYSITFCAARTCAQEERLNITVAPDS-----GVLPIQTLY  486
            AVRLG+ A++K  + V+ G +YS++F A+RTCAQEE+LNI+ +P+S     G+LPIQT+Y
Sbjct  80   AVRLGDGAAVKTKVKVTNGKFYSVSFSASRTCAQEEKLNISASPNSEPKDWGMLPIQTVY  139

Query  487  SINGWDCYAWAF  522
            S +GWD Y W F
Sbjct  140  SSDGWDSYCWGF  151



>ref|XP_004978108.1| PREDICTED: uncharacterized protein LOC101762525 [Setaria italica]
Length=381

 Score =   162 bits (411),  Expect = 9e-45, Method: Compositional matrix adjust.
 Identities = 76/127 (60%), Positives = 96/127 (76%), Gaps = 0/127 (0%)
 Frame = +1

Query  145  DGLLVNGNFEAPVKKTDLNGTIVTRHDAVPGWTVTGFVEYIQAGQKQGDMQLVVPEGFAA  324
            DGLL NGNFE    K+++NGT V   DA+  W + GFVEYI++G  Q DM L VPEG  A
Sbjct  34   DGLLPNGNFEQGPNKSEMNGTRVKDRDAILHWEIYGFVEYIESGHTQEDMILPVPEGDRA  93

Query  325  VRLGNEASIKQTLNVSKGMYYSITFCAARTCAQEERLNITVAPDSGVLPIQTLYSINGWD  504
            VRLGN+A+I+Q L V++  YYSITF AAR+CAQ E LN++V PD GVLPIQT+Y+ +GWD
Sbjct  94   VRLGNDATIRQKLCVTRQAYYSITFTAARSCAQAEALNVSVTPDFGVLPIQTVYTSSGWD  153

Query  505  CYAWAFQ  525
             Y+WAF+
Sbjct  154  SYSWAFK  160



>gb|ABR13280.1| unknown protein [Prunus dulcis]
Length=175

 Score =   156 bits (395),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 73/89 (82%), Positives = 80/89 (90%), Gaps = 0/89 (0%)
 Frame = +1

Query  259  EYIQAGQKQGDMQLVVPEGFAAVRLGNEASIKQTLNVSKGMYYSITFCAARTCAQEERLN  438
             YI++GQKQGDM LVVPEG  AVRLGNEASIKQ + V+KG+YYSITF AARTCAQEERLN
Sbjct  1    RYIKSGQKQGDMLLVVPEGAYAVRLGNEASIKQRIKVTKGLYYSITFSAARTCAQEERLN  60

Query  439  ITVAPDSGVLPIQTLYSINGWDCYAWAFQ  525
            I+VAPDSGVLPIQT+YS NGWD YAWAFQ
Sbjct  61   ISVAPDSGVLPIQTVYSSNGWDSYAWAFQ  89



>ref|XP_006412472.1| hypothetical protein EUTSA_v10025706mg [Eutrema salsugineum]
 gb|ESQ53925.1| hypothetical protein EUTSA_v10025706mg [Eutrema salsugineum]
Length=325

 Score =   160 bits (404),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 72/110 (65%), Positives = 89/110 (81%), Gaps = 0/110 (0%)
 Frame = +1

Query  196  LNGTIVTRHDAVPGWTVTGFVEYIQAGQKQGDMQLVVPEGFAAVRLGNEASIKQTLNVSK  375
            + GT V    A+P W ++GFVEYI +G KQGDM LVVP+G  AVRLGNEASIKQ +NV K
Sbjct  1    MKGTQVMNKTAIPKWELSGFVEYIPSGHKQGDMILVVPKGAFAVRLGNEASIKQKINVKK  60

Query  376  GMYYSITFCAARTCAQEERLNITVAPDSGVLPIQTLYSINGWDCYAWAFQ  525
            G YY+ITF AARTCAQ+E+LN++VAP  GV+PIQT+YS +GWD Y+WAF+
Sbjct  61   GSYYAITFSAARTCAQDEQLNVSVAPRHGVMPIQTVYSSSGWDLYSWAFK  110



>ref|NP_001140426.1| hypothetical protein precursor [Zea mays]
 gb|ACF83808.1| unknown [Zea mays]
 gb|ACR34644.1| unknown [Zea mays]
 gb|AFW70605.1| hypothetical protein ZEAMMB73_168025 [Zea mays]
Length=371

 Score =   160 bits (405),  Expect = 5e-44, Method: Compositional matrix adjust.
 Identities = 78/128 (61%), Positives = 94/128 (73%), Gaps = 1/128 (1%)
 Frame = +1

Query  142  TDGLLVNGNFEAPVKKTDLNGTIVTRHDAVPGWTVTGFVEYIQAGQKQGDMQLVVPEGFA  321
            TDGLL NGNFE     + L GT V    A+P W  +GFVEYI +GQKQGDM LVVPEG  
Sbjct  26   TDGLLPNGNFERSPLPSQLRGTRVVGASAIPSWQTSGFVEYISSGQKQGDMVLVVPEGAY  85

Query  322  AVRLGNEASIKQTLN-VSKGMYYSITFCAARTCAQEERLNITVAPDSGVLPIQTLYSING  498
            AVRLGNEASI+Q L   ++G  YS+TF AARTCAQ E+LN++ +  SG+L +QT+YS NG
Sbjct  86   AVRLGNEASIRQRLRGAARGARYSLTFSAARTCAQAEQLNVSASGQSGLLAMQTMYSSNG  145

Query  499  WDCYAWAF  522
            WD YAWA+
Sbjct  146  WDSYAWAW  153



>emb|CAA22573.1| putative protein [Arabidopsis thaliana]
 emb|CAB79963.1| putative protein [Arabidopsis thaliana]
Length=325

 Score =   159 bits (401),  Expect = 9e-44, Method: Compositional matrix adjust.
 Identities = 72/110 (65%), Positives = 88/110 (80%), Gaps = 0/110 (0%)
 Frame = +1

Query  196  LNGTIVTRHDAVPGWTVTGFVEYIQAGQKQGDMQLVVPEGFAAVRLGNEASIKQTLNVSK  375
            + GT V    A+P W ++GFVEYI +G KQGDM LVVP+G  AVRLGNEASIKQ ++V K
Sbjct  1    MKGTQVINITAIPNWELSGFVEYIPSGHKQGDMILVVPKGAFAVRLGNEASIKQKISVKK  60

Query  376  GMYYSITFCAARTCAQEERLNITVAPDSGVLPIQTLYSINGWDCYAWAFQ  525
            G YYSITF AARTCAQ+ERLN++VAP   V+PIQT+YS +GWD Y+WAF+
Sbjct  61   GSYYSITFSAARTCAQDERLNVSVAPHHAVMPIQTVYSSSGWDLYSWAFK  110



>ref|XP_011466738.1| PREDICTED: uncharacterized protein LOC101306247 isoform X2 [Fragaria 
vesca subsp. vesca]
 ref|XP_011466739.1| PREDICTED: uncharacterized protein LOC101306247 isoform X2 [Fragaria 
vesca subsp. vesca]
Length=333

 Score =   159 bits (401),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 73/114 (64%), Positives = 89/114 (78%), Gaps = 5/114 (4%)
 Frame = +1

Query  196  LNGTIVTRHDAVPGWTVTGFVEYIQAGQKQGDMQLVVPEGFAAVRLGNEASIKQTLNVSK  375
            + GT+VT H+A+P W  +G+VEYI++G KQGDM LVVPEG  A+RLGNEASIKQ + V+K
Sbjct  1    MKGTVVTAHNAIPNWETSGYVEYIKSGHKQGDMLLVVPEGGFAIRLGNEASIKQKIKVTK  60

Query  376  GMYYSITFCAARTCAQEERLNITVAP-----DSGVLPIQTLYSINGWDCYAWAF  522
            G +Y+ITF AARTCAQEE LNI+V P     D G+LPIQT+YS  GWD YAW F
Sbjct  61   GGFYAITFSAARTCAQEEILNISVNPNVEKQDFGILPIQTMYSSTGWDSYAWGF  114



>ref|XP_004241713.1| PREDICTED: uncharacterized protein LOC101268115 [Solanum lycopersicum]
Length=372

 Score =   159 bits (402),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 73/131 (56%), Positives = 97/131 (74%), Gaps = 5/131 (4%)
 Frame = +1

Query  145  DGLLVNGNFEAPVKKTDLNGTIVTRHDAVPGWTVTGFVEYIQAGQKQGDMQLVVPEGFAA  324
            DGLL NGNFE   K + + GT V    A+P W ++G+VEYI++GQ QGDM L VP+G  A
Sbjct  23   DGLLSNGNFELGPKPSQMKGTKVVDRHAIPNWEISGYVEYIKSGQTQGDMLLPVPQGDYA  82

Query  325  VRLGNEASIKQTLNVSKGMYYSITFCAARTCAQEERLNITVAPDS-----GVLPIQTLYS  489
            VRLG +ASIK  + V+KG++YSI+F  ARTCAQEE+LN++V+P+S     G+LP+QT+YS
Sbjct  83   VRLGEDASIKTKVKVTKGIFYSISFVFARTCAQEEKLNVSVSPNSEPNDWGMLPLQTMYS  142

Query  490  INGWDCYAWAF  522
              GWD Y+W F
Sbjct  143  SEGWDSYSWGF  153



>ref|XP_002453515.1| hypothetical protein SORBIDRAFT_04g007160 [Sorghum bicolor]
 gb|EES06491.1| hypothetical protein SORBIDRAFT_04g007160 [Sorghum bicolor]
Length=364

 Score =   159 bits (401),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 77/128 (60%), Positives = 95/128 (74%), Gaps = 1/128 (1%)
 Frame = +1

Query  142  TDGLLVNGNFEAPVKKTDLNGTIVTRHDAVPGWTVTGFVEYIQAGQKQGDMQLVVPEGFA  321
            TDGLL NGNFE     + L GT V    A+P W  +GFVEYI +G+KQGDM LVVPEG  
Sbjct  21   TDGLLPNGNFERGPAPSQLRGTRVMGSSAIPAWQTSGFVEYIPSGRKQGDMVLVVPEGAY  80

Query  322  AVRLGNEASIKQTLN-VSKGMYYSITFCAARTCAQEERLNITVAPDSGVLPIQTLYSING  498
            AVRLGNEASI+Q L+  ++G  YS+TF AARTCAQ E+LN++ +  SG+L +QT+YS NG
Sbjct  81   AVRLGNEASIRQRLHGAARGARYSLTFSAARTCAQAEQLNVSASGQSGLLAMQTMYSSNG  140

Query  499  WDCYAWAF  522
            WD YAWA+
Sbjct  141  WDSYAWAW  148



>ref|XP_002446726.1| hypothetical protein SORBIDRAFT_06g021300 [Sorghum bicolor]
 gb|EES11054.1| hypothetical protein SORBIDRAFT_06g021300 [Sorghum bicolor]
Length=378

 Score =   159 bits (401),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 74/128 (58%), Positives = 100/128 (78%), Gaps = 1/128 (1%)
 Frame = +1

Query  145  DGLLVNGNFEAPVKKTDLNGTIVTRHDAVPGWTVTGFVEYIQAGQKQGDMQLVVPEGFAA  324
            DGLL NGNFE    K+ +NG+ V   +++P W  +GFVEYI+ GQ+Q DM LVVPEG  A
Sbjct  30   DGLLPNGNFEQGPDKSQMNGSRVIGQNSIPCWETSGFVEYIEPGQQQNDMVLVVPEGARA  89

Query  325  VRLGNEASIKQTL-NVSKGMYYSITFCAARTCAQEERLNITVAPDSGVLPIQTLYSINGW  501
            VRLGN+A+I+Q L  +++ M YSITF AARTCAQ E+LN++VA +SGVLP+QT+Y+ +GW
Sbjct  90   VRLGNDATIRQQLPGLTRSMSYSITFSAARTCAQAEQLNVSVAAESGVLPVQTVYTSSGW  149

Query  502  DCYAWAFQ  525
            D Y++AF+
Sbjct  150  DSYSYAFK  157



>ref|XP_006356190.1| PREDICTED: uncharacterized protein LOC102589576 [Solanum tuberosum]
Length=371

 Score =   159 bits (401),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 72/131 (55%), Positives = 97/131 (74%), Gaps = 5/131 (4%)
 Frame = +1

Query  145  DGLLVNGNFEAPVKKTDLNGTIVTRHDAVPGWTVTGFVEYIQAGQKQGDMQLVVPEGFAA  324
            DGLL NGNFE   K + + GT V    A+P W ++G+VEYI++GQ QGDM L VP+G  A
Sbjct  22   DGLLSNGNFELGPKPSQMKGTKVVDRHAIPNWEISGYVEYIKSGQTQGDMLLPVPQGDYA  81

Query  325  VRLGNEASIKQTLNVSKGMYYSITFCAARTCAQEERLNITVAPDS-----GVLPIQTLYS  489
            VRLG +ASIK  + ++KG++YSI+F  ARTCAQEE+LN++V+P+S     G+LP+QT+YS
Sbjct  82   VRLGEDASIKTKVKLTKGVFYSISFVFARTCAQEEKLNVSVSPNSEPNDWGILPLQTMYS  141

Query  490  INGWDCYAWAF  522
              GWD Y+W F
Sbjct  142  SEGWDSYSWGF  152



>ref|XP_004951511.1| PREDICTED: uncharacterized protein LOC101755979 [Setaria italica]
Length=374

 Score =   158 bits (400),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 80/128 (63%), Positives = 92/128 (72%), Gaps = 1/128 (1%)
 Frame = +1

Query  142  TDGLLVNGNFEAPVKKTDLNGTIVTRHDAVPGWTVTGFVEYIQAGQKQGDMQLVVPEGFA  321
            TDGLL NGNFE     + L GT V    ++P W  +GFVEYI +GQKQGDM LVVPEG  
Sbjct  26   TDGLLPNGNFERGPLPSQLRGTRVLGSSSIPSWQTSGFVEYIPSGQKQGDMLLVVPEGAY  85

Query  322  AVRLGNEASIKQTLN-VSKGMYYSITFCAARTCAQEERLNITVAPDSGVLPIQTLYSING  498
            AVRLGNEASI+Q L   + G  YS+TF AARTCAQ ERLNI+ +  SG+L IQT YS NG
Sbjct  86   AVRLGNEASIRQRLRGAAPGARYSLTFSAARTCAQAERLNISASGQSGLLAIQTTYSSNG  145

Query  499  WDCYAWAF  522
            WD YAWA+
Sbjct  146  WDSYAWAW  153



>gb|KHN07099.1| hypothetical protein glysoja_023282 [Glycine soja]
Length=359

 Score =   157 bits (397),  Expect = 6e-43, Method: Compositional matrix adjust.
 Identities = 73/109 (67%), Positives = 88/109 (81%), Gaps = 1/109 (1%)
 Frame = +1

Query  202  GTIVTR-HDAVPGWTVTGFVEYIQAGQKQGDMQLVVPEGFAAVRLGNEASIKQTLNVSKG  378
            GT+VT    ++PGW ++GF+EYI++GQKQ DM LVVP G  AVRLGNEASIKQ L V KG
Sbjct  28   GTVVTGGPHSIPGWEISGFIEYIKSGQKQDDMLLVVPNGAYAVRLGNEASIKQNLKVVKG  87

Query  379  MYYSITFCAARTCAQEERLNITVAPDSGVLPIQTLYSINGWDCYAWAFQ  525
            MYYSITF  ARTCAQEE+LN++ APD  VLP+QT+Y  NGWD YAW+F+
Sbjct  88   MYYSITFVVARTCAQEEKLNVSAAPDWVVLPMQTVYGGNGWDAYAWSFR  136



>dbj|BAJ97095.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=365

 Score =   157 bits (398),  Expect = 6e-43, Method: Compositional matrix adjust.
 Identities = 72/127 (57%), Positives = 95/127 (75%), Gaps = 0/127 (0%)
 Frame = +1

Query  145  DGLLVNGNFEAPVKKTDLNGTIVTRHDAVPGWTVTGFVEYIQAGQKQGDMQLVVPEGFAA  324
            DGLL NG+F     K+ +NG +VT   A+P W ++GFVEYI++G  Q DM L VP G  A
Sbjct  27   DGLLPNGDFRNGPDKSQMNGPVVTGKHAIPNWELSGFVEYIESGHTQEDMILPVPVGANA  86

Query  325  VRLGNEASIKQTLNVSKGMYYSITFCAARTCAQEERLNITVAPDSGVLPIQTLYSINGWD  504
            VRLGN+A+I+Q L VS+  YYSI+F AAR+CAQ E+LN++V P+ GVLPIQT+Y+  GWD
Sbjct  87   VRLGNDATIRQQLKVSRHTYYSISFIAARSCAQAEKLNVSVDPEFGVLPIQTVYTNTGWD  146

Query  505  CYAWAFQ  525
             Y+WAF+
Sbjct  147  TYSWAFK  153



>dbj|BAK03126.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=374

 Score =   157 bits (398),  Expect = 7e-43, Method: Compositional matrix adjust.
 Identities = 78/128 (61%), Positives = 92/128 (72%), Gaps = 1/128 (1%)
 Frame = +1

Query  142  TDGLLVNGNFEAPVKKTDLNGTIVTRHDAVPGWTVTGFVEYIQAGQKQGDMQLVVPEGFA  321
            TDGLL NGNFE   + + L GT V    ++P W  +GFVEYI +GQKQGDM LVVPEG  
Sbjct  25   TDGLLANGNFERGPQPSQLRGTQVVGASSIPSWRTSGFVEYIPSGQKQGDMVLVVPEGAY  84

Query  322  AVRLGNEASIKQTLN-VSKGMYYSITFCAARTCAQEERLNITVAPDSGVLPIQTLYSING  498
            AVRLGNEASI Q L     G  YS+TF AARTCAQ ERLN++ +  SGVL +QT+YS NG
Sbjct  85   AVRLGNEASIAQRLRGAVPGARYSLTFSAARTCAQAERLNVSASGQSGVLVMQTMYSSNG  144

Query  499  WDCYAWAF  522
            WD Y+WA+
Sbjct  145  WDSYSWAW  152



>ref|XP_009591297.1| PREDICTED: uncharacterized protein LOC104088341 [Nicotiana tomentosiformis]
Length=372

 Score =   157 bits (397),  Expect = 9e-43, Method: Compositional matrix adjust.
 Identities = 76/132 (58%), Positives = 98/132 (74%), Gaps = 6/132 (5%)
 Frame = +1

Query  145  DGLLVNGNFEAPVKKTDLNGTIVTRHDAVPGWTVTGFVEYIQAGQKQGDMQLVVPEGFAA  324
            DGLL NGNFE   K + L GT VT   A+P W ++G+VEYI++GQ QGDM L VPEG  A
Sbjct  25   DGLLPNGNFEQGPKPSQLKGTKVTEPHAIPHWEISGYVEYIKSGQTQGDMLLPVPEGAFA  84

Query  325  VRLGNEASIKQTL-NVSKGMYYSITFCAARTCAQEERLNITVAP-----DSGVLPIQTLY  486
            VRLG +ASIK  + NV+KG +YS++F  ARTCAQEE+LN++V+P     D G+LP+QT+Y
Sbjct  85   VRLGEDASIKTRITNVTKGTFYSLSFNFARTCAQEEKLNVSVSPNNEPNDWGMLPMQTMY  144

Query  487  SINGWDCYAWAF  522
            S +GWD Y+W F
Sbjct  145  SSDGWDSYSWGF  156



>ref|XP_010088264.1| hypothetical protein L484_005140 [Morus notabilis]
 gb|EXB33248.1| hypothetical protein L484_005140 [Morus notabilis]
Length=378

 Score =   157 bits (396),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 74/132 (56%), Positives = 98/132 (74%), Gaps = 5/132 (4%)
 Frame = +1

Query  145  DGLLVNGNFEAPVKKTDLNGTIVTRHDAVPGWTVTGFVEYIQAGQKQGDMQLVVPEGFAA  324
            +GLL NGNFE   K +++ GT+V    A+P W ++G VEYI++G  QGDM LVVPEG  A
Sbjct  26   NGLLPNGNFEYGPKPSEMKGTLVLNRKAIPNWEISGEVEYIKSGHTQGDMLLVVPEGAFA  85

Query  325  VRLGNEASIKQTLNVSKGMYYSITFCAARTCAQEERLNITVAP-----DSGVLPIQTLYS  489
            VRLGNEASIKQ + + K  +YS+TF AARTCAQEE+LN++V+      D G+LP+QT+YS
Sbjct  86   VRLGNEASIKQKVRMIKDGFYSLTFSAARTCAQEEKLNVSVSRSLEPNDWGILPMQTMYS  145

Query  490  INGWDCYAWAFQ  525
             NGWD Y++ F+
Sbjct  146  SNGWDSYSYGFK  157



>ref|XP_010092662.1| hypothetical protein L484_019736 [Morus notabilis]
 gb|EXB51959.1| hypothetical protein L484_019736 [Morus notabilis]
Length=209

 Score =   152 bits (384),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 72/132 (55%), Positives = 95/132 (72%), Gaps = 5/132 (4%)
 Frame = +1

Query  145  DGLLVNGNFEAPVKKTDLNGTIVTRHDAVPGWTVTGFVEYIQAGQKQGDMQLVVPEGFAA  324
            +G L NGNFE   K +++ GT+V  H A+P W ++G V+YI++G  QGDM LVVPEG  A
Sbjct  26   NGHLPNGNFEYGPKPSEMKGTLVLNHKAIPNWEISGVVDYIKSGHTQGDMLLVVPEGAFA  85

Query  325  VRLGNEASIKQTLNVSKGMYYSITFCAARTCAQEERLNITVAPDS-----GVLPIQTLYS  489
             RLGNEASIKQ + V    +YS+TF AARTCAQEE+LN++V+P S     G+LP+QT+YS
Sbjct  86   GRLGNEASIKQKVKVITEGFYSLTFSAARTCAQEEKLNMSVSPSSEPNDWGILPMQTMYS  145

Query  490  INGWDCYAWAFQ  525
              GWD Y+  F+
Sbjct  146  RTGWDSYSCGFK  157



>gb|EMT04284.1| hypothetical protein F775_14656 [Aegilops tauschii]
Length=353

 Score =   156 bits (394),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 76/126 (60%), Positives = 93/126 (74%), Gaps = 0/126 (0%)
 Frame = +1

Query  142  TDGLLVNGNFEAPVKKTDLNGTIVTRHDAVPGWTVTGFVEYIQAGQKQGDMQLVVPEGFA  321
            TDGLL NGNFE    ++ ++GT VT   A+P W   G VEYI +GQKQGDM L VPEG  
Sbjct  25   TDGLLPNGNFEEAPDRSQMDGTRVTGRYAIPRWESCGCVEYICSGQKQGDMVLPVPEGAH  84

Query  322  AVRLGNEASIKQTLNVSKGMYYSITFCAARTCAQEERLNITVAPDSGVLPIQTLYSINGW  501
            AVRLGNEAS++Q L+V+ G +Y+ITF AARTCAQ E+LN+TV   SG LPIQT+Y+ +GW
Sbjct  85   AVRLGNEASVQQQLSVTPGTHYAITFSAARTCAQAEKLNVTVGAQSGELPIQTVYTSSGW  144

Query  502  DCYAWA  519
            D Y  A
Sbjct  145  DSYPSA  150



>ref|XP_003581384.1| PREDICTED: uncharacterized protein LOC100823957 [Brachypodium 
distachyon]
Length=386

 Score =   157 bits (396),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 75/131 (57%), Positives = 97/131 (74%), Gaps = 4/131 (3%)
 Frame = +1

Query  145  DGLLVNGNFEAPVKKTDLNGTIVTRHDAVPGWTVTGFVEYIQAGQKQGDMQLVVPEGFAA  324
            DG L+NGNFE    ++ ++G  V   DA+P W  TGFVEY++ G KQGDM L VPEG  A
Sbjct  30   DGPLLNGNFEDTPDRSQMDGLKVLGPDAIPYWKTTGFVEYVERGAKQGDMALTVPEGAHA  89

Query  325  VRLGNEASIKQTLNVSKGMYYSITFCAARTCAQ-EERLNITVAPD---SGVLPIQTLYSI  492
            VRLG ++SI+Q L+V+ G +Y+ITF AARTC Q +ERLN+++ PD   +G LPIQT+YS 
Sbjct  90   VRLGIQSSIEQQLSVTPGRHYAITFSAARTCTQADERLNVSILPDGVAAGELPIQTIYSH  149

Query  493  NGWDCYAWAFQ  525
            NGWD YAWAF+
Sbjct  150  NGWDSYAWAFK  160



>emb|CDO98108.1| unnamed protein product [Coffea canephora]
Length=368

 Score =   156 bits (395),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 72/131 (55%), Positives = 100/131 (76%), Gaps = 5/131 (4%)
 Frame = +1

Query  145  DGLLVNGNFEAPVKKTDLNGTIVTRHDAVPGWTVTGFVEYIQAGQKQGDMQLVVPEGFAA  324
            DGL+ NG+FE   K   ++GT V    +VP W ++GFVEYI++GQKQGDM L VP+G  A
Sbjct  23   DGLVPNGDFEEGPKPWQMHGTEVVDPHSVPHWELSGFVEYIKSGQKQGDMILPVPKGHFA  82

Query  325  VRLGNEASIKQTLNVSKGMYYSITFCAARTCAQEERLNITVAPDS-----GVLPIQTLYS  489
            +RLGNEASIK  + V+KG++YS++F AARTCAQ+E+LN++V+P+S     G+LP+QT+YS
Sbjct  83   LRLGNEASIKTKVQVAKGLFYSLSFGAARTCAQQEQLNLSVSPNSEPKDWGMLPMQTMYS  142

Query  490  INGWDCYAWAF  522
              GWD ++W F
Sbjct  143  TEGWDSFSWGF  153



>ref|XP_009778816.1| PREDICTED: uncharacterized protein LOC104228110 [Nicotiana sylvestris]
Length=372

 Score =   156 bits (394),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 75/132 (57%), Positives = 98/132 (74%), Gaps = 6/132 (5%)
 Frame = +1

Query  145  DGLLVNGNFEAPVKKTDLNGTIVTRHDAVPGWTVTGFVEYIQAGQKQGDMQLVVPEGFAA  324
            DGLL NGNFE   K + L GT VT   A+P W ++G+VEYI++GQ QGDM L VPEG  A
Sbjct  25   DGLLPNGNFEQGPKPSQLKGTRVTNPHAIPHWEISGYVEYIKSGQTQGDMLLPVPEGAFA  84

Query  325  VRLGNEASIKQTL-NVSKGMYYSITFCAARTCAQEERLNITVAPDS-----GVLPIQTLY  486
            VRLG +ASIK  + N +KG +YS++F  ARTCAQEE+LN++V+P+S     G+LP+QT+Y
Sbjct  85   VRLGEDASIKTRITNFTKGTFYSLSFNFARTCAQEEKLNVSVSPNSEPNDWGMLPMQTMY  144

Query  487  SINGWDCYAWAF  522
            S +GWD Y+W F
Sbjct  145  SSDGWDSYSWGF  156



>ref|XP_009758146.1| PREDICTED: uncharacterized protein LOC104210873 [Nicotiana sylvestris]
Length=372

 Score =   155 bits (393),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 71/131 (54%), Positives = 97/131 (74%), Gaps = 5/131 (4%)
 Frame = +1

Query  145  DGLLVNGNFEAPVKKTDLNGTIVTRHDAVPGWTVTGFVEYIQAGQKQGDMQLVVPEGFAA  324
            DG+L NGNFE   K + + GT V    A+P W ++G+VEYI++GQ QGDM L VP G  A
Sbjct  23   DGILPNGNFELGPKPSQMKGTKVVNRHAIPNWEISGYVEYIKSGQTQGDMLLPVPVGDYA  82

Query  325  VRLGNEASIKQTLNVSKGMYYSITFCAARTCAQEERLNITVAPDS-----GVLPIQTLYS  489
            VRLG +ASIK  + V+KG++YS++F  ARTCAQEE+LN++V+P+S     G+LP+QT+YS
Sbjct  83   VRLGEDASIKTKVKVTKGVFYSLSFVFARTCAQEEKLNVSVSPNSEPNDWGMLPMQTMYS  142

Query  490  INGWDCYAWAF  522
             +GWD Y+W F
Sbjct  143  SDGWDSYSWGF  153



>gb|EMT19274.1| hypothetical protein F775_14136 [Aegilops tauschii]
Length=393

 Score =   155 bits (393),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 72/130 (55%), Positives = 94/130 (72%), Gaps = 3/130 (2%)
 Frame = +1

Query  145  DGLLVNGNFEAPVKKTDLNGTIVTRHDAVPGWTVTGFVEYIQAGQKQGDMQLVVPEGFAA  324
            DG L+NGNFE    ++ +NG+ VT   A+P W  TGFVEYI+ G KQ  M LVVPEG  A
Sbjct  23   DGPLLNGNFEQAPNRSQMNGSRVTGKYAIPHWKATGFVEYIECGAKQDHMVLVVPEGRHA  82

Query  325  VRLGNEASIKQTLNVSKGMYYSITFCAARTCAQEERLNITVAP---DSGVLPIQTLYSIN  495
            VRLG E+SI+  L+V++G YYS+TF AARTCAQ E+L +++ P     G LP+QT+Y+ +
Sbjct  83   VRLGTESSIEHQLSVTRGKYYSVTFSAARTCAQSEKLRVSIVPGDVSGGELPVQTVYTSS  142

Query  496  GWDCYAWAFQ  525
            GWD YAWAF+
Sbjct  143  GWDSYAWAFK  152



>ref|XP_009590498.1| PREDICTED: uncharacterized protein LOC104087663 [Nicotiana tomentosiformis]
Length=372

 Score =   155 bits (392),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 71/131 (54%), Positives = 97/131 (74%), Gaps = 5/131 (4%)
 Frame = +1

Query  145  DGLLVNGNFEAPVKKTDLNGTIVTRHDAVPGWTVTGFVEYIQAGQKQGDMQLVVPEGFAA  324
            DG+L NGNFE   K + + GT V    A+P W ++G+VEYI++GQ QGDM L VP G  A
Sbjct  23   DGILPNGNFELGPKASQMKGTKVVDRHAIPDWEISGYVEYIKSGQTQGDMLLPVPVGDYA  82

Query  325  VRLGNEASIKQTLNVSKGMYYSITFCAARTCAQEERLNITVAPDS-----GVLPIQTLYS  489
            VRLG +ASIK  + V+KG++YS++F  ARTCAQEE+LN++V+P+S     G+LP+QT+YS
Sbjct  83   VRLGEDASIKTKVKVTKGVFYSLSFVFARTCAQEEKLNVSVSPNSEPNDWGMLPMQTMYS  142

Query  490  INGWDCYAWAF  522
             +GWD Y+W F
Sbjct  143  SDGWDSYSWGF  153



>ref|XP_004976081.1| PREDICTED: uncharacterized protein LOC101764801 [Setaria italica]
Length=392

 Score =   155 bits (392),  Expect = 7e-42, Method: Compositional matrix adjust.
 Identities = 72/134 (54%), Positives = 102/134 (76%), Gaps = 7/134 (5%)
 Frame = +1

Query  145  DGLLVNGNFEAPVKKTDLNGTIVTRHDAVPGWTVTGFVEYIQAGQKQGDMQLVVPEGFAA  324
            DG L+NGNFE P  ++ ++G+ VT  +A+P W  TG VEYI +GQ+QGDM L VPEG  A
Sbjct  26   DGPLLNGNFEYPPNQSQMSGSKVTGENAIPYWKTTGTVEYIGSGQQQGDMILTVPEGAHA  85

Query  325  VRLGNEASIKQTLNVSKGMYYSITFCAARTCAQEERLNITVAPDSGV-------LPIQTL  483
            +RLG++ASI+Q ++V++G+YYS+TF A+RTCAQ+E+L++T+ P +G        LPIQT+
Sbjct  86   LRLGSDASIQQQISVTRGLYYSVTFRASRTCAQDEKLSLTIVPVTGYPVQSGEPLPIQTV  145

Query  484  YSINGWDCYAWAFQ  525
            YS  GWD Y+WAF+
Sbjct  146  YSSCGWDAYSWAFK  159



>gb|EMS51274.1| hypothetical protein TRIUR3_06873 [Triticum urartu]
Length=377

 Score =   154 bits (390),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 71/130 (55%), Positives = 95/130 (73%), Gaps = 3/130 (2%)
 Frame = +1

Query  145  DGLLVNGNFEAPVKKTDLNGTIVTRHDAVPGWTVTGFVEYIQAGQKQGDMQLVVPEGFAA  324
            DG L+NGNFE    ++ +NG+ VT   A+P W  TGFVEYI+ G KQ  M LVVPEG  A
Sbjct  23   DGPLLNGNFEQAPNRSQMNGSRVTGKYAIPHWKATGFVEYIECGAKQDHMVLVVPEGRHA  82

Query  325  VRLGNEASIKQTLNVSKGMYYSITFCAARTCAQEERLNITVAP---DSGVLPIQTLYSIN  495
            VRLG ++SI+  L+V++G YYS+TF AARTCAQ E+L++++ P     G LP+QT+Y+ +
Sbjct  83   VRLGTDSSIEHQLSVTRGKYYSVTFSAARTCAQSEKLSVSIVPGDASGGELPVQTVYTSS  142

Query  496  GWDCYAWAFQ  525
            GWD YAWAF+
Sbjct  143  GWDSYAWAFK  152



>ref|XP_004235717.1| PREDICTED: uncharacterized protein LOC101252763 [Solanum lycopersicum]
Length=373

 Score =   154 bits (388),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 74/132 (56%), Positives = 97/132 (73%), Gaps = 6/132 (5%)
 Frame = +1

Query  145  DGLLVNGNFEAPVKKTDLNGTIVTRHDAVPGWTVTGFVEYIQAGQKQGDMQLVVPEGFAA  324
            DGLL NGNFE   K + + GT VT   A+P W ++G+VEYI++GQ QGDM L VPEG  A
Sbjct  26   DGLLPNGNFEQGPKASQMKGTKVTDPHAIPHWEISGYVEYIRSGQTQGDMLLPVPEGAFA  85

Query  325  VRLGNEASIK-QTLNVSKGMYYSITFCAARTCAQEERLNITVAP-----DSGVLPIQTLY  486
            VRLG +ASIK +  NV+ G +YS++F  ARTCAQEE+LN++V+P     D G+LP+QT+Y
Sbjct  86   VRLGEDASIKTRVTNVTSGSFYSLSFNFARTCAQEEKLNVSVSPNTEPNDWGMLPMQTMY  145

Query  487  SINGWDCYAWAF  522
            S +GWD Y+W F
Sbjct  146  SSDGWDSYSWGF  157



>gb|ABK24630.1| unknown [Picea sitchensis]
 gb|ABR18446.1| unknown [Picea sitchensis]
Length=408

 Score =   154 bits (389),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 78/129 (60%), Positives = 90/129 (70%), Gaps = 6/129 (5%)
 Frame = +1

Query  145  DGLLVNGNFEAP--VKKTDLNGTIVTRHDAVPGWTVTGFVEYIQAGQKQGDMQLVVPEGF  318
            DGLLVNGNFE      +T   G I    D++PGW + G VEYI  GQKQG M LVVPEG 
Sbjct  39   DGLLVNGNFEKEGIENRTSRAGDI----DSLPGWNIDGMVEYINEGQKQGSMYLVVPEGK  94

Query  319  AAVRLGNEASIKQTLNVSKGMYYSITFCAARTCAQEERLNITVAPDSGVLPIQTLYSING  498
             AVRLGNEA I Q +N+ KG  YS+TF AARTCAQ E LN++V P +  + +QTLYSI G
Sbjct  95   HAVRLGNEAQISQQINIQKGSTYSLTFSAARTCAQLESLNVSVPPSTRNVDLQTLYSIYG  154

Query  499  WDCYAWAFQ  525
            WD YAWAFQ
Sbjct  155  WDTYAWAFQ  163



>ref|XP_006826721.1| hypothetical protein AMTR_s00264p00012960 [Amborella trichopoda]
 gb|ERM93958.1| hypothetical protein AMTR_s00264p00012960 [Amborella trichopoda]
Length=372

 Score =   153 bits (386),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 68/131 (52%), Positives = 98/131 (75%), Gaps = 4/131 (3%)
 Frame = +1

Query  142  TDGLLVNGNFEAPVKKTDLNGTIVTRHDAVPGWTVTGFVEYIQAGQKQGDMQLVVPEGFA  321
            +DGLL NGNFE     + L G++V   +++P W + G VEY+++GQK GD+ LV+PEGFA
Sbjct  23   SDGLLPNGNFEKAPSHSSLKGSVVIGKNSLPDWEIGGAVEYVKSGQKSGDLMLVIPEGFA  82

Query  322  AVRLGNEASIKQTLNVSKGMYYSITFCAARTCAQEERLNITVAP----DSGVLPIQTLYS  489
            AVRLG++A I+Q ++V+KG  Y++T  AARTCA +E+LN+TV+     DSG++ +QT+Y+
Sbjct  83   AVRLGSDAFIRQRVSVNKGELYALTLSAARTCASDEKLNVTVSTDSIRDSGLISVQTIYN  142

Query  490  INGWDCYAWAF  522
              GWD YAWAF
Sbjct  143  AKGWDSYAWAF  153



>gb|KJB70569.1| hypothetical protein B456_011G080100 [Gossypium raimondii]
Length=328

 Score =   152 bits (383),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 68/105 (65%), Positives = 83/105 (79%), Gaps = 5/105 (5%)
 Frame = +1

Query  226  AVPGWTVTGFVEYIQAGQKQGDMQLVVPEGFAAVRLGNEASIKQTLNVSKGMYYSITFCA  405
            A+P W ++G+VEYI++G KQGDM L+VPEG  AVRLGNEA IKQ + V KG +YS+TF  
Sbjct  5    AIPNWEISGYVEYIKSGHKQGDMLLIVPEGAFAVRLGNEALIKQKIEVVKGDFYSLTFST  64

Query  406  ARTCAQEERLNITVAP-----DSGVLPIQTLYSINGWDCYAWAFQ  525
            ARTCAQEERLN++V+P     D G+ PIQT+YS NGWD YAWAFQ
Sbjct  65   ARTCAQEERLNVSVSPNNEKNDFGLFPIQTMYSSNGWDSYAWAFQ  109



>ref|XP_009764126.1| PREDICTED: uncharacterized protein LOC104215887 [Nicotiana sylvestris]
Length=379

 Score =   152 bits (384),  Expect = 9e-41, Method: Compositional matrix adjust.
 Identities = 72/132 (55%), Positives = 97/132 (73%), Gaps = 6/132 (5%)
 Frame = +1

Query  145  DGLLVNGNFEAPVKKTDLNGTIVTRHDAVPGWTVTGFVEYIQAGQKQGDMQLVVPEGFAA  324
            DGLL NGNFE   K + +  TIV    A+P W ++G+VEYI++GQ QGDM L VP+G  A
Sbjct  29   DGLLPNGNFEQGPKPSQMKHTIVINPHAIPHWELSGYVEYIKSGQMQGDMLLPVPQGDFA  88

Query  325  VRLGNEASIK-QTLNVSKGMYYSITFCAARTCAQEERLNITVAP-----DSGVLPIQTLY  486
            VRLG +AS+K + +NV+KG +Y+++F  ARTCAQEERLN++V P     D G+LP+QT+Y
Sbjct  89   VRLGEDASLKTKVVNVTKGTFYALSFVFARTCAQEERLNVSVTPSKEPKDWGMLPLQTMY  148

Query  487  SINGWDCYAWAF  522
            S +GWD Y+W F
Sbjct  149  SSDGWDTYSWGF  160



>gb|ACN40837.1| unknown [Picea sitchensis]
Length=408

 Score =   152 bits (384),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 77/129 (60%), Positives = 90/129 (70%), Gaps = 6/129 (5%)
 Frame = +1

Query  145  DGLLVNGNFEAP--VKKTDLNGTIVTRHDAVPGWTVTGFVEYIQAGQKQGDMQLVVPEGF  318
            DGLLVNGNFE      +T   G I    D++PGW + G VEYI  GQKQG + LVVPEG 
Sbjct  39   DGLLVNGNFEKEGIENRTSRAGDI----DSLPGWNIDGMVEYINEGQKQGSIYLVVPEGK  94

Query  319  AAVRLGNEASIKQTLNVSKGMYYSITFCAARTCAQEERLNITVAPDSGVLPIQTLYSING  498
             AVRLGNEA I Q +N+ KG  YS+TF AARTCAQ E LN++V P +  + +QTLYSI G
Sbjct  95   HAVRLGNEAQISQQINIQKGSTYSLTFSAARTCAQLESLNVSVPPSTRNVDLQTLYSIYG  154

Query  499  WDCYAWAFQ  525
            WD YAWAFQ
Sbjct  155  WDTYAWAFQ  163



>ref|NP_001141282.1| hypothetical protein precursor [Zea mays]
 gb|ACF85954.1| unknown [Zea mays]
 tpg|DAA37150.1| TPA: hypothetical protein ZEAMMB73_862661 [Zea mays]
Length=375

 Score =   151 bits (382),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 73/129 (57%), Positives = 99/129 (77%), Gaps = 2/129 (2%)
 Frame = +1

Query  145  DGLLVNGNFEAPVKKTDLNGTIVTRHDAVPGWTVTGFVEYIQAGQKQGD-MQLVVPEGFA  321
            DGLL NGNFE    K  +NGT V    ++P W ++GFVEYI +GQ+Q + M + VPEG  
Sbjct  25   DGLLPNGNFEQGPDKYQMNGTWVIGRKSIPCWEISGFVEYIVSGQQQDNGMVVAVPEGAR  84

Query  322  AVRLGNEASIKQTL-NVSKGMYYSITFCAARTCAQEERLNITVAPDSGVLPIQTLYSING  498
            AVRLGN+ASI+Q L  +++G  YS+TF A+RTCAQ E+LN++VAP+SGVLPIQT+Y+ +G
Sbjct  85   AVRLGNDASIRQRLTGMTRGTSYSVTFSASRTCAQAEQLNVSVAPESGVLPIQTVYTSSG  144

Query  499  WDCYAWAFQ  525
            WD Y++AF+
Sbjct  145  WDSYSYAFR  153



>ref|XP_006341715.1| PREDICTED: uncharacterized protein LOC102601890 [Solanum tuberosum]
Length=368

 Score =   150 bits (380),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 73/132 (55%), Positives = 95/132 (72%), Gaps = 6/132 (5%)
 Frame = +1

Query  145  DGLLVNGNFEAPVKKTDLNGTIVTRHDAVPGWTVTGFVEYIQAGQKQGDMQLVVPEGFAA  324
            DGLL NGNFE   K + + GT VT   A+P W ++G+VEYI+AGQ QGDM L VPEG  A
Sbjct  21   DGLLPNGNFEQGPKASQMKGTKVTDPHAIPHWEISGYVEYIKAGQTQGDMLLPVPEGAFA  80

Query  325  VRLGNEASIK-QTLNVSKGMYYSITFCAARTCAQEERLNITVAP-----DSGVLPIQTLY  486
            VRLG +A IK +  NV+ G +YS++F  ARTCAQEE+LN++V+P     D  +LP+QT+Y
Sbjct  81   VRLGEDAYIKTRVTNVTNGTFYSLSFNFARTCAQEEKLNVSVSPNNEPNDWAMLPMQTMY  140

Query  487  SINGWDCYAWAF  522
            S +GWD Y+W F
Sbjct  141  SSDGWDSYSWGF  152



>ref|XP_008363312.1| PREDICTED: uncharacterized protein LOC103427013 [Malus domestica]
Length=367

 Score =   150 bits (378),  Expect = 5e-40, Method: Compositional matrix adjust.
 Identities = 70/127 (55%), Positives = 87/127 (69%), Gaps = 0/127 (0%)
 Frame = +1

Query  145  DGLLVNGNFEAPVKKTDLNGTIVTRHDAVPGWTVTGFVEYIQAGQKQGDMQLVVPEGFAA  324
            DGLL NGNFE P K TDL  T++   +++P W + G VEYI AG + G M   V  G  A
Sbjct  30   DGLLANGNFEEPPKPTDLKKTVIIGKNSLPKWEIDGLVEYISAGPQPGGMYFDVAHGVHA  89

Query  325  VRLGNEASIKQTLNVSKGMYYSITFCAARTCAQEERLNITVAPDSGVLPIQTLYSINGWD  504
            VRLGN+ASI QT+ V  G  Y++TF A+RTCAQEE L ++V P +G LP+QTLYS NG D
Sbjct  90   VRLGNDASISQTIKVKLGSLYALTFGASRTCAQEEVLRVSVPPQAGDLPLQTLYSSNGGD  149

Query  505  CYAWAFQ  525
             YAW F+
Sbjct  150  TYAWGFR  156



>ref|XP_004307221.1| PREDICTED: uncharacterized protein LOC101292742 [Fragaria vesca 
subsp. vesca]
Length=368

 Score =   149 bits (377),  Expect = 8e-40, Method: Compositional matrix adjust.
 Identities = 69/127 (54%), Positives = 86/127 (68%), Gaps = 0/127 (0%)
 Frame = +1

Query  145  DGLLVNGNFEAPVKKTDLNGTIVTRHDAVPGWTVTGFVEYIQAGQKQGDMQLVVPEGFAA  324
            +GLL NGNFE P K + L  T++   +A+P W + GFVEYI  G + G M   V  G  A
Sbjct  29   EGLLANGNFEEPPKPSSLKKTVLIGKNALPKWEINGFVEYISGGPQPGGMYFAVAHGVHA  88

Query  325  VRLGNEASIKQTLNVSKGMYYSITFCAARTCAQEERLNITVAPDSGVLPIQTLYSINGWD  504
            VRLGNEASI QT+ V  G  Y++TF A+RTCAQEE L ++V P +G LP+QTLYS NG D
Sbjct  89   VRLGNEASISQTIKVKPGSLYALTFGASRTCAQEEVLRVSVPPQAGDLPLQTLYSSNGGD  148

Query  505  CYAWAFQ  525
             YAW F+
Sbjct  149  TYAWGFK  155



>ref|XP_009598172.1| PREDICTED: uncharacterized protein LOC104094024 [Nicotiana tomentosiformis]
Length=379

 Score =   149 bits (376),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 71/132 (54%), Positives = 96/132 (73%), Gaps = 6/132 (5%)
 Frame = +1

Query  145  DGLLVNGNFEAPVKKTDLNGTIVTRHDAVPGWTVTGFVEYIQAGQKQGDMQLVVPEGFAA  324
            DGLL NGNFE   K + +  T V    A+P W ++G+VEYI++GQ QGDM L VP+G  A
Sbjct  29   DGLLPNGNFEQGPKPSQMKHTRVMDPHAIPHWELSGYVEYIKSGQMQGDMLLPVPQGDFA  88

Query  325  VRLGNEASIK-QTLNVSKGMYYSITFCAARTCAQEERLNITVAP-----DSGVLPIQTLY  486
            VRLG +AS+K + +NV+KG +Y+++F  ARTCAQEERLN++V P     D G+LP+QT+Y
Sbjct  89   VRLGEDASLKTKVVNVTKGTFYALSFVFARTCAQEERLNVSVTPSKEPKDWGMLPLQTMY  148

Query  487  SINGWDCYAWAF  522
            S +GWD Y+W F
Sbjct  149  SSDGWDTYSWGF  160



>ref|XP_003588711.1| hypothetical protein MTR_1g011800 [Medicago truncatula]
Length=326

 Score =   148 bits (373),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 71/104 (68%), Positives = 84/104 (81%), Gaps = 1/104 (1%)
 Frame = +1

Query  148  GLLVNGNFEAPVKKTDLNGTIVTR-HDAVPGWTVTGFVEYIQAGQKQGDMQLVVPEGFAA  324
            GL+ NGNFE   K T+L GT+VT   +++P W ++G VEYI++GQKQGDM LVVPEG  A
Sbjct  7    GLVANGNFELGPKPTELKGTVVTGGKNSIPEWEISGLVEYIKSGQKQGDMLLVVPEGAYA  66

Query  325  VRLGNEASIKQTLNVSKGMYYSITFCAARTCAQEERLNITVAPD  456
            VRLGNEASIKQ + V KGMYYSITF  ARTCAQEER+NI+VAPD
Sbjct  67   VRLGNEASIKQRIKVIKGMYYSITFMVARTCAQEERINISVAPD  110



>ref|XP_008364711.1| PREDICTED: uncharacterized protein LOC103428382 [Malus domestica]
Length=367

 Score =   149 bits (375),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 72/127 (57%), Positives = 84/127 (66%), Gaps = 0/127 (0%)
 Frame = +1

Query  145  DGLLVNGNFEAPVKKTDLNGTIVTRHDAVPGWTVTGFVEYIQAGQKQGDMQLVVPEGFAA  324
            DGLL NGNFE P K T L  T++    A+P W + G VEYI AG + G M   V  G  A
Sbjct  30   DGLLANGNFEEPPKPTSLKKTVLVGKYALPKWEINGLVEYISAGPQPGGMYFHVAHGVHA  89

Query  325  VRLGNEASIKQTLNVSKGMYYSITFCAARTCAQEERLNITVAPDSGVLPIQTLYSINGWD  504
            VRLGNEASI QTL V  G  Y++TF A+RTCAQEE L + V P +G LP+QTLYS NG D
Sbjct  90   VRLGNEASISQTLKVKPGSLYALTFGASRTCAQEEVLRVLVPPQAGDLPMQTLYSSNGGD  149

Query  505  CYAWAFQ  525
             YAW F+
Sbjct  150  TYAWGFR  156



>ref|XP_008375195.1| PREDICTED: uncharacterized protein LOC103438421 [Malus domestica]
Length=367

 Score =   149 bits (375),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 72/127 (57%), Positives = 84/127 (66%), Gaps = 0/127 (0%)
 Frame = +1

Query  145  DGLLVNGNFEAPVKKTDLNGTIVTRHDAVPGWTVTGFVEYIQAGQKQGDMQLVVPEGFAA  324
            DGLL NGNFE P K T L  T++    A+P W + G VEYI AG + G M   V  G  A
Sbjct  30   DGLLANGNFEEPPKPTSLKKTVLVGKYALPKWEINGLVEYISAGPQPGGMYFHVAHGVHA  89

Query  325  VRLGNEASIKQTLNVSKGMYYSITFCAARTCAQEERLNITVAPDSGVLPIQTLYSINGWD  504
            VRLGNEASI QTL V  G  Y++TF A+RTCAQEE L + V P +G LP+QTLYS NG D
Sbjct  90   VRLGNEASISQTLKVKPGSLYALTFGASRTCAQEEVLRVLVPPQAGDLPMQTLYSSNGGD  149

Query  505  CYAWAFQ  525
             YAW F+
Sbjct  150  TYAWGFR  156



>ref|XP_008669230.1| PREDICTED: uncharacterized protein LOC103646278 [Zea mays]
 tpg|DAA37153.1| TPA: hypothetical protein ZEAMMB73_847781 [Zea mays]
Length=397

 Score =   149 bits (376),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 69/133 (52%), Positives = 98/133 (74%), Gaps = 6/133 (5%)
 Frame = +1

Query  145  DGLLVNGNFEAPVKKTDLNGTIVTRHDAVPGWTVTGFVEYIQAGQKQGDMQLVVPEGFAA  324
            DG L+NGNFE P  ++ ++G++VT   AV  W  +G +E+I +GQKQGDM L VP+G  A
Sbjct  33   DGPLLNGNFEDPPNQSQMSGSVVTGEHAVSYWKTSGHIEFICSGQKQGDMVLTVPDGSHA  92

Query  325  VRLGNEASIKQTLNVSKGMYYSITFCAARTCAQEERLNITVAPDSGV------LPIQTLY  486
            +RLG+ ASI+Q ++++KG+YYS+TF A+RTC+Q E LN+T AP SG       LP QT+Y
Sbjct  93   LRLGSGASIQQQISLTKGLYYSLTFSASRTCSQNEMLNVTAAPVSGSPAQTGELPTQTVY  152

Query  487  SINGWDCYAWAFQ  525
            + +GWD Y+WAF+
Sbjct  153  TSSGWDSYSWAFR  165



>ref|XP_007218160.1| hypothetical protein PRUPE_ppa007461mg [Prunus persica]
 gb|EMJ19359.1| hypothetical protein PRUPE_ppa007461mg [Prunus persica]
Length=367

 Score =   148 bits (374),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 71/127 (56%), Positives = 86/127 (68%), Gaps = 0/127 (0%)
 Frame = +1

Query  145  DGLLVNGNFEAPVKKTDLNGTIVTRHDAVPGWTVTGFVEYIQAGQKQGDMQLVVPEGFAA  324
            DGLL NGNFE P K T+L  T++    A+P W + GFVEYI  G + G M   V  G  A
Sbjct  28   DGLLNNGNFEEPPKPTNLKKTVLIGKYALPKWEINGFVEYISGGPQPGGMYFSVAHGVHA  87

Query  325  VRLGNEASIKQTLNVSKGMYYSITFCAARTCAQEERLNITVAPDSGVLPIQTLYSINGWD  504
            VRLGNEASI QT+ V  G  Y++TF A+RTCAQEE L ++V P +G LP+QTLYS NG D
Sbjct  88   VRLGNEASISQTIKVKPGSLYALTFGASRTCAQEEVLRVSVPPQAGDLPLQTLYSSNGGD  147

Query  505  CYAWAFQ  525
             YAW F+
Sbjct  148  TYAWGFR  154



>ref|XP_006346648.1| PREDICTED: uncharacterized protein LOC102598480 [Solanum tuberosum]
Length=380

 Score =   147 bits (372),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 70/132 (53%), Positives = 96/132 (73%), Gaps = 6/132 (5%)
 Frame = +1

Query  145  DGLLVNGNFEAPVKKTDLNGTIVTRHDAVPGWTVTGFVEYIQAGQKQGDMQLVVPEGFAA  324
            DGLL NGNFE   K + +  T V     +P W ++G+VEYI++GQ QGDM L VP+G  A
Sbjct  29   DGLLPNGNFEQGPKPSQMKKTRVIDPHGIPHWELSGYVEYIKSGQMQGDMLLPVPQGDYA  88

Query  325  VRLGNEASIK-QTLNVSKGMYYSITFCAARTCAQEERLNITVAPDS-----GVLPIQTLY  486
            VRLG +AS+K + +NV+K  +YS++F  ARTCAQEERLN++V+P+S     G+LP+QT+Y
Sbjct  89   VRLGEDASLKTKVINVTKETFYSLSFVFARTCAQEERLNVSVSPNSEPKDWGMLPLQTMY  148

Query  487  SINGWDCYAWAF  522
            S +GWD Y+W F
Sbjct  149  SSDGWDTYSWGF  160



>ref|XP_004252488.1| PREDICTED: uncharacterized protein LOC101250580 [Solanum lycopersicum]
Length=380

 Score =   147 bits (372),  Expect = 5e-39, Method: Compositional matrix adjust.
 Identities = 71/132 (54%), Positives = 96/132 (73%), Gaps = 6/132 (5%)
 Frame = +1

Query  145  DGLLVNGNFEAPVKKTDLNGTIVTRHDAVPGWTVTGFVEYIQAGQKQGDMQLVVPEGFAA  324
            DGLL NGNFE   K + +  T V    A+P W ++G+VEYI++GQ QGDM L VP+G  A
Sbjct  29   DGLLPNGNFEQGPKSSQMKNTRVIDPHAIPHWELSGYVEYIKSGQMQGDMLLPVPQGDYA  88

Query  325  VRLGNEASIK-QTLNVSKGMYYSITFCAARTCAQEERLNITVAPDS-----GVLPIQTLY  486
            VRLG  AS+K +  +V+KG +YS++F  ARTCAQEERLN++V+P+S     G+LP+QT+Y
Sbjct  89   VRLGEGASLKTKVTSVTKGTFYSLSFVFARTCAQEERLNVSVSPNSEPKDWGMLPLQTMY  148

Query  487  SINGWDCYAWAF  522
            S +GWD Y+W F
Sbjct  149  SSDGWDTYSWGF  160



Lambda      K        H        a         alpha
   0.317    0.131    0.394    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 561572122600