BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFF036J04

Length=521
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

emb|CDP07923.1|  unnamed protein product                                219   1e-65   Coffea canephora [robusta coffee]
ref|XP_010654914.1|  PREDICTED: UBX domain-containing protein 2 i...    208   1e-61   Vitis vinifera
ref|XP_003631347.1|  PREDICTED: UBX domain-containing protein 2 i...    208   2e-61   Vitis vinifera
ref|XP_004236895.1|  PREDICTED: UBX domain-containing protein 2         206   1e-60   Solanum lycopersicum
ref|XP_006355016.1|  PREDICTED: UBX domain-containing protein 2-like    203   1e-59   Solanum tuberosum [potatoes]
ref|XP_010654910.1|  PREDICTED: UBX domain-containing protein 2 i...    202   3e-59   Vitis vinifera
ref|XP_011070500.1|  PREDICTED: UBX domain-containing protein 2         201   8e-59   Sesamum indicum [beniseed]
ref|XP_009587838.1|  PREDICTED: UBX domain-containing protein 2         199   3e-58   Nicotiana tomentosiformis
gb|EYU30238.1|  hypothetical protein MIMGU_mgv1a006061mg                198   1e-57   Erythranthe guttata [common monkey flower]
ref|XP_002315828.1|  UBX domain-containing family protein               196   4e-57   
ref|XP_006378421.1|  hypothetical protein POPTR_0010s10910g             196   5e-57   
ref|XP_002311564.2|  hypothetical protein POPTR_0008s14230g             195   2e-56   
ref|XP_009775836.1|  PREDICTED: UBX domain-containing protein 2         195   2e-56   Nicotiana sylvestris
gb|EYU30240.1|  hypothetical protein MIMGU_mgv1a006061mg                193   5e-56   Erythranthe guttata [common monkey flower]
gb|EYU30237.1|  hypothetical protein MIMGU_mgv1a006061mg                194   7e-56   Erythranthe guttata [common monkey flower]
gb|EYU30239.1|  hypothetical protein MIMGU_mgv1a006061mg                194   7e-56   Erythranthe guttata [common monkey flower]
ref|XP_010043889.1|  PREDICTED: UBX domain-containing protein 2 i...    192   2e-55   Eucalyptus grandis [rose gum]
ref|XP_010043888.1|  PREDICTED: UBX domain-containing protein 2 i...    192   2e-55   Eucalyptus grandis [rose gum]
ref|XP_011025166.1|  PREDICTED: UBX domain-containing protein 7-like    192   3e-55   Populus euphratica
ref|XP_008220984.1|  PREDICTED: UBX domain-containing protein 2 i...    189   4e-54   Prunus mume [ume]
ref|XP_008220982.1|  PREDICTED: UBX domain-containing protein 2 i...    188   5e-54   Prunus mume [ume]
ref|XP_010270775.1|  PREDICTED: UBX domain-containing protein 2 i...    187   9e-54   Nelumbo nucifera [Indian lotus]
ref|XP_010270773.1|  PREDICTED: UBX domain-containing protein 2 i...    187   1e-53   Nelumbo nucifera [Indian lotus]
ref|XP_011021683.1|  PREDICTED: UBX domain-containing protein 2-like    187   1e-53   Populus euphratica
ref|XP_010270774.1|  PREDICTED: UBX domain-containing protein 2 i...    187   2e-53   Nelumbo nucifera [Indian lotus]
ref|XP_009351644.1|  PREDICTED: UBX domain-containing protein 2 i...    186   4e-53   Pyrus x bretschneideri [bai li]
ref|XP_009351643.1|  PREDICTED: UBX domain-containing protein 2 i...    186   5e-53   Pyrus x bretschneideri [bai li]
ref|XP_009351642.1|  PREDICTED: UBX domain-containing protein 2 i...    186   5e-53   Pyrus x bretschneideri [bai li]
gb|EPS73806.1|  hypothetical protein M569_00949                         182   2e-51   Genlisea aurea
ref|XP_002521873.1|  UBX domain-containing protein, putative            180   8e-51   
gb|AFK39103.1|  unknown                                                 173   1e-50   Lotus japonicus
gb|KDO53548.1|  hypothetical protein CISIN_1g013325mg                   174   1e-50   Citrus sinensis [apfelsine]
ref|XP_004509607.1|  PREDICTED: UBX domain-containing protein 7-like    179   3e-50   Cicer arietinum [garbanzo]
gb|KDO53547.1|  hypothetical protein CISIN_1g013325mg                   174   1e-49   Citrus sinensis [apfelsine]
ref|XP_010088526.1|  UBX domain-containing protein 2                    177   3e-49   Morus notabilis
ref|XP_006420698.1|  hypothetical protein CICLE_v10005240mg             173   4e-49   
gb|KDP38216.1|  hypothetical protein JCGZ_04859                         176   5e-49   Jatropha curcas
ref|XP_007045358.1|  UBX domain-containing protein isoform 3            175   8e-49   
ref|XP_007045357.1|  UBX domain-containing protein isoform 2            175   8e-49   
ref|XP_007045356.1|  UBX domain-containing protein isoform 1            175   1e-48   
gb|KDO53543.1|  hypothetical protein CISIN_1g013325mg                   174   2e-48   Citrus sinensis [apfelsine]
ref|XP_006470883.1|  PREDICTED: UBX domain-containing protein 2-like    174   2e-48   Citrus sinensis [apfelsine]
gb|KDO53544.1|  hypothetical protein CISIN_1g013325mg                   174   2e-48   Citrus sinensis [apfelsine]
gb|KJB30688.1|  hypothetical protein B456_005G158000                    173   2e-48   Gossypium raimondii
gb|KJB30689.1|  hypothetical protein B456_005G158000                    172   3e-48   Gossypium raimondii
gb|KHG06883.1|  UBX domain-containing 7                                 173   4e-48   Gossypium arboreum [tree cotton]
gb|KJB30687.1|  hypothetical protein B456_005G158000                    173   4e-48   Gossypium raimondii
gb|KJB30690.1|  hypothetical protein B456_005G158000                    172   5e-48   Gossypium raimondii
ref|XP_010680042.1|  PREDICTED: UBX domain-containing protein 2         171   2e-47   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_003547850.1|  PREDICTED: UBX domain-containing protein 7-l...    171   3e-47   Glycine max [soybeans]
ref|XP_008456878.1|  PREDICTED: UBX domain-containing protein 2         166   1e-45   
ref|XP_007156392.1|  hypothetical protein PHAVU_003G282600g             165   5e-45   Phaseolus vulgaris [French bean]
ref|XP_003628976.1|  UBX domain-containing protein                      165   6e-45   Medicago truncatula
ref|XP_003531952.1|  PREDICTED: UBX domain-containing protein 7-l...    164   6e-45   Glycine max [soybeans]
ref|XP_010554359.1|  PREDICTED: UBX domain-containing protein 2-like    160   2e-43   Tarenaya hassleriana [spider flower]
ref|XP_010476513.1|  PREDICTED: UBX domain-containing protein 2-like    159   9e-43   Camelina sativa [gold-of-pleasure]
ref|XP_010527851.1|  PREDICTED: UBX domain-containing protein 2 i...    158   1e-42   Tarenaya hassleriana [spider flower]
ref|XP_010458959.1|  PREDICTED: UBX domain-containing protein 2-like    158   1e-42   Camelina sativa [gold-of-pleasure]
ref|XP_006307428.1|  hypothetical protein CARUB_v10009052mg             158   2e-42   Capsella rubella
ref|XP_002890064.1|  UBX domain-containing protein                      158   2e-42   Arabidopsis lyrata subsp. lyrata
ref|XP_010496241.1|  PREDICTED: UBX domain-containing protein 2-like    157   3e-42   Camelina sativa [gold-of-pleasure]
ref|XP_008389121.1|  PREDICTED: UBX domain-containing protein 2-l...    157   3e-42   Malus domestica [apple tree]
ref|XP_008389120.1|  PREDICTED: UBX domain-containing protein 2-l...    157   3e-42   Malus domestica [apple tree]
ref|XP_008389122.1|  PREDICTED: UBX domain-containing protein 2-l...    157   3e-42   Malus domestica [apple tree]
ref|XP_010935375.1|  PREDICTED: UBX domain-containing protein 5 i...    155   9e-42   
ref|XP_004160516.1|  PREDICTED: uncharacterized protein LOC101223406    149   1e-41   
ref|XP_010935374.1|  PREDICTED: UBX domain-containing protein 2 i...    155   2e-41   Elaeis guineensis
ref|XP_004140414.1|  PREDICTED: UBX domain-containing protein 7-like    154   3e-41   Cucumis sativus [cucumbers]
emb|CDY69105.1|  BnaCnng61890D                                          154   5e-41   Brassica napus [oilseed rape]
ref|XP_009401234.1|  PREDICTED: UBX domain-containing protein 2         152   2e-40   Musa acuminata subsp. malaccensis [pisang utan]
ref|NP_563954.1|  UBX domain-containing protein                         152   2e-40   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008804300.1|  PREDICTED: UBX domain-containing protein 7         152   3e-40   Phoenix dactylifera
ref|XP_004297788.1|  PREDICTED: UBX domain-containing protein 2 i...    152   4e-40   Fragaria vesca subsp. vesca
ref|XP_006416998.1|  hypothetical protein EUTSA_v10007578mg             152   4e-40   Eutrema salsugineum [saltwater cress]
ref|XP_011463491.1|  PREDICTED: UBX domain-containing protein 2 i...    152   4e-40   Fragaria vesca subsp. vesca
emb|CDY45269.1|  BnaA06g09390D                                          147   1e-38   Brassica napus [oilseed rape]
ref|XP_009148836.1|  PREDICTED: UBX domain-containing protein 2         146   5e-38   Brassica rapa
gb|KHN06997.1|  UBX domain-containing protein 7                         141   3e-36   Glycine soja [wild soybean]
ref|XP_007045359.1|  UBX domain-containing protein isoform 4            140   6e-36   
ref|XP_007052064.1|  UBX domain-containing protein                      137   6e-35   
ref|XP_009398016.1|  PREDICTED: UBX domain-containing protein 2-like    133   1e-33   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009773267.1|  PREDICTED: uncharacterized protein LOC104223510    122   2e-31   Nicotiana sylvestris
ref|NP_001077535.1|  UBX domain-containing protein                      127   4e-31   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006855568.1|  hypothetical protein AMTR_s00044p00018360          125   8e-31   Amborella trichopoda
ref|XP_009110537.1|  PREDICTED: UBX domain-containing protein 2-like    124   2e-30   Brassica rapa
gb|AFW59833.1|  hypothetical protein ZEAMMB73_017157                    115   2e-28   
gb|EYU24728.1|  hypothetical protein MIMGU_mgv1a025994mg                117   3e-28   Erythranthe guttata [common monkey flower]
gb|AEV41029.1|  putative UBX domain-containing protein                  119   3e-28   Oryza minuta
gb|AEV40978.1|  putative UBX domain-containing protein                  119   3e-28   Oryza punctata
tpg|DAA35439.1|  TPA: hypothetical protein ZEAMMB73_856149              117   8e-28   
ref|NP_001170636.1|  uncharacterized protein LOC100384688               117   8e-28   Zea mays [maize]
ref|XP_002447303.1|  hypothetical protein SORBIDRAFT_06g032400          117   9e-28   Sorghum bicolor [broomcorn]
ref|XP_008668717.1|  PREDICTED: UBX domain-containing protein 2-like    117   1e-27   
ref|XP_004960126.1|  PREDICTED: UBX domain-containing protein 2-like    116   2e-27   Setaria italica
ref|XP_010240593.1|  PREDICTED: UBX domain-containing protein 7 i...    114   5e-27   
ref|XP_003580790.1|  PREDICTED: UBX domain-containing protein 2 i...    114   1e-26   Brachypodium distachyon [annual false brome]
dbj|BAK05667.1|  predicted protein                                      112   7e-26   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|AEV41122.1|  putative UBX domain-containing protein                  110   3e-25   Oryza officinalis
emb|CAE02831.2|  OSJNBa0043A12.36                                       110   3e-25   Oryza sativa Japonica Group [Japonica rice]
ref|XP_001758899.1|  predicted protein                                  102   1e-22   
ref|XP_009759130.1|  PREDICTED: UBX domain-containing protein 7-like  97.4    6e-21   Nicotiana sylvestris
ref|XP_010527852.1|  PREDICTED: UBX domain-containing protein 2 i...  96.7    1e-20   Tarenaya hassleriana [spider flower]
gb|KGN50781.1|  hypothetical protein Csa_5G259710                     94.0    2e-20   Cucumis sativus [cucumbers]
gb|AAF63167.1|AC010657_3  T5E21.7                                     96.3    5e-20   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006343881.1|  PREDICTED: UBX domain-containing protein 7-like  92.8    5e-19   Solanum tuberosum [potatoes]
ref|XP_010325366.1|  PREDICTED: LOW QUALITY PROTEIN: UBX domain-c...  92.0    6e-19   
ref|XP_008801336.1|  PREDICTED: UBX domain-containing protein 2-like  90.1    2e-18   
tpg|DAA35438.1|  TPA: hypothetical protein ZEAMMB73_856149            89.4    1e-17   
gb|KDO53545.1|  hypothetical protein CISIN_1g013325mg                 86.3    5e-17   Citrus sinensis [apfelsine]
ref|XP_008342902.1|  PREDICTED: LOW QUALITY PROTEIN: membrane-ass...  84.3    1e-16   
ref|XP_006414812.1|  hypothetical protein EUTSA_v10027208mg           85.5    2e-16   
ref|XP_009599661.1|  PREDICTED: UBX domain-containing protein 7 h...  84.7    2e-16   Nicotiana tomentosiformis
ref|XP_010253434.1|  PREDICTED: UBX domain-containing protein 7-like  83.6    6e-16   Nelumbo nucifera [Indian lotus]
ref|XP_009601783.1|  PREDICTED: uncharacterized protein LOC104097...  82.0    2e-15   Nicotiana tomentosiformis
gb|KDO48110.1|  hypothetical protein CISIN_1g021440mg                 80.9    3e-15   Citrus sinensis [apfelsine]
ref|XP_006653862.1|  PREDICTED: UBX domain-containing protein 2-like  81.6    3e-15   
gb|KDO48111.1|  hypothetical protein CISIN_1g021440mg                 80.9    3e-15   Citrus sinensis [apfelsine]
ref|XP_006480638.1|  PREDICTED: UBX domain-containing protein 7-l...  79.7    4e-15   
ref|XP_009139538.1|  PREDICTED: UBX domain-containing protein 2       81.6    5e-15   Brassica rapa
ref|XP_006480635.1|  PREDICTED: UBX domain-containing protein 7-l...  79.7    7e-15   
emb|CDX84023.1|  BnaC08g16220D                                        81.6    7e-15   
ref|XP_006480637.1|  PREDICTED: UBX domain-containing protein 7-l...  79.7    7e-15   
ref|XP_006480636.1|  PREDICTED: UBX domain-containing protein 7-l...  79.7    8e-15   
ref|XP_009601784.1|  PREDICTED: uncharacterized protein LOC104097...  80.5    8e-15   Nicotiana tomentosiformis
gb|EEE61882.1|  hypothetical protein OsJ_16574                        79.3    4e-14   Oryza sativa Japonica Group [Japonica rice]
gb|AIE88273.1|  hypothetical protein OG_BBa0063K01.4                  78.2    1e-13   Oryza glaberrima
gb|EMT10976.1|  hypothetical protein F775_30110                       76.6    2e-13   
emb|CDY01207.1|  BnaA04g06120D                                        77.8    3e-13   
gb|EMS63720.1|  UBX domain-containing protein 7                       77.0    3e-13   Triticum urartu
emb|CDY68911.1|  BnaAnng28760D                                        74.7    1e-12   Brassica napus [oilseed rape]
ref|XP_006414811.1|  hypothetical protein EUTSA_v10027532mg           73.6    4e-12   
ref|XP_006470475.1|  PREDICTED: UBX domain-containing protein 7-like  71.6    1e-11   
ref|XP_006446591.1|  hypothetical protein CICLE_v10017670mg           70.9    2e-11   Citrus clementina [clementine]
ref|XP_003604178.1|  UBX domain-containing protein                    69.7    2e-11   Medicago truncatula
gb|KDO55137.1|  hypothetical protein CISIN_1g036413mg                 69.7    4e-11   Citrus sinensis [apfelsine]
ref|XP_006414754.1|  hypothetical protein EUTSA_v10027144mg           67.8    3e-10   
ref|NP_001054216.1|  Os04g0670800                                     67.4    3e-10   
gb|KGN50782.1|  hypothetical protein Csa_5G259720                     63.9    8e-10   Cucumis sativus [cucumbers]
ref|NP_193161.3|  UBX domain-containing pseudogene                    65.1    4e-09   
ref|NP_001190727.1|  UBX domain-containing pseudogene                 65.1    5e-09   
emb|CAB10204.1|  hypothetical protein                                 64.3    7e-09   Arabidopsis thaliana [mouse-ear cress]
gb|KEH28537.1|  UBX domain protein                                    62.4    8e-09   Medicago truncatula
ref|XP_007222574.1|  hypothetical protein PRUPE_ppa008429mg           62.8    1e-08   
gb|KEH28538.1|  UBX domain protein                                    62.4    1e-08   Medicago truncatula
ref|XP_003604169.1|  UBX domain-containing protein                    62.4    1e-08   
gb|KFK22408.1|  hypothetical protein AALP_AAs65522U000100             62.0    3e-08   Arabis alpina [alpine rockcress]
ref|XP_010519462.1|  PREDICTED: UBX domain-containing protein 2-like  59.3    2e-07   Tarenaya hassleriana [spider flower]
gb|AEV41076.1|  putative UBX domain-containing protein                59.7    2e-07   Oryza minuta
ref|XP_002868299.1|  predicted protein                                59.7    3e-07   
ref|XP_005643712.1|  hypothetical protein COCSUDRAFT_59648            58.5    4e-07   Coccomyxa subellipsoidea C-169
gb|KFK22146.1|  hypothetical protein AALP_AAs62910U000300             55.8    3e-06   Arabis alpina [alpine rockcress]
emb|CDY12746.1|  BnaC04g28950D                                        55.5    4e-06   Brassica napus [oilseed rape]
ref|XP_009566058.1|  PREDICTED: UBX domain-containing protein 7       55.5    5e-06   Cuculus canorus
gb|KFO81222.1|  UBX domain-containing protein 7                       55.5    5e-06   Cuculus canorus
ref|XP_010792284.1|  PREDICTED: UBX domain-containing protein 7       54.7    5e-06   Notothenia coriiceps [yellowbelly rockcod]
ref|XP_004079303.2|  PREDICTED: UBX domain-containing protein 7       54.7    7e-06   
ref|XP_007431490.1|  PREDICTED: UBX domain-containing protein 7 i...  54.7    8e-06   Python bivittatus
ref|XP_007884078.1|  PREDICTED: UBX domain-containing protein 7 i...  54.7    9e-06   Callorhinchus milii [Australian ghost shark]
ref|XP_005151293.1|  PREDICTED: UBX domain-containing protein 7       54.7    9e-06   Melopsittacus undulatus
ref|XP_007559513.1|  PREDICTED: UBX domain-containing protein 7       54.3    1e-05   Poecilia formosa
ref|XP_010450078.1|  PREDICTED: UBX domain-containing protein 2-like  54.3    1e-05   Camelina sativa [gold-of-pleasure]
ref|XP_005796061.1|  PREDICTED: UBX domain-containing protein 7-like  54.3    1e-05   Xiphophorus maculatus
ref|XP_005721383.1|  PREDICTED: UBX domain-containing protein 7-like  54.3    1e-05   Pundamilia nyererei
ref|XP_004542734.1|  PREDICTED: UBX domain-containing protein 7-like  54.3    1e-05   Maylandia zebra
ref|XP_008432356.1|  PREDICTED: UBX domain-containing protein 7       54.3    1e-05   Poecilia reticulata
ref|XP_008332241.1|  PREDICTED: UBX domain-containing protein 7       54.3    1e-05   Cynoglossus semilaevis [half-smooth tongue sole]
ref|XP_006414759.1|  hypothetical protein EUTSA_v10027233mg           53.9    1e-05   
ref|XP_003438186.2|  PREDICTED: UBX domain-containing protein 7       53.9    1e-05   
ref|XP_006786563.1|  PREDICTED: UBX domain-containing protein 7-like  53.9    1e-05   Neolamprologus brichardi [lyretail cichlid]
ref|XP_010022496.1|  PREDICTED: UBX domain-containing protein 7       53.9    1e-05   Nestor notabilis
ref|XP_010741940.1|  PREDICTED: LOW QUALITY PROTEIN: UBX domain-c...  53.9    1e-05   
ref|XP_005303673.1|  PREDICTED: UBX domain-containing protein 7       53.9    1e-05   
ref|XP_003978227.1|  PREDICTED: UBX domain-containing protein 7-like  53.5    2e-05   Takifugu rubripes [tiger puffer]
gb|KFP66219.1|  UBX domain-containing protein 7                       53.1    2e-05   Cariama cristata
ref|XP_006285935.1|  hypothetical protein CARUB_v10007447mg           53.1    2e-05   
ref|XP_002874517.1|  predicted protein                                52.8    2e-05   
ref|XP_007884019.1|  PREDICTED: UBX domain-containing protein 7 i...  53.1    2e-05   Callorhinchus milii [Australian ghost shark]
ref|XP_006124906.1|  PREDICTED: UBX domain-containing protein 7       53.1    3e-05   
emb|CAG07636.1|  unnamed protein product                              53.1    3e-05   Tetraodon nigroviridis
ref|XP_001373967.2|  PREDICTED: UBX domain-containing protein 7       53.1    3e-05   Monodelphis domestica
ref|XP_003218371.1|  PREDICTED: UBX domain-containing protein 7       52.8    3e-05   Anolis carolinensis [Carolina anole]
ref|XP_004373649.1|  PREDICTED: UBX domain-containing protein 7       52.8    3e-05   Trichechus manatus latirostris
ref|XP_007537896.1|  PREDICTED: UBX domain-containing protein 7 i...  52.8    3e-05   Erinaceus europaeus [common hedgehog]
ref|XP_009139540.1|  PREDICTED: UBX domain-containing protein 7-like  52.8    3e-05   Brassica rapa
ref|XP_005529566.1|  PREDICTED: UBX domain-containing protein 7       52.8    3e-05   
gb|KFP06318.1|  UBX domain-containing protein 7                       52.8    3e-05   Calypte anna
ref|XP_006267089.1|  PREDICTED: UBX domain-containing protein 7       52.8    4e-05   Alligator mississippiensis
ref|XP_008499110.1|  PREDICTED: UBX domain-containing protein 7       52.8    4e-05   Calypte anna
ref|XP_006034950.1|  PREDICTED: UBX domain-containing protein 7       52.8    4e-05   
ref|XP_422667.3|  PREDICTED: UBX domain-containing protein 7 isof...  52.4    4e-05   
gb|KFW11978.1|  UBX domain-containing protein 7                       52.4    5e-05   Eurypyga helias
ref|XP_008283973.1|  PREDICTED: UBX domain-containing protein 7       52.4    5e-05   Stegastes partitus
gb|EMC77931.1|  UBX domain-containing protein 7                       52.4    5e-05   
ref|XP_010157159.1|  PREDICTED: UBX domain-containing protein 7       52.4    5e-05   Eurypyga helias
ref|XP_006010569.1|  PREDICTED: UBX domain-containing protein 7       52.4    5e-05   
ref|XP_009939092.1|  PREDICTED: UBX domain-containing protein 7       52.4    5e-05   Opisthocomus hoazin [hoatzin]
gb|KFR15588.1|  UBX domain-containing protein 7                       52.0    6e-05   Opisthocomus hoazin [hoatzin]
ref|XP_009995047.1|  PREDICTED: UBX domain-containing protein 7       52.0    6e-05   Chaetura pelagica
ref|XP_010436606.1|  PREDICTED: UBX domain-containing protein 2-like  51.6    7e-05   
emb|CDY01206.1|  BnaA04g06130D                                        51.6    7e-05   
ref|XP_002886675.1|  predicted protein                                51.6    7e-05   
ref|XP_646734.1|  UAS domain-containing protein                       51.6    7e-05   Dictyostelium discoideum AX4
ref|XP_009642777.1|  PREDICTED: UBX domain-containing protein 7       51.6    8e-05   Egretta garzetta
gb|KFW91268.1|  UBX domain-containing protein 7                       51.6    8e-05   Phalacrocorax carbo [common cormorant]
ref|XP_009503466.1|  PREDICTED: UBX domain-containing protein 7       51.6    8e-05   Phalacrocorax carbo [common cormorant]
gb|KFQ45369.1|  UBX domain-containing protein 7                       51.2    9e-05   Nestor notabilis
gb|KFP20656.1|  UBX domain-containing protein 7                       51.2    1e-04   Egretta garzetta
gb|KFV98068.1|  UBX domain-containing protein 7                       51.2    1e-04   Fulmarus glacialis
ref|XP_009584874.1|  PREDICTED: UBX domain-containing protein 7       51.2    1e-04   Fulmarus glacialis
ref|XP_010445452.1|  PREDICTED: UBX domain-containing protein 7       51.2    1e-04   Camelina sativa [gold-of-pleasure]
gb|KFO08321.1|  UBX domain-containing protein 7                       51.2    1e-04   Balearica regulorum gibbericeps
gb|KFZ68476.1|  UBX domain-containing protein 7                       51.2    1e-04   Podiceps cristatus
ref|XP_010311687.1|  PREDICTED: UBX domain-containing protein 7       51.2    1e-04   Balearica regulorum gibbericeps
gb|KFW86225.1|  UBX domain-containing protein 7                       51.2    1e-04   Manacus vitellinus
ref|XP_008928489.1|  PREDICTED: UBX domain-containing protein 7       51.2    1e-04   
gb|KFP38427.1|  UBX domain-containing protein 7                       51.2    1e-04   Chlamydotis macqueenii
ref|XP_005028141.1|  PREDICTED: UBX domain-containing protein 7       51.2    1e-04   
gb|KFO87511.1|  UBX domain-containing protein 7                       51.2    1e-04   Buceros rhinoceros silvestris
gb|KFQ95214.1|  UBX domain-containing protein 7                       51.2    1e-04   Nipponia nippon
ref|XP_009912522.1|  PREDICTED: UBX domain-containing protein 7 i...  50.8    1e-04   Haliaeetus albicilla
ref|XP_005050918.1|  PREDICTED: UBX domain-containing protein 7       51.2    1e-04   
ref|XP_010130823.1|  PREDICTED: UBX domain-containing protein 7       51.2    1e-04   Buceros rhinoceros silvestris
ref|XP_009875011.1|  PREDICTED: UBX domain-containing protein 7       51.2    1e-04   Apaloderma vittatum
ref|XP_009283288.1|  PREDICTED: UBX domain-containing protein 7       51.2    1e-04   Aptenodytes forsteri
gb|KFW66282.1|  UBX domain-containing protein 7                       50.8    1e-04   Pygoscelis adeliae
gb|KFM11413.1|  UBX domain-containing protein 7                       50.8    1e-04   Aptenodytes forsteri
ref|XP_009969814.1|  PREDICTED: UBX domain-containing protein 7       50.8    1e-04   Tyto alba [Schleiereule]
gb|KFP92412.1|  UBX domain-containing protein 7                       50.8    1e-04   Apaloderma vittatum
emb|CDQ70866.1|  unnamed protein product                              51.2    1e-04   Oncorhynchus mykiss
ref|XP_005241643.1|  PREDICTED: UBX domain-containing protein 7       50.8    1e-04   
gb|KFP51814.1|  UBX domain-containing protein 7                       50.8    1e-04   Cathartes aura
gb|KFQ00398.1|  UBX domain-containing protein 7                       50.8    1e-04   Haliaeetus albicilla
gb|KFV57093.1|  UBX domain-containing protein 7                       50.8    1e-04   Tyto alba [Schleiereule]
gb|KFV14929.1|  UBX domain-containing protein 7                       50.8    1e-04   Pterocles gutturalis
gb|KFQ80041.1|  UBX domain-containing protein 7                       50.8    1e-04   Phaethon lepturus
ref|XP_010559592.1|  PREDICTED: UBX domain-containing protein 7       50.8    1e-04   Haliaeetus leucocephalus
ref|XP_010081335.1|  PREDICTED: UBX domain-containing protein 7       50.8    1e-04   Pterocles gutturalis
ref|XP_010290507.1|  PREDICTED: UBX domain-containing protein 7       50.8    1e-04   Phaethon lepturus
ref|XP_009321171.1|  PREDICTED: UBX domain-containing protein 7       50.8    1e-04   Pygoscelis adeliae
gb|KFV66581.1|  UBX domain-containing protein 7                       50.8    1e-04   Picoides pubescens
ref|XP_010490003.1|  PREDICTED: UBX domain-containing protein 2-like  50.8    1e-04   
gb|EOA95320.1|  UBX domain-containing protein 7                       50.8    1e-04   Anas platyrhynchos [duck]
ref|XP_009897769.1|  PREDICTED: UBX domain-containing protein 7       50.8    1e-04   Picoides pubescens
gb|KGL73458.1|  UBX domain-containing protein 7                       50.8    2e-04   Tinamus guttatus
ref|XP_010124459.1|  PREDICTED: UBX domain-containing protein 7       50.8    2e-04   Chlamydotis macqueenii
ref|XP_004937060.1|  PREDICTED: UBX domain-containing protein 7 i...  50.8    2e-04   
ref|XP_007883905.1|  PREDICTED: UBX domain-containing protein 7 i...  50.4    2e-04   Callorhinchus milii [Australian ghost shark]
gb|KFO55952.1|  UBX domain-containing protein 7                       50.4    2e-04   Corvus brachyrhynchos
gb|KGL93583.1|  UBX domain-containing protein 7                       50.4    2e-04   Charadrius vociferus
ref|XP_008627792.1|  PREDICTED: UBX domain-containing protein 7       50.4    2e-04   
ref|XP_009883704.1|  PREDICTED: UBX domain-containing protein 7       50.4    2e-04   Charadrius vociferus
ref|XP_008767028.1|  PREDICTED: UBX domain-containing protein 7-l...  50.1    2e-04   Rattus norvegicus [brown rat]
ref|NP_001001951.1|  UBX domain-containing protein 7                  50.1    3e-04   Danio rerio [leopard danio]
ref|XP_003751122.2|  PREDICTED: UBX domain-containing protein 7-l...  49.7    3e-04   Rattus norvegicus [brown rat]
ref|XP_007884125.1|  PREDICTED: UBX domain-containing protein 7 i...  49.7    4e-04   Callorhinchus milii [Australian ghost shark]
ref|XP_007883858.1|  PREDICTED: UBX domain-containing protein 7 i...  49.7    4e-04   Callorhinchus milii [Australian ghost shark]
ref|XP_007883961.1|  PREDICTED: UBX domain-containing protein 7 i...  49.7    4e-04   Callorhinchus milii [Australian ghost shark]
ref|XP_007431491.1|  PREDICTED: UBX domain-containing protein 7 i...  49.3    4e-04   
ref|XP_003763741.1|  PREDICTED: UBX domain-containing protein 7       49.3    4e-04   
gb|KFV20176.1|  UBX domain-containing protein 7                       49.3    5e-04   Tauraco erythrolophus
ref|XP_009988324.1|  PREDICTED: UBX domain-containing protein 7       49.3    5e-04   Tauraco erythrolophus
ref|XP_005501670.1|  PREDICTED: UBX domain-containing protein 7       49.3    5e-04   
ref|XP_009025545.1|  hypothetical protein HELRODRAFT_189218           49.3    5e-04   Helobdella robusta
ref|XP_010223074.1|  PREDICTED: UBX domain-containing protein 7       49.3    5e-04   Tinamus guttatus
ref|XP_009461061.1|  PREDICTED: UBX domain-containing protein 7       49.3    5e-04   Nipponia nippon
ref|XP_009700833.1|  PREDICTED: UBX domain-containing protein 7       48.9    6e-04   Cariama cristata
ref|XP_005489656.1|  PREDICTED: UBX domain-containing protein 7       48.9    6e-04   
emb|CDY12748.1|  BnaC04g28930D                                        48.9    7e-04   Brassica napus [oilseed rape]
ref|XP_008836748.1|  PREDICTED: UBX domain-containing protein 7       48.9    7e-04   Nannospalax galili
ref|XP_010714849.1|  PREDICTED: UBX domain-containing protein 7       48.9    7e-04   Meleagris gallopavo [common turkey]
ref|XP_010409475.1|  PREDICTED: LOW QUALITY PROTEIN: UBX domain-c...  48.9    7e-04   
ref|XP_005344897.1|  PREDICTED: UBX domain-containing protein 7       48.9    7e-04   Microtus ochrogaster [prairie voles]
ref|XP_002191659.2|  PREDICTED: UBX domain-containing protein 7       48.9    7e-04   
ref|XP_009087756.1|  PREDICTED: UBX domain-containing protein 7       48.9    7e-04   
gb|KDR07635.1|  UBX domain-containing protein 7                       48.9    7e-04   Zootermopsis nevadensis
dbj|BAC85247.1|  unnamed protein product                              48.1    7e-04   Homo sapiens [man]
ref|XP_005425113.1|  PREDICTED: UBX domain-containing protein 7       48.9    7e-04   
emb|CDQ88588.1|  unnamed protein product                              48.5    8e-04   Oncorhynchus mykiss
ref|XP_009139539.1|  PREDICTED: UBX domain-containing protein 2-like  48.5    8e-04   Brassica rapa
ref|XP_009200299.1|  PREDICTED: UBX domain-containing protein 7-l...  47.4    0.001   



>emb|CDP07923.1| unnamed protein product [Coffea canephora]
Length=448

 Score =   219 bits (557),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 121/179 (68%), Positives = 140/179 (78%), Gaps = 8/179 (4%)
 Frame = +1

Query  1    QILVASFLEIAVGQSADTARQFLQATSWKLEEALQLFYVGNDGGVAAPSSYSP-LENTAP  177
            Q LV+SFLEIAVGQ+ADTARQFLQATSWKL+EA+QLFY+GN+GG AA S+ SP LE+  P
Sbjct  11   QSLVSSFLEIAVGQTADTARQFLQATSWKLDEAIQLFYIGNEGGAAASSAQSPQLESDLP  70

Query  178  lpdpslssisgsikgsgdesekQGDRDEVRPPLPVIRDVLYDTAVIRGLPAMGGSAHEAR  357
            L DPSL S + +     +    QGD D+VRPPLPVIRDVLYD  ++ G   MGGS+HEAR
Sbjct  71   LDDPSLRSGTRTDLEDQNIR--QGDGDDVRPPLPVIRDVLYDNTMLFGASRMGGSSHEAR  128

Query  358  SVVPFRNFEQEMKHPGVWETDKAS-----NSADNLASLYRPPFALMYHGSFEKAKDAAR  519
            +VVPFRNFE+E+K PGVWET+  S      S  NLASLYRPPFALMY GSFEKAKDAAR
Sbjct  129  AVVPFRNFEEELKRPGVWETENGSASTVDKSQYNLASLYRPPFALMYQGSFEKAKDAAR  187



>ref|XP_010654914.1| PREDICTED: UBX domain-containing protein 2 isoform X3 [Vitis 
vinifera]
Length=453

 Score =   208 bits (530),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 116/178 (65%), Positives = 135/178 (76%), Gaps = 9/178 (5%)
 Frame = +1

Query  1    QILVASFLEIAVGQSADTARQFLQATSWKLEEALQLFYVGNDGGVAAPSSYS-PLENTAP  177
            Q +V+SFLEIAVGQSADTARQFLQATSWKLEEA+QLFYVGN+GG  A SSYS P+EN +P
Sbjct  10   QSMVSSFLEIAVGQSADTARQFLQATSWKLEEAIQLFYVGNEGGTMAASSYSPPIENISP  69

Query  178  lpdpslssisgsikgsgdesekQGDRDEVRPPLPVIRDVLYDTAVIRGLPAMGGSAHEAR  357
                   S SGS K   +E+  Q D DEVRPPLPVIR+ LYD A++ G+   G  +HEA 
Sbjct  70   ---LPDQSSSGSRKDIENENVVQDDGDEVRPPLPVIREALYDDAMLYGVSRGGYPSHEAS  126

Query  358  SVVPFRNFEQEMKHPGVWETDK-----ASNSADNLASLYRPPFALMYHGSFEKAKDAA  516
            S+V FRNF+ EMK PG+WE++K     A NS DNLASLYRPPFALM+HG FEKAK AA
Sbjct  127  SLVAFRNFDDEMKRPGIWESEKGATSTAENSRDNLASLYRPPFALMHHGPFEKAKVAA  184



>ref|XP_003631347.1| PREDICTED: UBX domain-containing protein 2 isoform X1 [Vitis 
vinifera]
 emb|CBI27509.3| unnamed protein product [Vitis vinifera]
Length=456

 Score =   208 bits (530),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 116/178 (65%), Positives = 135/178 (76%), Gaps = 9/178 (5%)
 Frame = +1

Query  1    QILVASFLEIAVGQSADTARQFLQATSWKLEEALQLFYVGNDGGVAAPSSYS-PLENTAP  177
            Q +V+SFLEIAVGQSADTARQFLQATSWKLEEA+QLFYVGN+GG  A SSYS P+EN +P
Sbjct  10   QSMVSSFLEIAVGQSADTARQFLQATSWKLEEAIQLFYVGNEGGTMAASSYSPPIENISP  69

Query  178  lpdpslssisgsikgsgdesekQGDRDEVRPPLPVIRDVLYDTAVIRGLPAMGGSAHEAR  357
                   S SGS K   +E+  Q D DEVRPPLPVIR+ LYD A++ G+   G  +HEA 
Sbjct  70   ---LPDQSSSGSRKDIENENVVQDDGDEVRPPLPVIREALYDDAMLYGVSRGGYPSHEAS  126

Query  358  SVVPFRNFEQEMKHPGVWETDK-----ASNSADNLASLYRPPFALMYHGSFEKAKDAA  516
            S+V FRNF+ EMK PG+WE++K     A NS DNLASLYRPPFALM+HG FEKAK AA
Sbjct  127  SLVAFRNFDDEMKRPGIWESEKGATSTAENSRDNLASLYRPPFALMHHGPFEKAKVAA  184



>ref|XP_004236895.1| PREDICTED: UBX domain-containing protein 2 [Solanum lycopersicum]
Length=466

 Score =   206 bits (525),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 120/178 (67%), Positives = 135/178 (76%), Gaps = 8/178 (4%)
 Frame = +1

Query  1    QILVASFLEIAVGQSADTARQFLQATSWKLEEALQLFYVGNDGGVAAPSSYSPLENTAPl  180
            Q+LV+SFLEIAVGQ+ADTARQFLQATSWKLEEA+QLFY+GN+GG AA  +   L N A  
Sbjct  11   QMLVSSFLEIAVGQTADTARQFLQATSWKLEEAIQLFYIGNEGGAAASFNSPQLGNDA--  68

Query  181  pdpslssisgsikgsgdesekQGDRDEVRPPLPVIRDVLYDTAVIRGLPAMGGSAHEARS  360
                  S+SG    S D +  QGD D+VRPPLPV R+VLYD AV+ G   MGGS+ E R 
Sbjct  69   -LLGDPSLSGVGNDSADTNLLQGDGDDVRPPLPVKREVLYDNAVLYGSSGMGGSSREPRL  127

Query  361  VVPFRNFEQEMKHPGVWETDKASNSA-----DNLASLYRPPFALMYHGSFEKAKDAAR  519
            VVPFRNFE+EMKHPGVWE +K S S      DNLASLYRPPFALMYHGSFEKAKDAAR
Sbjct  128  VVPFRNFEEEMKHPGVWEAEKRSTSTADAAQDNLASLYRPPFALMYHGSFEKAKDAAR  185



>ref|XP_006355016.1| PREDICTED: UBX domain-containing protein 2-like [Solanum tuberosum]
Length=462

 Score =   203 bits (517),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 119/178 (67%), Positives = 135/178 (76%), Gaps = 8/178 (4%)
 Frame = +1

Query  1    QILVASFLEIAVGQSADTARQFLQATSWKLEEALQLFYVGNDGGVAAPSSYSPLENTAPl  180
            Q+LV+SFLEIAVGQ+ADTARQFLQATSWKLEEA+QLFY+GN+ G AA  +   L N A  
Sbjct  11   QMLVSSFLEIAVGQTADTARQFLQATSWKLEEAIQLFYIGNESGAAAFFNSPQLGNDA--  68

Query  181  pdpslssisgsikgsgdesekQGDRDEVRPPLPVIRDVLYDTAVIRGLPAMGGSAHEARS  360
                  S+SG +  S D +  QGD D+VRPPLPV R+VLYD AV+ G   MGGS+ E R 
Sbjct  69   -LLGDPSLSGVVNDSVDTNLVQGDGDDVRPPLPVKREVLYDNAVLYGSSGMGGSSREPRL  127

Query  361  VVPFRNFEQEMKHPGVWETDKASNSA-----DNLASLYRPPFALMYHGSFEKAKDAAR  519
            VVPFRNFE+EMKHPGVWE +K S S      DNLASLYRPPFALMYHGSFEKAKDAAR
Sbjct  128  VVPFRNFEEEMKHPGVWEAEKRSTSTADAAQDNLASLYRPPFALMYHGSFEKAKDAAR  185



>ref|XP_010654910.1| PREDICTED: UBX domain-containing protein 2 isoform X2 [Vitis 
vinifera]
Length=454

 Score =   202 bits (514),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 117/180 (65%), Positives = 135/180 (75%), Gaps = 15/180 (8%)
 Frame = +1

Query  1    QILVASFLEIAVGQSADTARQFLQATSWKLEEALQLFYVGNDGGVAAPSSYS-PLENTAP  177
            Q +V+SFLEIAVGQSADTARQFLQATSWKLEEA+QLFYVGN+GG  A SSYS P+EN +P
Sbjct  10   QSMVSSFLEIAVGQSADTARQFLQATSWKLEEAIQLFYVGNEGGTMAASSYSPPIENISP  69

Query  178  lpdpslssisgsikgsgdesekQGDRDEVRPPLPVIRDVLYDTAVI--RGLPAMGGSAHE  351
                   S SGS K   +E+  Q D DEVRPPLPVIR+ LYD A++  RG    G  +HE
Sbjct  70   ---LPDQSSSGSRKDIENENVVQDDGDEVRPPLPVIREALYDDAMLVSRG----GYPSHE  122

Query  352  ARSVVPFRNFEQEMKHPGVWETDK-----ASNSADNLASLYRPPFALMYHGSFEKAKDAA  516
            A S+V FRNF+ EMK PG+WE++K     A NS DNLASLYRPPFALM+HG FEKAK AA
Sbjct  123  ASSLVAFRNFDDEMKRPGIWESEKGATSTAENSRDNLASLYRPPFALMHHGPFEKAKVAA  182



>ref|XP_011070500.1| PREDICTED: UBX domain-containing protein 2 [Sesamum indicum]
Length=453

 Score =   201 bits (511),  Expect = 8e-59, Method: Compositional matrix adjust.
 Identities = 105/180 (58%), Positives = 132/180 (73%), Gaps = 11/180 (6%)
 Frame = +1

Query  1    QILVASFLEIAVGQSADTARQFLQATSWKLEEALQLFYVGNDGGVAAPSSYS-PLENTAP  177
            Q LV+SFLEIAVG++A+TARQFLQAT WKLEEA+QLFYVGN+G +A PS YS P E+  P
Sbjct  13   QKLVSSFLEIAVGETAETARQFLQATGWKLEEAIQLFYVGNEGRIATPSVYSPPTESDLP  72

Query  178  lpdpslssisgsikgsgdesekQGDRDEVRPPLPVIRDVLYDTAVIRGLPAMGGSAHEAR  357
                   S    +     + + + D ++VRPPLPV RDVLYD  ++ G   +GGS++ + 
Sbjct  73   ----LNDSNLSELGKELVDKDVRQDGEDVRPPLPVKRDVLYDNRMLYGGARLGGSSYASH  128

Query  358  SVVPFRNFEQEMKHPGVWETDKASNSA------DNLASLYRPPFALMYHGSFEKAKDAAR  519
            +VVPFRNFE+EMKHPGVWE ++ S+S+      DNLASLYRPPFALM+HG FEKAKD AR
Sbjct  129  TVVPFRNFEEEMKHPGVWEAEEGSSSSVADKTQDNLASLYRPPFALMFHGPFEKAKDEAR  188



>ref|XP_009587838.1| PREDICTED: UBX domain-containing protein 2 [Nicotiana tomentosiformis]
Length=453

 Score =   199 bits (507),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 119/178 (67%), Positives = 137/178 (77%), Gaps = 8/178 (4%)
 Frame = +1

Query  1    QILVASFLEIAVGQSADTARQFLQATSWKLEEALQLFYVGNDGGVAAPSSYSPLENTAPl  180
            QILV+SFLEIAVGQ+ADTARQFLQATSWKL+EA+QLFY+GN+ G AA  + S L N A  
Sbjct  11   QILVSSFLEIAVGQTADTARQFLQATSWKLDEAIQLFYIGNEAGAAASFNSSQLGNDA--  68

Query  181  pdpslssisgsikgsgdesekQGDRDEVRPPLPVIRDVLYDTAVIRGLPAMGGSAHEARS  360
                 SS+SG++K S D S  QGD D++RPPLPV R+VLYD AV+ G   +GGS+ E R 
Sbjct  69   -LLGGSSLSGAVKESADNSWGQGDGDDIRPPLPVKREVLYDNAVLYGSSGVGGSSREPRL  127

Query  361  VVPFRNFEQEMKHPGVWETDKASNSA-----DNLASLYRPPFALMYHGSFEKAKDAAR  519
            VVPFRNFE+EMK PGVWE +K S S      DNLASLYRPPFALMYHG FEKAKDAAR
Sbjct  128  VVPFRNFEEEMKRPGVWEAEKRSISTADAAQDNLASLYRPPFALMYHGPFEKAKDAAR  185



>gb|EYU30238.1| hypothetical protein MIMGU_mgv1a006061mg [Erythranthe guttata]
Length=458

 Score =   198 bits (504),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 105/180 (58%), Positives = 130/180 (72%), Gaps = 10/180 (6%)
 Frame = +1

Query  1    QILVASFLEIAVGQSADTARQFLQATSWKLEEALQLFYVGNDGGVAAPSSYS-PLENTAP  177
            Q +V+SFLEIAVGQ+ DTARQFLQAT W+LEEA+QLFYVGN+GG+A  S YS P EN  P
Sbjct  13   QNMVSSFLEIAVGQTVDTARQFLQATGWRLEEAIQLFYVGNEGGLATESVYSTPAENELP  72

Query  178  lpdpslssisgsikgsgdesekQGDRDEVRPPLPVIRDVLYDTAVIRGLPAMGGSAHEAR  357
            L + ++S +   +           D  +VRPPLPV RDVLYD++++ G+  +G S H   
Sbjct  73   LDESNMSELGKELMDRDVRI---NDGSDVRPPLPVRRDVLYDSSMLYGVQRVGDSPHATH  129

Query  358  SVVPFRNFEQEMKHPGVWETDKASNSA------DNLASLYRPPFALMYHGSFEKAKDAAR  519
            SVVPFRNF++EMKHPGVWE +  S+S+      DNLASLYRPPFALM+ G FEKAKD AR
Sbjct  130  SVVPFRNFDEEMKHPGVWEIEAGSSSSVVDKTQDNLASLYRPPFALMFQGPFEKAKDNAR  189



>ref|XP_002315828.1| UBX domain-containing family protein [Populus trichocarpa]
 gb|EEF01999.1| UBX domain-containing family protein [Populus trichocarpa]
Length=444

 Score =   196 bits (499),  Expect = 4e-57, Method: Compositional matrix adjust.
 Identities = 102/177 (58%), Positives = 124/177 (70%), Gaps = 18/177 (10%)
 Frame = +1

Query  1    QILVASFLEIAVGQSADTARQFLQATSWKLEEALQLFYVGNDGGVAAPSSYSPLENTAPl  180
            Q +V+SFLEIAVGQ+A+TARQFLQATSWKLE+A+QLFYVGN+GG  A +S+ P   T P 
Sbjct  11   QSMVSSFLEIAVGQTAETARQFLQATSWKLEDAIQLFYVGNEGGAVASASHPPPTETWP-  69

Query  181  pdpslssisgsikgsgdesekQGDRDEVRPPLPVIRDVLYDTAVIRGLPAMGGSAHEARS  360
                        +   +E     D +EVR PLPV+RD LYD A++ G    G   HEA S
Sbjct  70   ------------EDLENEKVGHSDGEEVRAPLPVVRDTLYDDAMLYGASRTGYPPHEASS  117

Query  361  VVPFRNFEQEMKHPGVWETDKAS-----NSADNLASLYRPPFALMYHGSFEKAKDAA  516
            ++ FRNF++EMKHPGVWE+D+ S     NS DNLASLYRPPF LM+HGSFEKAK AA
Sbjct  118  LIAFRNFDEEMKHPGVWESDQGSTSTTDNSRDNLASLYRPPFHLMFHGSFEKAKGAA  174



>ref|XP_006378421.1| hypothetical protein POPTR_0010s10910g [Populus trichocarpa]
 gb|ERP56218.1| hypothetical protein POPTR_0010s10910g [Populus trichocarpa]
Length=451

 Score =   196 bits (499),  Expect = 5e-57, Method: Compositional matrix adjust.
 Identities = 103/177 (58%), Positives = 126/177 (71%), Gaps = 11/177 (6%)
 Frame = +1

Query  1    QILVASFLEIAVGQSADTARQFLQATSWKLEEALQLFYVGNDGGVAAPSSYSPLENTAPl  180
            Q +V+SFLEIAVGQ+A+TARQFLQATSWKLE+A+QLFYVGN+GG  A +S+ P   T P 
Sbjct  11   QSMVSSFLEIAVGQTAETARQFLQATSWKLEDAIQLFYVGNEGGAVASASHPPPTETWP-  69

Query  181  pdpslssisgsikgsgdesekQGDRDEVRPPLPVIRDVLYDTAVIRGLPAMGGSAHEARS  360
                   +   +K   +E     D +EVR PLPV+RD LYD A++ G    G   HEA S
Sbjct  70   -----EVLESGLKDLENEKVGHSDGEEVRAPLPVVRDTLYDDAMLYGASRTGYPPHEASS  124

Query  361  VVPFRNFEQEMKHPGVWETDKAS-----NSADNLASLYRPPFALMYHGSFEKAKDAA  516
            ++ FRNF++EMKHPGVWE+D+ S     NS DNLASLYRPPF LM+HGSFEKAK AA
Sbjct  125  LIAFRNFDEEMKHPGVWESDQGSTSTTDNSRDNLASLYRPPFHLMFHGSFEKAKGAA  181



>ref|XP_002311564.2| hypothetical protein POPTR_0008s14230g [Populus trichocarpa]
 gb|EEE88931.2| hypothetical protein POPTR_0008s14230g [Populus trichocarpa]
Length=455

 Score =   195 bits (496),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 104/177 (59%), Positives = 127/177 (72%), Gaps = 11/177 (6%)
 Frame = +1

Query  1    QILVASFLEIAVGQSADTARQFLQATSWKLEEALQLFYVGNDGGVAAPSSYSPLENTAPl  180
            Q +V+SFLEIAVGQ+A+TARQFLQATSWKLE+A+QLFYVGN+GGV A +S+ P   T   
Sbjct  13   QSMVSSFLEIAVGQTAETARQFLQATSWKLEDAIQLFYVGNEGGVVASASHPPQTET---  69

Query  181  pdpslssisgsikgsgdesekQGDRDEVRPPLPVIRDVLYDTAVIRGLPAMGGSAHEARS  360
                       +K  G+E+   G  +EVR PLPV+RD LYD A++ G   MG   HEA S
Sbjct  70   ---RTDVHESGLKDFGNENVGPGGGEEVRAPLPVVRDTLYDDAMLYGASRMGHPPHEASS  126

Query  361  VVPFRNFEQEMKHPGVWETDKASNSA-----DNLASLYRPPFALMYHGSFEKAKDAA  516
            ++ FRNF++EMKH GVWE+D+ S S      DNLASLYRPPF LM+HGSFEKAKDAA
Sbjct  127  LIAFRNFDEEMKHSGVWESDQGSTSTIDNPRDNLASLYRPPFHLMFHGSFEKAKDAA  183



>ref|XP_009775836.1| PREDICTED: UBX domain-containing protein 2 [Nicotiana sylvestris]
Length=454

 Score =   195 bits (495),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 115/178 (65%), Positives = 134/178 (75%), Gaps = 8/178 (4%)
 Frame = +1

Query  1    QILVASFLEIAVGQSADTARQFLQATSWKLEEALQLFYVGNDGGVAAPSSYSPLENTAPl  180
            Q+LV+SFLEIAVGQ+ADTARQFLQATSWKL+EA+QLFY+GN+ G AA  +   L N A  
Sbjct  11   QMLVSSFLEIAVGQTADTARQFLQATSWKLDEAIQLFYIGNEAGAAASFNSPELGNDA--  68

Query  181  pdpslssisgsikgsgdesekQGDRDEVRPPLPVIRDVLYDTAVIRGLPAMGGSAHEARS  360
                  S+SG++K   D S  QGD D++RPPLPV R+VLYD AV+ G   +GGS+ E R 
Sbjct  69   -LLGDPSLSGAVKDLADNSWGQGDGDDIRPPLPVKREVLYDNAVLYGSSGVGGSSREPRL  127

Query  361  VVPFRNFEQEMKHPGVWETDKASNSA-----DNLASLYRPPFALMYHGSFEKAKDAAR  519
            VVPFRNFE+EMK PGVWE +K S S      DNLASLYRPPFALMYHG FEKAKDAAR
Sbjct  128  VVPFRNFEEEMKRPGVWEAEKRSISTADAAQDNLASLYRPPFALMYHGPFEKAKDAAR  185



>gb|EYU30240.1| hypothetical protein MIMGU_mgv1a006061mg [Erythranthe guttata]
Length=437

 Score =   193 bits (491),  Expect = 5e-56, Method: Compositional matrix adjust.
 Identities = 105/181 (58%), Positives = 130/181 (72%), Gaps = 11/181 (6%)
 Frame = +1

Query  1    QILVASFLEIAVGQSADTARQFLQATSWKLEEALQLFYVGNDGGVAAPSSYS-PLENTAP  177
            Q +V+SFLEIAVGQ+ DTARQFLQAT W+LEEA+QLFYVGN+GG+A  S YS P EN  P
Sbjct  13   QNMVSSFLEIAVGQTVDTARQFLQATGWRLEEAIQLFYVGNEGGLATESVYSTPAENELP  72

Query  178  lpdpslssisgsikgsgdesekQGDRDEVRPPLPVIRDVLYDTAVIRG-LPAMGGSAHEA  354
            L + ++S +   +           D  +VRPPLPV RDVLYD++++ G +  +G S H  
Sbjct  73   LDESNMSELGKELMDRDVRI---NDGSDVRPPLPVRRDVLYDSSMLYGRVQRVGDSPHAT  129

Query  355  RSVVPFRNFEQEMKHPGVWETDKASNSA------DNLASLYRPPFALMYHGSFEKAKDAA  516
             SVVPFRNF++EMKHPGVWE +  S+S+      DNLASLYRPPFALM+ G FEKAKD A
Sbjct  130  HSVVPFRNFDEEMKHPGVWEIEAGSSSSVVDKTQDNLASLYRPPFALMFQGPFEKAKDNA  189

Query  517  R  519
            R
Sbjct  190  R  190



>gb|EYU30237.1| hypothetical protein MIMGU_mgv1a006061mg [Erythranthe guttata]
Length=459

 Score =   194 bits (492),  Expect = 7e-56, Method: Compositional matrix adjust.
 Identities = 105/181 (58%), Positives = 130/181 (72%), Gaps = 11/181 (6%)
 Frame = +1

Query  1    QILVASFLEIAVGQSADTARQFLQATSWKLEEALQLFYVGNDGGVAAPSSYS-PLENTAP  177
            Q +V+SFLEIAVGQ+ DTARQFLQAT W+LEEA+QLFYVGN+GG+A  S YS P EN  P
Sbjct  13   QNMVSSFLEIAVGQTVDTARQFLQATGWRLEEAIQLFYVGNEGGLATESVYSTPAENELP  72

Query  178  lpdpslssisgsikgsgdesekQGDRDEVRPPLPVIRDVLYDTAVIRG-LPAMGGSAHEA  354
            L + ++S +   +           D  +VRPPLPV RDVLYD++++ G +  +G S H  
Sbjct  73   LDESNMSELGKELMDRDVRI---NDGSDVRPPLPVRRDVLYDSSMLYGRVQRVGDSPHAT  129

Query  355  RSVVPFRNFEQEMKHPGVWETDKASNSA------DNLASLYRPPFALMYHGSFEKAKDAA  516
             SVVPFRNF++EMKHPGVWE +  S+S+      DNLASLYRPPFALM+ G FEKAKD A
Sbjct  130  HSVVPFRNFDEEMKHPGVWEIEAGSSSSVVDKTQDNLASLYRPPFALMFQGPFEKAKDNA  189

Query  517  R  519
            R
Sbjct  190  R  190



>gb|EYU30239.1| hypothetical protein MIMGU_mgv1a006061mg [Erythranthe guttata]
Length=458

 Score =   194 bits (492),  Expect = 7e-56, Method: Compositional matrix adjust.
 Identities = 105/181 (58%), Positives = 130/181 (72%), Gaps = 11/181 (6%)
 Frame = +1

Query  1    QILVASFLEIAVGQSADTARQFLQATSWKLEEALQLFYVGNDGGVAAPSSYS-PLENTAP  177
            Q +V+SFLEIAVGQ+ DTARQFLQAT W+LEEA+QLFYVGN+GG+A  S YS P EN  P
Sbjct  13   QNMVSSFLEIAVGQTVDTARQFLQATGWRLEEAIQLFYVGNEGGLATESVYSTPAENELP  72

Query  178  lpdpslssisgsikgsgdesekQGDRDEVRPPLPVIRDVLYDTAVIRG-LPAMGGSAHEA  354
            L + ++S +   +           D  +VRPPLPV RDVLYD++++ G +  +G S H  
Sbjct  73   LDESNMSELGKELMDRDVRI---NDGSDVRPPLPVRRDVLYDSSMLYGRVQRVGDSPHAT  129

Query  355  RSVVPFRNFEQEMKHPGVWETDKASNSA------DNLASLYRPPFALMYHGSFEKAKDAA  516
             SVVPFRNF++EMKHPGVWE +  S+S+      DNLASLYRPPFALM+ G FEKAKD A
Sbjct  130  HSVVPFRNFDEEMKHPGVWEIEAGSSSSVVDKTQDNLASLYRPPFALMFQGPFEKAKDNA  189

Query  517  R  519
            R
Sbjct  190  R  190



>ref|XP_010043889.1| PREDICTED: UBX domain-containing protein 2 isoform X2 [Eucalyptus 
grandis]
 gb|KCW85907.1| hypothetical protein EUGRSUZ_B02622 [Eucalyptus grandis]
Length=453

 Score =   192 bits (489),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 105/177 (59%), Positives = 128/177 (72%), Gaps = 8/177 (5%)
 Frame = +1

Query  1    QILVASFLEIAVGQSADTARQFLQATSWKLEEALQLFYVGNDGGVAAPSSYSPLENTAPl  180
            Q +++SFLEIAVGQ+ADTARQFLQATSWKLEEALQLFYVGN+GGV    S  P  +    
Sbjct  11   QSMISSFLEIAVGQTADTARQFLQATSWKLEEALQLFYVGNEGGVIGGQSNPPPVDGG-N  69

Query  181  pdpslssisgsikgsgdesekQGDRDEVRPPLPVIRDVLYDTAVIRGLPAMGGSAHEARS  360
               +  +   S   +G+E+  Q D DEVRPPLPV R+VLYD A+    PA+G  +HE+ S
Sbjct  70   AACADENAGVSRNDNGNENIGQHDEDEVRPPLPVRREVLYDDAI--SYPALGMGSHESSS  127

Query  361  VVPFRNFEQEMKHPGVWETDKAS-----NSADNLASLYRPPFALMYHGSFEKAKDAA  516
            ++ FRNF++EMK PGVWE+D+ S     N+ DNLASLYRPPF LMY GSFEKAK AA
Sbjct  128  LIAFRNFDEEMKRPGVWESDQGSTSTAENARDNLASLYRPPFHLMYRGSFEKAKTAA  184



>ref|XP_010043888.1| PREDICTED: UBX domain-containing protein 2 isoform X1 [Eucalyptus 
grandis]
Length=459

 Score =   192 bits (488),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 105/177 (59%), Positives = 128/177 (72%), Gaps = 8/177 (5%)
 Frame = +1

Query  1    QILVASFLEIAVGQSADTARQFLQATSWKLEEALQLFYVGNDGGVAAPSSYSPLENTAPl  180
            Q +++SFLEIAVGQ+ADTARQFLQATSWKLEEALQLFYVGN+GGV    S  P  +    
Sbjct  11   QSMISSFLEIAVGQTADTARQFLQATSWKLEEALQLFYVGNEGGVIGGQSNPPPVDGG-N  69

Query  181  pdpslssisgsikgsgdesekQGDRDEVRPPLPVIRDVLYDTAVIRGLPAMGGSAHEARS  360
               +  +   S   +G+E+  Q D DEVRPPLPV R+VLYD A+    PA+G  +HE+ S
Sbjct  70   AACADENAGVSRNDNGNENIGQHDEDEVRPPLPVRREVLYDDAI--SYPALGMGSHESSS  127

Query  361  VVPFRNFEQEMKHPGVWETDKAS-----NSADNLASLYRPPFALMYHGSFEKAKDAA  516
            ++ FRNF++EMK PGVWE+D+ S     N+ DNLASLYRPPF LMY GSFEKAK AA
Sbjct  128  LIAFRNFDEEMKRPGVWESDQGSTSTAENARDNLASLYRPPFHLMYRGSFEKAKTAA  184



>ref|XP_011025166.1| PREDICTED: UBX domain-containing protein 7-like [Populus euphratica]
Length=455

 Score =   192 bits (487),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 101/177 (57%), Positives = 123/177 (69%), Gaps = 11/177 (6%)
 Frame = +1

Query  1    QILVASFLEIAVGQSADTARQFLQATSWKLEEALQLFYVGNDGGVAAPSSYSPLENTAPl  180
            Q +V+SFLEIAVGQ+A+TARQFLQATSWKLE+A+QLFYVGN+GGV A +S+ P   T   
Sbjct  13   QSMVSSFLEIAVGQTAETARQFLQATSWKLEDAIQLFYVGNEGGVVASASHPPQTETRTD  72

Query  181  pdpslssisgsikgsgdesekQGDRDEVRPPLPVIRDVLYDTAVIRGLPAMGGSAHEARS  360
               S     G+              +EVR PLPV+RD LYD A++ G   MG   HEA S
Sbjct  73   VHESGLKDFGNENVGPSGG------EEVRAPLPVVRDTLYDDAMLYGASRMGHPPHEASS  126

Query  361  VVPFRNFEQEMKHPGVWETDKASNSA-----DNLASLYRPPFALMYHGSFEKAKDAA  516
            ++ FRNF++EMKH GVWE+D+ S S      DNLASLYRPPF LM+HGSFEKAKDA+
Sbjct  127  LIAFRNFDEEMKHSGVWESDQGSTSTIDNPRDNLASLYRPPFHLMFHGSFEKAKDAS  183



>ref|XP_008220984.1| PREDICTED: UBX domain-containing protein 2 isoform X2 [Prunus 
mume]
Length=454

 Score =   189 bits (479),  Expect = 4e-54, Method: Compositional matrix adjust.
 Identities = 103/177 (58%), Positives = 125/177 (71%), Gaps = 6/177 (3%)
 Frame = +1

Query  1    QILVASFLEIAVGQSADTARQFLQATSWKLEEALQLFYVGNDGGVAAPSSYSPLENTAPl  180
            Q LV SFLEIAVGQ+ADTARQFLQAT W+LEEA+QLFYVGN+ G  A ++  P EN   L
Sbjct  11   QRLVTSFLEIAVGQTADTARQFLQATGWQLEEAIQLFYVGNEAGSIA-AAQPPTENIDHL  69

Query  181  pdpslssisgsikgsgdesekQGDRDEVRPPLPVIRDVLYDTAVIRGLPAMGGSAHEARS  360
             D +  +    +    +E+  Q   DEVRPP+PVIRDVLYD A + G P    S HE+ S
Sbjct  70   ADQTSGANENVVHHGINENVGQLGEDEVRPPMPVIRDVLYDDAALYGSPRARFSQHESGS  129

Query  361  VVPFRNFEQEMKHPGVWETDKASNSA-----DNLASLYRPPFALMYHGSFEKAKDAA  516
            V+ FRNFE+EMKHPGVWE+ + + S+     DNLASLYRPPF L++ GSFEKAK AA
Sbjct  130  VIAFRNFEEEMKHPGVWESGQGATSSAETARDNLASLYRPPFKLLFQGSFEKAKGAA  186



>ref|XP_008220982.1| PREDICTED: UBX domain-containing protein 2 isoform X1 [Prunus 
mume]
Length=456

 Score =   188 bits (478),  Expect = 5e-54, Method: Compositional matrix adjust.
 Identities = 104/177 (59%), Positives = 123/177 (69%), Gaps = 6/177 (3%)
 Frame = +1

Query  1    QILVASFLEIAVGQSADTARQFLQATSWKLEEALQLFYVGNDGGVAAPSSYSPLENTAPl  180
            Q LV SFLEIAVGQ+ADTARQFLQAT W+LEEA+QLFYVGN+ G  A ++  P EN   L
Sbjct  11   QRLVTSFLEIAVGQTADTARQFLQATGWQLEEAIQLFYVGNEAGSIA-AAQPPTENIDHL  69

Query  181  pdpslssisgsikgsgdesekQGDRDEVRPPLPVIRDVLYDTAVIRGLPAMGGSAHEARS  360
             D +  +    +    +E+  Q   DEVRPP+PVIRDVLYD A + G P    S HE+ S
Sbjct  70   ADQTSGANENVVHHGINENVGQLGEDEVRPPMPVIRDVLYDDAALYGSPRARFSQHESGS  129

Query  361  VVPFRNFEQEMKHPGVWE-----TDKASNSADNLASLYRPPFALMYHGSFEKAKDAA  516
            V+ FRNFE+EMKHPGVWE     T  A  + DNLASLYRPPF L++ GSFEKAK AA
Sbjct  130  VIAFRNFEEEMKHPGVWESGQGATSSAETARDNLASLYRPPFKLLFQGSFEKAKGAA  186



>ref|XP_010270775.1| PREDICTED: UBX domain-containing protein 2 isoform X3 [Nelumbo 
nucifera]
Length=427

 Score =   187 bits (475),  Expect = 9e-54, Method: Compositional matrix adjust.
 Identities = 105/177 (59%), Positives = 126/177 (71%), Gaps = 8/177 (5%)
 Frame = +1

Query  1    QILVASFLEIAVGQSADTARQFLQATSWKLEEALQLFYVGNDGGVAAPSSYSPLENTAPl  180
            Q +V+SFLEIAVGQSADTARQFLQATSWKLEEA+QLFYVGN+GG  + S   P E+  P 
Sbjct  11   QSMVSSFLEIAVGQSADTARQFLQATSWKLEEAIQLFYVGNEGGGPSSSHSPPGEDVQP-  69

Query  181  pdpslssisgsikgsgdesekQGDRDEVRPPLPVIRDVLYDTAVIRGLPAMGGSAHEARS  360
                  S SG  K   +E+  Q D  EVRPPLPV R+ LYD A++     MG  +HE  S
Sbjct  70   --LPEESSSGQAKDIVNENVGQDDASEVRPPLPVKREALYDDAMLYRSSRMGYPSHETSS  127

Query  361  VVPFRNFEQEMKHPGVWETDKASNSA-----DNLASLYRPPFALMYHGSFEKAKDAA  516
            ++ FRNF++EMK PGVWE+D+++ S      DNLASLYRPPFALM+HG FEKAK AA
Sbjct  128  MIAFRNFDEEMKQPGVWESDQSAASTTDSPRDNLASLYRPPFALMHHGFFEKAKVAA  184



>ref|XP_010270773.1| PREDICTED: UBX domain-containing protein 2 isoform X1 [Nelumbo 
nucifera]
Length=450

 Score =   187 bits (475),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 105/177 (59%), Positives = 126/177 (71%), Gaps = 8/177 (5%)
 Frame = +1

Query  1    QILVASFLEIAVGQSADTARQFLQATSWKLEEALQLFYVGNDGGVAAPSSYSPLENTAPl  180
            Q +V+SFLEIAVGQSADTARQFLQATSWKLEEA+QLFYVGN+GG  + S   P E+  P 
Sbjct  11   QSMVSSFLEIAVGQSADTARQFLQATSWKLEEAIQLFYVGNEGGGPSSSHSPPGEDVQP-  69

Query  181  pdpslssisgsikgsgdesekQGDRDEVRPPLPVIRDVLYDTAVIRGLPAMGGSAHEARS  360
                  S SG  K   +E+  Q D  EVRPPLPV R+ LYD A++     MG  +HE  S
Sbjct  70   --LPEESSSGQAKDIVNENVGQDDASEVRPPLPVKREALYDDAMLYRSSRMGYPSHETSS  127

Query  361  VVPFRNFEQEMKHPGVWETDKASNSA-----DNLASLYRPPFALMYHGSFEKAKDAA  516
            ++ FRNF++EMK PGVWE+D+++ S      DNLASLYRPPFALM+HG FEKAK AA
Sbjct  128  MIAFRNFDEEMKQPGVWESDQSAASTTDSPRDNLASLYRPPFALMHHGFFEKAKVAA  184



>ref|XP_011021683.1| PREDICTED: UBX domain-containing protein 2-like [Populus euphratica]
Length=457

 Score =   187 bits (476),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 100/177 (56%), Positives = 121/177 (68%), Gaps = 11/177 (6%)
 Frame = +1

Query  1    QILVASFLEIAVGQSADTARQFLQATSWKLEEALQLFYVGNDGGVAAPSSYSPLENTAPl  180
            Q +V+SFLEIAVGQ+A+TARQFLQATSWKLE+A+QLFY+GN+GG    +S+     T P 
Sbjct  8    QSMVSSFLEIAVGQTAETARQFLQATSWKLEDAIQLFYLGNEGGAVESASHPLPAETWPE  67

Query  181  pdpslssisgsikgsgdesekQGDRDEVRPPLPVIRDVLYDTAVIRGLPAMGGSAHEARS  360
               S      + K          D DEVR PLPV+RD LYD A++ G    G    EA S
Sbjct  68   VLESGLKDLENEKVG------HSDGDEVRAPLPVVRDTLYDDAMLYGASRTGYPPREASS  121

Query  361  VVPFRNFEQEMKHPGVWETDKAS-----NSADNLASLYRPPFALMYHGSFEKAKDAA  516
            ++ FRNF++EMKHPGVWE+D+ S     NS DNLASLYRPPF LM+HGSFEKAK AA
Sbjct  122  LIAFRNFDEEMKHPGVWESDQGSTSTTDNSRDNLASLYRPPFHLMFHGSFEKAKGAA  178



>ref|XP_010270774.1| PREDICTED: UBX domain-containing protein 2 isoform X2 [Nelumbo 
nucifera]
Length=448

 Score =   187 bits (475),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 105/177 (59%), Positives = 126/177 (71%), Gaps = 8/177 (5%)
 Frame = +1

Query  1    QILVASFLEIAVGQSADTARQFLQATSWKLEEALQLFYVGNDGGVAAPSSYSPLENTAPl  180
            Q +V+SFLEIAVGQSADTARQFLQATSWKLEEA+QLFYVGN+GG  + S   P E+  P 
Sbjct  11   QSMVSSFLEIAVGQSADTARQFLQATSWKLEEAIQLFYVGNEGGGPSSSHSPPGEDVQP-  69

Query  181  pdpslssisgsikgsgdesekQGDRDEVRPPLPVIRDVLYDTAVIRGLPAMGGSAHEARS  360
                  S SG  K   +E+  Q D  EVRPPLPV R+ LYD A++     MG  +HE  S
Sbjct  70   --LPEESSSGQAKDIVNENVGQDDASEVRPPLPVKREALYDDAMLYRSSRMGYPSHETSS  127

Query  361  VVPFRNFEQEMKHPGVWETDKASNSA-----DNLASLYRPPFALMYHGSFEKAKDAA  516
            ++ FRNF++EMK PGVWE+D+++ S      DNLASLYRPPFALM+HG FEKAK AA
Sbjct  128  MIAFRNFDEEMKQPGVWESDQSAASTTDSPRDNLASLYRPPFALMHHGFFEKAKVAA  184



>ref|XP_009351644.1| PREDICTED: UBX domain-containing protein 2 isoform X3 [Pyrus 
x bretschneideri]
Length=452

 Score =   186 bits (472),  Expect = 4e-53, Method: Compositional matrix adjust.
 Identities = 100/177 (56%), Positives = 122/177 (69%), Gaps = 7/177 (4%)
 Frame = +1

Query  1    QILVASFLEIAVGQSADTARQFLQATSWKLEEALQLFYVGNDGGVAAPSSYSPLENTAPl  180
            Q LV+SFLEIAVGQ+ADTARQFLQAT WKLEEA+QLFYVGN+ G+   ++  P EN   L
Sbjct  11   QTLVSSFLEIAVGQTADTARQFLQATGWKLEEAIQLFYVGNEAGIMTEAAPLPTENIDQL  70

Query  181  pdpslssisgsikgsgdesekQGDRDEVRPPLPVIRDVLYDTAVIRGLPAMGGSAHEARS  360
             + +            +E+ +Q   DEVR P+PVIRDVLYD   + G P    S H   S
Sbjct  71   AEQASGVNENVALPGVNENVEQFADDEVRAPMPVIRDVLYDDMSLYGAPRARFSQH--GS  128

Query  361  VVPFRNFEQEMKHPGVWETDKASNSA-----DNLASLYRPPFALMYHGSFEKAKDAA  516
            V+ FRNFE+EMKHPGVWE+D+ + S+     DNLASLYRPPF L++ GSFEKAK AA
Sbjct  129  VIAFRNFEEEMKHPGVWESDQGATSSANAVQDNLASLYRPPFKLLFQGSFEKAKSAA  185



>ref|XP_009351643.1| PREDICTED: UBX domain-containing protein 2 isoform X2 [Pyrus 
x bretschneideri]
Length=454

 Score =   186 bits (472),  Expect = 5e-53, Method: Compositional matrix adjust.
 Identities = 100/177 (56%), Positives = 122/177 (69%), Gaps = 7/177 (4%)
 Frame = +1

Query  1    QILVASFLEIAVGQSADTARQFLQATSWKLEEALQLFYVGNDGGVAAPSSYSPLENTAPl  180
            Q LV+SFLEIAVGQ+ADTARQFLQAT WKLEEA+QLFYVGN+ G+   ++  P EN   L
Sbjct  11   QTLVSSFLEIAVGQTADTARQFLQATGWKLEEAIQLFYVGNEAGIMTEAAPLPTENIDQL  70

Query  181  pdpslssisgsikgsgdesekQGDRDEVRPPLPVIRDVLYDTAVIRGLPAMGGSAHEARS  360
             + +            +E+ +Q   DEVR P+PVIRDVLYD   + G P    S H   S
Sbjct  71   AEQASGVNENVALPGVNENVEQFADDEVRAPMPVIRDVLYDDMSLYGAPRARFSQH--GS  128

Query  361  VVPFRNFEQEMKHPGVWETDKASNSA-----DNLASLYRPPFALMYHGSFEKAKDAA  516
            V+ FRNFE+EMKHPGVWE+D+ + S+     DNLASLYRPPF L++ GSFEKAK AA
Sbjct  129  VIAFRNFEEEMKHPGVWESDQGATSSANAVQDNLASLYRPPFKLLFQGSFEKAKSAA  185



>ref|XP_009351642.1| PREDICTED: UBX domain-containing protein 2 isoform X1 [Pyrus 
x bretschneideri]
Length=457

 Score =   186 bits (472),  Expect = 5e-53, Method: Compositional matrix adjust.
 Identities = 100/177 (56%), Positives = 122/177 (69%), Gaps = 7/177 (4%)
 Frame = +1

Query  1    QILVASFLEIAVGQSADTARQFLQATSWKLEEALQLFYVGNDGGVAAPSSYSPLENTAPl  180
            Q LV+SFLEIAVGQ+ADTARQFLQAT WKLEEA+QLFYVGN+ G+   ++  P EN   L
Sbjct  11   QTLVSSFLEIAVGQTADTARQFLQATGWKLEEAIQLFYVGNEAGIMTEAAPLPTENIDQL  70

Query  181  pdpslssisgsikgsgdesekQGDRDEVRPPLPVIRDVLYDTAVIRGLPAMGGSAHEARS  360
             + +            +E+ +Q   DEVR P+PVIRDVLYD   + G P    S H   S
Sbjct  71   AEQASGVNENVALPGVNENVEQFADDEVRAPMPVIRDVLYDDMSLYGAPRARFSQH--GS  128

Query  361  VVPFRNFEQEMKHPGVWETDKASNSA-----DNLASLYRPPFALMYHGSFEKAKDAA  516
            V+ FRNFE+EMKHPGVWE+D+ + S+     DNLASLYRPPF L++ GSFEKAK AA
Sbjct  129  VIAFRNFEEEMKHPGVWESDQGATSSANAVQDNLASLYRPPFKLLFQGSFEKAKSAA  185



>gb|EPS73806.1| hypothetical protein M569_00949, partial [Genlisea aurea]
Length=451

 Score =   182 bits (461),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 106/183 (58%), Positives = 127/183 (69%), Gaps = 21/183 (11%)
 Frame = +1

Query  1    QILVASFLEIAVGQSADTARQFLQATSWKLEEALQLFYVGNDGGVAAPSSYS-PLENTAP  177
            Q +V SFLEIAVGQ+A+TARQFLQATSWKLEEA+QLFY+ N+GG AA SS+S P EN  P
Sbjct  12   QRMVTSFLEIAVGQTAETARQFLQATSWKLEEAIQLFYIENEGGSAAASSFSFPPENDPP  71

Query  178  lpdpslssisgsikgsgdesekQGDRD---EVRPPLPVIRDVLYDTAVIRGLPAMGGSAH  348
              D S S +              G  D   +VRPPLP  RDVLYD  +      M G+ +
Sbjct  72   FKDLSRSELDKDF----------GSHDGGEDVRPPLPAKRDVLYDGLLPHNGERM-GTPY  120

Query  349  EARSVVPFRNFEQEMKHPGVWETDKASNSA------DNLASLYRPPFALMYHGSFEKAKD  510
             A SVVPFRNF++EM+HPGVWE ++ S+S+      DNLASLYRPPFALM+HGSFEKAKD
Sbjct  121  GAPSVVPFRNFQEEMRHPGVWEPERGSSSSMPTKPQDNLASLYRPPFALMFHGSFEKAKD  180

Query  511  AAR  519
             A+
Sbjct  181  YAK  183



>ref|XP_002521873.1| UBX domain-containing protein, putative [Ricinus communis]
 gb|EEF40509.1| UBX domain-containing protein, putative [Ricinus communis]
Length=452

 Score =   180 bits (456),  Expect = 8e-51, Method: Compositional matrix adjust.
 Identities = 100/178 (56%), Positives = 118/178 (66%), Gaps = 18/178 (10%)
 Frame = +1

Query  1    QILVASFLEIAVGQSADTARQFLQATSWKLEEALQLFYVGNDGG-VAAPSSYSPLENTAP  177
            Q +VA FLEIA GQ+ADTA QFLQATSWKLEEALQLFYVGN+ G VA+ S   PLEN   
Sbjct  10   QSMVACFLEIAAGQTADTAIQFLQATSWKLEEALQLFYVGNETGQVASASQSPPLENAG-  68

Query  178  lpdpslssisgsikgsgdesekQGDRDEVRPPLPVIRDVLYDTAVIRGLPAMGGSAHEAR  357
                        +K + +E   Q   D+VRPPLPV+RD LYD A+       G   HE+ 
Sbjct  69   -----------GLKDNENEKIGQNSADDVRPPLPVVRDTLYDDAMFYRTSRTGYPPHESS  117

Query  358  SVVPFRNFEQEMKHPGVWETDKASNSA-----DNLASLYRPPFALMYHGSFEKAKDAA  516
            S+V FRNF++EMK PGVWE+D+ + S      DNLASLYRPP  LM+HGSFEKAK  A
Sbjct  118  SLVAFRNFDEEMKRPGVWESDQGATSTADTARDNLASLYRPPLHLMFHGSFEKAKGVA  175



>gb|AFK39103.1| unknown [Lotus japonicus]
Length=195

 Score =   173 bits (438),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 97/176 (55%), Positives = 124/176 (70%), Gaps = 9/176 (5%)
 Frame = +1

Query  1    QILVASFLEIAVGQSADTARQFLQATSWKLEEALQLFYVGND-GGVAAPSSYS-PLENTA  174
            Q +V+SFLE+A GQ+ADTARQFLQATSWKLEEALQLF +GN+ G V  PSS++ PLEN  
Sbjct  11   QSMVSSFLEVAQGQTADTARQFLQATSWKLEEALQLFLIGNEAGAVPPPSSHTPPLENA-  69

Query  175  PlpdpslssisgsikgsgdesekQGDRDEVRPPLPVIRDVLYDTAVIRGLPAMGGSAHEA  354
                    + S   K + +ES    D ++VRPPLPVIR+ LYD A++ G    G    E 
Sbjct  70   -DSWTDHQTSSEPRKDAANESSGHNDGEDVRPPLPVIRETLYDDAMLFGASRFGQRPQEP  128

Query  355  RSVVPFRNFEQEMKHPGVWETDKAS-----NSADNLASLYRPPFALMYHGSFEKAK  507
             ++V FRNFE+EM+ PGVWE+D+ +     +S DNLASLYRPPF LM++GSF+KAK
Sbjct  129  NALVAFRNFEEEMRRPGVWESDQGAASTPESSRDNLASLYRPPFHLMFNGSFDKAK  184



>gb|KDO53548.1| hypothetical protein CISIN_1g013325mg [Citrus sinensis]
Length=238

 Score =   174 bits (441),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 95/177 (54%), Positives = 116/177 (66%), Gaps = 16/177 (9%)
 Frame = +1

Query  1    QILVASFLEIAVGQSADTARQFLQATSWKLEEALQLFYVGNDGGVAAPSSYSPLENTAPl  180
            Q +V+SFLEIAVGQ+A+TA QFLQATSWKL+EA+QLFYVGN+ G  A +S SP E  A  
Sbjct  11   QSMVSSFLEIAVGQTAETAVQFLQATSWKLDEAIQLFYVGNESGAIASASRSPAEEIA--  68

Query  181  pdpslssisgsikgsgdesekQGDRDEVRPPLPVIRDVLYDTAVIRGLPAMGGSAHEARS  360
                              +  Q   DEVR PLPV+RD LYD A+           HE  S
Sbjct  69   ---------NPGPEENSVTAGQEIGDEVRAPLPVVRDTLYDDAMFYAGSGARYPLHEPSS  119

Query  361  VVPFRNFEQEMKHPGVWETDK-----ASNSADNLASLYRPPFALMYHGSFEKAKDAA  516
            ++ FRNF++EMK PGVWE+++     A +S DNLASLYRPPF LM++GSFEKAKDAA
Sbjct  120  LIAFRNFDEEMKRPGVWESEQGAASTADSSRDNLASLYRPPFHLMFNGSFEKAKDAA  176



>ref|XP_004509607.1| PREDICTED: UBX domain-containing protein 7-like [Cicer arietinum]
Length=460

 Score =   179 bits (453),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 102/179 (57%), Positives = 127/179 (71%), Gaps = 9/179 (5%)
 Frame = +1

Query  1    QILVASFLEIAVGQSADTARQFLQATSWKLEEALQLFYVGND-GGVAAPSSYSP-LENTA  174
            Q LV+SFLE+A GQ+ADTARQFLQATSWKLEEALQLF +G++ G V AP+S++P LEN  
Sbjct  11   QSLVSSFLEVAQGQTADTARQFLQATSWKLEEALQLFLIGSETGAVPAPASFTPPLENVD  70

Query  175  PlpdpslssisgsikgsgdesekQGDRDEVRPPLPVIRDVLYDTAVIRGLPAMGGSAHEA  354
               D SL S      G+       GD  EVRPP+PVIR+ LYD A++ G P +G  + E 
Sbjct  71   AWTDQSLLSEPRKDTGNQSGGVNDGD--EVRPPIPVIRETLYDDAMLYGGPRLGHLSQEP  128

Query  355  RSVVPFRNFEQEMKHPGVWETDK-----ASNSADNLASLYRPPFALMYHGSFEKAKDAA  516
             S++ FRNFEQE + PGVWE+++     A +S DNLASLYRPPF LM+ GSF+KAK AA
Sbjct  129  SSLIAFRNFEQETRRPGVWESEQGAASTAESSRDNLASLYRPPFHLMFTGSFDKAKSAA  187



>gb|KDO53547.1| hypothetical protein CISIN_1g013325mg [Citrus sinensis]
Length=320

 Score =   174 bits (441),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 95/177 (54%), Positives = 116/177 (66%), Gaps = 16/177 (9%)
 Frame = +1

Query  1    QILVASFLEIAVGQSADTARQFLQATSWKLEEALQLFYVGNDGGVAAPSSYSPLENTAPl  180
            Q +V+SFLEIAVGQ+A+TA QFLQATSWKL+EA+QLFYVGN+ G  A +S SP E  A  
Sbjct  11   QSMVSSFLEIAVGQTAETAVQFLQATSWKLDEAIQLFYVGNESGAIASASRSPAEEIA--  68

Query  181  pdpslssisgsikgsgdesekQGDRDEVRPPLPVIRDVLYDTAVIRGLPAMGGSAHEARS  360
                              +  Q   DEVR PLPV+RD LYD A+           HE  S
Sbjct  69   ---------NPGPEENSVTAGQEIGDEVRAPLPVVRDTLYDDAMFYAGSGARYPLHEPSS  119

Query  361  VVPFRNFEQEMKHPGVWETDK-----ASNSADNLASLYRPPFALMYHGSFEKAKDAA  516
            ++ FRNF++EMK PGVWE+++     A +S DNLASLYRPPF LM++GSFEKAKDAA
Sbjct  120  LIAFRNFDEEMKRPGVWESEQGAASTADSSRDNLASLYRPPFHLMFNGSFEKAKDAA  176



>ref|XP_010088526.1| UBX domain-containing protein 2 [Morus notabilis]
 gb|EXB36443.1| UBX domain-containing protein 2 [Morus notabilis]
Length=486

 Score =   177 bits (448),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 98/179 (55%), Positives = 121/179 (68%), Gaps = 8/179 (4%)
 Frame = +1

Query  1    QILVASFLEIAVGQSADTARQFLQATSWKLEEALQLFYVGNDGG-VAAPSSYSPLENTAP  177
            Q +V+SFLEIAVGQ+A+TARQFLQATSWKLE+A+QLFYVG +GG V  PSS+SP      
Sbjct  34   QSMVSSFLEIAVGQTAETARQFLQATSWKLEDAIQLFYVGGEGGAVVEPSSHSPPRENLD  93

Query  178  lpdpslssisgsikgsgdesekQGDRDEVRPPLPVIRDVLYDTAVIRGLPAM-GGSAHEA  354
                + +      +   +      D DEVR PLPVIR+ LYD   I+    M G  +HE+
Sbjct  94   AFAENAAREEAERENRNENLGLD-DVDEVRAPLPVIREALYDDPSIQAASRMLGYPSHES  152

Query  355  RSVVPFRNFEQEMKHPGVWETDK-----ASNSADNLASLYRPPFALMYHGSFEKAKDAA  516
             SV+ FRNF +E++ PGVWE+D+     A NS DNLASLYRPPF LM+HG FEKAKD A
Sbjct  153  NSVIAFRNFGEEIRRPGVWESDQGAASTADNSRDNLASLYRPPFHLMFHGPFEKAKDTA  211



>ref|XP_006420698.1| hypothetical protein CICLE_v10005240mg [Citrus clementina]
 gb|ESR33938.1| hypothetical protein CICLE_v10005240mg [Citrus clementina]
Length=361

 Score =   173 bits (439),  Expect = 4e-49, Method: Compositional matrix adjust.
 Identities = 95/177 (54%), Positives = 116/177 (66%), Gaps = 16/177 (9%)
 Frame = +1

Query  1    QILVASFLEIAVGQSADTARQFLQATSWKLEEALQLFYVGNDGGVAAPSSYSPLENTAPl  180
            Q +V+SFLEIAVGQ+A+TA QFLQATSWKL+EA+QLFYVGN+ G  A +S SP E  A  
Sbjct  11   QSMVSSFLEIAVGQTAETAVQFLQATSWKLDEAIQLFYVGNESGAIASASRSPAEEIA--  68

Query  181  pdpslssisgsikgsgdesekQGDRDEVRPPLPVIRDVLYDTAVIRGLPAMGGSAHEARS  360
                              +  Q   DEVR PLPV+RD LYD A+           HE  S
Sbjct  69   ---------NPGPEENSVTAGQEIGDEVRAPLPVVRDTLYDDAMFYAGSGARYPHHEPSS  119

Query  361  VVPFRNFEQEMKHPGVWETDK-----ASNSADNLASLYRPPFALMYHGSFEKAKDAA  516
            ++ FRNF++EMK PGVWE+++     A +S DNLASLYRPPF LM++GSFEKAKDAA
Sbjct  120  LIAFRNFDEEMKRPGVWESEQGAASTADSSRDNLASLYRPPFHLMFNGSFEKAKDAA  176



>gb|KDP38216.1| hypothetical protein JCGZ_04859 [Jatropha curcas]
Length=454

 Score =   176 bits (445),  Expect = 5e-49, Method: Compositional matrix adjust.
 Identities = 101/178 (57%), Positives = 122/178 (69%), Gaps = 10/178 (6%)
 Frame = +1

Query  1    QILVASFLEIAVGQSADTARQFLQATSWKLEEALQLFYVGNDGGVAAPSSYS-PLENTAP  177
            Q +V+SFLEIAVGQ+A+TARQFLQATSWKLEEALQLFYVGND G  A +S+S P EN  P
Sbjct  11   QNMVSSFLEIAVGQTAETARQFLQATSWKLEEALQLFYVGNDVGPVASASHSPPTENANP  70

Query  178  lpdpslssisgsikgsgdesekQGDRDEVRPPLPVIRDVLYDTAVIRGLPAMGGSAHEAR  357
                     +G +K   +++  Q   +EVR PLPV+RD LYD A+       G    E+ 
Sbjct  71   ----WADENAGGVKDDENKNVGQDGGEEVRAPLPVVRDTLYDDAMFYRAYRTGYPPQESG  126

Query  358  SVVPFRNFEQEMKHPGVWETDK-----ASNSADNLASLYRPPFALMYHGSFEKAKDAA  516
            S++ FRNFE+EMK PGVWE+D+     A N  DNLASLY PPF LM+ GSFEKAK AA
Sbjct  127  SLIAFRNFEEEMKRPGVWESDQGATSTAENPRDNLASLYSPPFRLMFQGSFEKAKGAA  184



>ref|XP_007045358.1| UBX domain-containing protein isoform 3 [Theobroma cacao]
 gb|EOY01190.1| UBX domain-containing protein isoform 3 [Theobroma cacao]
Length=451

 Score =   175 bits (443),  Expect = 8e-49, Method: Compositional matrix adjust.
 Identities = 95/178 (53%), Positives = 121/178 (68%), Gaps = 10/178 (6%)
 Frame = +1

Query  1    QILVASFLEIAVGQSADTARQFLQATSWKLEEALQLFYVGNDGGVAAPSSYSP-LENTAP  177
            Q +V+SFLEIAVGQ+A+TA QFLQATSWKL+EA+QLFYVGN+GGV A SS SP LEN   
Sbjct  11   QRMVSSFLEIAVGQTAETATQFLQATSWKLDEAIQLFYVGNEGGVVASSSESPALENVDS  70

Query  178  lpdpslssisgsikgsgdesekQGDRDEVRPPLPVIRDVLYDTAVIRGLPAMGGSAHEAR  357
                +   ++     +   +      D+VRPPLPV+R+ LYD  ++ G   +G    +  
Sbjct  71   WASQNSGELNEPANDNVGSTGG----DDVRPPLPVVRETLYDDGMLYGASRLGYPPQQLS  126

Query  358  SVVPFRNFEQEMKHPGVWETDKASNSA-----DNLASLYRPPFALMYHGSFEKAKDAA  516
            S V FRNF++EMK PGVWE+D+ ++S      DNLASLYRPPF LM+ G FEKAK AA
Sbjct  127  SSVAFRNFDEEMKRPGVWESDEGASSTVDAPRDNLASLYRPPFHLMFQGPFEKAKAAA  184



>ref|XP_007045357.1| UBX domain-containing protein isoform 2 [Theobroma cacao]
 gb|EOY01189.1| UBX domain-containing protein isoform 2 [Theobroma cacao]
Length=454

 Score =   175 bits (443),  Expect = 8e-49, Method: Compositional matrix adjust.
 Identities = 95/178 (53%), Positives = 121/178 (68%), Gaps = 10/178 (6%)
 Frame = +1

Query  1    QILVASFLEIAVGQSADTARQFLQATSWKLEEALQLFYVGNDGGVAAPSSYSP-LENTAP  177
            Q +V+SFLEIAVGQ+A+TA QFLQATSWKL+EA+QLFYVGN+GGV A SS SP LEN   
Sbjct  11   QRMVSSFLEIAVGQTAETATQFLQATSWKLDEAIQLFYVGNEGGVVASSSESPALENVDS  70

Query  178  lpdpslssisgsikgsgdesekQGDRDEVRPPLPVIRDVLYDTAVIRGLPAMGGSAHEAR  357
                +   ++     +   +      D+VRPPLPV+R+ LYD  ++ G   +G    +  
Sbjct  71   WASQNSGELNEPANDNVGSTGG----DDVRPPLPVVRETLYDDGMLYGASRLGYPPQQLS  126

Query  358  SVVPFRNFEQEMKHPGVWETDKASNSA-----DNLASLYRPPFALMYHGSFEKAKDAA  516
            S V FRNF++EMK PGVWE+D+ ++S      DNLASLYRPPF LM+ G FEKAK AA
Sbjct  127  SSVAFRNFDEEMKRPGVWESDEGASSTVDAPRDNLASLYRPPFHLMFQGPFEKAKAAA  184



>ref|XP_007045356.1| UBX domain-containing protein isoform 1 [Theobroma cacao]
 gb|EOY01188.1| UBX domain-containing protein isoform 1 [Theobroma cacao]
Length=479

 Score =   175 bits (444),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 95/178 (53%), Positives = 121/178 (68%), Gaps = 10/178 (6%)
 Frame = +1

Query  1    QILVASFLEIAVGQSADTARQFLQATSWKLEEALQLFYVGNDGGVAAPSSYSP-LENTAP  177
            Q +V+SFLEIAVGQ+A+TA QFLQATSWKL+EA+QLFYVGN+GGV A SS SP LEN   
Sbjct  36   QRMVSSFLEIAVGQTAETATQFLQATSWKLDEAIQLFYVGNEGGVVASSSESPALENVDS  95

Query  178  lpdpslssisgsikgsgdesekQGDRDEVRPPLPVIRDVLYDTAVIRGLPAMGGSAHEAR  357
                +   ++     +   +      D+VRPPLPV+R+ LYD  ++ G   +G    +  
Sbjct  96   WASQNSGELNEPANDNVGSTGG----DDVRPPLPVVRETLYDDGMLYGASRLGYPPQQLS  151

Query  358  SVVPFRNFEQEMKHPGVWETDKASNSA-----DNLASLYRPPFALMYHGSFEKAKDAA  516
            S V FRNF++EMK PGVWE+D+ ++S      DNLASLYRPPF LM+ G FEKAK AA
Sbjct  152  SSVAFRNFDEEMKRPGVWESDEGASSTVDAPRDNLASLYRPPFHLMFQGPFEKAKAAA  209



>gb|KDO53543.1| hypothetical protein CISIN_1g013325mg [Citrus sinensis]
Length=444

 Score =   174 bits (440),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 95/177 (54%), Positives = 116/177 (66%), Gaps = 16/177 (9%)
 Frame = +1

Query  1    QILVASFLEIAVGQSADTARQFLQATSWKLEEALQLFYVGNDGGVAAPSSYSPLENTAPl  180
            Q +V+SFLEIAVGQ+A+TA QFLQATSWKL+EA+QLFYVGN+ G  A +S SP E  A  
Sbjct  11   QSMVSSFLEIAVGQTAETAVQFLQATSWKLDEAIQLFYVGNESGAIASASRSPAEEIA--  68

Query  181  pdpslssisgsikgsgdesekQGDRDEVRPPLPVIRDVLYDTAVIRGLPAMGGSAHEARS  360
                              +  Q   DEVR PLPV+RD LYD A+           HE  S
Sbjct  69   ---------NPGPEENSVTAGQEIGDEVRAPLPVVRDTLYDDAMFYAGSGARYPLHEPSS  119

Query  361  VVPFRNFEQEMKHPGVWETDK-----ASNSADNLASLYRPPFALMYHGSFEKAKDAA  516
            ++ FRNF++EMK PGVWE+++     A +S DNLASLYRPPF LM++GSFEKAKDAA
Sbjct  120  LIAFRNFDEEMKRPGVWESEQGAASTADSSRDNLASLYRPPFHLMFNGSFEKAKDAA  176



>ref|XP_006470883.1| PREDICTED: UBX domain-containing protein 2-like [Citrus sinensis]
Length=444

 Score =   174 bits (440),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 95/177 (54%), Positives = 116/177 (66%), Gaps = 16/177 (9%)
 Frame = +1

Query  1    QILVASFLEIAVGQSADTARQFLQATSWKLEEALQLFYVGNDGGVAAPSSYSPLENTAPl  180
            Q +V+SFLEIAVGQ+A+TA QFLQATSWKL+EA+QLFYVGN+ G  A +S SP E  A  
Sbjct  11   QSMVSSFLEIAVGQTAETAVQFLQATSWKLDEAIQLFYVGNESGAIASASRSPAEEIA--  68

Query  181  pdpslssisgsikgsgdesekQGDRDEVRPPLPVIRDVLYDTAVIRGLPAMGGSAHEARS  360
                              +  Q   DEVR PLPV+RD LYD A+           HE  S
Sbjct  69   ---------NPGPEENSVTAGQEIGDEVRAPLPVVRDTLYDDAMFYAGSGARYPLHEPSS  119

Query  361  VVPFRNFEQEMKHPGVWETDK-----ASNSADNLASLYRPPFALMYHGSFEKAKDAA  516
            ++ FRNF++EMK PGVWE+++     A +S DNLASLYRPPF LM++GSFEKAKDAA
Sbjct  120  LIAFRNFDEEMKRPGVWESEQGAASTADSSRDNLASLYRPPFHLMFNGSFEKAKDAA  176



>gb|KDO53544.1| hypothetical protein CISIN_1g013325mg [Citrus sinensis]
Length=445

 Score =   174 bits (440),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 95/177 (54%), Positives = 116/177 (66%), Gaps = 16/177 (9%)
 Frame = +1

Query  1    QILVASFLEIAVGQSADTARQFLQATSWKLEEALQLFYVGNDGGVAAPSSYSPLENTAPl  180
            Q +V+SFLEIAVGQ+A+TA QFLQATSWKL+EA+QLFYVGN+ G  A +S SP E  A  
Sbjct  11   QSMVSSFLEIAVGQTAETAVQFLQATSWKLDEAIQLFYVGNESGAIASASRSPAEEIA--  68

Query  181  pdpslssisgsikgsgdesekQGDRDEVRPPLPVIRDVLYDTAVIRGLPAMGGSAHEARS  360
                              +  Q   DEVR PLPV+RD LYD A+           HE  S
Sbjct  69   ---------NPGPEENSVTAGQEIGDEVRAPLPVVRDTLYDDAMFYAGSGARYPLHEPSS  119

Query  361  VVPFRNFEQEMKHPGVWETDK-----ASNSADNLASLYRPPFALMYHGSFEKAKDAA  516
            ++ FRNF++EMK PGVWE+++     A +S DNLASLYRPPF LM++GSFEKAKDAA
Sbjct  120  LIAFRNFDEEMKRPGVWESEQGAASTADSSRDNLASLYRPPFHLMFNGSFEKAKDAA  176



>gb|KJB30688.1| hypothetical protein B456_005G158000 [Gossypium raimondii]
Length=408

 Score =   173 bits (438),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 95/178 (53%), Positives = 121/178 (68%), Gaps = 10/178 (6%)
 Frame = +1

Query  1    QILVASFLEIAVGQSADTARQFLQATSWKLEEALQLFYVGNDGGVAAPSSYSP-LENTAP  177
            Q +V+SFLEIAVGQ+A+TA QFLQATSWKL+EALQLFYVGN+GGV   +S SP +EN   
Sbjct  11   QSMVSSFLEIAVGQTAETAMQFLQATSWKLDEALQLFYVGNEGGVVGTASESPAVENVDS  70

Query  178  lpdpslssisgsikgsgdesekQGDRDEVRPPLPVIRDVLYDTAVIRGLPAMGGSAHEAR  357
              D +   +  S          +    EVRPPLPV+R+ LYD A + G   +G    ++ 
Sbjct  71   WVDQNSGELKESGNSDVGPIGGE----EVRPPLPVVRETLYDDASLYGASRLGLPPQQSS  126

Query  358  SVVPFRNFEQEMKHPGVWETDKASNSA-----DNLASLYRPPFALMYHGSFEKAKDAA  516
            S++ FRNF++EMK PGVWE+D+ ++S      DNLASLYRPPF LM+ G FEKAK AA
Sbjct  127  SLIAFRNFDEEMKRPGVWESDEGASSTVDAPRDNLASLYRPPFHLMFQGPFEKAKAAA  184



>gb|KJB30689.1| hypothetical protein B456_005G158000 [Gossypium raimondii]
Length=430

 Score =   172 bits (437),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 95/178 (53%), Positives = 121/178 (68%), Gaps = 10/178 (6%)
 Frame = +1

Query  1    QILVASFLEIAVGQSADTARQFLQATSWKLEEALQLFYVGNDGGVAAPSSYSP-LENTAP  177
            Q +V+SFLEIAVGQ+A+TA QFLQATSWKL+EALQLFYVGN+GGV   +S SP +EN   
Sbjct  11   QSMVSSFLEIAVGQTAETAMQFLQATSWKLDEALQLFYVGNEGGVVGTASESPAVENVDS  70

Query  178  lpdpslssisgsikgsgdesekQGDRDEVRPPLPVIRDVLYDTAVIRGLPAMGGSAHEAR  357
              D +   +  S          +    EVRPPLPV+R+ LYD A + G   +G    ++ 
Sbjct  71   WVDQNSGELKESGNSDVGPIGGE----EVRPPLPVVRETLYDDASLYGASRLGLPPQQSS  126

Query  358  SVVPFRNFEQEMKHPGVWETDKASNSA-----DNLASLYRPPFALMYHGSFEKAKDAA  516
            S++ FRNF++EMK PGVWE+D+ ++S      DNLASLYRPPF LM+ G FEKAK AA
Sbjct  127  SLIAFRNFDEEMKRPGVWESDEGASSTVDAPRDNLASLYRPPFHLMFQGPFEKAKAAA  184



>gb|KHG06883.1| UBX domain-containing 7 [Gossypium arboreum]
Length=453

 Score =   173 bits (438),  Expect = 4e-48, Method: Compositional matrix adjust.
 Identities = 95/178 (53%), Positives = 121/178 (68%), Gaps = 10/178 (6%)
 Frame = +1

Query  1    QILVASFLEIAVGQSADTARQFLQATSWKLEEALQLFYVGNDGGVAAPSSYSP-LENTAP  177
            Q +V+SFLEIAVGQ+A+TA QFLQATSWKL+EALQLFYVGN+GGV   +S SP +EN   
Sbjct  11   QSMVSSFLEIAVGQTAETAMQFLQATSWKLDEALQLFYVGNEGGVVGTASESPAVENVDS  70

Query  178  lpdpslssisgsikgsgdesekQGDRDEVRPPLPVIRDVLYDTAVIRGLPAMGGSAHEAR  357
              D +   +  S          +    EVRPPLPV+R+ LYD A + G   +G    ++ 
Sbjct  71   WVDQNSGELKESGNSDVGPIGGE----EVRPPLPVVRETLYDDASLYGASRLGLPPQQSS  126

Query  358  SVVPFRNFEQEMKHPGVWETDKASNSA-----DNLASLYRPPFALMYHGSFEKAKDAA  516
            S++ FRNF++EMK PGVWE+D+ ++S      DNLASLYRPPF LM+ G FEKAK AA
Sbjct  127  SLIAFRNFDEEMKRPGVWESDEGASSTVDAPRDNLASLYRPPFHLMFQGPFEKAKAAA  184



>gb|KJB30687.1| hypothetical protein B456_005G158000 [Gossypium raimondii]
 gb|KJB30691.1| hypothetical protein B456_005G158000 [Gossypium raimondii]
Length=453

 Score =   173 bits (438),  Expect = 4e-48, Method: Compositional matrix adjust.
 Identities = 95/178 (53%), Positives = 121/178 (68%), Gaps = 10/178 (6%)
 Frame = +1

Query  1    QILVASFLEIAVGQSADTARQFLQATSWKLEEALQLFYVGNDGGVAAPSSYSP-LENTAP  177
            Q +V+SFLEIAVGQ+A+TA QFLQATSWKL+EALQLFYVGN+GGV   +S SP +EN   
Sbjct  11   QSMVSSFLEIAVGQTAETAMQFLQATSWKLDEALQLFYVGNEGGVVGTASESPAVENVDS  70

Query  178  lpdpslssisgsikgsgdesekQGDRDEVRPPLPVIRDVLYDTAVIRGLPAMGGSAHEAR  357
              D +   +  S          +    EVRPPLPV+R+ LYD A + G   +G    ++ 
Sbjct  71   WVDQNSGELKESGNSDVGPIGGE----EVRPPLPVVRETLYDDASLYGASRLGLPPQQSS  126

Query  358  SVVPFRNFEQEMKHPGVWETDKASNSA-----DNLASLYRPPFALMYHGSFEKAKDAA  516
            S++ FRNF++EMK PGVWE+D+ ++S      DNLASLYRPPF LM+ G FEKAK AA
Sbjct  127  SLIAFRNFDEEMKRPGVWESDEGASSTVDAPRDNLASLYRPPFHLMFQGPFEKAKAAA  184



>gb|KJB30690.1| hypothetical protein B456_005G158000 [Gossypium raimondii]
Length=450

 Score =   172 bits (437),  Expect = 5e-48, Method: Compositional matrix adjust.
 Identities = 95/178 (53%), Positives = 121/178 (68%), Gaps = 10/178 (6%)
 Frame = +1

Query  1    QILVASFLEIAVGQSADTARQFLQATSWKLEEALQLFYVGNDGGVAAPSSYSP-LENTAP  177
            Q +V+SFLEIAVGQ+A+TA QFLQATSWKL+EALQLFYVGN+GGV   +S SP +EN   
Sbjct  11   QSMVSSFLEIAVGQTAETAMQFLQATSWKLDEALQLFYVGNEGGVVGTASESPAVENVDS  70

Query  178  lpdpslssisgsikgsgdesekQGDRDEVRPPLPVIRDVLYDTAVIRGLPAMGGSAHEAR  357
              D +   +  S          +    EVRPPLPV+R+ LYD A + G   +G    ++ 
Sbjct  71   WVDQNSGELKESGNSDVGPIGGE----EVRPPLPVVRETLYDDASLYGASRLGLPPQQSS  126

Query  358  SVVPFRNFEQEMKHPGVWETDKASNSA-----DNLASLYRPPFALMYHGSFEKAKDAA  516
            S++ FRNF++EMK PGVWE+D+ ++S      DNLASLYRPPF LM+ G FEKAK AA
Sbjct  127  SLIAFRNFDEEMKRPGVWESDEGASSTVDAPRDNLASLYRPPFHLMFQGPFEKAKAAA  184



>ref|XP_010680042.1| PREDICTED: UBX domain-containing protein 2 [Beta vulgaris subsp. 
vulgaris]
Length=454

 Score =   171 bits (434),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 96/171 (56%), Positives = 116/171 (68%), Gaps = 9/171 (5%)
 Frame = +1

Query  1    QILVASFLEIAVGQSADTARQFLQATSWKLEEALQLFYVGNDGGVAAPSSY-SPLENTAP  177
            Q +V SFLEIAVGQ+ DTA QFLQAT WKLEEA+QLFYVG++GG  A SSY  P+EN  P
Sbjct  11   QSMVTSFLEIAVGQTVDTAHQFLQATGWKLEEAIQLFYVGHEGGEMASSSYFPPVENATP  70

Query  178  lpdpslssisgsikgsgdesekQGDRDEVRPPLPVIRDVLYDTAVIRGLPAMGGSAHEAR  357
            L D S S     I     E       D+VRPPLPVIR+ LYD  ++ G   +G  +H   
Sbjct  71   LADKSSSGSDEGIAKELSEL---NGGDDVRPPLPVIREALYDDTMLYGATRVGYPSHGPS  127

Query  358  SVVPFRNFEQEMKHPGVWETDKASNSA-----DNLASLYRPPFALMYHGSF  495
            SVV FRNFE+EMKHP VWE+++  +S      DNLA+LYRPPFA+M+ GSF
Sbjct  128  SVVAFRNFEEEMKHPAVWESEQGGSSTTESSRDNLAALYRPPFAIMHQGSF  178



>ref|XP_003547850.1| PREDICTED: UBX domain-containing protein 7-like isoform 1 [Glycine 
max]
 gb|KHN44547.1| UBX domain-containing protein 7 [Glycine soja]
Length=467

 Score =   171 bits (433),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 96/184 (52%), Positives = 120/184 (65%), Gaps = 12/184 (7%)
 Frame = +1

Query  1    QILVASFLEIAVGQSADTARQFLQATSWKLEEALQLFYVGNDGGVAAPSSYSPL------  162
            Q +V+SFLE+A GQ+A+TARQFLQATSWKLEEALQLF +G++GG        P       
Sbjct  11   QSMVSSFLEVAQGQTAETARQFLQATSWKLEEALQLFLIGSEGGAVPLPVPPPPLLHTPP  70

Query  163  -ENTAPlpdpslssisgsikgsgdesekQGDRDEVRPPLPVIRDVLYDTAVIRGLPAMGG  339
             EN     D    S       +  ES    D +EVRPPLPVIR+ LYD A++ G    G 
Sbjct  71   LENVDSWTDQQPLSEPRKDAAAASESIGLNDAEEVRPPLPVIRETLYDDAMLYGASRAGH  130

Query  340  SAHEARSVVPFRNFEQEMKHPGVWETDK-----ASNSADNLASLYRPPFALMYHGSFEKA  504
             +HE  S+V FRNFE+EM+ PGVWE+++     A  S DNLASLYRPPF LM++G+F+KA
Sbjct  131  RSHEPSSLVAFRNFEEEMRQPGVWESEQGAASTAEASRDNLASLYRPPFHLMFNGAFDKA  190

Query  505  KDAA  516
            KDAA
Sbjct  191  KDAA  194



>ref|XP_008456878.1| PREDICTED: UBX domain-containing protein 2 [Cucumis melo]
 ref|XP_008456880.1| PREDICTED: UBX domain-containing protein 2 [Cucumis melo]
 ref|XP_008456881.1| PREDICTED: UBX domain-containing protein 2 [Cucumis melo]
Length=450

 Score =   166 bits (420),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 94/177 (53%), Positives = 114/177 (64%), Gaps = 6/177 (3%)
 Frame = +1

Query  1    QILVASFLEIAVGQSADTARQFLQATSWKLEEALQLFYVGNDGGVAAPSSYSPLENTAPl  180
            Q +V+SFLEIAVGQ+A+TARQFLQATSWKLE+A+QLFYVGN+ GVA P S      T   
Sbjct  11   QSMVSSFLEIAVGQTAETARQFLQATSWKLEDAIQLFYVGNEAGVAGPPSVPSPPRTNEQ  70

Query  181  pdpslssisgsikgsgdesekQGDRDEVRPPLPVIRDVLYDTAVIRGLPAMGGSAHEARS  360
             + S    S                DEVRPPLPVIR+ LYD A++ G   MG   +E+ S
Sbjct  71   INSSTDHTSNVSGKHAGPGTFGQYEDEVRPPLPVIREALYDDAMLYGT-TMGYLPNESGS  129

Query  361  VVPFRNFEQEMKHPGVWET-----DKASNSADNLASLYRPPFALMYHGSFEKAKDAA  516
             + FRN + E+KH  VWE+       + NS DNLASLYRPP+ LM+ GSFEKAK AA
Sbjct  130  SIGFRNLQNEVKHHDVWESGDGAASTSGNSRDNLASLYRPPYHLMFTGSFEKAKGAA  186



>ref|XP_007156392.1| hypothetical protein PHAVU_003G282600g [Phaseolus vulgaris]
 gb|ESW28386.1| hypothetical protein PHAVU_003G282600g [Phaseolus vulgaris]
Length=461

 Score =   165 bits (417),  Expect = 5e-45, Method: Compositional matrix adjust.
 Identities = 89/177 (50%), Positives = 115/177 (65%), Gaps = 5/177 (3%)
 Frame = +1

Query  1    QILVASFLEIAVGQSADTARQFLQATSWKLEEALQLFYVGNDGGVAAPSSYSPLENTAPl  180
            Q +V+SFLE+A GQ+A+TARQFLQATSWKLEEALQLF +G++ G   P +          
Sbjct  11   QSMVSSFLEVAQGQTAETARQFLQATSWKLEEALQLFLIGSESGAVPPPTLHTPPLENVD  70

Query  181  pdpslssisgsikgsgdesekQGDRDEVRPPLPVIRDVLYDTAVIRGLPAMGGSAHEARS  360
                          +  ES    + DEVRPPLPVIR+ LYD A++ G   +G  + E  +
Sbjct  71   SWTDQPPSEPRKDATASESVGLNEADEVRPPLPVIRETLYDDAMLYGASRVGHRSQEPST  130

Query  361  VVPFRNFEQEMKHPGVWETDK-----ASNSADNLASLYRPPFALMYHGSFEKAKDAA  516
            +V FRNFE+EM++PGVWE ++     A  S DNLASLYRPPF LM++G F+KAKDAA
Sbjct  131  LVAFRNFEEEMRNPGVWEPEQGAASTAETSRDNLASLYRPPFHLMFNGPFDKAKDAA  187



>ref|XP_003628976.1| UBX domain-containing protein [Medicago truncatula]
 ref|XP_003636613.1| UBX domain-containing protein [Medicago truncatula]
 gb|AET03452.1| structural constituent of ribosome protein, putative [Medicago 
truncatula]
Length=461

 Score =   165 bits (417),  Expect = 6e-45, Method: Compositional matrix adjust.
 Identities = 96/181 (53%), Positives = 120/181 (66%), Gaps = 11/181 (6%)
 Frame = +1

Query  1    QILVASFLEIAVGQSADTARQFLQATSWKLEEALQLFYVGNDGG---VAAPSSYS-PLEN  168
            Q LV SFLE+A GQ+A TARQFLQATSWKLEEALQLF +G++ G   V AP+S++ PLEN
Sbjct  11   QTLVTSFLEVAQGQTAATARQFLQATSWKLEEALQLFLIGSETGAVPVPAPASFTPPLEN  70

Query  169  TAPlpdpslssisgsikgsgdesekQGDRDEVRPPLPVIRDVLYDTAVIRGLPAMGGSAH  348
                 D S  S + +   +      +G  DEVR PLPVIR+ LYD  ++ G   +G    
Sbjct  71   ADGWIDQSHLSETRTDTANQSGVVNEG--DEVRAPLPVIRETLYDNVLLYGGSRLGHLPQ  128

Query  349  EARSVVPFRNFEQEMKHPGVWETDK-----ASNSADNLASLYRPPFALMYHGSFEKAKDA  513
            E  S++ FRNFEQE + PGVWE ++     A +S D LASLYRPPF LM+ GSF+KAK A
Sbjct  129  EPNSLIAFRNFEQETRRPGVWEPEQGAASTAESSQDTLASLYRPPFHLMFTGSFDKAKSA  188

Query  514  A  516
            A
Sbjct  189  A  189



>ref|XP_003531952.1| PREDICTED: UBX domain-containing protein 7-like isoform 1 [Glycine 
max]
Length=468

 Score =   164 bits (416),  Expect = 6e-45, Method: Compositional matrix adjust.
 Identities = 93/185 (50%), Positives = 116/185 (63%), Gaps = 13/185 (7%)
 Frame = +1

Query  1    QILVASFLEIAVGQSADTARQFLQATSWKLEEALQLFYVGNDGGVAAPSSYSPL------  162
            Q +V+SFLE+A GQ+A+TARQFLQATSWKLEEALQLF +G++GG        P       
Sbjct  11   QSMVSSFLEVAQGQTAETARQFLQATSWKLEEALQLFLIGSEGGAVPLPVPPPPLLHTPP  70

Query  163  -ENTAPlpdpslssisgsikgsgdesekQ-GDRDEVRPPLPVIRDVLYDTAVIRGLPAMG  336
             EN     D    S       +         D +EVRPPLPVIR+ LYD A++ G     
Sbjct  71   LENVDSWTDQQPLSEPRKDAAAAASESIDLNDAEEVRPPLPVIRETLYDDAMLYGASRAS  130

Query  337  GSAHEARSVVPFRNFEQEMKHPGVWETDK-----ASNSADNLASLYRPPFALMYHGSFEK  501
              +HE  S+V FRNFE+EM+ PGVWE+++     A  S DNLASLYRPPF LM++G F+K
Sbjct  131  HRSHEPSSLVAFRNFEEEMRQPGVWESEQGAASTAETSRDNLASLYRPPFHLMFNGPFDK  190

Query  502  AKDAA  516
            AKDAA
Sbjct  191  AKDAA  195



>ref|XP_010554359.1| PREDICTED: UBX domain-containing protein 2-like [Tarenaya hassleriana]
Length=463

 Score =   160 bits (405),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 92/183 (50%), Positives = 119/183 (65%), Gaps = 14/183 (8%)
 Frame = +1

Query  1    QILVASFLEIAVGQSADTARQFLQATSWKLEEALQLFYVGNDGGVAAPSSYSPLENTAPl  180
            Q LV+SFLEIAVGQ+A+TARQFLQATSWKL+EA+QLFYVG++GG+   +++S  E+    
Sbjct  11   QRLVSSFLEIAVGQTAETARQFLQATSWKLDEAIQLFYVGSEGGMLPSATHSQPESN---  67

Query  181  pdpslssisgsikgsgdesekQGDRDEVRPPLPVIRDVLYDTAVIRGLPAMGGSAHEARS  360
                     G      +E+  Q + DEVRPPLPV+R+ LY   +  G    G S HE   
Sbjct  68   EHVVTDQSRGGASNPVNENLTQNEADEVRPPLPVVRETLYGEPMYYGAVRAGNSRHEPNP  127

Query  361  VVPFRNFEQEMKHPGVWETDKASNSA-----------DNLASLYRPPFALMYHGSFEKAK  507
            +V FR+F +E K PGVWE D+ ++SA           D+LASLYRPPF LM+ GSFE+AK
Sbjct  128  LVAFRDFSEEAKRPGVWEPDQGASSASASGSEVAAPRDSLASLYRPPFHLMFSGSFEQAK  187

Query  508  DAA  516
             AA
Sbjct  188  SAA  190



>ref|XP_010476513.1| PREDICTED: UBX domain-containing protein 2-like [Camelina sativa]
Length=464

 Score =   159 bits (401),  Expect = 9e-43, Method: Compositional matrix adjust.
 Identities = 92/181 (51%), Positives = 120/181 (66%), Gaps = 16/181 (9%)
 Frame = +1

Query  1    QILVASFLEIAVGQSADTARQFLQATSWKLEEALQLFYVGNDGGVAAPSSYSPLENTAPl  180
            Q LV+SFLEIAVGQ+A+TARQFLQATSWKL+EA+QLFY+GN+GG+    +++  E+  P 
Sbjct  11   QRLVSSFLEIAVGQTAETARQFLQATSWKLDEAIQLFYIGNEGGMLPSGTHTLPESNDP-  69

Query  181  pdpslssisgsikgsgdesekQGDRDEVRPPLPVIRDVLYDTAVIRGLPAMGGSAHEARS  360
                 S   G+   +G++   Q D DEVR PLPV+R+ LY  +V  G   +G S  E  S
Sbjct  70   ---MASQSWGATTDTGNQRMVQNDVDEVRAPLPVVRETLYGESVYYGAMRVGNSQPEPAS  126

Query  361  VVPFRNFEQEMKHPGVWETDKASNSA------------DNLASLYRPPFALMYHGSFEKA  504
            ++ FRNF +E K PGVWE D+ ++SA            D+LASLYRPPF LM+ GSFE A
Sbjct  127  LIAFRNFSEEPKSPGVWEPDEGASSASASASESASAPRDSLASLYRPPFHLMFQGSFEMA  186

Query  505  K  507
            K
Sbjct  187  K  187



>ref|XP_010527851.1| PREDICTED: UBX domain-containing protein 2 isoform X1 [Tarenaya 
hassleriana]
Length=459

 Score =   158 bits (400),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 95/184 (52%), Positives = 114/184 (62%), Gaps = 19/184 (10%)
 Frame = +1

Query  1    QILVASFLEIAVGQSADTARQFLQATSWKLEEALQLFYVGNDGGVAAPSSYSPLENTAPl  180
            Q LV+SFLEIAVGQ+ADTARQFLQATSWKLEEA+QLFYVG++GG+  PS    + N    
Sbjct  11   QRLVSSFLEIAVGQTADTARQFLQATSWKLEEAIQLFYVGSEGGM-LPSQPQSIANPV--  67

Query  181  pdpslssisgsikgsgdesekQGD-RDEVRPPLPVIRDVLYDTAVIRGLPAMGGSAHEAR  357
                            DE+  Q D  DEVRPPLPV+R+ LY  ++  G    G S  E+ 
Sbjct  68   ----ADQSWWGASNIADENIPQNDASDEVRPPLPVVRETLYGDSMYYGAVRPGNSGQESN  123

Query  358  SVVPFRNFEQEMKHPGVWETDK-----------ASNSADNLASLYRPPFALMYHGSFEKA  504
            S+V FRNF  E K PGVWE D+            +   D+LASLYRPPF LM+ GSFE+A
Sbjct  124  SLVAFRNFGDEAKRPGVWEPDQGASSASASGSEVATPRDSLASLYRPPFHLMFSGSFEQA  183

Query  505  KDAA  516
            K AA
Sbjct  184  KSAA  187



>ref|XP_010458959.1| PREDICTED: UBX domain-containing protein 2-like [Camelina sativa]
 ref|XP_010458960.1| PREDICTED: UBX domain-containing protein 2-like [Camelina sativa]
 ref|XP_010458961.1| PREDICTED: UBX domain-containing protein 2-like [Camelina sativa]
Length=457

 Score =   158 bits (400),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 91/179 (51%), Positives = 118/179 (66%), Gaps = 14/179 (8%)
 Frame = +1

Query  1    QILVASFLEIAVGQSADTARQFLQATSWKLEEALQLFYVGNDGGVAAPSSYSPLENTAPl  180
            Q LV+SFLEIAVGQ+A+TARQFLQATSWKL+EA+QLFY+GN+GG+    +++  E+  P 
Sbjct  11   QRLVSSFLEIAVGQTAETARQFLQATSWKLDEAIQLFYIGNEGGMLPSGTHTLPESNDP-  69

Query  181  pdpslssisgsikgsgdesekQGDRDEVRPPLPVIRDVLYDTAVIRGLPAMGGSAHEARS  360
                 S   G+   +G +   Q D DEVR PLPV+R+ LY  +V  G    G S  E  S
Sbjct  70   ---MASQSWGATTDTGTQRMVQNDVDEVRAPLPVVRETLYGESVYYGAVRGGNSQPEPTS  126

Query  361  VVPFRNFEQEMKHPGVWETDKASNSA----------DNLASLYRPPFALMYHGSFEKAK  507
            ++ FRNF +E K PG+WE D+ ++SA          D+LASLYRPPF LM+ GSFE AK
Sbjct  127  LIAFRNFSEEPKSPGIWEPDEGASSASASESASVPRDSLASLYRPPFHLMFQGSFEMAK  185



>ref|XP_006307428.1| hypothetical protein CARUB_v10009052mg [Capsella rubella]
 gb|EOA40326.1| hypothetical protein CARUB_v10009052mg [Capsella rubella]
Length=468

 Score =   158 bits (399),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 92/185 (50%), Positives = 121/185 (65%), Gaps = 20/185 (11%)
 Frame = +1

Query  1    QILVASFLEIAVGQSADTARQFLQATSWKLEEALQLFYVGNDGGVAAPSSYSPLENTAPl  180
            Q LV+SFLEIAVGQ+A+TARQFLQATSWKL+EA+QLFY+GN+GG+    +++  E+    
Sbjct  11   QRLVSSFLEIAVGQTAETARQFLQATSWKLDEAIQLFYIGNEGGMLPSGTHTQPESN---  67

Query  181  pdpslssisgsikgsgdesekQGDRDEVRPPLPVIRDVLYDTAVIRGLPAMGGSAHEARS  360
             D   +   G+   +G++   Q D DEVR PLPV+R+ LY  AV  G    G S  E  S
Sbjct  68   -DHMATQSWGAGTDTGNQGIVQSDVDEVRAPLPVVRETLYGDAVYYGAMRGGNSQPEPTS  126

Query  361  VVPFRNFEQEMKHPGVWETDKASNSA----------------DNLASLYRPPFALMYHGS  492
            ++ FRNF +E K PG+WE D+ ++SA                D+LASLYRPPF LM+HGS
Sbjct  127  LIAFRNFSEEPKSPGIWEPDEGASSASASASASASESSSAPRDSLASLYRPPFHLMFHGS  186

Query  493  FEKAK  507
            FE+AK
Sbjct  187  FEQAK  191



>ref|XP_002890064.1| UBX domain-containing protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH66323.1| UBX domain-containing protein [Arabidopsis lyrata subsp. lyrata]
Length=472

 Score =   158 bits (399),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 95/190 (50%), Positives = 122/190 (64%), Gaps = 26/190 (14%)
 Frame = +1

Query  1    QILVASFLEIAVGQSADTARQFLQATSWKLEEALQLFYVGNDGGVAAPSSYS-PLENTAP  177
            Q LV+SFLEIAVGQ+A+TARQFLQATSWKLEEA+QLFY+GN+GG+    +++ P  N   
Sbjct  11   QRLVSSFLEIAVGQTAETARQFLQATSWKLEEAIQLFYIGNEGGMLPSGTHTQPASN---  67

Query  178  lpdpslssisgsikgsgdesekQGDRDEVRPPLPVIRDVLYDTAVIRGLPAMGGSAHEAR  357
              D   +   G+  G+G+E   Q D DEVR PLPV+R+ LY  +V  G   +G S  E  
Sbjct  68   --DHVAAQSWGAATGTGNERILQNDVDEVRAPLPVVRETLYGESVYYGTMRVGNSQPEPN  125

Query  358  SVVPFRNFEQEMKHPGVWETDKASNSA--------------------DNLASLYRPPFAL  477
            S++ FRNF +E K PG+WE D+  +SA                    D+LASLYRPPF L
Sbjct  126  SLIAFRNFSEEPKSPGIWEPDEGDSSASASASASASASASESASAPRDSLASLYRPPFHL  185

Query  478  MYHGSFEKAK  507
            M+HGSFE+AK
Sbjct  186  MFHGSFEQAK  195



>ref|XP_010496241.1| PREDICTED: UBX domain-containing protein 2-like [Camelina sativa]
 ref|XP_010496249.1| PREDICTED: UBX domain-containing protein 2-like [Camelina sativa]
Length=463

 Score =   157 bits (398),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 90/181 (50%), Positives = 114/181 (63%), Gaps = 17/181 (9%)
 Frame = +1

Query  1    QILVASFLEIAVGQSADTARQFLQATSWKLEEALQLFYVGNDGGVAAPSSYSPLENTAPl  180
            Q LV+SFLEIAVGQ+A+TARQFLQATSWKL+EA+QLFY+GN+GG+    ++     T P 
Sbjct  11   QRLVSSFLEIAVGQTAETARQFLQATSWKLDEAIQLFYIGNEGGMLPSGTH-----TLPE  65

Query  181  pdpslssisgsikgsgdesekQGDRDEVRPPLPVIRDVLYDTAVIRGLPAMGGSAHEARS  360
             +  ++S S            Q D DEVR PLPV+R+ LY   V  G    G S  E  S
Sbjct  66   SNDPMASQSWGATTDTGNQRVQNDVDEVRAPLPVVRETLYGETVYYGAMRAGNSQPEPTS  125

Query  361  VVPFRNFEQEMKHPGVWETDKASNSA------------DNLASLYRPPFALMYHGSFEKA  504
            ++ FRNF +E K PG+WE D+ ++SA            D+LASLYRPPF LM+ GSFE A
Sbjct  126  LIAFRNFSEEPKSPGIWEPDEGASSASASASESASAPRDSLASLYRPPFHLMFQGSFELA  185

Query  505  K  507
            K
Sbjct  186  K  186



>ref|XP_008389121.1| PREDICTED: UBX domain-containing protein 2-like isoform X2 [Malus 
domestica]
Length=442

 Score =   157 bits (397),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 90/177 (51%), Positives = 111/177 (63%), Gaps = 19/177 (11%)
 Frame = +1

Query  1    QILVASFLEIAVGQSADTARQFLQATSWKLEEALQLFYVGNDGGVAAPSSYSPLENTAPl  180
            Q LV+SFLEIAVGQ+ADTARQFLQAT WKLEEA+QLFYVGN+ G+ A ++  P EN   L
Sbjct  11   QSLVSSFLEIAVGQTADTARQFLQATGWKLEEAIQLFYVGNEAGIMAEAAPLPTENIDRL  70

Query  181  pdpslssisgsikgsgdesekQGDRDEVRPPLPVIRDVLYDTAVIRGLPAMGGSAHEARS  360
             D +            +E+  Q   DEVR P+PVIRDVLYD   + G P    S HE   
Sbjct  71   ADQASGVNENVALPGANENVGQFSEDEVRAPMPVIRDVLYDDMALYGAPRARLSQHE---  127

Query  361  VVPFRNFEQEMKHPGVWETDKASNSA-----DNLASLYRPPFALMYHGSFEKAKDAA  516
                       + PGVWE+D+ + S+     +NLASLYRPPF +++ GSFEKAK AA
Sbjct  128  -----------QGPGVWESDQGATSSENATQENLASLYRPPFKILFQGSFEKAKSAA  173



>ref|XP_008389120.1| PREDICTED: UBX domain-containing protein 2-like isoform X1 [Malus 
domestica]
Length=445

 Score =   157 bits (397),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 90/177 (51%), Positives = 111/177 (63%), Gaps = 19/177 (11%)
 Frame = +1

Query  1    QILVASFLEIAVGQSADTARQFLQATSWKLEEALQLFYVGNDGGVAAPSSYSPLENTAPl  180
            Q LV+SFLEIAVGQ+ADTARQFLQAT WKLEEA+QLFYVGN+ G+ A ++  P EN   L
Sbjct  11   QSLVSSFLEIAVGQTADTARQFLQATGWKLEEAIQLFYVGNEAGIMAEAAPLPTENIDRL  70

Query  181  pdpslssisgsikgsgdesekQGDRDEVRPPLPVIRDVLYDTAVIRGLPAMGGSAHEARS  360
             D +            +E+  Q   DEVR P+PVIRDVLYD   + G P    S HE   
Sbjct  71   ADQASGVNENVALPGANENVGQFSEDEVRAPMPVIRDVLYDDMALYGAPRARLSQHE---  127

Query  361  VVPFRNFEQEMKHPGVWETDKASNSA-----DNLASLYRPPFALMYHGSFEKAKDAA  516
                       + PGVWE+D+ + S+     +NLASLYRPPF +++ GSFEKAK AA
Sbjct  128  -----------QGPGVWESDQGATSSENATQENLASLYRPPFKILFQGSFEKAKSAA  173



>ref|XP_008389122.1| PREDICTED: UBX domain-containing protein 2-like isoform X3 [Malus 
domestica]
Length=440

 Score =   157 bits (396),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 90/177 (51%), Positives = 111/177 (63%), Gaps = 19/177 (11%)
 Frame = +1

Query  1    QILVASFLEIAVGQSADTARQFLQATSWKLEEALQLFYVGNDGGVAAPSSYSPLENTAPl  180
            Q LV+SFLEIAVGQ+ADTARQFLQAT WKLEEA+QLFYVGN+ G+ A ++  P EN   L
Sbjct  11   QSLVSSFLEIAVGQTADTARQFLQATGWKLEEAIQLFYVGNEAGIMAEAAPLPTENIDRL  70

Query  181  pdpslssisgsikgsgdesekQGDRDEVRPPLPVIRDVLYDTAVIRGLPAMGGSAHEARS  360
             D +            +E+  Q   DEVR P+PVIRDVLYD   + G P    S HE   
Sbjct  71   ADQASGVNENVALPGANENVGQFSEDEVRAPMPVIRDVLYDDMALYGAPRARLSQHE---  127

Query  361  VVPFRNFEQEMKHPGVWETDKASNSA-----DNLASLYRPPFALMYHGSFEKAKDAA  516
                       + PGVWE+D+ + S+     +NLASLYRPPF +++ GSFEKAK AA
Sbjct  128  -----------QGPGVWESDQGATSSENATQENLASLYRPPFKILFQGSFEKAKSAA  173



>ref|XP_010935375.1| PREDICTED: UBX domain-containing protein 5 isoform X2 [Elaeis 
guineensis]
Length=413

 Score =   155 bits (392),  Expect = 9e-42, Method: Compositional matrix adjust.
 Identities = 93/176 (53%), Positives = 114/176 (65%), Gaps = 24/176 (14%)
 Frame = +1

Query  1    QILVASFLEIAVGQSADTARQFLQATSWKLEEALQLFYVGNDGGVAAPSSYSPLENTAPl  180
            Q L++SFLEIA+GQ+ADTA QFL+AT+WKLEEA+QLFY GN+ G  A SS  P  N +P 
Sbjct  11   QRLISSFLEIAIGQTADTAAQFLEATTWKLEEAIQLFYAGNEIGAVASSSLPPPVNESPS  70

Query  181  pdpslssisgsikgsgdesekQGDRDEVRPPLPVIRDVLYD--TAVIRGLPAMGGSAHEA  354
               ++       +G+       GD DEVR PLPV RD LY   ++ IR  P+        
Sbjct  71   ERENVVVNENVEQGA-------GD-DEVRAPLPVKRDTLYGDPSSFIRLHPS--------  114

Query  355  RSVVPFRNFEQEMKHPGVWETDK-----ASNSADNLASLYRPPFALMYHGSFEKAK  507
             SVV FRNFE+E K P VWE+D+     A+ S DNLASLYRPPFALMY G F+KAK
Sbjct  115  -SVVAFRNFEEESKRPAVWESDQKAASTANGSRDNLASLYRPPFALMYQGPFDKAK  169



>ref|XP_004160516.1| PREDICTED: uncharacterized protein LOC101223406 [Cucumis sativus]
Length=192

 Score =   149 bits (377),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 88/172 (51%), Positives = 112/172 (65%), Gaps = 6/172 (3%)
 Frame = +1

Query  1    QILVASFLEIAVGQSADTARQFLQATSWKLEEALQLFYVGNDGGVAAPSSYSPLENTAPl  180
            Q +V+SFLE+AVGQ+A+TARQFLQATSWKLE+A+QLFYVGN+GGV  P       +T   
Sbjct  11   QSMVSSFLEVAVGQTAETARQFLQATSWKLEDAIQLFYVGNEGGVVGPPPVPSPPSTNEQ  70

Query  181  pdpslssisgsikgsgdesekQGDRDEVRPPLPVIRDVLYDTAVIRGLPAMGGSAHEARS  360
             + S   IS                DEVRPPLPVIR+ LYD A++ G   MG   +E+ S
Sbjct  71   INSSTDHISNESGKHAGPGTFGQYEDEVRPPLPVIREALYDDAMLYG-TTMGYLPNESGS  129

Query  361  VVPFRNFEQEMKHPGVWETDKAS-----NSADNLASLYRPPFALMYHGSFEK  501
             + FRN + E+KH  VW++ + +     NS DNLASLYRPP+ LM+ GSFEK
Sbjct  130  SIGFRNLQNEVKHHDVWQSGEGAASTSGNSRDNLASLYRPPYHLMFTGSFEK  181



>ref|XP_010935374.1| PREDICTED: UBX domain-containing protein 2 isoform X1 [Elaeis 
guineensis]
Length=444

 Score =   155 bits (391),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 93/176 (53%), Positives = 114/176 (65%), Gaps = 24/176 (14%)
 Frame = +1

Query  1    QILVASFLEIAVGQSADTARQFLQATSWKLEEALQLFYVGNDGGVAAPSSYSPLENTAPl  180
            Q L++SFLEIA+GQ+ADTA QFL+AT+WKLEEA+QLFY GN+ G  A SS  P  N +P 
Sbjct  11   QRLISSFLEIAIGQTADTAAQFLEATTWKLEEAIQLFYAGNEIGAVASSSLPPPVNESPS  70

Query  181  pdpslssisgsikgsgdesekQGDRDEVRPPLPVIRDVLYD--TAVIRGLPAMGGSAHEA  354
               ++       +G+       GD DEVR PLPV RD LY   ++ IR  P+        
Sbjct  71   ERENVVVNENVEQGA-------GD-DEVRAPLPVKRDTLYGDPSSFIRLHPS--------  114

Query  355  RSVVPFRNFEQEMKHPGVWETDK-----ASNSADNLASLYRPPFALMYHGSFEKAK  507
             SVV FRNFE+E K P VWE+D+     A+ S DNLASLYRPPFALMY G F+KAK
Sbjct  115  -SVVAFRNFEEESKRPAVWESDQKAASTANGSRDNLASLYRPPFALMYQGPFDKAK  169



>ref|XP_004140414.1| PREDICTED: UBX domain-containing protein 7-like [Cucumis sativus]
Length=450

 Score =   154 bits (390),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 92/177 (52%), Positives = 116/177 (66%), Gaps = 6/177 (3%)
 Frame = +1

Query  1    QILVASFLEIAVGQSADTARQFLQATSWKLEEALQLFYVGNDGGVAAPSSYSPLENTAPl  180
            Q +V+SFLE+AVGQ+A+TARQFLQATSWKLE+A+QLFYVGN+GGV  P       +T   
Sbjct  11   QSMVSSFLEVAVGQTAETARQFLQATSWKLEDAIQLFYVGNEGGVVGPPPVPSPPSTNEQ  70

Query  181  pdpslssisgsikgsgdesekQGDRDEVRPPLPVIRDVLYDTAVIRGLPAMGGSAHEARS  360
             + S   IS                DEVRPPLPVIR+ LYD A++ G   MG   +E+ S
Sbjct  71   INSSTDHISNESGKHAGPGTFGQYEDEVRPPLPVIREALYDDAMLYGT-TMGYLPNESGS  129

Query  361  VVPFRNFEQEMKHPGVWETDKAS-----NSADNLASLYRPPFALMYHGSFEKAKDAA  516
             + FRN + E+KH  VW++ + +     NS DNLASLYRPP+ LM+ GSFEKAK AA
Sbjct  130  SIGFRNLQNEVKHHDVWQSGEGAASTSGNSRDNLASLYRPPYHLMFTGSFEKAKGAA  186



>emb|CDY69105.1| BnaCnng61890D [Brassica napus]
Length=454

 Score =   154 bits (389),  Expect = 5e-41, Method: Compositional matrix adjust.
 Identities = 86/169 (51%), Positives = 109/169 (64%), Gaps = 7/169 (4%)
 Frame = +1

Query  7    LVASFLEIAVGQSADTARQFLQATSWKLEEALQLFYVGNDGGVAAPSSYSPLENTAPlpd  186
            LV+SFLEIAVGQ+++TARQFL ATSWKLEEA+QLFYVG + GV  PS  +  + T     
Sbjct  13   LVSSFLEIAVGQTSETARQFLGATSWKLEEAIQLFYVGGEVGV-LPSGGTHTQPTV----  67

Query  187  pslssisgsikgsgdesekQGDRDEVRPPLPVIRDVLYDTAVIRGLPAMGGSAHEARSVV  366
                +              Q + DEVR PLPV+R+ LY  ++  G   +G S  E  S++
Sbjct  68   DDPMAAQSWGAAETGNERMQNEVDEVRAPLPVVRETLYGDSMYYGATRVGSSQREPASLI  127

Query  367  PFRNFEQEMKHPGVWETDKASNSA--DNLASLYRPPFALMYHGSFEKAK  507
             FRNF +E K PG+WE D+ + SA  D+LASLYRPPF LM HGSFE+AK
Sbjct  128  AFRNFSEEPKSPGIWEPDEEAASAPRDSLASLYRPPFHLMLHGSFEQAK  176



>ref|XP_009401234.1| PREDICTED: UBX domain-containing protein 2 [Musa acuminata subsp. 
malaccensis]
Length=439

 Score =   152 bits (384),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 91/176 (52%), Positives = 112/176 (64%), Gaps = 25/176 (14%)
 Frame = +1

Query  1    QILVASFLEIAVGQSADTARQFLQATSWKLEEALQLFYVGNDGGVAAPSSYSPLENTAPl  180
            Q LV+SFLEIA+GQ+ +TA QFLQAT WKLEEALQLFYVGN+GG  A SS+ P    +P 
Sbjct  11   QQLVSSFLEIALGQTPETATQFLQATGWKLEEALQLFYVGNEGGGLATSSFPPPPTGSP-  69

Query  181  pdpslssisgsikgsgdesekQGD-RDEVRPPLPVIRDVLY-DTAVIRGLPAMGGSAHEA  354
                    S         S  QG   DEVRPPLPV R+ LY DT + R         H++
Sbjct  70   --------SEQENVMSSGSLVQGALEDEVRPPLPVKRETLYGDTPLFR---------HQS  112

Query  355  RSVVPFRNFEQEMKHPGVWETDKASNSA-----DNLASLYRPPFALMYHGSFEKAK  507
             ++V FRNF++E K   VWE++++S S      DNLASLY PPFALMY GSF++AK
Sbjct  113  SAMVAFRNFDEESKRSAVWESNESSASTANGSRDNLASLYSPPFALMYQGSFDQAK  168



>ref|NP_563954.1| UBX domain-containing protein [Arabidopsis thaliana]
 ref|NP_973827.1| UBX domain-containing protein [Arabidopsis thaliana]
 gb|AAK43884.1|AF370507_1 Unknown protein [Arabidopsis thaliana]
 gb|AAL47388.1| unknown protein [Arabidopsis thaliana]
 dbj|BAH19997.1| AT1G14570 [Arabidopsis thaliana]
 gb|AEE29182.1| UBX domain-containing protein [Arabidopsis thaliana]
 gb|AEE29183.1| UBX domain-containing protein [Arabidopsis thaliana]
Length=468

 Score =   152 bits (385),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 92/189 (49%), Positives = 122/189 (65%), Gaps = 22/189 (12%)
 Frame = +1

Query  1    QILVASFLEIAVGQSADTARQFLQATSWKLEEALQLFYVGNDGGVAAPSSYS-PLENTAP  177
            Q LV+SFLEIAVGQ+A+TARQFLQATSWKLEEA+QLFY+GN+GG+    +++ P  N   
Sbjct  11   QRLVSSFLEIAVGQTAETARQFLQATSWKLEEAIQLFYIGNEGGMLQSGTHTQPASN---  67

Query  178  lpdpslssisgsikgsgdesekQGDRDEVRPPLPVIRDVLYDTAVIRGLPAMGGSAHEAR  357
              D + +   G+  G+G+E     D DEVR PLPV+R+ LY  ++  G   +G S  E  
Sbjct  68   --DDAAAQSWGAATGTGNEMILPNDVDEVRAPLPVVRETLYGESMYYGAMRVGNSQPEPN  125

Query  358  SVVPFRNFEQEMKHPGVWETDKASNSA----------------DNLASLYRPPFALMYHG  489
            S++ FRNF +E K PG+WE D+  +SA                D+LASLYRPPF LM+ G
Sbjct  126  SLIAFRNFSEEPKSPGIWEPDEGDSSASASASASASESASAPRDSLASLYRPPFHLMFQG  185

Query  490  SFEKAKDAA  516
            SFE+AK  +
Sbjct  186  SFEQAKTTS  194



>ref|XP_008804300.1| PREDICTED: UBX domain-containing protein 7 [Phoenix dactylifera]
Length=443

 Score =   152 bits (383),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 92/175 (53%), Positives = 111/175 (63%), Gaps = 23/175 (13%)
 Frame = +1

Query  1    QILVASFLEIAVGQSADTARQFLQATSWKLEEALQLFYVGNDGGVAAPSSYSPLENTAPl  180
            Q L++SFLEIA GQ+AD A QFL+ATSWKLEEA+QLFY GN+ G    SS  P  N  P 
Sbjct  11   QRLISSFLEIAAGQTADIAAQFLEATSWKLEEAIQLFYAGNEFGAVPSSSLPPPVNEIPS  70

Query  181  pdpslssisgsikgsgdesekQGDRDEVRPPLPVIRDVLY-DTAVIRGLPAMGGSAHEAR  357
               ++       +G+       GD DEVR PLPV RD LY D + IR  P+         
Sbjct  71   ERENVEVNENVGQGA-------GD-DEVRAPLPVKRDTLYGDPSFIRLHPS---------  113

Query  358  SVVPFRNFEQEMKHPGVWETDK-----ASNSADNLASLYRPPFALMYHGSFEKAK  507
            SVV FRNFE+E K P VWE+D+     ++ S DNLASLYRPPFALMY G+F+KAK
Sbjct  114  SVVAFRNFEEESKRPAVWESDQKAASTSNGSRDNLASLYRPPFALMYQGAFDKAK  168



>ref|XP_004297788.1| PREDICTED: UBX domain-containing protein 2 isoform X1 [Fragaria 
vesca subsp. vesca]
Length=489

 Score =   152 bits (383),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 88/183 (48%), Positives = 110/183 (60%), Gaps = 19/183 (10%)
 Frame = +1

Query  1    QILVASFLEIAVGQSADTARQFLQATSWKLEEALQLFYVGNDGGVAAPSSYSPLENTAPl  180
            Q  VA F+EIA GQ+ +TAR+FLQAT W LEEALQLFYVGN+ G        P+    P 
Sbjct  43   QSTVALFMEIAAGQTDETARRFLQATGWNLEEALQLFYVGNEAG--------PVAQPQPQ  94

Query  181  pdpslssisgsikgsgdesekQGDRDEVRPPLPVIRDVLYDTAVIRGLPAMGGSAHEAR-  357
            P    +S         +E+  Q   DEVR P+PVIRDVLYD   +     +  ++   R 
Sbjct  95   PPTGNASNLAEQSSGVNENVAQYVEDEVRAPMPVIRDVLYDDVALYQAGLLASTSPMTRL  154

Query  358  -----SVVPFRNFEQEMKHPGVWETDKASNSA-----DNLASLYRPPFALMYHGSFEKAK  507
                  V+ FRNF +E+KHPGVWE+++ + S      DNLASLYRPPF LM+ GSFEKAK
Sbjct  155  PVNESGVIAFRNFNEELKHPGVWESNEGATSTTDSSRDNLASLYRPPFKLMFQGSFEKAK  214

Query  508  DAA  516
             AA
Sbjct  215  SAA  217



>ref|XP_006416998.1| hypothetical protein EUTSA_v10007578mg [Eutrema salsugineum]
 gb|ESQ35351.1| hypothetical protein EUTSA_v10007578mg [Eutrema salsugineum]
Length=462

 Score =   152 bits (383),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 93/186 (50%), Positives = 118/186 (63%), Gaps = 22/186 (12%)
 Frame = +1

Query  1    QILVASFLEIAVGQSADTARQFLQATSWKLEEALQLFYVGNDGGVAAPSSYSPLENTAPl  180
            Q LV+SFLEIAVGQ++DTARQFL+ATSWKLEEA+QLFYVG +GG+    ++     T P 
Sbjct  11   QRLVSSFLEIAVGQTSDTARQFLEATSWKLEEAIQLFYVGGEGGMLPSGTH-----TQP-  64

Query  181  pdpslssisgsikgsgdesekQGDRDEVRPPLPVIRDVLYDTAVIRGLPAMGGSAHEARS  360
                    + S   +G+E  +Q D DEVRPPLPV+R+ LY      G   +G S  E  S
Sbjct  65   -ASDDHMAAQSWGAAGNERIQQNDVDEVRPPLPVVRETLYG-GDYYGAMRLGNSQPEPTS  122

Query  361  VVPFRNFEQEMKHPGVWETDKASNSA--------------DNLASLYRPPFALMYHGSFE  498
            ++ FRNF +E K PGVWE D+ ++SA              D+LASLYRPPF LM HGSFE
Sbjct  123  LIAFRNFNEEPKSPGVWEPDEGASSASASASVSETASAPRDSLASLYRPPFHLMLHGSFE  182

Query  499  KAKDAA  516
            +AK  +
Sbjct  183  QAKTTS  188



>ref|XP_011463491.1| PREDICTED: UBX domain-containing protein 2 isoform X2 [Fragaria 
vesca subsp. vesca]
Length=486

 Score =   152 bits (383),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 88/183 (48%), Positives = 110/183 (60%), Gaps = 19/183 (10%)
 Frame = +1

Query  1    QILVASFLEIAVGQSADTARQFLQATSWKLEEALQLFYVGNDGGVAAPSSYSPLENTAPl  180
            Q  VA F+EIA GQ+ +TAR+FLQAT W LEEALQLFYVGN+ G        P+    P 
Sbjct  43   QSTVALFMEIAAGQTDETARRFLQATGWNLEEALQLFYVGNEAG--------PVAQPQPQ  94

Query  181  pdpslssisgsikgsgdesekQGDRDEVRPPLPVIRDVLYDTAVIRGLPAMGGSAHEAR-  357
            P    +S         +E+  Q   DEVR P+PVIRDVLYD   +     +  ++   R 
Sbjct  95   PPTGNASNLAEQSSGVNENVAQYVEDEVRAPMPVIRDVLYDDVALYQAGLLASTSPMTRL  154

Query  358  -----SVVPFRNFEQEMKHPGVWETDKASNSA-----DNLASLYRPPFALMYHGSFEKAK  507
                  V+ FRNF +E+KHPGVWE+++ + S      DNLASLYRPPF LM+ GSFEKAK
Sbjct  155  PVNESGVIAFRNFNEELKHPGVWESNEGATSTTDSSRDNLASLYRPPFKLMFQGSFEKAK  214

Query  508  DAA  516
             AA
Sbjct  215  SAA  217



>emb|CDY45269.1| BnaA06g09390D [Brassica napus]
Length=467

 Score =   147 bits (372),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 88/182 (48%), Positives = 112/182 (62%), Gaps = 20/182 (11%)
 Frame = +1

Query  7    LVASFLEIAVGQSADTARQFLQATSWKLEEALQLFYVGNDGGVAAPSSYSPLENTAPlpd  186
            LV+SFLEIAVGQ+++TARQFL+ATSWKLEEA+QLFYVG + GV  PS  +   NT P   
Sbjct  13   LVSSFLEIAVGQTSETARQFLEATSWKLEEAIQLFYVGGEVGV-LPSGGT---NTRP-TV  67

Query  187  pslssisgsikgsgdesekQGDRDEVRPPLPVIRDVLYDTAVIRGLPAMGGSAHEARSVV  366
                +              Q + DEVR PLPV+R+ LY  ++  G   +G S  E  S++
Sbjct  68   DDPMAAQSWGAAETGNERMQNEVDEVRAPLPVVRETLYGDSMYYGGTRVGSSQREPASLI  127

Query  367  PFRNFEQEMKHPGVWETDKASNSA---------------DNLASLYRPPFALMYHGSFEK  501
             FRNF +E K PG+WE D+ ++SA               D+LASLYRPPF LM HGSFE+
Sbjct  128  AFRNFSEEPKSPGIWEPDEGASSASGSASAPEAASSAPRDSLASLYRPPFHLMLHGSFEQ  187

Query  502  AK  507
            AK
Sbjct  188  AK  189



>ref|XP_009148836.1| PREDICTED: UBX domain-containing protein 2 [Brassica rapa]
Length=466

 Score =   146 bits (368),  Expect = 5e-38, Method: Compositional matrix adjust.
 Identities = 86/181 (48%), Positives = 111/181 (61%), Gaps = 19/181 (10%)
 Frame = +1

Query  7    LVASFLEIAVGQSADTARQFLQATSWKLEEALQLFYVGNDGGVAAPSSYSPLENTAPlpd  186
            LV+SFLEIAVGQ+++TARQFL+ATSWKLEEA+QLFYVG + GV  PS  +  + T     
Sbjct  13   LVSSFLEIAVGQTSETARQFLEATSWKLEEAIQLFYVGGEVGV-LPSGGTHTQPTV----  67

Query  187  pslssisgsikgsgdesekQGDRDEVRPPLPVIRDVLYDTAVIRGLPAMGGSAHEARSVV  366
                +              Q + DEVR PLPV+R+ LY  ++  G   +G S  E  S++
Sbjct  68   DDPMAAHSWGAAETGNERMQNEVDEVRAPLPVVRETLYGDSMYYGGTRVGSSQREPASLI  127

Query  367  PFRNFEQEMKHPGVWETDKASNSA--------------DNLASLYRPPFALMYHGSFEKA  504
             FRNF +E K PG+WE D+ ++SA              D+LASLYRPPF LM HGSFE+A
Sbjct  128  AFRNFSEEPKSPGIWEPDEGASSASGSASAPEAASAPRDSLASLYRPPFHLMLHGSFEQA  187

Query  505  K  507
            K
Sbjct  188  K  188



>gb|KHN06997.1| UBX domain-containing protein 7 [Glycine soja]
Length=494

 Score =   141 bits (356),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 82/167 (49%), Positives = 100/167 (60%), Gaps = 13/167 (8%)
 Frame = +1

Query  55   ARQFLQATSWKLEEALQLFYVGNDGGVAAPSSYSPL-------ENTAPlpdpslssisgs  213
            ARQFLQATSWKLEEALQLF +G++GG        P        EN     D    S    
Sbjct  55   ARQFLQATSWKLEEALQLFLIGSEGGAVPLPVPPPPLLHTPPLENVDSWTDQQPLSEPRK  114

Query  214  ikgsgdesekQ-GDRDEVRPPLPVIRDVLYDTAVIRGLPAMGGSAHEARSVVPFRNFEQE  390
               +         D +EVRPPLPVIR+ LYD A++ G       +HE  S+V FRNFE+E
Sbjct  115  DAAAAASESIDLNDAEEVRPPLPVIRETLYDDAMLYGASRASHRSHEPSSLVAFRNFEEE  174

Query  391  MKHPGVWETDK-----ASNSADNLASLYRPPFALMYHGSFEKAKDAA  516
            M+ PGVWE+++     A  S DNLASLYRPPF LM++G F+KAKDAA
Sbjct  175  MRQPGVWESEQGAASTAETSRDNLASLYRPPFHLMFNGPFDKAKDAA  221



>ref|XP_007045359.1| UBX domain-containing protein isoform 4, partial [Theobroma cacao]
 gb|EOY01191.1| UBX domain-containing protein isoform 4, partial [Theobroma cacao]
Length=429

 Score =   140 bits (352),  Expect = 6e-36, Method: Compositional matrix adjust.
 Identities = 78/159 (49%), Positives = 101/159 (64%), Gaps = 10/159 (6%)
 Frame = +1

Query  58   RQFLQATSWKLEEALQLFYVGNDGGVAAPSSYSP-LENTAPlpdpslssisgsikgsgde  234
            R  + ATSWKL+EA+QLFYVGN+GGV A SS SP LEN       +   ++     +   
Sbjct  5    RHAVFATSWKLDEAIQLFYVGNEGGVVASSSESPALENVDSWASQNSGELNEPANDNVGS  64

Query  235  sekQGDRDEVRPPLPVIRDVLYDTAVIRGLPAMGGSAHEARSVVPFRNFEQEMKHPGVWE  414
            +      D+VRPPLPV+R+ LYD  ++ G   +G    +  S V FRNF++EMK PGVWE
Sbjct  65   TGG----DDVRPPLPVVRETLYDDGMLYGASRLGYPPQQLSSSVAFRNFDEEMKRPGVWE  120

Query  415  TDKASNSA-----DNLASLYRPPFALMYHGSFEKAKDAA  516
            +D+ ++S      DNLASLYRPPF LM+ G FEKAK AA
Sbjct  121  SDEGASSTVDAPRDNLASLYRPPFHLMFQGPFEKAKAAA  159



>ref|XP_007052064.1| UBX domain-containing protein [Theobroma cacao]
 gb|EOX96221.1| UBX domain-containing protein [Theobroma cacao]
Length=431

 Score =   137 bits (345),  Expect = 6e-35, Method: Compositional matrix adjust.
 Identities = 89/177 (50%), Positives = 113/177 (64%), Gaps = 16/177 (9%)
 Frame = +1

Query  1    QILVASFLEIAVGQSADTARQFLQATSWKLEEALQLFYVGNDGGVAAPSSYSPLENTAPl  180
            Q +V+SFLEIAVGQ+A+TA QFLQATSWKL+EA+QLFYVGN+GGV   SS S     A  
Sbjct  11   QRMVSSFLEIAVGQTAETATQFLQATSWKLDEAIQLFYVGNEGGVVGSSSVS---RQAEN  67

Query  181  pdpslssisgsikgsgdesekQGDRDEVRPPLPVIRDVLYDTAVIRGLPAMGGSAHEARS  360
             D      SG++    +     G  D VRPPLPV+R+ L+D A++ G   +G    E   
Sbjct  68   MDSWAYQNSGALNEHDNVGSTGG--DAVRPPLPVVRETLHDDAMLHGASRLGYPPQE---  122

Query  361  VVPFRNFEQEMKHPGVWETDKASNSA-----DNLASLYRPPFALMYHGSFEKAKDAA  516
               FRNF++E   PGVW++D+ ++S      DNLASLYRPPF LM+ G F  AK AA
Sbjct  123  ---FRNFDEETIRPGVWQSDEGASSTVDAPRDNLASLYRPPFHLMFQGPFRNAKAAA  176



>ref|XP_009398016.1| PREDICTED: UBX domain-containing protein 2-like [Musa acuminata 
subsp. malaccensis]
Length=434

 Score =   133 bits (335),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 84/174 (48%), Positives = 98/174 (56%), Gaps = 25/174 (14%)
 Frame = +1

Query  1    QILVASFLEIAVGQSADTARQFLQATSWKLEEALQLFYVGNDGGVAAPSSYSPLENTAPl  180
            Q LV SFLEIAVGQ+A TA QFLQAT W+L+EA+QLFYVGN+ G  A SS  P  N  P 
Sbjct  11   QQLVLSFLEIAVGQTAATATQFLQATRWRLDEAVQLFYVGNEDGGVASSSLPPPINERP-  69

Query  181  pdpslssisgsikgsgdesekQGDRDEVRPPLPVIRDVLYDTAVIRGLPAMGGSAHEARS  360
                              S  +   DEVRPPLPV R+ LY            G     R 
Sbjct  70   -------SGQVNFFGTTSSVPRPPEDEVRPPLPVKRETLY------------GDMPLFRP  110

Query  361  VVPFRNFEQEMKHPGVWETDK-----ASNSADNLASLYRPPFALMYHGSFEKAK  507
            V  FRNF++  K   VWE+D+     ++ S DNLASLY PPFALMY G FE+AK
Sbjct  111  VDAFRNFDEGSKRSAVWESDESAPSTSNGSRDNLASLYSPPFALMYQGPFEQAK  164



>ref|XP_009773267.1| PREDICTED: uncharacterized protein LOC104223510 [Nicotiana sylvestris]
Length=178

 Score =   122 bits (306),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 80/172 (47%), Positives = 92/172 (53%), Gaps = 46/172 (27%)
 Frame = +1

Query  1    QILVASFLEIAVGQSADTARQFLQATSWKLEEALQLFYVGNDGGVAAPSSYSPLENTAPl  180
            Q+LV+SFLEI VGQ+ADTARQFLQ TSW LEEA+QL Y+GN+GG AA  + S L N A  
Sbjct  11   QMLVSSFLEITVGQTADTARQFLQVTSWNLEEAIQLSYIGNEGGAAASVNSSQLGNDA--  68

Query  181  pdpslssisgsikgsgdesekQGDRDEVRPPLPVIRDVLYDTAVIRGLPAMGGSAHEARS  360
                                  GDR                         +GGS+ E R 
Sbjct  69   --------------------LLGDRSLSS-------------------SGVGGSSREPRL  89

Query  361  VVPFRNFEQEMKHPGVWETDKASN-----SADNLASLYRPPFALMYHGSFEK  501
            V P  NFE+EMK PGV E +K S      + DNLASL  PPFALMYHG FEK
Sbjct  90   VAPSCNFEEEMKCPGVLEAEKRSTPTTDAAQDNLASLCHPPFALMYHGPFEK  141



>ref|NP_001077535.1| UBX domain-containing protein [Arabidopsis thaliana]
 ref|NP_001077536.1| UBX domain-containing protein [Arabidopsis thaliana]
 gb|AEE29184.1| UBX domain-containing protein [Arabidopsis thaliana]
 gb|AEE29185.1| UBX domain-containing protein [Arabidopsis thaliana]
Length=447

 Score =   127 bits (318),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 84/189 (44%), Positives = 111/189 (59%), Gaps = 43/189 (23%)
 Frame = +1

Query  1    QILVASFLEIAVGQSADTARQFLQATSWKLEEALQLFYVGNDGGVAAPSSYS-PLENTAP  177
            Q LV+SFLEIAVGQ+A+TARQFLQATSWKLEEA+QLFY+GN+GG+    +++ P  N   
Sbjct  11   QRLVSSFLEIAVGQTAETARQFLQATSWKLEEAIQLFYIGNEGGMLQSGTHTQPASN---  67

Query  178  lpdpslssisgsikgsgdesekQGDRDEVRPPLPVIRDVLYDTAVIRGLPAMGGSAHEAR  357
              D + +   G+  G+G+E     D DEVR PLPV+R+ LY  ++  G            
Sbjct  68   --DDAAAQSWGAATGTGNEMILPNDVDEVRAPLPVVRETLYGESMYYG------------  113

Query  358  SVVPFRNFEQEMKHPGVWETDKASNSA----------------DNLASLYRPPFALMYHG  489
                     +E K PG+WE D+  +SA                D+LASLYRPPF LM+ G
Sbjct  114  ---------EEPKSPGIWEPDEGDSSASASASASASESASAPRDSLASLYRPPFHLMFQG  164

Query  490  SFEKAKDAA  516
            SFE+AK  +
Sbjct  165  SFEQAKTTS  173



>ref|XP_006855568.1| hypothetical protein AMTR_s00044p00018360 [Amborella trichopoda]
 gb|ERN17035.1| hypothetical protein AMTR_s00044p00018360 [Amborella trichopoda]
Length=442

 Score =   125 bits (315),  Expect = 8e-31, Method: Compositional matrix adjust.
 Identities = 83/179 (46%), Positives = 110/179 (61%), Gaps = 21/179 (12%)
 Frame = +1

Query  1    QILVASFLEIAVGQSADTARQFLQATSWKLEEALQLFYVGNDGGV----AAPSSYSPLEN  168
            QILVASF+E+A G+S   A QFLQAT+W+LE+A+QLF+VGNDG      A  SS+SP + 
Sbjct  9    QILVASFMEVAGGESTKIALQFLQATNWQLEDAIQLFFVGNDGNNTNTNAESSSFSPPKE  68

Query  169  TAPlpdpslssisgsikgsgdesekQGDRDEVRPPLPVIRDVLYDTAVIRGLPAMGGSAH  348
            T   P         +              + VRPPLPV R+ LY  + + G   +    H
Sbjct  69   TNHSPLHESEQEKDAKW-----------EEYVRPPLPVKREALYADSFMYGQRTL----H  113

Query  349  EARSVVPFRNFEQEMKHPGVWETDKASNSA-DNLASLYRPPFALMYHGSFEKAK-DAAR  519
                 V FR+FE+E K+P VW +++ ++ A DNLA+LYRPPF+LMY GSFEKAK DA+R
Sbjct  114  PPHQPVAFRDFEEEAKNPSVWGSEQGTSGARDNLAALYRPPFSLMYQGSFEKAKIDASR  172



>ref|XP_009110537.1| PREDICTED: UBX domain-containing protein 2-like [Brassica rapa]
Length=443

 Score =   124 bits (312),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 78/177 (44%), Positives = 101/177 (57%), Gaps = 23/177 (13%)
 Frame = +1

Query  1    QILVASFLEIAVGQSADTARQFLQATSWKLEEALQLFYVGNDGG--VAAPSSYSPLENTA  174
            Q LV+SFL+IAVGQ+A TARQFLQATSW L EA+QLFY G +GG  +A+ +   P+    
Sbjct  11   QSLVSSFLDIAVGQTAKTARQFLQATSWNLNEAVQLFYAGGEGGSMLASGTHTHPM----  66

Query  175  PlpdpslssisgsikgsgdesekQGDRDEVRPPLPVIRDVLYDTAVIRGLPAMGGSAHEA  354
                      S           K+ D D VR PLPV+ + LY  ++       G    E 
Sbjct  67   -------GRRSRRAAARARRERKRNDADGVRAPLPVVTETLYRDSMYYE----GNYEREL  115

Query  355  RSVVPFRNFEQEMKHPGVWETDKASNSAD------NLASLYRPPFALMYHGSFEKAK  507
             S++ F +F +E K  GVWE D+ ++SA       +LASLYRPPF LM HGSFE+ K
Sbjct  116  ASLIDFLDFSEEPKRSGVWEPDEVASSASTSGPRHSLASLYRPPFHLMTHGSFEQVK  172



>gb|AFW59833.1| hypothetical protein ZEAMMB73_017157 [Zea mays]
Length=193

 Score =   115 bits (287),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 74/180 (41%), Positives = 102/180 (57%), Gaps = 21/180 (12%)
 Frame = +1

Query  1    QILVASFLEIAVGQSADTARQFLQATSWKLEEALQLFYV-GNDGGVAAPSSYSPLENTAP  177
            + LV+SF+EI  GQ+ +TA QFLQ TSW LEEALQLFY+ G     AA S        AP
Sbjct  12   ETLVSSFIEITAGQTLETATQFLQMTSWHLEEALQLFYIDGEAAHTAAHSVDPSPAAAAP  71

Query  178  lpdpslssisgsikgsgdesekQGD----------RDEVRPPLPVIRDVLYDTAVIRGLP  327
                + + +  +++ +   +   GD           D+VR PLPV R+ LY   ++    
Sbjct  72   SALAAAAGVEEAMRFAPPPAAALGDAMSHGFGVREDDDVRAPLPVKRETLYGEGIV----  127

Query  328  AMGGSAHEARSVVPFRNFEQEMKHPGVWETDK--ASNSADNLASLYRPPFALMYHGSFEK  501
                S     +   FRNFEQE +   VW++++  AS+S DNLASLYRPPF LM++GSF+K
Sbjct  128  ----SVMRPNASAAFRNFEQEARQSAVWDSEQNVASSSGDNLASLYRPPFPLMFNGSFDK  183



>gb|EYU24728.1| hypothetical protein MIMGU_mgv1a025994mg, partial [Erythranthe 
guttata]
Length=320

 Score =   117 bits (294),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 59/98 (60%), Positives = 72/98 (73%), Gaps = 7/98 (7%)
 Frame = +1

Query  247  GDRDEVRPPLPVIRDVLYDTAVIRG-LPAMGGSAHEARSVVPFRNFEQEMKHPGVWETDK  423
             D  +VR PLPV RDVLYD++++ G +  +G S H   SVVPFRNF++EMKHPGVWE + 
Sbjct  8    NDGSDVRAPLPVRRDVLYDSSMLYGRVQRVGDSPHATHSVVPFRNFDEEMKHPGVWEIEA  67

Query  424  ASNSA------DNLASLYRPPFALMYHGSFEKAKDAAR  519
             S+S+      DNLASLYRPPFALM+ G FEKAKD AR
Sbjct  68   GSSSSVADKTQDNLASLYRPPFALMFQGPFEKAKDNAR  105



>gb|AEV41029.1| putative UBX domain-containing protein [Oryza minuta]
Length=463

 Score =   119 bits (297),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 77/183 (42%), Positives = 108/183 (59%), Gaps = 27/183 (15%)
 Frame = +1

Query  7    LVASFLEIAVGQSADTARQFLQATSWKLEEALQLFYVGNDGGVA---APSSYSPLENTAP  177
            LV+SFLEIA GQ+ + A QFLQ TSW LEEALQLFY+  +  +A   APS+ +     A 
Sbjct  14   LVSSFLEIAAGQTPEMATQFLQMTSWHLEEALQLFYIDGEAALAAHPAPSTAAAAAEAAA  73

Query  178  lpdpslssisgsikgsgdesekQGD--------RDEVRPPLPVIRDVLYDTA---VIRGL  324
            +   + + +  +++ +   +   GD         D+VR PLP  R+ LY  A   V+R  
Sbjct  74   VAVAAAAEVEDAMRFAPPPAAALGDEMLQGLGEEDDVRAPLPTKRETLYGDAPMVVVR--  131

Query  325  PAMGGSAHEARSVVPFRNFEQEMKHPGVWETDK--ASNSADNLASLYRPPFALMYHGSFE  498
                       S V FRNFE+E +   VW++++  AS+S DNLA+LYRPPFALM++G F+
Sbjct  132  ---------PNSTVAFRNFEEEARQSAVWDSEQNAASSSRDNLAALYRPPFALMFNGPFD  182

Query  499  KAK  507
            KAK
Sbjct  183  KAK  185



>gb|AEV40978.1| putative UBX domain-containing protein [Oryza punctata]
Length=463

 Score =   119 bits (297),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 77/183 (42%), Positives = 108/183 (59%), Gaps = 27/183 (15%)
 Frame = +1

Query  7    LVASFLEIAVGQSADTARQFLQATSWKLEEALQLFYVGNDGGVA---APSSYSPLENTAP  177
            LV+SFLEIA GQ+ + A QFLQ TSW LEEALQLFY+  +  +A   APS+ +     A 
Sbjct  14   LVSSFLEIAAGQTPEMATQFLQMTSWHLEEALQLFYIDGEAALAAHPAPSTAAAAAEAAA  73

Query  178  lpdpslssisgsikgsgdesekQGD--------RDEVRPPLPVIRDVLYDTA---VIRGL  324
            +   + + +  +++ +   +   GD         D+VR PLP  R+ LY  A   V+R  
Sbjct  74   VAVAAAAEVEDAMRFAPPPAAALGDEMLQGLGEEDDVRAPLPTKRETLYGDAPMVVVR--  131

Query  325  PAMGGSAHEARSVVPFRNFEQEMKHPGVWETDK--ASNSADNLASLYRPPFALMYHGSFE  498
                       S V FRNFE+E +   VW++++  AS+S DNLA+LYRPPFALM++G F+
Sbjct  132  ---------PNSTVAFRNFEEEARQSAVWDSEQNAASSSRDNLAALYRPPFALMFNGPFD  182

Query  499  KAK  507
            KAK
Sbjct  183  KAK  185



>tpg|DAA35439.1| TPA: hypothetical protein ZEAMMB73_856149 [Zea mays]
Length=461

 Score =   117 bits (293),  Expect = 8e-28, Method: Compositional matrix adjust.
 Identities = 76/188 (40%), Positives = 104/188 (55%), Gaps = 33/188 (18%)
 Frame = +1

Query  1    QILVASFLEIAVGQSADTARQFLQATSWKLEEALQLFYVGNDGGVAAPSSYSPLENTAPl  180
            + LV+SFLEIA GQ+ +TA QFL  TSW LEEALQLFY+  +      S+ +P    AP 
Sbjct  12   ETLVSSFLEIAAGQTPETATQFLLMTSWHLEEALQLFYIDGE------SALTPAHPVAPP  65

Query  181  pdpslssisgsikgsgdesekQ-----------------GDRDEVRPPLPVIRDVLYDTA  309
            P  + +S   +  G+ +                      G+ D+VR PLPV R+ LY   
Sbjct  66   PTSAAASALAAAAGAEEAMRFAPPPAAALGDAMLHGFGVGEDDDVRAPLPVKRETLYGEG  125

Query  310  VIRGLPAMGGSAHEARSVVPFRNFEQEMKHPGVWETDK--ASNSADNLASLYRPPFALMY  483
            ++        S     +   FRNFEQE +   VW++D+   S+S DNLASLYRPPF+LM+
Sbjct  126  IV--------SVMRPNASAAFRNFEQEARQSAVWDSDQNATSSSGDNLASLYRPPFSLMF  177

Query  484  HGSFEKAK  507
            +G F+KAK
Sbjct  178  NGPFDKAK  185



>ref|NP_001170636.1| uncharacterized protein LOC100384688 [Zea mays]
 gb|ACR34298.1| unknown [Zea mays]
 gb|AFW59832.1| hypothetical protein ZEAMMB73_017157 [Zea mays]
Length=459

 Score =   117 bits (293),  Expect = 8e-28, Method: Compositional matrix adjust.
 Identities = 76/182 (42%), Positives = 104/182 (57%), Gaps = 21/182 (12%)
 Frame = +1

Query  1    QILVASFLEIAVGQSADTARQFLQATSWKLEEALQLFYV-GNDGGVAAPSSYSPLENTAP  177
            + LV+SF+EI  GQ+ +TA QFLQ TSW LEEALQLFY+ G     AA S        AP
Sbjct  12   ETLVSSFIEITAGQTLETATQFLQMTSWHLEEALQLFYIDGEAAHTAAHSVDPSPAAAAP  71

Query  178  lpdpslssisgsikgsgdesekQGD----------RDEVRPPLPVIRDVLYDTAVIRGLP  327
                + + +  +++ +   +   GD           D+VR PLPV R+ LY   ++    
Sbjct  72   SALAAAAGVEEAMRFAPPPAAALGDAMSHGFGVREDDDVRAPLPVKRETLYGEGIV----  127

Query  328  AMGGSAHEARSVVPFRNFEQEMKHPGVWETDK--ASNSADNLASLYRPPFALMYHGSFEK  501
                S     +   FRNFEQE +   VW++++  AS+S DNLASLYRPPF LM++GSF+K
Sbjct  128  ----SVMRPNASAAFRNFEQEARQSAVWDSEQNVASSSGDNLASLYRPPFPLMFNGSFDK  183

Query  502  AK  507
            AK
Sbjct  184  AK  185



>ref|XP_002447303.1| hypothetical protein SORBIDRAFT_06g032400 [Sorghum bicolor]
 gb|EES11631.1| hypothetical protein SORBIDRAFT_06g032400 [Sorghum bicolor]
Length=463

 Score =   117 bits (293),  Expect = 9e-28, Method: Compositional matrix adjust.
 Identities = 75/184 (41%), Positives = 103/184 (56%), Gaps = 23/184 (13%)
 Frame = +1

Query  1    QILVASFLEIAVGQSADTARQFLQATSWKLEEALQLFYVGNDGGVAAPSSYSPLENTAPl  180
            + LV+SFLEIA GQ+ +TA QFLQ TSW LEEALQLFY+  +  + A     P    A  
Sbjct  12   ETLVSSFLEIAAGQTPETATQFLQMTSWHLEEALQLFYIDGESALGAAHPAVPPPAAAAA  71

Query  181  pdpslssisgsikg-------------sgdesekQGDRDEVRPPLPVIRDVLYDTAVIRG  321
               +L++ +G  +              +       G+ D+VR PLPV R+ LY   ++  
Sbjct  72   SASALAAAAGVEEAMRFAPPPAAALGDAMSHGFGVGEDDDVRAPLPVKRETLYGEGIV--  129

Query  322  LPAMGGSAHEARSVVPFRNFEQEMKHPGVWETDK--ASNSADNLASLYRPPFALMYHGSF  495
                  S     +   FRNFEQE +   VW++D+   S+S DNLASLYRPPF+LM++G F
Sbjct  130  ------SVMRPNASAAFRNFEQEARQSAVWDSDQNATSSSGDNLASLYRPPFSLMFNGPF  183

Query  496  EKAK  507
            +KAK
Sbjct  184  DKAK  187



>ref|XP_008668717.1| PREDICTED: UBX domain-containing protein 2-like [Zea mays]
Length=542

 Score =   117 bits (294),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 76/188 (40%), Positives = 104/188 (55%), Gaps = 33/188 (18%)
 Frame = +1

Query  1    QILVASFLEIAVGQSADTARQFLQATSWKLEEALQLFYVGNDGGVAAPSSYSPLENTAPl  180
            + LV+SFLEIA GQ+ +TA QFL  TSW LEEALQLFY+  +      S+ +P    AP 
Sbjct  93   ETLVSSFLEIAAGQTPETATQFLLMTSWHLEEALQLFYIDGE------SALTPAHPVAPP  146

Query  181  pdpslssisgsikgsgdesekQ-----------------GDRDEVRPPLPVIRDVLYDTA  309
            P  + +S   +  G+ +                      G+ D+VR PLPV R+ LY   
Sbjct  147  PTSAAASALAAAAGAEEAMRFAPPPAAALGDAMLHGFGVGEDDDVRAPLPVKRETLYGEG  206

Query  310  VIRGLPAMGGSAHEARSVVPFRNFEQEMKHPGVWETDK--ASNSADNLASLYRPPFALMY  483
            ++        S     +   FRNFEQE +   VW++D+   S+S DNLASLYRPPF+LM+
Sbjct  207  IV--------SVMRPNASAAFRNFEQEARQSAVWDSDQNATSSSGDNLASLYRPPFSLMF  258

Query  484  HGSFEKAK  507
            +G F+KAK
Sbjct  259  NGPFDKAK  266



>ref|XP_004960126.1| PREDICTED: UBX domain-containing protein 2-like [Setaria italica]
Length=456

 Score =   116 bits (291),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 75/190 (39%), Positives = 99/190 (52%), Gaps = 42/190 (22%)
 Frame = +1

Query  1    QILVASFLEIAVGQSADTARQFLQATSWKLEEALQLFYVGNDG-----------------  129
            + LV+SFLEIA GQ+ +TA QFLQ TSW LEEALQLFY+  +                  
Sbjct  12   EALVSSFLEIAAGQTPETATQFLQMTSWHLEEALQLFYIDGESALAARPAAPSAAAAMAA  71

Query  130  --GVAAPSSYSPLENTAPlpdpslssisgsikgsgdesekQGDRDEVRPPLPVIRDVLYD  303
              GV     ++P    A             +     +    G+ D+VR PLPV R+ LY 
Sbjct  72   AAGVEEALRFAPPPAAA-------------LGDPMLQGLGVGEDDDVRAPLPVKRETLYG  118

Query  304  TAVIRGLPAMGGSAHEARSVVPFRNFEQEMKHPGVWETDK--ASNSADNLASLYRPPFAL  477
               +        S     + V FRNFEQE +   VW++D+   S+S DNLASLYRPPF+L
Sbjct  119  DGPV--------SVLRPSTTVAFRNFEQEARQSAVWDSDQNATSSSRDNLASLYRPPFSL  170

Query  478  MYHGSFEKAK  507
            M++G F+KAK
Sbjct  171  MFNGPFDKAK  180



>ref|XP_010240593.1| PREDICTED: UBX domain-containing protein 7 isoform X2 [Brachypodium 
distachyon]
Length=318

 Score =   114 bits (285),  Expect = 5e-27, Method: Compositional matrix adjust.
 Identities = 75/182 (41%), Positives = 103/182 (57%), Gaps = 26/182 (14%)
 Frame = +1

Query  7    LVASFLEIAVGQSADTARQFLQATSWKLEEALQLFYVGNDGGVAAPSSYSPLENTAPlpd  186
            LV+SFLEIA GQ+  TA QFLQ TSW LEEA+QLFY+  DG  A  +  +    ++    
Sbjct  14   LVSSFLEIAAGQTPHTATQFLQMTSWHLEEAVQLFYI--DGEAALAAHSAAAPASSAAAL  71

Query  187  pslssisg------------sikgsgdesekQGDRDEVRPPLPVIRDVLY-DTAVIRGLP  327
             + +  +             +        ++QGD +EVR PLPV R+ LY D  ++   P
Sbjct  72   EAAALAAAEAEEGYRLAPPPAAALEDGMLQRQGDDEEVRAPLPVRRETLYGDVPMVVARP  131

Query  328  AMGGSAHEARSVVPFRNFEQEMKHPGVWETDK--ASNSADNLASLYRPPFALMYHGSFEK  501
                      S V FRNFE+E +   VW++++   S+S DNLASLYRPPF LM++G F+K
Sbjct  132  ---------NSTVAFRNFEEEARQSAVWDSEQNATSSSRDNLASLYRPPFDLMFNGPFDK  182

Query  502  AK  507
            AK
Sbjct  183  AK  184



>ref|XP_003580790.1| PREDICTED: UBX domain-containing protein 2 isoform X1 [Brachypodium 
distachyon]
Length=457

 Score =   114 bits (284),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 75/182 (41%), Positives = 103/182 (57%), Gaps = 26/182 (14%)
 Frame = +1

Query  7    LVASFLEIAVGQSADTARQFLQATSWKLEEALQLFYVGNDGGVAAPSSYSPLENTAPlpd  186
            LV+SFLEIA GQ+  TA QFLQ TSW LEEA+QLFY+  DG  A  +  +    ++    
Sbjct  14   LVSSFLEIAAGQTPHTATQFLQMTSWHLEEAVQLFYI--DGEAALAAHSAAAPASSAAAL  71

Query  187  pslssisg------------sikgsgdesekQGDRDEVRPPLPVIRDVLY-DTAVIRGLP  327
             + +  +             +        ++QGD +EVR PLPV R+ LY D  ++   P
Sbjct  72   EAAALAAAEAEEGYRLAPPPAAALEDGMLQRQGDDEEVRAPLPVRRETLYGDVPMVVARP  131

Query  328  AMGGSAHEARSVVPFRNFEQEMKHPGVWETDK--ASNSADNLASLYRPPFALMYHGSFEK  501
                      S V FRNFE+E +   VW++++   S+S DNLASLYRPPF LM++G F+K
Sbjct  132  ---------NSTVAFRNFEEEARQSAVWDSEQNATSSSRDNLASLYRPPFDLMFNGPFDK  182

Query  502  AK  507
            AK
Sbjct  183  AK  184



>dbj|BAK05667.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=453

 Score =   112 bits (279),  Expect = 7e-26, Method: Compositional matrix adjust.
 Identities = 77/181 (43%), Positives = 106/181 (59%), Gaps = 26/181 (14%)
 Frame = +1

Query  7    LVASFLEIAVGQSADTARQFLQATSWKLEEALQLFYVGNDGGVAAPSSYSPLENTAPlpd  186
            LV+SFLEIA GQ+  TA QFLQ TSW LEEALQLFY+  DG  A   ++ P+++ A    
Sbjct  14   LVSSFLEIAAGQTPHTAAQFLQMTSWHLEEALQLFYI--DGEAALAGAHPPVQSAAEAAL  71

Query  187  pslssisg-----------sikgsgdesekQGDRDEVRPPLPVIRDVLY-DTAVIRGLPA  330
             + ++ +            +        +  GD D+VR PLPV R+ LY DT  I   P 
Sbjct  72   AAAAAAAEVEEGFRYHPPPAAALEDGMLQGLGDDDDVRAPLPVRRETLYGDTPTIIARP-  130

Query  331  MGGSAHEARSVVPFRNFEQEMKHPGVWETDK--ASNSADNLASLYRPPFALMYHGSFEKA  504
               +A +A     FRNFE+E +    W++++   S+S+D LASLYRPPF LM++G F+KA
Sbjct  131  ---NATDA-----FRNFEEEARQ-SAWDSEQNATSSSSDKLASLYRPPFDLMFNGPFDKA  181

Query  505  K  507
            K
Sbjct  182  K  182



>gb|AEV41122.1| putative UBX domain-containing protein [Oryza officinalis]
Length=464

 Score =   110 bits (275),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 78/185 (42%), Positives = 105/185 (57%), Gaps = 29/185 (16%)
 Frame = +1

Query  7    LVASFLEIAVGQSADTARQFLQATSWKLEEALQLFYVGNDGGVAAPSSYSPLENTAPlpd  186
            LV+SFLEIA GQ+ +TA QFLQ TSW LEEALQLFY+  +  +AA  + SP    A    
Sbjct  14   LVSSFLEIAAGQTPETATQFLQMTSWHLEEALQLFYIDGEAALAAHPAPSPAAAAAAAEA  73

Query  187  pslssisgsikgsgde-----------sekQG--DRDEVRPPLPVIRDVLYDTA---VIR  318
             +++  + +                     QG  + D+VR PLP  R+ LY  A   V+R
Sbjct  74   AAVAVAAAAEVEDAMRFAPPPAAALGDGMLQGLGEEDDVRAPLPTKRETLYGDAPMVVVR  133

Query  319  GLPAMGGSAHEARSVVPFRNFEQEMKHPGVWETDK--ASNSADNLASLYRPPFALMYHGS  492
                         S V FRNFE+E +   VW++++  AS+S DNLA+LYRPPFALM++G 
Sbjct  134  -----------PNSTVAFRNFEEEARQSAVWDSEQNAASSSRDNLAALYRPPFALMFNGP  182

Query  493  FEKAK  507
            F+KAK
Sbjct  183  FDKAK  187



>emb|CAE02831.2| OSJNBa0043A12.36 [Oryza sativa Japonica Group]
 emb|CAH67698.1| H0624F09.6 [Oryza sativa Indica Group]
 dbj|BAG93324.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEC78226.1| hypothetical protein OsI_17866 [Oryza sativa Indica Group]
Length=459

 Score =   110 bits (275),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 76/184 (41%), Positives = 104/184 (57%), Gaps = 30/184 (16%)
 Frame = +1

Query  7    LVASFLEIAVGQSADTARQFLQATSWKLEEALQLFYVGNDGGVAAPSSYSPLENTAPlpd  186
            LV SFLEIA GQ+ +TA QFLQ TSW LEEALQLFY+  DG  A  +  +P    A    
Sbjct  14   LVTSFLEIAAGQTPETATQFLQMTSWHLEEALQLFYI--DGEAALAAHPAPSPAAAAEAA  71

Query  187  pslssisgsikgsgd------------esekQGDRDEVRPPLPVIRDVLYDTA---VIRG  321
             +  + +  ++ +                +  G+ ++VR PLP  R+ LY  A   V+R 
Sbjct  72   AAAVAAAAEVEDAMRFAPPPAAALGDGMLQGLGEEEDVRAPLPTKRETLYGDAPMVVVR-  130

Query  322  LPAMGGSAHEARSVVPFRNFEQEMKHPGVWETDK--ASNSADNLASLYRPPFALMYHGSF  495
                        S V FRNFE+E +   VW++++  AS+S DNLA+LYRPPFALM++G F
Sbjct  131  ----------PNSTVAFRNFEEESRQSAVWDSEQNAASSSRDNLAALYRPPFALMFNGPF  180

Query  496  EKAK  507
            +KAK
Sbjct  181  DKAK  184



>ref|XP_001758899.1| predicted protein [Physcomitrella patens]
 gb|EDQ76405.1| predicted protein [Physcomitrella patens]
Length=450

 Score =   102 bits (255),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 73/182 (40%), Positives = 102/182 (56%), Gaps = 13/182 (7%)
 Frame = +1

Query  1    QILVASFLEIAVGQSADTARQFLQATSWKLEEALQLFYVGNDGGVAAPSSYSPLENTAPl  180
            Q+++  F++I VG+SAD ARQFLQAT W L EA+QL++  N+    A +  +    +AP+
Sbjct  11   QLVMLEFMDI-VGESADRARQFLQATGWLLNEAVQLYFAENNEVGGANNDLAAPVVSAPV  69

Query  181  pdpslssisgsikgsgdesekQGDRDE-VRPPLPVIRDVLY-DTAVIRGLPAMGGSAHEA  354
                 +  S    GS   +++ GD +  VRPPLPV R+ LY D    R   A+   +H  
Sbjct  70   LPEQATLGSSLDPGSSTVNDRNGDNENYVRPPLPVKREALYEDMLQARVHQAVQYPSHSF  129

Query  355  RSVVPFRNFEQEMKHPGVWETDKAS--------NSADNLASLYRPPFALMYHGSFEKAKD  510
              V PFRNFE E      W   +AS        +S D+LA+LYRPPF  M+ G+FE+AK 
Sbjct  130  --VDPFRNFEDEANQQSSWGAGEASTHVGSAGGSSRDSLAALYRPPFVFMFQGTFEQAKT  187

Query  511  AA  516
             A
Sbjct  188  EA  189



>ref|XP_009759130.1| PREDICTED: UBX domain-containing protein 7-like [Nicotiana sylvestris]
Length=377

 Score = 97.4 bits (241),  Expect = 6e-21, Method: Compositional matrix adjust.
 Identities = 71/178 (40%), Positives = 94/178 (53%), Gaps = 44/178 (25%)
 Frame = +1

Query  1    QILVASFLEIAVGQSADTARQFLQATSWKLEEALQLFYVGNDGGVAAPSSYSPLENTAPl  180
            Q+L++SFLEIA+ Q+ADTARQFLQ T W LEEA+QLFY  N+  V  PS           
Sbjct  6    QMLISSFLEIAIDQTADTARQFLQTTKWNLEEAIQLFY--NNELVDNPS-----------  52

Query  181  pdpslssisgsikgsgdesekQGDRDEVRPPLPVIRDVLY---DTAVIRGLPAMGGSAHE  351
                            D+ +   D D+VRPPL V R+V+Y   +T    G      S+H 
Sbjct  53   ----------LNGDDDDDDDDDDDDDDVRPPLHVEREVIYGHNNTVQYNG----NSSSH-  97

Query  352  ARSVVPFRNFEQEM--KHPGVWETDKASNSADNLASLYRPPFALMYHGSFEKAKDAAR  519
                    NF+ E+  +   VW  ++     DNLAS+YRPPFAL+Y+G F  A D A+
Sbjct  98   --------NFDDEILSRLGDVWRVEERD---DNLASMYRPPFALIYNGPFNNAIDTAK  144



>ref|XP_010527852.1| PREDICTED: UBX domain-containing protein 2 isoform X2 [Tarenaya 
hassleriana]
Length=405

 Score = 96.7 bits (239),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 50/98 (51%), Positives = 61/98 (62%), Gaps = 11/98 (11%)
 Frame = +1

Query  256  DEVRPPLPVIRDVLYDTAVIRGLPAMGGSAHEARSVVPFRNFEQEMKHPGVWETDK----  423
            DEVRPPLPV+R+ LY  ++  G    G S  E+ S+V FRNF  E K PGVWE D+    
Sbjct  36   DEVRPPLPVVRETLYGDSMYYGAVRPGNSGQESNSLVAFRNFGDEAKRPGVWEPDQGASS  95

Query  424  -------ASNSADNLASLYRPPFALMYHGSFEKAKDAA  516
                    +   D+LASLYRPPF LM+ GSFE+AK AA
Sbjct  96   ASASGSEVATPRDSLASLYRPPFHLMFSGSFEQAKSAA  133



>gb|KGN50781.1| hypothetical protein Csa_5G259710 [Cucumis sativus]
Length=174

 Score = 94.0 bits (232),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 57/107 (53%), Positives = 70/107 (65%), Gaps = 0/107 (0%)
 Frame = +1

Query  1    QILVASFLEIAVGQSADTARQFLQATSWKLEEALQLFYVGNDGGVAAPSSYSPLENTAPl  180
            Q +V+SFLE+AVGQ+A+TARQFLQATSWKLE+A+QLFYVGN+GGV  P       +T   
Sbjct  11   QSMVSSFLEVAVGQTAETARQFLQATSWKLEDAIQLFYVGNEGGVVGPPPVPSPPSTNEQ  70

Query  181  pdpslssisgsikgsgdesekQGDRDEVRPPLPVIRDVLYDTAVIRG  321
             + S   IS                DEVRPPLPVIR+ LYD A++ G
Sbjct  71   INSSTDHISNESGKHAGPGTFGQYEDEVRPPLPVIREALYDDAMLYG  117



>gb|AAF63167.1|AC010657_3 T5E21.7 [Arabidopsis thaliana]
Length=514

 Score = 96.3 bits (238),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 58/109 (53%), Positives = 77/109 (71%), Gaps = 6/109 (6%)
 Frame = +1

Query  1    QILVASFLEIAVGQSADTARQFLQATSWKLEEALQLFYVGNDGGVAAPSSYS-PLENTAP  177
            Q LV+SFLEIAVGQ+A+TARQFLQATSWKLEEA+QLFY+GN+GG+    +++ P  N   
Sbjct  8    QRLVSSFLEIAVGQTAETARQFLQATSWKLEEAIQLFYIGNEGGMLQSGTHTQPASN---  64

Query  178  lpdpslssisgsikgsgdesekQGDRDEVRPPLPVIRDVLYDTAVIRGL  324
              D + +   G+  G+G+E     D DEVR PLPV+R+ LY  ++  GL
Sbjct  65   --DDAAAQSWGAATGTGNEMILPNDVDEVRAPLPVVRETLYGESMYYGL  111


 Score = 65.5 bits (158),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 35/78 (45%), Positives = 46/78 (59%), Gaps = 16/78 (21%)
 Frame = +1

Query  331  MGGSAHEARSVVPFRNFEQEMKHPGVWETDKASNSA----------------DNLASLYR  462
            +G S  E  S++ FRNF +E K PG+WE D+  +SA                D+LASLYR
Sbjct  168  VGNSQPEPNSLIAFRNFSEEPKSPGIWEPDEGDSSASASASASASESASAPRDSLASLYR  227

Query  463  PPFALMYHGSFEKAKDAA  516
            PPF LM+ GSFE+AK  +
Sbjct  228  PPFHLMFQGSFEQAKTTS  245



>ref|XP_006343881.1| PREDICTED: UBX domain-containing protein 7-like [Solanum tuberosum]
Length=424

 Score = 92.8 bits (229),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 62/174 (36%), Positives = 85/174 (49%), Gaps = 43/174 (25%)
 Frame = +1

Query  4    ILVASFLEIAVGQSADTARQFLQATSWKLEEALQLFYVGNDGG---VAAPSSYSPLENTA  174
            +L++SFL+IAV Q+ DTAR+FLQAT W LEEA+Q F+ GN+ G    A   +YSPL    
Sbjct  38   MLISSFLDIAVDQTVDTAREFLQATKWNLEEAIQRFFSGNNNGGAEAAESFNYSPLIEDN  97

Query  175  PlpdpslssisgsikgsgdesekQGDRDEVRPPLPVIRDVLYDTAVIRGLPAMGGSAHEA  354
            P    S                   D D+VR PLPV R+VLY            G   + 
Sbjct  98   PTLWESE------------------DDDDVRLPLPVRREVLYGEN--------SGLYEDE  131

Query  355  RSVVPFRNFEQEMKHPGVWETDKASNSADNLASLYRPPFALMYHGSFEKAKDAA  516
            R  +    F+              S   + L+ L+RPP+ L+Y+G F+ AK+A 
Sbjct  132  REQISSSTFD--------------SYDNNTLSVLFRPPYELLYNGPFDHAKEAG  171



>ref|XP_010325366.1| PREDICTED: LOW QUALITY PROTEIN: UBX domain-containing protein 
7-like [Solanum lycopersicum]
Length=375

 Score = 92.0 bits (227),  Expect = 6e-19, Method: Compositional matrix adjust.
 Identities = 61/174 (35%), Positives = 86/174 (49%), Gaps = 42/174 (24%)
 Frame = +1

Query  4    ILVASFLEIAVGQSADTARQFLQATSWKLEEALQLFYVGNDGGVAAPS---SYSPLENTA  174
            +L++SFL+IAV Q+ DTAR+FLQAT+W LEEA+Q F+ GN+ G  A +   +YSPL    
Sbjct  3    MLISSFLDIAVDQTVDTAREFLQATNWNLEEAIQRFFSGNNNGATAAAESFNYSPLIENT  62

Query  175  PlpdpslssisgsikgsgdesekQGDRDEVRPPLPVIRDVLYDTAVIRGLPAMGGSAHEA  354
            P                    E + D D+V  P PV R+V Y            G   + 
Sbjct  63   P-----------------TLREWEDDDDDVHLPSPVRREVFYGET--------SGLYEDE  97

Query  355  RSVVPFRNFEQEMKHPGVWETDKASNSADNLASLYRPPFALMYHGSFEKAKDAA  516
            R  +    F            D  SN+A  L+ L+RPP+  +Y+G F+ AK+A 
Sbjct  98   RDQISSSTF------------DSYSNNA--LSDLFRPPYEFLYNGPFDHAKEAG  137



>ref|XP_008801336.1| PREDICTED: UBX domain-containing protein 2-like [Phoenix dactylifera]
Length=340

 Score = 90.1 bits (222),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 57/172 (33%), Positives = 84/172 (49%), Gaps = 50/172 (29%)
 Frame = +1

Query  1    QILVASFLEIAVGQSADTARQFLQATSWKLEEALQLFYVGNDGGVAAPSSYSPLENTAPl  180
            Q+L++SFLEIA G S+D A ++LQAT+W+LE+A +LF+ G + G A              
Sbjct  11   QVLISSFLEIATGFSSDAAIKYLQATNWRLEDAFELFFAGGEPGTAFSDD----------  60

Query  181  pdpslssisgsikgsgdesekQGDRDEVRPPLPVIRDVLYDTAVIRGLPAMGGSAHEARS  360
                                 +   D V+PP+P+ R+VLY  A     P++     +A S
Sbjct  61   ---------------------RARDDGVQPPIPLKREVLYGPA-----PSLPSQCFDAES  94

Query  361  VVPFRNFEQEMKHPGVWETDKASNSADNLASLYRPPFALMYHGSFEKAKDAA  516
                           VW+++   ++   LASL+RPP  L+YHGSF  AK AA
Sbjct  95   --------------SVWKSEGGESNCSILASLFRPPSCLIYHGSFHDAKVAA  132



>tpg|DAA35438.1| TPA: hypothetical protein ZEAMMB73_856149 [Zea mays]
Length=426

 Score = 89.4 bits (220),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 61/163 (37%), Positives = 85/163 (52%), Gaps = 33/163 (20%)
 Frame = +1

Query  76   TSWKLEEALQLFYVGNDGGVAAPSSYSPLENTAPlpdpslssisgsikgsgdesekQ---  246
            TSW LEEALQLFY+  +      S+ +P    AP P  + +S   +  G+ +        
Sbjct  2    TSWHLEEALQLFYIDGE------SALTPAHPVAPPPTSAAASALAAAAGAEEAMRFAPPP  55

Query  247  --------------GDRDEVRPPLPVIRDVLYDTAVIRGLPAMGGSAHEARSVVPFRNFE  384
                          G+ D+VR PLPV R+ LY   ++        S     +   FRNFE
Sbjct  56   AAALGDAMLHGFGVGEDDDVRAPLPVKRETLYGEGIV--------SVMRPNASAAFRNFE  107

Query  385  QEMKHPGVWETDK--ASNSADNLASLYRPPFALMYHGSFEKAK  507
            QE +   VW++D+   S+S DNLASLYRPPF+LM++G F+KAK
Sbjct  108  QEARQSAVWDSDQNATSSSGDNLASLYRPPFSLMFNGPFDKAK  150



>gb|KDO53545.1| hypothetical protein CISIN_1g013325mg [Citrus sinensis]
Length=342

 Score = 86.3 bits (212),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 40/62 (65%), Positives = 50/62 (81%), Gaps = 5/62 (8%)
 Frame = +1

Query  346  HEARSVVPFRNFEQEMKHPGVWETDK-----ASNSADNLASLYRPPFALMYHGSFEKAKD  510
            HE  S++ FRNF++EMK PGVWE+++     A +S DNLASLYRPPF LM++GSFEKAKD
Sbjct  13   HEPSSLIAFRNFDEEMKRPGVWESEQGAASTADSSRDNLASLYRPPFHLMFNGSFEKAKD  72

Query  511  AA  516
            AA
Sbjct  73   AA  74



>ref|XP_008342902.1| PREDICTED: LOW QUALITY PROTEIN: membrane-associated progesterone 
receptor component 1-like [Malus domestica]
Length=249

 Score = 84.3 bits (207),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 44/79 (56%), Positives = 53/79 (67%), Gaps = 7/79 (9%)
 Frame = +1

Query  256  DEVRPPLPVIRDVLYDTAVIRGLPAMGGSAHEARSVVPFRNFEQEMKHPGVWETDKASNS  435
            DEVR P+PVIRDVL+D   + G P    S  +  SV+ FRNFE+EMKHPGV E+D+   S
Sbjct  41   DEVRXPMPVIRDVLFDDMSLYGAPRARFS--QQGSVIAFRNFEEEMKHPGVXESDQGDTS  98

Query  436  A-----DNLASLYRPPFAL  477
            +     DNLASLYRPP  L
Sbjct  99   SANAVQDNLASLYRPPVQL  117



>ref|XP_006414812.1| hypothetical protein EUTSA_v10027208mg, partial [Eutrema salsugineum]
 gb|ESQ56265.1| hypothetical protein EUTSA_v10027208mg, partial [Eutrema salsugineum]
Length=394

 Score = 85.5 bits (210),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 55/170 (32%), Positives = 82/170 (48%), Gaps = 34/170 (20%)
 Frame = +1

Query  1    QILVASFLEIAVGQSADTARQFLQATSWKLEEALQLFYV-GNDGGVAAPSSYSPLENTAP  177
            Q L++SF+EIAVGQ+ +TA QFL+ATSW LE+A+ LF V G +  ++ P + S       
Sbjct  12   QRLISSFIEIAVGQTIETALQFLKATSWNLEDAINLFLVHGQNQTLSYPQNSS-------  64

Query  178  lpdpslssisgsikgsgdesekQGDRDEVRPPLPVIRDVLYDTAVIRGLPAMGGSAHEAR  357
                                    + +++ PPLP IRD LYD++ +     +     E  
Sbjct  65   ----------------EQYWSDNQEEEQIHPPLPSIRDTLYDSSSMHHQTTVQVGPEE--  106

Query  358  SVVPFRNFEQEMKHPGVWETDKASNSADNLASLYRPPFALMYHGSFEKAK  507
                  + +QE    G        +    L++LYRPP  L++ GSFE AK
Sbjct  107  ----IWDLKQEPSDSG----SVVGSEGSRLSTLYRPPLKLLFQGSFEDAK  148



>ref|XP_009599661.1| PREDICTED: UBX domain-containing protein 7 homolog [Nicotiana 
tomentosiformis]
Length=367

 Score = 84.7 bits (208),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 65/177 (37%), Positives = 87/177 (49%), Gaps = 52/177 (29%)
 Frame = +1

Query  1    QILVASFLEIAVGQSADTARQFLQATSWKLEEALQLFYVGNDGGVAAPSSYSPLENTAPl  180
            Q+LV+SFLEIAV Q+ADTAR+FLQ TSW LEEA+QLFY  N+  V  PS     +N    
Sbjct  6    QMLVSSFLEIAVDQTADTARRFLQTTSWNLEEAIQLFY--NNELVHNPSLNGAADNWGQY  63

Query  181  pdpslssisgsikgsgdesekQGDRDEVRPPLPVIRDVLYDTAVIRGLPAMG-GSAHEAR  357
               ++                                  ++ AV    P +G GS+H   
Sbjct  64   DGDNVDDDD------------------------------HNIAV----PYIGNGSSH---  86

Query  358  SVVPFRNFEQEM--KHPG-VWETDKASNSADNLASLYRPPFALMYHGSFEKAKDAAR  519
                  N E ++    PG VW  ++     DNL+S+YRPPFAL+Y+G F  A D A+
Sbjct  87   ------NLENKILSSRPGDVWRVEERD---DNLSSMYRPPFALLYNGPFNNAIDTAK  134



>ref|XP_010253434.1| PREDICTED: UBX domain-containing protein 7-like [Nelumbo nucifera]
Length=361

 Score = 83.6 bits (205),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 62/170 (36%), Positives = 78/170 (46%), Gaps = 67/170 (39%)
 Frame = +1

Query  7    LVASFLEIAVGQSADTARQFLQATSWKLEEALQLFYVGNDGGVAAPSSYSPLENTAPlpd  186
            LV+SFL I VGQSA TA QFL+AT W LEEA++LFY G                      
Sbjct  13   LVSSFLGIVVGQSAQTAIQFLEATGWNLEEAIRLFYAGL---------------------  51

Query  187  pslssisgsikgsgdesekQGDRDEVRPPLPVIRDVLYDTAVIRGLPAMGGSAHEARSVV  366
                                  +D VRPPLPV R+ L D               E+   +
Sbjct  52   ----------------------QDNVRPPLPVKREKLCD---------------ESDHPM  74

Query  367  PFRNFEQEMKHPGVWETDKASNSADNLASLYRPPFALMYHGSFEKAKDAA  516
            P RN      H  VWE+ ++ +S  +LASLYRPP  L+Y G+F +AK  A
Sbjct  75   P-RN------HSNVWESGRSHSS--DLASLYRPPVELLYQGTFHEAKGEA  115



>ref|XP_009601783.1| PREDICTED: uncharacterized protein LOC104097000 isoform X1 [Nicotiana 
tomentosiformis]
Length=369

 Score = 82.0 bits (201),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 40/58 (69%), Positives = 48/58 (83%), Gaps = 0/58 (0%)
 Frame = +1

Query  1    QILVASFLEIAVGQSADTARQFLQATSWKLEEALQLFYVGNDGGVAAPSSYSPLENTA  174
            Q+LV+SFLEIAVGQ+A+TARQFLQATSW LEEA+QL Y+GN+GG AA  +   L N A
Sbjct  11   QMLVSSFLEIAVGQNANTARQFLQATSWNLEEAIQLSYIGNEGGAAASVNSPQLGNDA  68


 Score = 66.2 bits (160),  Expect = 8e-10, Method: Compositional matrix adjust.
 Identities = 34/56 (61%), Positives = 37/56 (66%), Gaps = 5/56 (9%)
 Frame = +1

Query  349  EARSVVPFRNFEQEMKHPGVWETDKASN-----SADNLASLYRPPFALMYHGSFEK  501
            E R V P  NFE+EMK PGV E +K S      + DNLASL  PPFALMYHG FEK
Sbjct  86   EPRLVAPSCNFEEEMKRPGVLEAEKRSTPTTDAAQDNLASLCHPPFALMYHGPFEK  141



>gb|KDO48110.1| hypothetical protein CISIN_1g021440mg [Citrus sinensis]
Length=312

 Score = 80.9 bits (198),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 63/172 (37%), Positives = 79/172 (46%), Gaps = 54/172 (31%)
 Frame = +1

Query  10   VASFLEIAVGQSADTARQFLQATSWKLEEALQLFYVGNDGGVAAPSSYSPLENTAPlpdp  189
            ++SFLEIAVG S  TA + LQATSWKL+EA+ LF+  N+    AP SYS L   A     
Sbjct  12   ISSFLEIAVGASGVTAIECLQATSWKLDEAILLFFAVNEADATAPPSYSALAENA-----  66

Query  190  slssisgsikgsgdesekQGDRD---EVRPPLPVIRDVLYDTAVIRGLPAMGGSAHEARS  360
                         D++   G +D   EV  P P  +D+ Y+ A                 
Sbjct  67   ---------NSRPDQNLVTGGQDGGYEVCVP-PHAKDLFYNDA-----------------  99

Query  361  VVPFRNFEQEMKHPGVWETDKASNSADNLASLYRPPFALMYHGSFEKAKDAA  516
                                    S D LASLYRPPF +M++GSFEKAKDAA
Sbjct  100  -------------------STTDTSHDILASLYRPPFHVMFNGSFEKAKDAA  132



>ref|XP_006653862.1| PREDICTED: UBX domain-containing protein 2-like [Oryza brachyantha]
Length=380

 Score = 81.6 bits (200),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 44/88 (50%), Positives = 60/88 (68%), Gaps = 10/88 (11%)
 Frame = +1

Query  250  DRDEVRPPLPVIRDVLYDTAVIRGLPAMGGSAHEARSVVPFRNFEQEMKHPGVWETDK--  423
            + ++VR PLPV R+ LY  A     PA+    H   S V FRNFE+E +   VW++++  
Sbjct  24   EEEDVRAPLPVKRETLYGDA-----PAV---VHRPNSTVAFRNFEEEARQSAVWDSEQNA  75

Query  424  ASNSADNLASLYRPPFALMYHGSFEKAK  507
            AS+S DNLA+LYRPPFALM++G F+KAK
Sbjct  76   ASSSRDNLAALYRPPFALMFNGPFDKAK  103



>gb|KDO48111.1| hypothetical protein CISIN_1g021440mg [Citrus sinensis]
Length=305

 Score = 80.9 bits (198),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 63/172 (37%), Positives = 79/172 (46%), Gaps = 54/172 (31%)
 Frame = +1

Query  10   VASFLEIAVGQSADTARQFLQATSWKLEEALQLFYVGNDGGVAAPSSYSPLENTAPlpdp  189
            ++SFLEIAVG S  TA + LQATSWKL+EA+ LF+  N+    AP SYS L   A     
Sbjct  12   ISSFLEIAVGASGVTAIECLQATSWKLDEAILLFFAVNEADATAPPSYSALAENA-----  66

Query  190  slssisgsikgsgdesekQGDRD---EVRPPLPVIRDVLYDTAVIRGLPAMGGSAHEARS  360
                         D++   G +D   EV  P P  +D+ Y+ A                 
Sbjct  67   ---------NSRPDQNLVTGGQDGGYEVCVP-PHAKDLFYNDA-----------------  99

Query  361  VVPFRNFEQEMKHPGVWETDKASNSADNLASLYRPPFALMYHGSFEKAKDAA  516
                                    S D LASLYRPPF +M++GSFEKAKDAA
Sbjct  100  -------------------STTDTSHDILASLYRPPFHVMFNGSFEKAKDAA  132



>ref|XP_006480638.1| PREDICTED: UBX domain-containing protein 7-like isoform X4 [Citrus 
sinensis]
Length=212

 Score = 79.7 bits (195),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 62/172 (36%), Positives = 78/172 (45%), Gaps = 54/172 (31%)
 Frame = +1

Query  10   VASFLEIAVGQSADTARQFLQATSWKLEEALQLFYVGNDGGVAAPSSYSPLENTAPlpdp  189
            ++SFLEIAVG S  TA + LQATSWKL+EA+ LF+  N+     P SYS L   A     
Sbjct  31   ISSFLEIAVGASGVTAIECLQATSWKLDEAILLFFAVNEADATVPPSYSALAENA-----  85

Query  190  slssisgsikgsgdesekQGDRD---EVRPPLPVIRDVLYDTAVIRGLPAMGGSAHEARS  360
                         D++   G +D   EV  P P  +D+ Y+ A                 
Sbjct  86   ---------NSRPDQNLVTGGQDGGYEVCVP-PHAKDLFYNDA-----------------  118

Query  361  VVPFRNFEQEMKHPGVWETDKASNSADNLASLYRPPFALMYHGSFEKAKDAA  516
                                    S D LASLYRPPF +M++GSFEKAKDAA
Sbjct  119  -------------------STTDTSHDILASLYRPPFHVMFNGSFEKAKDAA  151



>ref|XP_009139538.1| PREDICTED: UBX domain-containing protein 2 [Brassica rapa]
Length=427

 Score = 81.6 bits (200),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 54/179 (30%), Positives = 83/179 (46%), Gaps = 39/179 (22%)
 Frame = +1

Query  1    QILVASFLEIAVGQSADTARQFLQATSWKLEEALQLFYVGNDGGVAAPSSYSPLENTAPl  180
            Q L++SF+EIA+GQ+ DTA QFL+ TSW LEEA+ LF +  +       + + L  +   
Sbjct  6    QKLISSFMEIAIGQTKDTAIQFLKETSWNLEEAINLFLIHRENQPQRQQNATELHRS---  62

Query  181  pdpslssisgsikgsgdesekQGDRDEVRPPLPVIRDVLYDTAVIRGLPAMGGSAHEARS  360
                                   + + + PPLP IRD LYD++ +   P           
Sbjct  63   --------------------DYQEEEHIPPPLPSIRDTLYDSSYMYQTPVQ---------  93

Query  361  VVPFRNFEQEMKHPGVWETD-------KASNSADNLASLYRPPFALMYHGSFEKAKDAA  516
            V P   ++ E +     +TD       + S     L+SLYR P  L++ G+FE+AK  +
Sbjct  94   VCPEEIWDAESEPSEDSDTDVGPDSKPEPSEEPRRLSSLYRAPLKLLFQGTFEEAKSTS  152



>ref|XP_006480635.1| PREDICTED: UBX domain-containing protein 7-like isoform X1 [Citrus 
sinensis]
Length=294

 Score = 79.7 bits (195),  Expect = 7e-15, Method: Compositional matrix adjust.
 Identities = 62/172 (36%), Positives = 78/172 (45%), Gaps = 54/172 (31%)
 Frame = +1

Query  10   VASFLEIAVGQSADTARQFLQATSWKLEEALQLFYVGNDGGVAAPSSYSPLENTAPlpdp  189
            ++SFLEIAVG S  TA + LQATSWKL+EA+ LF+  N+     P SYS L   A     
Sbjct  31   ISSFLEIAVGASGVTAIECLQATSWKLDEAILLFFAVNEADATVPPSYSALAENA-----  85

Query  190  slssisgsikgsgdesekQGDRD---EVRPPLPVIRDVLYDTAVIRGLPAMGGSAHEARS  360
                         D++   G +D   EV  P P  +D+ Y+ A                 
Sbjct  86   ---------NSRPDQNLVTGGQDGGYEVCVP-PHAKDLFYNDA-----------------  118

Query  361  VVPFRNFEQEMKHPGVWETDKASNSADNLASLYRPPFALMYHGSFEKAKDAA  516
                                    S D LASLYRPPF +M++GSFEKAKDAA
Sbjct  119  -------------------STTDTSHDILASLYRPPFHVMFNGSFEKAKDAA  151



>emb|CDX84023.1| BnaC08g16220D [Brassica napus]
Length=458

 Score = 81.6 bits (200),  Expect = 7e-15, Method: Compositional matrix adjust.
 Identities = 62/185 (34%), Positives = 92/185 (50%), Gaps = 21/185 (11%)
 Frame = +1

Query  1    QILVASFLEIAVGQSADTARQFLQATSWKLEEALQLFYVGNDGGVAAPSSYSPLENTAPl  180
            Q LV+SFL+IAVGQ+A+TARQFLQ+  ++ +E  Q   + N    +      P +  + +
Sbjct  8    QRLVSSFLDIAVGQTAETARQFLQSRRYERKEFFQTDLLKNRSMRSKNRRRLPHKEKSSI  67

Query  181  pdpslssisgsikgsgdesekQGDRDEVRPPLPVIRDVLYDT------AVIRGLPAMGGS  342
                    +                + V+  L  +R+ LY        ++  G   +G  
Sbjct  68   RYCLEIFRTLKTTNIATSWNLN---EAVQ--LFYVRETLYGDPMYYGDSMYFGYTMLGNY  122

Query  343  AHEARSVVPFRNFEQEMKHPGVWETDKASNSA----------DNLASLYRPPFALMYHGS  492
              E  S++ F +F +E K PGVWE D+ ++SA           +LASLYRPPF LM HGS
Sbjct  123  ERELVSLIDFLDFSEEPKRPGVWEPDEVASSASASASTSGPRHSLASLYRPPFHLMTHGS  182

Query  493  FEKAK  507
            FE+AK
Sbjct  183  FEQAK  187



>ref|XP_006480637.1| PREDICTED: UBX domain-containing protein 7-like isoform X3 [Citrus 
sinensis]
Length=275

 Score = 79.7 bits (195),  Expect = 7e-15, Method: Compositional matrix adjust.
 Identities = 62/172 (36%), Positives = 78/172 (45%), Gaps = 54/172 (31%)
 Frame = +1

Query  10   VASFLEIAVGQSADTARQFLQATSWKLEEALQLFYVGNDGGVAAPSSYSPLENTAPlpdp  189
            ++SFLEIAVG S  TA + LQATSWKL+EA+ LF+  N+     P SYS L   A     
Sbjct  12   ISSFLEIAVGASGVTAIECLQATSWKLDEAILLFFAVNEADATVPPSYSALAENA-----  66

Query  190  slssisgsikgsgdesekQGDRD---EVRPPLPVIRDVLYDTAVIRGLPAMGGSAHEARS  360
                         D++   G +D   EV  P P  +D+ Y+ A                 
Sbjct  67   ---------NSRPDQNLVTGGQDGGYEVCVP-PHAKDLFYNDA-----------------  99

Query  361  VVPFRNFEQEMKHPGVWETDKASNSADNLASLYRPPFALMYHGSFEKAKDAA  516
                                    S D LASLYRPPF +M++GSFEKAKDAA
Sbjct  100  -------------------STTDTSHDILASLYRPPFHVMFNGSFEKAKDAA  132



>ref|XP_006480636.1| PREDICTED: UBX domain-containing protein 7-like isoform X2 [Citrus 
sinensis]
Length=278

 Score = 79.7 bits (195),  Expect = 8e-15, Method: Compositional matrix adjust.
 Identities = 62/172 (36%), Positives = 78/172 (45%), Gaps = 54/172 (31%)
 Frame = +1

Query  10   VASFLEIAVGQSADTARQFLQATSWKLEEALQLFYVGNDGGVAAPSSYSPLENTAPlpdp  189
            ++SFLEIAVG S  TA + LQATSWKL+EA+ LF+  N+     P SYS L   A     
Sbjct  31   ISSFLEIAVGASGVTAIECLQATSWKLDEAILLFFAVNEADATVPPSYSALAENA-----  85

Query  190  slssisgsikgsgdesekQGDRD---EVRPPLPVIRDVLYDTAVIRGLPAMGGSAHEARS  360
                         D++   G +D   EV  P P  +D+ Y+ A                 
Sbjct  86   ---------NSRPDQNLVTGGQDGGYEVCVP-PHAKDLFYNDA-----------------  118

Query  361  VVPFRNFEQEMKHPGVWETDKASNSADNLASLYRPPFALMYHGSFEKAKDAA  516
                                    S D LASLYRPPF +M++GSFEKAKDAA
Sbjct  119  -------------------STTDTSHDILASLYRPPFHVMFNGSFEKAKDAA  151



>ref|XP_009601784.1| PREDICTED: uncharacterized protein LOC104097000 isoform X2 [Nicotiana 
tomentosiformis]
Length=358

 Score = 80.5 bits (197),  Expect = 8e-15, Method: Compositional matrix adjust.
 Identities = 39/57 (68%), Positives = 46/57 (81%), Gaps = 0/57 (0%)
 Frame = +1

Query  4    ILVASFLEIAVGQSADTARQFLQATSWKLEEALQLFYVGNDGGVAAPSSYSPLENTA  174
            +LV+SFLEIAVGQ+ADT RQFLQATSW LEEA+QL Y+GN+GG AA  +   L N A
Sbjct  1    MLVSSFLEIAVGQTADTVRQFLQATSWNLEEAIQLSYIGNEGGAAASVNSPQLGNDA  57


 Score = 66.2 bits (160),  Expect = 8e-10, Method: Compositional matrix adjust.
 Identities = 34/56 (61%), Positives = 37/56 (66%), Gaps = 5/56 (9%)
 Frame = +1

Query  349  EARSVVPFRNFEQEMKHPGVWETDKASN-----SADNLASLYRPPFALMYHGSFEK  501
            E R V P  NFE+EMK PGV E +K S      + DNLASL  PPFALMYHG FEK
Sbjct  75   EPRLVAPSCNFEEEMKRPGVLEAEKRSTPTTDAAQDNLASLCHPPFALMYHGPFEK  130



>gb|EEE61882.1| hypothetical protein OsJ_16574 [Oryza sativa Japonica Group]
Length=421

 Score = 79.3 bits (194),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 43/92 (47%), Positives = 59/92 (64%), Gaps = 16/92 (17%)
 Frame = +1

Query  247  GDRDEVRPPLPVIRDVLYDTA---VIRGLPAMGGSAHEARSVVPFRNFEQEMKHPGVWET  417
            G+ ++VR PLP  R+ LY  A   V+R             S V FRNFE+E +   VW++
Sbjct  104  GEEEDVRAPLPTKRETLYGDAPMVVVR-----------PNSTVAFRNFEEESRQSAVWDS  152

Query  418  DK--ASNSADNLASLYRPPFALMYHGSFEKAK  507
            ++  AS+S DNLA+LYRPPFALM++G F+KAK
Sbjct  153  EQNAASSSRDNLAALYRPPFALMFNGPFDKAK  184



>gb|AIE88273.1| hypothetical protein OG_BBa0063K01.4 [Oryza glaberrima]
Length=540

 Score = 78.2 bits (191),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 43/92 (47%), Positives = 59/92 (64%), Gaps = 16/92 (17%)
 Frame = +1

Query  247  GDRDEVRPPLPVIRDVLYDTA---VIRGLPAMGGSAHEARSVVPFRNFEQEMKHPGVWET  417
            G+ ++VR PLP  R+ LY  A   V+R             S V FRNFE+E +   VW++
Sbjct  185  GEEEDVRAPLPTKRETLYGDAPMVVVR-----------PNSTVAFRNFEEESRQSAVWDS  233

Query  418  DK--ASNSADNLASLYRPPFALMYHGSFEKAK  507
            ++  AS+S DNLA+LYRPPFALM++G F+KAK
Sbjct  234  EQNAASSSRDNLAALYRPPFALMFNGPFDKAK  265



>gb|EMT10976.1| hypothetical protein F775_30110 [Aegilops tauschii]
Length=396

 Score = 76.6 bits (187),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 44/90 (49%), Positives = 58/90 (64%), Gaps = 13/90 (14%)
 Frame = +1

Query  247  GDRDEVRPPLPVIRDVLY-DTAVIRGLPAMGGSAHEARSVVPFRNFEQEMKHPGVWETDK  423
            GD D+VR PLPV R+ LY DT +I   P          + V FRNFE+E +    W++++
Sbjct  43   GDDDDVRAPLPVRRETLYGDTPMIVTRP---------NATVAFRNFEEEARQ-SAWDSEQ  92

Query  424  --ASNSADNLASLYRPPFALMYHGSFEKAK  507
               S+S DNLASLYRPPF LM++G F+KAK
Sbjct  93   NATSSSRDNLASLYRPPFDLMFNGPFDKAK  122



>emb|CDY01207.1| BnaA04g06120D [Brassica napus]
Length=789

 Score = 77.8 bits (190),  Expect = 3e-13, Method: Composition-based stats.
 Identities = 52/173 (30%), Positives = 79/173 (46%), Gaps = 53/173 (31%)
 Frame = +1

Query  1    QILVASFLEIAVGQSADTARQFLQATSWKLEEALQLFYVGNDGGVAAPSSYSPLENTAPl  180
            Q L++SF+EIA+GQ+ DTA QFL+ TSW LEEA+ LF +  +                  
Sbjct  6    QKLISSFMEIAIGQTKDTAIQFLKETSWNLEEAINLFLIHREN-----------------  48

Query  181  pdpslssisgsikgsgdesekQGDRDE-VRPPLPVIRDVLYDTAVIRGLPAMGGSAHEAR  357
                                 Q  ++E + PPLP IRD LYD++ +   P          
Sbjct  49   ---------------------QPQQEEHIPPPLPSIRDTLYDSSYMYQTPV---------  78

Query  358  SVVPFRNFEQEMKHPGVWETDKASNSADNLASLYRPPFALMYHGSFEKAKDAA  516
             V P   ++ E +      ++ +      L+SLYR P  L++ G+FE+AK  +
Sbjct  79   QVCPEEIWDAESE-----PSEDSDTDPRRLSSLYRAPLKLLFQGTFEEAKSTS  126



>gb|EMS63720.1| UBX domain-containing protein 7 [Triticum urartu]
Length=454

 Score = 77.0 bits (188),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 44/90 (49%), Positives = 58/90 (64%), Gaps = 13/90 (14%)
 Frame = +1

Query  247  GDRDEVRPPLPVIRDVLY-DTAVIRGLPAMGGSAHEARSVVPFRNFEQEMKHPGVWETDK  423
            GD D+VR PLPV R+ LY DT +I   P          + V FRNFE+E +    W++++
Sbjct  101  GDEDDVRAPLPVRRETLYGDTPMIVTRP---------NATVAFRNFEEEARQ-SAWDSEQ  150

Query  424  --ASNSADNLASLYRPPFALMYHGSFEKAK  507
               S+S DNLASLYRPPF LM++G F+KAK
Sbjct  151  NATSSSRDNLASLYRPPFDLMFNGPFDKAK  180



>emb|CDY68911.1| BnaAnng28760D [Brassica napus]
Length=385

 Score = 74.7 bits (182),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 41/92 (45%), Positives = 55/92 (60%), Gaps = 10/92 (11%)
 Frame = +1

Query  250  DRDEVRPPLPVIRDVLYDTAVIRGLPAMGGSAHEARSVVPFRNFEQEMKHPGVWETDKAS  429
            D D VR PLPV+ + LY  ++      +G    E  S++ F +F +E K  GVWE D+  
Sbjct  30   DADGVRAPLPVVTETLYRDSMYY----VGNYERELASLIDFIDFSEEPKRSGVWEPDEVG  85

Query  430  NSA------DNLASLYRPPFALMYHGSFEKAK  507
            +SA      ++LASLYRPPF LM HGSFE+ K
Sbjct  86   SSASTSGPRNSLASLYRPPFHLMTHGSFEQVK  117



>ref|XP_006414811.1| hypothetical protein EUTSA_v10027532mg [Eutrema salsugineum]
 gb|ESQ56264.1| hypothetical protein EUTSA_v10027532mg [Eutrema salsugineum]
Length=448

 Score = 73.6 bits (179),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 53/170 (31%), Positives = 82/170 (48%), Gaps = 35/170 (21%)
 Frame = +1

Query  1    QILVASFLEIAVGQSADTARQFLQATSWKLEEALQLFYVGNDGGVAAPSSYSPLENTAPl  180
            Q L+++F+EIAVGQ+ +TA+ FL+ T+W LEEA+ LF +        P SY         
Sbjct  11   QKLISTFMEIAVGQTKETAQLFLKTTNWNLEEAINLFLIDRKN---KPLSY---------  58

Query  181  pdpslssisgsikgsgdesekQGDRDEVRPPLPVIRDVLYDTAVIRGLPAMGGSAHEARS  360
                          S     ++ + +++  PL   RD LY ++ IR  P           
Sbjct  59   ------------HNSYLSDYQEEEEEQIPLPLSSTRDTLYGSSSIRRTPVQ---------  97

Query  361  VVPFRNFEQEMKHPGVWETDKASNSADN-LASLYRPPFALMYHGSFEKAK  507
            V P   +  + + P   ++D    S ++ L+SLYRPP  L++ GSFE AK
Sbjct  98   VRPEEIWNSKTE-PSDSDSDSVVGSKESKLSSLYRPPLKLLFKGSFEDAK  146



>ref|XP_006470475.1| PREDICTED: UBX domain-containing protein 7-like [Citrus sinensis]
Length=397

 Score = 71.6 bits (174),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 56/182 (31%), Positives = 79/182 (43%), Gaps = 64/182 (35%)
 Frame = +1

Query  7    LVASFLEIAVGQSADTARQFLQATSWKLEEALQLFYVGNDGGVAAPSSYSPLENTAPlpd  186
            +++SFLEI  GQ+ +TA + L AT+W L+EA+  F   N+        Y           
Sbjct  13   VISSFLEITNGQTEETAVKILNATNWNLDEAILRF--NNNSNNIDEDEYE----------  60

Query  187  pslssisgsikgsgdesekQGDRDEVRPPLPVIRDVLYDTAVIRGLPAMGGSAHEARSVV  366
                              +    DEVRPPLPV++D L                       
Sbjct  61   -----------------VEVDIEDEVRPPLPVVKDTL----------------------C  81

Query  367  PFRNFEQEMKHPGVWETDKASN------------SADNLASLYRPPFALMYHGSFEKAKD  510
             +  + Q+ K+P VWE++  S             + +NLASLYRPP  LM++GSFEKAKD
Sbjct  82   YYPQYYQQ-KNPEVWESEDNSEVWGSEEPSDNKNNNNNLASLYRPPVDLMFNGSFEKAKD  140

Query  511  AA  516
              
Sbjct  141  VG  142



>ref|XP_006446591.1| hypothetical protein CICLE_v10017670mg [Citrus clementina]
 gb|ESR59831.1| hypothetical protein CICLE_v10017670mg [Citrus clementina]
Length=369

 Score = 70.9 bits (172),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 55/182 (30%), Positives = 81/182 (45%), Gaps = 64/182 (35%)
 Frame = +1

Query  7    LVASFLEIAVGQSADTARQFLQATSWKLEEALQLFYVGNDGGVAAPSSYSPLENTAPlpd  186
            +++SFLEI  GQ+ +TA + L AT+W L+EA+ L +  N   +    +   ++       
Sbjct  13   VISSFLEITNGQTEETAVKILNATNWNLDEAI-LRFNNNSNNIDEDENEVEVD-------  64

Query  187  pslssisgsikgsgdesekQGDRDEVRPPLPVIRDVLYDTAVIRGLPAMGGSAHEARSVV  366
                                   DEVRPPLPV++D L                       
Sbjct  65   ---------------------IEDEVRPPLPVVKDTL----------------------C  81

Query  367  PFRNFEQEMKHPGVWETDKASN------------SADNLASLYRPPFALMYHGSFEKAKD  510
             +  + Q+ K+P VWE++  S             + +NLASLYRPP  LM++GSFEKAKD
Sbjct  82   YYPQYYQQ-KNPEVWESEDNSEVWGSEEPSDNKNNNNNLASLYRPPVDLMFNGSFEKAKD  140

Query  511  AA  516
              
Sbjct  141  VG  142



>ref|XP_003604178.1| UBX domain-containing protein [Medicago truncatula]
 gb|ACJ84042.1| unknown [Medicago truncatula]
 gb|AES86375.1| UBX domain protein [Medicago truncatula]
Length=286

 Score = 69.7 bits (169),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 59/174 (34%), Positives = 75/174 (43%), Gaps = 73/174 (42%)
 Frame = +1

Query  1    QILVASFLEIAVGQSADTARQFLQATSWKLEEALQLFYVGNDGGVAAPSSYSPLENTAPl  180
            + LV+ FLEIA GQ+A TA+ FLQATSW LEEAL+LF  G         +  PL +TA  
Sbjct  13   ETLVSYFLEIARGQTAATAKHFLQATSWNLEEALKLFLSG---------TKPPLMDTA--  61

Query  181  pdpslssisgsikgsgdesekQGDRDEVRP--PLPVIRDVLYDTAVIRGLPAMGGSAHEA  354
                                     +++ P  PLP+I++ L                   
Sbjct  62   -------------------------NQIDPSSPLPLIKETL-------------------  77

Query  355  RSVVPFRNFEQEMKHPGVWETDKASNSADNLASLYRPPFALMYHGSFEKAKDAA  516
                     E E       E+DK       LA LY PPF LM++GSF KAK AA
Sbjct  78   ---------ESEQGASSTSESDK-------LAYLYHPPFHLMFNGSFIKAKFAA  115



>gb|KDO55137.1| hypothetical protein CISIN_1g036413mg [Citrus sinensis]
Length=346

 Score = 69.7 bits (169),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 55/182 (30%), Positives = 79/182 (43%), Gaps = 64/182 (35%)
 Frame = +1

Query  7    LVASFLEIAVGQSADTARQFLQATSWKLEEALQLFYVGNDGGVAAPSSYSPLENTAPlpd  186
            +++SFLEI  GQ+ +TA + L AT+W L++A+  F   N+        Y           
Sbjct  13   VISSFLEITNGQTEETALKILNATNWNLDKAILRF--NNNSNNIDEDEYE----------  60

Query  187  pslssisgsikgsgdesekQGDRDEVRPPLPVIRDVLYDTAVIRGLPAMGGSAHEARSVV  366
                              +    DEVRPPLPV++D L                       
Sbjct  61   -----------------VEVDIEDEVRPPLPVVKDTL----------------------C  81

Query  367  PFRNFEQEMKHPGVWETDKASN------------SADNLASLYRPPFALMYHGSFEKAKD  510
             +  + Q+ K+P VWE++  S             + +NLASLYRPP  LM++GSFEKAKD
Sbjct  82   YYPQYYQQ-KNPEVWESEDNSEVWGSEEPSDNKNNNNNLASLYRPPVDLMFNGSFEKAKD  140

Query  511  AA  516
              
Sbjct  141  VG  142



>ref|XP_006414754.1| hypothetical protein EUTSA_v10027144mg, partial [Eutrema salsugineum]
 gb|ESQ56207.1| hypothetical protein EUTSA_v10027144mg, partial [Eutrema salsugineum]
Length=388

 Score = 67.8 bits (164),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 50/159 (31%), Positives = 73/159 (46%), Gaps = 36/159 (23%)
 Frame = +1

Query  37   GQSADTARQFLQATSWKLEEALQLFYV-GNDGGVAAPSSYSPLENTAPlpdpslssisgs  213
             Q+ +TA+QFL+ATSW LE+A+ LF V G +  ++ P + S                   
Sbjct  2    SQTIETAQQFLKATSWNLEDAINLFLVHGQNKTLSYPQNSS-------------------  42

Query  214  ikgsgdesekQGDRDEVRPPLPVIRDVLYDTAVIRGLPAMGGSAHEARSVVPFRNFEQEM  393
                        +  ++ PPLP IRD LYD++ +   P +     E        + +QE 
Sbjct  43   ----EQYWSDYQEEQQIPPPLPSIRDTLYDSSSMYHQPPVQVGPEE------IWDLKQEA  92

Query  394  KHPGVWETDKASNSADN-LASLYRPPFALMYHGSFEKAK  507
               G         S D+ L+SLYRPP  L++ GSFE AK
Sbjct  93   SDSG-----SVVGSEDSRLSSLYRPPLKLLFQGSFEYAK  126



>ref|NP_001054216.1| Os04g0670800 [Oryza sativa Japonica Group]
 dbj|BAF16130.1| Os04g0670800, partial [Oryza sativa Japonica Group]
Length=331

 Score = 67.4 bits (163),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 31/52 (60%), Positives = 42/52 (81%), Gaps = 2/52 (4%)
 Frame = +1

Query  358  SVVPFRNFEQEMKHPGVWETDK--ASNSADNLASLYRPPFALMYHGSFEKAK  507
            S V FRNFE+E +   VW++++  AS+S DNLA+LYRPPFALM++G F+KAK
Sbjct  5    STVAFRNFEEESRQSAVWDSEQNAASSSRDNLAALYRPPFALMFNGPFDKAK  56



>gb|KGN50782.1| hypothetical protein Csa_5G259720 [Cucumis sativus]
Length=164

 Score = 63.9 bits (154),  Expect = 8e-10, Method: Compositional matrix adjust.
 Identities = 31/62 (50%), Positives = 42/62 (68%), Gaps = 5/62 (8%)
 Frame = +1

Query  331  MGGSAHEARSVVPFRNFEQEMKHPGVWETDKAS-----NSADNLASLYRPPFALMYHGSF  495
            MG   +E+ S + FRN + E+KH  VW++ + +     NS DNLASLYRPP+ LM+ GSF
Sbjct  1    MGYLPNESGSSIGFRNLQNEVKHHDVWQSGEGAASTSGNSRDNLASLYRPPYHLMFTGSF  60

Query  496  EK  501
            EK
Sbjct  61   EK  62



>ref|NP_193161.3| UBX domain-containing pseudogene [Arabidopsis thaliana]
 gb|AEE83401.1| structural constituent of ribosome [Arabidopsis thaliana]
Length=821

 Score = 65.1 bits (157),  Expect = 4e-09, Method: Composition-based stats.
 Identities = 51/169 (30%), Positives = 79/169 (47%), Gaps = 55/169 (33%)
 Frame = +1

Query  7    LVASFLEIAVGQSADTARQFLQATSWKLEEALQLFYVGNDGGVAAPSSYSPLENTAPlpd  186
            L++SFL+I V Q+ + A QFL+AT+W LE+A+ LF +         +  +P  +      
Sbjct  13   LISSFLDITVNQTVEIATQFLEATTWNLEDAINLFLI---------ARRNPHHHHG----  59

Query  187  pslssisgsikgsgdesekQGDRDEVRP-PLPVIRDVLYDTAVIRGLPAMGGSAHEARSV  363
                                   +E+ P PLP  ++ LYD       P M  S + + +V
Sbjct  60   -----------------------EELVPLPLPSKKNTLYDYD-----PFM--SHNTSVAV  89

Query  364  VPFRNFEQEMKHPGVWETDKASNSADN-LASLYRPPFALMYHGSFEKAK  507
             P            +W+ +  S  +D+ L+SLYRPP +L +HGSFE AK
Sbjct  90   CP----------EEIWDDESTSEESDSRLSSLYRPPPSLFFHGSFEDAK  128



>ref|NP_001190727.1| UBX domain-containing pseudogene [Arabidopsis thaliana]
 gb|AEE83402.1| structural constituent of ribosome [Arabidopsis thaliana]
Length=815

 Score = 65.1 bits (157),  Expect = 5e-09, Method: Composition-based stats.
 Identities = 51/169 (30%), Positives = 79/169 (47%), Gaps = 55/169 (33%)
 Frame = +1

Query  7    LVASFLEIAVGQSADTARQFLQATSWKLEEALQLFYVGNDGGVAAPSSYSPLENTAPlpd  186
            L++SFL+I V Q+ + A QFL+AT+W LE+A+ LF +         +  +P  +      
Sbjct  13   LISSFLDITVNQTVEIATQFLEATTWNLEDAINLFLI---------ARRNPHHHHG----  59

Query  187  pslssisgsikgsgdesekQGDRDEVRP-PLPVIRDVLYDTAVIRGLPAMGGSAHEARSV  363
                                   +E+ P PLP  ++ LYD       P M  S + + +V
Sbjct  60   -----------------------EELVPLPLPSKKNTLYDYD-----PFM--SHNTSVAV  89

Query  364  VPFRNFEQEMKHPGVWETDKASNSADN-LASLYRPPFALMYHGSFEKAK  507
             P            +W+ +  S  +D+ L+SLYRPP +L +HGSFE AK
Sbjct  90   CP----------EEIWDDESTSEESDSRLSSLYRPPPSLFFHGSFEDAK  128



>emb|CAB10204.1| hypothetical protein [Arabidopsis thaliana]
 emb|CAB78467.1| hypothetical protein [Arabidopsis thaliana]
Length=724

 Score = 64.3 bits (155),  Expect = 7e-09, Method: Composition-based stats.
 Identities = 51/169 (30%), Positives = 79/169 (47%), Gaps = 55/169 (33%)
 Frame = +1

Query  7    LVASFLEIAVGQSADTARQFLQATSWKLEEALQLFYVGNDGGVAAPSSYSPLENTAPlpd  186
            L++SFL+I V Q+ + A QFL+AT+W LE+A+ LF +         +  +P  +      
Sbjct  13   LISSFLDITVNQTVEIATQFLEATTWNLEDAINLFLI---------ARRNPHHHHG----  59

Query  187  pslssisgsikgsgdesekQGDRDEVRP-PLPVIRDVLYDTAVIRGLPAMGGSAHEARSV  363
                                   +E+ P PLP  ++ LYD       P M  S + + +V
Sbjct  60   -----------------------EELVPLPLPSKKNTLYDYD-----PFM--SHNTSVAV  89

Query  364  VPFRNFEQEMKHPGVWETDKASNSADN-LASLYRPPFALMYHGSFEKAK  507
             P            +W+ +  S  +D+ L+SLYRPP +L +HGSFE AK
Sbjct  90   CP----------EEIWDDESTSEESDSRLSSLYRPPPSLFFHGSFEDAK  128



>gb|KEH28537.1| UBX domain protein [Medicago truncatula]
Length=259

 Score = 62.4 bits (150),  Expect = 8e-09, Method: Compositional matrix adjust.
 Identities = 55/174 (32%), Positives = 72/174 (41%), Gaps = 56/174 (32%)
 Frame = +1

Query  1    QILVASFLEIAVGQSADTARQFLQATSWKLEEALQLFYVGN--DGGVAAPSSYSPLENTA  174
            + L++ FL  A  Q+ DTA  FLQA++W LEEAL  +  G+  D  +      S L + +
Sbjct  8    ETLISIFLNTARPQNDDTAIHFLQASNWDLEEALHCYLSGDYDDQAILLSDRGSRLGHIS  67

Query  175  PlpdpslssisgsikgsgdesekQGDRDEVRPPLPVIRDVLYDTAVIRGLPAMGGSAHEA  354
            P                           E R  LP I                     E 
Sbjct  68   P---------------------------EKRNSLPYI-------------------VQE-  80

Query  355  RSVVPFRNFEQEMKHPGVWETDKASNSADNLASLYRPPFALMYHGSFEKAKDAA  516
                P R +E E+   G   +   S+  DNLASLYRPPF L++ GSF KAK AA
Sbjct  81   ----PTRVWETEL---GATTSTAESSRQDNLASLYRPPFHLLFDGSFYKAKSAA  127



>ref|XP_007222574.1| hypothetical protein PRUPE_ppa008429mg [Prunus persica]
 gb|EMJ23773.1| hypothetical protein PRUPE_ppa008429mg [Prunus persica]
Length=332

 Score = 62.8 bits (151),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 30/53 (57%), Positives = 36/53 (68%), Gaps = 5/53 (9%)
 Frame = +1

Query  373  RNFEQEMKHPGVWE-----TDKASNSADNLASLYRPPFALMYHGSFEKAKDAA  516
            ++F    +HPGVWE     T  A  + DNLASLYRPPF L++ GSFEKAK AA
Sbjct  12   QDFHNMNRHPGVWESGQGATSSAETARDNLASLYRPPFKLLFQGSFEKAKGAA  64



>gb|KEH28538.1| UBX domain protein [Medicago truncatula]
Length=305

 Score = 62.4 bits (150),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 54/174 (31%), Positives = 71/174 (41%), Gaps = 56/174 (32%)
 Frame = +1

Query  1    QILVASFLEIAVGQSADTARQFLQATSWKLEEALQLFYVGN--DGGVAAPSSYSPLENTA  174
            + L++ FL  A  Q+ DTA  FLQA++W LEEAL  +  G+  D  +      S L + +
Sbjct  8    ETLISIFLNTARPQNDDTAIHFLQASNWDLEEALHCYLSGDYDDQAILLSDRGSRLGHIS  67

Query  175  PlpdpslssisgsikgsgdesekQGDRDEVRPPLPVIRDVLYDTAVIRGLPAMGGSAHEA  354
            P                           E R  LP I                       
Sbjct  68   P---------------------------EKRNSLPYIVQE--------------------  80

Query  355  RSVVPFRNFEQEMKHPGVWETDKASNSADNLASLYRPPFALMYHGSFEKAKDAA  516
                P R +E E+   G   +   S+  DNLASLYRPPF L++ GSF KAK AA
Sbjct  81   ----PTRVWETEL---GATTSTAESSRQDNLASLYRPPFHLLFDGSFYKAKSAA  127



>ref|XP_003604169.1| UBX domain-containing protein [Medicago truncatula]
 gb|AES86366.1| UBX domain protein [Medicago truncatula]
Length=320

 Score = 62.4 bits (150),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 55/174 (32%), Positives = 72/174 (41%), Gaps = 56/174 (32%)
 Frame = +1

Query  1    QILVASFLEIAVGQSADTARQFLQATSWKLEEALQLFYVGN--DGGVAAPSSYSPLENTA  174
            + L++ FL  A  Q+ DTA  FLQA++W LEEAL  +  G+  D  +      S L + +
Sbjct  8    ETLISIFLNTARPQNDDTAIHFLQASNWDLEEALHCYLSGDYDDQAILLSDRGSRLGHIS  67

Query  175  PlpdpslssisgsikgsgdesekQGDRDEVRPPLPVIRDVLYDTAVIRGLPAMGGSAHEA  354
            P                           E R  LP I                     E 
Sbjct  68   P---------------------------EKRNSLPYI-------------------VQE-  80

Query  355  RSVVPFRNFEQEMKHPGVWETDKASNSADNLASLYRPPFALMYHGSFEKAKDAA  516
                P R +E E+   G   +   S+  DNLASLYRPPF L++ GSF KAK AA
Sbjct  81   ----PTRVWETEL---GATTSTAESSRQDNLASLYRPPFHLLFDGSFYKAKSAA  127



>gb|KFK22408.1| hypothetical protein AALP_AAs65522U000100 [Arabis alpina]
Length=377

 Score = 62.0 bits (149),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 48/161 (30%), Positives = 72/161 (45%), Gaps = 37/161 (23%)
 Frame = +1

Query  7    LVASFLEIAVGQSADTARQFLQATSWKLEEALQLFYVGNDGGVAAPSSYSPLENTAPlpd  186
            L+++F+EIAVG S +TA  FL+AT+W LE+A+ LF +      A   SY   EN+     
Sbjct  11   LISTFVEIAVGHSIETAILFLKATNWNLEDAINLFLIHRSNHQAL--SY---ENSL----  61

Query  187  pslssisgsikgsgdesekQGDRDEVRPPLPVIRDVLYDTAVIRGLPAMGGSAHEARSVV  366
                      +     S    D +++  PLP  RD LYD       P+M           
Sbjct  62   ----------EQYHYHSNNSQDEEQIPLPLPSRRDTLYDD------PSMC----------  95

Query  367  PFRNFEQEMKHPGVWETDKASNSADNLASLYRPPFALMYHG  489
              RN    +    +W++   S     L+SL+RPP  L++  
Sbjct  96   --RNTSVPVCPEQIWDSMTPSGPCSKLSSLFRPPIDLLFKA  134



>ref|XP_010519462.1| PREDICTED: UBX domain-containing protein 2-like [Tarenaya hassleriana]
Length=357

 Score = 59.3 bits (142),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 31/58 (53%), Positives = 39/58 (67%), Gaps = 6/58 (10%)
 Frame = +1

Query  7    LVASFLEIAVGQSADTARQFLQATSWKLEEALQLFYVGN------DGGVAAPSSYSPL  162
            LV+SFLEI VG++  TAR+FLQATSW L EA+ LFY GN      +  V AP  + P+
Sbjct  10   LVSSFLEITVGETVTTARRFLQATSWNLGEAVLLFYSGNQKDHVEEDEVNAPLMHDPM  67



>gb|AEV41076.1| putative UBX domain-containing protein [Oryza minuta]
Length=402

 Score = 59.7 bits (143),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 27/37 (73%), Positives = 31/37 (84%), Gaps = 0/37 (0%)
 Frame = +1

Query  7    LVASFLEIAVGQSADTARQFLQATSWKLEEALQLFYV  117
            LV+SFLEIA GQ+ +TA QFLQ TSW LEE LQLFY+
Sbjct  14   LVSSFLEIAAGQTPETATQFLQMTSWHLEEPLQLFYI  50



>ref|XP_002868299.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH44558.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
Length=694

 Score = 59.7 bits (143),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 52/168 (31%), Positives = 76/168 (45%), Gaps = 59/168 (35%)
 Frame = +1

Query  7    LVASFLEIAVGQSADTARQFLQATSWKLEEALQLFYVGNDGGVAAPSSYSPLENTAPlpd  186
            L++SFL+I VGQS + A QFL+AT+W LE+A+ LF +                N  P   
Sbjct  12   LISSFLDITVGQSVEIALQFLKATNWHLEDAINLFLIAR-------------RNPNP---  55

Query  187  pslssisgsikgsgdesekQGDRDEVRPPLPVIRDVLYDTAVIRGLPAMGGSAHEARSVV  366
                                   ++V  PLP + D LYD++ +R   ++  S  +     
Sbjct  56   -----------------------EQVPLPLPSMMDTLYDSS-MRHNTSVAVSPED-----  86

Query  367  PFRNFEQEMKHPGVWE-TDKASNSADNLASLYRPPFALMYHGSFEKAK  507
                         +W+ T + S S   L+SLYRPP +L +HGSFE AK
Sbjct  87   -------------IWDSTSEESESYSRLSSLYRPPPSLFFHGSFEDAK  121



>ref|XP_005643712.1| hypothetical protein COCSUDRAFT_59648 [Coccomyxa subellipsoidea 
C-169]
 gb|EIE19168.1| hypothetical protein COCSUDRAFT_59648 [Coccomyxa subellipsoidea 
C-169]
Length=440

 Score = 58.5 bits (140),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 52/173 (30%), Positives = 83/173 (48%), Gaps = 26/173 (15%)
 Frame = +1

Query  7    LVASFLEIAVGQSADTARQFLQATSWKLEEALQLFYVGNDGGVAAPSSYSPLENTAPlpd  186
            ++A+F +I  G    TA+  L+AT++ LE+A+ LF+  +     + S  +    +AP+  
Sbjct  4    VMANFTDI-TGADHSTAQGLLEATNYDLEQAVGLFFATHGEAAGSASGAAHSHPSAPMDT  62

Query  187  pslssisgsikgsgdesekQGDRDEVRPPLPVIRDVLY-DTAVIRGLPAMGGSAHEARSV  363
                                   + VRPPLP +RD LY +T   RG  A G  +H+ + V
Sbjct  63   GGGPMPHPM-------------EEHVRPPLPAVRDRLYGETFTSRG--ASGSQSHQ-QEV  106

Query  364  VPFRNFEQEMKHPGVWETDKASNSADN--LASLYRPPFALMYHGSFEKAKDAA  516
              FR+F+ E          +A   ++   LA L+ PP  LM+ G+ E+AK AA
Sbjct  107  QAFRDFKAETS------KSRAGGKSNQPGLAGLFEPPHDLMFKGTLEEAKAAA  153



>gb|KFK22146.1| hypothetical protein AALP_AAs62910U000300 [Arabis alpina]
Length=408

 Score = 55.8 bits (133),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 27/57 (47%), Positives = 37/57 (65%), Gaps = 9/57 (16%)
 Frame = +1

Query  7    LVASFLEIAVGQSADTARQFLQATSWKLEEALQLFYVGND---------GGVAAPSS  150
            L++SFLE AVGQ+ +TAR FLQ T+W +EEA+ L+ + N+           VAAP S
Sbjct  23   LISSFLETAVGQTVETARTFLQTTNWNIEEAINLYLMNNNYDSSLYHDYNQVAAPRS  79



>emb|CDY12746.1| BnaC04g28950D [Brassica napus]
Length=421

 Score = 55.5 bits (132),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 23/48 (48%), Positives = 37/48 (77%), Gaps = 0/48 (0%)
 Frame = +1

Query  7    LVASFLEIAVGQSADTARQFLQATSWKLEEALQLFYVGNDGGVAAPSS  150
            L++SFLE+AVGQ+ +TA++FL+ T+W +EE++ LF + N+   AA  S
Sbjct  47   LISSFLEVAVGQTVETAKRFLETTNWNIEESINLFLLRNNYDHAAEES  94



>ref|XP_009566058.1| PREDICTED: UBX domain-containing protein 7 [Cuculus canorus]
Length=474

 Score = 55.5 bits (132),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 52/169 (31%), Positives = 76/169 (45%), Gaps = 39/169 (23%)
 Frame = +1

Query  37   GQSADTARQFLQATSWKLEEALQLFYVGNDGGVAAPSSYSPLENTAPlpdpslssisgsi  216
            G S    R  L+A +  LE A+ +F  G  GG+A   S S    +A              
Sbjct  10   GASESVGRHMLEACNNNLEMAVTMFLDG--GGIAEEPSTSSAGVSA--------------  53

Query  217  kgsgdesekQGDRDEVRPPLPVIRDVLYDTAVIRGLPAMGGSAHEARSVVP-FRNF----  381
                    +    DEVRPP+P  +++L +   + G P        ARS+   FR+F    
Sbjct  54   -------VRPHTEDEVRPPIPPKQEILVEPEPLFGAPK---RRRPARSIFDGFRDFQTET  103

Query  382  ---EQEMKHPGVWETDKASNSADNLASLYRPPFALMYHGSFEKAKDAAR  519
               EQE+++ G    DK   +   LA+L+RPP  LM+ GSFE AK+  +
Sbjct  104  IRQEQELRNGGA--VDKKLTT---LAALFRPPIDLMHKGSFETAKECGQ  147



>gb|KFO81222.1| UBX domain-containing protein 7, partial [Cuculus canorus]
Length=467

 Score = 55.5 bits (132),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 52/169 (31%), Positives = 76/169 (45%), Gaps = 39/169 (23%)
 Frame = +1

Query  37   GQSADTARQFLQATSWKLEEALQLFYVGNDGGVAAPSSYSPLENTAPlpdpslssisgsi  216
            G S    R  L+A +  LE A+ +F  G  GG+A   S S    +A              
Sbjct  3    GASESVGRHMLEACNNNLEMAVTMFLDG--GGIAEEPSTSSAGVSA--------------  46

Query  217  kgsgdesekQGDRDEVRPPLPVIRDVLYDTAVIRGLPAMGGSAHEARSVVP-FRNF----  381
                    +    DEVRPP+P  +++L +   + G P        ARS+   FR+F    
Sbjct  47   -------VRPHTEDEVRPPIPPKQEILVEPEPLFGAPK---RRRPARSIFDGFRDFQTET  96

Query  382  ---EQEMKHPGVWETDKASNSADNLASLYRPPFALMYHGSFEKAKDAAR  519
               EQE+++ G    DK   +   LA+L+RPP  LM+ GSFE AK+  +
Sbjct  97   IRQEQELRNGGA--VDKKLTT---LAALFRPPIDLMHKGSFETAKECGQ  140



>ref|XP_010792284.1| PREDICTED: UBX domain-containing protein 7 [Notothenia coriiceps]
Length=292

 Score = 54.7 bits (130),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 37/96 (39%), Positives = 53/96 (55%), Gaps = 16/96 (17%)
 Frame = +1

Query  256  DEVRPPLPVIRDVLYDTAVIRGLPAMGGSAHEARSVVP-FRNF-------EQEMKHPGVW  411
            DEVR P+P  +D+L +   + G+P        ARS+   FR+F       EQE+++ G  
Sbjct  75   DEVRAPIPQKQDILVEPEPLFGVPK---RRRPARSIFDGFRDFQTETIRQEQELRNGGT-  130

Query  412  ETDKASNSADNLASLYRPPFALMYHGSFEKAKDAAR  519
              DK  ++   LA L+RPP  LM+ GSFE AKD  +
Sbjct  131  -VDKKLST---LADLFRPPIELMHKGSFETAKDCGQ  162



>ref|XP_004079303.2| PREDICTED: UBX domain-containing protein 7 [Oryzias latipes]
Length=522

 Score = 54.7 bits (130),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 54/179 (30%), Positives = 79/179 (44%), Gaps = 39/179 (22%)
 Frame = +1

Query  7    LVASFLEIAVGQSADTARQFLQATSWKLEEALQLFYVGNDGGVAAPSSYSPLENTAPlpd  186
            L+  F  I  G +    +  L+A +  LE A+ +F  G  GG+A   S S     +    
Sbjct  24   LIQQFTAI-TGATESVGKHMLEACNNNLEMAVTMFLDG--GGIAEEPSTSSSSAASSSRA  80

Query  187  pslssisgsikgsgdesekQGDRDEVRPPLPVIRDVLYDTAVIRGLPAMGGSAHEARSVV  366
            P                      DEVR P+P  +D+L +   + G+P        ARS+ 
Sbjct  81   PPT--------------------DEVRAPIPQKQDILVEPEPLFGVPK---RRRPARSIF  117

Query  367  P-FRNF-------EQEMKHPGVWETDKASNSADNLASLYRPPFALMYHGSFEKAKDAAR  519
              FR+F       EQE+++ G    DK  ++   LA L+RPP  LM+ GSFE AKD  +
Sbjct  118  DGFRDFQTETIRQEQELRNGGT--VDKKLST---LADLFRPPIELMHKGSFETAKDCGQ  171



>ref|XP_007431490.1| PREDICTED: UBX domain-containing protein 7 isoform X1 [Python 
bivittatus]
Length=488

 Score = 54.7 bits (130),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 55/181 (30%), Positives = 80/181 (44%), Gaps = 44/181 (24%)
 Frame = +1

Query  7    LVASFLEIAVGQSADTARQFLQATSWKLEEALQLFYVGNDGGVAA-PSSYS-PLENTAPl  180
            L+  F  I  G S    +  L+A +  LE A+ +F  G  GG+A  PS+ S  + N  P 
Sbjct  16   LIQQFTAI-TGASESVGKHMLEACNNNLEMAVTMFLDG--GGIAEEPSTSSASVSNLRPH  72

Query  181  pdpslssisgsikgsgdesekQGDRDEVRPPLPVIRDVLYDTAVIRGLPAMGGSAHEARS  360
                                     DEVR P+P  +++L +   + G P        ARS
Sbjct  73   T-----------------------EDEVRAPIPQKQEILVEPEPLFGAPK---RRRPARS  106

Query  361  VVP-FRNF-------EQEMKHPGVWETDKASNSADNLASLYRPPFALMYHGSFEKAKDAA  516
            +   FR+F       EQE+++ G    DK   +   LA L+RPP  LM+ GSFE AK+  
Sbjct  107  IFDGFRDFQTETIRQEQELRNGGA--IDKKLTT---LADLFRPPIDLMHKGSFETAKECG  161

Query  517  R  519
            +
Sbjct  162  Q  162



>ref|XP_007884078.1| PREDICTED: UBX domain-containing protein 7 isoform X5 [Callorhinchus 
milii]
Length=494

 Score = 54.7 bits (130),  Expect = 9e-06, Method: Compositional matrix adjust.
 Identities = 55/181 (30%), Positives = 81/181 (45%), Gaps = 40/181 (22%)
 Frame = +1

Query  1    QILVASFLEIAVGQSADTARQFLQATSWKLEEALQLFYVGNDGGVAAPSSYSPLENTAPl  180
            Q L+  F  I  G S    +  L+A +  LE A+ ++  G  GG+A   S S    +A  
Sbjct  16   QGLIRQFTAI-TGASESVGKHILEACNNNLEMAVTMYLDG--GGIAEEPSTSTAGTSASR  72

Query  181  pdpslssisgsikgsgdesekQGDRDEVRPPLPVIRDVLYDTAVIRGLPAMGGSAHEARS  360
            P                       +DEVR P+P  +D+L +   + G P        ARS
Sbjct  73   PPA---------------------QDEVRAPIPQKQDILVEPEPLFGAPK---RRRPARS  108

Query  361  VVP-FRNF-------EQEMKHPGVWETDKASNSADNLASLYRPPFALMYHGSFEKAKDAA  516
            +   FR+F       EQE+++ G    DK   +   LA L+RPP  LM+ GSFE AK++ 
Sbjct  109  IFDGFRDFQTETIRQEQELRNGGP--VDKKLTT---LADLFRPPIDLMHKGSFETAKESG  163

Query  517  R  519
            +
Sbjct  164  Q  164



>ref|XP_005151293.1| PREDICTED: UBX domain-containing protein 7 [Melopsittacus undulatus]
Length=479

 Score = 54.7 bits (130),  Expect = 9e-06, Method: Compositional matrix adjust.
 Identities = 53/178 (30%), Positives = 77/178 (43%), Gaps = 39/178 (22%)
 Frame = +1

Query  10   VASFLEIAVGQSADTARQFLQATSWKLEEALQLFYVGNDGGVAAPSSYSPLENTAPlpdp  189
             + F  I  G S    +  L+A +  LE A+ +F  G  GG+A   S S    +A  P  
Sbjct  6    CSVFTSIITGASESVGKHMLEACNNNLEMAVTMFLDG--GGIAEEPSTSSAGVSAVRPHT  63

Query  190  slssisgsikgsgdesekQGDRDEVRPPLPVIRDVLYDTAVIRGLPAMGGSAHEARSVVP  369
                                  DEVR P+P  +++L +   + G P        ARS+  
Sbjct  64   ---------------------EDEVRAPIPQKQEILVEPEPLFGAPK---RRRPARSIFD  99

Query  370  -FRNF-------EQEMKHPGVWETDKASNSADNLASLYRPPFALMYHGSFEKAKDAAR  519
             FR+F       EQE+++ G    DK   +   LA L+RPP  LM+ GSFE AK+  +
Sbjct  100  GFRDFQTETIRQEQELRNGGA--VDKKLTT---LADLFRPPIDLMHKGSFETAKECGQ  152



>ref|XP_007559513.1| PREDICTED: UBX domain-containing protein 7 [Poecilia formosa]
Length=526

 Score = 54.3 bits (129),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 37/96 (39%), Positives = 53/96 (55%), Gaps = 16/96 (17%)
 Frame = +1

Query  256  DEVRPPLPVIRDVLYDTAVIRGLPAMGGSAHEARSVVP-FRNF-------EQEMKHPGVW  411
            DEVR P+P  +D+L +   + G+P        ARS+   FR+F       EQE+++ G  
Sbjct  75   DEVRAPIPQKQDILVEPEPLFGVPKR---RRPARSIFDGFRDFQTETIRQEQELRNGGT-  130

Query  412  ETDKASNSADNLASLYRPPFALMYHGSFEKAKDAAR  519
              DK  ++   LA L+RPP  LM+ GSFE AKD  +
Sbjct  131  -VDKKLST---LADLFRPPIELMHKGSFETAKDCGQ  162



>ref|XP_010450078.1| PREDICTED: UBX domain-containing protein 2-like [Camelina sativa]
Length=432

 Score = 54.3 bits (129),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 22/42 (52%), Positives = 31/42 (74%), Gaps = 0/42 (0%)
 Frame = +1

Query  7    LVASFLEIAVGQSADTARQFLQATSWKLEEALQLFYVGNDGG  132
            L++SFLEIAVGQ+ +TAR FLQ + W + EA+ LF + N+  
Sbjct  29   LISSFLEIAVGQTTETARGFLQTSGWNINEAIDLFLITNNNN  70



>ref|XP_005796061.1| PREDICTED: UBX domain-containing protein 7-like [Xiphophorus 
maculatus]
Length=526

 Score = 54.3 bits (129),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 37/96 (39%), Positives = 53/96 (55%), Gaps = 16/96 (17%)
 Frame = +1

Query  256  DEVRPPLPVIRDVLYDTAVIRGLPAMGGSAHEARSVVP-FRNF-------EQEMKHPGVW  411
            DEVR P+P  +D+L +   + G+P        ARS+   FR+F       EQE+++ G  
Sbjct  75   DEVRAPIPQKQDILVEPEPLFGVPKR---RRPARSIFDGFRDFQTETIRQEQELRNGGT-  130

Query  412  ETDKASNSADNLASLYRPPFALMYHGSFEKAKDAAR  519
              DK  ++   LA L+RPP  LM+ GSFE AKD  +
Sbjct  131  -VDKKLST---LADLFRPPIELMHKGSFETAKDCGQ  162



>ref|XP_005721383.1| PREDICTED: UBX domain-containing protein 7-like [Pundamilia nyererei]
 ref|XP_005912846.1| PREDICTED: UBX domain-containing protein 7-like [Haplochromis 
burtoni]
Length=528

 Score = 54.3 bits (129),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 37/96 (39%), Positives = 53/96 (55%), Gaps = 16/96 (17%)
 Frame = +1

Query  256  DEVRPPLPVIRDVLYDTAVIRGLPAMGGSAHEARSVVP-FRNF-------EQEMKHPGVW  411
            DEVR P+P  +D+L +   + G+P        ARS+   FR+F       EQE+++ G  
Sbjct  75   DEVRAPIPQKQDILVEPEPLFGVPKR---RRPARSIFDGFRDFQTETIRQEQELRNGGT-  130

Query  412  ETDKASNSADNLASLYRPPFALMYHGSFEKAKDAAR  519
              DK  ++   LA L+RPP  LM+ GSFE AKD  +
Sbjct  131  -VDKKLST---LADLFRPPIELMHKGSFETAKDCGQ  162



>ref|XP_004542734.1| PREDICTED: UBX domain-containing protein 7-like [Maylandia zebra]
Length=528

 Score = 54.3 bits (129),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 37/96 (39%), Positives = 53/96 (55%), Gaps = 16/96 (17%)
 Frame = +1

Query  256  DEVRPPLPVIRDVLYDTAVIRGLPAMGGSAHEARSVVP-FRNF-------EQEMKHPGVW  411
            DEVR P+P  +D+L +   + G+P        ARS+   FR+F       EQE+++ G  
Sbjct  75   DEVRAPIPQKQDILVEPEPLFGVPKR---RRPARSIFDGFRDFQTETIRQEQELRNGGT-  130

Query  412  ETDKASNSADNLASLYRPPFALMYHGSFEKAKDAAR  519
              DK  ++   LA L+RPP  LM+ GSFE AKD  +
Sbjct  131  -VDKKLST---LADLFRPPIELMHKGSFETAKDCGQ  162



>ref|XP_008432356.1| PREDICTED: UBX domain-containing protein 7 [Poecilia reticulata]
Length=526

 Score = 54.3 bits (129),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 37/96 (39%), Positives = 53/96 (55%), Gaps = 16/96 (17%)
 Frame = +1

Query  256  DEVRPPLPVIRDVLYDTAVIRGLPAMGGSAHEARSVVP-FRNF-------EQEMKHPGVW  411
            DEVR P+P  +D+L +   + G+P        ARS+   FR+F       EQE+++ G  
Sbjct  75   DEVRAPIPQKQDILVEPEPLFGVPKR---RRPARSIFDGFRDFQTETIRQEQELRNGGT-  130

Query  412  ETDKASNSADNLASLYRPPFALMYHGSFEKAKDAAR  519
              DK  ++   LA L+RPP  LM+ GSFE AKD  +
Sbjct  131  -VDKKLST---LADLFRPPIELMHKGSFETAKDCGQ  162



>ref|XP_008332241.1| PREDICTED: UBX domain-containing protein 7 [Cynoglossus semilaevis]
Length=539

 Score = 54.3 bits (129),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 37/96 (39%), Positives = 53/96 (55%), Gaps = 16/96 (17%)
 Frame = +1

Query  256  DEVRPPLPVIRDVLYDTAVIRGLPAMGGSAHEARSVVP-FRNF-------EQEMKHPGVW  411
            DEVR P+P  +D+L +   + G+P        ARS+   FR+F       EQE+++ G  
Sbjct  75   DEVRAPIPQKQDILVEPEPLFGVPKR---RRPARSIFDGFRDFQTETIRQEQELRNGGA-  130

Query  412  ETDKASNSADNLASLYRPPFALMYHGSFEKAKDAAR  519
              DK  ++   LA L+RPP  LM+ GSFE AKD  +
Sbjct  131  -VDKKLST---LADLFRPPIELMHKGSFETAKDCGQ  162



>ref|XP_006414759.1| hypothetical protein EUTSA_v10027233mg [Eutrema salsugineum]
 gb|ESQ56212.1| hypothetical protein EUTSA_v10027233mg [Eutrema salsugineum]
Length=418

 Score = 53.9 bits (128),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 22/40 (55%), Positives = 32/40 (80%), Gaps = 0/40 (0%)
 Frame = +1

Query  7    LVASFLEIAVGQSADTARQFLQATSWKLEEALQLFYVGND  126
            L++SFLEIAVGQ+ +TA +FL+ T+W +EEA+ LF   N+
Sbjct  45   LISSFLEIAVGQTVETATRFLETTNWNIEEAINLFLFDNN  84



>ref|XP_003438186.2| PREDICTED: UBX domain-containing protein 7 [Oreochromis niloticus]
Length=540

 Score = 53.9 bits (128),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 37/96 (39%), Positives = 53/96 (55%), Gaps = 16/96 (17%)
 Frame = +1

Query  256  DEVRPPLPVIRDVLYDTAVIRGLPAMGGSAHEARSVVP-FRNF-------EQEMKHPGVW  411
            DEVR P+P  +D+L +   + G+P        ARS+   FR+F       EQE+++ G  
Sbjct  87   DEVRAPIPQKQDILVEPEPLFGVPKR---RRPARSIFDGFRDFQTETIRQEQELRNGGT-  142

Query  412  ETDKASNSADNLASLYRPPFALMYHGSFEKAKDAAR  519
              DK  ++   LA L+RPP  LM+ GSFE AKD  +
Sbjct  143  -VDKKLST---LADLFRPPIELMHKGSFETAKDCGQ  174



>ref|XP_006786563.1| PREDICTED: UBX domain-containing protein 7-like [Neolamprologus 
brichardi]
Length=543

 Score = 53.9 bits (128),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 37/96 (39%), Positives = 53/96 (55%), Gaps = 16/96 (17%)
 Frame = +1

Query  256  DEVRPPLPVIRDVLYDTAVIRGLPAMGGSAHEARSVVP-FRNF-------EQEMKHPGVW  411
            DEVR P+P  +D+L +   + G+P        ARS+   FR+F       EQE+++ G  
Sbjct  87   DEVRAPIPQKQDILVEPEPLFGVPKR---RRPARSIFDGFRDFQTETIRQEQELRNGGT-  142

Query  412  ETDKASNSADNLASLYRPPFALMYHGSFEKAKDAAR  519
              DK  ++   LA L+RPP  LM+ GSFE AKD  +
Sbjct  143  -VDKKLST---LADLFRPPIELMHKGSFETAKDCGQ  174



>ref|XP_010022496.1| PREDICTED: UBX domain-containing protein 7, partial [Nestor notabilis]
Length=413

 Score = 53.9 bits (128),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 53/175 (30%), Positives = 76/175 (43%), Gaps = 39/175 (22%)
 Frame = +1

Query  19   FLEIAVGQSADTARQFLQATSWKLEEALQLFYVGNDGGVAAPSSYSPLENTAPlpdpsls  198
            F  I  G S    +  L+A +  LE A+ +F  G  GG+A   S S    +A  P     
Sbjct  23   FSSIITGASESVGKHMLEACNNNLEMAVTMFLDG--GGIAEEPSTSSAGVSAVRPHT---  77

Query  199  sisgsikgsgdesekQGDRDEVRPPLPVIRDVLYDTAVIRGLPAMGGSAHEARSVVP-FR  375
                               DEVR P+P  +++L +   + G P        ARS+   FR
Sbjct  78   ------------------EDEVRAPIPQKQEILVEPEPLFGAPK---RRRPARSIFDGFR  116

Query  376  NF-------EQEMKHPGVWETDKASNSADNLASLYRPPFALMYHGSFEKAKDAAR  519
            +F       EQE+++ G    DK   +   LA L+RPP  LM+ GSFE AK+  +
Sbjct  117  DFQTETIRQEQELRNGGA--VDKKLTT---LADLFRPPIDLMHKGSFETAKECGQ  166



>ref|XP_010741940.1| PREDICTED: LOW QUALITY PROTEIN: UBX domain-containing protein 
7 [Larimichthys crocea]
Length=527

 Score = 53.9 bits (128),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 55/179 (31%), Positives = 80/179 (45%), Gaps = 39/179 (22%)
 Frame = +1

Query  7    LVASFLEIAVGQSADTARQFLQATSWKLEEALQLFYVGNDGGVAAPSSYSPLENTAPlpd  186
            L+  F  I  G +    +  L+A +  LE A+ +F  G  GG+A   S S          
Sbjct  15   LIQQFTAI-TGATESVGKHMLEACNNNLEMAVTMFLDG--GGIAEEPSTS----------  61

Query  187  pslssisgsikgsgdesekQGDRDEVRPPLPVIRDVLYDTAVIRGLPAMGGSAHEARSVV  366
                        S   S +    DEVR P+P  +D+L +   + G+P        ARS+ 
Sbjct  62   ----------SSSAASSSRAPPSDEVRAPIPQKQDILVEPEPLFGVPKR---RRPARSIF  108

Query  367  P-FRNF-------EQEMKHPGVWETDKASNSADNLASLYRPPFALMYHGSFEKAKDAAR  519
              FR+F       EQE+++ G    DK  ++   LA L+RPP  LM+ GSFE AKD  +
Sbjct  109  DGFRDFQTETIRQEQELRNGGT--VDKKLST---LADLFRPPIELMHKGSFETAKDCGQ  162



>ref|XP_005303673.1| PREDICTED: UBX domain-containing protein 7 [Chrysemys picta bellii]
Length=489

 Score = 53.9 bits (128),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 54/180 (30%), Positives = 79/180 (44%), Gaps = 42/180 (23%)
 Frame = +1

Query  7    LVASFLEIAVGQSADTARQFLQATSWKLEEALQLFYVGNDGGVAA-PSSYSPLENTAPlp  183
            L+  F  I  G S    +  L+A +  LE A+ +F  G  GG+A  PS+ S   +T    
Sbjct  16   LIQQFTAI-TGASESVGKHMLEACNNNLEMAVTMFLDG--GGIAEEPSTSSAAVSTVRPD  72

Query  184  dpslssisgsikgsgdesekQGDRDEVRPPLPVIRDVLYDTAVIRGLPAMGGSAHEARSV  363
                                    DEVR P+P  +++L +   + G P        ARS+
Sbjct  73   T----------------------EDEVRAPIPQKQEILVEPEPLFGAPK---RRRPARSI  107

Query  364  VP-FRNF-------EQEMKHPGVWETDKASNSADNLASLYRPPFALMYHGSFEKAKDAAR  519
               FR+F       EQE+++ G    DK   +   LA L+RPP  LM+ GSFE AK+  +
Sbjct  108  FDGFRDFQTETIRQEQELRNGGA--IDKKLTT---LADLFRPPIDLMHKGSFETAKECGQ  162



>ref|XP_003978227.1| PREDICTED: UBX domain-containing protein 7-like [Takifugu rubripes]
Length=533

 Score = 53.5 bits (127),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 53/173 (31%), Positives = 77/173 (45%), Gaps = 18/173 (10%)
 Frame = +1

Query  7    LVASFLEIAVGQSADTARQFLQATSWKLEEALQLFYVGNDGGVAAPSSYSPLENTAPlpd  186
            L+  F  I  G +    +  L+A +  LE A+ +F  G  GG+A            P   
Sbjct  15   LIRQFTAI-TGATESVGKHMLEACNNNLEMAVTMFLDG--GGIA----------EEPSTS  61

Query  187  pslssisgsikgsgdesekQGDRDEVRPPLPVIRDVLYDTAVIRGLPAMGGSAHEARSVV  366
             S S+ S S   S   S +    DEVR P+P  +D+L +   + G+P        ARS+ 
Sbjct  62   TSTSTSSSSSSSSAASSSRAPPTDEVRAPIPQKQDILVEPEPLFGVPKR---RRPARSIF  118

Query  367  P-FRNFEQE-MKHPGVWETDKASNSADNLASLYRPPFALMYHGSFEKAKDAAR  519
              FR+F+ E ++                LA L+RPP  LM+ GSFE AKD  +
Sbjct  119  DGFRDFQTETIRQEQELRNGTVDKKLSTLADLFRPPIELMHKGSFETAKDCGQ  171



>gb|KFP66219.1| UBX domain-containing protein 7, partial [Cariama cristata]
Length=419

 Score = 53.1 bits (126),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 37/98 (38%), Positives = 53/98 (54%), Gaps = 16/98 (16%)
 Frame = +1

Query  250  DRDEVRPPLPVIRDVLYDTAVIRGLPAMGGSAHEARSVVP-FRNF-------EQEMKHPG  405
            DRDEVR P+P  +++L +   + G P        ARS+   FR+F       EQE+++ G
Sbjct  3    DRDEVRAPIPQKQEILVEPEPLFGAPK---RRRPARSIFDGFRDFQTETIRQEQELRNGG  59

Query  406  VWETDKASNSADNLASLYRPPFALMYHGSFEKAKDAAR  519
                DK   +   LA L+RPP  LM+ GSFE AK+  +
Sbjct  60   A--VDKKLTT---LADLFRPPIDLMHKGSFETAKECGQ  92



>ref|XP_006285935.1| hypothetical protein CARUB_v10007447mg, partial [Capsella rubella]
 gb|EOA18833.1| hypothetical protein CARUB_v10007447mg, partial [Capsella rubella]
Length=436

 Score = 53.1 bits (126),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 22/39 (56%), Positives = 31/39 (79%), Gaps = 0/39 (0%)
 Frame = +1

Query  10   VASFLEIAVGQSADTARQFLQATSWKLEEALQLFYVGND  126
            V SFLEIAVG++ +TAR+FLQ T WK++EA+ L+   N+
Sbjct  35   VTSFLEIAVGETRETARRFLQRTDWKIDEAINLYLTNNN  73



>ref|XP_002874517.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH50776.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
Length=333

 Score = 52.8 bits (125),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 30/69 (43%), Positives = 39/69 (57%), Gaps = 12/69 (17%)
 Frame = +1

Query  319  GLPAMGGSAHEARSVVPFRNFEQEMKHPGVWETD------KASNSADNLASLYRPPFALM  480
            G   +G S H+   ++  RNF +      +W  D       AS S  +LASLYRPPF LM
Sbjct  82   GAMTVGISQHQPDCLIANRNFSE------IWGLDMDAFSPSASASKRSLASLYRPPFHLM  135

Query  481  YHGSFEKAK  507
            +HGSFE+AK
Sbjct  136  FHGSFEQAK  144



>ref|XP_007884019.1| PREDICTED: UBX domain-containing protein 7 isoform X4 [Callorhinchus 
milii]
Length=499

 Score = 53.1 bits (126),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 50/181 (28%), Positives = 76/181 (42%), Gaps = 35/181 (19%)
 Frame = +1

Query  1    QILVASFLEIAVGQSADTARQFLQATSWKLEEALQLFYVGNDGGVAAPSSYSPLENTAPl  180
            Q L+  F  I  G S    +  L+A +  LE A+ ++  G  GG+A   S S    +A  
Sbjct  16   QGLIRQFTAI-TGASESVGKHILEACNNNLEMAVTMYLDG--GGIAEEPSTSTAGTSASR  72

Query  181  pdpslssisgsikgsgdesekQGDRDEVRPPLPVIRDVLYDTAVIRGLPAMGGSAHEARS  360
            P                       +DEVR P+P  +D+L +   + G P        ARS
Sbjct  73   PPA---------------------QDEVRAPIPQKQDILVEPEPLFGAPKR---RRPARS  108

Query  361  VVP-FRNFEQEMKHPGVWETDK-------ASNSADNLASLYRPPFALMYHGSFEKAKDAA  516
            +   FR+F+ E      +  ++              LA L+RPP  LM+ GSFE AK++ 
Sbjct  109  IFDGFRDFQTETSEYCCFRQEQELRNGGPVDKKLTTLADLFRPPIDLMHKGSFETAKESG  168

Query  517  R  519
            +
Sbjct  169  Q  169



>ref|XP_006124906.1| PREDICTED: UBX domain-containing protein 7, partial [Pelodiscus 
sinensis]
Length=481

 Score = 53.1 bits (126),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 50/172 (29%), Positives = 76/172 (44%), Gaps = 43/172 (25%)
 Frame = +1

Query  34   VGQSADTARQFLQATSWKLEEALQLFYVGNDGGVAAPSSYSP--LENTAPlpdpslssis  207
            +G S    +  L+A +  LE A+ +F  G  GG+A   S S   + N  P          
Sbjct  16   IGASESVGQHMLEACNNNLEMAVTMFLDG--GGIAEEPSTSSAAVSNVRPHT--------  65

Query  208  gsikgsgdesekQGDRDEVRPPLPVIRDVLYDTAVIRGLPAMGGSAHEARSVVP-FRNF-  381
                            +EVR P+P  +++L +   + G+P        ARS+   FR+F 
Sbjct  66   ---------------EEEVRAPIPQKQEILVEPEPLFGVPK---RRRPARSIFDGFRDFQ  107

Query  382  ------EQEMKHPGVWETDKASNSADNLASLYRPPFALMYHGSFEKAKDAAR  519
                  EQE+++ G    DK   +   LA L+RPP  LM+ GSFE AK+  +
Sbjct  108  TETIRQEQELRNGGA--IDKKLTT---LADLFRPPIDLMHKGSFETAKECGQ  154



>emb|CAG07636.1| unnamed protein product, partial [Tetraodon nigroviridis]
Length=472

 Score = 53.1 bits (126),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 32/90 (36%), Positives = 46/90 (51%), Gaps = 5/90 (6%)
 Frame = +1

Query  256  DEVRPPLPVIRDVLYDTAVIRGLPAMGGSAHEARSVVP-FRNFEQE-MKHPGVWETDKAS  429
            DEVR P+P  +D+L +   + G+P        ARS+   FR+F+ E ++           
Sbjct  76   DEVRAPIPQKQDILVEPEPLFGVPKR---RRPARSIFDGFRDFQTETIRQEQELRNGTVD  132

Query  430  NSADNLASLYRPPFALMYHGSFEKAKDAAR  519
                 LA L+RPP  LM+ GSFE AKD  +
Sbjct  133  KKLSTLADLFRPPIELMHKGSFETAKDCGQ  162



>ref|XP_001373967.2| PREDICTED: UBX domain-containing protein 7 [Monodelphis domestica]
Length=489

 Score = 53.1 bits (126),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 53/181 (29%), Positives = 78/181 (43%), Gaps = 44/181 (24%)
 Frame = +1

Query  7    LVASFLEIAVGQSADTARQFLQATSWKLEEALQLFYVGNDGGVAAPSSYSP--LENTAPl  180
            L+  F  I  G S    +  L+A +  LE A+ +F  G  GG+A   S S   + +  P 
Sbjct  16   LIQQFTAI-TGASESVGKHMLEACNNNLEMAVTMFLDG--GGIAEEPSTSSAGVSSVRPH  72

Query  181  pdpslssisgsikgsgdesekQGDRDEVRPPLPVIRDVLYDTAVIRGLPAMGGSAHEARS  360
                                     DEVR P+P  +++L +   + G P        ARS
Sbjct  73   T-----------------------EDEVRAPIPQKQEILVEPEPLFGAPK---RRRPARS  106

Query  361  VVP-FRNF-------EQEMKHPGVWETDKASNSADNLASLYRPPFALMYHGSFEKAKDAA  516
            +   FR+F       EQE+++ G    DK   +   LA L+RPP  LM+ GSFE AK+  
Sbjct  107  IFDGFRDFQTETIRQEQELRNGGA--IDKKLTT---LADLFRPPIDLMHKGSFETAKECG  161

Query  517  R  519
            +
Sbjct  162  Q  162



>ref|XP_003218371.1| PREDICTED: UBX domain-containing protein 7 [Anolis carolinensis]
Length=488

 Score = 52.8 bits (125),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 54/181 (30%), Positives = 80/181 (44%), Gaps = 44/181 (24%)
 Frame = +1

Query  7    LVASFLEIAVGQSADTARQFLQATSWKLEEALQLFYVGNDGGVAA-PSSYS-PLENTAPl  180
            L+  F  I  G +    +  L+A +  LE A+ +F  G  GG+A  PS+ S  + N  P 
Sbjct  16   LLQQFTAI-TGATESIGKHMLEACNNNLEMAVTMFLDG--GGIAEEPSTSSASVSNLRPH  72

Query  181  pdpslssisgsikgsgdesekQGDRDEVRPPLPVIRDVLYDTAVIRGLPAMGGSAHEARS  360
                                     DEVR P+P  +++L +   + G P        ARS
Sbjct  73   T-----------------------EDEVRAPIPQKQEILVEPEPLFGAPK---RRRPARS  106

Query  361  VVP-FRNF-------EQEMKHPGVWETDKASNSADNLASLYRPPFALMYHGSFEKAKDAA  516
            +   FR+F       EQE+++ G    DK   +   LA L+RPP  LM+ GSFE AK+  
Sbjct  107  IFDGFRDFQTETIRQEQELRNGGA--IDKKLTT---LADLFRPPIDLMHKGSFETAKECG  161

Query  517  R  519
            +
Sbjct  162  Q  162



>ref|XP_004373649.1| PREDICTED: UBX domain-containing protein 7 [Trichechus manatus 
latirostris]
Length=489

 Score = 52.8 bits (125),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 54/180 (30%), Positives = 79/180 (44%), Gaps = 42/180 (23%)
 Frame = +1

Query  7    LVASFLEIAVGQSADTARQFLQATSWKLEEALQLFYVGNDGGVAA-PSSYSPLENTAPlp  183
            L+  F  I  G S    +  L+A S  LE A+ +F  G  GG+A  PS+ S   +T    
Sbjct  16   LIQQFTAI-TGASESVGKHMLEACSNNLEMAVTMFLDG--GGIAEEPSTSSASVSTGRPH  72

Query  184  dpslssisgsikgsgdesekQGDRDEVRPPLPVIRDVLYDTAVIRGLPAMGGSAHEARSV  363
                                    +EVR P+P  +++L +   + G P        ARS+
Sbjct  73   A----------------------EEEVRAPIPQKQEILVEPEPLFGAPK---RRRPARSI  107

Query  364  VP-FRNF-------EQEMKHPGVWETDKASNSADNLASLYRPPFALMYHGSFEKAKDAAR  519
               FR+F       EQE+++ G    DK   +   LA L+RPP  LM+ GSFE AK+  +
Sbjct  108  FDGFRDFQTETIRQEQELRNGGA--IDKKLTT---LADLFRPPIDLMHKGSFETAKECGQ  162



>ref|XP_007537896.1| PREDICTED: UBX domain-containing protein 7 isoform X1 [Erinaceus 
europaeus]
Length=489

 Score = 52.8 bits (125),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 54/179 (30%), Positives = 78/179 (44%), Gaps = 40/179 (22%)
 Frame = +1

Query  7    LVASFLEIAVGQSADTARQFLQATSWKLEEALQLFYVGNDGGVAAPSSYSPLENTAPlpd  186
            L+  F  I  G S    +  L+A S  LE A+ +F  G  GG+A   S S    +A  P 
Sbjct  16   LIQQFTAI-TGASESVGKHMLEACSNNLEMAVTMFLDG--GGIAEEPSTSSASVSAGRPH  72

Query  187  pslssisgsikgsgdesekQGDRDEVRPPLPVIRDVLYDTAVIRGLPAMGGSAHEARSVV  366
                                   +EVR P+P  +++L +   + G P        ARS+ 
Sbjct  73   T---------------------EEEVRAPIPQKQEILVEPEPLFGAPK---RRRPARSIF  108

Query  367  P-FRNF-------EQEMKHPGVWETDKASNSADNLASLYRPPFALMYHGSFEKAKDAAR  519
              FR+F       EQE+++ G    DK   +   LA L+RPP  LM+ GSFE AK+  +
Sbjct  109  DGFRDFQTETIRQEQELRNGGA--IDKKLTT---LADLFRPPIDLMHKGSFETAKECGQ  162



>ref|XP_009139540.1| PREDICTED: UBX domain-containing protein 7-like [Brassica rapa]
Length=412

 Score = 52.8 bits (125),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 19/40 (48%), Positives = 34/40 (85%), Gaps = 0/40 (0%)
 Frame = +1

Query  7    LVASFLEIAVGQSADTARQFLQATSWKLEEALQLFYVGND  126
            L++SFLE+AVGQ+ +TA++FL+ T+W ++E++ LF + N+
Sbjct  48   LISSFLEVAVGQTVETAKRFLETTNWNIDESINLFLLRNN  87



>ref|XP_005529566.1| PREDICTED: UBX domain-containing protein 7 [Pseudopodoces humilis]
Length=507

 Score = 52.8 bits (125),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 54/179 (30%), Positives = 78/179 (44%), Gaps = 40/179 (22%)
 Frame = +1

Query  7    LVASFLEIAVGQSADTARQFLQATSWKLEEALQLFYVGNDGGVAAPSSYSPLENTAPlpd  186
            LV  F  I  G S    +  L+A +  LE A+ +F  G  GG+A   S S    +A    
Sbjct  34   LVQQFTAI-TGASESVGKHMLEACNNNLEMAVTMFLDG--GGIAEEPSTSSAAVSA----  86

Query  187  pslssisgsikgsgdesekQGDRDEVRPPLPVIRDVLYDTAVIRGLPAMGGSAHEARSVV  366
                              +    DEVR P+P  +++L +   + G P        ARS+ 
Sbjct  87   -----------------VRPHPEDEVRAPIPQKQEILVEPEPLFGAPK---RRRPARSIF  126

Query  367  P-FRNF-------EQEMKHPGVWETDKASNSADNLASLYRPPFALMYHGSFEKAKDAAR  519
              FR+F       EQE+++ G    DK   +   LA L+RPP  LM+ GSFE AK+  +
Sbjct  127  DGFRDFQTETIRQEQELRNGGA--VDKKLTT---LADLFRPPIDLMHKGSFETAKECGQ  180



>gb|KFP06318.1| UBX domain-containing protein 7, partial [Calypte anna]
Length=467

 Score = 52.8 bits (125),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 52/170 (31%), Positives = 74/170 (44%), Gaps = 39/170 (23%)
 Frame = +1

Query  34   VGQSADTARQFLQATSWKLEEALQLFYVGNDGGVAAPSSYSPLENTAPlpdpslssisgs  213
             G S    +  L+A S  LE A+ +F  G  GG+A   S S    +A  P          
Sbjct  2    TGASESVGKHMLEACSNNLEMAVTMFLDG--GGIAEEPSTSSAAVSAVRPHT--------  51

Query  214  ikgsgdesekQGDRDEVRPPLPVIRDVLYDTAVIRGLPAMGGSAHEARSVVP-FRNF---  381
                          DEVR P+P  +++L +   + G P        ARS+   FR+F   
Sbjct  52   -------------EDEVRAPIPQKQEILVEPEPLFGAPK---RRRPARSIFDGFRDFQTE  95

Query  382  ----EQEMKHPGVWETDKASNSADNLASLYRPPFALMYHGSFEKAKDAAR  519
                EQE+++ G    DK   +   LA L+RPP  LM+ GSFE AK+  +
Sbjct  96   TIRQEQELRNGGA--VDKKLTT---LADLFRPPIDLMHKGSFETAKECGQ  140



>ref|XP_006267089.1| PREDICTED: UBX domain-containing protein 7 [Alligator mississippiensis]
Length=489

 Score = 52.8 bits (125),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 54/179 (30%), Positives = 78/179 (44%), Gaps = 40/179 (22%)
 Frame = +1

Query  7    LVASFLEIAVGQSADTARQFLQATSWKLEEALQLFYVGNDGGVAAPSSYSPLENTAPlpd  186
            L+  F  I  G S    +  L+A +  LE A+ +F  G  GG+A   S S    +A  P 
Sbjct  16   LIQQFTAI-TGASESVGKHMLEACNNNLEMAVTMFLDG--GGIAEEPSTSSAGVSAVRPH  72

Query  187  pslssisgsikgsgdesekQGDRDEVRPPLPVIRDVLYDTAVIRGLPAMGGSAHEARSVV  366
                                   DEVR P+P  +++L +   + G P        ARS+ 
Sbjct  73   T---------------------EDEVRAPIPQKQEILVEPEPLFGAPK---RRRPARSIF  108

Query  367  P-FRNF-------EQEMKHPGVWETDKASNSADNLASLYRPPFALMYHGSFEKAKDAAR  519
              FR+F       EQE+++ G    DK   +   LA L+RPP  LM+ GSFE AK+  +
Sbjct  109  DGFRDFQTETIRQEQELRNGGA--IDKKLTT---LADLFRPPIDLMHKGSFETAKECGQ  162



>ref|XP_008499110.1| PREDICTED: UBX domain-containing protein 7, partial [Calypte 
anna]
Length=466

 Score = 52.8 bits (125),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 52/170 (31%), Positives = 74/170 (44%), Gaps = 39/170 (23%)
 Frame = +1

Query  34   VGQSADTARQFLQATSWKLEEALQLFYVGNDGGVAAPSSYSPLENTAPlpdpslssisgs  213
             G S    +  L+A S  LE A+ +F  G  GG+A   S S    +A  P          
Sbjct  1    TGASESVGKHMLEACSNNLEMAVTMFLDG--GGIAEEPSTSSAAVSAVRPHT--------  50

Query  214  ikgsgdesekQGDRDEVRPPLPVIRDVLYDTAVIRGLPAMGGSAHEARSVVP-FRNF---  381
                          DEVR P+P  +++L +   + G P        ARS+   FR+F   
Sbjct  51   -------------EDEVRAPIPQKQEILVEPEPLFGAPK---RRRPARSIFDGFRDFQTE  94

Query  382  ----EQEMKHPGVWETDKASNSADNLASLYRPPFALMYHGSFEKAKDAAR  519
                EQE+++ G    DK   +   LA L+RPP  LM+ GSFE AK+  +
Sbjct  95   TIRQEQELRNGGA--VDKKLTT---LADLFRPPIDLMHKGSFETAKECGQ  139



>ref|XP_006034950.1| PREDICTED: UBX domain-containing protein 7 [Alligator sinensis]
Length=480

 Score = 52.8 bits (125),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 52/173 (30%), Positives = 76/173 (44%), Gaps = 39/173 (23%)
 Frame = +1

Query  25   EIAVGQSADTARQFLQATSWKLEEALQLFYVGNDGGVAAPSSYSPLENTAPlpdpslssi  204
            E+  G S    +  L+A +  LE A+ +F  G  GG+A   S S    +A  P       
Sbjct  12   EMDAGASESVGKHMLEACNNNLEMAVTMFLDG--GGIAEEPSTSSAGVSAVRPHT-----  64

Query  205  sgsikgsgdesekQGDRDEVRPPLPVIRDVLYDTAVIRGLPAMGGSAHEARSVVP-FRNF  381
                             DEVR P+P  +++L +   + G P        ARS+   FR+F
Sbjct  65   ----------------EDEVRAPIPQKQEILVEPEPLFGAPK---RRRPARSIFDGFRDF  105

Query  382  -------EQEMKHPGVWETDKASNSADNLASLYRPPFALMYHGSFEKAKDAAR  519
                   EQE+++ G    DK   +   LA L+RPP  LM+ GSFE AK+  +
Sbjct  106  QTETIRQEQELRNGGA--IDKKLTT---LADLFRPPIDLMHKGSFETAKECGQ  153



>ref|XP_422667.3| PREDICTED: UBX domain-containing protein 7 isoform X2 [Gallus 
gallus]
Length=597

 Score = 52.4 bits (124),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 53/179 (30%), Positives = 78/179 (44%), Gaps = 40/179 (22%)
 Frame = +1

Query  7    LVASFLEIAVGQSADTARQFLQATSWKLEEALQLFYVGNDGGVAAPSSYSPLENTAPlpd  186
            L+  F  I  G S    +  L+A +  LE A+ +F  G  GG+A   S S    +A    
Sbjct  124  LIQQFTAI-TGASESVGKHMLEACNNNLEMAVTMFLDG--GGIAEEPSTSSAAVSA----  176

Query  187  pslssisgsikgsgdesekQGDRDEVRPPLPVIRDVLYDTAVIRGLPAMGGSAHEARSVV  366
                              +    DEVR P+P  +++L +   + G P        ARS+ 
Sbjct  177  -----------------VRPHTEDEVRAPIPQKQEILVEPEPLFGAPK---RRRPARSIF  216

Query  367  P-FRNF-------EQEMKHPGVWETDKASNSADNLASLYRPPFALMYHGSFEKAKDAAR  519
              FR+F       EQE+++ G    DK   +   LA L+RPP  LM+ GSFE AK+  +
Sbjct  217  DGFRDFQTETIRQEQELRNGGA--VDKKLTT---LADLFRPPIDLMHKGSFETAKECGQ  270



>gb|KFW11978.1| UBX domain-containing protein 7, partial [Eurypyga helias]
Length=468

 Score = 52.4 bits (124),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 52/170 (31%), Positives = 73/170 (43%), Gaps = 39/170 (23%)
 Frame = +1

Query  34   VGQSADTARQFLQATSWKLEEALQLFYVGNDGGVAAPSSYSPLENTAPlpdpslssisgs  213
             G S    +  L+A +  LE A+ +F  G  GG+A   S S    +A  P          
Sbjct  3    TGASESVGKHMLEACNNNLEMAVTMFLDG--GGIAEEPSTSSAGVSAVRPHT--------  52

Query  214  ikgsgdesekQGDRDEVRPPLPVIRDVLYDTAVIRGLPAMGGSAHEARSVVP-FRNF---  381
                          DEVR P+P  R++L +     G P        ARS+   FR+F   
Sbjct  53   -------------EDEVRAPIPQKREILVEPEPFFGAPK---RRRPARSIFDGFRDFQTE  96

Query  382  ----EQEMKHPGVWETDKASNSADNLASLYRPPFALMYHGSFEKAKDAAR  519
                EQE+++ G    DK   +   LA L+RPP  LM+ GSFE AK+  +
Sbjct  97   TIRQEQELRNGGA--VDKKLTT---LADLFRPPIDLMHKGSFETAKECGQ  141



>ref|XP_008283973.1| PREDICTED: UBX domain-containing protein 7 [Stegastes partitus]
Length=539

 Score = 52.4 bits (124),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 53/179 (30%), Positives = 79/179 (44%), Gaps = 39/179 (22%)
 Frame = +1

Query  7    LVASFLEIAVGQSADTARQFLQATSWKLEEALQLFYVGNDGGVAAPSSYSPLENTAPlpd  186
            L+  F  I  G +    +  L+A +  LE A+ +F  G  GG+A   S S     +    
Sbjct  27   LIQQFTAI-TGATESVGKHMLEACNNNLEMAVTMFLDG--GGIAEEPSTSSSSAASSSRA  83

Query  187  pslssisgsikgsgdesekQGDRDEVRPPLPVIRDVLYDTAVIRGLPAMGGSAHEARSVV  366
            P                      DEVR P+P  +D+L +   + G+P        ARS+ 
Sbjct  84   PPT--------------------DEVRAPIPQKQDILVEPEPLFGVPKR---RRPARSIF  120

Query  367  P-FRNF-------EQEMKHPGVWETDKASNSADNLASLYRPPFALMYHGSFEKAKDAAR  519
              FR+F       EQE+++ G    DK  ++   LA L+RPP  LM+ GSFE AK+  +
Sbjct  121  DGFRDFQTETIRQEQELRNGGT--VDKKLST---LADLFRPPIELMHKGSFETAKECGQ  174



>gb|EMC77931.1| UBX domain-containing protein 7, partial [Columba livia]
Length=468

 Score = 52.4 bits (124),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 52/171 (30%), Positives = 75/171 (44%), Gaps = 39/171 (23%)
 Frame = +1

Query  31   AVGQSADTARQFLQATSWKLEEALQLFYVGNDGGVAAPSSYSPLENTAPlpdpslssisg  210
            A G S    +  L+A +  LE A+ +F  G  GG+A   S S    +A  P         
Sbjct  2    AAGASESVGKHMLEACNNNLEMAVTMFLDG--GGIAEEPSTSSAGVSAVRPHT-------  52

Query  211  sikgsgdesekQGDRDEVRPPLPVIRDVLYDTAVIRGLPAMGGSAHEARSVVP-FRNF--  381
                           DEVR P+P  +++L +   + G P        ARS+   FR+F  
Sbjct  53   --------------EDEVRAPIPQKQEILVEPEPLFGAPK---RRRPARSIFDGFRDFQT  95

Query  382  -----EQEMKHPGVWETDKASNSADNLASLYRPPFALMYHGSFEKAKDAAR  519
                 EQE+++ G    DK   +   LA L+RPP  LM+ GSFE AK+  +
Sbjct  96   ETIRQEQELRNGGA--VDKKLTT---LADLFRPPIDLMHKGSFETAKECGQ  141



>ref|XP_010157159.1| PREDICTED: UBX domain-containing protein 7, partial [Eurypyga 
helias]
Length=475

 Score = 52.4 bits (124),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 52/170 (31%), Positives = 73/170 (43%), Gaps = 39/170 (23%)
 Frame = +1

Query  34   VGQSADTARQFLQATSWKLEEALQLFYVGNDGGVAAPSSYSPLENTAPlpdpslssisgs  213
             G S    +  L+A +  LE A+ +F  G  GG+A   S S    +A  P          
Sbjct  10   TGASESVGKHMLEACNNNLEMAVTMFLDG--GGIAEEPSTSSAGVSAVRPHT--------  59

Query  214  ikgsgdesekQGDRDEVRPPLPVIRDVLYDTAVIRGLPAMGGSAHEARSVVP-FRNF---  381
                          DEVR P+P  R++L +     G P        ARS+   FR+F   
Sbjct  60   -------------EDEVRAPIPQKREILVEPEPFFGAPK---RRRPARSIFDGFRDFQTE  103

Query  382  ----EQEMKHPGVWETDKASNSADNLASLYRPPFALMYHGSFEKAKDAAR  519
                EQE+++ G    DK   +   LA L+RPP  LM+ GSFE AK+  +
Sbjct  104  TIRQEQELRNGGA--VDKKLTT---LADLFRPPIDLMHKGSFETAKECGQ  148



>ref|XP_006010569.1| PREDICTED: UBX domain-containing protein 7 [Latimeria chalumnae]
Length=473

 Score = 52.4 bits (124),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 47/171 (27%), Positives = 73/171 (43%), Gaps = 46/171 (27%)
 Frame = +1

Query  7    LVASFLEIAVGQSADTARQFLQATSWKLEEALQLFYVGNDGGVAAPSSYSPLENTAPlpd  186
            LV  F+ I  G + +  +  L+A S+ LE A+ ++  G  GG+A   S S    +A    
Sbjct  16   LVQQFIAI-TGANENVGKHMLEACSYNLEMAVTMYLDG--GGIAEEPSTSSAGTSAASLP  72

Query  187  pslssisgsikgsgdesekQGDRDEVRPPLPVIRDVLYDTAVIRGLPAMGGSAHEARSVV  366
             +                     DEVR P+P  +D+L ++  +                 
Sbjct  73   LA--------------------EDEVRAPIPQKQDILVESEPL-----------------  95

Query  367  PFRNFEQEMKHPGVWETDKASNSADNLASLYRPPFALMYHGSFEKAKDAAR  519
             F   EQE+++ G    DK   +   LA L+RPP  LM+ GSFE AK+  +
Sbjct  96   -FIRQEQELRNGGA--IDKKLTT---LADLFRPPIELMHKGSFETAKETGQ  140



>ref|XP_009939092.1| PREDICTED: UBX domain-containing protein 7 [Opisthocomus hoazin]
Length=526

 Score = 52.4 bits (124),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 51/171 (30%), Positives = 76/171 (44%), Gaps = 41/171 (24%)
 Frame = +1

Query  34   VGQSADTARQFLQATSWKLEEALQLFYVGNDGGVAA-PSSYSPLENTAPlpdpslssisg  210
             G S    +  L+A +  LE A+ +F  G  GG+A  PS+ S   +T             
Sbjct  61   TGASESVGKHMLEACNNNLEMAVTMFLDG--GGIAEEPSTSSAGVSTVRPH---------  109

Query  211  sikgsgdesekQGDRDEVRPPLPVIRDVLYDTAVIRGLPAMGGSAHEARSVVP-FRNF--  381
                         + DEVR P+P  +++L +   + G P        ARS+   FR+F  
Sbjct  110  -------------NEDEVRAPIPQKQEILVEPEPLFGAPK---RRRPARSIFDGFRDFQT  153

Query  382  -----EQEMKHPGVWETDKASNSADNLASLYRPPFALMYHGSFEKAKDAAR  519
                 EQE+++ G    DK   +   LA L+RPP  LM+ GSFE AK+  +
Sbjct  154  ETIRQEQELRNGGA--VDKKLTT---LADLFRPPIDLMHKGSFETAKECGQ  199



>gb|KFR15588.1| UBX domain-containing protein 7, partial [Opisthocomus hoazin]
Length=468

 Score = 52.0 bits (123),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 51/171 (30%), Positives = 77/171 (45%), Gaps = 41/171 (24%)
 Frame = +1

Query  34   VGQSADTARQFLQATSWKLEEALQLFYVGNDGGVAA-PSSYSPLENTAPlpdpslssisg  210
             G S    +  L+A +  LE A+ +F  G  GG+A  PS+ S   +T             
Sbjct  3    TGASESVGKHMLEACNNNLEMAVTMFLDG--GGIAEEPSTSSAGVSTV------------  48

Query  211  sikgsgdesekQGDRDEVRPPLPVIRDVLYDTAVIRGLPAMGGSAHEARSVVP-FRNF--  381
                      +  + DEVR P+P  +++L +   + G P        ARS+   FR+F  
Sbjct  49   ----------RPHNEDEVRAPIPQKQEILVEPEPLFGAPK---RRRPARSIFDGFRDFQT  95

Query  382  -----EQEMKHPGVWETDKASNSADNLASLYRPPFALMYHGSFEKAKDAAR  519
                 EQE+++ G    DK   +   LA L+RPP  LM+ GSFE AK+  +
Sbjct  96   ETIRQEQELRNGGA--VDKKLTT---LADLFRPPIDLMHKGSFETAKECGQ  141



>ref|XP_009995047.1| PREDICTED: UBX domain-containing protein 7 [Chaetura pelagica]
 gb|KFU88936.1| UBX domain-containing protein 7 [Chaetura pelagica]
Length=467

 Score = 52.0 bits (123),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 52/169 (31%), Positives = 75/169 (44%), Gaps = 39/169 (23%)
 Frame = +1

Query  37   GQSADTARQFLQATSWKLEEALQLFYVGNDGGVAAPSSYSPLENTAPlpdpslssisgsi  216
            G S   A+  L+A +  LE A+ +F  G  GG+A   S S    +A  P           
Sbjct  3    GASESVAKHMLEACNNNLEMAVTMFLDG--GGIAEEPSTSSAGVSAVRPHT---------  51

Query  217  kgsgdesekQGDRDEVRPPLPVIRDVLYDTAVIRGLPAMGGSAHEARSVVP-FRNF----  381
                         DEVR P+P  +++L +   + G P        ARS+   FR+F    
Sbjct  52   ------------EDEVRAPIPQKQEILVEPEPLFGAPK---RRRPARSIFDGFRDFQTET  96

Query  382  ---EQEMKHPGVWETDKASNSADNLASLYRPPFALMYHGSFEKAKDAAR  519
               EQE+++ G    DK   +   LA L+RPP  LM+ GSFE AK+  +
Sbjct  97   IRQEQELRNGGA--VDKKLTT---LADLFRPPIDLMHKGSFETAKECGQ  140



>ref|XP_010436606.1| PREDICTED: UBX domain-containing protein 2-like [Camelina sativa]
Length=358

 Score = 51.6 bits (122),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 23/47 (49%), Positives = 32/47 (68%), Gaps = 0/47 (0%)
 Frame = +1

Query  7    LVASFLEIAVGQSADTARQFLQATSWKLEEALQLFYVGNDGGVAAPS  147
            L++SFLEIAVGQ+ +TAR FLQ + W +  A+ LF + N+     PS
Sbjct  30   LISSFLEIAVGQTTETARGFLQTSGWNINVAIDLFLITNNTYSPPPS  76



>emb|CDY01206.1| BnaA04g06130D [Brassica napus]
Length=412

 Score = 51.6 bits (122),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 19/39 (49%), Positives = 32/39 (82%), Gaps = 0/39 (0%)
 Frame = +1

Query  7    LVASFLEIAVGQSADTARQFLQATSWKLEEALQLFYVGN  123
            L++SFLE+AVGQ+ +TA+ FL+ T+W ++E++ LF + N
Sbjct  48   LISSFLEVAVGQTVETAKTFLETTNWNIDESINLFLLRN  86



>ref|XP_002886675.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH62934.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
Length=305

 Score = 51.6 bits (122),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 26/53 (49%), Positives = 35/53 (66%), Gaps = 3/53 (6%)
 Frame = +1

Query  7    LVASFLEIAVGQSADTARQFLQATSWKLEEALQLFYV---GNDGGVAAPSSYS  156
            LV+SFLEIAV Q+ +TA + L AT+WK+EEA+ LF++    N      PS  S
Sbjct  9    LVSSFLEIAVDQTVETAIKCLNATNWKVEEAINLFFLIDRRNQSSTQKPSDSS  61



>ref|XP_646734.1| UAS domain-containing protein [Dictyostelium discoideum AX4]
 sp|Q55BU7.1|UBXN7_DICDI RecName: Full=UBX domain-containing protein 7 homolog [Dictyostelium 
discoideum]
 gb|EAL72529.1| UAS domain-containing protein [Dictyostelium discoideum AX4]
Length=503

 Score = 51.6 bits (122),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 44/170 (26%), Positives = 73/170 (43%), Gaps = 18/170 (11%)
 Frame = +1

Query  7    LVASFLEIAVGQSADTARQFLQATSWKLEEALQLFYVGNDGGVAAPSSYSPLENTAPlpd  186
            ++++FL I     +  A   L+  +W +E ++  F+  ND     PS      N  P   
Sbjct  6    ILSNFLSITGCDDSSLATTILENNNWDVERSVDFFFTMND-----PS------NVKPTTS  54

Query  187  pslssisgsikgsgdesekQGDRDEVRPPLPVIRDVLYDTAVIRGLPAMGGSAHEARSVV  366
               +S   +   S   SE   + DE R P+P   D L D       P       +     
Sbjct  55   SKKTSSPPTASSSSASSEFDYNEDEFRDPIPQKMDKLVDHYY---QPTQRSYQKQTNVFE  111

Query  367  PFRNFEQEMKHPGVWETDKASNSADNLASLYRPPFALMYHGSFEKAKDAA  516
             FR+FE+E    G+   DKA+    +L+ L++PP  ++  G+F++ K  A
Sbjct  112  AFRDFEKER---GI-NQDKATEKQKSLSELFKPPLDILTFGTFDEIKKMA  157



>ref|XP_009642777.1| PREDICTED: UBX domain-containing protein 7 [Egretta garzetta]
Length=493

 Score = 51.6 bits (122),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 51/173 (29%), Positives = 76/173 (44%), Gaps = 39/173 (23%)
 Frame = +1

Query  25   EIAVGQSADTARQFLQATSWKLEEALQLFYVGNDGGVAAPSSYSPLENTAPlpdpslssi  204
            ++  G S    +  L+A +  LE A+ +F  G  GG+A   S S    +A  P       
Sbjct  25   KLGRGASESVGKHMLEACNNNLEMAVTMFLDG--GGIAEEPSTSSAAVSAVRPHT-----  77

Query  205  sgsikgsgdesekQGDRDEVRPPLPVIRDVLYDTAVIRGLPAMGGSAHEARSVVP-FRNF  381
                             DEVR P+P  +++L +   + G P        ARS+   FR+F
Sbjct  78   ----------------EDEVRAPIPQKQEILVEPEPLFGAPK---RRRPARSIFDGFRDF  118

Query  382  -------EQEMKHPGVWETDKASNSADNLASLYRPPFALMYHGSFEKAKDAAR  519
                   EQE+++ G    DK   +   LA L+RPP  LM+ GSFE AK+  +
Sbjct  119  QTETIRQEQELRNGGA--VDKKLTT---LADLFRPPIDLMHKGSFETAKECGQ  166



>gb|KFW91268.1| UBX domain-containing protein 7, partial [Phalacrocorax carbo]
Length=470

 Score = 51.6 bits (122),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 52/172 (30%), Positives = 78/172 (45%), Gaps = 43/172 (25%)
 Frame = +1

Query  34   VGQSADTARQFLQATSWKLEEALQLFYVGNDGGVAA--PSSYSPLENTAPlpdpslssis  207
             G S    +  L+A +  LE A+ +F    DGGV A  PS+ S                 
Sbjct  5    TGASESVGKHMLEACNNNLEMAVTMFL---DGGVIAEEPSTSS-----------------  44

Query  208  gsikgsgdesekQGDRDEVRPPLPVIRDVLYDTAVIRGLPAMGGSAHEARSVVP-FRNF-  381
                 +G  + +  + DEVR P+P  +++L +   + G P        ARS+   FR+F 
Sbjct  45   -----AGVSAVRPHNEDEVRAPIPQKQEILVEPEPLFGAPK---RRRPARSIFDGFRDFQ  96

Query  382  ------EQEMKHPGVWETDKASNSADNLASLYRPPFALMYHGSFEKAKDAAR  519
                  EQE+++ G    DK   +   LA L+RPP  LM+ GSFE AK+  +
Sbjct  97   TETIRQEQELRNGGA--VDKKLTT---LADLFRPPIDLMHKGSFETAKECGQ  143



>ref|XP_009503466.1| PREDICTED: UBX domain-containing protein 7, partial [Phalacrocorax 
carbo]
Length=469

 Score = 51.6 bits (122),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 52/172 (30%), Positives = 78/172 (45%), Gaps = 43/172 (25%)
 Frame = +1

Query  34   VGQSADTARQFLQATSWKLEEALQLFYVGNDGGVAA--PSSYSPLENTAPlpdpslssis  207
             G S    +  L+A +  LE A+ +F    DGGV A  PS+ S                 
Sbjct  4    TGASESVGKHMLEACNNNLEMAVTMFL---DGGVIAEEPSTSS-----------------  43

Query  208  gsikgsgdesekQGDRDEVRPPLPVIRDVLYDTAVIRGLPAMGGSAHEARSVVP-FRNF-  381
                 +G  + +  + DEVR P+P  +++L +   + G P        ARS+   FR+F 
Sbjct  44   -----AGVSAVRPHNEDEVRAPIPQKQEILVEPEPLFGAPK---RRRPARSIFDGFRDFQ  95

Query  382  ------EQEMKHPGVWETDKASNSADNLASLYRPPFALMYHGSFEKAKDAAR  519
                  EQE+++ G    DK   +   LA L+RPP  LM+ GSFE AK+  +
Sbjct  96   TETIRQEQELRNGGA--VDKKLTT---LADLFRPPIDLMHKGSFETAKECGQ  142



>gb|KFQ45369.1| UBX domain-containing protein 7, partial [Nestor notabilis]
Length=388

 Score = 51.2 bits (121),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 51/170 (30%), Positives = 74/170 (44%), Gaps = 39/170 (23%)
 Frame = +1

Query  34   VGQSADTARQFLQATSWKLEEALQLFYVGNDGGVAAPSSYSPLENTAPlpdpslssisgs  213
             G S    +  L+A +  LE A+ +F  G  GG+A   S S    +A  P          
Sbjct  2    TGASESVGKHMLEACNNNLEMAVTMFLDG--GGIAEEPSTSSAGVSAVRPHT--------  51

Query  214  ikgsgdesekQGDRDEVRPPLPVIRDVLYDTAVIRGLPAMGGSAHEARSVVP-FRNF---  381
                          DEVR P+P  +++L +   + G P        ARS+   FR+F   
Sbjct  52   -------------EDEVRAPIPQKQEILVEPEPLFGAPK---RRRPARSIFDGFRDFQTE  95

Query  382  ----EQEMKHPGVWETDKASNSADNLASLYRPPFALMYHGSFEKAKDAAR  519
                EQE+++ G    DK   +   LA L+RPP  LM+ GSFE AK+  +
Sbjct  96   TIRQEQELRNGGA--VDKKLTT---LADLFRPPIDLMHKGSFETAKECGQ  140



>gb|KFP20656.1| UBX domain-containing protein 7, partial [Egretta garzetta]
Length=468

 Score = 51.2 bits (121),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 51/170 (30%), Positives = 74/170 (44%), Gaps = 39/170 (23%)
 Frame = +1

Query  34   VGQSADTARQFLQATSWKLEEALQLFYVGNDGGVAAPSSYSPLENTAPlpdpslssisgs  213
             G S    +  L+A +  LE A+ +F  G  GG+A   S S    +A  P          
Sbjct  3    TGASESVGKHMLEACNNNLEMAVTMFLDG--GGIAEEPSTSSAAVSAVRPHT--------  52

Query  214  ikgsgdesekQGDRDEVRPPLPVIRDVLYDTAVIRGLPAMGGSAHEARSVVP-FRNF---  381
                          DEVR P+P  +++L +   + G P        ARS+   FR+F   
Sbjct  53   -------------EDEVRAPIPQKQEILVEPEPLFGAPK---RRRPARSIFDGFRDFQTE  96

Query  382  ----EQEMKHPGVWETDKASNSADNLASLYRPPFALMYHGSFEKAKDAAR  519
                EQE+++ G    DK   +   LA L+RPP  LM+ GSFE AK+  +
Sbjct  97   TIRQEQELRNGGA--VDKKLTT---LADLFRPPIDLMHKGSFETAKECGQ  141



>gb|KFV98068.1| UBX domain-containing protein 7, partial [Fulmarus glacialis]
Length=468

 Score = 51.2 bits (121),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 51/170 (30%), Positives = 74/170 (44%), Gaps = 39/170 (23%)
 Frame = +1

Query  34   VGQSADTARQFLQATSWKLEEALQLFYVGNDGGVAAPSSYSPLENTAPlpdpslssisgs  213
             G S    +  L+A +  LE A+ +F  G  GG+A   S S    +A  P          
Sbjct  3    TGASESVGKHMLEACNNNLEMAVTMFLDG--GGIAEEPSTSSAAVSAVRPHT--------  52

Query  214  ikgsgdesekQGDRDEVRPPLPVIRDVLYDTAVIRGLPAMGGSAHEARSVVP-FRNF---  381
                          DEVR P+P  +++L +   + G P        ARS+   FR+F   
Sbjct  53   -------------EDEVRAPIPQKQEILVEPEPLFGAPK---RRRPARSIFDGFRDFQTE  96

Query  382  ----EQEMKHPGVWETDKASNSADNLASLYRPPFALMYHGSFEKAKDAAR  519
                EQE+++ G    DK   +   LA L+RPP  LM+ GSFE AK+  +
Sbjct  97   TIRQEQELRNGGA--VDKKLTT---LADLFRPPIDLMHKGSFETAKECGQ  141



>ref|XP_009584874.1| PREDICTED: UBX domain-containing protein 7, partial [Fulmarus 
glacialis]
Length=469

 Score = 51.2 bits (121),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 51/170 (30%), Positives = 74/170 (44%), Gaps = 39/170 (23%)
 Frame = +1

Query  34   VGQSADTARQFLQATSWKLEEALQLFYVGNDGGVAAPSSYSPLENTAPlpdpslssisgs  213
             G S    +  L+A +  LE A+ +F  G  GG+A   S S    +A  P          
Sbjct  4    TGASESVGKHMLEACNNNLEMAVTMFLDG--GGIAEEPSTSSAAVSAVRPHT--------  53

Query  214  ikgsgdesekQGDRDEVRPPLPVIRDVLYDTAVIRGLPAMGGSAHEARSVVP-FRNF---  381
                          DEVR P+P  +++L +   + G P        ARS+   FR+F   
Sbjct  54   -------------EDEVRAPIPQKQEILVEPEPLFGAPK---RRRPARSIFDGFRDFQTE  97

Query  382  ----EQEMKHPGVWETDKASNSADNLASLYRPPFALMYHGSFEKAKDAAR  519
                EQE+++ G    DK   +   LA L+RPP  LM+ GSFE AK+  +
Sbjct  98   TIRQEQELRNGGA--VDKKLTT---LADLFRPPIDLMHKGSFETAKECGQ  142



>ref|XP_010445452.1| PREDICTED: UBX domain-containing protein 7 [Camelina sativa]
Length=430

 Score = 51.2 bits (121),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 21/42 (50%), Positives = 30/42 (71%), Gaps = 0/42 (0%)
 Frame = +1

Query  7    LVASFLEIAVGQSADTARQFLQATSWKLEEALQLFYVGNDGG  132
            L++SFLEIAVGQ+ +TAR FLQ + W +  A+ LF + N+  
Sbjct  30   LISSFLEIAVGQTTETARVFLQTSGWNINVAIDLFLITNNNN  71



>gb|KFO08321.1| UBX domain-containing protein 7, partial [Balearica regulorum 
gibbericeps]
Length=468

 Score = 51.2 bits (121),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 51/170 (30%), Positives = 74/170 (44%), Gaps = 39/170 (23%)
 Frame = +1

Query  34   VGQSADTARQFLQATSWKLEEALQLFYVGNDGGVAAPSSYSPLENTAPlpdpslssisgs  213
             G S    +  L+A +  LE A+ +F  G  GG+A   S S    +A  P          
Sbjct  3    TGASESVGKHMLEACNNNLEMAVTMFLDG--GGIAEEPSTSSAAVSAVRPHT--------  52

Query  214  ikgsgdesekQGDRDEVRPPLPVIRDVLYDTAVIRGLPAMGGSAHEARSVVP-FRNF---  381
                          DEVR P+P  +++L +   + G P        ARS+   FR+F   
Sbjct  53   -------------EDEVRAPIPQKQEILVEPEPLFGAPK---RRRPARSIFDGFRDFQTE  96

Query  382  ----EQEMKHPGVWETDKASNSADNLASLYRPPFALMYHGSFEKAKDAAR  519
                EQE+++ G    DK   +   LA L+RPP  LM+ GSFE AK+  +
Sbjct  97   TIRQEQELRNGGA--VDKKLTT---LADLFRPPIDLMHKGSFETAKECGQ  141



>gb|KFZ68476.1| UBX domain-containing protein 7, partial [Podiceps cristatus]
Length=468

 Score = 51.2 bits (121),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 51/170 (30%), Positives = 74/170 (44%), Gaps = 39/170 (23%)
 Frame = +1

Query  34   VGQSADTARQFLQATSWKLEEALQLFYVGNDGGVAAPSSYSPLENTAPlpdpslssisgs  213
             G S    +  L+A +  LE A+ +F  G  GG+A   S S    +A  P          
Sbjct  3    TGASESVGKHMLEACNNNLEMAVTMFLDG--GGIAEEPSTSSAAVSAVRPHT--------  52

Query  214  ikgsgdesekQGDRDEVRPPLPVIRDVLYDTAVIRGLPAMGGSAHEARSVVP-FRNF---  381
                          DEVR P+P  +++L +   + G P        ARS+   FR+F   
Sbjct  53   -------------EDEVRAPIPQKQEILVEPEPLFGAPK---RRRPARSIFDGFRDFQTE  96

Query  382  ----EQEMKHPGVWETDKASNSADNLASLYRPPFALMYHGSFEKAKDAAR  519
                EQE+++ G    DK   +   LA L+RPP  LM+ GSFE AK+  +
Sbjct  97   TIRQEQELRNGGA--VDKKLTT---LADLFRPPIDLMHKGSFETAKECGQ  141



>ref|XP_010311687.1| PREDICTED: UBX domain-containing protein 7, partial [Balearica 
regulorum gibbericeps]
Length=469

 Score = 51.2 bits (121),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 51/170 (30%), Positives = 74/170 (44%), Gaps = 39/170 (23%)
 Frame = +1

Query  34   VGQSADTARQFLQATSWKLEEALQLFYVGNDGGVAAPSSYSPLENTAPlpdpslssisgs  213
             G S    +  L+A +  LE A+ +F  G  GG+A   S S    +A  P          
Sbjct  4    TGASESVGKHMLEACNNNLEMAVTMFLDG--GGIAEEPSTSSAAVSAVRPHT--------  53

Query  214  ikgsgdesekQGDRDEVRPPLPVIRDVLYDTAVIRGLPAMGGSAHEARSVVP-FRNF---  381
                          DEVR P+P  +++L +   + G P        ARS+   FR+F   
Sbjct  54   -------------EDEVRAPIPQKQEILVEPEPLFGAPK---RRRPARSIFDGFRDFQTE  97

Query  382  ----EQEMKHPGVWETDKASNSADNLASLYRPPFALMYHGSFEKAKDAAR  519
                EQE+++ G    DK   +   LA L+RPP  LM+ GSFE AK+  +
Sbjct  98   TIRQEQELRNGGA--VDKKLTT---LADLFRPPIDLMHKGSFETAKECGQ  142



>gb|KFW86225.1| UBX domain-containing protein 7, partial [Manacus vitellinus]
Length=468

 Score = 51.2 bits (121),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 51/169 (30%), Positives = 74/169 (44%), Gaps = 39/169 (23%)
 Frame = +1

Query  37   GQSADTARQFLQATSWKLEEALQLFYVGNDGGVAAPSSYSPLENTAPlpdpslssisgsi  216
            G S    +  L+A +  LE A+ +F  G  GG+A   S S    +A  P           
Sbjct  4    GASESVGKHMLEACNNNLEMAVTMFLDG--GGIAEEPSTSSAGVSAARPHT---------  52

Query  217  kgsgdesekQGDRDEVRPPLPVIRDVLYDTAVIRGLPAMGGSAHEARSVVP-FRNF----  381
                         DEVR P+P  +++L +   + G P        ARS+   FR+F    
Sbjct  53   ------------EDEVRAPIPQKQEILVEPEPLFGAPK---RRRPARSIFDGFRDFQTET  97

Query  382  ---EQEMKHPGVWETDKASNSADNLASLYRPPFALMYHGSFEKAKDAAR  519
               EQE+++ G    DK   +   LA L+RPP  LM+ GSFE AK+  +
Sbjct  98   IRQEQELRNGGA--VDKKLTT---LADLFRPPIDLMHKGSFETAKECGQ  141



>ref|XP_008928489.1| PREDICTED: UBX domain-containing protein 7, partial [Manacus 
vitellinus]
Length=469

 Score = 51.2 bits (121),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 51/169 (30%), Positives = 74/169 (44%), Gaps = 39/169 (23%)
 Frame = +1

Query  37   GQSADTARQFLQATSWKLEEALQLFYVGNDGGVAAPSSYSPLENTAPlpdpslssisgsi  216
            G S    +  L+A +  LE A+ +F  G  GG+A   S S    +A  P           
Sbjct  5    GASESVGKHMLEACNNNLEMAVTMFLDG--GGIAEEPSTSSAGVSAARPHT---------  53

Query  217  kgsgdesekQGDRDEVRPPLPVIRDVLYDTAVIRGLPAMGGSAHEARSVVP-FRNF----  381
                         DEVR P+P  +++L +   + G P        ARS+   FR+F    
Sbjct  54   ------------EDEVRAPIPQKQEILVEPEPLFGAPK---RRRPARSIFDGFRDFQTET  98

Query  382  ---EQEMKHPGVWETDKASNSADNLASLYRPPFALMYHGSFEKAKDAAR  519
               EQE+++ G    DK   +   LA L+RPP  LM+ GSFE AK+  +
Sbjct  99   IRQEQELRNGGA--VDKKLTT---LADLFRPPIDLMHKGSFETAKECGQ  142



>gb|KFP38427.1| UBX domain-containing protein 7, partial [Chlamydotis macqueenii]
Length=468

 Score = 51.2 bits (121),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 51/171 (30%), Positives = 74/171 (43%), Gaps = 39/171 (23%)
 Frame = +1

Query  31   AVGQSADTARQFLQATSWKLEEALQLFYVGNDGGVAAPSSYSPLENTAPlpdpslssisg  210
              G S    +  L+A +  LE A+ +F  G  GG+A   S S    +A  P         
Sbjct  2    VTGASESVGKHMLEACNNNLEMAVTMFLDG--GGIAEEPSTSSAGVSAVRPHT-------  52

Query  211  sikgsgdesekQGDRDEVRPPLPVIRDVLYDTAVIRGLPAMGGSAHEARSVVP-FRNF--  381
                           DEVR P+P  +++L +   + G P        ARS+   FR+F  
Sbjct  53   --------------EDEVRAPIPQKQEILVEPEPLFGAPK---RRRPARSIFDGFRDFQT  95

Query  382  -----EQEMKHPGVWETDKASNSADNLASLYRPPFALMYHGSFEKAKDAAR  519
                 EQE+++ G    DK   +   LA L+RPP  LM+ GSFE AK+  +
Sbjct  96   ETIRQEQELRNGGA--VDKKLTT---LADLFRPPIDLMHKGSFETAKECGQ  141



>ref|XP_005028141.1| PREDICTED: UBX domain-containing protein 7 [Anas platyrhynchos]
Length=478

 Score = 51.2 bits (121),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 50/173 (29%), Positives = 74/173 (43%), Gaps = 43/173 (25%)
 Frame = +1

Query  31   AVGQSADTARQFLQATSWKLEEALQLFYVGNDGGVAAPSSYSP--LENTAPlpdpslssi  204
              G S    +  L+A +  LE A+ +F  G  GG+A   S S   + +  P         
Sbjct  12   VTGASESVGKHMLEACNNNLEMAVTMFLDG--GGIAEEPSTSSAGVSSVRPHT-------  62

Query  205  sgsikgsgdesekQGDRDEVRPPLPVIRDVLYDTAVIRGLPAMGGSAHEARSVVP-FRNF  381
                             DEVR P+P  +++L +   + G P        ARS+   FR+F
Sbjct  63   ----------------EDEVRAPIPQKQEILVEPEPLFGAPK---RRRPARSIFDGFRDF  103

Query  382  -------EQEMKHPGVWETDKASNSADNLASLYRPPFALMYHGSFEKAKDAAR  519
                   EQE+++ G    DK   +   LA L+RPP  LM+ GSFE AK+  +
Sbjct  104  QTETIRQEQELRNGGA--VDKKLTT---LADLFRPPIDLMHKGSFETAKECGQ  151



>gb|KFO87511.1| UBX domain-containing protein 7, partial [Buceros rhinoceros 
silvestris]
Length=467

 Score = 51.2 bits (121),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 51/171 (30%), Positives = 74/171 (43%), Gaps = 39/171 (23%)
 Frame = +1

Query  31   AVGQSADTARQFLQATSWKLEEALQLFYVGNDGGVAAPSSYSPLENTAPlpdpslssisg  210
              G S    +  L+A +  LE A+ +F  G  GG+A   S S    +A  P         
Sbjct  1    VTGASESVGKHMLEACNNNLEMAVTMFLDG--GGIAEEPSTSSAGVSAVRPHT-------  51

Query  211  sikgsgdesekQGDRDEVRPPLPVIRDVLYDTAVIRGLPAMGGSAHEARSVVP-FRNF--  381
                           DEVR P+P  +++L +   + G P        ARS+   FR+F  
Sbjct  52   --------------EDEVRAPIPQKQEILVEPEPLFGAPK---RRRPARSIFDGFRDFQT  94

Query  382  -----EQEMKHPGVWETDKASNSADNLASLYRPPFALMYHGSFEKAKDAAR  519
                 EQE+++ G    DK   +   LA L+RPP  LM+ GSFE AK+  +
Sbjct  95   ETIRQEQELRNGGA--VDKKLTT---LADLFRPPIDLMHKGSFETAKECGQ  140



>gb|KFQ95214.1| UBX domain-containing protein 7, partial [Nipponia nippon]
Length=468

 Score = 51.2 bits (121),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 51/170 (30%), Positives = 74/170 (44%), Gaps = 39/170 (23%)
 Frame = +1

Query  34   VGQSADTARQFLQATSWKLEEALQLFYVGNDGGVAAPSSYSPLENTAPlpdpslssisgs  213
             G S    +  L+A +  LE A+ +F  G  GG+A   S S    +A  P          
Sbjct  3    TGASESVGKHMLEACNNNLEMAVTMFLDG--GGIAEEPSTSSAGVSAVRPHT--------  52

Query  214  ikgsgdesekQGDRDEVRPPLPVIRDVLYDTAVIRGLPAMGGSAHEARSVVP-FRNF---  381
                          DEVR P+P  +++L +   + G P        ARS+   FR+F   
Sbjct  53   -------------EDEVRAPIPQKQEILVEPEPLFGAPK---RRRPARSIFDGFRDFQTE  96

Query  382  ----EQEMKHPGVWETDKASNSADNLASLYRPPFALMYHGSFEKAKDAAR  519
                EQE+++ G    DK   +   LA L+RPP  LM+ GSFE AK+  +
Sbjct  97   TIRQEQELRNGGA--VDKKLTT---LADLFRPPIDLMHKGSFETAKECGQ  141



>ref|XP_009912522.1| PREDICTED: UBX domain-containing protein 7 isoform X1 [Haliaeetus 
albicilla]
Length=422

 Score = 50.8 bits (120),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 36/97 (37%), Positives = 52/97 (54%), Gaps = 16/97 (16%)
 Frame = +1

Query  253  RDEVRPPLPVIRDVLYDTAVIRGLPAMGGSAHEARSVVP-FRNF-------EQEMKHPGV  408
            RDEVR P+P  +++L +   + G P        ARS+   FR+F       EQE+++ G 
Sbjct  7    RDEVRAPIPQKQEILVEPEPLFGAPK---RRRPARSIFDGFRDFQTETIRQEQELRNGGA  63

Query  409  WETDKASNSADNLASLYRPPFALMYHGSFEKAKDAAR  519
               DK   +   LA L+RPP  LM+ GSFE AK+  +
Sbjct  64   --VDKKLTT---LADLFRPPIDLMHKGSFETAKECGQ  95



>ref|XP_005050918.1| PREDICTED: UBX domain-containing protein 7 [Ficedula albicollis]
Length=645

 Score = 51.2 bits (121),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 51/171 (30%), Positives = 75/171 (44%), Gaps = 39/171 (23%)
 Frame = +1

Query  31   AVGQSADTARQFLQATSWKLEEALQLFYVGNDGGVAAPSSYSPLENTAPlpdpslssisg  210
            A G S    +  L+A +  LE A+ +F  G  GG+A   S S    +A            
Sbjct  179  ASGASESVGKHMLEACNNNLEMAVTMFLDG--GGIAEEPSTSSAAVSA------------  224

Query  211  sikgsgdesekQGDRDEVRPPLPVIRDVLYDTAVIRGLPAMGGSAHEARSVVP-FRNF--  381
                      +    DEVR P+P  +++L +   + G P        ARS+   FR+F  
Sbjct  225  ---------VRPHPEDEVRAPIPQKQEILVEPEPLFGAPKR---RRPARSIFDGFRDFQT  272

Query  382  -----EQEMKHPGVWETDKASNSADNLASLYRPPFALMYHGSFEKAKDAAR  519
                 EQE+++ G    DK   +   LA L+RPP  LM+ GSFE AK+  +
Sbjct  273  ETIRQEQELRNGGA--VDKKLTT---LADLFRPPIDLMHKGSFETAKECGQ  318



>ref|XP_010130823.1| PREDICTED: UBX domain-containing protein 7, partial [Buceros 
rhinoceros silvestris]
Length=469

 Score = 51.2 bits (121),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 51/171 (30%), Positives = 74/171 (43%), Gaps = 39/171 (23%)
 Frame = +1

Query  31   AVGQSADTARQFLQATSWKLEEALQLFYVGNDGGVAAPSSYSPLENTAPlpdpslssisg  210
              G S    +  L+A +  LE A+ +F  G  GG+A   S S    +A  P         
Sbjct  3    VTGASESVGKHMLEACNNNLEMAVTMFLDG--GGIAEEPSTSSAGVSAVRPHT-------  53

Query  211  sikgsgdesekQGDRDEVRPPLPVIRDVLYDTAVIRGLPAMGGSAHEARSVVP-FRNF--  381
                           DEVR P+P  +++L +   + G P        ARS+   FR+F  
Sbjct  54   --------------EDEVRAPIPQKQEILVEPEPLFGAPK---RRRPARSIFDGFRDFQT  96

Query  382  -----EQEMKHPGVWETDKASNSADNLASLYRPPFALMYHGSFEKAKDAAR  519
                 EQE+++ G    DK   +   LA L+RPP  LM+ GSFE AK+  +
Sbjct  97   ETIRQEQELRNGGA--VDKKLTT---LADLFRPPIDLMHKGSFETAKECGQ  142



>ref|XP_009875011.1| PREDICTED: UBX domain-containing protein 7, partial [Apaloderma 
vittatum]
Length=470

 Score = 51.2 bits (121),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 51/170 (30%), Positives = 74/170 (44%), Gaps = 39/170 (23%)
 Frame = +1

Query  34   VGQSADTARQFLQATSWKLEEALQLFYVGNDGGVAAPSSYSPLENTAPlpdpslssisgs  213
             G S    +  L+A +  LE A+ +F  G  GG+A   S S    +A  P          
Sbjct  4    TGASESVGKHMLEACNNNLEMAVTMFLDG--GGIAEEPSTSSAGVSAVRPHT--------  53

Query  214  ikgsgdesekQGDRDEVRPPLPVIRDVLYDTAVIRGLPAMGGSAHEARSVVP-FRNF---  381
                          DEVR P+P  +++L +   + G P        ARS+   FR+F   
Sbjct  54   -------------EDEVRAPIPQKQEILVEPEPLFGAPK---RRRPARSIFDGFRDFQTE  97

Query  382  ----EQEMKHPGVWETDKASNSADNLASLYRPPFALMYHGSFEKAKDAAR  519
                EQE+++ G    DK   +   LA L+RPP  LM+ GSFE AK+  +
Sbjct  98   TIRQEQELRNGGA--VDKKLTT---LADLFRPPIDLMHKGSFETAKECGQ  142



>ref|XP_009283288.1| PREDICTED: UBX domain-containing protein 7 [Aptenodytes forsteri]
Length=473

 Score = 51.2 bits (121),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 51/170 (30%), Positives = 74/170 (44%), Gaps = 39/170 (23%)
 Frame = +1

Query  34   VGQSADTARQFLQATSWKLEEALQLFYVGNDGGVAAPSSYSPLENTAPlpdpslssisgs  213
             G S    +  L+A +  LE A+ +F  G  GG+A   S S    +A  P          
Sbjct  8    TGASESVGKHMLEACNNNLEMAVTMFLDG--GGIAEEPSTSSAGVSAVRPHT--------  57

Query  214  ikgsgdesekQGDRDEVRPPLPVIRDVLYDTAVIRGLPAMGGSAHEARSVVP-FRNF---  381
                          DEVR P+P  +++L +   + G P        ARS+   FR+F   
Sbjct  58   -------------EDEVRAPIPQKQEILVEPEPLFGAPK---RRRPARSIFDGFRDFQTE  101

Query  382  ----EQEMKHPGVWETDKASNSADNLASLYRPPFALMYHGSFEKAKDAAR  519
                EQE+++ G    DK   +   LA L+RPP  LM+ GSFE AK+  +
Sbjct  102  TIRQEQELRNGGA--VDKKLTT---LADLFRPPIDLMHKGSFETAKECGQ  146



>gb|KFW66282.1| UBX domain-containing protein 7, partial [Pygoscelis adeliae]
Length=468

 Score = 50.8 bits (120),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 51/170 (30%), Positives = 74/170 (44%), Gaps = 39/170 (23%)
 Frame = +1

Query  34   VGQSADTARQFLQATSWKLEEALQLFYVGNDGGVAAPSSYSPLENTAPlpdpslssisgs  213
             G S    +  L+A +  LE A+ +F  G  GG+A   S S    +A  P          
Sbjct  3    TGASESVGKHMLEACNNNLEMAVTMFLDG--GGIAEEPSTSSAGVSAVRPHT--------  52

Query  214  ikgsgdesekQGDRDEVRPPLPVIRDVLYDTAVIRGLPAMGGSAHEARSVVP-FRNF---  381
                          DEVR P+P  +++L +   + G P        ARS+   FR+F   
Sbjct  53   -------------EDEVRAPIPQKQEILVEPEPLFGAPK---RRRPARSIFDGFRDFQTE  96

Query  382  ----EQEMKHPGVWETDKASNSADNLASLYRPPFALMYHGSFEKAKDAAR  519
                EQE+++ G    DK   +   LA L+RPP  LM+ GSFE AK+  +
Sbjct  97   TIRQEQELRNGGA--VDKKLTT---LADLFRPPIDLMHKGSFETAKECGQ  141



>gb|KFM11413.1| UBX domain-containing protein 7, partial [Aptenodytes forsteri]
Length=468

 Score = 50.8 bits (120),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 51/170 (30%), Positives = 74/170 (44%), Gaps = 39/170 (23%)
 Frame = +1

Query  34   VGQSADTARQFLQATSWKLEEALQLFYVGNDGGVAAPSSYSPLENTAPlpdpslssisgs  213
             G S    +  L+A +  LE A+ +F  G  GG+A   S S    +A  P          
Sbjct  3    TGASESVGKHMLEACNNNLEMAVTMFLDG--GGIAEEPSTSSAGVSAVRPHT--------  52

Query  214  ikgsgdesekQGDRDEVRPPLPVIRDVLYDTAVIRGLPAMGGSAHEARSVVP-FRNF---  381
                          DEVR P+P  +++L +   + G P        ARS+   FR+F   
Sbjct  53   -------------EDEVRAPIPQKQEILVEPEPLFGAPK---RRRPARSIFDGFRDFQTE  96

Query  382  ----EQEMKHPGVWETDKASNSADNLASLYRPPFALMYHGSFEKAKDAAR  519
                EQE+++ G    DK   +   LA L+RPP  LM+ GSFE AK+  +
Sbjct  97   TIRQEQELRNGGA--VDKKLTT---LADLFRPPIDLMHKGSFETAKECGQ  141



>ref|XP_009969814.1| PREDICTED: UBX domain-containing protein 7, partial [Tyto alba]
Length=469

 Score = 50.8 bits (120),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 51/170 (30%), Positives = 74/170 (44%), Gaps = 39/170 (23%)
 Frame = +1

Query  34   VGQSADTARQFLQATSWKLEEALQLFYVGNDGGVAAPSSYSPLENTAPlpdpslssisgs  213
             G S    +  L+A +  LE A+ +F  G  GG+A   S S    +A  P          
Sbjct  4    TGASESVGKHMLEACNNNLEMAVTMFLDG--GGIAEEPSTSSAGVSAVQPHA--------  53

Query  214  ikgsgdesekQGDRDEVRPPLPVIRDVLYDTAVIRGLPAMGGSAHEARSVVP-FRNF---  381
                          DEVR P+P  +++L +   + G P        ARS+   FR+F   
Sbjct  54   -------------EDEVRAPIPQKQEILVEPEPLFGAPK---RRRPARSIFDGFRDFQTE  97

Query  382  ----EQEMKHPGVWETDKASNSADNLASLYRPPFALMYHGSFEKAKDAAR  519
                EQE+++ G    DK   +   LA L+RPP  LM+ GSFE AK+  +
Sbjct  98   TIRQEQELRNGGA--VDKKLTT---LADLFRPPIDLMHKGSFETAKECGQ  142



>gb|KFP92412.1| UBX domain-containing protein 7, partial [Apaloderma vittatum]
Length=469

 Score = 50.8 bits (120),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 51/170 (30%), Positives = 74/170 (44%), Gaps = 39/170 (23%)
 Frame = +1

Query  34   VGQSADTARQFLQATSWKLEEALQLFYVGNDGGVAAPSSYSPLENTAPlpdpslssisgs  213
             G S    +  L+A +  LE A+ +F  G  GG+A   S S    +A  P          
Sbjct  3    TGASESVGKHMLEACNNNLEMAVTMFLDG--GGIAEEPSTSSAGVSAVRPHT--------  52

Query  214  ikgsgdesekQGDRDEVRPPLPVIRDVLYDTAVIRGLPAMGGSAHEARSVVP-FRNF---  381
                          DEVR P+P  +++L +   + G P        ARS+   FR+F   
Sbjct  53   -------------EDEVRAPIPQKQEILVEPEPLFGAPK---RRRPARSIFDGFRDFQTE  96

Query  382  ----EQEMKHPGVWETDKASNSADNLASLYRPPFALMYHGSFEKAKDAAR  519
                EQE+++ G    DK   +   LA L+RPP  LM+ GSFE AK+  +
Sbjct  97   TIRQEQELRNGGA--VDKKLTT---LADLFRPPIDLMHKGSFETAKECGQ  141



>emb|CDQ70866.1| unnamed protein product [Oncorhynchus mykiss]
Length=541

 Score = 51.2 bits (121),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 33/91 (36%), Positives = 46/91 (51%), Gaps = 6/91 (7%)
 Frame = +1

Query  256  DEVRPPLPVIRDVLYDTAVIRGLPAMGGSAHEARSVVP-FRNFEQEM--KHPGVWETDKA  426
            DEVR P+P  +D+L +   + G P        ARS+   FR+F+ E   +   +     A
Sbjct  77   DEVRAPIPQKQDILVEPEPMFGAPKR---RRPARSIFDGFRDFQTETIRQEQELRNGSAA  133

Query  427  SNSADNLASLYRPPFALMYHGSFEKAKDAAR  519
                  LA L+RPP  LM+ GSFE AKD  +
Sbjct  134  DKKLSTLADLFRPPVELMHKGSFETAKDCGQ  164



>ref|XP_005241643.1| PREDICTED: UBX domain-containing protein 7, partial [Falco peregrinus]
 ref|XP_005437208.1| PREDICTED: UBX domain-containing protein 7, partial [Falco cherrug]
Length=469

 Score = 50.8 bits (120),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 51/170 (30%), Positives = 74/170 (44%), Gaps = 39/170 (23%)
 Frame = +1

Query  34   VGQSADTARQFLQATSWKLEEALQLFYVGNDGGVAAPSSYSPLENTAPlpdpslssisgs  213
             G S    +  L+A +  LE A+ +F  G  GG+A   S S    +A  P          
Sbjct  4    TGASESVGKHMLEACNNNLEMAVTMFLDG--GGIAEEPSTSSAGVSAVRPHT--------  53

Query  214  ikgsgdesekQGDRDEVRPPLPVIRDVLYDTAVIRGLPAMGGSAHEARSVVP-FRNF---  381
                          DEVR P+P  +++L +   + G P        ARS+   FR+F   
Sbjct  54   -------------EDEVRAPIPQKQEILVEPEPLFGAPK---RRRPARSIFDGFRDFQTE  97

Query  382  ----EQEMKHPGVWETDKASNSADNLASLYRPPFALMYHGSFEKAKDAAR  519
                EQE+++ G    DK   +   LA L+RPP  LM+ GSFE AK+  +
Sbjct  98   TIRQEQELRNGGA--VDKKLTT---LADLFRPPIDLMHKGSFETAKECGQ  142



>gb|KFP51814.1| UBX domain-containing protein 7, partial [Cathartes aura]
Length=468

 Score = 50.8 bits (120),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 51/170 (30%), Positives = 74/170 (44%), Gaps = 39/170 (23%)
 Frame = +1

Query  34   VGQSADTARQFLQATSWKLEEALQLFYVGNDGGVAAPSSYSPLENTAPlpdpslssisgs  213
             G S    +  L+A +  LE A+ +F  G  GG+A   S S    +A  P          
Sbjct  3    TGASESVGKHMLEACNNNLEMAVTMFLDG--GGIAEEPSTSSAGVSAVRPHT--------  52

Query  214  ikgsgdesekQGDRDEVRPPLPVIRDVLYDTAVIRGLPAMGGSAHEARSVVP-FRNF---  381
                          DEVR P+P  +++L +   + G P        ARS+   FR+F   
Sbjct  53   -------------EDEVRAPIPQKQEILVEPEPLFGAPK---RRRPARSIFDGFRDFQTE  96

Query  382  ----EQEMKHPGVWETDKASNSADNLASLYRPPFALMYHGSFEKAKDAAR  519
                EQE+++ G    DK   +   LA L+RPP  LM+ GSFE AK+  +
Sbjct  97   TIRQEQELRNGGA--VDKKLTT---LADLFRPPIDLMHKGSFETAKECGQ  141



>gb|KFQ00398.1| UBX domain-containing protein 7, partial [Haliaeetus albicilla]
Length=468

 Score = 50.8 bits (120),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 51/170 (30%), Positives = 74/170 (44%), Gaps = 39/170 (23%)
 Frame = +1

Query  34   VGQSADTARQFLQATSWKLEEALQLFYVGNDGGVAAPSSYSPLENTAPlpdpslssisgs  213
             G S    +  L+A +  LE A+ +F  G  GG+A   S S    +A  P          
Sbjct  3    TGASESVGKHMLEACNNNLEMAVTMFLDG--GGIAEEPSTSSAGVSAVRPHT--------  52

Query  214  ikgsgdesekQGDRDEVRPPLPVIRDVLYDTAVIRGLPAMGGSAHEARSVVP-FRNF---  381
                          DEVR P+P  +++L +   + G P        ARS+   FR+F   
Sbjct  53   -------------EDEVRAPIPQKQEILVEPEPLFGAPK---RRRPARSIFDGFRDFQTE  96

Query  382  ----EQEMKHPGVWETDKASNSADNLASLYRPPFALMYHGSFEKAKDAAR  519
                EQE+++ G    DK   +   LA L+RPP  LM+ GSFE AK+  +
Sbjct  97   TIRQEQELRNGGA--VDKKLTT---LADLFRPPIDLMHKGSFETAKECGQ  141



>gb|KFV57093.1| UBX domain-containing protein 7, partial [Tyto alba]
Length=468

 Score = 50.8 bits (120),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 51/170 (30%), Positives = 74/170 (44%), Gaps = 39/170 (23%)
 Frame = +1

Query  34   VGQSADTARQFLQATSWKLEEALQLFYVGNDGGVAAPSSYSPLENTAPlpdpslssisgs  213
             G S    +  L+A +  LE A+ +F  G  GG+A   S S    +A  P          
Sbjct  3    TGASESVGKHMLEACNNNLEMAVTMFLDG--GGIAEEPSTSSAGVSAVQPHA--------  52

Query  214  ikgsgdesekQGDRDEVRPPLPVIRDVLYDTAVIRGLPAMGGSAHEARSVVP-FRNF---  381
                          DEVR P+P  +++L +   + G P        ARS+   FR+F   
Sbjct  53   -------------EDEVRAPIPQKQEILVEPEPLFGAPK---RRRPARSIFDGFRDFQTE  96

Query  382  ----EQEMKHPGVWETDKASNSADNLASLYRPPFALMYHGSFEKAKDAAR  519
                EQE+++ G    DK   +   LA L+RPP  LM+ GSFE AK+  +
Sbjct  97   TIRQEQELRNGGA--VDKKLTT---LADLFRPPIDLMHKGSFETAKECGQ  141



>gb|KFV14929.1| UBX domain-containing protein 7, partial [Pterocles gutturalis]
Length=468

 Score = 50.8 bits (120),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 51/170 (30%), Positives = 74/170 (44%), Gaps = 39/170 (23%)
 Frame = +1

Query  34   VGQSADTARQFLQATSWKLEEALQLFYVGNDGGVAAPSSYSPLENTAPlpdpslssisgs  213
             G S    +  L+A +  LE A+ +F  G  GG+A   S S    +A  P          
Sbjct  3    TGASESVGKHMLEACNNNLEMAVTMFLDG--GGIAEEPSTSSAGVSAVRPHT--------  52

Query  214  ikgsgdesekQGDRDEVRPPLPVIRDVLYDTAVIRGLPAMGGSAHEARSVVP-FRNF---  381
                          DEVR P+P  +++L +   + G P        ARS+   FR+F   
Sbjct  53   -------------EDEVRAPIPQKQEILVEPEPLFGAPK---RRRPARSIFDGFRDFQTE  96

Query  382  ----EQEMKHPGVWETDKASNSADNLASLYRPPFALMYHGSFEKAKDAAR  519
                EQE+++ G    DK   +   LA L+RPP  LM+ GSFE AK+  +
Sbjct  97   TIRQEQELRNGGA--VDKKLTT---LADLFRPPIDLMHKGSFETAKECGQ  141



>gb|KFQ80041.1| UBX domain-containing protein 7, partial [Phaethon lepturus]
Length=468

 Score = 50.8 bits (120),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 51/170 (30%), Positives = 74/170 (44%), Gaps = 39/170 (23%)
 Frame = +1

Query  34   VGQSADTARQFLQATSWKLEEALQLFYVGNDGGVAAPSSYSPLENTAPlpdpslssisgs  213
             G S    +  L+A +  LE A+ +F  G  GG+A   S S    +A  P          
Sbjct  3    TGASESVGKHMLEACNNNLEMAVTMFLDG--GGIAEEPSTSSAGVSAVRPHT--------  52

Query  214  ikgsgdesekQGDRDEVRPPLPVIRDVLYDTAVIRGLPAMGGSAHEARSVVP-FRNF---  381
                          DEVR P+P  +++L +   + G P        ARS+   FR+F   
Sbjct  53   -------------EDEVRAPIPQKQEILVEPEPLFGAPK---RRRPARSIFDGFRDFQTE  96

Query  382  ----EQEMKHPGVWETDKASNSADNLASLYRPPFALMYHGSFEKAKDAAR  519
                EQE+++ G    DK   +   LA L+RPP  LM+ GSFE AK+  +
Sbjct  97   TIRQEQELRNGGA--VDKKLTT---LADLFRPPIDLMHKGSFETAKECGQ  141



>ref|XP_010559592.1| PREDICTED: UBX domain-containing protein 7, partial [Haliaeetus 
leucocephalus]
Length=469

 Score = 50.8 bits (120),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 51/170 (30%), Positives = 74/170 (44%), Gaps = 39/170 (23%)
 Frame = +1

Query  34   VGQSADTARQFLQATSWKLEEALQLFYVGNDGGVAAPSSYSPLENTAPlpdpslssisgs  213
             G S    +  L+A +  LE A+ +F  G  GG+A   S S    +A  P          
Sbjct  4    TGASESVGKHMLEACNNNLEMAVTMFLDG--GGIAEEPSTSSAGVSAVRPHT--------  53

Query  214  ikgsgdesekQGDRDEVRPPLPVIRDVLYDTAVIRGLPAMGGSAHEARSVVP-FRNF---  381
                          DEVR P+P  +++L +   + G P        ARS+   FR+F   
Sbjct  54   -------------EDEVRAPIPQKQEILVEPEPLFGAPK---RRRPARSIFDGFRDFQTE  97

Query  382  ----EQEMKHPGVWETDKASNSADNLASLYRPPFALMYHGSFEKAKDAAR  519
                EQE+++ G    DK   +   LA L+RPP  LM+ GSFE AK+  +
Sbjct  98   TIRQEQELRNGGA--VDKKLTT---LADLFRPPIDLMHKGSFETAKECGQ  142



>ref|XP_010081335.1| PREDICTED: UBX domain-containing protein 7, partial [Pterocles 
gutturalis]
Length=469

 Score = 50.8 bits (120),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 51/170 (30%), Positives = 74/170 (44%), Gaps = 39/170 (23%)
 Frame = +1

Query  34   VGQSADTARQFLQATSWKLEEALQLFYVGNDGGVAAPSSYSPLENTAPlpdpslssisgs  213
             G S    +  L+A +  LE A+ +F  G  GG+A   S S    +A  P          
Sbjct  4    TGASESVGKHMLEACNNNLEMAVTMFLDG--GGIAEEPSTSSAGVSAVRPHT--------  53

Query  214  ikgsgdesekQGDRDEVRPPLPVIRDVLYDTAVIRGLPAMGGSAHEARSVVP-FRNF---  381
                          DEVR P+P  +++L +   + G P        ARS+   FR+F   
Sbjct  54   -------------EDEVRAPIPQKQEILVEPEPLFGAPK---RRRPARSIFDGFRDFQTE  97

Query  382  ----EQEMKHPGVWETDKASNSADNLASLYRPPFALMYHGSFEKAKDAAR  519
                EQE+++ G    DK   +   LA L+RPP  LM+ GSFE AK+  +
Sbjct  98   TIRQEQELRNGGA--VDKKLTT---LADLFRPPIDLMHKGSFETAKECGQ  142



>ref|XP_010290507.1| PREDICTED: UBX domain-containing protein 7, partial [Phaethon 
lepturus]
Length=469

 Score = 50.8 bits (120),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 51/170 (30%), Positives = 74/170 (44%), Gaps = 39/170 (23%)
 Frame = +1

Query  34   VGQSADTARQFLQATSWKLEEALQLFYVGNDGGVAAPSSYSPLENTAPlpdpslssisgs  213
             G S    +  L+A +  LE A+ +F  G  GG+A   S S    +A  P          
Sbjct  4    TGASESVGKHMLEACNNNLEMAVTMFLDG--GGIAEEPSTSSAGVSAVRPHT--------  53

Query  214  ikgsgdesekQGDRDEVRPPLPVIRDVLYDTAVIRGLPAMGGSAHEARSVVP-FRNF---  381
                          DEVR P+P  +++L +   + G P        ARS+   FR+F   
Sbjct  54   -------------EDEVRAPIPQKQEILVEPEPLFGAPK---RRRPARSIFDGFRDFQTE  97

Query  382  ----EQEMKHPGVWETDKASNSADNLASLYRPPFALMYHGSFEKAKDAAR  519
                EQE+++ G    DK   +   LA L+RPP  LM+ GSFE AK+  +
Sbjct  98   TIRQEQELRNGGA--VDKKLTT---LADLFRPPIDLMHKGSFETAKECGQ  142



>ref|XP_009321171.1| PREDICTED: UBX domain-containing protein 7 [Pygoscelis adeliae]
Length=473

 Score = 50.8 bits (120),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 51/170 (30%), Positives = 74/170 (44%), Gaps = 39/170 (23%)
 Frame = +1

Query  34   VGQSADTARQFLQATSWKLEEALQLFYVGNDGGVAAPSSYSPLENTAPlpdpslssisgs  213
             G S    +  L+A +  LE A+ +F  G  GG+A   S S    +A  P          
Sbjct  8    TGASESVGKHMLEACNNNLEMAVTMFLDG--GGIAEEPSTSSAGVSAVRPHT--------  57

Query  214  ikgsgdesekQGDRDEVRPPLPVIRDVLYDTAVIRGLPAMGGSAHEARSVVP-FRNF---  381
                          DEVR P+P  +++L +   + G P        ARS+   FR+F   
Sbjct  58   -------------EDEVRAPIPQKQEILVEPEPLFGAPK---RRRPARSIFDGFRDFQTE  101

Query  382  ----EQEMKHPGVWETDKASNSADNLASLYRPPFALMYHGSFEKAKDAAR  519
                EQE+++ G    DK   +   LA L+RPP  LM+ GSFE AK+  +
Sbjct  102  TIRQEQELRNGGA--VDKKLTT---LADLFRPPIDLMHKGSFETAKECGQ  146



>gb|KFV66581.1| UBX domain-containing protein 7, partial [Picoides pubescens]
Length=468

 Score = 50.8 bits (120),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 51/170 (30%), Positives = 74/170 (44%), Gaps = 39/170 (23%)
 Frame = +1

Query  34   VGQSADTARQFLQATSWKLEEALQLFYVGNDGGVAAPSSYSPLENTAPlpdpslssisgs  213
             G S    +  L+A +  LE A+ +F  G  GG+A   S S    +A  P          
Sbjct  3    TGASESVGKHMLEACNNNLEMAVTMFLDG--GGIAEEPSTSSAGVSAVRPHA--------  52

Query  214  ikgsgdesekQGDRDEVRPPLPVIRDVLYDTAVIRGLPAMGGSAHEARSVVP-FRNF---  381
                          DEVR P+P  +++L +   + G P        ARS+   FR+F   
Sbjct  53   -------------EDEVRAPIPQKQEILVEPEPLFGAPK---RRRPARSIFDGFRDFQTE  96

Query  382  ----EQEMKHPGVWETDKASNSADNLASLYRPPFALMYHGSFEKAKDAAR  519
                EQE+++ G    DK   +   LA L+RPP  LM+ GSFE AK+  +
Sbjct  97   TIRQEQELRNGGA--VDKKLTT---LADLFRPPIDLMHKGSFETAKECGQ  141



>ref|XP_010490003.1| PREDICTED: UBX domain-containing protein 2-like [Camelina sativa]
Length=320

 Score = 50.8 bits (120),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 22/37 (59%), Positives = 30/37 (81%), Gaps = 0/37 (0%)
 Frame = +1

Query  7    LVASFLEIAVGQSADTARQFLQATSWKLEEALQLFYV  117
            L+ASF+EI+ GQ+  TA QFL+ATSW LE+A+ LF +
Sbjct  8    LIASFIEISGGQTEKTAFQFLEATSWNLEDAVNLFLI  44



>gb|EOA95320.1| UBX domain-containing protein 7, partial [Anas platyrhynchos]
Length=468

 Score = 50.8 bits (120),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 50/173 (29%), Positives = 74/173 (43%), Gaps = 43/173 (25%)
 Frame = +1

Query  31   AVGQSADTARQFLQATSWKLEEALQLFYVGNDGGVAAPSSYSP--LENTAPlpdpslssi  204
              G S    +  L+A +  LE A+ +F  G  GG+A   S S   + +  P         
Sbjct  2    VTGASESVGKHMLEACNNNLEMAVTMFLDG--GGIAEEPSTSSAGVSSVRPHT-------  52

Query  205  sgsikgsgdesekQGDRDEVRPPLPVIRDVLYDTAVIRGLPAMGGSAHEARSVVP-FRNF  381
                             DEVR P+P  +++L +   + G P        ARS+   FR+F
Sbjct  53   ----------------EDEVRAPIPQKQEILVEPEPLFGAPK---RRRPARSIFDGFRDF  93

Query  382  -------EQEMKHPGVWETDKASNSADNLASLYRPPFALMYHGSFEKAKDAAR  519
                   EQE+++ G    DK   +   LA L+RPP  LM+ GSFE AK+  +
Sbjct  94   QTETIRQEQELRNGGA--VDKKLTT---LADLFRPPIDLMHKGSFETAKECGQ  141



>ref|XP_009897769.1| PREDICTED: UBX domain-containing protein 7 [Picoides pubescens]
Length=516

 Score = 50.8 bits (120),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 51/172 (30%), Positives = 75/172 (44%), Gaps = 39/172 (23%)
 Frame = +1

Query  28   IAVGQSADTARQFLQATSWKLEEALQLFYVGNDGGVAAPSSYSPLENTAPlpdpslssis  207
            +  G S    +  L+A +  LE A+ +F  G  GG+A   S S    +A  P        
Sbjct  49   LLAGASESVGKHMLEACNNNLEMAVTMFLDG--GGIAEEPSTSSAGVSAVRPHA------  100

Query  208  gsikgsgdesekQGDRDEVRPPLPVIRDVLYDTAVIRGLPAMGGSAHEARSVVP-FRNF-  381
                            DEVR P+P  +++L +   + G P        ARS+   FR+F 
Sbjct  101  ---------------EDEVRAPIPQKQEILVEPEPLFGAPK---RRRPARSIFDGFRDFQ  142

Query  382  ------EQEMKHPGVWETDKASNSADNLASLYRPPFALMYHGSFEKAKDAAR  519
                  EQE+++ G    DK   +   LA L+RPP  LM+ GSFE AK+  +
Sbjct  143  TETIRQEQELRNGGA--VDKKLTT---LADLFRPPIDLMHKGSFETAKECGQ  189



>gb|KGL73458.1| UBX domain-containing protein 7, partial [Tinamus guttatus]
Length=468

 Score = 50.8 bits (120),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 51/169 (30%), Positives = 73/169 (43%), Gaps = 39/169 (23%)
 Frame = +1

Query  37   GQSADTARQFLQATSWKLEEALQLFYVGNDGGVAAPSSYSPLENTAPlpdpslssisgsi  216
            G S    +  L+A +  LE A+ +F  G  GG+A   S S     A  P           
Sbjct  4    GASESVGKHMLEACNNNLEMAVTMFLDG--GGIAEEPSTSSAAVAAVRPHT---------  52

Query  217  kgsgdesekQGDRDEVRPPLPVIRDVLYDTAVIRGLPAMGGSAHEARSVVP-FRNF----  381
                         DEVR P+P  +++L +   + G P        ARS+   FR+F    
Sbjct  53   ------------EDEVRAPIPQKQEILVEPEPLFGAPK---RRRPARSIFDGFRDFQTET  97

Query  382  ---EQEMKHPGVWETDKASNSADNLASLYRPPFALMYHGSFEKAKDAAR  519
               EQE+++ G    DK   +   LA L+RPP  LM+ GSFE AK+  +
Sbjct  98   IRQEQELRNGGA--VDKKLTT---LADLFRPPIDLMHKGSFETAKECGQ  141



>ref|XP_010124459.1| PREDICTED: UBX domain-containing protein 7, partial [Chlamydotis 
macqueenii]
Length=465

 Score = 50.8 bits (120),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 51/169 (30%), Positives = 74/169 (44%), Gaps = 39/169 (23%)
 Frame = +1

Query  37   GQSADTARQFLQATSWKLEEALQLFYVGNDGGVAAPSSYSPLENTAPlpdpslssisgsi  216
            G S    +  L+A +  LE A+ +F  G  GG+A   S S    +A  P           
Sbjct  1    GASESVGKHMLEACNNNLEMAVTMFLDG--GGIAEEPSTSSAGVSAVRPHT---------  49

Query  217  kgsgdesekQGDRDEVRPPLPVIRDVLYDTAVIRGLPAMGGSAHEARSVVP-FRNF----  381
                         DEVR P+P  +++L +   + G P        ARS+   FR+F    
Sbjct  50   ------------EDEVRAPIPQKQEILVEPEPLFGAPK---RRRPARSIFDGFRDFQTET  94

Query  382  ---EQEMKHPGVWETDKASNSADNLASLYRPPFALMYHGSFEKAKDAAR  519
               EQE+++ G    DK   +   LA L+RPP  LM+ GSFE AK+  +
Sbjct  95   IRQEQELRNGGA--VDKKLTT---LADLFRPPIDLMHKGSFETAKECGQ  138



>ref|XP_004937060.1| PREDICTED: UBX domain-containing protein 7 isoform X3 [Gallus 
gallus]
Length=627

 Score = 50.8 bits (120),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 50/169 (30%), Positives = 74/169 (44%), Gaps = 39/169 (23%)
 Frame = +1

Query  37   GQSADTARQFLQATSWKLEEALQLFYVGNDGGVAAPSSYSPLENTAPlpdpslssisgsi  216
            G S    +  L+A +  LE A+ +F  G  GG+A   S S    +A              
Sbjct  163  GASESVGKHMLEACNNNLEMAVTMFLDG--GGIAEEPSTSSAAVSA--------------  206

Query  217  kgsgdesekQGDRDEVRPPLPVIRDVLYDTAVIRGLPAMGGSAHEARSVVP-FRNF----  381
                    +    DEVR P+P  +++L +   + G P        ARS+   FR+F    
Sbjct  207  -------VRPHTEDEVRAPIPQKQEILVEPEPLFGAPK---RRRPARSIFDGFRDFQTET  256

Query  382  ---EQEMKHPGVWETDKASNSADNLASLYRPPFALMYHGSFEKAKDAAR  519
               EQE+++ G    DK   +   LA L+RPP  LM+ GSFE AK+  +
Sbjct  257  IRQEQELRNGGA--VDKKLTT---LADLFRPPIDLMHKGSFETAKECGQ  300



>ref|XP_007883905.1| PREDICTED: UBX domain-containing protein 7 isoform X2 [Callorhinchus 
milii]
Length=508

 Score = 50.4 bits (119),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 50/167 (30%), Positives = 75/167 (45%), Gaps = 39/167 (23%)
 Frame = +1

Query  43   SADTARQFLQATSWKLEEALQLFYVGNDGGVAAPSSYSPLENTAPlpdpslssisgsikg  222
            S    +  L+A +  LE A+ ++  G  GG+A   S S    +A  P             
Sbjct  43   SESVGKHILEACNNNLEMAVTMYLDG--GGIAEEPSTSTAGTSASRPPA-----------  89

Query  223  sgdesekQGDRDEVRPPLPVIRDVLYDTAVIRGLPAMGGSAHEARSVVP-FRNF------  381
                      +DEVR P+P  +D+L +   + G P        ARS+   FR+F      
Sbjct  90   ----------QDEVRAPIPQKQDILVEPEPLFGAPK---RRRPARSIFDGFRDFQTETIR  136

Query  382  -EQEMKHPGVWETDKASNSADNLASLYRPPFALMYHGSFEKAKDAAR  519
             EQE+++ G    DK   +   LA L+RPP  LM+ GSFE AK++ +
Sbjct  137  QEQELRNGGP--VDKKLTT---LADLFRPPIDLMHKGSFETAKESGQ  178



>gb|KFO55952.1| UBX domain-containing protein 7, partial [Corvus brachyrhynchos]
Length=468

 Score = 50.4 bits (119),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 50/169 (30%), Positives = 74/169 (44%), Gaps = 39/169 (23%)
 Frame = +1

Query  37   GQSADTARQFLQATSWKLEEALQLFYVGNDGGVAAPSSYSPLENTAPlpdpslssisgsi  216
            G S    +  L+A +  LE A+ +F  G  GG+A   S S    +A              
Sbjct  4    GASESVGKHMLEACNNNLEMAVTMFLDG--GGIAEEPSTSSAAVSA--------------  47

Query  217  kgsgdesekQGDRDEVRPPLPVIRDVLYDTAVIRGLPAMGGSAHEARSVVP-FRNF----  381
                    +    DEVR P+P  +++L +   + G P        ARS+   FR+F    
Sbjct  48   -------VRPHPEDEVRAPIPQKQEILVEPEPLFGAPK---RRRPARSIFDGFRDFQTET  97

Query  382  ---EQEMKHPGVWETDKASNSADNLASLYRPPFALMYHGSFEKAKDAAR  519
               EQE+++ G    DK   +   LA L+RPP  LM+ GSFE AK+  +
Sbjct  98   IRQEQELRNGGA--VDKKLTT---LADLFRPPIDLMHKGSFETAKECGQ  141



>gb|KGL93583.1| UBX domain-containing protein 7, partial [Charadrius vociferus]
Length=468

 Score = 50.4 bits (119),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 52/170 (31%), Positives = 75/170 (44%), Gaps = 39/170 (23%)
 Frame = +1

Query  34   VGQSADTARQFLQATSWKLEEALQLFYVGNDGGVAAPSSYSPLENTAPlpdpslssisgs  213
             G S    +  L+A +  LE A+ +F  G  GG+A   S S    +A  P P        
Sbjct  3    TGASESVGKHMLEACNNNLEMAVTMFLDG--GGIAEEPSTSSAGVSAVRPHP--------  52

Query  214  ikgsgdesekQGDRDEVRPPLPVIRDVLYDTAVIRGLPAMGGSAHEARSVVP-FRNF---  381
                          DEVR P+P  +++L +   + G P        ARS+   FR+F   
Sbjct  53   -------------EDEVRAPIPQKQEILVEPEPLFGAPK---RRRPARSIFDGFRDFQTE  96

Query  382  ----EQEMKHPGVWETDKASNSADNLASLYRPPFALMYHGSFEKAKDAAR  519
                EQE+++ G    DK   +   LA L+RPP  LM+ GSFE AK+  +
Sbjct  97   TIRQEQELRNGGA--VDKKLTT---LADLFRPPIDLMHKGSFETAKECGQ  141



>ref|XP_008627792.1| PREDICTED: UBX domain-containing protein 7, partial [Corvus brachyrhynchos]
Length=469

 Score = 50.4 bits (119),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 50/169 (30%), Positives = 74/169 (44%), Gaps = 39/169 (23%)
 Frame = +1

Query  37   GQSADTARQFLQATSWKLEEALQLFYVGNDGGVAAPSSYSPLENTAPlpdpslssisgsi  216
            G S    +  L+A +  LE A+ +F  G  GG+A   S S    +A              
Sbjct  5    GASESVGKHMLEACNNNLEMAVTMFLDG--GGIAEEPSTSSAAVSA--------------  48

Query  217  kgsgdesekQGDRDEVRPPLPVIRDVLYDTAVIRGLPAMGGSAHEARSVVP-FRNF----  381
                    +    DEVR P+P  +++L +   + G P        ARS+   FR+F    
Sbjct  49   -------VRPHPEDEVRAPIPQKQEILVEPEPLFGAPK---RRRPARSIFDGFRDFQTET  98

Query  382  ---EQEMKHPGVWETDKASNSADNLASLYRPPFALMYHGSFEKAKDAAR  519
               EQE+++ G    DK   +   LA L+RPP  LM+ GSFE AK+  +
Sbjct  99   IRQEQELRNGGA--VDKKLTT---LADLFRPPIDLMHKGSFETAKECGQ  142



Lambda      K        H        a         alpha
   0.316    0.132    0.387    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 566636427000