BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFF036G08

Length=576
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009794575.1|  PREDICTED: threonine--tRNA ligase, mitochond...    250   8e-75   Nicotiana sylvestris
ref|XP_009622103.1|  PREDICTED: threonine--tRNA ligase, mitochond...    244   1e-72   Nicotiana tomentosiformis
ref|XP_006355966.1|  PREDICTED: threonine--tRNA ligase, mitochond...    231   5e-68   Solanum tuberosum [potatoes]
ref|XP_004238685.1|  PREDICTED: threonine--tRNA ligase, mitochond...    230   2e-67   Solanum lycopersicum
gb|EPS72288.1|  hypothetical protein M569_02470                         226   5e-66   Genlisea aurea
ref|XP_011076219.1|  PREDICTED: threonine--tRNA ligase, mitochond...    226   5e-66   Sesamum indicum [beniseed]
ref|XP_004246064.1|  PREDICTED: threonine--tRNA ligase, mitochond...    225   8e-66   Solanum lycopersicum
ref|XP_006355233.1|  PREDICTED: threonine--tRNA ligase, mitochond...    225   9e-66   Solanum tuberosum [potatoes]
ref|XP_010100498.1|  Threonine--tRNA ligase                             223   1e-65   
ref|XP_010644571.1|  PREDICTED: threonine--tRNA ligase, mitochond...    224   2e-65   Vitis vinifera
ref|XP_002265302.1|  PREDICTED: threonine--tRNA ligase, mitochond...    223   7e-65   Vitis vinifera
ref|XP_010274328.1|  PREDICTED: threonine--tRNA ligase, mitochond...    218   7e-64   
emb|CDP00192.1|  unnamed protein product                                220   9e-64   Coffea canephora [robusta coffee]
ref|XP_006438442.1|  hypothetical protein CICLE_v100308252mg            213   2e-63   
ref|XP_010274327.1|  PREDICTED: threonine--tRNA ligase, mitochond...    219   2e-63   Nelumbo nucifera [Indian lotus]
gb|EYU25062.1|  hypothetical protein MIMGU_mgv1a002240mg                218   3e-63   Erythranthe guttata [common monkey flower]
gb|KDO82530.1|  hypothetical protein CISIN_1g0066802mg                  208   6e-63   Citrus sinensis [apfelsine]
ref|XP_007157476.1|  hypothetical protein PHAVU_002G072800g             218   7e-63   Phaseolus vulgaris [French bean]
ref|XP_004167577.1|  PREDICTED: LOW QUALITY PROTEIN: threonine--t...    211   1e-62   
ref|XP_008460557.1|  PREDICTED: threonine--tRNA ligase, mitochond...    216   4e-62   Cucumis melo [Oriental melon]
ref|XP_010044651.1|  PREDICTED: threonine--tRNA ligase, mitochond...    214   1e-61   Eucalyptus grandis [rose gum]
ref|XP_006483810.1|  PREDICTED: threonine--tRNA ligase, mitochond...    213   3e-61   Citrus sinensis [apfelsine]
ref|XP_010272819.1|  PREDICTED: threonine--tRNA ligase, mitochond...    213   6e-61   Nelumbo nucifera [Indian lotus]
ref|XP_004142299.1|  PREDICTED: threonine--tRNA ligase, mitochond...    212   7e-61   Cucumis sativus [cucumbers]
ref|XP_003613276.1|  Threonyl-tRNA synthetase                           212   7e-61   Medicago truncatula
ref|XP_002521030.1|  threonyl-tRNA synthetase, putative                 211   9e-61   
ref|XP_003519592.1|  PREDICTED: threonine--tRNA ligase, mitochond...    211   1e-60   Glycine max [soybeans]
ref|XP_006394912.1|  hypothetical protein EUTSA_v10003725mg             211   1e-60   Eutrema salsugineum [saltwater cress]
gb|KDP21323.1|  hypothetical protein JCGZ_21794                         210   4e-60   Jatropha curcas
ref|XP_006289423.1|  hypothetical protein CARUB_v10002922mg             210   4e-60   Capsella rubella
ref|XP_008361801.1|  PREDICTED: LOW QUALITY PROTEIN: threonine--t...    210   4e-60   
ref|XP_009360487.1|  PREDICTED: threonine--tRNA ligase, mitochond...    209   6e-60   Pyrus x bretschneideri [bai li]
ref|XP_010533069.1|  PREDICTED: threonine--tRNA ligase, mitochond...    209   1e-59   Tarenaya hassleriana [spider flower]
ref|XP_004489863.1|  PREDICTED: threonine--tRNA ligase, mitochond...    208   2e-59   Cicer arietinum [garbanzo]
ref|XP_010913364.1|  PREDICTED: threonine--tRNA ligase, mitochond...    208   2e-59   Elaeis guineensis
ref|XP_002872240.1|  AT5g26830/F2P16_90                                 208   2e-59   Arabidopsis lyrata subsp. lyrata
gb|KHN00337.1|  Threonine--tRNA ligase, mitochondrial                   208   2e-59   Glycine soja [wild soybean]
ref|XP_004296467.2|  PREDICTED: threonine--tRNA ligase, mitochond...    208   3e-59   Fragaria vesca subsp. vesca
ref|XP_007225203.1|  hypothetical protein PRUPE_ppa002055mg             207   4e-59   Prunus persica
ref|XP_008221771.1|  PREDICTED: threonine--tRNA ligase, mitochond...    207   4e-59   Prunus mume [ume]
emb|CAA74705.1|  threonyl-tRNA synthetase                               207   6e-59   Arabidopsis thaliana [mouse-ear cress]
ref|NP_198035.2|  threonyl-tRNA synthetase                              207   6e-59   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006836673.1|  hypothetical protein AMTR_s00088p00069780          207   7e-59   
ref|XP_003517788.1|  PREDICTED: threonine--tRNA ligase, mitochond...    207   8e-59   Glycine max [soybeans]
ref|XP_010455043.1|  PREDICTED: threonine--tRNA ligase, mitochond...    206   8e-59   Camelina sativa [gold-of-pleasure]
ref|XP_006378416.1|  Threonyl-tRNA synthetase family protein            206   1e-58   
ref|XP_010493938.1|  PREDICTED: threonine--tRNA ligase, mitochond...    206   2e-58   Camelina sativa [gold-of-pleasure]
gb|AAK82468.1|  AT5g26830/F2P16_90                                      205   2e-58   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008340003.1|  PREDICTED: threonine--tRNA ligase, mitochond...    205   2e-58   
ref|XP_010688668.1|  PREDICTED: threonine--tRNA ligase, mitochond...    205   3e-58   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_010551550.1|  PREDICTED: threonine--tRNA ligase, mitochond...    205   3e-58   Tarenaya hassleriana [spider flower]
emb|CDX80596.1|  BnaC07g28480D                                          205   3e-58   
gb|KFK26446.1|  hypothetical protein AALP_AA8G249500                    205   3e-58   Arabis alpina [alpine rockcress]
ref|XP_008802022.1|  PREDICTED: threonine--tRNA ligase, mitochond...    204   5e-58   Phoenix dactylifera
ref|XP_011021655.1|  PREDICTED: threonine--tRNA ligase, mitochond...    203   9e-58   Populus euphratica
ref|XP_009151164.1|  PREDICTED: threonine--tRNA ligase, mitochond...    203   2e-57   Brassica rapa
gb|KJB48102.1|  hypothetical protein B456_008G053600                    202   2e-57   Gossypium raimondii
emb|CDX87030.1|  BnaC09g03450D                                          202   3e-57   
dbj|BAC41894.1|  unknown protein                                        190   3e-57   Arabidopsis thaliana [mouse-ear cress]
ref|XP_007044584.1|  Threonyl-tRNA synthetase isoform 3                 201   5e-57   
ref|XP_009111770.1|  PREDICTED: threonine--tRNA ligase, mitochond...    201   5e-57   Brassica rapa
ref|XP_007044582.1|  Threonyl-tRNA synthetase isoform 1                 202   5e-57   
ref|XP_011025470.1|  PREDICTED: threonine--tRNA ligase, mitochond...    202   5e-57   Populus euphratica
ref|XP_002311580.2|  Threonyl-tRNA synthetase family protein            201   7e-57   Populus trichocarpa [western balsam poplar]
ref|XP_007044585.1|  Threonyl-tRNA synthetase isoform 4                 199   1e-56   
ref|XP_007044583.1|  Threonyl-tRNA synthetase isoform 2                 200   1e-56   
ref|NP_173238.1|  threonyl-tRNA synthetase                              191   2e-54   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002892976.1|  hypothetical protein ARALYDRAFT_472010             188   1e-53   
ref|XP_009412586.1|  PREDICTED: threonine--tRNA ligase, mitochond...    192   2e-53   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_008644625.1|  PREDICTED: threonine--tRNA ligase, mitochond...    189   2e-52   
ref|XP_002464119.1|  hypothetical protein SORBIDRAFT_01g012680          188   3e-52   Sorghum bicolor [broomcorn]
ref|XP_003573669.1|  PREDICTED: threonine--tRNA ligase, mitochond...    188   3e-52   Brachypodium distachyon [annual false brome]
gb|EEE68426.1|  hypothetical protein OsJ_26793                          188   3e-52   Oryza sativa Japonica Group [Japonica rice]
gb|EEC83307.1|  hypothetical protein OsI_28676                          188   3e-52   Oryza sativa Indica Group [Indian rice]
dbj|BAI39857.1|  putative threonyl-tRNA synthetase                      188   4e-52   Oryza sativa Indica Group [Indian rice]
ref|NP_001061475.1|  Os08g0295300                                       188   4e-52   
dbj|BAJ93554.1|  predicted protein                                      187   1e-51   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_001784310.1|  predicted protein                                  186   1e-51   
ref|XP_008664856.1|  PREDICTED: LOW QUALITY PROTEIN: threonine--t...    186   3e-51   Zea mays [maize]
ref|XP_004973168.1|  PREDICTED: threonine--tRNA ligase, mitochond...    183   2e-50   Setaria italica
gb|EMT11254.1|  Threonyl-tRNA synthetase, mitochondrial                 184   5e-50   
ref|XP_006659275.1|  PREDICTED: threonine--tRNA ligase, mitochond...    182   5e-50   Oryza brachyantha
ref|XP_006303165.1|  hypothetical protein CARUB_v10008521mg             181   6e-50   Capsella rubella
ref|XP_007199721.1|  hypothetical protein PRUPE_ppa002288mg             181   1e-49   Prunus persica
emb|CDM81189.1|  unnamed protein product                                180   2e-49   Triticum aestivum [Canadian hard winter wheat]
ref|XP_007204844.1|  hypothetical protein PRUPE_ppa026578mg             167   3e-49   
ref|XP_010480524.1|  PREDICTED: probable threonine--tRNA ligase, ...    179   3e-49   
ref|XP_004968434.1|  PREDICTED: threonine--tRNA ligase, mitochond...    179   6e-49   Setaria italica
ref|XP_010476961.1|  PREDICTED: LOW QUALITY PROTEIN: probable thr...    174   3e-48   Camelina sativa [gold-of-pleasure]
gb|AAB61048.1|  Similar to threonyl-tRNA synthetase; coded for by...    175   1e-47   Arabidopsis thaliana [mouse-ear cress]
gb|EMS59266.1|  Threonyl-tRNA synthetase, mitochondrial                 176   6e-47   Triticum urartu
ref|XP_007200687.1|  hypothetical protein PRUPE_ppa017189mg             169   1e-45   Prunus persica
ref|XP_009117622.1|  PREDICTED: threonine--tRNA ligase, mitochond...    166   1e-44   Brassica rapa
emb|CDY21715.1|  BnaA09g44660D                                          164   1e-43   Brassica napus [oilseed rape]
ref|XP_004304268.2|  PREDICTED: threonine--tRNA ligase, mitochond...    156   1e-40   Fragaria vesca subsp. vesca
ref|XP_004296468.1|  PREDICTED: probable threonine--tRNA ligase, ...    143   9e-40   Fragaria vesca subsp. vesca
ref|XP_008237148.1|  PREDICTED: threonine--tRNA ligase, mitochond...    151   4e-39   
ref|XP_005837214.1|  hypothetical protein GUITHDRAFT_93029              149   3e-38   Guillardia theta CCMP2712
gb|EST08708.1|  threonyl-tRNA synthetase                                146   5e-37   Kalmanozyma brasiliensis GHG001
dbj|GAC98443.1|  threonyl-tRNA synthetase                               144   3e-36   Pseudozyma hubeiensis SY62
gb|KIY63302.1|  threonyl-tRNA synthetase                                144   3e-36   Cylindrobasidium torrendii FP15055 ss-10
ref|XP_007880033.1|  hypothetical protein PFL1_04316                    144   5e-36   Anthracocystis flocculosa PF-1
emb|CEG83597.1|  Putative Threonyl-tRNA synthetase                      134   7e-36   Rhizopus microsporus
gb|KIJ16340.1|  hypothetical protein PAXINDRAFT_168488                  142   8e-36   Paxillus involutus ATCC 200175
gb|KIK95681.1|  hypothetical protein PAXRUDRAFT_140136                  142   8e-36   Paxillus rubicundulus Ve08.2h10
emb|CCF49315.1|  probable THS1-threonyl tRNA synthetase, cytosolic      143   9e-36   Ustilago hordei
emb|CBQ69805.1|  probable THS1-threonyl tRNA synthetase, cytosolic      142   2e-35   Sporisorium reilianum SRZ2
gb|EPB83961.1|  threonyl-tRNA synthetase                                141   2e-35   Mucor circinelloides f. circinelloides 1006PhL
ref|XP_002991732.1|  hypothetical protein SELMODRAFT_134156             140   3e-35   
gb|EMD37085.1|  hypothetical protein CERSUDRAFT_84103                   141   3e-35   Gelatoporia subvermispora B
gb|KDN39007.1|  threonyl-tRNA synthetase                                141   3e-35   Tilletiaria anomala UBC 951
dbj|GAK66757.1|  threonyl-tRNA synthetase                               141   4e-35   Moesziomyces antarcticus
ref|XP_011391697.1|  putative threonine--tRNA ligase THS1               141   5e-35   Ustilago maydis 521
ref|XP_002989765.1|  hypothetical protein SELMODRAFT_130418             140   5e-35   
gb|KIJ63654.1|  hypothetical protein HYDPIDRAFT_175966                  140   5e-35   Hydnomerulius pinastri MD-312
dbj|GAN09335.1|  threonyl-tRNA synthetase                               140   6e-35   Mucor ambiguus
dbj|GAC77380.1|  threonyl-trna synthetase                               140   1e-34   Moesziomyces antarcticus T-34
gb|ETS60492.1|  hypothetical protein PaG_05336                          140   1e-34   Moesziomyces aphidis DSM 70725
gb|EIE81909.1|  hypothetical protein RO3G_06614                         139   1e-34   Rhizopus delemar RA 99-880
emb|CCV00396.1|  unnamed protein product                                139   1e-34   Malassezia sympodialis ATCC 42132
gb|KIP05628.1|  hypothetical protein PHLGIDRAFT_24993                   139   1e-34   Phlebiopsis gigantea 11061_1 CR5-6
ref|XP_006455238.1|  hypothetical protein AGABI2DRAFT_226641            139   2e-34   Agaricus bisporus var. bisporus H97
gb|KJA25358.1|  hypothetical protein HYPSUDRAFT_64939                   139   2e-34   Hypholoma sublateritium FD-334 SS-4
gb|ESW99362.1|  Threonine--tRNA ligase, cytoplasmic                     138   2e-34   Ogataea parapolymorpha DL-1
gb|KIM53290.1|  hypothetical protein SCLCIDRAFT_1222926                 138   3e-34   Scleroderma citrinum Foug A
gb|KFH73555.1|  threonyl-tRNA synthetase                                138   3e-34   Mortierella verticillata NRRL 6337
ref|XP_007769801.1|  threonyl-tRNA synthetase                           138   3e-34   Coniophora puteana RWD-64-598 SS2
emb|CEJ02301.1|  Putative Threonyl-tRNA synthetase                      135   5e-34   Rhizopus microsporus
gb|KIK27269.1|  hypothetical protein PISMIDRAFT_28163                   137   5e-34   Pisolithus microcarpus 441
gb|KIO11143.1|  hypothetical protein M404DRAFT_13351                    137   5e-34   Pisolithus tinctorius Marx 270
emb|CDI55881.1|  probable THS1-threonyl tRNA synthetase, cytosolic      138   5e-34   Melanopsichium pennsylvanicum 4
emb|CDO68587.1|  hypothetical protein BN946_scf184996.g18               137   6e-34   Trametes cinnabarina
emb|CEI97578.1|  Putative Threonyl-trna synthetase                      135   8e-34   Rhizopus microsporus
ref|XP_002432585.1|  Threonyl-tRNA synthetase, cytoplasmic, putative    137   1e-33   Pediculus humanus corporis [human body lice]
ref|XP_009550526.1|  hypothetical protein HETIRDRAFT_65578              137   1e-33   Heterobasidion irregulare TC 32-1
gb|ELU38637.1|  Ths1p                                                   137   1e-33   Rhizoctonia solani AG-1 IA
emb|CCO30571.1|  threonyl-tRNA synthetase                               135   1e-33   Rhizoctonia solani AG-1 IB
dbj|GAA98628.1|  hypothetical protein E5Q_05315                         137   1e-33   Mixia osmundae IAM 14324
ref|NP_001022034.1|  Protein TARS-1, isoform b                          136   1e-33   Caenorhabditis elegans [roundworm]
ref|NP_001022033.1|  Protein TARS-1, isoform a                          136   2e-33   Caenorhabditis elegans [roundworm]
gb|EPE06040.1|  threonyl-trna synthetase                                136   2e-33   Ophiostoma piceae UAMH 11346
ref|XP_009919139.1|  PREDICTED: probable threonine--tRNA ligase 2...    132   2e-33   Haliaeetus albicilla
emb|CEL59014.1|  threonyl-tRNA synthetase                               135   2e-33   Rhizoctonia solani AG-1 IB
gb|EJU01306.1|  threonyl-tRNA synthetase                                135   3e-33   Dacryopinax primogenitus
gb|KFM74402.1|  Threonine--tRNA ligase, cytoplasmic                     135   3e-33   Stegodyphus mimosarum
gb|KDQ13759.1|  hypothetical protein BOTBODRAFT_44972                   135   3e-33   Botryobasidium botryosum FD-172 SS1
gb|KIJ96896.1|  hypothetical protein K443DRAFT_681974                   135   4e-33   Laccaria amethystina LaAM-08-1
ref|XP_007379420.1|  threonyl-tRNA synthetase                           135   4e-33   Punctularia strigosozonata HHB-11173 SS5
ref|XP_007855570.1|  threonyl-trna synthetase                           135   4e-33   
emb|CEG74606.1|  Putative Threonyl-tRNA synthetase                      135   4e-33   Rhizopus microsporus
ref|XP_006675165.1|  hypothetical protein BATDEDRAFT_18299              135   4e-33   Batrachochytrium dendrobatidis JAM81
ref|XP_007330835.1|  hypothetical protein AGABI1DRAFT_60603             135   4e-33   Agaricus bisporus var. burnettii JB137-S8
gb|KDQ50940.1|  hypothetical protein JAAARDRAFT_41579                   135   5e-33   Jaapia argillacea MUCL 33604
gb|KFH72646.1|  threonyl-tRNA synthetase                                135   5e-33   Mortierella verticillata NRRL 6337
ref|XP_003667634.1|  hypothetical protein NDAI_0A02330                  135   5e-33   Naumovozyma dairenensis CBS 421
ref|XP_007365562.1|  threonyl-tRNA synthetase                           135   5e-33   Dichomitus squalens LYAD-421 SS1
gb|ENN74529.1|  hypothetical protein YQE_08853                          134   6e-33   Dendroctonus ponderosae
emb|CEP09308.1|  hypothetical protein                                   135   6e-33   Parasitella parasitica
gb|KIK46023.1|  hypothetical protein CY34DRAFT_22231                    134   6e-33   Suillus luteus UH-Slu-Lm8-n1
ref|XP_001878968.1|  predicted protein                                  134   7e-33   Laccaria bicolor S238N-H82
ref|XP_007316884.1|  hypothetical protein SERLADRAFT_368238             134   8e-33   Serpula lacrymans var. lacrymans S7.9
gb|KDN46541.1|  LOW QUALITY PROTEIN: hypothetical protein RSAG8_0...    134   8e-33   Rhizoctonia solani AG-8 WAC10335
gb|KIM92325.1|  hypothetical protein PILCRDRAFT_810369                  134   1e-32   Piloderma croceum F 1598
ref|XP_003080220.1|  putative threonyl-tRNA synthetase (ISS)            134   1e-32   
emb|CEF98631.1|  Anticodon-binding                                      134   1e-32   Ostreococcus tauri
ref|XP_505278.1|  YALI0F11231p                                          134   1e-32   Yarrowia lipolytica CLIB122
ref|XP_002631322.1|  C. briggsae CBR-TRS-1 protein                      134   1e-32   Caenorhabditis briggsae
ref|XP_002491958.1|  Threonyl-tRNA synthetase, essential cytoplas...    134   1e-32   Komagataella phaffii GS115
emb|CCG82579.1|  Threonyl-tRNA synthetase                               134   1e-32   Taphrina deformans PYCC 5710
emb|CDY19754.1|  BnaA09g04070D                                          132   1e-32   Brassica napus [oilseed rape]
ref|XP_636821.1|  threonyl-tRNA synthetase                              134   1e-32   Dictyostelium discoideum AX4
emb|CAP23504.2|  Protein CBR-TARS-1                                     134   1e-32   Caenorhabditis briggsae
gb|EUC61236.1|  cytoplasmic threonine-tRNA ligase                       134   1e-32   Rhizoctonia solani AG-3 Rhs1AP
ref|XP_007394540.1|  hypothetical protein PHACADRAFT_194288             133   2e-32   Phanerochaete carnosa HHB-10118-sp
gb|EFA05822.1|  hypothetical protein TcasGA2_TC008604                   133   2e-32   
ref|XP_008198247.1|  PREDICTED: threonine--tRNA ligase, cytoplasm...    133   2e-32   Tribolium castaneum [rust-red flour beetle]
ref|XP_967345.1|  PREDICTED: threonine--tRNA ligase, cytoplasmic ...    133   2e-32   Tribolium castaneum [rust-red flour beetle]
ref|XP_008043826.1|  tars protein                                       132   3e-32   Trametes versicolor FP-101664 SS1
gb|EPS93174.1|  hypothetical protein FOMPIDRAFT_1026618                 132   3e-32   Fomitopsis pinicola FP-58527 SS1
gb|KIJ28159.1|  hypothetical protein M422DRAFT_37403                    132   3e-32   Sphaerobolus stellatus SS14
ref|XP_010160781.1|  PREDICTED: probable threonine--tRNA ligase 2...    128   4e-32   Antrostomus carolinensis
ref|XP_001841372.2|  tars protein                                       132   4e-32   Coprinopsis cinerea okayama7#130
ref|XP_003116880.1|  CRE-TARS-1 protein                                 132   4e-32   Caenorhabditis remanei
ref|XP_011406310.1|  PREDICTED: threonine--tRNA ligase, cytoplasm...    132   4e-32   
gb|KIM36149.1|  hypothetical protein M413DRAFT_20609                    132   4e-32   Hebeloma cylindrosporum h7
gb|KDQ32844.1|  hypothetical protein PLEOSDRAFT_1032700                 132   4e-32   Pleurotus ostreatus PC15
ref|XP_003955557.1|  hypothetical protein KAFR_0B01230                  132   5e-32   Kazachstania africana CBS 2517
ref|XP_001550563.1|  hypothetical protein BC1G_11336                    132   5e-32   Botrytis cinerea B05.10
ref|XP_001587735.1|  hypothetical protein SS1G_10975                    132   5e-32   Sclerotinia sclerotiorum 1980 UF-70
ref|XP_002420321.1|  threonyl-tRNA synthetase, cytoplasmic, putative    132   6e-32   Candida dubliniensis CD36
ref|XP_002172490.1|  cytoplasmic threonine-tRNA ligase Trs1             132   6e-32   Schizosaccharomyces japonicus yFS275
gb|KII91811.1|  hypothetical protein PLICRDRAFT_38662                   132   7e-32   Plicaturopsis crispa FD-325 SS-3
ref|XP_004200388.1|  Piso0_002974                                       132   7e-32   
gb|KFP72660.1|  putative threonine--tRNA ligase 2, cytoplasmic          130   7e-32   Apaloderma vittatum
gb|KDR13507.1|  Threonyl-tRNA synthetase, cytoplasmic                   132   7e-32   Zootermopsis nevadensis
gb|EMC81245.1|  putative threonyl-tRNA synthetase 2, cytoplasmic        131   7e-32   
ref|XP_009867831.1|  PREDICTED: probable threonine--tRNA ligase 2...    130   9e-32   Apaloderma vittatum
gb|KIY49829.1|  tars protein                                            131   9e-32   Fistulina hepatica ATCC 64428
ref|XP_010570569.1|  PREDICTED: threonine--tRNA ligase, cytoplasm...    132   9e-32   Haliaeetus leucocephalus
ref|XP_008925398.1|  PREDICTED: LOW QUALITY PROTEIN: probable thr...    131   1e-31   
gb|KDR74949.1|  hypothetical protein GALMADRAFT_249885                  131   1e-31   Galerina marginata CBS 339.88
ref|XP_001418868.1|  predicted protein                                  130   1e-31   Ostreococcus lucimarinus CCE9901
gb|KFP96981.1|  putative threonine--tRNA ligase 2, cytoplasmic          130   1e-31   Leptosomus discolor
ref|XP_009980107.1|  PREDICTED: threonine--tRNA ligase, cytoplasm...    131   1e-31   Tauraco erythrolophus
gb|ESZ90653.1|  threonyl-tRNA synthetase                                131   1e-31   Sclerotinia borealis F-4128
gb|KFQ99509.1|  putative threonine--tRNA ligase 2, cytoplasmic          130   1e-31   Opisthocomus hoazin [hoatzin]
ref|XP_005511265.1|  PREDICTED: probable threonine--tRNA ligase 2...    131   1e-31   
ref|XP_007303607.1|  threonyl-tRNA synthetase                           131   1e-31   Stereum hirsutum FP-91666 SS1
ref|XP_009944987.1|  PREDICTED: probable threonine--tRNA ligase 2...    130   1e-31   Leptosomus discolor
ref|XP_009934283.1|  PREDICTED: probable threonine--tRNA ligase 2...    131   1e-31   Opisthocomus hoazin [hoatzin]
ref|NP_001280151.1|  probable threonyl-tRNA synthetase 2, cytopla...    131   1e-31   Gallus gallus [bantam]
gb|KIZ00239.1|  threonyl-tRNA synthetase                                130   2e-31   Monoraphidium neglectum
ref|XP_009992825.1|  PREDICTED: probable threonine--tRNA ligase 2...    130   2e-31   Chaetura pelagica
emb|CCE44005.1|  hypothetical protein CPAR2_502300                      131   2e-31   Candida parapsilosis
gb|ESA17167.1|  hypothetical protein GLOINDRAFT_345213                  130   2e-31   
emb|CBY19737.1|  unnamed protein product                                130   2e-31   Oikopleura dioica
ref|XP_003288175.1|  threonyl-tRNA synthetase                           130   2e-31   Dictyostelium purpureum
ref|XP_005487937.1|  PREDICTED: probable threonine--tRNA ligase 2...    130   2e-31   
ref|XP_003031033.1|  hypothetical protein SCHCODRAFT_77271              130   2e-31   Schizophyllum commune H4-8
emb|CDR44075.1|  CYFA0S13e02894g1_1                                     130   2e-31   Cyberlindnera fabianii
emb|CCE32326.1|  probable THS1-threonyl tRNA synthetase,cytosolic       130   2e-31   Claviceps purpurea 20.1
ref|XP_010195073.1|  PREDICTED: probable threonine--tRNA ligase 2...    128   2e-31   Colius striatus
ref|XP_006811408.1|  PREDICTED: threonine--tRNA ligase, cytoplasm...    130   3e-31   Saccoglossus kowalevskii
ref|XP_002771785.1|  threonyl-tRNA synthetase, putative                 130   3e-31   Perkinsus marinus ATCC 50983
emb|CBY35782.1|  unnamed protein product                                130   3e-31   Oikopleura dioica
gb|KGK38420.1|  hypothetical protein JL09_g2427                         130   3e-31   Pichia kudriavzevii
gb|KFV00689.1|  putative threonine--tRNA ligase 2, cytoplasmic          130   3e-31   Tauraco erythrolophus
gb|KIM27789.1|  hypothetical protein M408DRAFT_329743                   130   3e-31   Serendipita vermifera MAFF 305830
gb|AAU89472.1|  theronyl tRNA synthatase-like protein                   125   3e-31   Aedes aegypti
gb|KIK68334.1|  hypothetical protein GYMLUDRAFT_35720                   130   3e-31   Gymnopus luxurians FD-317 M1
gb|KIL94540.1|  hypothetical protein FAVG1_01471                        130   3e-31   Fusarium avenaceum
ref|XP_004531260.1|  PREDICTED: threonine--tRNA ligase, cytoplasm...    130   3e-31   Ceratitis capitata [medfly]
emb|CCK69517.1|  hypothetical protein KNAG_0C04150                      130   3e-31   Kazachstania naganishii CBS 8797
gb|KFV55285.1|  putative threonine--tRNA ligase 2, cytoplasmic          129   3e-31   Tyto alba [Schleiereule]
ref|XP_003848298.1|  threonine--tRNA ligase                             128   3e-31   Zymoseptoria tritici IPO323
ref|XP_005521510.1|  PREDICTED: probable threonine--tRNA ligase 2...    130   3e-31   Pseudopodoces humilis [Tibetan ground-jay]
ref|XP_009968247.1|  PREDICTED: probable threonine--tRNA ligase 2...    129   4e-31   Tyto alba [Schleiereule]
ref|XP_008601338.1|  threonyl-tRNA synthetase                           129   4e-31   Beauveria bassiana ARSEF 2860
gb|KIN00956.1|  hypothetical protein OIDMADRAFT_103659                  129   4e-31   Oidiodendron maius Zn
gb|KFP24546.1|  putative threonine--tRNA ligase 2, cytoplasmic          127   4e-31   Colius striatus
ref|XP_011397153.1|  Threonine-tRNA ligase, mitochondrial               129   5e-31   Auxenochlorella protothecoides
gb|EHK45204.1|  hypothetical protein TRIATDRAFT_128075                  129   5e-31   Trichoderma atroviride IMI 206040
gb|EKG10485.1|  hypothetical protein MPH_12343                          129   5e-31   Macrophomina phaseolina MS6
ref|XP_009319874.1|  PREDICTED: probable threonine--tRNA ligase 2...    129   5e-31   Pygoscelis adeliae
gb|KFW65406.1|  putative threonine--tRNA ligase 2, cytoplasmic          129   5e-31   Pygoscelis adeliae
ref|XP_002550936.1|  threonyl-tRNA synthetase                           130   5e-31   Candida tropicalis MYA-3404
ref|XP_007056480.1|  PREDICTED: probable threonine--tRNA ligase 2...    129   6e-31   
ref|XP_005145729.1|  PREDICTED: probable threonine--tRNA ligase 2...    129   6e-31   Melopsittacus undulatus
gb|EFZ18882.1|  hypothetical protein SINV_16250                         129   6e-31   
gb|KFQ76650.1|  putative threonine--tRNA ligase 2, cytoplasmic          129   6e-31   Phaethon lepturus
gb|KIL65999.1|  hypothetical protein M378DRAFT_75677                    129   6e-31   Amanita muscaria Koide BX008
ref|XP_011158574.1|  PREDICTED: threonine--tRNA ligase, cytoplasm...    129   6e-31   
gb|ETN67379.1|  threonyl-tRNA synthetase                                129   6e-31   Anopheles darlingi [American malaria mosquito]
gb|KEQ91202.1|  hypothetical protein AUEXF2481DRAFT_8816                129   7e-31   Aureobasidium subglaciale EXF-2481
ref|XP_007343809.1|  threonyl-tRNA synthetase                           129   7e-31   
ref|XP_011158573.1|  PREDICTED: threonine--tRNA ligase, cytoplasm...    129   7e-31   
emb|CEJ81687.1|  Putative Threonyl-tRNA synthetase, cytoplasmic         129   7e-31   Torrubiella hemipterigena
gb|KFU87220.1|  putative threonine--tRNA ligase 2, cytoplasmic          129   7e-31   Chaetura pelagica
ref|XP_010287049.1|  PREDICTED: probable threonine--tRNA ligase 2...    129   7e-31   Phaethon lepturus
gb|EFX86211.1|  hypothetical protein DAPPUDRAFT_127463                  129   7e-31   Daphnia pulex
ref|XP_008554535.1|  PREDICTED: threonine--tRNA ligase, cytoplasm...    129   7e-31   Microplitis demolitor
gb|KFP03020.1|  putative threonine--tRNA ligase 2, cytoplasmic          128   8e-31   Calypte anna
ref|XP_005025500.1|  PREDICTED: probable threonine--tRNA ligase 2...    129   8e-31   
gb|EXM28576.1|  threonyl-tRNA synthetase                                129   8e-31   Fusarium oxysporum f. sp. vasinfectum 25433
ref|XP_005437495.1|  PREDICTED: probable threonine--tRNA ligase 2...    129   8e-31   
gb|EWZ50111.1|  threonyl-tRNA synthetase                                129   8e-31   Fusarium oxysporum Fo47
gb|EWG38020.1|  threonyl-tRNA synthetase                                129   8e-31   Fusarium verticillioides 7600
gb|EXK47356.1|  threonyl-tRNA synthetase                                129   8e-31   Fusarium oxysporum f. sp. melonis 26406
ref|XP_008554533.1|  PREDICTED: threonine--tRNA ligase, cytoplasm...    129   8e-31   Microplitis demolitor
gb|EWY94579.1|  threonyl-tRNA synthetase                                129   8e-31   Fusarium oxysporum FOSC 3-a
ref|XP_008494852.1|  PREDICTED: probable threonine--tRNA ligase 2...    128   8e-31   Calypte anna
ref|XP_010014179.1|  PREDICTED: probable threonine--tRNA ligase 2...    129   9e-31   Nestor notabilis
gb|EXM10554.1|  threonyl-tRNA synthetase                                129   9e-31   Fusarium oxysporum f. sp. cubense tropical race 4 54006
gb|EDZ71519.1|  YIL078Wp-like protein                                   128   9e-31   Saccharomyces cerevisiae AWRI1631
gb|KGQ05016.1|  Threonine--tRNA ligase, cytoplasmic                     129   9e-31   Beauveria bassiana D1-5
ref|XP_319682.4|  AGAP008929-PA                                         129   9e-31   Anopheles gambiae str. PEST
gb|ENH60618.1|  Threonyl-tRNA synthetase, cytoplasmic                   129   9e-31   Fusarium oxysporum f. sp. cubense race 1
gb|KGQ84983.1|  threonyl-tRNA synthetase, cytoplasmic                   128   9e-31   Candida albicans P94015
emb|CCT62045.1|  probable THS1-threonyl tRNA synthetase, cytosolic      129   9e-31   Fusarium fujikuroi IMI 58289
gb|EHK26348.1|  hypothetical protein TRIVIDRAFT_82314                   129   9e-31   
gb|EMT66828.1|  Threonyl-tRNA synthetase, cytoplasmic                   129   9e-31   
gb|KGU06567.1|  threonyl-tRNA synthetase, cytoplasmic                   128   9e-31   
gb|EEQ46063.1|  threonyl-tRNA synthetase                                128   9e-31   
ref|XP_710514.1|  hypothetical protein CaO19.5685                       128   1e-30   
gb|EXA53764.1|  threonyl-tRNA synthetase                                129   1e-30   
gb|KGU08168.1|  threonyl-tRNA synthetase, cytoplasmic                   128   1e-30   
gb|KGQ87066.1|  threonyl-tRNA synthetase, cytoplasmic                   128   1e-30   
ref|XP_006672150.1|  threonine-tRNA ligase                              129   1e-30   
gb|AJR53093.1|  Ths1p                                                   128   1e-30   
gb|AJR38945.1|  Ths1p                                                   128   1e-30   
ref|XP_007673015.1|  hypothetical protein BAUCODRAFT_30366              129   1e-30   
gb|EDV09560.1|  threonyl-tRNA synthetase                                128   1e-30   
ref|XP_005052144.1|  PREDICTED: probable threonine--tRNA ligase 2...    129   1e-30   
ref|XP_009884085.1|  PREDICTED: probable threonine--tRNA ligase 2...    129   1e-30   
gb|KFP34665.1|  putative threonine--tRNA ligase 2, cytoplasmic          128   1e-30   
gb|EIW09934.1|  Ths1p                                                   128   1e-30   
gb|EHN06623.1|  Ths1p                                                   128   1e-30   
gb|KHC51738.1|  threonyl-tRNA synthetase, cytoplasmic                   128   1e-30   
gb|KHC33840.1|  threonyl-tRNA synthetase, cytoplasmic                   128   1e-30   
gb|KFO72069.1|  putative threonine--tRNA ligase 2, cytoplasmic          128   1e-30   
ref|XP_010114469.1|  PREDICTED: probable threonine--tRNA ligase 2...    128   1e-30   
ref|NP_116578.3|  threonine--tRNA ligase THS1                           128   1e-30   
gb|EDN61420.1|  threonyl-tRNA synthetase                                128   1e-30   
emb|CAA26666.1|  unnamed protein product                                128   1e-30   
ref|XP_009553641.1|  PREDICTED: probable threonine--tRNA ligase 2...    128   1e-30   
gb|AJR47138.1|  Ths1p                                                   128   1e-30   
gb|AJR37072.1|  Ths1p                                                   128   1e-30   
gb|EGA78432.1|  Ths1p                                                   128   1e-30   
gb|AJR38174.1|  Ths1p                                                   128   1e-30   
gb|KFV92314.1|  putative threonine--tRNA ligase 2, cytoplasmic          128   1e-30   
ref|XP_006780537.1|  PREDICTED: probable threonine--tRNA ligase 2...    128   1e-30   
ref|XP_005419820.1|  PREDICTED: probable threonine--tRNA ligase 2...    129   1e-30   
ref|XP_009576132.1|  PREDICTED: probable threonine--tRNA ligase 2...    128   1e-30   
ref|XP_001658309.1|  AAEL001206-PA                                      128   1e-30   
gb|KHN80838.1|  Threonine--tRNA ligase, cytoplasmic                     125   1e-30   
gb|KFQ42737.1|  putative threonine--tRNA ligase 2, cytoplasmic          128   1e-30   
ref|XP_003053410.1|  predicted protein                                  128   1e-30   
gb|EWG95461.1|  Ths1p                                                   128   1e-30   
ref|XP_007931291.1|  hypothetical protein MYCFIDRAFT_45851              128   1e-30   
ref|XP_009807382.1|  PREDICTED: probable threonine--tRNA ligase 2...    128   1e-30   
ref|XP_009088363.1|  PREDICTED: threonine--tRNA ligase, cytoplasm...    128   1e-30   
gb|KFP63323.1|  putative threonine--tRNA ligase 2, cytoplasmic          127   1e-30   
gb|EJW87440.1|  hypothetical protein WUBG_01653                         122   1e-30   
ref|XP_006268868.1|  PREDICTED: probable threonine--tRNA ligase 2...    128   1e-30   
gb|EQK97771.1|  threonine-tRNA ligase                                   128   1e-30   
gb|KFV51513.1|  putative threonine--tRNA ligase 2, cytoplasmic          127   1e-30   
gb|KFO03777.1|  putative threonine--tRNA ligase 2, cytoplasmic          127   2e-30   
gb|AJR39322.1|  Ths1p                                                   128   2e-30   
gb|EEU08659.1|  Ths1p                                                   128   2e-30   
gb|KFW97023.1|  putative threonine--tRNA ligase 2, cytoplasmic          127   2e-30   
ref|XP_010310509.1|  PREDICTED: probable threonine--tRNA ligase 2...    128   2e-30   
ref|XP_005234248.1|  PREDICTED: probable threonine--tRNA ligase 2...    128   2e-30   
ref|XP_006020081.1|  PREDICTED: probable threonine--tRNA ligase 2...    128   2e-30   
ref|XP_002595927.1|  hypothetical protein BRAFLDRAFT_268618             127   2e-30   
gb|EGU89228.1|  hypothetical protein FOXB_00181                         128   2e-30   
gb|KFP47497.1|  putative threonine--tRNA ligase 2, cytoplasmic          127   2e-30   
gb|KFQ76130.1|  putative threonine--tRNA ligase 2, cytoplasmic          127   2e-30   
gb|KFZ14160.1|  hypothetical protein V502_06226                         129   2e-30   
gb|KEQ62613.1|  threonyl-tRNA synthetase-like protein                   128   2e-30   
ref|XP_003867401.1|  Ths1 threonyl-tRNA synthetase                      129   2e-30   
ref|XP_005913075.1|  PREDICTED: probable threonine--tRNA ligase 2...    128   2e-30   
gb|KFV95622.1|  putative threonine--tRNA ligase 2, cytoplasmic          127   2e-30   
ref|XP_009507742.1|  PREDICTED: probable threonine--tRNA ligase 2...    127   2e-30   
ref|XP_004539781.1|  PREDICTED: probable threonine--tRNA ligase 2...    128   2e-30   
gb|KFY83935.1|  hypothetical protein V500_09757                         127   2e-30   
ref|XP_010155633.1|  PREDICTED: probable threonine--tRNA ligase 2...    127   2e-30   
gb|ELR10251.1|  threonyl-tRNA synthetase                                127   2e-30   
ref|XP_006966394.1|  hypothetical protein TRIREDRAFT_49197              127   2e-30   
ref|XP_001524878.1|  threonyl-tRNA synthetase                           127   3e-30   
emb|CDS08596.1|  Putative Threonyl-tRNA synthetase                      127   3e-30   
gb|KEY67536.1|  hypothetical protein S7711_02454                        127   3e-30   
gb|KFY16149.1|  hypothetical protein V492_01529                         127   3e-30   
gb|KFQ16963.1|  putative threonine--tRNA ligase 2, cytoplasmic          127   3e-30   
gb|KFY47332.1|  hypothetical protein V494_00035                         128   3e-30   
gb|KFY79763.1|  hypothetical protein V499_01279                         127   3e-30   
ref|XP_003437726.1|  PREDICTED: probable threonine--tRNA ligase 2...    127   3e-30   
gb|AJR45798.1|  Ths1p                                                   127   3e-30   
gb|KFM08256.1|  putative threonine--tRNA ligase 2, cytoplasmic          127   3e-30   
gb|KFZ01149.1|  hypothetical protein V501_10191                         127   3e-30   
ref|XP_005447730.1|  PREDICTED: probable threonine--tRNA ligase 2...    127   3e-30   
ref|XP_003738717.1|  PREDICTED: threonine--tRNA ligase, cytoplasm...    127   3e-30   
ref|XP_009278712.1|  PREDICTED: probable threonine--tRNA ligase 2...    127   3e-30   
gb|KFP20154.1|  putative threonine--tRNA ligase 2, cytoplasmic          127   3e-30   
gb|KFY69405.1|  hypothetical protein V496_00263                         127   4e-30   
gb|KFY32296.1|  hypothetical protein V493_00327                         127   4e-30   
ref|XP_009679776.1|  PREDICTED: probable threonine--tRNA ligase 2...    125   4e-30   
ref|XP_009642125.1|  PREDICTED: probable threonine--tRNA ligase 2...    127   4e-30   
ref|XP_002999991.1|  threonyl-tRNA synthetase                           127   4e-30   
gb|KFR02142.1|  putative threonine--tRNA ligase 2, cytoplasmic          126   4e-30   
gb|KDN71676.1|  putative threonyl-tRNA synthetase                       127   4e-30   
gb|KFA64144.1|  hypothetical protein S40285_00810                       127   4e-30   
ref|XP_009656705.1|  threonyl-tRNA synthetase                           127   4e-30   
ref|XP_009679775.1|  PREDICTED: probable threonine--tRNA ligase 2...    125   4e-30   
ref|XP_009468051.1|  PREDICTED: threonine--tRNA ligase, cytoplasm...    127   4e-30   
gb|KDE05999.1|  threonyl-tRNA synthetase, cytoplasmic                   127   4e-30   
gb|ERS96433.1|  threonine-tRNA ligase                                   127   4e-30   
gb|KHJ99685.1|  threonine--tRNA ligase                                  126   4e-30   
gb|EMG45420.1|  Threonyl-tRNA synthetase, cytoplasmic, putative         121   5e-30   
ref|XP_008942445.1|  PREDICTED: threonine--tRNA ligase, cytoplasm...    127   5e-30   
ref|XP_005650255.1|  threonyl-tRNA synthetase                           127   5e-30   
ref|XP_005178932.1|  PREDICTED: threonine--tRNA ligase, cytoplasm...    127   5e-30   
gb|KIH94797.1|  threonyl-tRNA synthetase                                127   5e-30   
gb|KDD76365.1|  class II core domain (G, H, P, S and T) tRNA synt...    126   5e-30   
ref|XP_006695243.1|  threonyl-tRNA synthetase-like protein              127   5e-30   
emb|CCA73856.1|  probable THS1-threonyl tRNA synthetase, cytosolic      126   5e-30   
gb|KFV84725.1|  putative threonine--tRNA ligase 2, cytoplasmic          126   6e-30   
emb|CCF39893.1|  threonyl-tRNA synthetase                               126   6e-30   
ref|XP_002164939.2|  PREDICTED: threonine--tRNA ligase, cytoplasm...    126   6e-30   
ref|XP_009679773.1|  PREDICTED: probable threonine--tRNA ligase 2...    126   6e-30   
ref|XP_008081385.1|  Class II aaRS and biotin synthetase                126   6e-30   
gb|KFP70847.1|  putative threonine--tRNA ligase 2, cytoplasmic          125   7e-30   
gb|EFN80796.1|  Threonyl-tRNA synthetase, cytoplasmic                   125   7e-30   
ref|XP_009076978.1|  PREDICTED: probable threonine--tRNA ligase 2...    126   8e-30   
ref|XP_011145093.1|  PREDICTED: threonine--tRNA ligase, cytoplasm...    125   8e-30   
ref|XP_011145094.1|  PREDICTED: threonine--tRNA ligase, cytoplasm...    125   9e-30   
gb|KGL77238.1|  putative threonine--tRNA ligase 2, cytoplasmic          125   9e-30   
ref|XP_002499537.1|  predicted protein                                  125   9e-30   
gb|EMF09081.1|  threonyl-tRNA synthetase                                125   1e-29   
gb|KFO83315.1|  putative threonine--tRNA ligase 2, cytoplasmic          125   1e-29   
gb|EYB23886.1|  hypothetical protein FG05_01248                         125   1e-29   
ref|XP_011317025.1|  threonyl-tRNA synthetase                           125   1e-29   
ref|XP_010131002.1|  PREDICTED: probable threonine--tRNA ligase 2...    125   1e-29   
ref|XP_010212954.1|  PREDICTED: probable threonine--tRNA ligase 2...    125   1e-29   
ref|XP_009251840.1|  hypothetical protein FPSE_00445                    125   1e-29   
ref|XP_006975908.1|  PREDICTED: probable threonine--tRNA ligase 2...    125   1e-29   
gb|KFY01987.1|  hypothetical protein O988_02411                         125   1e-29   
ref|XP_005285035.1|  PREDICTED: probable threonine--tRNA ligase 2...    125   1e-29   
gb|KFX87183.1|  hypothetical protein V490_08457                         125   1e-29   
ref|XP_449908.1|  hypothetical protein                                  125   1e-29   
gb|EHJ63622.1|  hypothetical protein KGM_17077                          125   1e-29   
emb|CEF69353.1|  Threonyl-tRNA synthetase                               125   1e-29   
gb|KFZ63134.1|  putative threonine--tRNA ligase 2, cytoplasmic          125   1e-29   
ref|XP_011264915.1|  PREDICTED: threonine--tRNA ligase, cytoplasm...    125   1e-29   
ref|XP_011264916.1|  PREDICTED: threonine--tRNA ligase, cytoplasm...    125   1e-29   
ref|XP_011264917.1|  PREDICTED: threonine--tRNA ligase, cytoplasm...    125   1e-29   
ref|XP_002195014.2|  PREDICTED: probable threonine--tRNA ligase 2...    125   1e-29   
gb|KFY48183.1|  hypothetical protein V495_01555                         125   1e-29   
ref|XP_002412596.1|  threonyl-tRNA synthetase, putative                 125   1e-29   
gb|KEQ69550.1|  threonyl-tRNA synthetase                                125   2e-29   
ref|XP_011290653.1|  PREDICTED: threonine--tRNA ligase, cytoplasm...    125   2e-29   
gb|ELK24179.1|  Putative threonyl-tRNA synthetase 2, cytoplasmic        124   2e-29   
ref|XP_007269965.1|  threonyl-tRNA synthetase                           125   2e-29   
ref|XP_009221267.1|  threonyl-tRNA synthetase                           125   2e-29   
gb|KEQ81052.1|  threonyl-tRNA synthetase                                125   2e-29   
ref|XP_005178933.1|  PREDICTED: threonine--tRNA ligase, cytoplasm...    125   2e-29   
emb|CCU74990.1|  threonyl-tRNA synthetase                               125   2e-29   
ref|XP_006771831.1|  PREDICTED: probable threonine--tRNA ligase 2...    124   2e-29   
ref|XP_004879582.1|  PREDICTED: probable threonine--tRNA ligase 2...    123   2e-29   
ref|XP_001845897.1|  threonyl-tRNA synthetase                           124   2e-29   
gb|KFV63505.1|  putative threonine--tRNA ligase 2, cytoplasmic          124   2e-29   
gb|KEZ43583.1|  hypothetical protein SAPIO_CDS4509                      125   2e-29   
ref|XP_002770111.1|  DEHA2B10252p                                       124   2e-29   
ref|XP_005648591.1|  threonyl-tRNA synthetase                           125   2e-29   
emb|CCM03110.1|  predicted protein                                      124   2e-29   
ref|XP_003665483.1|  hypothetical protein MYCTH_2309291                 123   3e-29   
ref|XP_009044100.1|  hypothetical protein LOTGIDRAFT_103202             124   3e-29   
emb|CDH49718.1|  threonyl-trna synthetase                               124   3e-29   
ref|XP_007872125.1|  hypothetical protein PNEG_00254                    124   3e-29   
ref|XP_009909554.1|  PREDICTED: probable threonine--tRNA ligase 2...    124   3e-29   
ref|XP_005357852.1|  PREDICTED: probable threonine--tRNA ligase 2...    125   3e-29   
ref|XP_005357853.1|  PREDICTED: probable threonine--tRNA ligase 2...    124   3e-29   
gb|ENH85866.1|  threonyl-trna synthetase                                125   3e-29   
ref|XP_003683234.1|  hypothetical protein TDEL_0H01640                  124   3e-29   
ref|XP_007869787.1|  threonyl-tRNA synthetase                           124   3e-29   
ref|XP_005727652.1|  PREDICTED: probable threonine--tRNA ligase 2...    124   3e-29   
ref|XP_004623299.1|  PREDICTED: LOW QUALITY PROTEIN: probable thr...    124   3e-29   
ref|XP_004531261.1|  PREDICTED: threonine--tRNA ligase, cytoplasm...    124   3e-29   
gb|EFQ31810.1|  threonyl-tRNA synthetase                                124   3e-29   
ref|XP_008158386.1|  PREDICTED: probable threonine--tRNA ligase 2...    123   4e-29   
ref|NP_001014042.1|  probable threonine--tRNA ligase 2, cytoplasmic     122   4e-29   
ref|XP_006874591.1|  PREDICTED: probable threonine--tRNA ligase 2...    124   4e-29   
gb|KFY28417.1|  hypothetical protein V491_00475                         125   4e-29   
dbj|BAO41767.1|  threonyl-tRNA synthetase                               124   4e-29   
ref|XP_004990683.1|  threonyl-tRNA synthetase isoform 2                 124   4e-29   
ref|XP_005084486.1|  PREDICTED: probable threonine--tRNA ligase 2...    124   4e-29   
ref|XP_003648097.1|  hypothetical protein Ecym_7461                     124   4e-29   
ref|XP_003716364.1|  threonyl-tRNA synthetase                           124   4e-29   
ref|XP_002614318.1|  conserved hypothetical protein                     124   5e-29   
ref|XP_011274772.1|  threonyl-tRNA synthetase                           124   5e-29   
ref|XP_002841475.1|  hypothetical protein                               123   5e-29   
emb|CCD74805.1|  putative threonyl-tRNA synthetase                      121   5e-29   
ref|XP_006108820.1|  PREDICTED: probable threonine--tRNA ligase 2...    123   5e-29   
ref|XP_005987820.1|  PREDICTED: probable threonine--tRNA ligase 2...    124   5e-29   
emb|CDQ73766.1|  unnamed protein product                                122   5e-29   
ref|XP_011298380.1|  PREDICTED: threonine--tRNA ligase, cytoplasm...    124   5e-29   
ref|XP_009862171.1|  PREDICTED: threonine--tRNA ligase, cytoplasm...    124   5e-29   
ref|XP_011298382.1|  PREDICTED: threonine--tRNA ligase, cytoplasm...    123   5e-29   
ref|XP_009862172.1|  PREDICTED: threonine--tRNA ligase, cytoplasm...    124   5e-29   
ref|XP_004658124.1|  PREDICTED: probable threonine--tRNA ligase 2...    124   6e-29   
ref|XP_005987818.1|  PREDICTED: probable threonine--tRNA ligase 2...    124   6e-29   
ref|XP_006874592.1|  PREDICTED: probable threonine--tRNA ligase 2...    124   6e-29   
ref|XP_011342020.1|  PREDICTED: threonine--tRNA ligase, cytoplasm...    123   6e-29   
ref|XP_007294761.1|  threonyl-tRNA synthetase                           124   6e-29   
ref|XP_001696198.1|  hypothetical protein CHLREDRAFT_167047             123   6e-29   
ref|XP_003674309.1|  hypothetical protein NCAS_0A13710                  124   6e-29   
gb|KFB38665.1|  AGAP008929-PA-like protein                              124   6e-29   
ref|XP_011342019.1|  PREDICTED: threonine--tRNA ligase, cytoplasm...    123   6e-29   
ref|XP_008275872.1|  PREDICTED: probable threonine--tRNA ligase 2...    123   6e-29   
gb|KIW00873.1|  threonine-tRNA ligase                                   123   6e-29   
ref|XP_005987817.1|  PREDICTED: probable threonine--tRNA ligase 2...    124   6e-29   
ref|XP_008275871.1|  PREDICTED: threonine--tRNA ligase, cytoplasm...    124   6e-29   
ref|XP_005987819.1|  PREDICTED: probable threonine--tRNA ligase 2...    123   6e-29   
ref|XP_006003382.1|  PREDICTED: threonine--tRNA ligase, cytoplasm...    122   7e-29   
ref|XP_004879581.1|  PREDICTED: probable threonine--tRNA ligase 2...    123   7e-29   
ref|XP_001929781.1|  hypothetical protein                               123   7e-29   
ref|XP_004351232.1|  threonyl-tRNA synthetase                           123   7e-29   
ref|XP_008309055.1|  PREDICTED: threonine--tRNA ligase, cytoplasm...    123   7e-29   
ref|XP_004852723.1|  PREDICTED: probable threonine--tRNA ligase 2...    123   7e-29   
ref|XP_007273985.1|  threonyl-trna synthetase                           123   7e-29   
ref|XP_011418149.1|  PREDICTED: threonine--tRNA ligase, cytoplasm...    123   7e-29   
gb|EPQ62227.1|  Threonyl-tRNA synthetase                                123   7e-29   
ref|XP_004852724.1|  PREDICTED: probable threonine--tRNA ligase 2...    123   8e-29   
ref|XP_009862168.1|  PREDICTED: threonine--tRNA ligase, cytoplasm...    123   8e-29   
ref|XP_011192188.1|  PREDICTED: threonine--tRNA ligase, cytoplasm...    123   8e-29   
ref|XP_009862169.1|  PREDICTED: threonine--tRNA ligase, cytoplasm...    123   8e-29   
ref|XP_002946221.1|  hypothetical protein VOLCADRAFT_102823             123   8e-29   
ref|XP_011418148.1|  PREDICTED: threonine--tRNA ligase, cytoplasm...    123   8e-29   
ref|XP_009862170.1|  PREDICTED: threonine--tRNA ligase, cytoplasm...    123   9e-29   
ref|XP_011192187.1|  PREDICTED: threonine--tRNA ligase, cytoplasm...    123   9e-29   
ref|XP_011212417.1|  PREDICTED: threonine--tRNA ligase, cytoplasm...    123   9e-29   



>ref|XP_009794575.1| PREDICTED: threonine--tRNA ligase, mitochondrial [Nicotiana sylvestris]
Length=725

 Score =   250 bits (638),  Expect = 8e-75, Method: Compositional matrix adjust.
 Identities = 137/186 (74%), Positives = 158/186 (85%), Gaps = 4/186 (2%)
 Frame = +1

Query  28   TSQLLWRLISF---RHPPSPSNSIFIRRFSLRPSQMGKADKssaannsaPDHPKDDAYLQ  198
             S L WRL +    R PP     + +RRFS  P  MGKA K S AN+SA  +PKD++YLQ
Sbjct  4    ASPLYWRLFTQSICRRPPPCKQFLLLRRFSSEPP-MGKAAKGSEANSSAVSYPKDESYLQ  62

Query  199  SVIPKRISLFESIKsqqqlqrlslsPDPIKIELPNGSVKEGKKWNTTPLDIAKELSKSLA  378
            +VIPKRI+LF+SI+++Q LQRLSLSPDPIKIELP+G++KEGKKWNTTPLDIAKE+SKSLA
Sbjct  63   NVIPKRIALFQSIQNEQHLQRLSLSPDPIKIELPSGTMKEGKKWNTTPLDIAKEISKSLA  122

Query  379  SNALISKVNGVLWDMSRPLEGDCKLELFTFDSDEGRDTFWHSSAHILGQSVEMKYGCKLC  558
            SNALI+KVNGVLWD+ RPLEGDCKLELFTFDSDEGRDTFWHSSAHILG+S+E  YGCKLC
Sbjct  123  SNALIAKVNGVLWDLLRPLEGDCKLELFTFDSDEGRDTFWHSSAHILGESLERTYGCKLC  182

Query  559  IGPCTT  576
            IGPCTT
Sbjct  183  IGPCTT  188



>ref|XP_009622103.1| PREDICTED: threonine--tRNA ligase, mitochondrial [Nicotiana tomentosiformis]
Length=721

 Score =   244 bits (622),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 135/187 (72%), Positives = 157/187 (84%), Gaps = 3/187 (2%)
 Frame = +1

Query  16   MVCATSQLLWRLISFRHPPSPSNSIFIRRFSLRPSQMGKADKssaannsaPDHPKDDAYL  195
            M+ A+      LI  R PP     + +R FS  P  MGK  K S AN+SA  +PKD++YL
Sbjct  1    MLLASRLFTQSLI--RRPPPCKQFLLLRSFSSEPP-MGKTPKGSEANSSAASYPKDESYL  57

Query  196  QSVIPKRISLFESIKsqqqlqrlslsPDPIKIELPNGSVKEGKKWNTTPLDIAKELSKSL  375
            Q+VIPKRI+LFESI+++Q+LQRLSLSPDPIKIELP+G++KEGKKWNTTPLDIAKE+SKSL
Sbjct  58   QNVIPKRIALFESIQNEQRLQRLSLSPDPIKIELPSGTMKEGKKWNTTPLDIAKEISKSL  117

Query  376  ASNALISKVNGVLWDMSRPLEGDCKLELFTFDSDEGRDTFWHSSAHILGQSVEMKYGCKL  555
            ASNALI+KVNGVLWD+ RPLEGDCKLELFTFDSDEGRDTFWHSSAHILG+S+E  YGCKL
Sbjct  118  ASNALIAKVNGVLWDLLRPLEGDCKLELFTFDSDEGRDTFWHSSAHILGESLERTYGCKL  177

Query  556  CIGPCTT  576
            CIGPCTT
Sbjct  178  CIGPCTT  184



>ref|XP_006355966.1| PREDICTED: threonine--tRNA ligase, mitochondrial-like [Solanum 
tuberosum]
Length=725

 Score =   231 bits (590),  Expect = 5e-68, Method: Compositional matrix adjust.
 Identities = 134/187 (72%), Positives = 156/187 (83%), Gaps = 6/187 (3%)
 Frame = +1

Query  28   TSQLLWRLI--SFRHPPSPSN--SIFIRRFSLRPSQMGKADKssaannsaPDHPKDDAYL  195
             S L WRL   S R PP P    S+F R FS  P  MGKA KSS AN+SA   PKD+ YL
Sbjct  4    ASPLCWRLFTQSIRRPPPPCKHFSLFRRCFS-SPPPMGKAAKSSEANSSA-SIPKDETYL  61

Query  196  QSVIPKRISLFESIKsqqqlqrlslsPDPIKIELPNGSVKEGKKWNTTPLDIAKELSKSL  375
            Q+VIPKRI+LFES+++QQ+LQRL+LSPDPIKIEL +G++KEGK+WNTTP DIAKE+SKSL
Sbjct  62   QNVIPKRIALFESLQNQQRLQRLALSPDPIKIELVDGTIKEGKQWNTTPFDIAKEISKSL  121

Query  376  ASNALISKVNGVLWDMSRPLEGDCKLELFTFDSDEGRDTFWHSSAHILGQSVEMKYGCKL  555
            A+NALI+KVNGVLWDM RPLEGDCKLE+F F+SDEGRDTFWHSSAHILG+S+E  +GCKL
Sbjct  122  AANALIAKVNGVLWDMLRPLEGDCKLEIFKFESDEGRDTFWHSSAHILGESLERTFGCKL  181

Query  556  CIGPCTT  576
            CIGPCTT
Sbjct  182  CIGPCTT  188



>ref|XP_004238685.1| PREDICTED: threonine--tRNA ligase, mitochondrial-like [Solanum 
lycopersicum]
Length=725

 Score =   230 bits (587),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 133/187 (71%), Positives = 155/187 (83%), Gaps = 6/187 (3%)
 Frame = +1

Query  28   TSQLLWRLI--SFRHPPSPSN--SIFIRRFSLRPSQMGKADKssaannsaPDHPKDDAYL  195
             S L WRL   S R PP P    SI  R FS  P  MGK  KS  AN+SA   PKD+ YL
Sbjct  4    ASPLCWRLFTQSIRRPPPPCKHFSILRRCFSSTPP-MGKTAKSCEANSSA-SIPKDETYL  61

Query  196  QSVIPKRISLFESIKsqqqlqrlslsPDPIKIELPNGSVKEGKKWNTTPLDIAKELSKSL  375
            ++VIPKRI+LFESI++QQ+LQRL+LSPDPIKIEL +G++KEGKKWNTTPLDIAKE+SKSL
Sbjct  62   ENVIPKRIALFESIQNQQRLQRLALSPDPIKIELVDGTIKEGKKWNTTPLDIAKEISKSL  121

Query  376  ASNALISKVNGVLWDMSRPLEGDCKLELFTFDSDEGRDTFWHSSAHILGQSVEMKYGCKL  555
            A+NALI+KVNGVLWD+SRPLEGDCKLE+F F++DEGRDTFWHSSAHILG+S+E  +GCKL
Sbjct  122  AANALIAKVNGVLWDLSRPLEGDCKLEIFKFETDEGRDTFWHSSAHILGESLERTFGCKL  181

Query  556  CIGPCTT  576
            CIGPCTT
Sbjct  182  CIGPCTT  188



>gb|EPS72288.1| hypothetical protein M569_02470 [Genlisea aurea]
Length=690

 Score =   226 bits (575),  Expect = 5e-66, Method: Compositional matrix adjust.
 Identities = 109/137 (80%), Positives = 127/137 (93%), Gaps = 0/137 (0%)
 Frame = +1

Query  166  PDHPKDDAYLQSVIPKRISLFESIKsqqqlqrlslsPDPIKIELPNGSVKEGKKWNTTPL  345
            P+  KD+AYLQ+VIPKRI+LFESI++QQ+L  L+LSPDPI++ LP+G VKEGKKWNTTP 
Sbjct  17   PEFRKDEAYLQTVIPKRIALFESIQNQQKLSLLALSPDPIQVVLPDGKVKEGKKWNTTPF  76

Query  346  DIAKELSKSLASNALISKVNGVLWDMSRPLEGDCKLELFTFDSDEGRDTFWHSSAHILGQ  525
            DIAK++SK+LASNALISKVNGVLWDM+RPLEGDC LELFTFD+DEGRDTFWHSSAHILG+
Sbjct  77   DIAKDISKNLASNALISKVNGVLWDMNRPLEGDCNLELFTFDTDEGRDTFWHSSAHILGE  136

Query  526  SVEMKYGCKLCIGPCTT  576
            S+E  YGCKLCIGPCTT
Sbjct  137  SLEQAYGCKLCIGPCTT  153



>ref|XP_011076219.1| PREDICTED: threonine--tRNA ligase, mitochondrial [Sesamum indicum]
Length=722

 Score =   226 bits (576),  Expect = 5e-66, Method: Compositional matrix adjust.
 Identities = 112/137 (82%), Positives = 126/137 (92%), Gaps = 0/137 (0%)
 Frame = +1

Query  166  PDHPKDDAYLQSVIPKRISLFESIKsqqqlqrlslsPDPIKIELPNGSVKEGKKWNTTPL  345
            P + KD+AYLQSVI KRI+LFESIK+QQ L RL+LSPD I+I LP+G VKEGKKWNTTP 
Sbjct  49   PAYSKDEAYLQSVIQKRIALFESIKNQQNLSRLALSPDQIQITLPDGKVKEGKKWNTTPF  108

Query  346  DIAKELSKSLASNALISKVNGVLWDMSRPLEGDCKLELFTFDSDEGRDTFWHSSAHILGQ  525
            D+AKE+SKSLASNALISKVNGVLWDM+RPLEGDCKLELFTFD+DEGRDTFWHSSAHILG+
Sbjct  109  DVAKEISKSLASNALISKVNGVLWDMNRPLEGDCKLELFTFDTDEGRDTFWHSSAHILGE  168

Query  526  SVEMKYGCKLCIGPCTT  576
            S+E  YGC+LCIGPCTT
Sbjct  169  SLEQTYGCRLCIGPCTT  185



>ref|XP_004246064.1| PREDICTED: threonine--tRNA ligase, mitochondrial-like [Solanum 
lycopersicum]
Length=676

 Score =   225 bits (573),  Expect = 8e-66, Method: Compositional matrix adjust.
 Identities = 112/135 (83%), Positives = 128/135 (95%), Gaps = 0/135 (0%)
 Frame = +1

Query  172  HPKDDAYLQSVIPKRISLFESIKsqqqlqrlslsPDPIKIELPNGSVKEGKKWNTTPLDI  351
            +P+D+ YL+ V+P+RI+LF SI++QQ+LQRLSLSPDPIKIELPNG+VKEGKKWNTTPLDI
Sbjct  5    YPRDENYLEIVVPRRIALFVSIQNQQRLQRLSLSPDPIKIELPNGTVKEGKKWNTTPLDI  64

Query  352  AKELSKSLASNALISKVNGVLWDMSRPLEGDCKLELFTFDSDEGRDTFWHSSAHILGQSV  531
            AKE+SKSL SNALI+KVNGVLWD+ RPLE DCKLELFTFDSDEGRDTFWHSSAHILG+S+
Sbjct  65   AKEISKSLGSNALIAKVNGVLWDLLRPLESDCKLELFTFDSDEGRDTFWHSSAHILGESL  124

Query  532  EMKYGCKLCIGPCTT  576
            E KYGCKLCIGPCTT
Sbjct  125  ERKYGCKLCIGPCTT  139



>ref|XP_006355233.1| PREDICTED: threonine--tRNA ligase, mitochondrial-like [Solanum 
tuberosum]
Length=676

 Score =   225 bits (573),  Expect = 9e-66, Method: Compositional matrix adjust.
 Identities = 112/135 (83%), Positives = 128/135 (95%), Gaps = 0/135 (0%)
 Frame = +1

Query  172  HPKDDAYLQSVIPKRISLFESIKsqqqlqrlslsPDPIKIELPNGSVKEGKKWNTTPLDI  351
            +P+D+ YL+ V+P+RI+LF SI++QQ+LQRLSLSPDPIKIELPNG+VKEGKKWNTTPLDI
Sbjct  5    YPRDENYLEIVVPRRIALFVSIQNQQRLQRLSLSPDPIKIELPNGTVKEGKKWNTTPLDI  64

Query  352  AKELSKSLASNALISKVNGVLWDMSRPLEGDCKLELFTFDSDEGRDTFWHSSAHILGQSV  531
            AKE+SKSL SNALI+KVNGVLWD+ RPLE DCKLELFTFDSDEGRDTFWHSSAHILG+S+
Sbjct  65   AKEISKSLGSNALIAKVNGVLWDLLRPLESDCKLELFTFDSDEGRDTFWHSSAHILGESL  124

Query  532  EMKYGCKLCIGPCTT  576
            E KYGCKLCIGPCTT
Sbjct  125  ERKYGCKLCIGPCTT  139



>ref|XP_010100498.1| Threonine--tRNA ligase [Morus notabilis]
 gb|EXB82632.1| Threonine--tRNA ligase [Morus notabilis]
Length=625

 Score =   223 bits (569),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 108/134 (81%), Positives = 127/134 (95%), Gaps = 0/134 (0%)
 Frame = +1

Query  175  PKDDAYLQSVIPKRISLFESIKsqqqlqrlslsPDPIKIELPNGSVKEGKKWNTTPLDIA  354
            PKD+AYL +VIPKRI LFESIK+QQQ++RLSL  DPIKI LP+G+VKEGKKW T+P D+A
Sbjct  62   PKDEAYLNAVIPKRIQLFESIKAQQQVERLSLQSDPIKITLPDGTVKEGKKWVTSPFDVA  121

Query  355  KELSKSLASNALISKVNGVLWDMSRPLEGDCKLELFTFDSDEGRDTFWHSSAHILGQSVE  534
            KE+SKSLA+NALIS+VNGVLWDM+RPLEGDC+L+LFTF+SDEGRDTFWHSSAHILGQ++E
Sbjct  122  KEISKSLAANALISQVNGVLWDMTRPLEGDCELKLFTFESDEGRDTFWHSSAHILGQALE  181

Query  535  MKYGCKLCIGPCTT  576
            M+YGCKLCIGPCTT
Sbjct  182  MEYGCKLCIGPCTT  195



>ref|XP_010644571.1| PREDICTED: threonine--tRNA ligase, mitochondrial-like [Vitis 
vinifera]
 emb|CBI39735.3| unnamed protein product [Vitis vinifera]
Length=686

 Score =   224 bits (572),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 111/135 (82%), Positives = 121/135 (90%), Gaps = 0/135 (0%)
 Frame = +1

Query  172  HPKDDAYLQSVIPKRISLFESIKsqqqlqrlslsPDPIKIELPNGSVKEGKKWNTTPLDI  351
            HPKDD YL  VIPKRI+LFESIKSQQ   R S+S DPIKI LP+G+VKEGKKW TTP DI
Sbjct  15   HPKDDEYLSCVIPKRIALFESIKSQQISHRRSISGDPIKITLPDGTVKEGKKWETTPFDI  74

Query  352  AKELSKSLASNALISKVNGVLWDMSRPLEGDCKLELFTFDSDEGRDTFWHSSAHILGQSV  531
            AKE+SK LASNALIS+VNGVLWDMSR LEGDC L+LFTFDSDEGRDTFWHSSAHILGQ++
Sbjct  75   AKEISKGLASNALISQVNGVLWDMSRALEGDCGLKLFTFDSDEGRDTFWHSSAHILGQAL  134

Query  532  EMKYGCKLCIGPCTT  576
            EM+YGCKLCIGPCTT
Sbjct  135  EMEYGCKLCIGPCTT  149



>ref|XP_002265302.1| PREDICTED: threonine--tRNA ligase, mitochondrial [Vitis vinifera]
 emb|CBI32119.3| unnamed protein product [Vitis vinifera]
Length=686

 Score =   223 bits (567),  Expect = 7e-65, Method: Compositional matrix adjust.
 Identities = 108/135 (80%), Positives = 122/135 (90%), Gaps = 0/135 (0%)
 Frame = +1

Query  172  HPKDDAYLQSVIPKRISLFESIKsqqqlqrlslsPDPIKIELPNGSVKEGKKWNTTPLDI  351
            HPKDD YL  VIPKRI++FESIK+QQ   R S+S DPIKI LP+G+VKEGKKW TTPLDI
Sbjct  15   HPKDDEYLSCVIPKRIAVFESIKAQQIAHRQSISGDPIKITLPDGTVKEGKKWATTPLDI  74

Query  352  AKELSKSLASNALISKVNGVLWDMSRPLEGDCKLELFTFDSDEGRDTFWHSSAHILGQSV  531
            A+E+SK LASNALIS VNG+LWDMSRPLEGDC+L+LFTFDSDEGRDTFWHSSAHILGQ++
Sbjct  75   AREISKGLASNALISLVNGILWDMSRPLEGDCELKLFTFDSDEGRDTFWHSSAHILGQAL  134

Query  532  EMKYGCKLCIGPCTT  576
            E+ YGCKLCIGPCTT
Sbjct  135  EVAYGCKLCIGPCTT  149



>ref|XP_010274328.1| PREDICTED: threonine--tRNA ligase, mitochondrial-like isoform 
X2 [Nelumbo nucifera]
Length=582

 Score =   218 bits (555),  Expect = 7e-64, Method: Compositional matrix adjust.
 Identities = 103/137 (75%), Positives = 123/137 (90%), Gaps = 0/137 (0%)
 Frame = +1

Query  166  PDHPKDDAYLQSVIPKRISLFESIKsqqqlqrlslsPDPIKIELPNGSVKEGKKWNTTPL  345
            P HPKD+AYL SVI KRI LFE+IK+QQ  +R  +  +PIKI LP+G+VKEGKKW ++P+
Sbjct  56   PSHPKDEAYLHSVIQKRIRLFEAIKAQQIEERQRIGGEPIKITLPDGTVKEGKKWISSPM  115

Query  346  DIAKELSKSLASNALISKVNGVLWDMSRPLEGDCKLELFTFDSDEGRDTFWHSSAHILGQ  525
            DIAK +SKSLA+NALIS+VNGVLWDM RPLEGDC+L+LFTF++DEGRDTFWHSSAHILGQ
Sbjct  116  DIAKGISKSLAANALISQVNGVLWDMFRPLEGDCELKLFTFEADEGRDTFWHSSAHILGQ  175

Query  526  SVEMKYGCKLCIGPCTT  576
            S+EM+YGCKLCIGPCTT
Sbjct  176  SLEMEYGCKLCIGPCTT  192



>emb|CDP00192.1| unnamed protein product [Coffea canephora]
Length=727

 Score =   220 bits (561),  Expect = 9e-64, Method: Compositional matrix adjust.
 Identities = 124/192 (65%), Positives = 142/192 (74%), Gaps = 14/192 (7%)
 Frame = +1

Query  28   TSQLLWRLISFRHPPSPSNS-IFIRRFSLR--------PSQMGKADKssaannsaPDHPK  180
            TSQL WR         P  S +  R F LR        P  MG A   S      P  PK
Sbjct  4    TSQLCWRFALLLRRLPPPPSGLHFRTFLLRHCSSLHSPPLPMGTASNDSG-----PSVPK  58

Query  181  DDAYLQSVIPKRISLFESIKsqqqlqrlslsPDPIKIELPNGSVKEGKKWNTTPLDIAKE  360
            D+AYL + I KRI LF+SI+ +++LQRLSLSPDPI+I LP+GSVKEGKKWNTTP D+AKE
Sbjct  59   DEAYLATAINKRIDLFKSIQDREKLQRLSLSPDPIRIVLPDGSVKEGKKWNTTPFDVAKE  118

Query  361  LSKSLASNALISKVNGVLWDMSRPLEGDCKLELFTFDSDEGRDTFWHSSAHILGQSVEMK  540
            +SKSLASNALI+KV+G LWDM RPLEGDC+L+LFTFDSDEGRDTFWHSSAHILGQS+E  
Sbjct  119  ISKSLASNALIAKVDGALWDMHRPLEGDCELKLFTFDSDEGRDTFWHSSAHILGQSLEQT  178

Query  541  YGCKLCIGPCTT  576
            YGC+LCIGPCTT
Sbjct  179  YGCRLCIGPCTT  190



>ref|XP_006438442.1| hypothetical protein CICLE_v100308252mg, partial [Citrus clementina]
 gb|ESR51682.1| hypothetical protein CICLE_v100308252mg, partial [Citrus clementina]
Length=403

 Score =   213 bits (541),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 116/193 (60%), Positives = 138/193 (72%), Gaps = 19/193 (10%)
 Frame = +1

Query  10   CFMVCATSQLLWRLIS---FR-HPPSPSNSIFIRRFSLRPSQMGKADKssaannsaPDHP  177
            C  V AT     R IS   FR     PS++  +RR    PS               P+  
Sbjct  4    CAKVLATLTFNCRRISSQLFRCQNTKPSSATNLRRIRAMPS---------------PNQV  48

Query  178  KDDAYLQSVIPKRISLFESIKsqqqlqrlslsPDPIKIELPNGSVKEGKKWNTTPLDIAK  357
            KD+ YL  VIPKRISLF+S++S+QQ +  SL  DPIKI LP+GSVKEGK+W T+P+DIA+
Sbjct  49   KDEEYLNKVIPKRISLFQSLQSEQQARLQSLPHDPIKITLPDGSVKEGKRWETSPMDIAQ  108

Query  358  ELSKSLASNALISKVNGVLWDMSRPLEGDCKLELFTFDSDEGRDTFWHSSAHILGQSVEM  537
             +SKSLA+NALIS VNGVLWDM+RPLE DC L+LFTFDSDEGRDTFWHSSAHILGQ++E 
Sbjct  109  GISKSLAANALISMVNGVLWDMTRPLEADCDLKLFTFDSDEGRDTFWHSSAHILGQAIEQ  168

Query  538  KYGCKLCIGPCTT  576
            +YGCKLCIGPCTT
Sbjct  169  QYGCKLCIGPCTT  181



>ref|XP_010274327.1| PREDICTED: threonine--tRNA ligase, mitochondrial-like isoform 
X1 [Nelumbo nucifera]
Length=729

 Score =   219 bits (558),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 103/137 (75%), Positives = 123/137 (90%), Gaps = 0/137 (0%)
 Frame = +1

Query  166  PDHPKDDAYLQSVIPKRISLFESIKsqqqlqrlslsPDPIKIELPNGSVKEGKKWNTTPL  345
            P HPKD+AYL SVI KRI LFE+IK+QQ  +R  +  +PIKI LP+G+VKEGKKW ++P+
Sbjct  56   PSHPKDEAYLHSVIQKRIRLFEAIKAQQIEERQRIGGEPIKITLPDGTVKEGKKWISSPM  115

Query  346  DIAKELSKSLASNALISKVNGVLWDMSRPLEGDCKLELFTFDSDEGRDTFWHSSAHILGQ  525
            DIAK +SKSLA+NALIS+VNGVLWDM RPLEGDC+L+LFTF++DEGRDTFWHSSAHILGQ
Sbjct  116  DIAKGISKSLAANALISQVNGVLWDMFRPLEGDCELKLFTFEADEGRDTFWHSSAHILGQ  175

Query  526  SVEMKYGCKLCIGPCTT  576
            S+EM+YGCKLCIGPCTT
Sbjct  176  SLEMEYGCKLCIGPCTT  192



>gb|EYU25062.1| hypothetical protein MIMGU_mgv1a002240mg [Erythranthe guttata]
Length=696

 Score =   218 bits (556),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 105/137 (77%), Positives = 123/137 (90%), Gaps = 0/137 (0%)
 Frame = +1

Query  166  PDHPKDDAYLQSVIPKRISLFESIKsqqqlqrlslsPDPIKIELPNGSVKEGKKWNTTPL  345
            P   KD+ YLQ V+PKRI++FE+I ++Q L RL LSPDPIKI LP+G+VKEGKKWNTTPL
Sbjct  21   PAFVKDEDYLQRVVPKRIAMFETILNEQTLSRLQLSPDPIKITLPDGNVKEGKKWNTTPL  80

Query  346  DIAKELSKSLASNALISKVNGVLWDMSRPLEGDCKLELFTFDSDEGRDTFWHSSAHILGQ  525
            D+AKE+SKSLA+NALI+KV+GVLWDMSRP EGDCKLELF FD+DEGRDTFWHSSAHILG+
Sbjct  81   DVAKEISKSLAANALIAKVDGVLWDMSRPFEGDCKLELFNFDTDEGRDTFWHSSAHILGE  140

Query  526  SVEMKYGCKLCIGPCTT  576
            S+E  YGC+LCIGPCTT
Sbjct  141  SLEQAYGCRLCIGPCTT  157



>gb|KDO82530.1| hypothetical protein CISIN_1g0066802mg, partial [Citrus sinensis]
 gb|KDO82531.1| hypothetical protein CISIN_1g0066802mg, partial [Citrus sinensis]
 gb|KDO82532.1| hypothetical protein CISIN_1g0066802mg, partial [Citrus sinensis]
Length=310

 Score =   208 bits (530),  Expect = 6e-63, Method: Compositional matrix adjust.
 Identities = 114/195 (58%), Positives = 138/195 (71%), Gaps = 19/195 (10%)
 Frame = +1

Query  4    FACFMVCATSQLLWRLIS---FR-HPPSPSNSIFIRRFSLRPSQMGKADKssaannsaPD  171
              C  + AT     R +S   FR     PS++  +RR    PS               P+
Sbjct  2    LQCAKILATLTFNCRRVSSQLFRCQNTKPSSATNLRRICAMPS---------------PN  46

Query  172  HPKDDAYLQSVIPKRISLFESIKsqqqlqrlslsPDPIKIELPNGSVKEGKKWNTTPLDI  351
              KD+ YL  VIPKRISLF+S++S+QQ +  SL  DPIKI LP+GSVKEGK+W T+P+DI
Sbjct  47   PVKDEEYLIKVIPKRISLFQSLQSEQQARLQSLPHDPIKITLPDGSVKEGKRWETSPMDI  106

Query  352  AKELSKSLASNALISKVNGVLWDMSRPLEGDCKLELFTFDSDEGRDTFWHSSAHILGQSV  531
            A+ +SKSLA+NALIS VNGVLWDM+RPLE DC L+LFTFDSDEGRDTFWHSSAHILGQ++
Sbjct  107  AQGISKSLAANALISMVNGVLWDMTRPLEADCDLKLFTFDSDEGRDTFWHSSAHILGQAI  166

Query  532  EMKYGCKLCIGPCTT  576
            E +YGCKLCIGPCTT
Sbjct  167  EQQYGCKLCIGPCTT  181



>ref|XP_007157476.1| hypothetical protein PHAVU_002G072800g [Phaseolus vulgaris]
 gb|ESW29470.1| hypothetical protein PHAVU_002G072800g [Phaseolus vulgaris]
Length=707

 Score =   218 bits (554),  Expect = 7e-63, Method: Compositional matrix adjust.
 Identities = 113/183 (62%), Positives = 139/183 (76%), Gaps = 16/183 (9%)
 Frame = +1

Query  37   LLWRLISFRHPPSPSNSIF---IRRFSLRPSQMGKADKssaannsaPDHPKDDAYLQSVI  207
            +L+ LI  R   SP + +    I RFS   + M               H KDDAYLQ+ I
Sbjct  1    MLYSLIRLRRYASPHSPLLRLPINRFSSAVAAMVA-------------HAKDDAYLQAAI  47

Query  208  PKRISLFESIKsqqqlqrlslsPDPIKIELPNGSVKEGKKWNTTPLDIAKELSKSLASNA  387
            PKRI LF++I+++QQ QRLSLSPDPIK+ LP+G V+E KKW TTPLD+A+E+SK+LA+NA
Sbjct  48   PKRIQLFQTIQAEQQTQRLSLSPDPIKVNLPDGGVREAKKWLTTPLDVAREISKNLANNA  107

Query  388  LISKVNGVLWDMSRPLEGDCKLELFTFDSDEGRDTFWHSSAHILGQSVEMKYGCKLCIGP  567
            LI+KVNGVLWDM+RPLE DC+L++F FD DEGRDTFWHSSAHILGQS+E +YGCKLCIGP
Sbjct  108  LIAKVNGVLWDMTRPLEEDCQLQIFKFDDDEGRDTFWHSSAHILGQSLETEYGCKLCIGP  167

Query  568  CTT  576
            CTT
Sbjct  168  CTT  170



>ref|XP_004167577.1| PREDICTED: LOW QUALITY PROTEIN: threonine--tRNA ligase, mitochondrial-like 
[Cucumis sativus]
 gb|KGN49713.1| hypothetical protein Csa_5G080790 [Cucumis sativus]
Length=412

 Score =   211 bits (536),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 100/135 (74%), Positives = 119/135 (88%), Gaps = 0/135 (0%)
 Frame = +1

Query  172  HPKDDAYLQSVIPKRISLFESIKsqqqlqrlslsPDPIKIELPNGSVKEGKKWNTTPLDI  351
            HPKD+AYL + IPKRI LF+SI++Q    R SL    IKI LP+G++KEG+KW T PLD+
Sbjct  53   HPKDEAYLSTTIPKRIQLFQSIQAQILADRSSLPSHQIKITLPDGTMKEGQKWKTAPLDV  112

Query  352  AKELSKSLASNALISKVNGVLWDMSRPLEGDCKLELFTFDSDEGRDTFWHSSAHILGQSV  531
            AKE+SKSLA+NALI++V+GVLWDMSRPLE DC+L+LFTFDSDEGRDTFWHSSAHILGQS+
Sbjct  113  AKEISKSLAANALIAQVDGVLWDMSRPLENDCELKLFTFDSDEGRDTFWHSSAHILGQSL  172

Query  532  EMKYGCKLCIGPCTT  576
            EM+YGCKLCIGPCTT
Sbjct  173  EMEYGCKLCIGPCTT  187



>ref|XP_008460557.1| PREDICTED: threonine--tRNA ligase, mitochondrial [Cucumis melo]
Length=724

 Score =   216 bits (549),  Expect = 4e-62, Method: Compositional matrix adjust.
 Identities = 101/135 (75%), Positives = 120/135 (89%), Gaps = 0/135 (0%)
 Frame = +1

Query  172  HPKDDAYLQSVIPKRISLFESIKsqqqlqrlslsPDPIKIELPNGSVKEGKKWNTTPLDI  351
            HPKD+ YL + IPKRI LF+SI++Q    R SL   PIKI LP+G++KEG+KW TTPLD+
Sbjct  53   HPKDETYLSTTIPKRIQLFQSIQAQLLADRSSLPSHPIKITLPDGTMKEGQKWKTTPLDV  112

Query  352  AKELSKSLASNALISKVNGVLWDMSRPLEGDCKLELFTFDSDEGRDTFWHSSAHILGQSV  531
            AKE+SKSLA+NALI++V+GVLWDMSRPLE DC+L+LFTFDSDEGRDTFWHSSAHILGQS+
Sbjct  113  AKEISKSLAANALIAQVDGVLWDMSRPLENDCELKLFTFDSDEGRDTFWHSSAHILGQSL  172

Query  532  EMKYGCKLCIGPCTT  576
            EM+YGCKLCIGPCTT
Sbjct  173  EMEYGCKLCIGPCTT  187



>ref|XP_010044651.1| PREDICTED: threonine--tRNA ligase, mitochondrial [Eucalyptus 
grandis]
 gb|KCW86747.1| hypothetical protein EUGRSUZ_B03357 [Eucalyptus grandis]
Length=737

 Score =   214 bits (546),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 104/133 (78%), Positives = 123/133 (92%), Gaps = 0/133 (0%)
 Frame = +1

Query  178  KDDAYLQSVIPKRISLFESIKsqqqlqrlslsPDPIKIELPNGSVKEGKKWNTTPLDIAK  357
            KD+ YL+ VIPKRI+LFESIK++Q  QR S++ +PIKI LP+GSVKEGKKW T+PLDIA+
Sbjct  68   KDENYLKLVIPKRIALFESIKAKQLSQRQSIAGEPIKITLPDGSVKEGKKWETSPLDIAR  127

Query  358  ELSKSLASNALISKVNGVLWDMSRPLEGDCKLELFTFDSDEGRDTFWHSSAHILGQSVEM  537
             +SKSLA+NALIS+V+G LWDMSRPLEGDC+L+LFTFDSDEGRDTFWHSSAHILGQS+EM
Sbjct  128  GISKSLAANALISQVDGALWDMSRPLEGDCELKLFTFDSDEGRDTFWHSSAHILGQSLEM  187

Query  538  KYGCKLCIGPCTT  576
            +YGCKLCIGPCTT
Sbjct  188  EYGCKLCIGPCTT  200



>ref|XP_006483810.1| PREDICTED: threonine--tRNA ligase, mitochondrial-like [Citrus 
sinensis]
Length=718

 Score =   213 bits (542),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 116/193 (60%), Positives = 138/193 (72%), Gaps = 19/193 (10%)
 Frame = +1

Query  10   CFMVCATSQLLWRLIS---FR-HPPSPSNSIFIRRFSLRPSQMGKADKssaannsaPDHP  177
            C  V AT     R IS   FR     PS++  +RR    PS               P+  
Sbjct  4    CAKVLATLTFNCRRISSQLFRCQNTKPSSATNLRRICAMPS---------------PNQV  48

Query  178  KDDAYLQSVIPKRISLFESIKsqqqlqrlslsPDPIKIELPNGSVKEGKKWNTTPLDIAK  357
            KD+ YL  VIPKRISLF+S++S+QQ +  SL  DPIKI LP+GSVKEGK+W T+P+DIA+
Sbjct  49   KDEEYLNKVIPKRISLFQSLQSEQQARLQSLPHDPIKITLPDGSVKEGKRWETSPMDIAQ  108

Query  358  ELSKSLASNALISKVNGVLWDMSRPLEGDCKLELFTFDSDEGRDTFWHSSAHILGQSVEM  537
             +SKSLA+NALIS VNGVLWDM+RPLE DC L+LFTFDSDEGRDTFWHSSAHILGQ++E 
Sbjct  109  GISKSLAANALISMVNGVLWDMTRPLEADCDLKLFTFDSDEGRDTFWHSSAHILGQAIEQ  168

Query  538  KYGCKLCIGPCTT  576
            +YGCKLCIGPCTT
Sbjct  169  QYGCKLCIGPCTT  181



>ref|XP_010272819.1| PREDICTED: threonine--tRNA ligase, mitochondrial-like [Nelumbo 
nucifera]
Length=726

 Score =   213 bits (541),  Expect = 6e-61, Method: Compositional matrix adjust.
 Identities = 98/137 (72%), Positives = 122/137 (89%), Gaps = 0/137 (0%)
 Frame = +1

Query  166  PDHPKDDAYLQSVIPKRISLFESIKsqqqlqrlslsPDPIKIELPNGSVKEGKKWNTTPL  345
            P H KD+AYL+SVI KRI LFE+IK++Q  +R  +  +PIKI LP+G+VKEGKKW ++P+
Sbjct  53   PSHAKDEAYLESVIQKRIRLFEAIKAKQIEERQRIGGEPIKITLPDGTVKEGKKWISSPM  112

Query  346  DIAKELSKSLASNALISKVNGVLWDMSRPLEGDCKLELFTFDSDEGRDTFWHSSAHILGQ  525
            DIA+++SKSLA+NALIS+VNG LWDM RPLEG C+L+LFTF++DEGRDTFWHSSAHILGQ
Sbjct  113  DIARDISKSLAANALISQVNGTLWDMLRPLEGHCELKLFTFETDEGRDTFWHSSAHILGQ  172

Query  526  SVEMKYGCKLCIGPCTT  576
            S+EM+YGCKLCIGPCTT
Sbjct  173  SLEMEYGCKLCIGPCTT  189



>ref|XP_004142299.1| PREDICTED: threonine--tRNA ligase, mitochondrial-like [Cucumis 
sativus]
Length=724

 Score =   212 bits (540),  Expect = 7e-61, Method: Compositional matrix adjust.
 Identities = 100/135 (74%), Positives = 119/135 (88%), Gaps = 0/135 (0%)
 Frame = +1

Query  172  HPKDDAYLQSVIPKRISLFESIKsqqqlqrlslsPDPIKIELPNGSVKEGKKWNTTPLDI  351
            HPKD+AYL + IPKRI LF+SI++Q    R SL    IKI LP+G++KEG+KW T PLD+
Sbjct  53   HPKDEAYLSTTIPKRIQLFQSIQAQILADRSSLPSHQIKITLPDGTMKEGQKWKTAPLDV  112

Query  352  AKELSKSLASNALISKVNGVLWDMSRPLEGDCKLELFTFDSDEGRDTFWHSSAHILGQSV  531
            AKE+SKSLA+NALI++V+GVLWDMSRPLE DC+L+LFTFDSDEGRDTFWHSSAHILGQS+
Sbjct  113  AKEISKSLAANALIAQVDGVLWDMSRPLENDCELKLFTFDSDEGRDTFWHSSAHILGQSL  172

Query  532  EMKYGCKLCIGPCTT  576
            EM+YGCKLCIGPCTT
Sbjct  173  EMEYGCKLCIGPCTT  187



>ref|XP_003613276.1| Threonyl-tRNA synthetase [Medicago truncatula]
 gb|AES96234.1| threonyl-tRNA synthetase/threonine-tRNA ligase, putative [Medicago 
truncatula]
Length=711

 Score =   212 bits (540),  Expect = 7e-61, Method: Compositional matrix adjust.
 Identities = 108/175 (62%), Positives = 135/175 (77%), Gaps = 13/175 (7%)
 Frame = +1

Query  61   RHPPSPSNSIFIR---RFSLRPSQMGKADKssaannsaPDHPKDDAYLQSVIPKRISLFE  231
            R+ PS + S+F+    RF+   S                 HPKD++YL + IPKR+ +FE
Sbjct  10   RNIPSSTTSLFLHIGNRFNFSSSAAAMV----------VAHPKDESYLAATIPKRVQIFE  59

Query  232  SIKsqqqlqrlslsPDPIKIELPNGSVKEGKKWNTTPLDIAKELSKSLASNALISKVNGV  411
            +++++QQ +RLSLSPDPIK+ LP+G+VKEGKKW TTP DIA+E+SK+LA+NALISKVNGV
Sbjct  60   ALQAEQQTRRLSLSPDPIKVTLPDGNVKEGKKWQTTPFDIAREISKNLANNALISKVNGV  119

Query  412  LWDMSRPLEGDCKLELFTFDSDEGRDTFWHSSAHILGQSVEMKYGCKLCIGPCTT  576
            LWDM+RPLE D  L+LF FD DEGRDTFWHSSAHILGQS+E +YGCKLCIGPCTT
Sbjct  120  LWDMNRPLEEDSSLQLFKFDDDEGRDTFWHSSAHILGQSLETEYGCKLCIGPCTT  174



>ref|XP_002521030.1| threonyl-tRNA synthetase, putative [Ricinus communis]
 gb|EEF41447.1| threonyl-tRNA synthetase, putative [Ricinus communis]
Length=691

 Score =   211 bits (538),  Expect = 9e-61, Method: Compositional matrix adjust.
 Identities = 99/135 (73%), Positives = 122/135 (90%), Gaps = 0/135 (0%)
 Frame = +1

Query  172  HPKDDAYLQSVIPKRISLFESIKsqqqlqrlslsPDPIKIELPNGSVKEGKKWNTTPLDI  351
            HPKD++YL++VI KRI  FESIK+QQ  +  SL  D IKI LPNG+VKEGK+W ++P+DI
Sbjct  43   HPKDESYLRTVIDKRIKFFESIKAQQLSRLQSLEHDTIKISLPNGTVKEGKRWISSPMDI  102

Query  352  AKELSKSLASNALISKVNGVLWDMSRPLEGDCKLELFTFDSDEGRDTFWHSSAHILGQSV  531
            AKE+SKSLA+NALI++V+GVLWDM+RPLE +C+L++FTFDSDEGRDTFWHSSAHILGQS+
Sbjct  103  AKEISKSLAANALIAQVDGVLWDMNRPLETNCELKIFTFDSDEGRDTFWHSSAHILGQSL  162

Query  532  EMKYGCKLCIGPCTT  576
            EM+YGCKLCIGPCTT
Sbjct  163  EMEYGCKLCIGPCTT  177



>ref|XP_003519592.1| PREDICTED: threonine--tRNA ligase, mitochondrial-like [Glycine 
max]
Length=710

 Score =   211 bits (538),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 101/135 (75%), Positives = 122/135 (90%), Gaps = 0/135 (0%)
 Frame = +1

Query  172  HPKDDAYLQSVIPKRISLFESIKsqqqlqrlslsPDPIKIELPNGSVKEGKKWNTTPLDI  351
            H KD+AYL + IPKRI LFE+I ++Q  QRLSLSPDPIK+ LP+GSVKE KKW+TTPLD+
Sbjct  39   HAKDEAYLSATIPKRIRLFETILAEQHTQRLSLSPDPIKVTLPDGSVKEAKKWHTTPLDV  98

Query  352  AKELSKSLASNALISKVNGVLWDMSRPLEGDCKLELFTFDSDEGRDTFWHSSAHILGQSV  531
            A+E+SK+LA++ALI+KVNGVLWDM+RPLE DC+L++F FD DEGRDTFWHSSAHILGQS+
Sbjct  99   AREISKNLANSALIAKVNGVLWDMTRPLEDDCQLQIFKFDDDEGRDTFWHSSAHILGQSL  158

Query  532  EMKYGCKLCIGPCTT  576
            E +YGCKLCIGPCTT
Sbjct  159  ETEYGCKLCIGPCTT  173



>ref|XP_006394912.1| hypothetical protein EUTSA_v10003725mg [Eutrema salsugineum]
 gb|ESQ32198.1| hypothetical protein EUTSA_v10003725mg [Eutrema salsugineum]
Length=712

 Score =   211 bits (538),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 99/136 (73%), Positives = 119/136 (88%), Gaps = 0/136 (0%)
 Frame = +1

Query  169  DHPKDDAYLQSVIPKRISLFESIKsqqqlqrlslsPDPIKIELPNGSVKEGKKWNTTPLD  348
            +HPKD+AYL +VIPKRI+LFE I++ Q  +  SL  DPIKI LP+G+VKEGKKW TTP+D
Sbjct  40   NHPKDEAYLATVIPKRITLFEQIQANQLEKLKSLPHDPIKITLPDGNVKEGKKWETTPMD  99

Query  349  IAKELSKSLASNALISKVNGVLWDMSRPLEGDCKLELFTFDSDEGRDTFWHSSAHILGQS  528
            IA+++SK LA++ALIS VN VLWDMSRPLEGDCKLELF FDSD+GRDT WHSSAHILGQ+
Sbjct  100  IAEQISKGLANSALISAVNDVLWDMSRPLEGDCKLELFKFDSDKGRDTLWHSSAHILGQA  159

Query  529  VEMKYGCKLCIGPCTT  576
            +E +YGC+LCIGPCTT
Sbjct  160  LEQEYGCQLCIGPCTT  175



>gb|KDP21323.1| hypothetical protein JCGZ_21794 [Jatropha curcas]
Length=676

 Score =   210 bits (534),  Expect = 4e-60, Method: Compositional matrix adjust.
 Identities = 102/135 (76%), Positives = 120/135 (89%), Gaps = 0/135 (0%)
 Frame = +1

Query  172  HPKDDAYLQSVIPKRISLFESIKsqqqlqrlslsPDPIKIELPNGSVKEGKKWNTTPLDI  351
            HPKD+AYL++VI KRI LFESIKSQQ     SL+ D IKI LP+G+VKEGKKW ++P+DI
Sbjct  5    HPKDEAYLKAVIDKRIKLFESIKSQQLASLQSLNHDTIKITLPDGTVKEGKKWLSSPMDI  64

Query  352  AKELSKSLASNALISKVNGVLWDMSRPLEGDCKLELFTFDSDEGRDTFWHSSAHILGQSV  531
            AKE+SKSLA+NALI++V+G LWDM+RPLE DC+L+LFTFDSDEGRDTFWHSSAHILGQS+
Sbjct  65   AKEISKSLAANALIAQVDGTLWDMNRPLECDCELKLFTFDSDEGRDTFWHSSAHILGQSL  124

Query  532  EMKYGCKLCIGPCTT  576
            E  YGCKLCIGPCTT
Sbjct  125  EATYGCKLCIGPCTT  139



>ref|XP_006289423.1| hypothetical protein CARUB_v10002922mg [Capsella rubella]
 gb|EOA22321.1| hypothetical protein CARUB_v10002922mg [Capsella rubella]
Length=713

 Score =   210 bits (535),  Expect = 4e-60, Method: Compositional matrix adjust.
 Identities = 98/136 (72%), Positives = 116/136 (85%), Gaps = 0/136 (0%)
 Frame = +1

Query  169  DHPKDDAYLQSVIPKRISLFESIKsqqqlqrlslsPDPIKIELPNGSVKEGKKWNTTPLD  348
            +HPKD+AYL +VIPKRI LFE I++ Q     S+  DPIKI LP+G+VKEGKKW TTP+D
Sbjct  41   NHPKDEAYLSAVIPKRIRLFEQIQANQLENLKSMPHDPIKITLPDGNVKEGKKWETTPMD  100

Query  349  IAKELSKSLASNALISKVNGVLWDMSRPLEGDCKLELFTFDSDEGRDTFWHSSAHILGQS  528
            IA ++SK LA++ALIS VN VLWDMSRPLEGDCKLELF FDSD+GRDT WHSSAHILGQ+
Sbjct  101  IAAQISKGLANSALISAVNDVLWDMSRPLEGDCKLELFKFDSDKGRDTLWHSSAHILGQA  160

Query  529  VEMKYGCKLCIGPCTT  576
            +E +YGC+LCIGPCTT
Sbjct  161  LEQEYGCQLCIGPCTT  176



>ref|XP_008361801.1| PREDICTED: LOW QUALITY PROTEIN: threonine--tRNA ligase, mitochondrial-like 
[Malus domestica]
Length=731

 Score =   210 bits (535),  Expect = 4e-60, Method: Compositional matrix adjust.
 Identities = 107/176 (61%), Positives = 132/176 (75%), Gaps = 6/176 (3%)
 Frame = +1

Query  67   PPSPSNSIFIRRFSLRP------SQMGKADKssaannsaPDHPKDDAYLQSVIPKRISLF  228
            P + + S F+RR S  P      S      +    + +   HPKDDAYL++VIPKRI LF
Sbjct  12   PAAAAISFFLRRNSYSPFSSLSTSPPPLLPQLPTDSAAMAPHPKDDAYLEAVIPKRIKLF  71

Query  229  ESIKsqqqlqrlslsPDPIKIELPNGSVKEGKKWNTTPLDIAKELSKSLASNALISKVNG  408
            E+I++QQ   R SL  DPIKI LP G  KEGK+W T+P DIAK++SKSLAS+A+I+KVNG
Sbjct  72   EAIQAQQLAHRQSLPSDPIKITLPGGQEKEGKRWVTSPFDIAKDISKSLASSAVIAKVNG  131

Query  409  VLWDMSRPLEGDCKLELFTFDSDEGRDTFWHSSAHILGQSVEMKYGCKLCIGPCTT  576
             LWDM RPLEGDC+L+LF F+ DEGRDTFWHSSAHILGQ++E++YGCKLCIGPCTT
Sbjct  132  DLWDMGRPLEGDCELKLFKFEDDEGRDTFWHSSAHILGQALEVEYGCKLCIGPCTT  187



>ref|XP_009360487.1| PREDICTED: threonine--tRNA ligase, mitochondrial-like [Pyrus 
x bretschneideri]
 ref|XP_009363511.1| PREDICTED: threonine--tRNA ligase, mitochondrial-like [Pyrus 
x bretschneideri]
Length=676

 Score =   209 bits (532),  Expect = 6e-60, Method: Compositional matrix adjust.
 Identities = 100/135 (74%), Positives = 119/135 (88%), Gaps = 0/135 (0%)
 Frame = +1

Query  172  HPKDDAYLQSVIPKRISLFESIKsqqqlqrlslsPDPIKIELPNGSVKEGKKWNTTPLDI  351
            HPKDDAYL++VIPKRI LFE+I++QQ   R SL  DPIKI LP G  KEGK+W T+P DI
Sbjct  4    HPKDDAYLEAVIPKRIKLFEAIQAQQLAHRQSLPSDPIKITLPGGQEKEGKRWVTSPFDI  63

Query  352  AKELSKSLASNALISKVNGVLWDMSRPLEGDCKLELFTFDSDEGRDTFWHSSAHILGQSV  531
            AK++SKSLAS+A+I+KVNG LWDMSRPLEGDC+L+LF F+ DEGRDTFWHSSAHILGQ++
Sbjct  64   AKDISKSLASSAVIAKVNGDLWDMSRPLEGDCELKLFKFEDDEGRDTFWHSSAHILGQAL  123

Query  532  EMKYGCKLCIGPCTT  576
            E++YGCKLCIGPCTT
Sbjct  124  EVEYGCKLCIGPCTT  138



>ref|XP_010533069.1| PREDICTED: threonine--tRNA ligase, mitochondrial-like [Tarenaya 
hassleriana]
Length=714

 Score =   209 bits (531),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 99/135 (73%), Positives = 116/135 (86%), Gaps = 0/135 (0%)
 Frame = +1

Query  172  HPKDDAYLQSVIPKRISLFESIKsqqqlqrlslsPDPIKIELPNGSVKEGKKWNTTPLDI  351
            HPKD++YL +VIPKRI LFE I++ Q  Q  SL  DPIKI LP+GSV+EGK+W TTP+DI
Sbjct  43   HPKDESYLSAVIPKRIKLFEQIQALQLEQLQSLPQDPIKITLPDGSVREGKRWATTPMDI  102

Query  352  AKELSKSLASNALISKVNGVLWDMSRPLEGDCKLELFTFDSDEGRDTFWHSSAHILGQSV  531
            A  +SK LA+NALIS VN VLWDMSRPLEGDC LE+FTFDSD+GRDTFWHSSAHILG+++
Sbjct  103  ALGISKGLAANALISSVNDVLWDMSRPLEGDCNLEIFTFDSDKGRDTFWHSSAHILGEAL  162

Query  532  EMKYGCKLCIGPCTT  576
            E +YGCKLCIGPCTT
Sbjct  163  EQEYGCKLCIGPCTT  177



>ref|XP_004489863.1| PREDICTED: threonine--tRNA ligase, mitochondrial-like [Cicer 
arietinum]
Length=719

 Score =   208 bits (530),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 99/135 (73%), Positives = 123/135 (91%), Gaps = 0/135 (0%)
 Frame = +1

Query  172  HPKDDAYLQSVIPKRISLFESIKsqqqlqrlslsPDPIKIELPNGSVKEGKKWNTTPLDI  351
            H KD++YL + IPKR+ +FESI+++QQ++RLSLS DPIK+ LP+GSVKEGKKW TTPLD+
Sbjct  48   HAKDESYLAATIPKRVRIFESIQAEQQIRRLSLSADPIKVTLPDGSVKEGKKWQTTPLDV  107

Query  352  AKELSKSLASNALISKVNGVLWDMSRPLEGDCKLELFTFDSDEGRDTFWHSSAHILGQSV  531
            A+E+SK+LA+NALI+KVNGVLWDM+RPLE D +L++F FD DEGRDTFWHSSAHILGQS+
Sbjct  108  AREISKNLANNALIAKVNGVLWDMTRPLEEDSQLQIFRFDDDEGRDTFWHSSAHILGQSL  167

Query  532  EMKYGCKLCIGPCTT  576
            E +YGCKLCIGPCTT
Sbjct  168  ETEYGCKLCIGPCTT  182



>ref|XP_010913364.1| PREDICTED: threonine--tRNA ligase, mitochondrial [Elaeis guineensis]
Length=727

 Score =   208 bits (530),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 99/156 (63%), Positives = 128/156 (82%), Gaps = 0/156 (0%)
 Frame = +1

Query  109  LRPSQMGKADKssaannsaPDHPKDDAYLQSVIPKRISLFESIKsqqqlqrlslsPDPIK  288
            L  S MG++    A   + P   KD+AYL+++I KR+ LFE+I++QQ  +R  +  +PIK
Sbjct  35   LSVSAMGESRAGEAKGKAKPKASKDEAYLEAIIEKRVRLFEAIQAQQLTERQKVGGEPIK  94

Query  289  IELPNGSVKEGKKWNTTPLDIAKELSKSLASNALISKVNGVLWDMSRPLEGDCKLELFTF  468
            I LP+G+VKEGKKW T+P+DIAKE+S  LA++ALI++VNG LWDM+RPLEGDC+L+LF F
Sbjct  95   ITLPDGTVKEGKKWMTSPIDIAKEISSGLAASALIAQVNGTLWDMTRPLEGDCELKLFKF  154

Query  469  DSDEGRDTFWHSSAHILGQSVEMKYGCKLCIGPCTT  576
            DS+EGRDTFWHSSAHILGQSVEM++GCKLCIGPCTT
Sbjct  155  DSNEGRDTFWHSSAHILGQSVEMEFGCKLCIGPCTT  190



>ref|XP_002872240.1| AT5g26830/F2P16_90 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH48499.1| AT5g26830/F2P16_90 [Arabidopsis lyrata subsp. lyrata]
Length=713

 Score =   208 bits (529),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 98/136 (72%), Positives = 116/136 (85%), Gaps = 0/136 (0%)
 Frame = +1

Query  169  DHPKDDAYLQSVIPKRISLFESIKsqqqlqrlslsPDPIKIELPNGSVKEGKKWNTTPLD  348
            +HPKD+AYL +VIPKRI LFE I++ Q     SL  DPIKI LP+G+VKEGKKW TTP+D
Sbjct  41   NHPKDEAYLSAVIPKRIRLFEQIQANQLENLKSLPHDPIKITLPDGNVKEGKKWETTPID  100

Query  349  IAKELSKSLASNALISKVNGVLWDMSRPLEGDCKLELFTFDSDEGRDTFWHSSAHILGQS  528
            IA ++SK LA++ALIS V+ VLWDMSRPLEGDCKLELF FDSD+GRDT WHSSAHILGQ+
Sbjct  101  IAAQISKGLANSALISAVDDVLWDMSRPLEGDCKLELFKFDSDKGRDTLWHSSAHILGQA  160

Query  529  VEMKYGCKLCIGPCTT  576
            +E +YGC+LCIGPCTT
Sbjct  161  LEQEYGCQLCIGPCTT  176



>gb|KHN00337.1| Threonine--tRNA ligase, mitochondrial [Glycine soja]
Length=725

 Score =   208 bits (529),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 100/133 (75%), Positives = 121/133 (91%), Gaps = 0/133 (0%)
 Frame = +1

Query  178  KDDAYLQSVIPKRISLFESIKsqqqlqrlslsPDPIKIELPNGSVKEGKKWNTTPLDIAK  357
            KD+AYL + IPKRI LFE+I ++Q  QRLSLSPDPIK+ LP+GSVKE KKW+TTPLD+A+
Sbjct  44   KDEAYLSATIPKRIRLFETILAEQHTQRLSLSPDPIKVTLPDGSVKEAKKWHTTPLDVAR  103

Query  358  ELSKSLASNALISKVNGVLWDMSRPLEGDCKLELFTFDSDEGRDTFWHSSAHILGQSVEM  537
            E+SK+LA++ALI+KVNGVLWDM+RPLE DC+L++F FD DEGRDTFWHSSAHILGQS+E 
Sbjct  104  EISKNLANSALIAKVNGVLWDMTRPLEDDCQLQIFKFDDDEGRDTFWHSSAHILGQSLET  163

Query  538  KYGCKLCIGPCTT  576
            +YGCKLCIGPCTT
Sbjct  164  EYGCKLCIGPCTT  176



>ref|XP_004296467.2| PREDICTED: threonine--tRNA ligase, mitochondrial [Fragaria vesca 
subsp. vesca]
Length=732

 Score =   208 bits (529),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 100/135 (74%), Positives = 115/135 (85%), Gaps = 0/135 (0%)
 Frame = +1

Query  172  HPKDDAYLQSVIPKRISLFESIKsqqqlqrlslsPDPIKIELPNGSVKEGKKWNTTPLDI  351
            HPKD AYL +V+PKRI LF  I +QQ  +R +L  DPIKI LP+G VKEGKKW T+P DI
Sbjct  60   HPKDGAYLTTVVPKRIGLFMKIHAQQHGERQALPSDPIKITLPDGKVKEGKKWVTSPFDI  119

Query  352  AKELSKSLASNALISKVNGVLWDMSRPLEGDCKLELFTFDSDEGRDTFWHSSAHILGQSV  531
            AKE+SK LASNALIS VNG LWDM+RPLEGDC+L+LFTFD DEGRDTFWHSSAHILG+++
Sbjct  120  AKEISKGLASNALISGVNGQLWDMTRPLEGDCELKLFTFDDDEGRDTFWHSSAHILGEAL  179

Query  532  EMKYGCKLCIGPCTT  576
            E +YGCKLCIGPCTT
Sbjct  180  EAEYGCKLCIGPCTT  194



>ref|XP_007225203.1| hypothetical protein PRUPE_ppa002055mg [Prunus persica]
 gb|EMJ26402.1| hypothetical protein PRUPE_ppa002055mg [Prunus persica]
Length=724

 Score =   207 bits (528),  Expect = 4e-59, Method: Compositional matrix adjust.
 Identities = 98/135 (73%), Positives = 117/135 (87%), Gaps = 0/135 (0%)
 Frame = +1

Query  172  HPKDDAYLQSVIPKRISLFESIKsqqqlqrlslsPDPIKIELPNGSVKEGKKWNTTPLDI  351
            HPKDDAYL +VIPKRI LFE+I++QQ+    SL  DPIKI LP G  KEGK+W T+P DI
Sbjct  52   HPKDDAYLATVIPKRIKLFEAIQAQQRAHLQSLPSDPIKITLPGGQEKEGKRWITSPFDI  111

Query  352  AKELSKSLASNALISKVNGVLWDMSRPLEGDCKLELFTFDSDEGRDTFWHSSAHILGQSV  531
            A+E+SKSLASNALIS+VNGVLWDM+RPLEGDC L++F F+ + GRDTFWHSSAHILGQ++
Sbjct  112  AREISKSLASNALISEVNGVLWDMNRPLEGDCTLKIFKFEDEVGRDTFWHSSAHILGQAL  171

Query  532  EMKYGCKLCIGPCTT  576
            E++YGCKLCIGPCTT
Sbjct  172  EVEYGCKLCIGPCTT  186



>ref|XP_008221771.1| PREDICTED: threonine--tRNA ligase, mitochondrial-like [Prunus 
mume]
Length=721

 Score =   207 bits (528),  Expect = 4e-59, Method: Compositional matrix adjust.
 Identities = 98/135 (73%), Positives = 116/135 (86%), Gaps = 0/135 (0%)
 Frame = +1

Query  172  HPKDDAYLQSVIPKRISLFESIKsqqqlqrlslsPDPIKIELPNGSVKEGKKWNTTPLDI  351
            HPKDD YL +VIPKRI LFE+I++QQ+    SL  DPIKI LP G  KEGK+W T+P DI
Sbjct  49   HPKDDTYLAAVIPKRIKLFEAIQAQQRAHLQSLPSDPIKITLPGGQEKEGKRWITSPFDI  108

Query  352  AKELSKSLASNALISKVNGVLWDMSRPLEGDCKLELFTFDSDEGRDTFWHSSAHILGQSV  531
            A+E+SKSLASNALIS+VNGVLWDM+RPLEGDC L++F F+ D GRDTFWHSSAHILGQ++
Sbjct  109  AREISKSLASNALISEVNGVLWDMNRPLEGDCTLKIFKFEDDVGRDTFWHSSAHILGQAL  168

Query  532  EMKYGCKLCIGPCTT  576
            E++YGCKLCIGPCTT
Sbjct  169  EVEYGCKLCIGPCTT  183



>emb|CAA74705.1| threonyl-tRNA synthetase [Arabidopsis thaliana]
Length=709

 Score =   207 bits (526),  Expect = 6e-59, Method: Compositional matrix adjust.
 Identities = 96/136 (71%), Positives = 116/136 (85%), Gaps = 0/136 (0%)
 Frame = +1

Query  169  DHPKDDAYLQSVIPKRISLFESIKsqqqlqrlslsPDPIKIELPNGSVKEGKKWNTTPLD  348
            +HPKD+AYL +VIPKRI LFE I++ Q     SL  DPIK+ LP+G+VKEGKKW TTP+D
Sbjct  37   NHPKDEAYLSAVIPKRIKLFEQIQANQLENLKSLPHDPIKVTLPDGNVKEGKKWETTPMD  96

Query  349  IAKELSKSLASNALISKVNGVLWDMSRPLEGDCKLELFTFDSDEGRDTFWHSSAHILGQS  528
            IA ++SK LA++ALIS V+ VLWDM+RPLEGDCKLELF FDSD+GRDT WHSSAHILGQ+
Sbjct  97   IAAQISKGLANSALISAVDDVLWDMNRPLEGDCKLELFKFDSDKGRDTLWHSSAHILGQA  156

Query  529  VEMKYGCKLCIGPCTT  576
            +E +YGC+LCIGPCTT
Sbjct  157  LEQEYGCQLCIGPCTT  172



>ref|NP_198035.2| threonyl-tRNA synthetase [Arabidopsis thaliana]
 sp|O04630.3|SYTM_ARATH RecName: Full=Threonine--tRNA ligase, mitochondrial; AltName: 
Full=Threonyl-tRNA synthetase; Short=ThrRS; Flags: Precursor 
[Arabidopsis thaliana]
 gb|AED93610.1| threonyl-tRNA synthetase [Arabidopsis thaliana]
Length=709

 Score =   207 bits (526),  Expect = 6e-59, Method: Compositional matrix adjust.
 Identities = 96/136 (71%), Positives = 116/136 (85%), Gaps = 0/136 (0%)
 Frame = +1

Query  169  DHPKDDAYLQSVIPKRISLFESIKsqqqlqrlslsPDPIKIELPNGSVKEGKKWNTTPLD  348
            +HPKD+AYL +VIPKRI LFE I++ Q     SL  DPIK+ LP+G+VKEGKKW TTP+D
Sbjct  37   NHPKDEAYLSAVIPKRIKLFEQIQANQLENLKSLPHDPIKVTLPDGNVKEGKKWETTPMD  96

Query  349  IAKELSKSLASNALISKVNGVLWDMSRPLEGDCKLELFTFDSDEGRDTFWHSSAHILGQS  528
            IA ++SK LA++ALIS V+ VLWDM+RPLEGDCKLELF FDSD+GRDT WHSSAHILGQ+
Sbjct  97   IAAQISKGLANSALISAVDDVLWDMNRPLEGDCKLELFKFDSDKGRDTLWHSSAHILGQA  156

Query  529  VEMKYGCKLCIGPCTT  576
            +E +YGC+LCIGPCTT
Sbjct  157  LEQEYGCQLCIGPCTT  172



>ref|XP_006836673.1| hypothetical protein AMTR_s00088p00069780 [Amborella trichopoda]
 gb|ERM99526.1| hypothetical protein AMTR_s00088p00069780 [Amborella trichopoda]
Length=723

 Score =   207 bits (526),  Expect = 7e-59, Method: Compositional matrix adjust.
 Identities = 100/135 (74%), Positives = 116/135 (86%), Gaps = 0/135 (0%)
 Frame = +1

Query  172  HPKDDAYLQSVIPKRISLFESIKsqqqlqrlslsPDPIKIELPNGSVKEGKKWNTTPLDI  351
            H KD+AYLQ+VI KRISLFE IK++Q   R ++  + IKI LP G VKEGKK  T+P+DI
Sbjct  52   HKKDEAYLQAVIQKRISLFEKIKAEQLAHRQAIGGEKIKITLPGGKVKEGKKLITSPMDI  111

Query  352  AKELSKSLASNALISKVNGVLWDMSRPLEGDCKLELFTFDSDEGRDTFWHSSAHILGQSV  531
            AKE+SKSLA NALIS+VNG LWDMSRPLE DC+L+L+TFDS EGRDTFWHSSAHILGQS+
Sbjct  112  AKEISKSLAGNALISQVNGTLWDMSRPLEEDCELKLYTFDSHEGRDTFWHSSAHILGQSL  171

Query  532  EMKYGCKLCIGPCTT  576
            EM+YGCKLCIGPCTT
Sbjct  172  EMEYGCKLCIGPCTT  186



>ref|XP_003517788.1| PREDICTED: threonine--tRNA ligase, mitochondrial-like [Glycine 
max]
Length=717

 Score =   207 bits (526),  Expect = 8e-59, Method: Compositional matrix adjust.
 Identities = 97/135 (72%), Positives = 123/135 (91%), Gaps = 0/135 (0%)
 Frame = +1

Query  172  HPKDDAYLQSVIPKRISLFESIKsqqqlqrlslsPDPIKIELPNGSVKEGKKWNTTPLDI  351
            H KD+AYL + IPKR+ LFE+I+++Q+ QRLSLSPDPIK+ LP+G+VK+ KKW +TPLD+
Sbjct  46   HAKDEAYLSAAIPKRVRLFETIQAEQRTQRLSLSPDPIKVTLPDGNVKDAKKWLSTPLDV  105

Query  352  AKELSKSLASNALISKVNGVLWDMSRPLEGDCKLELFTFDSDEGRDTFWHSSAHILGQSV  531
            A+E+SK+LA++ALI+KVNGVLWDM+RPLE DC+L++F FD DEGRDTFWHSSAHILGQS+
Sbjct  106  AREISKNLANSALIAKVNGVLWDMTRPLEDDCQLQIFKFDDDEGRDTFWHSSAHILGQSL  165

Query  532  EMKYGCKLCIGPCTT  576
            E +YGCKLCIGPCTT
Sbjct  166  ETEYGCKLCIGPCTT  180



>ref|XP_010455043.1| PREDICTED: threonine--tRNA ligase, mitochondrial [Camelina sativa]
Length=716

 Score =   206 bits (525),  Expect = 8e-59, Method: Compositional matrix adjust.
 Identities = 96/136 (71%), Positives = 117/136 (86%), Gaps = 0/136 (0%)
 Frame = +1

Query  169  DHPKDDAYLQSVIPKRISLFESIKsqqqlqrlslsPDPIKIELPNGSVKEGKKWNTTPLD  348
            +HPKD+AYL +VIPKRI +FE I++ Q  +  SL  DPIKI LP+G+VKEG+KW TTP+D
Sbjct  44   NHPKDEAYLSAVIPKRIKIFEQIQANQLEKLKSLPHDPIKITLPDGNVKEGRKWETTPMD  103

Query  349  IAKELSKSLASNALISKVNGVLWDMSRPLEGDCKLELFTFDSDEGRDTFWHSSAHILGQS  528
            IA ++SK LA++ALIS V+ VLWDMSRPLEGDCKLELF FDSD+GRDT WHSSAHILGQ+
Sbjct  104  IAAQISKGLANSALISAVDDVLWDMSRPLEGDCKLELFKFDSDKGRDTLWHSSAHILGQA  163

Query  529  VEMKYGCKLCIGPCTT  576
            +E +YGC+LCIGPCTT
Sbjct  164  LEQEYGCQLCIGPCTT  179



>ref|XP_006378416.1| Threonyl-tRNA synthetase family protein [Populus trichocarpa]
 gb|ERP56213.1| Threonyl-tRNA synthetase family protein [Populus trichocarpa]
Length=696

 Score =   206 bits (524),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 95/135 (70%), Positives = 120/135 (89%), Gaps = 0/135 (0%)
 Frame = +1

Query  172  HPKDDAYLQSVIPKRISLFESIKsqqqlqrlslsPDPIKIELPNGSVKEGKKWNTTPLDI  351
            H KD+ YL +VIPKRI LF+SI+S+Q  +  SL  D IKI LP+G+VKEGK+W+++P+DI
Sbjct  45   HQKDEGYLNTVIPKRIQLFQSIQSEQLSRIQSLPHDSIKITLPDGTVKEGKRWHSSPMDI  104

Query  352  AKELSKSLASNALISKVNGVLWDMSRPLEGDCKLELFTFDSDEGRDTFWHSSAHILGQSV  531
            AKE+ KS+A+NALIS+VNGVLWDM+RPLE DC+L++F F+SDEGRDTFWHSSAHILGQ++
Sbjct  105  AKEIGKSVAANALISQVNGVLWDMNRPLEDDCELKIFNFESDEGRDTFWHSSAHILGQAL  164

Query  532  EMKYGCKLCIGPCTT  576
            EM+YGCKLCIGPCTT
Sbjct  165  EMEYGCKLCIGPCTT  179



>ref|XP_010493938.1| PREDICTED: threonine--tRNA ligase, mitochondrial-like [Camelina 
sativa]
Length=712

 Score =   206 bits (523),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 95/136 (70%), Positives = 117/136 (86%), Gaps = 0/136 (0%)
 Frame = +1

Query  169  DHPKDDAYLQSVIPKRISLFESIKsqqqlqrlslsPDPIKIELPNGSVKEGKKWNTTPLD  348
            +HPKD+AYL +VIPKRI +FE I++ Q  +  SL  DPIKI LP+G+VKEG+KW TTP+D
Sbjct  40   NHPKDEAYLSAVIPKRIKIFEQIQANQLEKLKSLPHDPIKITLPDGNVKEGRKWETTPMD  99

Query  349  IAKELSKSLASNALISKVNGVLWDMSRPLEGDCKLELFTFDSDEGRDTFWHSSAHILGQS  528
            IA ++SK LA++ALIS V+ VLWDM+RPLEGDCKLELF FDSD+GRDT WHSSAHILGQ+
Sbjct  100  IAAQISKGLANSALISAVDDVLWDMTRPLEGDCKLELFKFDSDKGRDTLWHSSAHILGQA  159

Query  529  VEMKYGCKLCIGPCTT  576
            +E +YGC+LCIGPCTT
Sbjct  160  LEQEYGCQLCIGPCTT  175



>gb|AAK82468.1| AT5g26830/F2P16_90 [Arabidopsis thaliana]
 gb|AAO64760.1| At5g26830/F2P16_90 [Arabidopsis thaliana]
Length=676

 Score =   205 bits (521),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 95/136 (70%), Positives = 116/136 (85%), Gaps = 0/136 (0%)
 Frame = +1

Query  169  DHPKDDAYLQSVIPKRISLFESIKsqqqlqrlslsPDPIKIELPNGSVKEGKKWNTTPLD  348
            +HPKD+AYL +VIPKRI LFE I++ Q     SL  DPIK+ LP+G+VKEGKKW TTP+D
Sbjct  4    NHPKDEAYLSAVIPKRIKLFEQIQANQLENLKSLPHDPIKVTLPDGNVKEGKKWETTPMD  63

Query  349  IAKELSKSLASNALISKVNGVLWDMSRPLEGDCKLELFTFDSDEGRDTFWHSSAHILGQS  528
            IA ++SK LA++ALIS V+ VLWD++RPLEGDCKLELF FDSD+GRDT WHSSAHILGQ+
Sbjct  64   IAAQISKGLANSALISAVDDVLWDVNRPLEGDCKLELFKFDSDKGRDTLWHSSAHILGQA  123

Query  529  VEMKYGCKLCIGPCTT  576
            +E +YGC+LCIGPCTT
Sbjct  124  LEQEYGCQLCIGPCTT  139



>ref|XP_008340003.1| PREDICTED: threonine--tRNA ligase, mitochondrial-like [Malus 
domestica]
Length=676

 Score =   205 bits (521),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 98/135 (73%), Positives = 118/135 (87%), Gaps = 0/135 (0%)
 Frame = +1

Query  172  HPKDDAYLQSVIPKRISLFESIKsqqqlqrlslsPDPIKIELPNGSVKEGKKWNTTPLDI  351
            HPKDDAYL++VIPKRI LFE+I++QQ   R SL  DPIKI LP G  KEGK+W T+P DI
Sbjct  4    HPKDDAYLEAVIPKRIKLFEAIQAQQLAHRQSLPSDPIKITLPGGQEKEGKRWVTSPFDI  63

Query  352  AKELSKSLASNALISKVNGVLWDMSRPLEGDCKLELFTFDSDEGRDTFWHSSAHILGQSV  531
            AK++SKSLAS+A+I+KVNG LWDM+RPLE DC+L+LF F+ DEGRDTFWHSSAHILGQ++
Sbjct  64   AKDISKSLASSAVIAKVNGDLWDMARPLEFDCELKLFKFEDDEGRDTFWHSSAHILGQAL  123

Query  532  EMKYGCKLCIGPCTT  576
            E++YGCKLCIGPCTT
Sbjct  124  EVEYGCKLCIGPCTT  138



>ref|XP_010688668.1| PREDICTED: threonine--tRNA ligase, mitochondrial [Beta vulgaris 
subsp. vulgaris]
Length=688

 Score =   205 bits (521),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 100/133 (75%), Positives = 117/133 (88%), Gaps = 0/133 (0%)
 Frame = +1

Query  178  KDDAYLQSVIPKRISLFESIKsqqqlqrlslsPDPIKIELPNGSVKEGKKWNTTPLDIAK  357
            KD+AYL SVIPKRISLFESIK++Q L  LS+S + IKI LP+G+VKEGKKW TTP +IA 
Sbjct  19   KDEAYLTSVIPKRISLFESIKAEQALHHLSISGESIKITLPDGNVKEGKKWITTPFEIAA  78

Query  358  ELSKSLASNALISKVNGVLWDMSRPLEGDCKLELFTFDSDEGRDTFWHSSAHILGQSVEM  537
            ++SK LASNA+IS+VNG LWDM+RP EGDC L+L+TFD DEGRDTFWHSSAHILGQ++EM
Sbjct  79   QISKKLASNAVISRVNGDLWDMNRPFEGDCDLKLYTFDDDEGRDTFWHSSAHILGQALEM  138

Query  538  KYGCKLCIGPCTT  576
             YGCKLCIGPCTT
Sbjct  139  TYGCKLCIGPCTT  151



>ref|XP_010551550.1| PREDICTED: threonine--tRNA ligase, mitochondrial-like [Tarenaya 
hassleriana]
Length=717

 Score =   205 bits (521),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 98/135 (73%), Positives = 115/135 (85%), Gaps = 0/135 (0%)
 Frame = +1

Query  172  HPKDDAYLQSVIPKRISLFESIKsqqqlqrlslsPDPIKIELPNGSVKEGKKWNTTPLDI  351
            HPKD+AYL +VIPKRI LFE I++QQ  Q  SL  D IKI LP+GS +EGK+W TTP++I
Sbjct  46   HPKDEAYLSAVIPKRIKLFEQIQAQQLEQLQSLPHDAIKITLPDGSAREGKRWATTPMEI  105

Query  352  AKELSKSLASNALISKVNGVLWDMSRPLEGDCKLELFTFDSDEGRDTFWHSSAHILGQSV  531
            A  +SK LA+NALIS VN VLWDM+RPLEGDC LE+FTFDSD+GRDTFWHSSAHILGQ++
Sbjct  106  ALGISKGLAANALISSVNDVLWDMTRPLEGDCNLEIFTFDSDKGRDTFWHSSAHILGQAL  165

Query  532  EMKYGCKLCIGPCTT  576
            E +YGCKLCIGPCTT
Sbjct  166  EQEYGCKLCIGPCTT  180



>emb|CDX80596.1| BnaC07g28480D [Brassica napus]
Length=714

 Score =   205 bits (521),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 104/167 (62%), Positives = 126/167 (75%), Gaps = 6/167 (4%)
 Frame = +1

Query  94   IRRFSLR------PSQMGKADKssaannsaPDHPKDDAYLQSVIPKRISLFESIKsqqql  255
            IRRF+        PS++          + A  + K++AYL +VIPKRI+LFE I++ Q  
Sbjct  10   IRRFTASHSVSPPPSRLASLSSFRTVPSMAASNQKNEAYLSAVIPKRITLFEQIQADQLE  69

Query  256  qrlslsPDPIKIELPNGSVKEGKKWNTTPLDIAKELSKSLASNALISKVNGVLWDMSRPL  435
            +  SL  DPIKI LP+GSVKEGKKW TTP+DIA ++SK LA++ALIS VN  LWDMSRPL
Sbjct  70   KLKSLPHDPIKITLPDGSVKEGKKWETTPMDIAAQISKGLANSALISSVNDELWDMSRPL  129

Query  436  EGDCKLELFTFDSDEGRDTFWHSSAHILGQSVEMKYGCKLCIGPCTT  576
            EGDCKLELF FDSD+GRDT WHSSAHILGQ++E +YGCKLCIGPCTT
Sbjct  130  EGDCKLELFKFDSDKGRDTLWHSSAHILGQAIEQEYGCKLCIGPCTT  176



>gb|KFK26446.1| hypothetical protein AALP_AA8G249500 [Arabis alpina]
Length=714

 Score =   205 bits (521),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 94/136 (69%), Positives = 115/136 (85%), Gaps = 0/136 (0%)
 Frame = +1

Query  169  DHPKDDAYLQSVIPKRISLFESIKsqqqlqrlslsPDPIKIELPNGSVKEGKKWNTTPLD  348
            +HPKD+AYL SVIPKRI LFE I+  Q     +L  DPIKI LP+G+VK+G+KW TTP+D
Sbjct  42   NHPKDEAYLSSVIPKRIKLFEEIQVNQLEYLRALPHDPIKITLPDGTVKDGRKWETTPMD  101

Query  349  IAKELSKSLASNALISKVNGVLWDMSRPLEGDCKLELFTFDSDEGRDTFWHSSAHILGQS  528
            IA ++SK LA++ALIS+VN  LWDM+RPLEGDCKL+LF FDSD+GRDT WHSSAHILGQ+
Sbjct  102  IAGQISKGLATSALISEVNDALWDMTRPLEGDCKLQLFKFDSDKGRDTLWHSSAHILGQA  161

Query  529  VEMKYGCKLCIGPCTT  576
            +E +YGC+LCIGPCTT
Sbjct  162  LEQEYGCQLCIGPCTT  177



>ref|XP_008802022.1| PREDICTED: threonine--tRNA ligase, mitochondrial [Phoenix dactylifera]
Length=727

 Score =   204 bits (520),  Expect = 5e-58, Method: Compositional matrix adjust.
 Identities = 97/153 (63%), Positives = 125/153 (82%), Gaps = 0/153 (0%)
 Frame = +1

Query  118  SQMGKADKssaannsaPDHPKDDAYLQSVIPKRISLFESIKsqqqlqrlslsPDPIKIEL  297
            S MG++        + P   KDDAYL+++I KRI +FESI++QQ  +R  +S +PIKI L
Sbjct  38   SAMGESRAGEVKGKAKPKASKDDAYLEAIIEKRIRMFESIQAQQLAERQKISGEPIKITL  97

Query  298  PNGSVKEGKKWNTTPLDIAKELSKSLASNALISKVNGVLWDMSRPLEGDCKLELFTFDSD  477
            P+G+ KEGKKW T+P+DIA+ +S  LA++ALI++VNG LWDM+RPLEGDC+L+LF FDS+
Sbjct  98   PDGTTKEGKKWMTSPIDIAQGISSGLAASALIAQVNGTLWDMTRPLEGDCELKLFKFDSN  157

Query  478  EGRDTFWHSSAHILGQSVEMKYGCKLCIGPCTT  576
            EGRDTFWHSSAHILGQSVEM++GCKLCIGPCTT
Sbjct  158  EGRDTFWHSSAHILGQSVEMEFGCKLCIGPCTT  190



>ref|XP_011021655.1| PREDICTED: threonine--tRNA ligase, mitochondrial-like [Populus 
euphratica]
Length=678

 Score =   203 bits (517),  Expect = 9e-58, Method: Compositional matrix adjust.
 Identities = 94/135 (70%), Positives = 118/135 (87%), Gaps = 0/135 (0%)
 Frame = +1

Query  172  HPKDDAYLQSVIPKRISLFESIKsqqqlqrlslsPDPIKIELPNGSVKEGKKWNTTPLDI  351
            H KD+ YL +VIPKRI LF+SI+S+Q  +  SL  D IKI LP+G+VK GK+W ++P+DI
Sbjct  7    HQKDEGYLNTVIPKRIQLFQSIQSEQLSRIQSLPHDSIKITLPDGTVKVGKRWQSSPMDI  66

Query  352  AKELSKSLASNALISKVNGVLWDMSRPLEGDCKLELFTFDSDEGRDTFWHSSAHILGQSV  531
            AKE+ KS+A+NALIS+VNGVLWDM+RPLE DC+L++F F+SDEGRDTFWHSSAHILGQ++
Sbjct  67   AKEIGKSVAANALISQVNGVLWDMNRPLEDDCELKIFNFESDEGRDTFWHSSAHILGQAL  126

Query  532  EMKYGCKLCIGPCTT  576
            EM+YGCKLCIGPCTT
Sbjct  127  EMEYGCKLCIGPCTT  141



>ref|XP_009151164.1| PREDICTED: threonine--tRNA ligase, mitochondrial-like [Brassica 
rapa]
 emb|CDX88245.1| BnaA06g28360D [Brassica napus]
Length=718

 Score =   203 bits (516),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 97/133 (73%), Positives = 114/133 (86%), Gaps = 0/133 (0%)
 Frame = +1

Query  178  KDDAYLQSVIPKRISLFESIKsqqqlqrlslsPDPIKIELPNGSVKEGKKWNTTPLDIAK  357
            K++AYL +VIPKRI+LFE I++ Q  +  SL  DPIKI LP+GSVKEGKKW TTP+DIA 
Sbjct  48   KNEAYLSAVIPKRITLFEQIQADQLEKLKSLPHDPIKITLPDGSVKEGKKWETTPMDIAA  107

Query  358  ELSKSLASNALISKVNGVLWDMSRPLEGDCKLELFTFDSDEGRDTFWHSSAHILGQSVEM  537
            ++SK LA++ALIS VN  LWDMSRPLEGDCKLELF FDSD+GRDT WHSSAHILGQ++E 
Sbjct  108  QISKGLANSALISSVNDELWDMSRPLEGDCKLELFKFDSDKGRDTLWHSSAHILGQAIEQ  167

Query  538  KYGCKLCIGPCTT  576
            +YGCKLCIGPCTT
Sbjct  168  EYGCKLCIGPCTT  180



>gb|KJB48102.1| hypothetical protein B456_008G053600 [Gossypium raimondii]
Length=714

 Score =   202 bits (515),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 121/192 (63%), Positives = 140/192 (73%), Gaps = 20/192 (10%)
 Frame = +1

Query  16   MVCATSQLLWRLISFRHPP-----SPSNSIFIRRFSLRPSQMGKADKssaannsaPDHPK  180
            M+CA S  L R  SF HP       PS S  +R FS              A   A  HPK
Sbjct  1    MLCALSFALRRYYSF-HPALFLLSKPSFSSPLRLFS--------------AFTMASSHPK  45

Query  181  DDAYLQSVIPKRISLFESIKsqqqlqrlslsPDPIKIELPNGSVKEGKKWNTTPLDIAKE  360
            D+AYL  VI KRI LF+S++SQQQ   LSL  DP+K+ LP+GSVKEGKKW +TP+DIA+ 
Sbjct  46   DEAYLNQVIKKRIKLFQSLQSQQQSHLLSLPHDPLKVTLPDGSVKEGKKWVSTPMDIAQG  105

Query  361  LSKSLASNALISKVNGVLWDMSRPLEGDCKLELFTFDSDEGRDTFWHSSAHILGQSVEMK  540
            +SKSLA+NALIS VNGVLWDM+RPLEGDC+L++FTFDSDEGRDTFWHSSAHILGQS+E  
Sbjct  106  ISKSLAANALISSVNGVLWDMNRPLEGDCELKIFTFDSDEGRDTFWHSSAHILGQSLESI  165

Query  541  YGCKLCIGPCTT  576
            YGCKLCIGPCTT
Sbjct  166  YGCKLCIGPCTT  177



>emb|CDX87030.1| BnaC09g03450D [Brassica napus]
Length=719

 Score =   202 bits (515),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 96/135 (71%), Positives = 114/135 (84%), Gaps = 0/135 (0%)
 Frame = +1

Query  172  HPKDDAYLQSVIPKRISLFESIKsqqqlqrlslsPDPIKIELPNGSVKEGKKWNTTPLDI  351
            HPK+++YL +VIPKRI LFE I+S Q  +  SL  DPIKI LP+G+VKEG+KW TTP+DI
Sbjct  38   HPKNESYLSAVIPKRIKLFEQIQSHQLEKLKSLPHDPIKITLPDGTVKEGRKWETTPMDI  97

Query  352  AKELSKSLASNALISKVNGVLWDMSRPLEGDCKLELFTFDSDEGRDTFWHSSAHILGQSV  531
            A E+SK LA+ ALIS VN  LWDMSRPLEGDCKLELF FDSD+GRDT WHSSAH+LGQ++
Sbjct  98   AGEISKGLANAALISSVNDELWDMSRPLEGDCKLELFKFDSDKGRDTLWHSSAHVLGQAL  157

Query  532  EMKYGCKLCIGPCTT  576
            E +YGC+LCIGPCTT
Sbjct  158  EQEYGCQLCIGPCTT  172



>dbj|BAC41894.1| unknown protein [Arabidopsis thaliana]
Length=186

 Score =   190 bits (482),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 91/134 (68%), Positives = 111/134 (83%), Gaps = 1/134 (1%)
 Frame = +1

Query  172  HPKDDAYLQSVIPKRISLFESIKsqqqlqrlslsPDPIKIEL-PNGSVKEGKKWNTTPLD  348
            HPKD+AYL SVIPKRI LFE I+++Q  Q  S   DPIKI L P+G  KEG++W T+P+D
Sbjct  6    HPKDEAYLSSVIPKRIRLFEEIQAEQLEQLQSRPHDPIKITLLPDGIEKEGRRWETSPMD  65

Query  349  IAKELSKSLASNALISKVNGVLWDMSRPLEGDCKLELFTFDSDEGRDTFWHSSAHILGQS  528
            IA ++SK LA +AL+S VN VLWDM+RPLEGDC LE+F FDSD+GR+TFWHSSAHILGQ+
Sbjct  66   IAVQISKGLAKSALVSSVNHVLWDMNRPLEGDCSLEIFGFDSDQGRNTFWHSSAHILGQA  125

Query  529  VEMKYGCKLCIGPC  570
            +E +YGCKLCIGPC
Sbjct  126  LEQEYGCKLCIGPC  139



>ref|XP_007044584.1| Threonyl-tRNA synthetase isoform 3 [Theobroma cacao]
 gb|EOY00416.1| Threonyl-tRNA synthetase isoform 3 [Theobroma cacao]
Length=686

 Score =   201 bits (512),  Expect = 5e-57, Method: Compositional matrix adjust.
 Identities = 113/187 (60%), Positives = 139/187 (74%), Gaps = 9/187 (5%)
 Frame = +1

Query  16   MVCATSQLLWRLISFRHPPSPSNSIFIRRFSLRPSQMGKADKssaannsaPDHPKDDAYL  195
            M+C  S  L R IS   P S   ++F+       S+   + +  +A   A  HPKD+AYL
Sbjct  1    MLCTLSSTLRRSIS---PSSSQPALFLL------SKPSSSLRLFSALTMASSHPKDEAYL  51

Query  196  QSVIPKRISLFESIKsqqqlqrlslsPDPIKIELPNGSVKEGKKWNTTPLDIAKELSKSL  375
              VI KRI +F+S++SQQQ    SL  +PIKI LP+GSVKEGK W ++P+DIA+ +SKSL
Sbjct  52   NQVIEKRIKIFQSLQSQQQSHLQSLPHEPIKITLPDGSVKEGKTWVSSPMDIAQGISKSL  111

Query  376  ASNALISKVNGVLWDMSRPLEGDCKLELFTFDSDEGRDTFWHSSAHILGQSVEMKYGCKL  555
            A+NALIS VNGVLWDM+RPLEGDC+L++FTFDSDEGRDTFWHSSAHILGQS+E  YGCKL
Sbjct  112  AANALISSVNGVLWDMNRPLEGDCELKIFTFDSDEGRDTFWHSSAHILGQSLESIYGCKL  171

Query  556  CIGPCTT  576
            CIGPCTT
Sbjct  172  CIGPCTT  178



>ref|XP_009111770.1| PREDICTED: threonine--tRNA ligase, mitochondrial [Brassica rapa]
Length=707

 Score =   201 bits (512),  Expect = 5e-57, Method: Compositional matrix adjust.
 Identities = 98/161 (61%), Positives = 123/161 (76%), Gaps = 0/161 (0%)
 Frame = +1

Query  94   IRRFSLRPSQMGKADKssaannsaPDHPKDDAYLQSVIPKRISLFESIKsqqqlqrlsls  273
            I R++  PS++            + +HPK+++YL +VIPKRI LFE I+S Q  +  SL 
Sbjct  10   ISRYASPPSRLASTSSFCTLPTMSTNHPKNESYLSAVIPKRIKLFEQIQSHQLEKLKSLP  69

Query  274  PDPIKIELPNGSVKEGKKWNTTPLDIAKELSKSLASNALISKVNGVLWDMSRPLEGDCKL  453
             DPIKI LP+G+VKEG+KW TTP+DIA E+ K LA++ALIS VN  LWDMSR LEGDCKL
Sbjct  70   HDPIKITLPDGTVKEGRKWETTPMDIAGEILKGLANSALISSVNDELWDMSRVLEGDCKL  129

Query  454  ELFTFDSDEGRDTFWHSSAHILGQSVEMKYGCKLCIGPCTT  576
            ELF FDSD+GRDT WHSSAH+LGQ++E +YGC+LCIGPCTT
Sbjct  130  ELFKFDSDKGRDTLWHSSAHVLGQALEQEYGCQLCIGPCTT  170



>ref|XP_007044582.1| Threonyl-tRNA synthetase isoform 1 [Theobroma cacao]
 gb|EOY00414.1| Threonyl-tRNA synthetase isoform 1 [Theobroma cacao]
Length=715

 Score =   202 bits (513),  Expect = 5e-57, Method: Compositional matrix adjust.
 Identities = 113/187 (60%), Positives = 139/187 (74%), Gaps = 9/187 (5%)
 Frame = +1

Query  16   MVCATSQLLWRLISFRHPPSPSNSIFIRRFSLRPSQMGKADKssaannsaPDHPKDDAYL  195
            M+C  S  L R IS   P S   ++F+       S+   + +  +A   A  HPKD+AYL
Sbjct  1    MLCTLSSTLRRSIS---PSSSQPALFLL------SKPSSSLRLFSALTMASSHPKDEAYL  51

Query  196  QSVIPKRISLFESIKsqqqlqrlslsPDPIKIELPNGSVKEGKKWNTTPLDIAKELSKSL  375
              VI KRI +F+S++SQQQ    SL  +PIKI LP+GSVKEGK W ++P+DIA+ +SKSL
Sbjct  52   NQVIEKRIKIFQSLQSQQQSHLQSLPHEPIKITLPDGSVKEGKTWVSSPMDIAQGISKSL  111

Query  376  ASNALISKVNGVLWDMSRPLEGDCKLELFTFDSDEGRDTFWHSSAHILGQSVEMKYGCKL  555
            A+NALIS VNGVLWDM+RPLEGDC+L++FTFDSDEGRDTFWHSSAHILGQS+E  YGCKL
Sbjct  112  AANALISSVNGVLWDMNRPLEGDCELKIFTFDSDEGRDTFWHSSAHILGQSLESIYGCKL  171

Query  556  CIGPCTT  576
            CIGPCTT
Sbjct  172  CIGPCTT  178



>ref|XP_011025470.1| PREDICTED: threonine--tRNA ligase, mitochondrial-like [Populus 
euphratica]
Length=715

 Score =   202 bits (513),  Expect = 5e-57, Method: Compositional matrix adjust.
 Identities = 93/135 (69%), Positives = 116/135 (86%), Gaps = 0/135 (0%)
 Frame = +1

Query  172  HPKDDAYLQSVIPKRISLFESIKsqqqlqrlslsPDPIKIELPNGSVKEGKKWNTTPLDI  351
            H +D+ YL   IPKRI LF+SI+S+Q  +  SL  D IKI LP+G+VKEGK+W ++P+DI
Sbjct  44   HARDEGYLNIAIPKRIQLFQSIQSEQLSRLQSLPHDSIKITLPDGTVKEGKRWESSPMDI  103

Query  352  AKELSKSLASNALISKVNGVLWDMSRPLEGDCKLELFTFDSDEGRDTFWHSSAHILGQSV  531
            AKE+ KS+A NALIS+VNGVLWDM+RPLE DC+L++F F+SDEGRDTFWHSSAHILGQ++
Sbjct  104  AKEIGKSVAGNALISQVNGVLWDMNRPLEDDCELKIFNFESDEGRDTFWHSSAHILGQAL  163

Query  532  EMKYGCKLCIGPCTT  576
            EM+YGCKLCIGPCTT
Sbjct  164  EMEYGCKLCIGPCTT  178



>ref|XP_002311580.2| Threonyl-tRNA synthetase family protein [Populus trichocarpa]
 gb|EEE88947.2| Threonyl-tRNA synthetase family protein [Populus trichocarpa]
Length=715

 Score =   201 bits (511),  Expect = 7e-57, Method: Compositional matrix adjust.
 Identities = 93/135 (69%), Positives = 116/135 (86%), Gaps = 0/135 (0%)
 Frame = +1

Query  172  HPKDDAYLQSVIPKRISLFESIKsqqqlqrlslsPDPIKIELPNGSVKEGKKWNTTPLDI  351
            H +D+ YL   IPKRI LF+SI+S+Q  +  SL  D IKI LP+G+VKEGK+W ++P+DI
Sbjct  44   HARDEEYLNIAIPKRIQLFQSIQSEQLSRLQSLPHDSIKITLPDGTVKEGKRWESSPMDI  103

Query  352  AKELSKSLASNALISKVNGVLWDMSRPLEGDCKLELFTFDSDEGRDTFWHSSAHILGQSV  531
            AKE+ KS+A NALIS+VNGVLWDM+RPLE DC+L++F F+SDEGRDTFWHSSAHILGQ++
Sbjct  104  AKEIGKSVAGNALISQVNGVLWDMNRPLEDDCELKIFNFESDEGRDTFWHSSAHILGQAL  163

Query  532  EMKYGCKLCIGPCTT  576
            EM+YGCKLCIGPCTT
Sbjct  164  EMEYGCKLCIGPCTT  178



>ref|XP_007044585.1| Threonyl-tRNA synthetase isoform 4 [Theobroma cacao]
 gb|EOY00417.1| Threonyl-tRNA synthetase isoform 4 [Theobroma cacao]
Length=616

 Score =   199 bits (507),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 100/135 (74%), Positives = 118/135 (87%), Gaps = 0/135 (0%)
 Frame = +1

Query  172  HPKDDAYLQSVIPKRISLFESIKsqqqlqrlslsPDPIKIELPNGSVKEGKKWNTTPLDI  351
            HPKD+AYL  VI KRI +F+S++SQQQ    SL  +PIKI LP+GSVKEGK W ++P+DI
Sbjct  5    HPKDEAYLNQVIEKRIKIFQSLQSQQQSHLQSLPHEPIKITLPDGSVKEGKTWVSSPMDI  64

Query  352  AKELSKSLASNALISKVNGVLWDMSRPLEGDCKLELFTFDSDEGRDTFWHSSAHILGQSV  531
            A+ +SKSLA+NALIS VNGVLWDM+RPLEGDC+L++FTFDSDEGRDTFWHSSAHILGQS+
Sbjct  65   AQGISKSLAANALISSVNGVLWDMNRPLEGDCELKIFTFDSDEGRDTFWHSSAHILGQSL  124

Query  532  EMKYGCKLCIGPCTT  576
            E  YGCKLCIGPCTT
Sbjct  125  ESIYGCKLCIGPCTT  139



>ref|XP_007044583.1| Threonyl-tRNA synthetase isoform 2 [Theobroma cacao]
 gb|EOY00415.1| Threonyl-tRNA synthetase isoform 2 [Theobroma cacao]
Length=645

 Score =   200 bits (508),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 100/135 (74%), Positives = 118/135 (87%), Gaps = 0/135 (0%)
 Frame = +1

Query  172  HPKDDAYLQSVIPKRISLFESIKsqqqlqrlslsPDPIKIELPNGSVKEGKKWNTTPLDI  351
            HPKD+AYL  VI KRI +F+S++SQQQ    SL  +PIKI LP+GSVKEGK W ++P+DI
Sbjct  5    HPKDEAYLNQVIEKRIKIFQSLQSQQQSHLQSLPHEPIKITLPDGSVKEGKTWVSSPMDI  64

Query  352  AKELSKSLASNALISKVNGVLWDMSRPLEGDCKLELFTFDSDEGRDTFWHSSAHILGQSV  531
            A+ +SKSLA+NALIS VNGVLWDM+RPLEGDC+L++FTFDSDEGRDTFWHSSAHILGQS+
Sbjct  65   AQGISKSLAANALISSVNGVLWDMNRPLEGDCELKIFTFDSDEGRDTFWHSSAHILGQSL  124

Query  532  EMKYGCKLCIGPCTT  576
            E  YGCKLCIGPCTT
Sbjct  125  ESIYGCKLCIGPCTT  139



>ref|NP_173238.1| threonyl-tRNA synthetase [Arabidopsis thaliana]
 sp|Q8GZ45.2|SYTC_ARATH RecName: Full=Probable threonine--tRNA ligase, cytoplasmic; AltName: 
Full=Threonyl-tRNA synthetase; Short=ThrRS [Arabidopsis 
thaliana]
 gb|AAF97275.1|AC034106_18 Strong similarity to threonyl-tRNA synthetase from Arabidopsis 
thaliana gb|Y14329 and is a member of the tRNA synthetase 
PF|00587 class II [Arabidopsis thaliana]
 gb|AEE29656.1| threonyl-tRNA synthetase [Arabidopsis thaliana]
Length=458

 Score =   191 bits (484),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 91/134 (68%), Positives = 111/134 (83%), Gaps = 1/134 (1%)
 Frame = +1

Query  172  HPKDDAYLQSVIPKRISLFESIKsqqqlqrlslsPDPIKIEL-PNGSVKEGKKWNTTPLD  348
            HPKD+AYL SVIPKRI LFE I+++Q  Q  S   DPIKI L P+G  KEG++W T+P+D
Sbjct  6    HPKDEAYLSSVIPKRIRLFEEIQAEQLEQLQSRPHDPIKITLLPDGIEKEGRRWETSPMD  65

Query  349  IAKELSKSLASNALISKVNGVLWDMSRPLEGDCKLELFTFDSDEGRDTFWHSSAHILGQS  528
            IA ++SK LA +AL+S VN VLWDM+RPLEGDC LE+F FDSD+GR+TFWHSSAHILGQ+
Sbjct  66   IAVQISKGLAKSALVSSVNHVLWDMNRPLEGDCSLEIFGFDSDQGRNTFWHSSAHILGQA  125

Query  529  VEMKYGCKLCIGPC  570
            +E +YGCKLCIGPC
Sbjct  126  LEQEYGCKLCIGPC  139



>ref|XP_002892976.1| hypothetical protein ARALYDRAFT_472010 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH69235.1| hypothetical protein ARALYDRAFT_472010 [Arabidopsis lyrata subsp. 
lyrata]
Length=458

 Score =   188 bits (478),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 91/136 (67%), Positives = 110/136 (81%), Gaps = 1/136 (1%)
 Frame = +1

Query  172  HPKDDAYLQSVIPKRISLFESIKsqqqlqrlslsPDPIKIEL-PNGSVKEGKKWNTTPLD  348
            HPKD+AYL SVIPKRI +FE I+++Q  Q  S   DPIKI L P+G VKEGK+W TTP+D
Sbjct  6    HPKDEAYLSSVIPKRIRIFEEIQAEQLEQLQSRPHDPIKITLLPDGIVKEGKRWETTPMD  65

Query  349  IAKELSKSLASNALISKVNGVLWDMSRPLEGDCKLELFTFDSDEGRDTFWHSSAHILGQS  528
            IA ++SK  A +AL+S V+ VLWDM+RPLEGDC LE+F FDSD+GRDTFWHSSA ILG +
Sbjct  66   IAVQISKGFAKSALVSSVDHVLWDMNRPLEGDCSLEIFGFDSDQGRDTFWHSSALILGHA  125

Query  529  VEMKYGCKLCIGPCTT  576
            +E +YGCKLCIGPC T
Sbjct  126  LEQEYGCKLCIGPCKT  141



>ref|XP_009412586.1| PREDICTED: threonine--tRNA ligase, mitochondrial [Musa acuminata 
subsp. malaccensis]
Length=731

 Score =   192 bits (488),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 92/133 (69%), Positives = 115/133 (86%), Gaps = 0/133 (0%)
 Frame = +1

Query  178  KDDAYLQSVIPKRISLFESIKsqqqlqrlslsPDPIKIELPNGSVKEGKKWNTTPLDIAK  357
            KD+AYL +VI KR+ LFESI++QQ+ +RL L  + I+I LP+G++KEGKKW T+P+DIAK
Sbjct  62   KDEAYLDAVIQKRVHLFESIQAQQKAERLDLDGESIRITLPDGTIKEGKKWLTSPMDIAK  121

Query  358  ELSKSLASNALISKVNGVLWDMSRPLEGDCKLELFTFDSDEGRDTFWHSSAHILGQSVEM  537
            E+S  LA++ALI++VNG LWDM+RPLEGD  L+LF FD  EGRDTFWHSSAHILGQS+EM
Sbjct  122  EISSGLAASALIAQVNGFLWDMTRPLEGDSNLKLFKFDDAEGRDTFWHSSAHILGQSLEM  181

Query  538  KYGCKLCIGPCTT  576
            +YGCKLCIGPCTT
Sbjct  182  EYGCKLCIGPCTT  194



>ref|XP_008644625.1| PREDICTED: threonine--tRNA ligase, mitochondrial-like [Zea mays]
 gb|AFW68051.1| hypothetical protein ZEAMMB73_499676 [Zea mays]
Length=739

 Score =   189 bits (479),  Expect = 2e-52, Method: Composition-based stats.
 Identities = 83/133 (62%), Positives = 112/133 (84%), Gaps = 0/133 (0%)
 Frame = +1

Query  178  KDDAYLQSVIPKRISLFESIKsqqqlqrlslsPDPIKIELPNGSVKEGKKWNTTPLDIAK  357
            +DD+YL++V  KRI  FE I+++Q ++RL++  + IK+ LP+G++KEGKKW TTP+DIAK
Sbjct  70   RDDSYLEAVTQKRIRFFEEIQARQAVERLNIGGEVIKVTLPDGAIKEGKKWITTPMDIAK  129

Query  358  ELSKSLASNALISKVNGVLWDMSRPLEGDCKLELFTFDSDEGRDTFWHSSAHILGQSVEM  537
            E+S   A++ LI++V+  LWDM RPLEGDCKL++F FD++EGRDTFWHSSAHILG+S+E 
Sbjct  130  EISSGFAASCLIAQVDETLWDMGRPLEGDCKLQMFKFDTNEGRDTFWHSSAHILGESIER  189

Query  538  KYGCKLCIGPCTT  576
             YGCKLCIGPCTT
Sbjct  190  AYGCKLCIGPCTT  202



>ref|XP_002464119.1| hypothetical protein SORBIDRAFT_01g012680 [Sorghum bicolor]
 gb|EER91117.1| hypothetical protein SORBIDRAFT_01g012680 [Sorghum bicolor]
Length=739

 Score =   188 bits (478),  Expect = 3e-52, Method: Composition-based stats.
 Identities = 84/133 (63%), Positives = 112/133 (84%), Gaps = 0/133 (0%)
 Frame = +1

Query  178  KDDAYLQSVIPKRISLFESIKsqqqlqrlslsPDPIKIELPNGSVKEGKKWNTTPLDIAK  357
            +DD+YL++V  KRI LFE I+++Q ++RL++  + IK+ LP+G++KEGKKW TTP+DIAK
Sbjct  70   RDDSYLEAVTQKRIRLFEEIQARQAVERLNIGGEVIKVTLPDGAIKEGKKWITTPMDIAK  129

Query  358  ELSKSLASNALISKVNGVLWDMSRPLEGDCKLELFTFDSDEGRDTFWHSSAHILGQSVEM  537
            E+S   AS+ LI++V+  LWDM RPLE DCKL++F FD++EGRDTFWHSSAHILG+S+E 
Sbjct  130  EISSGFASSCLIAQVDETLWDMGRPLESDCKLQMFKFDTNEGRDTFWHSSAHILGESIER  189

Query  538  KYGCKLCIGPCTT  576
             YGCKLCIGPCTT
Sbjct  190  AYGCKLCIGPCTT  202



>ref|XP_003573669.1| PREDICTED: threonine--tRNA ligase, mitochondrial [Brachypodium 
distachyon]
Length=736

 Score =   188 bits (478),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 91/132 (69%), Positives = 113/132 (86%), Gaps = 0/132 (0%)
 Frame = +1

Query  181  DDAYLQSVIPKRISLFESIKsqqqlqrlslsPDPIKIELPNGSVKEGKKWNTTPLDIAKE  360
            D AYL++V  KRI LFE I+S+Q L+RL++  +PIKI LP+G+VKEGKKW +TP+DIAK 
Sbjct  68   DGAYLEAVTQKRIRLFEEIQSRQALERLNIGGEPIKIILPDGAVKEGKKWISTPMDIAKG  127

Query  361  LSKSLASNALISKVNGVLWDMSRPLEGDCKLELFTFDSDEGRDTFWHSSAHILGQSVEMK  540
            +S  LA++ LI++VNG+LWDM RPLEGDC L+LF FDS+EGRDTFWHSSAHILG+S+E  
Sbjct  128  ISSGLAASCLIAQVNGILWDMERPLEGDCDLKLFKFDSNEGRDTFWHSSAHILGESLERA  187

Query  541  YGCKLCIGPCTT  576
            YGCKLCIGPCTT
Sbjct  188  YGCKLCIGPCTT  199



>gb|EEE68426.1| hypothetical protein OsJ_26793 [Oryza sativa Japonica Group]
Length=701

 Score =   188 bits (477),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 89/137 (65%), Positives = 116/137 (85%), Gaps = 0/137 (0%)
 Frame = +1

Query  166  PDHPKDDAYLQSVIPKRISLFESIKsqqqlqrlslsPDPIKIELPNGSVKEGKKWNTTPL  345
            P+   D AYL++V  KRI  FE I+++Q L+RL++  +PI+I LP+G+VK+GKKW +TP+
Sbjct  28   PNVEPDVAYLEAVTQKRIRQFEEIQAKQALERLNIGGEPIRITLPDGAVKDGKKWISTPM  87

Query  346  DIAKELSKSLASNALISKVNGVLWDMSRPLEGDCKLELFTFDSDEGRDTFWHSSAHILGQ  525
            DIAKE+S  LA++ LI++VNG LWDM+RPLEGDC+L+LF FDS+EGRDTFWHSSAHILG+
Sbjct  88   DIAKEISSGLANSCLIAQVNGTLWDMTRPLEGDCELKLFKFDSNEGRDTFWHSSAHILGE  147

Query  526  SVEMKYGCKLCIGPCTT  576
            S+E  YGCKLCIGPCTT
Sbjct  148  SLERAYGCKLCIGPCTT  164



>gb|EEC83307.1| hypothetical protein OsI_28676 [Oryza sativa Indica Group]
Length=716

 Score =   188 bits (477),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 89/137 (65%), Positives = 116/137 (85%), Gaps = 0/137 (0%)
 Frame = +1

Query  166  PDHPKDDAYLQSVIPKRISLFESIKsqqqlqrlslsPDPIKIELPNGSVKEGKKWNTTPL  345
            P+   D AYL++V  KRI  FE I+++Q L+RL++  +PI+I LP+G+VK+GKKW +TP+
Sbjct  72   PNVEPDVAYLEAVTQKRIRQFEEIQAKQALERLNIGGEPIRITLPDGAVKDGKKWISTPM  131

Query  346  DIAKELSKSLASNALISKVNGVLWDMSRPLEGDCKLELFTFDSDEGRDTFWHSSAHILGQ  525
            DIAKE+S  LA++ LI++VNG LWDM+RPLEGDC+L+LF FDS+EGRDTFWHSSAHILG+
Sbjct  132  DIAKEISSGLANSCLIAQVNGTLWDMTRPLEGDCELKLFKFDSNEGRDTFWHSSAHILGE  191

Query  526  SVEMKYGCKLCIGPCTT  576
            S+E  YGCKLCIGPCTT
Sbjct  192  SLERAYGCKLCIGPCTT  208



>dbj|BAI39857.1| putative threonyl-tRNA synthetase [Oryza sativa Indica Group]
Length=749

 Score =   188 bits (478),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 89/137 (65%), Positives = 116/137 (85%), Gaps = 0/137 (0%)
 Frame = +1

Query  166  PDHPKDDAYLQSVIPKRISLFESIKsqqqlqrlslsPDPIKIELPNGSVKEGKKWNTTPL  345
            P+   D AYL++V  KRI  FE I+++Q L+RL++  +PI+I LP+G+VK+GKKW +TP+
Sbjct  76   PNVEPDVAYLEAVTQKRIRQFEEIQAKQALERLNIGGEPIRITLPDGAVKDGKKWISTPM  135

Query  346  DIAKELSKSLASNALISKVNGVLWDMSRPLEGDCKLELFTFDSDEGRDTFWHSSAHILGQ  525
            DIAKE+S  LA++ LI++VNG LWDM+RPLEGDC+L+LF FDS+EGRDTFWHSSAHILG+
Sbjct  136  DIAKEISSGLANSCLIAQVNGTLWDMTRPLEGDCELKLFKFDSNEGRDTFWHSSAHILGE  195

Query  526  SVEMKYGCKLCIGPCTT  576
            S+E  YGCKLCIGPCTT
Sbjct  196  SLERAYGCKLCIGPCTT  212



>ref|NP_001061475.1| Os08g0295300 [Oryza sativa Japonica Group]
 dbj|BAD01219.1| putative threonyl-tRNA synthetase [Oryza sativa Japonica Group]
 dbj|BAD01414.1| putative threonyl-tRNA synthetase [Oryza sativa Japonica Group]
 dbj|BAF23389.1| Os08g0295300 [Oryza sativa Japonica Group]
 dbj|BAG91912.1| unnamed protein product [Oryza sativa Japonica Group]
Length=745

 Score =   188 bits (477),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 89/137 (65%), Positives = 116/137 (85%), Gaps = 0/137 (0%)
 Frame = +1

Query  166  PDHPKDDAYLQSVIPKRISLFESIKsqqqlqrlslsPDPIKIELPNGSVKEGKKWNTTPL  345
            P+   D AYL++V  KRI  FE I+++Q L+RL++  +PI+I LP+G+VK+GKKW +TP+
Sbjct  72   PNVEPDVAYLEAVTQKRIRQFEEIQAKQALERLNIGGEPIRITLPDGAVKDGKKWISTPM  131

Query  346  DIAKELSKSLASNALISKVNGVLWDMSRPLEGDCKLELFTFDSDEGRDTFWHSSAHILGQ  525
            DIAKE+S  LA++ LI++VNG LWDM+RPLEGDC+L+LF FDS+EGRDTFWHSSAHILG+
Sbjct  132  DIAKEISSGLANSCLIAQVNGTLWDMTRPLEGDCELKLFKFDSNEGRDTFWHSSAHILGE  191

Query  526  SVEMKYGCKLCIGPCTT  576
            S+E  YGCKLCIGPCTT
Sbjct  192  SLERAYGCKLCIGPCTT  208



>dbj|BAJ93554.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=711

 Score =   187 bits (474),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 88/132 (67%), Positives = 112/132 (85%), Gaps = 0/132 (0%)
 Frame = +1

Query  181  DDAYLQSVIPKRISLFESIKsqqqlqrlslsPDPIKIELPNGSVKEGKKWNTTPLDIAKE  360
            D AYL  V PKRI +FE I+++Q L+RL++  DPI++ LP+G++KEGKKW +TP+DIA  
Sbjct  43   DAAYLAVVTPKRIRIFEEIQARQALERLNIGGDPIRVTLPDGAIKEGKKWISTPMDIATG  102

Query  361  LSKSLASNALISKVNGVLWDMSRPLEGDCKLELFTFDSDEGRDTFWHSSAHILGQSVEMK  540
            +S  LA++ LI++VNGVLWDM+RPLEGDC L+LF FDS+EGRDTFWHSSAHILG+S+E  
Sbjct  103  ISTGLAASCLIAQVNGVLWDMTRPLEGDCDLKLFKFDSNEGRDTFWHSSAHILGESLERV  162

Query  541  YGCKLCIGPCTT  576
            YGCKLCIGPCTT
Sbjct  163  YGCKLCIGPCTT  174



>ref|XP_001784310.1| predicted protein [Physcomitrella patens]
 gb|EDQ50872.1| predicted protein [Physcomitrella patens]
Length=685

 Score =   186 bits (473),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 81/126 (64%), Positives = 107/126 (85%), Gaps = 0/126 (0%)
 Frame = +1

Query  199  SVIPKRISLFESIKsqqqlqrlslsPDPIKIELPNGSVKEGKKWNTTPLDIAKELSKSLA  378
            +VI KR+ LFE ++ +Q     +   DPIKI +P+G+V++GKKW T+P+D+A+E+S+ LA
Sbjct  22   TVIKKRVELFEKLQKEQAEAFRAKGGDPIKITMPDGAVRDGKKWITSPMDVAREISQGLA  81

Query  379  SNALISKVNGVLWDMSRPLEGDCKLELFTFDSDEGRDTFWHSSAHILGQSVEMKYGCKLC  558
            ++ALI++VNGVLWDM+RPLEGDC L+L  F+SD+GRDTFWHSSAHILGQS+EM YGCKLC
Sbjct  82   NSALIAEVNGVLWDMTRPLEGDCTLQLHKFESDKGRDTFWHSSAHILGQSIEMTYGCKLC  141

Query  559  IGPCTT  576
            IGPCTT
Sbjct  142  IGPCTT  147



>ref|XP_008664856.1| PREDICTED: LOW QUALITY PROTEIN: threonine--tRNA ligase, mitochondrial-like 
[Zea mays]
Length=737

 Score =   186 bits (471),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 85/133 (64%), Positives = 113/133 (85%), Gaps = 0/133 (0%)
 Frame = +1

Query  178  KDDAYLQSVIPKRISLFESIKsqqqlqrlslsPDPIKIELPNGSVKEGKKWNTTPLDIAK  357
            +DD+YL++V  KRI LFE I+++Q ++RL++  + IKI LP+G++KEGKKW TTP+DIAK
Sbjct  68   RDDSYLEAVTHKRIRLFEEIQARQAVERLNIGGEVIKITLPDGAIKEGKKWITTPMDIAK  127

Query  358  ELSKSLASNALISKVNGVLWDMSRPLEGDCKLELFTFDSDEGRDTFWHSSAHILGQSVEM  537
            E+S   A++ LI++V+  LWDM RPLEGDCKL++F FD++EGRDTFWHSSAHILG+S+E 
Sbjct  128  EISSGFAASCLIAQVDETLWDMGRPLEGDCKLQMFKFDTNEGRDTFWHSSAHILGESLER  187

Query  538  KYGCKLCIGPCTT  576
             YGCKLCIGPCTT
Sbjct  188  AYGCKLCIGPCTT  200



>ref|XP_004973168.1| PREDICTED: threonine--tRNA ligase, mitochondrial-like [Setaria 
italica]
Length=739

 Score =   183 bits (465),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 83/133 (62%), Positives = 114/133 (86%), Gaps = 0/133 (0%)
 Frame = +1

Query  178  KDDAYLQSVIPKRISLFESIKsqqqlqrlslsPDPIKIELPNGSVKEGKKWNTTPLDIAK  357
            +DD+YL+++  KRI +F+ I++++ L+RL++  + IK+ LP+G++K+GKKW TTP+DIAK
Sbjct  70   RDDSYLEAITQKRIRMFDDIQARRALERLNIGGEVIKVTLPDGAIKDGKKWITTPMDIAK  129

Query  358  ELSKSLASNALISKVNGVLWDMSRPLEGDCKLELFTFDSDEGRDTFWHSSAHILGQSVEM  537
            E+S  LA++ LI++V+  LWDM RPLEGDCKL+LF FDS+EGRDTFWHSSAHILG+S+E 
Sbjct  130  EISSGLAASCLIAQVDETLWDMGRPLEGDCKLQLFKFDSNEGRDTFWHSSAHILGESLER  189

Query  538  KYGCKLCIGPCTT  576
             YGCKLCIGPCTT
Sbjct  190  AYGCKLCIGPCTT  202



>gb|EMT11254.1| Threonyl-tRNA synthetase, mitochondrial [Aegilops tauschii]
Length=1098

 Score =   184 bits (468),  Expect = 5e-50, Method: Compositional matrix adjust.
 Identities = 88/137 (64%), Positives = 114/137 (83%), Gaps = 4/137 (3%)
 Frame = +1

Query  166  PDHPKDDAYLQSVIPKRISLFESIKsqqqlqrlslsPDPIKIELPNGSVKEGKKWNTTPL  345
            PD P    YL++V  KRI +FE I+++Q L+RL++  DPI++ LP+G++KEGKKW +TP+
Sbjct  8    PDAP----YLEAVTQKRIRIFEEIQARQALERLNIGGDPIRVTLPDGAIKEGKKWISTPM  63

Query  346  DIAKELSKSLASNALISKVNGVLWDMSRPLEGDCKLELFTFDSDEGRDTFWHSSAHILGQ  525
            DIA  +S  LA++ LI++VNGVLWDM+RPLEGDC L+LF FDS+EGRDTFWHSSAHILG+
Sbjct  64   DIATGISTGLAASCLIAQVNGVLWDMTRPLEGDCDLKLFKFDSNEGRDTFWHSSAHILGE  123

Query  526  SVEMKYGCKLCIGPCTT  576
            S+E  YGCKLCIGPCTT
Sbjct  124  SIERVYGCKLCIGPCTT  140



>ref|XP_006659275.1| PREDICTED: threonine--tRNA ligase, mitochondrial-like [Oryza 
brachyantha]
Length=696

 Score =   182 bits (461),  Expect = 5e-50, Method: Compositional matrix adjust.
 Identities = 88/137 (64%), Positives = 112/137 (82%), Gaps = 0/137 (0%)
 Frame = +1

Query  166  PDHPKDDAYLQSVIPKRISLFESIKsqqqlqrlslsPDPIKIELPNGSVKEGKKWNTTPL  345
            P    D  YL++   KRI +FE I+++Q L+RLS+  +PIK+ LP+G+VKE KKW +TP+
Sbjct  23   PTFEPDVPYLEAGTAKRIRMFEEIQAKQALERLSIGGEPIKVTLPDGAVKECKKWISTPM  82

Query  346  DIAKELSKSLASNALISKVNGVLWDMSRPLEGDCKLELFTFDSDEGRDTFWHSSAHILGQ  525
            DIAKE+S  LA+  LI++VNG LWDM+RPLEGDC+L+LF FDS+EGRDTFWHSSAHILG+
Sbjct  83   DIAKEISTGLAAGCLIAQVNGTLWDMTRPLEGDCELKLFKFDSNEGRDTFWHSSAHILGE  142

Query  526  SVEMKYGCKLCIGPCTT  576
            S+E  YGCKLCIGPCTT
Sbjct  143  SLERAYGCKLCIGPCTT  159



>ref|XP_006303165.1| hypothetical protein CARUB_v10008521mg [Capsella rubella]
 gb|EOA36063.1| hypothetical protein CARUB_v10008521mg [Capsella rubella]
Length=664

 Score =   181 bits (460),  Expect = 6e-50, Method: Compositional matrix adjust.
 Identities = 88/135 (65%), Positives = 107/135 (79%), Gaps = 1/135 (1%)
 Frame = +1

Query  175  PKDDAYLQSVIPKRISLFESIKsqqqlqrlslsPDPIKIEL-PNGSVKEGKKWNTTPLDI  351
            P+D+AYL SVIPKRI LFE I++    Q  SL  DPIKI L P+G VKEGK+W TTP+DI
Sbjct  7    PRDEAYLSSVIPKRIRLFEQIQADHLEQLQSLPHDPIKITLLPDGIVKEGKRWETTPMDI  66

Query  352  AKELSKSLASNALISKVNGVLWDMSRPLEGDCKLELFTFDSDEGRDTFWHSSAHILGQSV  531
            A ++S+ LA +AL+S VN VLWDM+RPLE DC LE+  FDS++GRDT WHSSAHILGQ++
Sbjct  67   AVQISRGLAKSALVSSVNNVLWDMNRPLESDCSLEILGFDSNQGRDTLWHSSAHILGQAL  126

Query  532  EMKYGCKLCIGPCTT  576
            E +YGCKL IGPC T
Sbjct  127  EQEYGCKLYIGPCKT  141



>ref|XP_007199721.1| hypothetical protein PRUPE_ppa002288mg [Prunus persica]
 gb|EMJ00920.1| hypothetical protein PRUPE_ppa002288mg [Prunus persica]
Length=691

 Score =   181 bits (459),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 92/137 (67%), Positives = 114/137 (83%), Gaps = 5/137 (4%)
 Frame = +1

Query  178  KDDAYLQSVIPKRISLFESIKsqqqlqrlslsP-DPIKIELPNGSVKEGKKWNTTPLDIA  354
            KD+AYL++VIPKRI LFESI+++Q+  R SL   DPI+I L +G VKEGKKW T+P +IA
Sbjct  6    KDEAYLEAVIPKRIELFESIQAEQRAARQSLPSFDPIRITLSDGKVKEGKKWITSPFEIA  65

Query  355  KELSKSLASNALISKVNGVLWDMSRPLEGDCKLELFTFDS----DEGRDTFWHSSAHILG  522
             E+SKSLASNALIS+VNGVLWDM+RPLEGD +L LFT DS    ++ R TFWHSS+HILG
Sbjct  66   SEISKSLASNALISEVNGVLWDMNRPLEGDAELRLFTLDSFDNNEDVRHTFWHSSSHILG  125

Query  523  QSVEMKYGCKLCIGPCT  573
            Q++E++YGCKLCIGPC 
Sbjct  126  QALEVEYGCKLCIGPCA  142



>emb|CDM81189.1| unnamed protein product [Triticum aestivum]
Length=706

 Score =   180 bits (457),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 87/137 (64%), Positives = 112/137 (82%), Gaps = 4/137 (3%)
 Frame = +1

Query  166  PDHPKDDAYLQSVIPKRISLFESIKsqqqlqrlslsPDPIKIELPNGSVKEGKKWNTTPL  345
            PD P    YL +V  KRI +FE I+++Q L+RL++  D I++ LP+G++KEGKKW +TP+
Sbjct  37   PDAP----YLDAVTQKRIRIFEEIQARQALERLNIGGDSIRVTLPDGAIKEGKKWISTPM  92

Query  346  DIAKELSKSLASNALISKVNGVLWDMSRPLEGDCKLELFTFDSDEGRDTFWHSSAHILGQ  525
            DIA  +S  LA++ LI++VNGVLWDM+RPLEGDC L+LF FDS+EGRDTFWHSSAHILG+
Sbjct  93   DIASGISTGLAASCLIAQVNGVLWDMTRPLEGDCDLKLFKFDSNEGRDTFWHSSAHILGE  152

Query  526  SVEMKYGCKLCIGPCTT  576
            S+E  YGCKLCIGPCTT
Sbjct  153  SLERVYGCKLCIGPCTT  169



>ref|XP_007204844.1| hypothetical protein PRUPE_ppa026578mg [Prunus persica]
 gb|EMJ06043.1| hypothetical protein PRUPE_ppa026578mg [Prunus persica]
Length=134

 Score =   167 bits (424),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 91/136 (67%), Positives = 106/136 (78%), Gaps = 11/136 (8%)
 Frame = +1

Query  172  HPKDDAYLQSVIPKRISLFESIKsqqqlqrlslsPDPIKIELPNGSVKEGKKWNTTPLDI  351
            H KDDAYL +VIPK I LFESI++QQ   RL    DPIKI LP+G V+EGKKW T+P DI
Sbjct  6    HAKDDAYLDAVIPKGIQLFESIEAQQHAARLPS--DPIKITLPDGKVEEGKKWITSPFDI  63

Query  352  AKELSKSLASNALISKVNGVLWDMSRPLEGDCKLELFTFDSDEG----RDTFWHSSAHIL  519
            A E+SKSLASNALIS+VNGVLWD++RPLEGD +L++FT DS +     R TFWHSSAHI+
Sbjct  64   ASEISKSLASNALISEVNGVLWDINRPLEGDAELKIFTLDSFDDNVDVRHTFWHSSAHII  123

Query  520  GQSVEMKYGCKLCIGP  567
            GQ     YGCKLCIGP
Sbjct  124  GQ-----YGCKLCIGP  134



>ref|XP_010480524.1| PREDICTED: probable threonine--tRNA ligase, cytoplasmic [Camelina 
sativa]
Length=668

 Score =   179 bits (455),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 85/135 (63%), Positives = 107/135 (79%), Gaps = 4/135 (3%)
 Frame = +1

Query  175  PKDDAYLQSVIPKRISLFESIKsqqqlqrlslsPDPIKIEL-PNGSVKEGKKWNTTPLDI  351
            PKD+ YL SVI KRI LFE I+++Q         DPIKI L P+G VKEG +W TTP+DI
Sbjct  7    PKDETYLSSVISKRIRLFEQIQAEQLQSLPH---DPIKITLLPDGIVKEGNRWETTPMDI  63

Query  352  AKELSKSLASNALISKVNGVLWDMSRPLEGDCKLELFTFDSDEGRDTFWHSSAHILGQSV  531
            A ++S+ LA +AL+S VN VLWDM+RPLEGDC LE+F FDSD+GRDTFWHSSAH+LGQ++
Sbjct  64   AGQISRVLAESALVSSVNRVLWDMNRPLEGDCSLEIFRFDSDQGRDTFWHSSAHLLGQAL  123

Query  532  EMKYGCKLCIGPCTT  576
            + ++GCKLC+GPC T
Sbjct  124  KQEFGCKLCLGPCET  138



>ref|XP_004968434.1| PREDICTED: threonine--tRNA ligase, mitochondrial-like [Setaria 
italica]
Length=741

 Score =   179 bits (454),  Expect = 6e-49, Method: Compositional matrix adjust.
 Identities = 86/133 (65%), Positives = 111/133 (83%), Gaps = 0/133 (0%)
 Frame = +1

Query  178  KDDAYLQSVIPKRISLFESIKsqqqlqrlslsPDPIKIELPNGSVKEGKKWNTTPLDIAK  357
            +DD+YL++V   RI  FE I+++Q L+RL++  + IK+ LP+G++KEGKK  TTP+DIAK
Sbjct  72   RDDSYLEAVTQTRIRKFEEIQARQALERLNIGGELIKVTLPDGAIKEGKKLITTPMDIAK  131

Query  358  ELSKSLASNALISKVNGVLWDMSRPLEGDCKLELFTFDSDEGRDTFWHSSAHILGQSVEM  537
            E+S  LA++ LI+KV+  LWDM RPLEGDCKL+LF FDS+EGRDTFWHSSAHILG+S+E 
Sbjct  132  EISSGLAASCLIAKVDETLWDMGRPLEGDCKLQLFKFDSNEGRDTFWHSSAHILGESLER  191

Query  538  KYGCKLCIGPCTT  576
             YGCKLCIGPCTT
Sbjct  192  VYGCKLCIGPCTT  204



>ref|XP_010476961.1| PREDICTED: LOW QUALITY PROTEIN: probable threonine--tRNA ligase, 
cytoplasmic [Camelina sativa]
Length=453

 Score =   174 bits (441),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 87/135 (64%), Positives = 104/135 (77%), Gaps = 8/135 (6%)
 Frame = +1

Query  175  PKDDAYLQSVIPKRISLFESIKsqqqlqrlslsPDPIKIEL-PNGSVKEGKKWNTTPLDI  351
            PKD+AYL SVI KRI LF+ I++    +  SL  DPIKI L PNG VKEGK+W TTP+DI
Sbjct  7    PKDEAYLSSVISKRIRLFQQIQADHLEKLQSLPHDPIKITLLPNGIVKEGKRWETTPMDI  66

Query  352  AKELSKSLASNALISKVNGVLWDMSRPLEGDCKLELFTFDSDEGRDTFWHSSAHILGQSV  531
            A ++S+ LA +AL+S VN VLWDM+RPLEG        FDSD+GRDTFWHSSAHILGQS+
Sbjct  67   AGQISRVLAKSALVSSVNRVLWDMNRPLEG-------XFDSDQGRDTFWHSSAHILGQSL  119

Query  532  EMKYGCKLCIGPCTT  576
            E +YGCKLC+GPC T
Sbjct  120  EQEYGCKLCLGPCET  134



>gb|AAB61048.1| Similar to threonyl-tRNA synthetase; coded for by A. thaliana 
cDNA R65376 [Arabidopsis thaliana]
Length=702

 Score =   175 bits (444),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 84/120 (70%), Positives = 100/120 (83%), Gaps = 0/120 (0%)
 Frame = +1

Query  169  DHPKDDAYLQSVIPKRISLFESIKsqqqlqrlslsPDPIKIELPNGSVKEGKKWNTTPLD  348
            +HPKD+AYL +VIPKRI LFE I++ Q     SL  DPIK+ LP+G+VKEGKKW TTP+D
Sbjct  37   NHPKDEAYLSAVIPKRIKLFEQIQANQLENLKSLPHDPIKVTLPDGNVKEGKKWETTPMD  96

Query  349  IAKELSKSLASNALISKVNGVLWDMSRPLEGDCKLELFTFDSDEGRDTFWHSSAHILGQS  528
            IA ++SK LA++ALIS V+ VLWDM+RPLEGDCKLELF FDSD+GRDT WHSSAHILGQ 
Sbjct  97   IAAQISKGLANSALISAVDDVLWDMNRPLEGDCKLELFKFDSDKGRDTLWHSSAHILGQG  156



>gb|EMS59266.1| Threonyl-tRNA synthetase, mitochondrial [Triticum urartu]
Length=1047

 Score =   176 bits (445),  Expect = 6e-47, Method: Compositional matrix adjust.
 Identities = 88/153 (58%), Positives = 113/153 (74%), Gaps = 21/153 (14%)
 Frame = +1

Query  181  DDAYLQSVIPKRISLFESIKsqqqlqrlslsPDPIKIELPNGSVKEGKKWNTTPLDIAKE  360
            D AYL++V  KRI +FE I+++Q L+RL++  DPI++ LP+G++KEGKKW +TP+DIA  
Sbjct  9    DAAYLEAVTQKRIRIFEEIQARQALERLNIGGDPIRVTLPDGAIKEGKKWISTPMDIASG  68

Query  361  LSKSLASNALISKVNGVLWDMSRPLEGDCKLELFTFDSDEGRDTFWHSSAHILG------  522
            +S  LA++ LI++VNGVLWDM+RPLEGDC L+LF FDS+EGRDTFWHSSAHILG      
Sbjct  69   ISTGLAASCLIAQVNGVLWDMTRPLEGDCDLKLFKFDSNEGRDTFWHSSAHILGEVSVII  128

Query  523  ---------------QSVEMKYGCKLCIGPCTT  576
                           QS+E  YGCKLCIGPCTT
Sbjct  129  HSQFIFFLIEEDVCLQSIERVYGCKLCIGPCTT  161



>ref|XP_007200687.1| hypothetical protein PRUPE_ppa017189mg [Prunus persica]
 gb|EMJ01886.1| hypothetical protein PRUPE_ppa017189mg [Prunus persica]
Length=689

 Score =   169 bits (429),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 88/139 (63%), Positives = 108/139 (78%), Gaps = 7/139 (5%)
 Frame = +1

Query  172  HPKDDAYLQSVIPKRISLFESIKsqqqlqrlslsP-DPIKIELPNGSVKEGKKWNTTPLD  348
            H KD  YL   IPKR  LFESI+++Q+  R S    DPI+I LP+G VKEGKKW T+P +
Sbjct  4    HAKD--YLMVDIPKRNKLFESIQAEQRAARQSHPSFDPIRITLPDGKVKEGKKWITSPFE  61

Query  349  IAKELSKSLASNALISKVNGVLWDMSRPLEGDCKLELFTFDS----DEGRDTFWHSSAHI  516
            IA E+SKSLASNALIS+VNGVLWDM+RPLEGD +L + T DS    ++ R TFWHSS+HI
Sbjct  62   IASEISKSLASNALISEVNGVLWDMNRPLEGDAELRILTLDSFDNNEDVRHTFWHSSSHI  121

Query  517  LGQSVEMKYGCKLCIGPCT  573
            LGQ++EM+YGC+LCIGPC 
Sbjct  122  LGQALEMEYGCRLCIGPCA  140



>ref|XP_009117622.1| PREDICTED: threonine--tRNA ligase, mitochondrial-like [Brassica 
rapa]
Length=628

 Score =   166 bits (421),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 79/135 (59%), Positives = 105/135 (78%), Gaps = 5/135 (4%)
 Frame = +1

Query  169  DHPKDDAYLQSVIPKRISLFESIKsqqqlqrlslsPDPIKIELPNG-SVKEGKKWNTTPL  345
            +HP+D+AYL +VI KRI LFE  +++Q  +  S   +PIK+ + +G +VKEGK+W TTP 
Sbjct  4    EHPRDEAYLSAVIEKRIRLFEEFQAKQLAEIQSRPHEPIKVTIRDGGNVKEGKRWETTPA  63

Query  346  DIAKELSKSLASNALISKVNGVLWDMSRPLEGDCKLELFTFDSDEGRDTFWHSSAHILGQ  525
            +IA+++S  LA++ALIS VN VLWDM+RPLE DC LE F+FDSD+GRDTFW SSAHIL  
Sbjct  64   EIARQISVGLANSALISSVNDVLWDMNRPLEADCSLEFFSFDSDKGRDTFWRSSAHILA-  122

Query  526  SVEMKYGCKLCIGPC  570
               ++YGCKLC+GPC
Sbjct  123  ---LEYGCKLCVGPC  134



>emb|CDY21715.1| BnaA09g44660D [Brassica napus]
Length=628

 Score =   164 bits (414),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 79/135 (59%), Positives = 103/135 (76%), Gaps = 5/135 (4%)
 Frame = +1

Query  169  DHPKDDAYLQSVIPKRISLFESIKsqqqlqrlslsPDPIKIELPNG-SVKEGKKWNTTPL  345
            +HP+D+AYL +VI KRI LFE  +++Q  +  S   DPIK+ + +G +VKEGK+W TTP 
Sbjct  4    EHPRDEAYLSAVIEKRIRLFEEFQAKQLAEIQSRPHDPIKVTIRDGGNVKEGKRWETTPA  63

Query  346  DIAKELSKSLASNALISKVNGVLWDMSRPLEGDCKLELFTFDSDEGRDTFWHSSAHILGQ  525
            +IA+++S  LA++ALIS VN VLWDM+RPLE DC LE F+FDSD+GRDTFW SSAHI   
Sbjct  64   EIARQISVGLANSALISSVNDVLWDMNRPLEADCSLEFFSFDSDKGRDTFWRSSAHI---  120

Query  526  SVEMKYGCKLCIGPC  570
                +YGCKLC+GPC
Sbjct  121  -CRCEYGCKLCVGPC  134



>ref|XP_004304268.2| PREDICTED: threonine--tRNA ligase, mitochondrial-like [Fragaria 
vesca subsp. vesca]
 ref|XP_011467923.1| PREDICTED: threonine--tRNA ligase, mitochondrial-like [Fragaria 
vesca subsp. vesca]
 ref|XP_011467924.1| PREDICTED: threonine--tRNA ligase, mitochondrial-like [Fragaria 
vesca subsp. vesca]
Length=746

 Score =   156 bits (395),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 76/130 (58%), Positives = 105/130 (81%), Gaps = 3/130 (2%)
 Frame = +1

Query  196  QSVIPKRISLFESIKsqqqlqrlslsPDPIKIELPNGSVKE---GKKWNTTPLDIAKELS  366
            +++I ++I LFESI+++Q+    SL  + IKI L  G VKE   GKKW T+PLDIA+E+S
Sbjct  75   KAIISRKIKLFESIQAEQEEPIQSLPAESIKITLWYGQVKEVKEGKKWITSPLDIAEEVS  134

Query  367  KSLASNALISKVNGVLWDMSRPLEGDCKLELFTFDSDEGRDTFWHSSAHILGQSVEMKYG  546
            +S AS AL+++VNG  WDMS+PLE DC+L++FTF+ ++GRDTFWHSS+HILG ++E ++G
Sbjct  135  ESFASKALVAEVNGTPWDMSKPLECDCELKIFTFEDNKGRDTFWHSSSHILGHALEAEFG  194

Query  547  CKLCIGPCTT  576
            CKLCIGPCTT
Sbjct  195  CKLCIGPCTT  204



>ref|XP_004296468.1| PREDICTED: probable threonine--tRNA ligase, cytoplasmic [Fragaria 
vesca subsp. vesca]
 ref|XP_011462344.1| PREDICTED: probable threonine--tRNA ligase, cytoplasmic [Fragaria 
vesca subsp. vesca]
 ref|XP_011462345.1| PREDICTED: probable threonine--tRNA ligase, cytoplasmic [Fragaria 
vesca subsp. vesca]
Length=114

 Score =   143 bits (360),  Expect = 9e-40, Method: Compositional matrix adjust.
 Identities = 70/106 (66%), Positives = 84/106 (79%), Gaps = 4/106 (4%)
 Frame = +1

Query  172  HPKDDAYLQSVIPKRISLFESIKsqqqlqrlslsPDPIKIELPNGSVKEGKKWNTTPLDI  351
            HPKDDAYL +V+PKRI LF  I+++          DPIKI L +G VKEGKKW T+P D+
Sbjct  4    HPKDDAYLTNVVPKRIRLFMEIQARHAALPS----DPIKITLLDGKVKEGKKWVTSPFDV  59

Query  352  AKELSKSLASNALISKVNGVLWDMSRPLEGDCKLELFTFDSDEGRD  489
             KE+SKSLASNALIS+VNGVLWDM+RPLEGDC L+LFTF++ EGRD
Sbjct  60   VKEISKSLASNALISEVNGVLWDMTRPLEGDCDLKLFTFENAEGRD  105



>ref|XP_008237148.1| PREDICTED: threonine--tRNA ligase, mitochondrial-like, partial 
[Prunus mume]
Length=648

 Score =   151 bits (381),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 70/99 (71%), Positives = 84/99 (85%), Gaps = 4/99 (4%)
 Frame = +1

Query  289  IELPNGSVKEGKKWNTTPLDIAKELSKSLASNALISKVNGVLWDMSRPLEGDCKLELFTF  468
            I LP+G VKEGKKW T+P +IA E+SKSLASNALIS+VNGVLWDM+RPLEGD +L LFT 
Sbjct  1    ITLPDGKVKEGKKWITSPFEIASEISKSLASNALISEVNGVLWDMNRPLEGDAELRLFTL  60

Query  469  DS----DEGRDTFWHSSAHILGQSVEMKYGCKLCIGPCT  573
            DS    ++ R TFWHSS+HILGQ++E++YGCKLCIGPC 
Sbjct  61   DSFDNNEDVRHTFWHSSSHILGQALEVEYGCKLCIGPCA  99



>ref|XP_005837214.1| hypothetical protein GUITHDRAFT_93029 [Guillardia theta CCMP2712]
 gb|EKX50234.1| hypothetical protein GUITHDRAFT_93029 [Guillardia theta CCMP2712]
Length=690

 Score =   149 bits (376),  Expect = 3e-38, Method: Composition-based stats.
 Identities = 68/118 (58%), Positives = 94/118 (80%), Gaps = 0/118 (0%)
 Frame = +1

Query  214  RISLFESIKsqqqlqrlslsPDPIKIELPNGSVKEGKKWNTTPLDIAKELSKSLASNALI  393
            R+ +FE IK++++ ++ +L  DPIK+ LP+G+VKEG K  TTP DIA E+SK LA+NA++
Sbjct  30   RLEMFEKIKAKREAEKGNLPNDPIKVTLPDGNVKEGVKNKTTPFDIAMEISKGLANNAVV  89

Query  394  SKVNGVLWDMSRPLEGDCKLELFTFDSDEGRDTFWHSSAHILGQSVEMKYGCKLCIGP  567
            +KVNG  WD+ RPLEGD +LEL  FDS EGR+TFWHSSAH+LG ++E ++G  LC+GP
Sbjct  90   AKVNGKTWDLHRPLEGDAELELCKFDSPEGRETFWHSSAHVLGLALENRFGAHLCVGP  147



>gb|EST08708.1| threonyl-tRNA synthetase [Pseudozyma brasiliensis GHG001]
Length=759

 Score =   146 bits (369),  Expect = 5e-37, Method: Compositional matrix adjust.
 Identities = 66/120 (55%), Positives = 90/120 (75%), Gaps = 0/120 (0%)
 Frame = +1

Query  214  RISLFESIKsqqqlqrlslsPDPIKIELPNGSVKEGKKWNTTPLDIAKELSKSLASNALI  393
            RI++FE +K++Q  +  +    PI + +P+GS ++G  + T+PLDIAKE+SKSL+   +I
Sbjct  85   RIAMFEKLKAEQDAEFAAKPRQPITVTMPDGSTRQGTSYETSPLDIAKEISKSLSERIVI  144

Query  394  SKVNGVLWDMSRPLEGDCKLELFTFDSDEGRDTFWHSSAHILGQSVEMKYGCKLCIGPCT  573
            SKV+  LWD+ RPLEGDCKLELF F+S EG+  FWHSSAH+LG++ E  YGC LCIGP T
Sbjct  145  SKVDETLWDLERPLEGDCKLELFDFESPEGKRVFWHSSAHVLGEACEKHYGCHLCIGPPT  204



>dbj|GAC98443.1| threonyl-tRNA synthetase [Pseudozyma hubeiensis SY62]
Length=760

 Score =   144 bits (363),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 65/120 (54%), Positives = 89/120 (74%), Gaps = 0/120 (0%)
 Frame = +1

Query  214  RISLFESIKsqqqlqrlslsPDPIKIELPNGSVKEGKKWNTTPLDIAKELSKSLASNALI  393
            RI++FE +K++Q  +  +    PI + +P+GS ++G  + T+P+DIAKE+SKSL+   +I
Sbjct  86   RIAMFEKLKAEQDAEFAAKPRQPITVTMPDGSTRQGTSYETSPMDIAKEISKSLSERIVI  145

Query  394  SKVNGVLWDMSRPLEGDCKLELFTFDSDEGRDTFWHSSAHILGQSVEMKYGCKLCIGPCT  573
            SKV+  LWD+ RPLE DCKLELF FDS EG+  FWHSSAH+LG++ E  YGC LCIGP T
Sbjct  146  SKVDDNLWDLERPLEADCKLELFDFDSPEGKRVFWHSSAHVLGEACEKHYGCHLCIGPPT  205



>gb|KIY63302.1| threonyl-tRNA synthetase [Cylindrobasidium torrendii FP15055 
ss-10]
Length=702

 Score =   144 bits (362),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 63/120 (53%), Positives = 88/120 (73%), Gaps = 0/120 (0%)
 Frame = +1

Query  214  RISLFESIKsqqqlqrlslsPDPIKIELPNGSVKEGKKWNTTPLDIAKELSKSLASNALI  393
            RI LFE +K++   +  + + +PI++ +P+GS + G  W T+P+DIAKE+SKSL+   +I
Sbjct  37   RIKLFEELKAEYDAEVKAKTKEPIEVTMPDGSTRTGTSWETSPMDIAKEVSKSLSERIVI  96

Query  394  SKVNGVLWDMSRPLEGDCKLELFTFDSDEGRDTFWHSSAHILGQSVEMKYGCKLCIGPCT  573
            +KV+G LWD+ RPLEG CKLEL  F+  EG+  FWHSSAH+LG+S E  YGC LC+GP T
Sbjct  97   AKVDGNLWDLERPLEGPCKLELLDFEHPEGKRVFWHSSAHVLGESAEKHYGCHLCLGPPT  156



>ref|XP_007880033.1| hypothetical protein PFL1_04316 [Pseudozyma flocculosa PF-1]
 gb|EPQ27989.1| hypothetical protein PFL1_04316 [Pseudozyma flocculosa PF-1]
Length=763

 Score =   144 bits (362),  Expect = 5e-36, Method: Compositional matrix adjust.
 Identities = 65/120 (54%), Positives = 88/120 (73%), Gaps = 0/120 (0%)
 Frame = +1

Query  214  RISLFESIKsqqqlqrlslsPDPIKIELPNGSVKEGKKWNTTPLDIAKELSKSLASNALI  393
            RI++FE +K++Q     S    PI++ +P+GSVKEG  W TTP+DIAK++SKSL+   +I
Sbjct  89   RIAMFEKLKAEQDAHAASQPRQPIQVTMPDGSVKEGTAWETTPMDIAKQISKSLSERVVI  148

Query  394  SKVNGVLWDMSRPLEGDCKLELFTFDSDEGRDTFWHSSAHILGQSVEMKYGCKLCIGPCT  573
            +KV+  LWD+ RPLE   KL+LF F+S EG+  FWHSSAH+LG++ E  YGC LCIGP T
Sbjct  149  AKVDDTLWDLERPLEQSAKLQLFDFESPEGKRVFWHSSAHVLGEAAEKHYGCHLCIGPPT  208



>emb|CEG83597.1| Putative Threonyl-tRNA synthetase [Rhizopus microsporus]
Length=177

 Score =   134 bits (338),  Expect = 7e-36, Method: Compositional matrix adjust.
 Identities = 64/126 (51%), Positives = 84/126 (67%), Gaps = 4/126 (3%)
 Frame = +1

Query  190  YLQSVIPKRISLFESIKsqqqlqrlslsPDPIKIELPNGSVKEGKKWNTTPLDIAKELSK  369
            YLQ     RI LF+  K +   +      +PI I LP+GS KEG  W TTPL +A ++SK
Sbjct  41   YLQH----RIELFDKWKKEADEEIAKKPREPITITLPDGSTKEGVSWETTPLSLAADISK  96

Query  370  SLASNALISKVNGVLWDMSRPLEGDCKLELFTFDSDEGRDTFWHSSAHILGQSVEMKYGC  549
            SLA   +I+KV+G LWD++RPLE  C L+L  F++DE +  FWHSSAH+LG++ E  YGC
Sbjct  97   SLAERTIIAKVDGDLWDLTRPLEKSCNLQLLDFENDEAKKVFWHSSAHMLGEACERHYGC  156

Query  550  KLCIGP  567
             LCIGP
Sbjct  157  HLCIGP  162



>gb|KIJ16340.1| hypothetical protein PAXINDRAFT_168488 [Paxillus involutus ATCC 
200175]
Length=728

 Score =   142 bits (359),  Expect = 8e-36, Method: Compositional matrix adjust.
 Identities = 64/125 (51%), Positives = 88/125 (70%), Gaps = 0/125 (0%)
 Frame = +1

Query  199  SVIPKRISLFESIKsqqqlqrlslsPDPIKIELPNGSVKEGKKWNTTPLDIAKELSKSLA  378
            + I +RI LFE ++++      + S + I I +P+GS ++G  W TTP+D+AKE+SKSL+
Sbjct  51   AYIDERIKLFEQLQAEYNEYVKAQSREEIAITMPDGSERKGTSWQTTPMDVAKEVSKSLS  110

Query  379  SNALISKVNGVLWDMSRPLEGDCKLELFTFDSDEGRDTFWHSSAHILGQSVEMKYGCKLC  558
               +I+KVNG LWD+ RPLE  CKLEL  F+  EG+  FWHSSAH+LG++ E  YGC LC
Sbjct  111  ERVVIAKVNGDLWDLERPLEASCKLELLDFEHPEGKRVFWHSSAHVLGEAAERHYGCHLC  170

Query  559  IGPCT  573
            IGP T
Sbjct  171  IGPPT  175



>gb|KIK95681.1| hypothetical protein PAXRUDRAFT_140136 [Paxillus rubicundulus 
Ve08.2h10]
Length=730

 Score =   142 bits (359),  Expect = 8e-36, Method: Compositional matrix adjust.
 Identities = 64/125 (51%), Positives = 88/125 (70%), Gaps = 0/125 (0%)
 Frame = +1

Query  199  SVIPKRISLFESIKsqqqlqrlslsPDPIKIELPNGSVKEGKKWNTTPLDIAKELSKSLA  378
            + I +RI LFE ++++      + S + I I +P+GS ++G  W TTP+D+AKE+SKSL+
Sbjct  51   AYIDERIKLFEQLQAEYNEHVKAQSREEITITMPDGSERKGTSWETTPMDVAKEVSKSLS  110

Query  379  SNALISKVNGVLWDMSRPLEGDCKLELFTFDSDEGRDTFWHSSAHILGQSVEMKYGCKLC  558
               +I+KVNG LWD+ RPLE  CKLEL  F+  EG+  FWHSSAH+LG++ E  YGC LC
Sbjct  111  ERVVIAKVNGDLWDLERPLEASCKLELLDFEHPEGKRVFWHSSAHVLGEAAERHYGCHLC  170

Query  559  IGPCT  573
            IGP T
Sbjct  171  IGPPT  175



>emb|CCF49315.1| probable THS1-threonyl tRNA synthetase, cytosolic [Ustilago hordei]
Length=770

 Score =   143 bits (360),  Expect = 9e-36, Method: Compositional matrix adjust.
 Identities = 64/120 (53%), Positives = 90/120 (75%), Gaps = 0/120 (0%)
 Frame = +1

Query  214  RISLFESIKsqqqlqrlslsPDPIKIELPNGSVKEGKKWNTTPLDIAKELSKSLASNALI  393
            RI++FE +K++Q  +  +    PI + +P+GS ++G  + T+P++IAKE+SKSL+   +I
Sbjct  96   RIAMFEKLKAEQDAEFAAKPRQPITVTMPDGSTRQGTSFETSPMNIAKEISKSLSERIVI  155

Query  394  SKVNGVLWDMSRPLEGDCKLELFTFDSDEGRDTFWHSSAHILGQSVEMKYGCKLCIGPCT  573
            SKV+  LWD+ RPLEGDCKLELF F+S EG+  FWHSSAH+LG++ E  YGC LCIGP T
Sbjct  156  SKVDDTLWDLERPLEGDCKLELFDFESPEGKRVFWHSSAHVLGEACEKHYGCHLCIGPPT  215



>emb|CBQ69805.1| probable THS1-threonyl tRNA synthetase, cytosolic [Sporisorium 
reilianum SRZ2]
Length=764

 Score =   142 bits (357),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 64/120 (53%), Positives = 89/120 (74%), Gaps = 0/120 (0%)
 Frame = +1

Query  214  RISLFESIKsqqqlqrlslsPDPIKIELPNGSVKEGKKWNTTPLDIAKELSKSLASNALI  393
            RI++FE +K++Q  +  +    PI + +P+GS ++G  + T+P+DIAKE+SKSL+   +I
Sbjct  90   RIAMFEKLKAEQDAEFAAKPRQPITVTMPDGSKRQGTSYETSPMDIAKEISKSLSERIVI  149

Query  394  SKVNGVLWDMSRPLEGDCKLELFTFDSDEGRDTFWHSSAHILGQSVEMKYGCKLCIGPCT  573
            SKV+  LWD+ RPLE DCKLELF F+S EG+  FWHSSAH+LG++ E  YGC LCIGP T
Sbjct  150  SKVDDNLWDLERPLEADCKLELFDFESPEGKRVFWHSSAHVLGEACEKHYGCHLCIGPPT  209



>gb|EPB83961.1| threonyl-tRNA synthetase [Mucor circinelloides f. circinelloides 
1006PhL]
Length=716

 Score =   141 bits (356),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 64/121 (53%), Positives = 84/121 (69%), Gaps = 0/121 (0%)
 Frame = +1

Query  205  IPKRISLFESIKsqqqlqrlslsPDPIKIELPNGSVKEGKKWNTTPLDIAKELSKSLASN  384
            +  RI +F+ +K+    +      +PI I LP+G+ KEG  W TTPL IA  ++KSLA  
Sbjct  42   LQHRIDMFDRLKAAADAEIAQKPREPITITLPDGTQKEGTSWETTPLSIALGIAKSLAER  101

Query  385  ALISKVNGVLWDMSRPLEGDCKLELFTFDSDEGRDTFWHSSAHILGQSVEMKYGCKLCIG  564
             +ISKV+G LWD++RPLEG CKLEL  FD+DEG+  FWHSSAH+LG++ E  Y C LCIG
Sbjct  102  TVISKVDGELWDLTRPLEGSCKLELLDFDNDEGKMVFWHSSAHMLGEACERHYACNLCIG  161

Query  565  P  567
            P
Sbjct  162  P  162



>ref|XP_002991732.1| hypothetical protein SELMODRAFT_134156 [Selaginella moellendorffii]
 gb|EFJ07136.1| hypothetical protein SELMODRAFT_134156 [Selaginella moellendorffii]
Length=647

 Score =   140 bits (353),  Expect = 3e-35, Method: Composition-based stats.
 Identities = 68/127 (54%), Positives = 91/127 (72%), Gaps = 2/127 (2%)
 Frame = +1

Query  202  VIPKRISLFESIKsqqqlqrlslsPDPIKIE-LPNGSV-KEGKKWNTTPLDIAKELSKSL  375
            VI KRI +F  +++ ++ +   L   PI +  L +G V   G++  TTPLDIA+ +SK  
Sbjct  6    VIQKRIRIFSELQASERARNEELGGQPIDVTVLKDGEVVYPGRRLLTTPLDIARLISKKK  65

Query  376  ASNALISKVNGVLWDMSRPLEGDCKLELFTFDSDEGRDTFWHSSAHILGQSVEMKYGCKL  555
            A++ +I++VNG LWDM RPLE DC L L+ F  ++GRDTFWHSSAHILG+S+E  YGCKL
Sbjct  66   AADYVIAQVNGTLWDMGRPLEEDCTLVLYAFKDEQGRDTFWHSSAHILGESLEQAYGCKL  125

Query  556  CIGPCTT  576
            CIGPCTT
Sbjct  126  CIGPCTT  132



>gb|EMD37085.1| hypothetical protein CERSUDRAFT_84103 [Ceriporiopsis subvermispora 
B]
Length=723

 Score =   141 bits (355),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 63/120 (53%), Positives = 85/120 (71%), Gaps = 0/120 (0%)
 Frame = +1

Query  214  RISLFESIKsqqqlqrlslsPDPIKIELPNGSVKEGKKWNTTPLDIAKELSKSLASNALI  393
            RI +FE +K++      +   + I I LP+GSV++GK W T+P+D+AKE+SK LA   +I
Sbjct  57   RIKIFEKLKAEYDEWVKAQPREEIDITLPDGSVRKGKSWETSPMDVAKEISKGLADRIVI  116

Query  394  SKVNGVLWDMSRPLEGDCKLELFTFDSDEGRDTFWHSSAHILGQSVEMKYGCKLCIGPCT  573
            +KVN  +WD+ RPLEG CKLEL  F+  EG+  FWHSSAH+LG++ E  YGC LCIGP T
Sbjct  117  AKVNDNVWDLERPLEGSCKLELLDFEHPEGKRVFWHSSAHVLGEAAERHYGCHLCIGPPT  176



>gb|KDN39007.1| threonyl-tRNA synthetase [Tilletiaria anomala UBC 951]
Length=756

 Score =   141 bits (355),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 69/127 (54%), Positives = 87/127 (69%), Gaps = 1/127 (1%)
 Frame = +1

Query  199  SVIPKRISLFESIKsqqqlqrlslsPDPIKIELPNGSVKEGKKWNTTPLDIAKELSKSLA  378
            S    RI LFE +K++Q     +   D I I LP+GS K GK W T+P+DIAK +SKSLA
Sbjct  72   SFFSHRIQLFEKLKAEQDAHAAAQPRDGINITLPDGSNKPGKAWETSPMDIAKAISKSLA  131

Query  379  SNALISKVNG-VLWDMSRPLEGDCKLELFTFDSDEGRDTFWHSSAHILGQSVEMKYGCKL  555
               +ISKV+   LWD+ RPLE  CK+E F F+SDEG+  FWHSSAH+LG++ E  YGC L
Sbjct  132  ERIVISKVDDETLWDLERPLEKSCKVEFFDFNSDEGKRVFWHSSAHVLGEAAEQHYGCHL  191

Query  556  CIGPCTT  576
            CIGP T+
Sbjct  192  CIGPPTS  198



>dbj|GAK66757.1| threonyl-tRNA synthetase [Pseudozyma antarctica]
Length=760

 Score =   141 bits (355),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 64/120 (53%), Positives = 88/120 (73%), Gaps = 0/120 (0%)
 Frame = +1

Query  214  RISLFESIKsqqqlqrlslsPDPIKIELPNGSVKEGKKWNTTPLDIAKELSKSLASNALI  393
            RI++FE +K++Q  +  +    PI + +P+GS +EG  + T+P+DIAK +SKSL+   +I
Sbjct  86   RIAMFEKLKAEQDAELAAKPRQPITVTMPDGSKREGTSFETSPMDIAKAISKSLSERIVI  145

Query  394  SKVNGVLWDMSRPLEGDCKLELFTFDSDEGRDTFWHSSAHILGQSVEMKYGCKLCIGPCT  573
            SKV+  LWD+ RPLE DCKLELF F+S EG+  FWHSSAH+LG++ E  YGC LCIGP T
Sbjct  146  SKVDDTLWDLERPLEADCKLELFDFESAEGKRVFWHSSAHVLGEACEKHYGCHLCIGPPT  205



>ref|XP_011391697.1| putative threonine--tRNA ligase THS1 [Ustilago maydis 521]
 gb|KIS66786.1| putative threonine--tRNA ligase THS1 [Ustilago maydis 521]
Length=759

 Score =   141 bits (355),  Expect = 5e-35, Method: Compositional matrix adjust.
 Identities = 65/120 (54%), Positives = 90/120 (75%), Gaps = 0/120 (0%)
 Frame = +1

Query  214  RISLFESIKsqqqlqrlslsPDPIKIELPNGSVKEGKKWNTTPLDIAKELSKSLASNALI  393
            RI++FE +K++Q  Q  ++   PI + +P+GS ++G  + T+P+DIAK++SKSL+   +I
Sbjct  85   RIAMFEKLKAEQDAQIAAMPRQPITVTMPDGSTRQGICYETSPMDIAKQISKSLSERIVI  144

Query  394  SKVNGVLWDMSRPLEGDCKLELFTFDSDEGRDTFWHSSAHILGQSVEMKYGCKLCIGPCT  573
            SKV+  LWD+ RPLE DCKLELF FDS EG+  FWHSSAH+LG++ E  YGC LCIGP T
Sbjct  145  SKVDDNLWDLERPLEADCKLELFDFDSPEGKRVFWHSSAHVLGEACEKHYGCHLCIGPPT  204



>ref|XP_002989765.1| hypothetical protein SELMODRAFT_130418 [Selaginella moellendorffii]
 gb|EFJ09242.1| hypothetical protein SELMODRAFT_130418 [Selaginella moellendorffii]
Length=647

 Score =   140 bits (352),  Expect = 5e-35, Method: Composition-based stats.
 Identities = 66/128 (52%), Positives = 90/128 (70%), Gaps = 2/128 (2%)
 Frame = +1

Query  199  SVIPKRISLFESIKsqqqlqrlslsPDPIKIELPNGS--VKEGKKWNTTPLDIAKELSKS  372
            +VI KRI +F  +++ ++ +   L   PI + +      V  G++  TTPLDIA+ +SK 
Sbjct  5    AVIQKRIRIFSELQASERARNEKLGGQPIDVTVHKDGEVVYPGRRLLTTPLDIARLISKK  64

Query  373  LASNALISKVNGVLWDMSRPLEGDCKLELFTFDSDEGRDTFWHSSAHILGQSVEMKYGCK  552
             A++ +I++VNG LWDM RPLE DC L L+ F  ++GRDTFWHSSAHILG+S+E  YGCK
Sbjct  65   KAADYVIAQVNGTLWDMGRPLEEDCTLVLYAFKDEQGRDTFWHSSAHILGESLEQAYGCK  124

Query  553  LCIGPCTT  576
            LCIGPCTT
Sbjct  125  LCIGPCTT  132



>gb|KIJ63654.1| hypothetical protein HYDPIDRAFT_175966 [Hydnomerulius pinastri 
MD-312]
Length=728

 Score =   140 bits (354),  Expect = 5e-35, Method: Compositional matrix adjust.
 Identities = 63/125 (50%), Positives = 87/125 (70%), Gaps = 0/125 (0%)
 Frame = +1

Query  199  SVIPKRISLFESIKsqqqlqrlslsPDPIKIELPNGSVKEGKKWNTTPLDIAKELSKSLA  378
            + I +RI LFE ++++      +   + I I +P+GS ++G  W T+P+DIAKE+SKSL+
Sbjct  51   AYIDQRIKLFEQLQAEHSDFVKAQPREDITITMPDGSERKGTSWETSPMDIAKEVSKSLS  110

Query  379  SNALISKVNGVLWDMSRPLEGDCKLELFTFDSDEGRDTFWHSSAHILGQSVEMKYGCKLC  558
               +I+KVNG LWD+ RPLE  CKLEL  F+  EG+  FWHSSAH+LG++ E  YGC LC
Sbjct  111  ERVVIAKVNGDLWDLERPLEASCKLELLDFEHPEGKRVFWHSSAHVLGEAAERHYGCHLC  170

Query  559  IGPCT  573
            IGP T
Sbjct  171  IGPPT  175



>dbj|GAN09335.1| threonyl-tRNA synthetase [Mucor ambiguus]
Length=716

 Score =   140 bits (353),  Expect = 6e-35, Method: Compositional matrix adjust.
 Identities = 65/132 (49%), Positives = 87/132 (66%), Gaps = 0/132 (0%)
 Frame = +1

Query  172  HPKDDAYLQSVIPKRISLFESIKsqqqlqrlslsPDPIKIELPNGSVKEGKKWNTTPLDI  351
            HP +       +  RI +F+ +K+    +      +PI I LP+G+ KEG  W TTPL I
Sbjct  31   HPLEITPAPEFLQHRIDMFDKLKAAADAEIAQKPREPITITLPDGTQKEGTSWETTPLSI  90

Query  352  AKELSKSLASNALISKVNGVLWDMSRPLEGDCKLELFTFDSDEGRDTFWHSSAHILGQSV  531
            A  ++KSLA   +ISKV+G LWD++RPLE  CKLEL  F++DEG+  FWHSSAH+LG++ 
Sbjct  91   ALGIAKSLAERTVISKVDGELWDLTRPLEASCKLELLDFENDEGKMVFWHSSAHMLGEAC  150

Query  532  EMKYGCKLCIGP  567
            E  YGC LCIGP
Sbjct  151  ERHYGCNLCIGP  162



>dbj|GAC77380.1| threonyl-trna synthetase [Pseudozyma antarctica T-34]
Length=759

 Score =   140 bits (352),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 63/120 (53%), Positives = 88/120 (73%), Gaps = 0/120 (0%)
 Frame = +1

Query  214  RISLFESIKsqqqlqrlslsPDPIKIELPNGSVKEGKKWNTTPLDIAKELSKSLASNALI  393
            RI++FE +K++Q  +  +    PI + +P+GS +EG  + T+P+DIAK +SKSL+   +I
Sbjct  85   RIAMFEKLKAEQDAELAAKPRQPITVTMPDGSKREGTSFETSPMDIAKAISKSLSERIVI  144

Query  394  SKVNGVLWDMSRPLEGDCKLELFTFDSDEGRDTFWHSSAHILGQSVEMKYGCKLCIGPCT  573
            SKV+  LWD+ RPLE DC+LELF F+S EG+  FWHSSAH+LG++ E  YGC LCIGP T
Sbjct  145  SKVDDTLWDLERPLEADCRLELFDFESPEGKRVFWHSSAHVLGEACEKHYGCHLCIGPPT  204



>gb|ETS60492.1| hypothetical protein PaG_05336 [Pseudozyma aphidis DSM 70725]
Length=757

 Score =   140 bits (352),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 63/120 (53%), Positives = 88/120 (73%), Gaps = 0/120 (0%)
 Frame = +1

Query  214  RISLFESIKsqqqlqrlslsPDPIKIELPNGSVKEGKKWNTTPLDIAKELSKSLASNALI  393
            RI++FE +K++Q  +  +    PI + +P+GS +EG  + T+P+DIAK +SKSL+   +I
Sbjct  83   RIAMFEKLKAEQDAEFAAKPRQPITVTMPDGSKREGTSFETSPMDIAKAISKSLSERIVI  142

Query  394  SKVNGVLWDMSRPLEGDCKLELFTFDSDEGRDTFWHSSAHILGQSVEMKYGCKLCIGPCT  573
            SKV+  LWD+ RPLE DC+LELF F+S EG+  FWHSSAH+LG++ E  YGC LCIGP T
Sbjct  143  SKVDDTLWDLERPLEADCRLELFDFESPEGKRVFWHSSAHVLGEACEKHYGCHLCIGPPT  202



>gb|EIE81909.1| hypothetical protein RO3G_06614 [Rhizopus delemar RA 99-880]
Length=713

 Score =   139 bits (351),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 65/126 (52%), Positives = 86/126 (68%), Gaps = 4/126 (3%)
 Frame = +1

Query  190  YLQSVIPKRISLFESIKsqqqlqrlslsPDPIKIELPNGSVKEGKKWNTTPLDIAKELSK  369
            YLQ     RI LFE +K +   +      +PI I LP+GSVKEG  W TTP+ IA  ++K
Sbjct  28   YLQH----RIDLFEKLKKEADEEIAKKPREPITITLPDGSVKEGTSWETTPISIAVGIAK  83

Query  370  SLASNALISKVNGVLWDMSRPLEGDCKLELFTFDSDEGRDTFWHSSAHILGQSVEMKYGC  549
            SLA   +I+KV+G LWD++RP E  C+LEL  F+++EG+  FWHSSAH+LG++ E  YGC
Sbjct  84   SLAERTVIAKVDGELWDLTRPFEKSCQLELLDFENEEGKKVFWHSSAHMLGEACERHYGC  143

Query  550  KLCIGP  567
             LCIGP
Sbjct  144  HLCIGP  149



>emb|CCV00396.1| unnamed protein product [Malassezia sympodialis ATCC 42132]
Length=737

 Score =   139 bits (351),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 63/120 (53%), Positives = 86/120 (72%), Gaps = 0/120 (0%)
 Frame = +1

Query  214  RISLFESIKsqqqlqrlslsPDPIKIELPNGSVKEGKKWNTTPLDIAKELSKSLASNALI  393
            RI +FE +K++Q   R +    PI I +P+GS +EG KW T+P+D+A+++SKSL+   +I
Sbjct  60   RIDMFERVKAEQDAARAAAERSPIVITMPDGSTREGTKWETSPMDVARQISKSLSERVVI  119

Query  394  SKVNGVLWDMSRPLEGDCKLELFTFDSDEGRDTFWHSSAHILGQSVEMKYGCKLCIGPCT  573
            SKVNG LWD+ RPLE +  LEL  F+  EG+  FWHSSAH+LG++ E  YGC LCIGP T
Sbjct  120  SKVNGQLWDLERPLEDNVTLELLDFEHPEGKRVFWHSSAHVLGEAAERHYGCHLCIGPPT  179



>gb|KIP05628.1| hypothetical protein PHLGIDRAFT_24993 [Phlebiopsis gigantea 11061_1 
CR5-6]
Length=730

 Score =   139 bits (351),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 63/120 (53%), Positives = 83/120 (69%), Gaps = 0/120 (0%)
 Frame = +1

Query  214  RISLFESIKsqqqlqrlslsPDPIKIELPNGSVKEGKKWNTTPLDIAKELSKSLASNALI  393
            RI +FE +K++          + I+I LP+GS ++G  W T+PLDIAKE+SK LA   +I
Sbjct  59   RIKIFEKLKAEYDEWVKVQPREEIEITLPDGSKRKGTSWETSPLDIAKEISKGLADRIVI  118

Query  394  SKVNGVLWDMSRPLEGDCKLELFTFDSDEGRDTFWHSSAHILGQSVEMKYGCKLCIGPCT  573
            SKV+G +WD+ RPLEG C LEL  F+  EG+  FWHSSAH+LG++ E  YGC LCIGP T
Sbjct  119  SKVDGAVWDLERPLEGSCSLELLDFEHPEGKRVFWHSSAHVLGEAAERHYGCHLCIGPPT  178



>ref|XP_006455238.1| hypothetical protein AGABI2DRAFT_226641 [Agaricus bisporus var. 
bisporus H97]
 gb|EKV43973.1| hypothetical protein AGABI2DRAFT_226641 [Agaricus bisporus var. 
bisporus H97]
Length=721

 Score =   139 bits (349),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 65/120 (54%), Positives = 83/120 (69%), Gaps = 0/120 (0%)
 Frame = +1

Query  214  RISLFESIKsqqqlqrlslsPDPIKIELPNGSVKEGKKWNTTPLDIAKELSKSLASNALI  393
            RI +F+ +K +      +   + I I LP+GS ++GK W T+PLDIAK LSKSLA   +I
Sbjct  56   RIKMFDELKVKYDAFVAAQPREEITITLPDGSERKGKSWETSPLDIAKLLSKSLADRVVI  115

Query  394  SKVNGVLWDMSRPLEGDCKLELFTFDSDEGRDTFWHSSAHILGQSVEMKYGCKLCIGPCT  573
            SKV+GVLWD+ RPLE   KLEL  F+  EG+  FWHSSAH+LG++ E  YGC LCIGP T
Sbjct  116  SKVDGVLWDLERPLEKSVKLELLDFEHPEGKKVFWHSSAHVLGEAAERHYGCHLCIGPPT  175



>gb|KJA25358.1| hypothetical protein HYPSUDRAFT_64939 [Hypholoma sublateritium 
FD-334 SS-4]
Length=724

 Score =   139 bits (349),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 60/120 (50%), Positives = 86/120 (72%), Gaps = 0/120 (0%)
 Frame = +1

Query  214  RISLFESIKsqqqlqrlslsPDPIKIELPNGSVKEGKKWNTTPLDIAKELSKSLASNALI  393
            RI +F+ +K++      +   D I + +P+GS ++GK W T+P+D+AKE+SKSL+   +I
Sbjct  57   RIKIFDELKAEYDAFVAAQPRDEITVTMPDGSERKGKAWETSPMDVAKEVSKSLSERIVI  116

Query  394  SKVNGVLWDMSRPLEGDCKLELFTFDSDEGRDTFWHSSAHILGQSVEMKYGCKLCIGPCT  573
            +KV+GVLWD+ RPLE  CKLEL  F+  EG+  FWHSSAH+LG++ E  YGC LC+GP T
Sbjct  117  AKVDGVLWDLDRPLEKACKLELLDFEHPEGKRVFWHSSAHVLGEAAERHYGCHLCLGPPT  176



>gb|ESW99362.1| Threonine--tRNA ligase, cytoplasmic [Ogataea parapolymorpha DL-1]
Length=714

 Score =   138 bits (348),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 67/123 (54%), Positives = 80/123 (65%), Gaps = 0/123 (0%)
 Frame = +1

Query  205  IPKRISLFESIKsqqqlqrlslsPDPIKIELPNGSVKEGKKWNTTPLDIAKELSKSLASN  384
            I  RI +FE IK++Q  +  +    PIK+ L +G+VKE   W TTP DIAKE+ KS    
Sbjct  43   IEHRIRIFERIKARQDAELAAKERLPIKVTLKDGTVKEATSWETTPFDIAKEIGKSFCER  102

Query  385  ALISKVNGVLWDMSRPLEGDCKLELFTFDSDEGRDTFWHSSAHILGQSVEMKYGCKLCIG  564
             +ISKVNG LWD+ RP E D KLE F FDS EG+  FWHSSAHILG+  E  YG  LC G
Sbjct  103  QVISKVNGELWDLERPFEADSKLEFFDFDSPEGKQVFWHSSAHILGEGCENHYGAHLCFG  162

Query  565  PCT  573
            P T
Sbjct  163  PPT  165



>gb|KIM53290.1| hypothetical protein SCLCIDRAFT_1222926 [Scleroderma citrinum 
Foug A]
Length=715

 Score =   138 bits (348),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 62/123 (50%), Positives = 85/123 (69%), Gaps = 0/123 (0%)
 Frame = +1

Query  205  IPKRISLFESIKsqqqlqrlslsPDPIKIELPNGSVKEGKKWNTTPLDIAKELSKSLASN  384
            I  RI +FE ++ +  +   S   + I I +P+GS ++G  W T+P+DIAKE+SKSL+  
Sbjct  40   IDHRIKMFEQLQEEYDVFVKSQQREEITITMPDGSQRKGTSWETSPMDIAKEVSKSLSER  99

Query  385  ALISKVNGVLWDMSRPLEGDCKLELFTFDSDEGRDTFWHSSAHILGQSVEMKYGCKLCIG  564
             +I+KVNG LWD+ RPLE  CK+EL  F+  EG+  FWHSSAH+LG++ E  YGC LCIG
Sbjct  100  VVIAKVNGELWDLERPLESSCKVELLDFEHPEGKRVFWHSSAHVLGEAAERHYGCHLCIG  159

Query  565  PCT  573
            P T
Sbjct  160  PPT  162



>gb|KFH73555.1| threonyl-tRNA synthetase [Mortierella verticillata NRRL 6337]
Length=725

 Score =   138 bits (348),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 59/121 (49%), Positives = 85/121 (70%), Gaps = 0/121 (0%)
 Frame = +1

Query  205  IPKRISLFESIKsqqqlqrlslsPDPIKIELPNGSVKEGKKWNTTPLDIAKELSKSLASN  384
            +  RI++F+ +K +      +    PI I +P+GSV+EG  W T+P+DIAK ++KSL+  
Sbjct  54   VAHRIAMFDELKKKSDAADAAQPRVPITITMPDGSVREGTAWETSPMDIAKSIAKSLSER  113

Query  385  ALISKVNGVLWDMSRPLEGDCKLELFTFDSDEGRDTFWHSSAHILGQSVEMKYGCKLCIG  564
             +I+KV+ VLWD+ RPL   CKLEL  F+++EG+  FWHSSAH+LG++ E  YGC LCIG
Sbjct  114  VVIAKVDKVLWDLERPLVASCKLELLDFENEEGKSVFWHSSAHVLGEACEKHYGCHLCIG  173

Query  565  P  567
            P
Sbjct  174  P  174



>ref|XP_007769801.1| threonyl-tRNA synthetase [Coniophora puteana RWD-64-598 SS2]
 gb|EIW79924.1| threonyl-tRNA synthetase [Coniophora puteana RWD-64-598 SS2]
Length=757

 Score =   138 bits (348),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 61/120 (51%), Positives = 83/120 (69%), Gaps = 0/120 (0%)
 Frame = +1

Query  214  RISLFESIKsqqqlqrlslsPDPIKIELPNGSVKEGKKWNTTPLDIAKELSKSLASNALI  393
            RI +FE ++++      +     I + LP+GS ++G  W T+P+DIAKE+SK L+   +I
Sbjct  77   RIQIFEKLQAEHTEWVKAQPRQEITVTLPDGSERKGTSWETSPMDIAKEISKGLSEKVVI  136

Query  394  SKVNGVLWDMSRPLEGDCKLELFTFDSDEGRDTFWHSSAHILGQSVEMKYGCKLCIGPCT  573
            +KV+G LWD+ RPLE  CKL L  F+SDEG+  FWHSSAH+LG+S E  YGC LCIGP T
Sbjct  137  AKVDGTLWDLERPLEASCKLVLLDFESDEGKRVFWHSSAHVLGESAERHYGCHLCIGPPT  196



>emb|CEJ02301.1| Putative Threonyl-tRNA synthetase [Rhizopus microsporus]
Length=431

 Score =   135 bits (340),  Expect = 5e-34, Method: Compositional matrix adjust.
 Identities = 64/126 (51%), Positives = 84/126 (67%), Gaps = 4/126 (3%)
 Frame = +1

Query  190  YLQSVIPKRISLFESIKsqqqlqrlslsPDPIKIELPNGSVKEGKKWNTTPLDIAKELSK  369
            YLQ     RI LF+  K +   +      +PI I LP+GS KEG  W TTPL +A ++SK
Sbjct  41   YLQH----RIELFDKWKKEADEEIAKKPREPITITLPDGSTKEGVSWETTPLSLAADISK  96

Query  370  SLASNALISKVNGVLWDMSRPLEGDCKLELFTFDSDEGRDTFWHSSAHILGQSVEMKYGC  549
            SLA   +I+KV+G LWD++RPLE  C L+L  F++DE +  FWHSSAH+LG++ E  YGC
Sbjct  97   SLAERTIIAKVDGDLWDLTRPLEKSCNLQLLDFENDEAKKVFWHSSAHMLGEACERHYGC  156

Query  550  KLCIGP  567
             LCIGP
Sbjct  157  HLCIGP  162



>gb|KIK27269.1| hypothetical protein PISMIDRAFT_28163 [Pisolithus microcarpus 
441]
Length=728

 Score =   137 bits (346),  Expect = 5e-34, Method: Compositional matrix adjust.
 Identities = 61/127 (48%), Positives = 85/127 (67%), Gaps = 0/127 (0%)
 Frame = +1

Query  193  LQSVIPKRISLFESIKsqqqlqrlslsPDPIKIELPNGSVKEGKKWNTTPLDIAKELSKS  372
            L + +  RI +FE ++ +      +   + I I +P+GS ++G  W T+P+D+AKE+SKS
Sbjct  49   LPNYVDHRIKMFEQLQQEYTEFVKAQPREEITITMPDGSQRKGTSWETSPMDVAKEVSKS  108

Query  373  LASNALISKVNGVLWDMSRPLEGDCKLELFTFDSDEGRDTFWHSSAHILGQSVEMKYGCK  552
            L+   +I+KVN  LWD+ RPLE  CKLEL  FD  EG+  FWHSSAH+LG++ E  YGC 
Sbjct  109  LSERIVIAKVNDQLWDLERPLESSCKLELLDFDHPEGKRVFWHSSAHVLGEAAERHYGCH  168

Query  553  LCIGPCT  573
            LCIGP T
Sbjct  169  LCIGPPT  175



>gb|KIO11143.1| hypothetical protein M404DRAFT_13351 [Pisolithus tinctorius Marx 
270]
Length=639

 Score =   137 bits (344),  Expect = 5e-34, Method: Compositional matrix adjust.
 Identities = 61/123 (50%), Positives = 83/123 (67%), Gaps = 0/123 (0%)
 Frame = +1

Query  205  IPKRISLFESIKsqqqlqrlslsPDPIKIELPNGSVKEGKKWNTTPLDIAKELSKSLASN  384
            I  RI +FE ++        +   + I I +P+GS ++G  W T+P+D+AKE+SKSL+  
Sbjct  53   IDHRIKMFEQLQQDYIEFVKAQPREEITITMPDGSERKGMSWETSPMDVAKEVSKSLSER  112

Query  385  ALISKVNGVLWDMSRPLEGDCKLELFTFDSDEGRDTFWHSSAHILGQSVEMKYGCKLCIG  564
             +I+KV+G LWD+ RPLE  CKLEL  FD  EG+  FWHSSAH+LG++ E  YGC LCIG
Sbjct  113  IVIAKVDGELWDLERPLERSCKLELLDFDHPEGKRVFWHSSAHVLGEAAERHYGCHLCIG  172

Query  565  PCT  573
            P T
Sbjct  173  PPT  175



>emb|CDI55881.1| probable THS1-threonyl tRNA synthetase, cytosolic [Melanopsichium 
pennsylvanicum 4]
Length=770

 Score =   138 bits (347),  Expect = 5e-34, Method: Compositional matrix adjust.
 Identities = 62/120 (52%), Positives = 89/120 (74%), Gaps = 0/120 (0%)
 Frame = +1

Query  214  RISLFESIKsqqqlqrlslsPDPIKIELPNGSVKEGKKWNTTPLDIAKELSKSLASNALI  393
            RI++FE +K++Q  +  +    PI + +P+GS ++   ++T+P+DIAK++SKSL+   +I
Sbjct  95   RIAMFEKLKAEQDAEFAAKPRQPITVTMPDGSTRQVTSYDTSPMDIAKDISKSLSERIVI  154

Query  394  SKVNGVLWDMSRPLEGDCKLELFTFDSDEGRDTFWHSSAHILGQSVEMKYGCKLCIGPCT  573
            SKV+  LWD+ RPLE DCKLELF F+S EG+  FWHSSAH+LG++ E  YGC LCIGP T
Sbjct  155  SKVDDNLWDLERPLEADCKLELFDFESPEGKRVFWHSSAHVLGEACEKHYGCHLCIGPPT  214



>emb|CDO68587.1| hypothetical protein BN946_scf184996.g18 [Trametes cinnabarina]
Length=729

 Score =   137 bits (346),  Expect = 6e-34, Method: Compositional matrix adjust.
 Identities = 60/120 (50%), Positives = 82/120 (68%), Gaps = 0/120 (0%)
 Frame = +1

Query  214  RISLFESIKsqqqlqrlslsPDPIKIELPNGSVKEGKKWNTTPLDIAKELSKSLASNALI  393
            R+ +FE +K+       +     I + LP+GS ++G  W TTP+D+AKE+++SLA   +I
Sbjct  56   RLKIFEKLKADYDEWVKNQPRQEITVTLPDGSQRKGTSWETTPMDVAKEIAQSLADRVVI  115

Query  394  SKVNGVLWDMSRPLEGDCKLELFTFDSDEGRDTFWHSSAHILGQSVEMKYGCKLCIGPCT  573
            +KVNG LWD+ RPLEG C LEL  F+  EG+  FWHSSAH+LG++ E  YGC LCIGP T
Sbjct  116  AKVNGELWDLERPLEGSCNLELLDFEHPEGKRVFWHSSAHVLGEAAERHYGCHLCIGPPT  175



>emb|CEI97578.1| Putative Threonyl-trna synthetase [Rhizopus microsporus]
Length=463

 Score =   135 bits (340),  Expect = 8e-34, Method: Compositional matrix adjust.
 Identities = 64/126 (51%), Positives = 84/126 (67%), Gaps = 4/126 (3%)
 Frame = +1

Query  190  YLQSVIPKRISLFESIKsqqqlqrlslsPDPIKIELPNGSVKEGKKWNTTPLDIAKELSK  369
            YLQ     RI LF+  K +   +      +PI I LP+GS KEG  W TTPL +A ++SK
Sbjct  41   YLQH----RIGLFDKWKKEADEEIAKKPREPITITLPDGSTKEGISWETTPLSLAADISK  96

Query  370  SLASNALISKVNGVLWDMSRPLEGDCKLELFTFDSDEGRDTFWHSSAHILGQSVEMKYGC  549
            SLA   +I+KV+G LWD++RPLE  C L+L  F++DE +  FWHSSAH+LG++ E  YGC
Sbjct  97   SLAERTIIAKVDGDLWDLTRPLEKSCNLQLLDFENDEAKKVFWHSSAHMLGEACERHYGC  156

Query  550  KLCIGP  567
             LCIGP
Sbjct  157  HLCIGP  162



>ref|XP_002432585.1| Threonyl-tRNA synthetase, cytoplasmic, putative [Pediculus humanus 
corporis]
 gb|EEB19847.1| Threonyl-tRNA synthetase, cytoplasmic, putative [Pediculus humanus 
corporis]
Length=717

 Score =   137 bits (344),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 62/123 (50%), Positives = 87/123 (71%), Gaps = 0/123 (0%)
 Frame = +1

Query  199  SVIPKRISLFESIKsqqqlqrlslsPDPIKIELPNGSVKEGKKWNTTPLDIAKELSKSLA  378
            + I +R  L+  +K+  + +  S + +PIKI LP+G + EG+ W T+P DIAK +S+ LA
Sbjct  50   NYIEERNVLWNKLKTAYEAEIASKTSNPIKITLPDGKIVEGESWKTSPYDIAKGISQGLA  109

Query  379  SNALISKVNGVLWDMSRPLEGDCKLELFTFDSDEGRDTFWHSSAHILGQSVEMKYGCKLC  558
             N +I+KVNGVLWD+ RPLE DCKL+L  FD +E +  FWHS+AHILG+++E  YG  LC
Sbjct  110  DNTVIAKVNGVLWDLERPLESDCKLQLLKFDDEEAQQVFWHSTAHILGEALERLYGGHLC  169

Query  559  IGP  567
             GP
Sbjct  170  YGP  172



>ref|XP_009550526.1| hypothetical protein HETIRDRAFT_65578 [Heterobasidion irregulare 
TC 32-1]
 gb|ETW77277.1| hypothetical protein HETIRDRAFT_65578 [Heterobasidion irregulare 
TC 32-1]
Length=739

 Score =   137 bits (344),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 63/134 (47%), Positives = 89/134 (66%), Gaps = 0/134 (0%)
 Frame = +1

Query  172  HPKDDAYLQSVIPKRISLFESIKsqqqlqrlslsPDPIKIELPNGSVKEGKKWNTTPLDI  351
            HP +     +    RI +F+ +K++      +   + I I LP+GS ++G  W T+P+D+
Sbjct  45   HPLEMQPAPAFFDHRIKIFDRLKAEHDAFVAAQPREEIAITLPDGSQRKGTSWETSPMDV  104

Query  352  AKELSKSLASNALISKVNGVLWDMSRPLEGDCKLELFTFDSDEGRDTFWHSSAHILGQSV  531
            AKE+SKSL+   +I+KV+ VLWD+ RPLEG CKLEL  F+  EG+  FWHSSAH+LG++ 
Sbjct  105  AKEISKSLSERLVIAKVDDVLWDLERPLEGPCKLELLDFEHPEGKKVFWHSSAHVLGEAS  164

Query  532  EMKYGCKLCIGPCT  573
            E  YGC LCIGP T
Sbjct  165  ERHYGCHLCIGPPT  178



>gb|ELU38637.1| Ths1p [Rhizoctonia solani AG-1 IA]
Length=752

 Score =   137 bits (344),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 60/120 (50%), Positives = 82/120 (68%), Gaps = 0/120 (0%)
 Frame = +1

Query  214  RISLFESIKsqqqlqrlslsPDPIKIELPNGSVKEGKKWNTTPLDIAKELSKSLASNALI  393
            RI +++ +K +      +   +PI I LP+GS KEGK W T+P+ IA +LSKSL+   +I
Sbjct  90   RIQIYDKLKKEYDEFVSAQPREPITITLPDGSTKEGKSWETSPMSIAAQLSKSLSERVVI  149

Query  394  SKVNGVLWDMSRPLEGDCKLELFTFDSDEGRDTFWHSSAHILGQSVEMKYGCKLCIGPCT  573
            +KV+G LWD+ RPLE  C LEL  F+  EG+  FWHSSAH+LG++ E  YGC LC+GP T
Sbjct  150  AKVDGNLWDLERPLEKSCSLELLDFEHPEGKRVFWHSSAHVLGEAAEKHYGCHLCVGPPT  209



>emb|CCO30571.1| threonyl-tRNA synthetase [Rhizoctonia solani AG-1 IB]
Length=622

 Score =   135 bits (341),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 60/120 (50%), Positives = 82/120 (68%), Gaps = 0/120 (0%)
 Frame = +1

Query  214  RISLFESIKsqqqlqrlslsPDPIKIELPNGSVKEGKKWNTTPLDIAKELSKSLASNALI  393
            RI +++ +K +      +   +PI I LP+GS KEGK W T+P+ IA +LSKSL+   +I
Sbjct  57   RIQIYDKLKKEYDEFVAAQPREPITITLPDGSTKEGKSWETSPMAIAAQLSKSLSERVVI  116

Query  394  SKVNGVLWDMSRPLEGDCKLELFTFDSDEGRDTFWHSSAHILGQSVEMKYGCKLCIGPCT  573
            +KV+G LWD+ RPLE  C LEL  F+  EG+  FWHSSAH+LG++ E  YGC LC+GP T
Sbjct  117  AKVDGGLWDLERPLEKSCSLELLDFEHPEGKRVFWHSSAHVLGEAAEKHYGCHLCVGPPT  176



>dbj|GAA98628.1| hypothetical protein E5Q_05315 [Mixia osmundae IAM 14324]
 gb|KEI38990.1| hypothetical protein L969DRAFT_88382 [Mixia osmundae IAM 14324]
Length=798

 Score =   137 bits (344),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 62/123 (50%), Positives = 90/123 (73%), Gaps = 0/123 (0%)
 Frame = +1

Query  205  IPKRISLFESIKsqqqlqrlslsPDPIKIELPNGSVKEGKKWNTTPLDIAKELSKSLASN  384
            + +R++LFE +K++Q  +  + + + I+I LP+G VK+G  + T+P+ IA ++SK LA  
Sbjct  115  LARRLALFEQLKAEQDAELKNKAKEVIEITLPSGDVKKGTSYETSPMSIALDISKGLAEK  174

Query  385  ALISKVNGVLWDMSRPLEGDCKLELFTFDSDEGRDTFWHSSAHILGQSVEMKYGCKLCIG  564
             +I+KV+G LWD+ RPLE  CKLEL  F+S EG++ FWHSSAHILG++ E  YGC LCIG
Sbjct  175  TVIAKVDGDLWDLERPLEKSCKLELLDFESKEGKNVFWHSSAHILGEAAERHYGCHLCIG  234

Query  565  PCT  573
            P T
Sbjct  235  PPT  237



>ref|NP_001022034.1| Protein TARS-1, isoform b [Caenorhabditis elegans]
 emb|CAD89723.1| TARS-1, isoform b [Caenorhabditis elegans]
Length=684

 Score =   136 bits (342),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 62/131 (47%), Positives = 88/131 (67%), Gaps = 0/131 (0%)
 Frame = +1

Query  175  PKDDAYLQSVIPKRISLFESIKsqqqlqrlslsPDPIKIELPNGSVKEGKKWNTTPLDIA  354
            P D A   + I +RI L++ +K++   +  +   +PI+I LP+G + EGK W TTP +IA
Sbjct  5    PTDMAPWPAFIEERIKLWDKLKAEYDAEIAAKESEPIQITLPDGKIHEGKTWRTTPFEIA  64

Query  355  KELSKSLASNALISKVNGVLWDMSRPLEGDCKLELFTFDSDEGRDTFWHSSAHILGQSVE  534
            + +SK LA  A+I+KVNG +WD+ RP EG+ KLEL  FD DE +  FWHSSAH+LG+++E
Sbjct  65   ERISKGLAEAAVIAKVNGAVWDLDRPFEGNAKLELLKFDDDEAKQVFWHSSAHVLGEAME  124

Query  535  MKYGCKLCIGP  567
               G  LC GP
Sbjct  125  RYCGGHLCYGP  135



>ref|NP_001022033.1| Protein TARS-1, isoform a [Caenorhabditis elegans]
 sp|P52709.1|SYTC_CAEEL RecName: Full=Threonine--tRNA ligase, cytoplasmic; AltName: Full=Threonyl-tRNA 
synthetase; Short=ThrRS [Caenorhabditis elegans]
 emb|CAA93762.1| TARS-1, isoform a [Caenorhabditis elegans]
Length=725

 Score =   136 bits (342),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 62/131 (47%), Positives = 88/131 (67%), Gaps = 0/131 (0%)
 Frame = +1

Query  175  PKDDAYLQSVIPKRISLFESIKsqqqlqrlslsPDPIKIELPNGSVKEGKKWNTTPLDIA  354
            P D A   + I +RI L++ +K++   +  +   +PI+I LP+G + EGK W TTP +IA
Sbjct  46   PTDMAPWPAFIEERIKLWDKLKAEYDAEIAAKESEPIQITLPDGKIHEGKTWRTTPFEIA  105

Query  355  KELSKSLASNALISKVNGVLWDMSRPLEGDCKLELFTFDSDEGRDTFWHSSAHILGQSVE  534
            + +SK LA  A+I+KVNG +WD+ RP EG+ KLEL  FD DE +  FWHSSAH+LG+++E
Sbjct  106  ERISKGLAEAAVIAKVNGAVWDLDRPFEGNAKLELLKFDDDEAKQVFWHSSAHVLGEAME  165

Query  535  MKYGCKLCIGP  567
               G  LC GP
Sbjct  166  RYCGGHLCYGP  176



>gb|EPE06040.1| threonyl-trna synthetase [Ophiostoma piceae UAMH 11346]
Length=770

 Score =   136 bits (343),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 60/123 (49%), Positives = 85/123 (69%), Gaps = 0/123 (0%)
 Frame = +1

Query  205  IPKRISLFESIKsqqqlqrlslsPDPIKIELPNGSVKEGKKWNTTPLDIAKELSKSLASN  384
            IP R+++++ +K+    +  S+  +PI + LP+G   EG  W+T P DIA+ +SKSLA  
Sbjct  30   IPHRLAIYDRLKAVADAKVASMPREPITVTLPDGRKIEGTAWDTRPYDIARGISKSLADR  89

Query  385  ALISKVNGVLWDMSRPLEGDCKLELFTFDSDEGRDTFWHSSAHILGQSVEMKYGCKLCIG  564
             +ISKVNGVLWD+ RP EGD  +EL  F+ +E +  FWHSSAHILG++ E ++GC LC G
Sbjct  90   TVISKVNGVLWDLMRPFEGDAAVELLDFEDEEAKRVFWHSSAHILGEAAEKQFGCHLCFG  149

Query  565  PCT  573
            P T
Sbjct  150  PPT  152



>ref|XP_009919139.1| PREDICTED: probable threonine--tRNA ligase 2, cytoplasmic, partial 
[Haliaeetus albicilla]
Length=323

 Score =   132 bits (331),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 64/135 (47%), Positives = 88/135 (65%), Gaps = 3/135 (2%)
 Frame = +1

Query  172  HPKDDAYLQSVIPKRISLFESIKsqqqlqrlslsPD---PIKIELPNGSVKEGKKWNTTP  342
            H  D  Y  S I  R+ L+E++K +        + +   PIKI L +G + EG+ W TTP
Sbjct  38   HRNDLQYEPSFIEDRLKLYEALKKEHDALLAYRAANQSKPIKIILTDGKMTEGESWKTTP  97

Query  343  LDIAKELSKSLASNALISKVNGVLWDMSRPLEGDCKLELFTFDSDEGRDTFWHSSAHILG  522
              +A  +S+ LASNA+I+KVNG LWD+ RPLEGDC LEL  FD++E +  +WHSSAHILG
Sbjct  98   YQLAVGISQVLASNAVIAKVNGELWDLDRPLEGDCTLELLMFDNEEAKAVYWHSSAHILG  157

Query  523  QSVEMKYGCKLCIGP  567
            +++E  +G  LC GP
Sbjct  158  EAMEGYFGGCLCYGP  172



>emb|CEL59014.1| threonyl-tRNA synthetase [Rhizoctonia solani AG-1 IB]
Length=726

 Score =   135 bits (341),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 60/120 (50%), Positives = 82/120 (68%), Gaps = 0/120 (0%)
 Frame = +1

Query  214  RISLFESIKsqqqlqrlslsPDPIKIELPNGSVKEGKKWNTTPLDIAKELSKSLASNALI  393
            RI +++ +K +      +   +PI I LP+GS KEGK W T+P+ IA +LSKSL+   +I
Sbjct  57   RIQIYDKLKKEYDEFVAAQPREPITITLPDGSTKEGKSWETSPMAIAAQLSKSLSERVVI  116

Query  394  SKVNGVLWDMSRPLEGDCKLELFTFDSDEGRDTFWHSSAHILGQSVEMKYGCKLCIGPCT  573
            +KV+G LWD+ RPLE  C LEL  F+  EG+  FWHSSAH+LG++ E  YGC LC+GP T
Sbjct  117  AKVDGGLWDLERPLEKSCSLELLDFEHPEGKRVFWHSSAHVLGEAAEKHYGCHLCVGPPT  176



>gb|EJU01306.1| threonyl-tRNA synthetase [Dacryopinax sp. DJM-731 SS1]
Length=735

 Score =   135 bits (341),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 62/129 (48%), Positives = 88/129 (68%), Gaps = 4/129 (3%)
 Frame = +1

Query  187  AYLQSVIPKRISLFESIKsqqqlqrlslsPDPIKIELPNGSVKEGKKWNTTPLDIAKELS  366
            AY+Q    +RI ++  +K++Q           I++ LP+GSV++G  W T+P+ IA+E+S
Sbjct  60   AYMQ----ERIDMWNKLKAEQDEFYAKQPRQEIQVTLPDGSVRKGMSWETSPMMIAEEIS  115

Query  367  KSLASNALISKVNGVLWDMSRPLEGDCKLELFTFDSDEGRDTFWHSSAHILGQSVEMKYG  546
            KSLA   +I KV+G LWD+ RP+EG CKL+L  F+  EG+  FWHSSAH+LG++ E  YG
Sbjct  116  KSLAEKVVIGKVDGQLWDLHRPMEGSCKLQLLAFEDKEGQQVFWHSSAHVLGEAAERHYG  175

Query  547  CKLCIGPCT  573
            C LCIGP T
Sbjct  176  CHLCIGPPT  184



>gb|KFM74402.1| Threonine--tRNA ligase, cytoplasmic, partial [Stegodyphus mimosarum]
Length=670

 Score =   135 bits (339),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 62/123 (50%), Positives = 88/123 (72%), Gaps = 0/123 (0%)
 Frame = +1

Query  199  SVIPKRISLFESIKsqqqlqrlslsPDPIKIELPNGSVKEGKKWNTTPLDIAKELSKSLA  378
            S I +R+ ++E + +  + +  + +P+PI I LP+G V EG+ W TTP  IA+ +S+ LA
Sbjct  37   SYIQERLEMWEKLYADYKAELAAKTPNPITITLPDGKVVEGESWRTTPYQIAQGISQGLA  96

Query  379  SNALISKVNGVLWDMSRPLEGDCKLELFTFDSDEGRDTFWHSSAHILGQSVEMKYGCKLC  558
             + +I+KVNG LWD+ RPLE DCKLEL  FDS+EG+  FWHSSAH+LG+++E  YG  LC
Sbjct  97   DSVVIAKVNGELWDLDRPLELDCKLELKKFDSEEGKQVFWHSSAHMLGEAMERVYGGCLC  156

Query  559  IGP  567
             GP
Sbjct  157  YGP  159



>gb|KDQ13759.1| hypothetical protein BOTBODRAFT_44972 [Botryobasidium botryosum 
FD-172 SS1]
Length=736

 Score =   135 bits (341),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 59/120 (49%), Positives = 82/120 (68%), Gaps = 0/120 (0%)
 Frame = +1

Query  214  RISLFESIKsqqqlqrlslsPDPIKIELPNGSVKEGKKWNTTPLDIAKELSKSLASNALI  393
            RI +F+ +K++      +     I + +P+GS ++G  W T+P+DIAKE+SKSL+   +I
Sbjct  64   RIKIFDKLKAEHDEWLKNQPRQAISVTMPDGSARQGTSWETSPMDIAKEISKSLSERVVI  123

Query  394  SKVNGVLWDMSRPLEGDCKLELFTFDSDEGRDTFWHSSAHILGQSVEMKYGCKLCIGPCT  573
            +KVNG LWD+ RPLE  C LEL  F+  EG+  FWHSSAH+LG++ E  YGC LCIGP T
Sbjct  124  AKVNGELWDLERPLEASCSLELLDFEHPEGKRVFWHSSAHVLGEAAEKHYGCHLCIGPPT  183



>gb|KIJ96896.1| hypothetical protein K443DRAFT_681974 [Laccaria amethystina LaAM-08-1]
Length=722

 Score =   135 bits (340),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 60/120 (50%), Positives = 85/120 (71%), Gaps = 0/120 (0%)
 Frame = +1

Query  214  RISLFESIKsqqqlqrlslsPDPIKIELPNGSVKEGKKWNTTPLDIAKELSKSLASNALI  393
            RI +F+ +K++      S   + I I +P+GS ++GK W T+P+D+AKE+SKSL+   +I
Sbjct  56   RIKIFDELKAEYDEFVKSQPREEIAITMPDGSERKGKSWETSPMDVAKEVSKSLSERIVI  115

Query  394  SKVNGVLWDMSRPLEGDCKLELFTFDSDEGRDTFWHSSAHILGQSVEMKYGCKLCIGPCT  573
            +KV+G LWD+ RPLE  CKLEL  F+  EG+  FWHSSAH+LG++ E  YGC LC+GP T
Sbjct  116  AKVDGELWDLERPLEKACKLELLDFEHPEGKKVFWHSSAHVLGEAAERHYGCHLCLGPPT  175



>ref|XP_007379420.1| threonyl-tRNA synthetase [Punctularia strigosozonata HHB-11173 
SS5]
 gb|EIN14503.1| threonyl-tRNA synthetase [Punctularia strigosozonata HHB-11173 
SS5]
Length=732

 Score =   135 bits (340),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 61/120 (51%), Positives = 81/120 (68%), Gaps = 0/120 (0%)
 Frame = +1

Query  214  RISLFESIKsqqqlqrlslsPDPIKIELPNGSVKEGKKWNTTPLDIAKELSKSLASNALI  393
            RI +FE +K++      +     I I +P+GS + G  W T+P+D+AKE+SKSLA   +I
Sbjct  61   RIKMFEQLKAEYDEWVKAQPRQEIAISMPDGSQRTGTSWETSPMDVAKEISKSLAERVVI  120

Query  394  SKVNGVLWDMSRPLEGDCKLELFTFDSDEGRDTFWHSSAHILGQSVEMKYGCKLCIGPCT  573
            +KV+G LWD+ RPLE    LEL +FD  EG+  FWHSSAH+LG+S E  YGC LCIGP T
Sbjct  121  AKVDGELWDLERPLEKSASLELLSFDDAEGKRVFWHSSAHVLGESAERHYGCHLCIGPPT  180



>ref|XP_007855570.1| threonyl-trna synthetase [Moniliophthora roreri MCA 2997]
 gb|ESK85122.1| threonyl-trna synthetase [Moniliophthora roreri MCA 2997]
Length=723

 Score =   135 bits (340),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 61/120 (51%), Positives = 83/120 (69%), Gaps = 0/120 (0%)
 Frame = +1

Query  214  RISLFESIKsqqqlqrlslsPDPIKIELPNGSVKEGKKWNTTPLDIAKELSKSLASNALI  393
            RI +FE +K++      S   + I I LP+G+ K+G  W T+P+DIAKE+SK L+   +I
Sbjct  49   RIQMFEQLKAEYDEAAKSKPREEITITLPDGNEKKGISWETSPMDIAKEISKGLSEKVVI  108

Query  394  SKVNGVLWDMSRPLEGDCKLELFTFDSDEGRDTFWHSSAHILGQSVEMKYGCKLCIGPCT  573
            +KV+G LWD+ RPLE  CKLEL  F+  EG+  FWHSSAH+LG++ E  YGC LC+GP T
Sbjct  109  AKVDGELWDLERPLESSCKLELLDFEHPEGKRVFWHSSAHVLGEAAERHYGCHLCLGPPT  168



>emb|CEG74606.1| Putative Threonyl-tRNA synthetase [Rhizopus microsporus]
Length=717

 Score =   135 bits (340),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 64/126 (51%), Positives = 84/126 (67%), Gaps = 4/126 (3%)
 Frame = +1

Query  190  YLQSVIPKRISLFESIKsqqqlqrlslsPDPIKIELPNGSVKEGKKWNTTPLDIAKELSK  369
            YLQ     RI LF+  K +   +      +PI I LP+GS KEG  W TTPL +A ++SK
Sbjct  41   YLQH----RIELFDKWKKEADEEIAKKPREPITITLPDGSTKEGISWETTPLSLAADISK  96

Query  370  SLASNALISKVNGVLWDMSRPLEGDCKLELFTFDSDEGRDTFWHSSAHILGQSVEMKYGC  549
            SLA   +I+KV+G LWD++RPLE  C L+L  F++DE +  FWHSSAH+LG++ E  YGC
Sbjct  97   SLAERTIIAKVDGDLWDLTRPLEKSCNLQLLDFENDEAKKVFWHSSAHMLGEACERHYGC  156

Query  550  KLCIGP  567
             LCIGP
Sbjct  157  HLCIGP  162



>ref|XP_006675165.1| hypothetical protein BATDEDRAFT_18299 [Batrachochytrium dendrobatidis 
JAM81]
 gb|EGF83910.1| hypothetical protein BATDEDRAFT_18299 [Batrachochytrium dendrobatidis 
JAM81]
Length=706

 Score =   135 bits (339),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 60/121 (50%), Positives = 83/121 (69%), Gaps = 0/121 (0%)
 Frame = +1

Query  205  IPKRISLFESIKsqqqlqrlslsPDPIKIELPNGSVKEGKKWNTTPLDIAKELSKSLASN  384
            I  RI +F+ +K +   +  +    PI++ LP+G +  G  W TTP +IAK LSKSLA  
Sbjct  38   IQHRIDMFDRLKKEYDAEIAAKPRTPIEVTLPDGRIMPGVAWETTPFEIAKTLSKSLADR  97

Query  385  ALISKVNGVLWDMSRPLEGDCKLELFTFDSDEGRDTFWHSSAHILGQSVEMKYGCKLCIG  564
             +I+KV+GVL+D+ RP+E  C LEL  FD +EG+  FWHSSAH+LG++ E+ YGC LCIG
Sbjct  98   VVIAKVDGVLFDLVRPMEQSCSLELLDFDHEEGKKVFWHSSAHVLGEACELHYGCHLCIG  157

Query  565  P  567
            P
Sbjct  158  P  158



>ref|XP_007330835.1| hypothetical protein AGABI1DRAFT_60603 [Agaricus bisporus var. 
burnettii JB137-S8]
 gb|EKM78406.1| hypothetical protein AGABI1DRAFT_60603 [Agaricus bisporus var. 
burnettii JB137-S8]
Length=721

 Score =   135 bits (340),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 64/120 (53%), Positives = 82/120 (68%), Gaps = 0/120 (0%)
 Frame = +1

Query  214  RISLFESIKsqqqlqrlslsPDPIKIELPNGSVKEGKKWNTTPLDIAKELSKSLASNALI  393
            RI +F+ +K +      +   + I I L +GS ++GK W T+PLDIAK LSKSLA   +I
Sbjct  56   RIKMFDELKVKYDAFVAAQPREEITITLLDGSERKGKSWETSPLDIAKLLSKSLADRVVI  115

Query  394  SKVNGVLWDMSRPLEGDCKLELFTFDSDEGRDTFWHSSAHILGQSVEMKYGCKLCIGPCT  573
            SKV+GVLWD+ RPLE   KLEL  F+  EG+  FWHSSAH+LG++ E  YGC LCIGP T
Sbjct  116  SKVDGVLWDLERPLEKSVKLELLDFEDPEGKKVFWHSSAHVLGEAAERHYGCHLCIGPPT  175



>gb|KDQ50940.1| hypothetical protein JAAARDRAFT_41579 [Jaapia argillacea MUCL 
33604]
Length=733

 Score =   135 bits (340),  Expect = 5e-33, Method: Compositional matrix adjust.
 Identities = 61/120 (51%), Positives = 84/120 (70%), Gaps = 0/120 (0%)
 Frame = +1

Query  214  RISLFESIKsqqqlqrlslsPDPIKIELPNGSVKEGKKWNTTPLDIAKELSKSLASNALI  393
            RI +F+ +K++      +     I + LP+GS ++G  W T+P+DIAKELSKSL+   +I
Sbjct  61   RIQMFDKLKAEYDAWVKAQPRQEIAVTLPDGSERKGTSWETSPMDIAKELSKSLSERIVI  120

Query  394  SKVNGVLWDMSRPLEGDCKLELFTFDSDEGRDTFWHSSAHILGQSVEMKYGCKLCIGPCT  573
            +KVNG LWD+ RPLE  CKLEL  F++ +G+  FWHSSAH+LG++ E  YGC LCIGP T
Sbjct  121  AKVNGDLWDLDRPLESSCKLELLDFENPDGKKVFWHSSAHVLGEASERHYGCHLCIGPPT  180



>gb|KFH72646.1| threonyl-tRNA synthetase [Mortierella verticillata NRRL 6337]
Length=721

 Score =   135 bits (339),  Expect = 5e-33, Method: Compositional matrix adjust.
 Identities = 58/121 (48%), Positives = 84/121 (69%), Gaps = 0/121 (0%)
 Frame = +1

Query  205  IPKRISLFESIKsqqqlqrlslsPDPIKIELPNGSVKEGKKWNTTPLDIAKELSKSLASN  384
            +  RI++F+ +K +      +    PI I +P+GS++EG  W T+P+DIAK +SKSL+  
Sbjct  49   VAHRIAMFDDLKKKADEVEAAQPRVPISIAMPDGSIREGIAWETSPMDIAKAISKSLSER  108

Query  385  ALISKVNGVLWDMSRPLEGDCKLELFTFDSDEGRDTFWHSSAHILGQSVEMKYGCKLCIG  564
             +I+KV+ VLWD+ RPL   C+LEL  F+ +EG+  FWHSSAH+LG++ E  YGC LCIG
Sbjct  109  VVIAKVDKVLWDLERPLVDSCQLELLDFEHEEGKAVFWHSSAHVLGEACEKHYGCHLCIG  168

Query  565  P  567
            P
Sbjct  169  P  169



>ref|XP_003667634.1| hypothetical protein NDAI_0A02330 [Naumovozyma dairenensis CBS 
421]
 emb|CCD22391.1| hypothetical protein NDAI_0A02330 [Naumovozyma dairenensis CBS 
421]
Length=730

 Score =   135 bits (339),  Expect = 5e-33, Method: Compositional matrix adjust.
 Identities = 67/128 (52%), Positives = 87/128 (68%), Gaps = 5/128 (4%)
 Frame = +1

Query  205  IPKRISLFESIKsqqqlqrlslsPDPIKIELPNGSVKEGKKWNTTPLDIAKELSKSLASN  384
            I +RI LFE++K Q   +  S+   P+KI L +G+VKE   W TTP+DIA+ +SKSLA N
Sbjct  38   IEERIQLFETLKKQYDEKVASMKRVPLKIVLKDGAVKEATSWETTPMDIARGISKSLADN  97

Query  385  ALISKVNGVLWDMSRPLEGDC-----KLELFTFDSDEGRDTFWHSSAHILGQSVEMKYGC  549
              I+KVNG LWD+ RP EGD      KL+L  FDSDEG+  FWHSSAH+LG++ E   G 
Sbjct  98   VCIAKVNGQLWDLDRPFEGDVADEEIKLQLLDFDSDEGKKVFWHSSAHVLGEACECNLGA  157

Query  550  KLCIGPCT  573
             +C+GP T
Sbjct  158  HICLGPPT  165



>ref|XP_007365562.1| threonyl-tRNA synthetase [Dichomitus squalens LYAD-421 SS1]
 gb|EJF61861.1| threonyl-tRNA synthetase [Dichomitus squalens LYAD-421 SS1]
Length=728

 Score =   135 bits (339),  Expect = 5e-33, Method: Compositional matrix adjust.
 Identities = 61/120 (51%), Positives = 81/120 (68%), Gaps = 0/120 (0%)
 Frame = +1

Query  214  RISLFESIKsqqqlqrlslsPDPIKIELPNGSVKEGKKWNTTPLDIAKELSKSLASNALI  393
            RI LF+ +K++      +     I I LP+G+ ++G  W TTPLDIAK +S+ LA   +I
Sbjct  54   RIKLFDKLKAEYDEWLKNQPRQEITITLPDGAQRKGTSWETTPLDIAKAISQGLADKVVI  113

Query  394  SKVNGVLWDMSRPLEGDCKLELFTFDSDEGRDTFWHSSAHILGQSVEMKYGCKLCIGPCT  573
            +KVNG LWD+ RP EG   L+L TFD +EG+  FWHSSAH+LG++ E  YGC LCIGP T
Sbjct  114  AKVNGELWDLERPFEGSASLQLLTFDDEEGKRVFWHSSAHVLGEASERHYGCHLCIGPPT  173



>gb|ENN74529.1| hypothetical protein YQE_08853, partial [Dendroctonus ponderosae]
 gb|ERL89808.1| hypothetical protein D910_07169 [Dendroctonus ponderosae]
Length=699

 Score =   134 bits (338),  Expect = 6e-33, Method: Compositional matrix adjust.
 Identities = 62/123 (50%), Positives = 86/123 (70%), Gaps = 0/123 (0%)
 Frame = +1

Query  199  SVIPKRISLFESIKsqqqlqrlslsPDPIKIELPNGSVKEGKKWNTTPLDIAKELSKSLA  378
            S I +R+ L++ +K+Q +    + +P PIK+ LP+G V E   W TT  D+AK +S+ LA
Sbjct  26   SFIQERLQLWDKLKAQYEADLAAKTPAPIKVTLPDGKVVEATAWKTTVYDVAKGISQGLA  85

Query  379  SNALISKVNGVLWDMSRPLEGDCKLELFTFDSDEGRDTFWHSSAHILGQSVEMKYGCKLC  558
             N++ISKVNGVLWD+ RPLE DCK+EL  FD  E +  FWHS+AH+LG+++E  YG  LC
Sbjct  86   DNSVISKVNGVLWDLDRPLESDCKVELLKFDDTEAQAVFWHSTAHVLGEALERIYGGCLC  145

Query  559  IGP  567
             GP
Sbjct  146  YGP  148



>emb|CEP09308.1| hypothetical protein [Parasitella parasitica]
Length=987

 Score =   135 bits (341),  Expect = 6e-33, Method: Compositional matrix adjust.
 Identities = 61/121 (50%), Positives = 81/121 (67%), Gaps = 0/121 (0%)
 Frame = +1

Query  205  IPKRISLFESIKsqqqlqrlslsPDPIKIELPNGSVKEGKKWNTTPLDIAKELSKSLASN  384
            +  RI +F+ +K+    +      +PI + LP+GS KEG  W TTP  IA  ++KSLA  
Sbjct  313  LQHRIDMFDRLKAAADAEIAQKPREPITVTLPDGSQKEGTSWETTPFSIALGIAKSLAER  372

Query  385  ALISKVNGVLWDMSRPLEGDCKLELFTFDSDEGRDTFWHSSAHILGQSVEMKYGCKLCIG  564
             +ISKV+G LWD++RPLE  CKLEL  FD+ EG+  FWHSSAH+LG++ E  Y C LCIG
Sbjct  373  TVISKVDGELWDLTRPLESSCKLELLDFDNQEGKMVFWHSSAHMLGEACERHYACNLCIG  432

Query  565  P  567
            P
Sbjct  433  P  433



>gb|KIK46023.1| hypothetical protein CY34DRAFT_22231 [Suillus luteus UH-Slu-Lm8-n1]
Length=728

 Score =   134 bits (338),  Expect = 6e-33, Method: Compositional matrix adjust.
 Identities = 60/120 (50%), Positives = 81/120 (68%), Gaps = 0/120 (0%)
 Frame = +1

Query  214  RISLFESIKsqqqlqrlslsPDPIKIELPNGSVKEGKKWNTTPLDIAKELSKSLASNALI  393
            RI LFE + ++          + I + +P+GS + G  W T+P+D+AKE+SKSL+   +I
Sbjct  56   RIKLFEELHAKHNEFVKIQPREEIVVTMPDGSERMGTSWETSPMDVAKEVSKSLSERIVI  115

Query  394  SKVNGVLWDMSRPLEGDCKLELFTFDSDEGRDTFWHSSAHILGQSVEMKYGCKLCIGPCT  573
            +KVNG LWD+ RPLE  CKLEL  F+  EG+  FWHSSAH+LG++ E  YGC LCIGP T
Sbjct  116  AKVNGDLWDLERPLEASCKLELLDFEHPEGKRVFWHSSAHVLGEAAERHYGCHLCIGPPT  175



>ref|XP_001878968.1| predicted protein [Laccaria bicolor S238N-H82]
 gb|EDR10518.1| predicted protein [Laccaria bicolor S238N-H82]
Length=721

 Score =   134 bits (338),  Expect = 7e-33, Method: Compositional matrix adjust.
 Identities = 60/120 (50%), Positives = 85/120 (71%), Gaps = 0/120 (0%)
 Frame = +1

Query  214  RISLFESIKsqqqlqrlslsPDPIKIELPNGSVKEGKKWNTTPLDIAKELSKSLASNALI  393
            RI +F+ +K++      S   + I I +P+GS ++GK W T+P+D+AKE+SKSL+   +I
Sbjct  55   RIKIFDELKAEYDEFVKSQPREEIVITMPDGSERKGKSWETSPMDVAKEVSKSLSERIVI  114

Query  394  SKVNGVLWDMSRPLEGDCKLELFTFDSDEGRDTFWHSSAHILGQSVEMKYGCKLCIGPCT  573
            +KV+G LWD+ RPLE  CKLEL  F+  EG+  FWHSSAH+LG++ E  YGC LC+GP T
Sbjct  115  AKVDGELWDLDRPLEKACKLELLDFEHPEGKKVFWHSSAHVLGEAAERHYGCHLCLGPPT  174



>ref|XP_007316884.1| hypothetical protein SERLADRAFT_368238 [Serpula lacrymans var. 
lacrymans S7.9]
 gb|EGO01054.1| hypothetical protein SERLA73DRAFT_121422 [Serpula lacrymans var. 
lacrymans S7.3]
 gb|EGO26711.1| hypothetical protein SERLADRAFT_368238 [Serpula lacrymans var. 
lacrymans S7.9]
Length=727

 Score =   134 bits (338),  Expect = 8e-33, Method: Compositional matrix adjust.
 Identities = 60/118 (51%), Positives = 82/118 (69%), Gaps = 0/118 (0%)
 Frame = +1

Query  214  RISLFESIKsqqqlqrlslsPDPIKIELPNGSVKEGKKWNTTPLDIAKELSKSLASNALI  393
            RI +FE +K++      +     I I LP+GS ++G  W T+P+D+AKE+SKSL+   +I
Sbjct  55   RIKIFEKLKAEYDDFVKAQPRQEIVITLPDGSERKGTSWETSPMDVAKEVSKSLSERIVI  114

Query  394  SKVNGVLWDMSRPLEGDCKLELFTFDSDEGRDTFWHSSAHILGQSVEMKYGCKLCIGP  567
            +KV+G LWD+ RPLE  CKLEL  F+  EG+  FWHSSAH+LG++ E  YGC LCIGP
Sbjct  115  AKVDGNLWDLERPLEAACKLELLDFEHPEGKRVFWHSSAHVLGEAAERHYGCHLCIGP  172



>gb|KDN46541.1| LOW QUALITY PROTEIN: hypothetical protein RSAG8_04194, partial 
[Rhizoctonia solani AG-8 WAC10335]
Length=647

 Score =   134 bits (336),  Expect = 8e-33, Method: Compositional matrix adjust.
 Identities = 60/120 (50%), Positives = 81/120 (68%), Gaps = 0/120 (0%)
 Frame = +1

Query  214  RISLFESIKsqqqlqrlslsPDPIKIELPNGSVKEGKKWNTTPLDIAKELSKSLASNALI  393
            R+ +++ +K +      +   + I I LP+GS KEGK W T+P+ IA +LSKSLA   +I
Sbjct  89   RVQIYDKLKKEYDEFVATQPHEVITITLPDGSTKEGKSWETSPMTIASQLSKSLAERVVI  148

Query  394  SKVNGVLWDMSRPLEGDCKLELFTFDSDEGRDTFWHSSAHILGQSVEMKYGCKLCIGPCT  573
            +KV+G LWD+ RPLE  C LEL  F+  EG+  FWHSSAH+LG++ E  YGC LCIGP T
Sbjct  149  AKVDGGLWDLERPLEKSCSLELLDFEHPEGKRVFWHSSAHVLGEAAEKHYGCHLCIGPPT  208



>gb|KIM92325.1| hypothetical protein PILCRDRAFT_810369 [Piloderma croceum F 1598]
Length=728

 Score =   134 bits (337),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 60/123 (49%), Positives = 84/123 (68%), Gaps = 0/123 (0%)
 Frame = +1

Query  205  IPKRISLFESIKsqqqlqrlslsPDPIKIELPNGSVKEGKKWNTTPLDIAKELSKSLASN  384
            I  RI +FE +K++      +   + I I +P+GS ++GK W T+P+D+AKE+SKSL+  
Sbjct  53   IDHRIKIFEKLKAEHDEFVKAQPREDIVITMPDGSERKGKSWETSPMDVAKEISKSLSER  112

Query  385  ALISKVNGVLWDMSRPLEGDCKLELFTFDSDEGRDTFWHSSAHILGQSVEMKYGCKLCIG  564
             +I+KVNG +WD+ RPLEG   LE   F+  EG+  FWHSSAH+LG++ E  YGC LCIG
Sbjct  113  IVIAKVNGDVWDLERPLEGPSSLEFLDFEHPEGKRVFWHSSAHVLGEAAERHYGCHLCIG  172

Query  565  PCT  573
            P T
Sbjct  173  PPT  175



>ref|XP_003080220.1| putative threonyl-tRNA synthetase (ISS) [Ostreococcus tauri]
Length=673

 Score =   134 bits (336),  Expect = 1e-32, Method: Composition-based stats.
 Identities = 54/97 (56%), Positives = 75/97 (77%), Gaps = 0/97 (0%)
 Frame = +1

Query  277  DPIKIELPNGSVKEGKKWNTTPLDIAKELSKSLASNALISKVNGVLWDMSRPLEGDCKLE  456
            +PI + LP+G VK G ++ TTP D+A  + K LA NAL++KV+G  WDM RPLEGDC L+
Sbjct  50   EPIAVTLPDGGVKAGVRFATTPYDVAMSIHKKLAQNALVAKVDGEFWDMRRPLEGDCALQ  109

Query  457  LFTFDSDEGRDTFWHSSAHILGQSVEMKYGCKLCIGP  567
            +FTFD  EG++ +WHSSAH+LG+++E++YG  L IGP
Sbjct  110  MFTFDDAEGKECYWHSSAHVLGEALELEYGADLTIGP  146



>emb|CEF98631.1| Anticodon-binding [Ostreococcus tauri]
Length=693

 Score =   134 bits (336),  Expect = 1e-32, Method: Composition-based stats.
 Identities = 54/97 (56%), Positives = 75/97 (77%), Gaps = 0/97 (0%)
 Frame = +1

Query  277  DPIKIELPNGSVKEGKKWNTTPLDIAKELSKSLASNALISKVNGVLWDMSRPLEGDCKLE  456
            +PI + LP+G VK G ++ TTP D+A  + K LA NAL++KV+G  WDM RPLEGDC L+
Sbjct  50   EPIAVTLPDGGVKAGVRFATTPYDVAMSIHKKLAQNALVAKVDGEFWDMRRPLEGDCALQ  109

Query  457  LFTFDSDEGRDTFWHSSAHILGQSVEMKYGCKLCIGP  567
            +FTFD  EG++ +WHSSAH+LG+++E++YG  L IGP
Sbjct  110  MFTFDDAEGKECYWHSSAHVLGEALELEYGADLTIGP  146



>ref|XP_505278.1| YALI0F11231p [Yarrowia lipolytica]
 emb|CAG78085.1| YALI0F11231p [Yarrowia lipolytica CLIB122]
Length=755

 Score =   134 bits (337),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 61/120 (51%), Positives = 79/120 (66%), Gaps = 0/120 (0%)
 Frame = +1

Query  214  RISLFESIKsqqqlqrlslsPDPIKIELPNGSVKEGKKWNTTPLDIAKELSKSLASNALI  393
            RI +F+ +K +      +    PI + L +G+ KE   W T+P+DI K +SKSL    +I
Sbjct  76   RIKMFDELKVEYDAFVAAQERKPIVVTLKDGTPKEATAWETSPMDICKTISKSLPDQTVI  135

Query  394  SKVNGVLWDMSRPLEGDCKLELFTFDSDEGRDTFWHSSAHILGQSVEMKYGCKLCIGPCT  573
            +KVNG LWDM RPLEGD KLE   F+SDEG+  FWHSSAH+LG++ E  YG  LCIGP T
Sbjct  136  AKVNGELWDMERPLEGDAKLEFLDFNSDEGKRVFWHSSAHVLGEATERHYGAHLCIGPPT  195



>ref|XP_002631322.1| C. briggsae CBR-TRS-1 protein [Caenorhabditis briggsae]
Length=704

 Score =   134 bits (336),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 62/131 (47%), Positives = 88/131 (67%), Gaps = 0/131 (0%)
 Frame = +1

Query  175  PKDDAYLQSVIPKRISLFESIKsqqqlqrlslsPDPIKIELPNGSVKEGKKWNTTPLDIA  354
            P D +   + I +RI L++ +K++   +  +   +PI+I LP+G V EGK W TTP +IA
Sbjct  26   PTDMSPWPAFIDERIKLWDKLKNEYDAEIEAKESEPIEITLPDGKVHEGKSWRTTPFEIA  85

Query  355  KELSKSLASNALISKVNGVLWDMSRPLEGDCKLELFTFDSDEGRDTFWHSSAHILGQSVE  534
            + +SK LA  A+ISKVNGV+WD+ RP EG+  LEL  F+ DE +  FWHSSAH+LG+++E
Sbjct  86   ERISKGLAEAAVISKVNGVVWDLDRPFEGNATLELLKFEDDEAKQVFWHSSAHVLGEAME  145

Query  535  MKYGCKLCIGP  567
               G  LC GP
Sbjct  146  RYCGGHLCYGP  156



>ref|XP_002491958.1| Threonyl-tRNA synthetase, essential cytoplasmic protein [Komagataella 
pastoris GS115]
 emb|CAY69678.1| Threonyl-tRNA synthetase, essential cytoplasmic protein [Komagataella 
pastoris GS115]
 emb|CCA37946.1| threonyl-tRNA synthetase [Komagataella pastoris CBS 7435]
Length=712

 Score =   134 bits (336),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 64/128 (50%), Positives = 85/128 (66%), Gaps = 4/128 (3%)
 Frame = +1

Query  190  YLQSVIPKRISLFESIKsqqqlqrlslsPDPIKIELPNGSVKEGKKWNTTPLDIAKELSK  369
            +LQS    RI LF+ +K++   +  +    PIKI L +G+VKEG  W T+P +IAK + K
Sbjct  40   FLQS----RIQLFDELKAKYDAEVAAKERSPIKITLKDGTVKEGVAWETSPFEIAKSIGK  95

Query  370  SLASNALISKVNGVLWDMSRPLEGDCKLELFTFDSDEGRDTFWHSSAHILGQSVEMKYGC  549
            S     +ISKVNG LWD+ RPLE D +LE F F++ EG+  FWHSSAH+LG++ E  YG 
Sbjct  96   SFLERQVISKVNGELWDLERPLEADSQLEFFDFETPEGKRVFWHSSAHVLGEACECHYGA  155

Query  550  KLCIGPCT  573
             LCIGP T
Sbjct  156  HLCIGPPT  163



>emb|CCG82579.1| Threonyl-tRNA synthetase [Taphrina deformans PYCC 5710]
Length=755

 Score =   134 bits (337),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 61/123 (50%), Positives = 83/123 (67%), Gaps = 0/123 (0%)
 Frame = +1

Query  205  IPKRISLFESIKsqqqlqrlslsPDPIKIELPNGSVKEGKKWNTTPLDIAKELSKSLASN  384
            +  RI+LF+ +K++Q           I I LP+G+ K G  W TTP+ +A E+S+ LA  
Sbjct  59   MAHRIALFDKLKAEQDDIAAKSERKRITITLPDGATKIGTSWETTPMSVALEISQGLADR  118

Query  385  ALISKVNGVLWDMSRPLEGDCKLELFTFDSDEGRDTFWHSSAHILGQSVEMKYGCKLCIG  564
             +I+KVNG LWDM+RP+E D  LELF F++ EG+  FWHSSAH+LG++ E  YGC LCIG
Sbjct  119  TIIAKVNGNLWDMTRPIEEDASLELFDFNTPEGKRVFWHSSAHMLGEATERHYGCHLCIG  178

Query  565  PCT  573
            P T
Sbjct  179  PPT  181



>emb|CDY19754.1| BnaA09g04070D [Brassica napus]
Length=609

 Score =   132 bits (333),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 59/78 (76%), Positives = 68/78 (87%), Gaps = 0/78 (0%)
 Frame = +1

Query  343  LDIAKELSKSLASNALISKVNGVLWDMSRPLEGDCKLELFTFDSDEGRDTFWHSSAHILG  522
            +DIA E+SK LA++ALIS VN  LWDMSR LEGDCKLELF FDSD+GRDT WHSSAH+LG
Sbjct  1    MDIAGEISKGLANSALISSVNDELWDMSRVLEGDCKLELFKFDSDKGRDTLWHSSAHVLG  60

Query  523  QSVEMKYGCKLCIGPCTT  576
            Q++E +YGC LCIGPCTT
Sbjct  61   QALEQEYGCHLCIGPCTT  78



>ref|XP_636821.1| threonyl-tRNA synthetase [Dictyostelium discoideum AX4]
 sp|Q54J66.1|SYTC1_DICDI RecName: Full=Probable threonine--tRNA ligase 1, cytoplasmic; 
AltName: Full=Threonyl-tRNA synthetase; Short=ThrRS [Dictyostelium 
discoideum]
 gb|EAL63315.1| threonyl-tRNA synthetase [Dictyostelium discoideum AX4]
Length=710

 Score =   134 bits (336),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 65/125 (52%), Positives = 89/125 (71%), Gaps = 1/125 (1%)
 Frame = +1

Query  205  IPKRISLFESIKsqqqlqrlslsPDPIKIELPNGSVKEGKKWNTTPLDIAKELSKSLASN  384
            + +RI ++ES+K++       +  +PI + LP+G V  G K  TTP DIAK +S+ LA +
Sbjct  50   VKERIEIWESLKAKHLESLKDMKEEPINVTLPDGKVVAGIKNKTTPYDIAKGISRGLADS  109

Query  385  ALISKVNG-VLWDMSRPLEGDCKLELFTFDSDEGRDTFWHSSAHILGQSVEMKYGCKLCI  561
             + SKVNG  +WD+SRPLE DC L+L  FDS+EG+ TFWHSSAHILGQ++E  YG +LCI
Sbjct  110  IVSSKVNGEQIWDISRPLEADCNLQLCKFDSEEGKKTFWHSSAHILGQAMERIYGGQLCI  169

Query  562  GPCTT  576
            GP T+
Sbjct  170  GPATS  174



>emb|CAP23504.2| Protein CBR-TARS-1 [Caenorhabditis briggsae]
Length=729

 Score =   134 bits (336),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 62/131 (47%), Positives = 88/131 (67%), Gaps = 0/131 (0%)
 Frame = +1

Query  175  PKDDAYLQSVIPKRISLFESIKsqqqlqrlslsPDPIKIELPNGSVKEGKKWNTTPLDIA  354
            P D +   + I +RI L++ +K++   +  +   +PI+I LP+G V EGK W TTP +IA
Sbjct  50   PTDMSPWPAFIDERIKLWDKLKNEYDAEIEAKESEPIEITLPDGKVHEGKSWRTTPFEIA  109

Query  355  KELSKSLASNALISKVNGVLWDMSRPLEGDCKLELFTFDSDEGRDTFWHSSAHILGQSVE  534
            + +SK LA  A+ISKVNGV+WD+ RP EG+  LEL  F+ DE +  FWHSSAH+LG+++E
Sbjct  110  ERISKGLAEAAVISKVNGVVWDLDRPFEGNATLELLKFEDDEAKQVFWHSSAHVLGEAME  169

Query  535  MKYGCKLCIGP  567
               G  LC GP
Sbjct  170  RYCGGHLCYGP  180



>gb|EUC61236.1| cytoplasmic threonine-tRNA ligase [Rhizoctonia solani AG-3 Rhs1AP]
 gb|KEP55051.1| cytoplasmic threonine-tRNA ligase [Rhizoctonia solani 123E]
Length=757

 Score =   134 bits (336),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 60/120 (50%), Positives = 81/120 (68%), Gaps = 0/120 (0%)
 Frame = +1

Query  214  RISLFESIKsqqqlqrlslsPDPIKIELPNGSVKEGKKWNTTPLDIAKELSKSLASNALI  393
            RI +++ +K +      +   + I I LP+GS KEGK W T+P+ IA +LSKSL+   +I
Sbjct  89   RIQIYDKLKKEYDEFVAAQPHEAITITLPDGSTKEGKSWETSPMTIATQLSKSLSERVVI  148

Query  394  SKVNGVLWDMSRPLEGDCKLELFTFDSDEGRDTFWHSSAHILGQSVEMKYGCKLCIGPCT  573
            +KV+G LWD+ RPLE  C LEL  F+  EG+  FWHSSAH+LG++ E  YGC LCIGP T
Sbjct  149  AKVDGGLWDLERPLEKSCSLELLDFEHPEGKRVFWHSSAHVLGEAAEKHYGCHLCIGPPT  208



>ref|XP_007394540.1| hypothetical protein PHACADRAFT_194288 [Phanerochaete carnosa 
HHB-10118-sp]
 gb|EKM56703.1| hypothetical protein PHACADRAFT_194288 [Phanerochaete carnosa 
HHB-10118-sp]
Length=730

 Score =   133 bits (335),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 59/120 (49%), Positives = 82/120 (68%), Gaps = 0/120 (0%)
 Frame = +1

Query  214  RISLFESIKsqqqlqrlslsPDPIKIELPNGSVKEGKKWNTTPLDIAKELSKSLASNALI  393
            RI LFE +K++   +  +     I+I L +GS ++G  W T+P+ IAK++S+ LA   +I
Sbjct  59   RIKLFEKLKAEYDERLKTQPRQEIEITLLDGSKRQGTSWETSPMGIAKQISQGLADRTVI  118

Query  394  SKVNGVLWDMSRPLEGDCKLELFTFDSDEGRDTFWHSSAHILGQSVEMKYGCKLCIGPCT  573
            +KVNG +WD+ RPLEG C LEL  FD  EG+  FWHSSAH+LG++ E  YGC LC+GP T
Sbjct  119  AKVNGQVWDLERPLEGSCTLELLDFDHPEGKRVFWHSSAHVLGEAAERHYGCHLCVGPPT  178



>gb|EFA05822.1| hypothetical protein TcasGA2_TC008604 [Tribolium castaneum]
Length=685

 Score =   133 bits (334),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 64/123 (52%), Positives = 86/123 (70%), Gaps = 0/123 (0%)
 Frame = +1

Query  199  SVIPKRISLFESIKsqqqlqrlslsPDPIKIELPNGSVKEGKKWNTTPLDIAKELSKSLA  378
            S I  R+ +++ +K++++ +  S     IK+ LP+G V EG  W TT  DIAK +S+ LA
Sbjct  19   SFIQTRLDIWDKLKAEKEAEIASKPLQGIKVTLPDGKVVEGVAWKTTAYDIAKGISQGLA  78

Query  379  SNALISKVNGVLWDMSRPLEGDCKLELFTFDSDEGRDTFWHSSAHILGQSVEMKYGCKLC  558
             N +ISKVNGVLWD+ RPLEGDCKLEL  FD+ E +  FWHS+AHILG+++E  YG  LC
Sbjct  79   DNCVISKVNGVLWDLDRPLEGDCKLELLKFDNPEAQSVFWHSTAHILGEALERVYGGCLC  138

Query  559  IGP  567
             GP
Sbjct  139  YGP  141



>ref|XP_008198247.1| PREDICTED: threonine--tRNA ligase, cytoplasmic isoform X1 [Tribolium 
castaneum]
Length=712

 Score =   133 bits (334),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 64/123 (52%), Positives = 86/123 (70%), Gaps = 0/123 (0%)
 Frame = +1

Query  199  SVIPKRISLFESIKsqqqlqrlslsPDPIKIELPNGSVKEGKKWNTTPLDIAKELSKSLA  378
            S I  R+ +++ +K++++ +  S     IK+ LP+G V EG  W TT  DIAK +S+ LA
Sbjct  46   SFIQTRLDIWDKLKAEKEAEIASKPLQGIKVTLPDGKVVEGVAWKTTAYDIAKGISQGLA  105

Query  379  SNALISKVNGVLWDMSRPLEGDCKLELFTFDSDEGRDTFWHSSAHILGQSVEMKYGCKLC  558
             N +ISKVNGVLWD+ RPLEGDCKLEL  FD+ E +  FWHS+AHILG+++E  YG  LC
Sbjct  106  DNCVISKVNGVLWDLDRPLEGDCKLELLKFDNPEAQSVFWHSTAHILGEALERVYGGCLC  165

Query  559  IGP  567
             GP
Sbjct  166  YGP  168



>ref|XP_967345.1| PREDICTED: threonine--tRNA ligase, cytoplasmic isoform X2 [Tribolium 
castaneum]
Length=707

 Score =   133 bits (334),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 64/123 (52%), Positives = 86/123 (70%), Gaps = 0/123 (0%)
 Frame = +1

Query  199  SVIPKRISLFESIKsqqqlqrlslsPDPIKIELPNGSVKEGKKWNTTPLDIAKELSKSLA  378
            S I  R+ +++ +K++++ +  S     IK+ LP+G V EG  W TT  DIAK +S+ LA
Sbjct  41   SFIQTRLDIWDKLKAEKEAEIASKPLQGIKVTLPDGKVVEGVAWKTTAYDIAKGISQGLA  100

Query  379  SNALISKVNGVLWDMSRPLEGDCKLELFTFDSDEGRDTFWHSSAHILGQSVEMKYGCKLC  558
             N +ISKVNGVLWD+ RPLEGDCKLEL  FD+ E +  FWHS+AHILG+++E  YG  LC
Sbjct  101  DNCVISKVNGVLWDLDRPLEGDCKLELLKFDNPEAQSVFWHSTAHILGEALERVYGGCLC  160

Query  559  IGP  567
             GP
Sbjct  161  YGP  163



>ref|XP_008043826.1| tars protein [Trametes versicolor FP-101664 SS1]
 gb|EIW53517.1| tars protein [Trametes versicolor FP-101664 SS1]
Length=725

 Score =   132 bits (333),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 59/120 (49%), Positives = 84/120 (70%), Gaps = 0/120 (0%)
 Frame = +1

Query  214  RISLFESIKsqqqlqrlslsPDPIKIELPNGSVKEGKKWNTTPLDIAKELSKSLASNALI  393
            R+ +FE +K++Q     +     I I LP+GS ++G  W T+P+D+AK++S+SLA   +I
Sbjct  53   RLKIFEKLKAEQDEWVKNQPRQEISITLPDGSQRKGTSWETSPMDVAKQISQSLADRVVI  112

Query  394  SKVNGVLWDMSRPLEGDCKLELFTFDSDEGRDTFWHSSAHILGQSVEMKYGCKLCIGPCT  573
            +KV+G LWD+ RPLEG C +EL  F+  EG+  FWHSSAH+LG++ E  YGC LCIGP T
Sbjct  113  AKVDGNLWDLERPLEGSCSVELLDFEHPEGKRVFWHSSAHVLGEASERHYGCHLCIGPPT  172



>gb|EPS93174.1| hypothetical protein FOMPIDRAFT_1026618 [Fomitopsis pinicola 
FP-58527 SS1]
Length=728

 Score =   132 bits (333),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 59/120 (49%), Positives = 82/120 (68%), Gaps = 0/120 (0%)
 Frame = +1

Query  214  RISLFESIKsqqqlqrlslsPDPIKIELPNGSVKEGKKWNTTPLDIAKELSKSLASNALI  393
            RI +F+ +K++      +     I+I +P+GS ++G  W T+P+ IAKE+SK LA   +I
Sbjct  57   RIKMFDQLKAEYDEWVKAQPRQEIEITMPDGSKRKGTSWETSPMGIAKEISKGLADRIVI  116

Query  394  SKVNGVLWDMSRPLEGDCKLELFTFDSDEGRDTFWHSSAHILGQSVEMKYGCKLCIGPCT  573
            +KVNG +WD+ RPLEG C LEL  F+  EG+  FWHSSAH+LG++ E  YGC LCIGP T
Sbjct  117  AKVNGDVWDLERPLEGSCTLELLDFEHPEGKRVFWHSSAHVLGEAAERHYGCHLCIGPPT  176



>gb|KIJ28159.1| hypothetical protein M422DRAFT_37403 [Sphaerobolus stellatus 
SS14]
Length=737

 Score =   132 bits (333),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 57/120 (48%), Positives = 85/120 (71%), Gaps = 0/120 (0%)
 Frame = +1

Query  214  RISLFESIKsqqqlqrlslsPDPIKIELPNGSVKEGKKWNTTPLDIAKELSKSLASNALI  393
            RI +FE+ +++      +   + I + +P+GS+++G  W T+P+D+A+E+SKS +   +I
Sbjct  61   RIKIFEAEQAKYVEWVKNQPREEIDVTMPDGSIRKGTSWETSPIDVAREISKSFSERMVI  120

Query  394  SKVNGVLWDMSRPLEGDCKLELFTFDSDEGRDTFWHSSAHILGQSVEMKYGCKLCIGPCT  573
            +KV+G LWD+ RPLE   KLEL  FD+DEG+  FWHSSAHILG++ E  +GC LCIGP T
Sbjct  121  AKVDGQLWDLERPLEKSSKLELLDFDNDEGKRVFWHSSAHILGEAAERHFGCHLCIGPPT  180



>ref|XP_010160781.1| PREDICTED: probable threonine--tRNA ligase 2, cytoplasmic, partial 
[Caprimulgus carolinensis]
Length=313

 Score =   128 bits (322),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 61/124 (49%), Positives = 85/124 (69%), Gaps = 3/124 (2%)
 Frame = +1

Query  205  IPKRISLFESIKsqqqlqrlslsPD---PIKIELPNGSVKEGKKWNTTPLDIAKELSKSL  375
            I  R+ L+E++K +        + +   PIKI L +G V EG+ W TTP  +A  +S++L
Sbjct  39   IEDRLKLYEALKKEHDALLAYRAANQSKPIKIILTDGKVAEGESWKTTPYQLAVGISQAL  98

Query  376  ASNALISKVNGVLWDMSRPLEGDCKLELFTFDSDEGRDTFWHSSAHILGQSVEMKYGCKL  555
            ASNA+I+KVNG LWD+ RPLEGDC LEL  FD++E +  +WHSSAHILG+++E  +G  L
Sbjct  99   ASNAVIAKVNGDLWDLDRPLEGDCTLELLMFDNEEAKAVYWHSSAHILGEAMEGYFGGCL  158

Query  556  CIGP  567
            C GP
Sbjct  159  CYGP  162



>ref|XP_001841372.2| tars protein [Coprinopsis cinerea okayama7#130]
 gb|EAU80442.2| tars protein [Coprinopsis cinerea okayama7#130]
Length=720

 Score =   132 bits (333),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 58/120 (48%), Positives = 83/120 (69%), Gaps = 0/120 (0%)
 Frame = +1

Query  214  RISLFESIKsqqqlqrlslsPDPIKIELPNGSVKEGKKWNTTPLDIAKELSKSLASNALI  393
            RI +FE +K++      +   + I + LP+GS ++   W+T+P+D+AKE+SKSL+   +I
Sbjct  53   RIQMFEQLKAEYDEWVKAQPREEITVTLPDGSERKATSWDTSPMDVAKEVSKSLSEKVVI  112

Query  394  SKVNGVLWDMSRPLEGDCKLELFTFDSDEGRDTFWHSSAHILGQSVEMKYGCKLCIGPCT  573
            +KV+  LWD+ RPLE  CKLEL  FD  EG+  FWHSSAH+LG++ E  YGC LC+GP T
Sbjct  113  AKVDDELWDLERPLEKSCKLELLDFDHPEGKKVFWHSSAHVLGEAAERHYGCHLCLGPPT  172



>ref|XP_003116880.1| CRE-TARS-1 protein [Caenorhabditis remanei]
 gb|EFO85746.1| CRE-TARS-1 protein [Caenorhabditis remanei]
Length=749

 Score =   132 bits (333),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 59/123 (48%), Positives = 85/123 (69%), Gaps = 0/123 (0%)
 Frame = +1

Query  199  SVIPKRISLFESIKsqqqlqrlslsPDPIKIELPNGSVKEGKKWNTTPLDIAKELSKSLA  378
            + I +RI L++ +K +   +  +   +PI+I LP+G V +GK W TTP +IA+++SK LA
Sbjct  78   AFIEERIKLWDKLKLEYDAEIAAKVSEPIEITLPDGKVHDGKSWRTTPFEIAEKISKGLA  137

Query  379  SNALISKVNGVLWDMSRPLEGDCKLELFTFDSDEGRDTFWHSSAHILGQSVEMKYGCKLC  558
              A+ISKVNGV+WD+ RP EG+  LEL  F+ DE +  FWHSSAH+LG+++E   G  LC
Sbjct  138  EAAVISKVNGVVWDLDRPFEGNATLELLKFEDDEAKQVFWHSSAHVLGEAMERYCGGHLC  197

Query  559  IGP  567
             GP
Sbjct  198  YGP  200



>ref|XP_011406310.1| PREDICTED: threonine--tRNA ligase, cytoplasmic-like [Amphimedon 
queenslandica]
Length=653

 Score =   132 bits (331),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 61/121 (50%), Positives = 83/121 (69%), Gaps = 0/121 (0%)
 Frame = +1

Query  205  IPKRISLFESIKsqqqlqrlslsPDPIKIELPNGSVKEGKKWNTTPLDIAKELSKSLASN  384
            I  R ++F+ +K++   +  +  P PIK+ LP+G V EG  W TTP DIA ++SK LA N
Sbjct  17   IASRNAIFDRLKAEYLAEIEAKEPRPIKVTLPDGKVMEGLSWRTTPYDIASQISKGLADN  76

Query  385  ALISKVNGVLWDMSRPLEGDCKLELFTFDSDEGRDTFWHSSAHILGQSVEMKYGCKLCIG  564
            A+ISKVNG ++D+ RPLE DC LEL  F+  E +  FWHS+AHILG+++E  YG  LC G
Sbjct  77   AVISKVNGSVFDLERPLEEDCTLELLKFEDPEAQTVFWHSTAHILGEAMERHYGGCLCYG  136

Query  565  P  567
            P
Sbjct  137  P  137



>gb|KIM36149.1| hypothetical protein M413DRAFT_20609 [Hebeloma cylindrosporum 
h7]
Length=698

 Score =   132 bits (332),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 56/120 (47%), Positives = 83/120 (69%), Gaps = 0/120 (0%)
 Frame = +1

Query  214  RISLFESIKsqqqlqrlslsPDPIKIELPNGSVKEGKKWNTTPLDIAKELSKSLASNALI  393
            R+ +F  +K++      +   + I + +P+GS ++ K W T+P+D+AKE+SKSL+   +I
Sbjct  58   RLKIFNELKAEYDAFVAAQPREEITVTMPDGSERKAKSWETSPMDVAKEVSKSLSERIVI  117

Query  394  SKVNGVLWDMSRPLEGDCKLELFTFDSDEGRDTFWHSSAHILGQSVEMKYGCKLCIGPCT  573
            +KV+G LWD+ RPLE  CKLEL  F+  EG+  FWHSSAH+LG++ E  YGC LC+GP T
Sbjct  118  AKVDGTLWDLERPLEKSCKLELLDFEHPEGKKVFWHSSAHVLGEAAERHYGCHLCLGPPT  177



>gb|KDQ32844.1| hypothetical protein PLEOSDRAFT_1032700 [Pleurotus ostreatus 
PC15]
Length=718

 Score =   132 bits (332),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 57/120 (48%), Positives = 84/120 (70%), Gaps = 0/120 (0%)
 Frame = +1

Query  214  RISLFESIKsqqqlqrlslsPDPIKIELPNGSVKEGKKWNTTPLDIAKELSKSLASNALI  393
            R+ +FE +K++      +   + I + +P+GS ++G+ W T+P+DIAKE+SKSL+   +I
Sbjct  47   RLKIFEKLKAEYDEFVKAQPREEITVTMPDGSERKGQSWETSPMDIAKEVSKSLSERVVI  106

Query  394  SKVNGVLWDMSRPLEGDCKLELFTFDSDEGRDTFWHSSAHILGQSVEMKYGCKLCIGPCT  573
            +KV+G LWD+ RPLE  C L+L  F+  EG+  FWHSSAH+LG++ E  YGC LCIGP T
Sbjct  107  AKVDGDLWDLERPLEKSCSLQLLDFEHPEGKRVFWHSSAHVLGEAAERHYGCHLCIGPPT  166



>ref|XP_003955557.1| hypothetical protein KAFR_0B01230 [Kazachstania africana CBS 
2517]
 emb|CCF56422.1| hypothetical protein KAFR_0B01230 [Kazachstania africana CBS 
2517]
Length=729

 Score =   132 bits (332),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 66/127 (52%), Positives = 86/127 (68%), Gaps = 4/127 (3%)
 Frame = +1

Query  205  IPKRISLFESIKsqqqlqrlslsPDPIKIELPNGSVKEGKKWNTTPLDIAKELSKSLASN  384
            I +RI  FE ++ +   +  SL  +PIKI L +GS+K G  W TTPLDIA+E+SKSLA  
Sbjct  41   IQERIEFFEKLQREYHEKISSLGRNPIKIVLKDGSIKVGTSWETTPLDIAREISKSLADR  100

Query  385  ALISKVNGVLWDMSRPLEG----DCKLELFTFDSDEGRDTFWHSSAHILGQSVEMKYGCK  552
              I+KVNG LWD+ RP EG    + KLEL  F+SDEG+  FWHSSAH+LG++ E   G  
Sbjct  101  LCIAKVNGQLWDLERPFEGESNEELKLELLDFESDEGKRVFWHSSAHVLGEACECNLGAH  160

Query  553  LCIGPCT  573
            +C+GP T
Sbjct  161  ICLGPPT  167



>ref|XP_001550563.1| hypothetical protein BC1G_11336 [Botrytis cinerea B05.10]
 emb|CCD55829.1| similar to threonyl-tRNA synthetase [Botrytis cinerea T4]
 gb|EMR82189.1| putative threonyl-trna synthetase protein [Botrytis cinerea BcDW1]
Length=787

 Score =   132 bits (333),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 63/124 (51%), Positives = 86/124 (69%), Gaps = 3/124 (2%)
 Frame = +1

Query  205  IPKRISLFESIKsqqqlqrlslsPDPIKIELPNGSVKEGKKWNTTPLDIAKELSKSLASN  384
            I  RI++F+ +K++   +  +   DPI I L +GSVKEG  W TTP  IA+ +SKSL   
Sbjct  57   IAHRIAVFDKLKAKYDAEIAAKPRDPITITLADGSVKEGIAWETTPAQIAEGISKSLLKR  116

Query  385  ALISKVNG---VLWDMSRPLEGDCKLELFTFDSDEGRDTFWHSSAHILGQSVEMKYGCKL  555
             +++K+NG    LWD+ RPLE DC LEL  F+++EGR  FWHSSAHILG++ E ++GC L
Sbjct  117  TVVAKLNGDSEQLWDLERPLEKDCTLELLPFENEEGRRVFWHSSAHILGEASERRFGCSL  176

Query  556  CIGP  567
            CIGP
Sbjct  177  CIGP  180



>ref|XP_001587735.1| hypothetical protein SS1G_10975 [Sclerotinia sclerotiorum 1980]
 gb|EDN95100.1| hypothetical protein SS1G_10975 [Sclerotinia sclerotiorum 1980 
UF-70]
Length=791

 Score =   132 bits (333),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 63/124 (51%), Positives = 86/124 (69%), Gaps = 3/124 (2%)
 Frame = +1

Query  205  IPKRISLFESIKsqqqlqrlslsPDPIKIELPNGSVKEGKKWNTTPLDIAKELSKSLASN  384
            I  RI++F+ +K++   +  +    PI I L +GS+KEG  W TTP  IA+ +SKSL   
Sbjct  57   IAHRIAVFDKLKAKYDAEIAAKPRVPITITLADGSIKEGIAWETTPAQIAEGISKSLLKR  116

Query  385  ALISKVNG---VLWDMSRPLEGDCKLELFTFDSDEGRDTFWHSSAHILGQSVEMKYGCKL  555
             +++K+NG    LWD+ RPLE DCKLEL  F++DEGR  FWHSSAHILG++ E ++GC L
Sbjct  117  TVVAKLNGDSEQLWDLERPLENDCKLELLPFENDEGRRVFWHSSAHILGEASERRFGCSL  176

Query  556  CIGP  567
            CIGP
Sbjct  177  CIGP  180



>ref|XP_002420321.1| threonyl-tRNA synthetase, cytoplasmic, putative [Candida dubliniensis 
CD36]
 emb|CAX41396.1| threonyl-tRNA synthetase, cytoplasmic, putative [Candida dubliniensis 
CD36]
Length=706

 Score =   132 bits (331),  Expect = 6e-32, Method: Compositional matrix adjust.
 Identities = 67/136 (49%), Positives = 87/136 (64%), Gaps = 3/136 (2%)
 Frame = +1

Query  175  PKDDAYLQ---SVIPKRISLFESIKsqqqlqrlslsPDPIKIELPNGSVKEGKKWNTTPL  345
            P +  YL    + I +RI LFE +K+Q   +  +    PIKI L +G+VKEG  + T+P+
Sbjct  20   PANSLYLDPQPAFIEERIKLFEELKAQYDEEISNKEKTPIKITLRDGTVKEGTAFETSPM  79

Query  346  DIAKELSKSLASNALISKVNGVLWDMSRPLEGDCKLELFTFDSDEGRDTFWHSSAHILGQ  525
            DIA  + KS A   +I+KV+G LWDM RPLEGD KLE   F+  EG+  FWHSSAHILG+
Sbjct  80   DIANSIGKSFAERQVIAKVDGKLWDMPRPLEGDVKLEFLDFEHPEGKAVFWHSSAHILGE  139

Query  526  SVEMKYGCKLCIGPCT  573
            + E  YGC L  GP T
Sbjct  140  ACECHYGCHLSHGPPT  155



>ref|XP_002172490.1| cytoplasmic threonine-tRNA ligase Trs1 [Schizosaccharomyces japonicus 
yFS275]
 gb|EEB06197.1| cytoplasmic threonine-tRNA ligase Trs1 [Schizosaccharomyces japonicus 
yFS275]
Length=699

 Score =   132 bits (331),  Expect = 6e-32, Method: Compositional matrix adjust.
 Identities = 60/124 (48%), Positives = 82/124 (66%), Gaps = 0/124 (0%)
 Frame = +1

Query  205  IPKRISLFESIKsqqqlqrlslsPDPIKIELPNGSVKEGKKWNTTPLDIAKELSKSLASN  384
            I  RI++FE ++ + +    +     I + LP+GS +E   W TTP+DIA  +SK LA  
Sbjct  19   IQYRIAMFEQLQKEYKEFIAAQPRKTITVTLPDGSTREATSWETTPMDIAVSISKGLADR  78

Query  385  ALISKVNGVLWDMSRPLEGDCKLELFTFDSDEGRDTFWHSSAHILGQSVEMKYGCKLCIG  564
             +ISKVN  LWD++RPLE  C L+L  F+  EG+  FWHSSAHILG++ E+ +GC LCIG
Sbjct  79   TVISKVNDQLWDLTRPLEDSCTLKLLDFNDPEGKRVFWHSSAHILGEASELHFGCHLCIG  138

Query  565  PCTT  576
            P TT
Sbjct  139  PPTT  142



>gb|KII91811.1| hypothetical protein PLICRDRAFT_38662 [Plicaturopsis crispa FD-325 
SS-3]
Length=725

 Score =   132 bits (331),  Expect = 7e-32, Method: Compositional matrix adjust.
 Identities = 60/120 (50%), Positives = 80/120 (67%), Gaps = 0/120 (0%)
 Frame = +1

Query  214  RISLFESIKsqqqlqrlslsPDPIKIELPNGSVKEGKKWNTTPLDIAKELSKSLASNALI  393
            R+ LFE  K++      S   + I + LP+G+ ++   W T+PLDIAK +SKSLA   +I
Sbjct  52   RVQLFEKFKAEHDEFIKSQPHEEISVTLPDGTERKATSWETSPLDIAKAISKSLADRIVI  111

Query  394  SKVNGVLWDMSRPLEGDCKLELFTFDSDEGRDTFWHSSAHILGQSVEMKYGCKLCIGPCT  573
             KV+G LWD+ RPLE  CKL+L  F+  EG+  FWHSSAH+LG++ E  YGC LCIGP T
Sbjct  112  GKVDGQLWDLERPLEKSCKLQLLDFEHPEGKKVFWHSSAHVLGEAAEKHYGCHLCIGPPT  171



>ref|XP_004200388.1| Piso0_002974 [Millerozyma farinosa CBS 7064]
 ref|XP_004201019.1| Piso0_002974 [Millerozyma farinosa CBS 7064]
 emb|CCE80647.1| Piso0_002974 [Millerozyma farinosa CBS 7064]
 emb|CCE79882.1| Piso0_002974 [Millerozyma farinosa CBS 7064]
Length=730

 Score =   132 bits (331),  Expect = 7e-32, Method: Compositional matrix adjust.
 Identities = 66/123 (54%), Positives = 81/123 (66%), Gaps = 0/123 (0%)
 Frame = +1

Query  205  IPKRISLFESIKsqqqlqrlslsPDPIKIELPNGSVKEGKKWNTTPLDIAKELSKSLASN  384
            I +RI  FE I  +Q  +       PIKI L +GSVKEG  + T+PLDIA+ + KS +  
Sbjct  53   IEERIKYFEEIAERQGKELAQKERKPIKITLKDGSVKEGVSYETSPLDIAQSIGKSFSER  112

Query  385  ALISKVNGVLWDMSRPLEGDCKLELFTFDSDEGRDTFWHSSAHILGQSVEMKYGCKLCIG  564
             +ISKVNG LWDM RPLE D +LE   FDS EG+  FWHSSAHI+G+S E+ YGC L  G
Sbjct  113  QVISKVNGELWDMPRPLEQDSQLEFLDFDSREGKMVFWHSSAHIMGESCELCYGCHLSHG  172

Query  565  PCT  573
            P T
Sbjct  173  PPT  175



>gb|KFP72660.1| putative threonine--tRNA ligase 2, cytoplasmic, partial [Apaloderma 
vittatum]
Length=562

 Score =   130 bits (327),  Expect = 7e-32, Method: Compositional matrix adjust.
 Identities = 61/126 (48%), Positives = 85/126 (67%), Gaps = 3/126 (2%)
 Frame = +1

Query  199  SVIPKRISLFESIKsqqqlqrlslsPD---PIKIELPNGSVKEGKKWNTTPLDIAKELSK  369
            + I  R+ L+E++K +        + +   PIKI L +G   EG+ W TTP  +A  +S+
Sbjct  2    NFIEDRLKLYEALKKEHDALLAYRAANESKPIKITLTDGKTTEGESWKTTPYQLAAGVSQ  61

Query  370  SLASNALISKVNGVLWDMSRPLEGDCKLELFTFDSDEGRDTFWHSSAHILGQSVEMKYGC  549
             LASNA+I+KVNG LWD+ RPLEGDC LEL TFD++E +  +WHSSAHILG+++E  +G 
Sbjct  62   GLASNAVIAKVNGELWDLDRPLEGDCTLELLTFDNEEAKAVYWHSSAHILGEAMEGYFGG  121

Query  550  KLCIGP  567
             LC GP
Sbjct  122  CLCYGP  127



>gb|KDR13507.1| Threonyl-tRNA synthetase, cytoplasmic [Zootermopsis nevadensis]
Length=791

 Score =   132 bits (332),  Expect = 7e-32, Method: Compositional matrix adjust.
 Identities = 59/123 (48%), Positives = 89/123 (72%), Gaps = 0/123 (0%)
 Frame = +1

Query  199  SVIPKRISLFESIKsqqqlqrlslsPDPIKIELPNGSVKEGKKWNTTPLDIAKELSKSLA  378
            + I +RI+L++ +K Q + +  + +  PIKI LP+G V EG+ W TTP ++A+ +S+ LA
Sbjct  124  TYIEERINLWDKLKLQYETELAAKTSVPIKITLPDGKVTEGQSWRTTPYEVARGISQGLA  183

Query  379  SNALISKVNGVLWDMSRPLEGDCKLELFTFDSDEGRDTFWHSSAHILGQSVEMKYGCKLC  558
             N++++KVNG LWD+ RPLE D +L+L  FD +EG+  FWHS+AHILG+++E  YG  LC
Sbjct  184  DNSVVAKVNGELWDLGRPLEKDSELQLLKFDDNEGQQVFWHSTAHILGEAMERVYGGCLC  243

Query  559  IGP  567
             GP
Sbjct  244  YGP  246



>gb|EMC81245.1| putative threonyl-tRNA synthetase 2, cytoplasmic, partial [Columba 
livia]
Length=673

 Score =   131 bits (330),  Expect = 7e-32, Method: Compositional matrix adjust.
 Identities = 62/126 (49%), Positives = 86/126 (68%), Gaps = 3/126 (2%)
 Frame = +1

Query  199  SVIPKRISLFESIKsqqqlqrlslsPD---PIKIELPNGSVKEGKKWNTTPLDIAKELSK  369
            S I  R+ L+E++K +        + +   PIKI L +G + EG+ W TTP  +A  +S+
Sbjct  2    SFIEDRLKLYEALKKEHDALLAHRAANQSKPIKISLADGKMAEGESWKTTPYQLAVGISQ  61

Query  370  SLASNALISKVNGVLWDMSRPLEGDCKLELFTFDSDEGRDTFWHSSAHILGQSVEMKYGC  549
             LASNA+I+KVNG LWD+ RPLEGDC LEL TFD++E +  +WHSSAHILG+++E  +G 
Sbjct  62   VLASNAVIAKVNGELWDLDRPLEGDCTLELLTFDNEEAKAVYWHSSAHILGEAMEGYFGG  121

Query  550  KLCIGP  567
             LC GP
Sbjct  122  CLCYGP  127



>ref|XP_009867831.1| PREDICTED: probable threonine--tRNA ligase 2, cytoplasmic, partial 
[Apaloderma vittatum]
Length=628

 Score =   130 bits (328),  Expect = 9e-32, Method: Compositional matrix adjust.
 Identities = 63/135 (47%), Positives = 87/135 (64%), Gaps = 3/135 (2%)
 Frame = +1

Query  172  HPKDDAYLQSVIPKRISLFESIKsqqqlqrlslsPD---PIKIELPNGSVKEGKKWNTTP  342
            H  D     + I  R+ L+E++K +        + +   PIKI L +G   EG+ W TTP
Sbjct  60   HQNDLESEPNFIEDRLKLYEALKKEHDALLAYRAANESKPIKITLTDGKTTEGESWKTTP  119

Query  343  LDIAKELSKSLASNALISKVNGVLWDMSRPLEGDCKLELFTFDSDEGRDTFWHSSAHILG  522
              +A  +S+ LASNA+I+KVNG LWD+ RPLEGDC LEL TFD++E +  +WHSSAHILG
Sbjct  120  YQLAAGVSQGLASNAVIAKVNGELWDLDRPLEGDCTLELLTFDNEEAKAVYWHSSAHILG  179

Query  523  QSVEMKYGCKLCIGP  567
            +++E  +G  LC GP
Sbjct  180  EAMEGYFGGCLCYGP  194



>gb|KIY49829.1| tars protein [Fistulina hepatica ATCC 64428]
Length=707

 Score =   131 bits (330),  Expect = 9e-32, Method: Compositional matrix adjust.
 Identities = 56/123 (46%), Positives = 81/123 (66%), Gaps = 0/123 (0%)
 Frame = +1

Query  205  IPKRISLFESIKsqqqlqrlslsPDPIKIELPNGSVKEGKKWNTTPLDIAKELSKSLASN  384
            I  RI +FE++K +      +   + I + LP+GS +    W ++P+D+A+ +SKSLA  
Sbjct  33   IDHRIQMFEALKLEYDEFVKAQPREEITVTLPDGSTRSATSWESSPMDVARVISKSLAEK  92

Query  385  ALISKVNGVLWDMSRPLEGDCKLELFTFDSDEGRDTFWHSSAHILGQSVEMKYGCKLCIG  564
             +I+KV+G LWD+ RPLE  C LEL  F+  EG+  FWHSSAH+LG++ E  YGC LC+G
Sbjct  93   VVIAKVDGTLWDLERPLEKSCSLELLDFEHTEGKKVFWHSSAHVLGEAAERHYGCHLCLG  152

Query  565  PCT  573
            P T
Sbjct  153  PPT  155



>ref|XP_010570569.1| PREDICTED: threonine--tRNA ligase, cytoplasmic-like [Haliaeetus 
leucocephalus]
Length=786

 Score =   132 bits (331),  Expect = 9e-32, Method: Compositional matrix adjust.
 Identities = 64/135 (47%), Positives = 88/135 (65%), Gaps = 3/135 (2%)
 Frame = +1

Query  172  HPKDDAYLQSVIPKRISLFESIKsqqqlqrlslsPD---PIKIELPNGSVKEGKKWNTTP  342
            H  D  Y  S I  R+ L+E++K +        + +   PIKI L +G + EG+ W TTP
Sbjct  106  HRNDLQYEPSFIEDRLKLYEALKKEHDALLAYRAANQSKPIKIILTDGKMTEGESWKTTP  165

Query  343  LDIAKELSKSLASNALISKVNGVLWDMSRPLEGDCKLELFTFDSDEGRDTFWHSSAHILG  522
              +A  +S+ LASNA+I+KVNG LWD+ RPLEGDC LEL  FD++E +  +WHSSAHILG
Sbjct  166  YQLAVGISQVLASNAVIAKVNGELWDLDRPLEGDCTLELLMFDNEEAKAVYWHSSAHILG  225

Query  523  QSVEMKYGCKLCIGP  567
            +++E  +G  LC GP
Sbjct  226  EAMEGYFGGCLCYGP  240



>ref|XP_008925398.1| PREDICTED: LOW QUALITY PROTEIN: probable threonine--tRNA ligase 
2, cytoplasmic [Manacus vitellinus]
Length=724

 Score =   131 bits (330),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 64/135 (47%), Positives = 89/135 (66%), Gaps = 3/135 (2%)
 Frame = +1

Query  172  HPKDDAYLQSVIPKRISLFESIKsqqqlqrlslsPDP---IKIELPNGSVKEGKKWNTTP  342
            H  D   + S I  R+ L+E++K +        + +    IKI L +G++ EG+ W TTP
Sbjct  46   HQSDLQCVPSFIEDRLKLYEALKKEHDALLAYRAANQSQSIKITLKDGTMAEGESWKTTP  105

Query  343  LDIAKELSKSLASNALISKVNGVLWDMSRPLEGDCKLELFTFDSDEGRDTFWHSSAHILG  522
              IA  +S++LASNA+I+KVNG LWD+ RPLEGDC LEL TFD +E +  +WHSSAHILG
Sbjct  106  YQIAVGISQALASNAVIAKVNGELWDLDRPLEGDCTLELLTFDDEEAKAVYWHSSAHILG  165

Query  523  QSVEMKYGCKLCIGP  567
            +++E  +G  LC GP
Sbjct  166  EAMEGYFGGCLCYGP  180



>gb|KDR74949.1| hypothetical protein GALMADRAFT_249885 [Galerina marginata CBS 
339.88]
Length=723

 Score =   131 bits (329),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 56/120 (47%), Positives = 83/120 (69%), Gaps = 0/120 (0%)
 Frame = +1

Query  214  RISLFESIKsqqqlqrlslsPDPIKIELPNGSVKEGKKWNTTPLDIAKELSKSLASNALI  393
            R+ +F  +K++      +   + I + +P+GS ++ K W T+P+D+AKE+SKSL+   +I
Sbjct  56   RLKIFNELKAEYDAFVAAQPREEITVTMPDGSERKAKSWGTSPMDVAKEVSKSLSERIVI  115

Query  394  SKVNGVLWDMSRPLEGDCKLELFTFDSDEGRDTFWHSSAHILGQSVEMKYGCKLCIGPCT  573
            +KV+G LWD+ RPLE  CKLEL  F+  EG+  FWHSSAH+LG++ E  YGC LC+GP T
Sbjct  116  AKVDGNLWDLERPLEKSCKLELLDFEHPEGKKVFWHSSAHVLGEAAERHYGCHLCLGPPT  175



>ref|XP_001418868.1| predicted protein [Ostreococcus lucimarinus CCE9901]
 gb|ABO97161.1| predicted protein [Ostreococcus lucimarinus CCE9901]
Length=674

 Score =   130 bits (328),  Expect = 1e-31, Method: Composition-based stats.
 Identities = 54/95 (57%), Positives = 75/95 (79%), Gaps = 0/95 (0%)
 Frame = +1

Query  283  IKIELPNGSVKEGKKWNTTPLDIAKELSKSLASNALISKVNGVLWDMSRPLEGDCKLELF  462
            IK+ LP+G+ K+G ++ TTP DIA  + K LA +AL++KV+G  WDM RPLEGDC L LF
Sbjct  48   IKVTLPDGAQKDGTRFATTPFDIALGIHKKLAQSALVAKVDGEFWDMRRPLEGDCALALF  107

Query  463  TFDSDEGRDTFWHSSAHILGQSVEMKYGCKLCIGP  567
            TFD +EG++ +WHSSAH+LG+++E++YG  L IGP
Sbjct  108  TFDDEEGKECYWHSSAHVLGEALELEYGADLTIGP  142



>gb|KFP96981.1| putative threonine--tRNA ligase 2, cytoplasmic, partial [Leptosomus 
discolor]
Length=673

 Score =   130 bits (328),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 62/126 (49%), Positives = 85/126 (67%), Gaps = 3/126 (2%)
 Frame = +1

Query  199  SVIPKRISLFESIKsqqqlqrlslsPD---PIKIELPNGSVKEGKKWNTTPLDIAKELSK  369
            S I  R+ L+E +K +          +   PIKI L +G + EG+ W TTP  +A  +S+
Sbjct  2    SFIEDRLKLYEVLKKEHDALLAYRVANQSKPIKITLTDGKMAEGESWKTTPYQLAVGISQ  61

Query  370  SLASNALISKVNGVLWDMSRPLEGDCKLELFTFDSDEGRDTFWHSSAHILGQSVEMKYGC  549
            +LASNA+I+KVNG LWD+ RPLEGDC LEL TFD++E +  +WHSSAHILG+++E  +G 
Sbjct  62   ALASNAVIAKVNGELWDLDRPLEGDCTLELLTFDNEEAKAVYWHSSAHILGEAMEGYFGG  121

Query  550  KLCIGP  567
             LC GP
Sbjct  122  CLCYGP  127



>ref|XP_009980107.1| PREDICTED: threonine--tRNA ligase, cytoplasmic-like [Tauraco 
erythrolophus]
Length=736

 Score =   131 bits (329),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 63/135 (47%), Positives = 88/135 (65%), Gaps = 3/135 (2%)
 Frame = +1

Query  172  HPKDDAYLQSVIPKRISLFESIKsqqqlqrlslsPD---PIKIELPNGSVKEGKKWNTTP  342
            H KD     S I  R+ L++ +K +        + +   PIKI L +G + EG+ W TTP
Sbjct  56   HRKDLQCEPSFIEDRLKLYKELKKEHDALLAYRAANQSKPIKINLTDGKIAEGESWKTTP  115

Query  343  LDIAKELSKSLASNALISKVNGVLWDMSRPLEGDCKLELFTFDSDEGRDTFWHSSAHILG  522
              +A  +S+ LASNA+++KVNG LWD+ RPLEGDC LEL TFD++E +  +WHSSAHILG
Sbjct  116  YQLAAGISQVLASNAVVAKVNGELWDLDRPLEGDCTLELLTFDNEEAKAVYWHSSAHILG  175

Query  523  QSVEMKYGCKLCIGP  567
            +++E  +G  LC GP
Sbjct  176  EAMEGYFGGCLCYGP  190



>gb|ESZ90653.1| threonyl-tRNA synthetase [Sclerotinia borealis F-4157]
Length=790

 Score =   131 bits (330),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 61/124 (49%), Positives = 87/124 (70%), Gaps = 3/124 (2%)
 Frame = +1

Query  205  IPKRISLFESIKsqqqlqrlslsPDPIKIELPNGSVKEGKKWNTTPLDIAKELSKSLASN  384
            I  RI++F+ +K++   +  +   +PI I L +GS+KEG  W TTP  IA+ +SKSL   
Sbjct  60   IAHRIAVFDKLKAKYDAKIAAKVREPITITLADGSIKEGIAWETTPAQIAEGISKSLLKR  119

Query  385  ALISKVNG---VLWDMSRPLEGDCKLELFTFDSDEGRDTFWHSSAHILGQSVEMKYGCKL  555
             +++K+NG    LWD+ RPLE DCKLEL  F+++EG+  FWHSSAHILG++ E ++GC L
Sbjct  120  TVVAKLNGDSEQLWDLERPLEKDCKLELLPFENEEGKRVFWHSSAHILGEASERRFGCSL  179

Query  556  CIGP  567
            CIGP
Sbjct  180  CIGP  183



>gb|KFQ99509.1| putative threonine--tRNA ligase 2, cytoplasmic, partial [Opisthocomus 
hoazin]
Length=673

 Score =   130 bits (328),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 62/126 (49%), Positives = 86/126 (68%), Gaps = 3/126 (2%)
 Frame = +1

Query  199  SVIPKRISLFESIKsqqqlqrlslsPD---PIKIELPNGSVKEGKKWNTTPLDIAKELSK  369
            S I  R+ L+E++K +        + +   PIKI L +G + EG+ W TTP  +A E+S+
Sbjct  2    SFIEDRLKLYEALKKEHDALLAYRATNQSKPIKITLTDGKMVEGESWKTTPYQLATEISQ  61

Query  370  SLASNALISKVNGVLWDMSRPLEGDCKLELFTFDSDEGRDTFWHSSAHILGQSVEMKYGC  549
             L+SNA+I+KVN  LWD+ RPLEGDC LEL TFDS+E +  +WHSSAHILG+++E  +G 
Sbjct  62   VLSSNAVIAKVNSELWDLDRPLEGDCTLELLTFDSEEAKAVYWHSSAHILGEAMEGYFGG  121

Query  550  KLCIGP  567
             LC GP
Sbjct  122  CLCYGP  127



>ref|XP_005511265.1| PREDICTED: probable threonine--tRNA ligase 2, cytoplasmic [Columba 
livia]
Length=772

 Score =   131 bits (329),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 62/126 (49%), Positives = 86/126 (68%), Gaps = 3/126 (2%)
 Frame = +1

Query  199  SVIPKRISLFESIKsqqqlqrlslsPD---PIKIELPNGSVKEGKKWNTTPLDIAKELSK  369
            S I  R+ L+E++K +        + +   PIKI L +G + EG+ W TTP  +A  +S+
Sbjct  101  SFIEDRLKLYEALKKEHDALLAHRAANQSKPIKISLADGKMAEGESWKTTPYQLAVGISQ  160

Query  370  SLASNALISKVNGVLWDMSRPLEGDCKLELFTFDSDEGRDTFWHSSAHILGQSVEMKYGC  549
             LASNA+I+KVNG LWD+ RPLEGDC LEL TFD++E +  +WHSSAHILG+++E  +G 
Sbjct  161  VLASNAVIAKVNGELWDLDRPLEGDCTLELLTFDNEEAKAVYWHSSAHILGEAMEGYFGG  220

Query  550  KLCIGP  567
             LC GP
Sbjct  221  CLCYGP  226



>ref|XP_007303607.1| threonyl-tRNA synthetase [Stereum hirsutum FP-91666 SS1]
 gb|EIM87343.1| threonyl-tRNA synthetase [Stereum hirsutum FP-91666 SS1]
Length=733

 Score =   131 bits (329),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 59/120 (49%), Positives = 83/120 (69%), Gaps = 0/120 (0%)
 Frame = +1

Query  214  RISLFESIKsqqqlqrlslsPDPIKIELPNGSVKEGKKWNTTPLDIAKELSKSLASNALI  393
            RI +FE +K++      S   + I + LP+G+ K+   W ++P+DIAKE+SKSL+   +I
Sbjct  65   RIKIFEKLKAEYDEHVKSQPREEITVTLPDGNEKKATSWESSPMDIAKEISKSLSERLVI  124

Query  394  SKVNGVLWDMSRPLEGDCKLELFTFDSDEGRDTFWHSSAHILGQSVEMKYGCKLCIGPCT  573
            +KV+G LWD+ RPLE  CK+EL  F+  EG+  FWHSSAH+LG++ E  YGC LCIGP T
Sbjct  125  AKVDGELWDLERPLEKSCKVELLDFEHPEGKKVFWHSSAHVLGEASERHYGCHLCIGPPT  184



>ref|XP_009944987.1| PREDICTED: probable threonine--tRNA ligase 2, cytoplasmic, partial 
[Leptosomus discolor]
Length=708

 Score =   130 bits (328),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 62/126 (49%), Positives = 85/126 (67%), Gaps = 3/126 (2%)
 Frame = +1

Query  199  SVIPKRISLFESIKsqqqlqrlslsPD---PIKIELPNGSVKEGKKWNTTPLDIAKELSK  369
            S I  R+ L+E +K +          +   PIKI L +G + EG+ W TTP  +A  +S+
Sbjct  37   SFIEDRLKLYEVLKKEHDALLAYRVANQSKPIKITLTDGKMAEGESWKTTPYQLAVGISQ  96

Query  370  SLASNALISKVNGVLWDMSRPLEGDCKLELFTFDSDEGRDTFWHSSAHILGQSVEMKYGC  549
            +LASNA+I+KVNG LWD+ RPLEGDC LEL TFD++E +  +WHSSAHILG+++E  +G 
Sbjct  97   ALASNAVIAKVNGELWDLDRPLEGDCTLELLTFDNEEAKAVYWHSSAHILGEAMEGYFGG  156

Query  550  KLCIGP  567
             LC GP
Sbjct  157  CLCYGP  162



>ref|XP_009934283.1| PREDICTED: probable threonine--tRNA ligase 2, cytoplasmic [Opisthocomus 
hoazin]
Length=730

 Score =   131 bits (329),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 62/126 (49%), Positives = 86/126 (68%), Gaps = 3/126 (2%)
 Frame = +1

Query  199  SVIPKRISLFESIKsqqqlqrlslsPD---PIKIELPNGSVKEGKKWNTTPLDIAKELSK  369
            S I  R+ L+E++K +        + +   PIKI L +G + EG+ W TTP  +A E+S+
Sbjct  59   SFIEDRLKLYEALKKEHDALLAYRATNQSKPIKITLTDGKMVEGESWKTTPYQLATEISQ  118

Query  370  SLASNALISKVNGVLWDMSRPLEGDCKLELFTFDSDEGRDTFWHSSAHILGQSVEMKYGC  549
             L+SNA+I+KVN  LWD+ RPLEGDC LEL TFDS+E +  +WHSSAHILG+++E  +G 
Sbjct  119  VLSSNAVIAKVNSELWDLDRPLEGDCTLELLTFDSEEAKAVYWHSSAHILGEAMEGYFGG  178

Query  550  KLCIGP  567
             LC GP
Sbjct  179  CLCYGP  184



>ref|NP_001280151.1| probable threonyl-tRNA synthetase 2, cytoplasmic [Gallus gallus]
Length=784

 Score =   131 bits (329),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 62/126 (49%), Positives = 84/126 (67%), Gaps = 3/126 (2%)
 Frame = +1

Query  199  SVIPKRISLFESIKsqqqlqrlslsPD---PIKIELPNGSVKEGKKWNTTPLDIAKELSK  369
            S I  R+ L+E++K +        + +   PIKI L +G + +G+ W TTP  +A  +S+
Sbjct  113  SFIEDRLKLYETLKKEHDALLAYRAANETKPIKITLTDGKIADGESWKTTPYQLAVGISQ  172

Query  370  SLASNALISKVNGVLWDMSRPLEGDCKLELFTFDSDEGRDTFWHSSAHILGQSVEMKYGC  549
             LASNA+I+KVNG LWD+ RPLEGDC LEL TFD  E +  +WHSSAHILG+++E  YG 
Sbjct  173  GLASNAVIAKVNGELWDLDRPLEGDCTLELLTFDDQEAQAVYWHSSAHILGEAMEGYYGG  232

Query  550  KLCIGP  567
             LC GP
Sbjct  233  CLCYGP  238



>gb|KIZ00239.1| threonyl-tRNA synthetase [Monoraphidium neglectum]
Length=659

 Score =   130 bits (327),  Expect = 2e-31, Method: Composition-based stats.
 Identities = 61/121 (50%), Positives = 88/121 (73%), Gaps = 2/121 (2%)
 Frame = +1

Query  211  KRISLFESI--KsqqqlqrlslsPDPIKIELPNGSVKEGKKWNTTPLDIAKELSKSLASN  384
            KRI+LFE    + QQ+++    +  PIK+ LP+G++KE  K  TTPLD+A E+SKSL   
Sbjct  31   KRIALFEQFYEREQQRVEEARKAAVPIKVVLPDGAIKEAIKGATTPLDVANEISKSLGKK  90

Query  385  ALISKVNGVLWDMSRPLEGDCKLELFTFDSDEGRDTFWHSSAHILGQSVEMKYGCKLCIG  564
             L++ V+G +WD  RPLE DC L+L T+D  +G++TFWHSSAH+LG+++EM++G  L IG
Sbjct  91   VLVATVDGEVWDAFRPLEADCALQLLTWDEPDGKETFWHSSAHVLGEALEMEFGVDLTIG  150

Query  565  P  567
            P
Sbjct  151  P  151



>ref|XP_009992825.1| PREDICTED: probable threonine--tRNA ligase 2, cytoplasmic [Chaetura 
pelagica]
Length=735

 Score =   130 bits (328),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 66/135 (49%), Positives = 88/135 (65%), Gaps = 3/135 (2%)
 Frame = +1

Query  172  HPKDDAYLQSVIPKRISLFESIKsqq---qlqrlslsPDPIKIELPNGSVKEGKKWNTTP  342
            H KD     S I  R+ L+E++K +       R +    PIKI L +G V EG+ W TTP
Sbjct  55   HQKDVQCEPSFIKDRLKLYEALKKEHDALLAYRAASESKPIKITLTDGKVAEGESWKTTP  114

Query  343  LDIAKELSKSLASNALISKVNGVLWDMSRPLEGDCKLELFTFDSDEGRDTFWHSSAHILG  522
              +A  +S+ LASNA+I+KVNG LWD+ R LEGDC LEL TFD++E +  +WHSSAHILG
Sbjct  115  YQLAVGISQMLASNAVIAKVNGELWDLDRQLEGDCTLELLTFDNEEAKAVYWHSSAHILG  174

Query  523  QSVEMKYGCKLCIGP  567
            +++E  +G  LC GP
Sbjct  175  EAMEGYFGGCLCYGP  189



>emb|CCE44005.1| hypothetical protein CPAR2_502300 [Candida parapsilosis]
Length=900

 Score =   131 bits (329),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 62/125 (50%), Positives = 82/125 (66%), Gaps = 0/125 (0%)
 Frame = +1

Query  199  SVIPKRISLFESIKsqqqlqrlslsPDPIKIELPNGSVKEGKKWNTTPLDIAKELSKSLA  378
            + + +RI LF+ +K++   +  +    PI+I L +GSVKEG  + T+P+DIA  + KS A
Sbjct  42   AFLEERIKLFDELKAKYDAEIAAKEKKPIQITLKDGSVKEGTSYETSPMDIANSIGKSFA  101

Query  379  SNALISKVNGVLWDMSRPLEGDCKLELFTFDSDEGRDTFWHSSAHILGQSVEMKYGCKLC  558
               +ISKVNG LWDM RPLEGD  LE   F+  EG+  FWHSSAHILG++ E  YGC L 
Sbjct  102  ERQVISKVNGKLWDMPRPLEGDATLEFLDFEHPEGKAVFWHSSAHILGEACECHYGCHLS  161

Query  559  IGPCT  573
             GP T
Sbjct  162  HGPPT  166



>gb|ESA17167.1| hypothetical protein GLOINDRAFT_345213 [Rhizophagus irregularis 
DAOM 181602]
 gb|EXX52587.1| threonine--tRNA ligase THS1 [Rhizophagus irregularis DAOM 197198w]
Length=729

 Score =   130 bits (327),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 62/121 (51%), Positives = 78/121 (64%), Gaps = 0/121 (0%)
 Frame = +1

Query  205  IPKRISLFESIKsqqqlqrlslsPDPIKIELPNGSVKEGKKWNTTPLDIAKELSKSLASN  384
            I  RI LFE  K     +  +    PI +  P+G   E   W TTPL+IAK +SKSL   
Sbjct  48   IVHRIKLFEEWKKAYDEEIKNRPRVPITVTFPDGRKLEATAWETTPLEIAKNISKSLYER  107

Query  385  ALISKVNGVLWDMSRPLEGDCKLELFTFDSDEGRDTFWHSSAHILGQSVEMKYGCKLCIG  564
             +I+KVNGVL+D+ RPLE DC LEL  F+ +EG+  FWHSSAH+LG++ E  YGC LCIG
Sbjct  108  TVIAKVNGVLFDLIRPLEIDCTLELLDFEHEEGKKVFWHSSAHVLGEACERHYGCNLCIG  167

Query  565  P  567
            P
Sbjct  168  P  168



>emb|CBY19737.1| unnamed protein product [Oikopleura dioica]
Length=800

 Score =   130 bits (328),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 58/121 (48%), Positives = 86/121 (71%), Gaps = 0/121 (0%)
 Frame = +1

Query  205  IPKRISLFESIKsqqqlqrlslsPDPIKIELPNGSVKEGKKWNTTPLDIAKELSKSLASN  384
            +  R+ +F+ + + Q+ +  ++  +PIK+ LP+G+VKEG  W TTPLDIAK +S  LA+ 
Sbjct  114  VAYRLKMFDELFAAQEERIAAMPKNPIKVTLPDGAVKEGTSWETTPLDIAKSISSGLANV  173

Query  385  ALISKVNGVLWDMSRPLEGDCKLELFTFDSDEGRDTFWHSSAHILGQSVEMKYGCKLCIG  564
             + +KVNG +WD++R LEGDC +EL  F   EG++T+WHSSAHILG+ +E  +G  LC G
Sbjct  174  VVCAKVNGQVWDLTRKLEGDCSIELLKFSDKEGKETYWHSSAHILGECMERYFGGALCYG  233

Query  565  P  567
            P
Sbjct  234  P  234



>ref|XP_003288175.1| threonyl-tRNA synthetase [Dictyostelium purpureum]
 gb|EGC35308.1| threonyl-tRNA synthetase [Dictyostelium purpureum]
Length=713

 Score =   130 bits (327),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 66/124 (53%), Positives = 88/124 (71%), Gaps = 0/124 (0%)
 Frame = +1

Query  205  IPKRISLFESIKsqqqlqrlslsPDPIKIELPNGSVKEGKKWNTTPLDIAKELSKSLASN  384
            I +RI+++E +K+Q      +L  +PI I LP+G V  G K  TTP D+AK +S+ LA +
Sbjct  54   IKERIAIWEGLKAQHLEAIKNLPDEPILITLPDGKVIHGVKNKTTPYDVAKGISRGLADS  113

Query  385  ALISKVNGVLWDMSRPLEGDCKLELFTFDSDEGRDTFWHSSAHILGQSVEMKYGCKLCIG  564
             + S VN  + D+SRPLEGDCKLEL  FD+D G+ TFWHSSAHILGQ++E  YG +LCIG
Sbjct  114  IVSSIVNEQIHDISRPLEGDCKLELCKFDTDAGKKTFWHSSAHILGQAMERVYGGQLCIG  173

Query  565  PCTT  576
            P T+
Sbjct  174  PATS  177



>ref|XP_005487937.1| PREDICTED: probable threonine--tRNA ligase 2, cytoplasmic [Zonotrichia 
albicollis]
Length=768

 Score =   130 bits (328),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 64/135 (47%), Positives = 87/135 (64%), Gaps = 3/135 (2%)
 Frame = +1

Query  172  HPKDDAYLQSVIPKRISLFESIKsqqqlqrlslsPD---PIKIELPNGSVKEGKKWNTTP  342
            H  D   + S I  R+ L+E +K +        + +   PIKI L +G   EG+ W TTP
Sbjct  88   HQNDLQCVPSFIEDRLKLYEVLKKEHDALLAYRAVNQSKPIKITLTDGETLEGESWKTTP  147

Query  343  LDIAKELSKSLASNALISKVNGVLWDMSRPLEGDCKLELFTFDSDEGRDTFWHSSAHILG  522
              +A  +S+ LASNA+I+KVNG LWD+ RPLEGDC LEL TFD++E +  +WHSSAHILG
Sbjct  148  YQLAVGISQVLASNAVIAKVNGELWDLDRPLEGDCTLELLTFDNEEAKAVYWHSSAHILG  207

Query  523  QSVEMKYGCKLCIGP  567
            +++E  +G  LC GP
Sbjct  208  EAMEGHFGGCLCYGP  222



>ref|XP_003031033.1| hypothetical protein SCHCODRAFT_77271 [Schizophyllum commune 
H4-8]
 gb|EFI96130.1| hypothetical protein SCHCODRAFT_77271 [Schizophyllum commune 
H4-8]
Length=728

 Score =   130 bits (327),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 57/120 (48%), Positives = 81/120 (68%), Gaps = 0/120 (0%)
 Frame = +1

Query  214  RISLFESIKsqqqlqrlslsPDPIKIELPNGSVKEGKKWNTTPLDIAKELSKSLASNALI  393
            RI +++ +K++      +   + I I LP+G+ ++G  W T+P+ IA E+SK LA   +I
Sbjct  60   RIKMYDQLKAEYDEFVKAQPREEITITLPDGAERKGTSWETSPMSIALEISKGLADKVVI  119

Query  394  SKVNGVLWDMSRPLEGDCKLELFTFDSDEGRDTFWHSSAHILGQSVEMKYGCKLCIGPCT  573
            +KV+G LWD+ RPLE  CKLEL  FD  EG+  FWHSSAH+LG++ E  YGC LC+GP T
Sbjct  120  AKVDGQLWDLERPLEKSCKLELLDFDHPEGKRVFWHSSAHVLGEAAERHYGCHLCLGPPT  179



>emb|CDR44075.1| CYFA0S13e02894g1_1 [Cyberlindnera fabianii]
Length=743

 Score =   130 bits (327),  Expect = 2e-31, Method: Composition-based stats.
 Identities = 59/123 (48%), Positives = 80/123 (65%), Gaps = 0/123 (0%)
 Frame = +1

Query  205  IPKRISLFESIKsqqqlqrlslsPDPIKIELPNGSVKEGKKWNTTPLDIAKELSKSLASN  384
            I +RI LF+ +K +      +     IKI L +G++KEG  W T+P+DIAKE+ KS    
Sbjct  67   IDERIQLFDKLKKEYDDHVAAQPRVAIKITLKDGTIKEGTAWETSPMDIAKEIGKSFVER  126

Query  385  ALISKVNGVLWDMSRPLEGDCKLELFTFDSDEGRDTFWHSSAHILGQSVEMKYGCKLCIG  564
              ISKV+G LWD+ RPLE D  LE F F+++EGR  FWHSSAH+LG++ E   G  +C+G
Sbjct  127  QCISKVDGELWDLERPLEKDAVLEFFDFETEEGRRVFWHSSAHVLGEACECNMGAHICLG  186

Query  565  PCT  573
            P T
Sbjct  187  PPT  189



>emb|CCE32326.1| probable THS1-threonyl tRNA synthetase,cytosolic [Claviceps purpurea 
20.1]
Length=740

 Score =   130 bits (327),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 63/127 (50%), Positives = 86/127 (68%), Gaps = 0/127 (0%)
 Frame = +1

Query  193  LQSVIPKRISLFESIKsqqqlqrlslsPDPIKIELPNGSVKEGKKWNTTPLDIAKELSKS  372
            L   I  R+ +F+ IK++Q  +  +   + I I L +G  ++G  W TTPL IAK +SKS
Sbjct  47   LPQFIQHRLDIFDQIKARQDAEIAAKPREEITITLSDGKEEKGTSWETTPLMIAKGISKS  106

Query  373  LASNALISKVNGVLWDMSRPLEGDCKLELFTFDSDEGRDTFWHSSAHILGQSVEMKYGCK  552
            L    +I+KV+G LWD++RPLE  C LEL +FDS+EG+  FWHSSAHILG++ E +YGC 
Sbjct  107  LVERTVITKVDGELWDLTRPLEKSCNLELISFDSEEGKAVFWHSSAHILGEACERRYGCY  166

Query  553  LCIGPCT  573
            LC GP T
Sbjct  167  LCNGPPT  173



>ref|XP_010195073.1| PREDICTED: probable threonine--tRNA ligase 2, cytoplasmic, partial 
[Colius striatus]
Length=474

 Score =   128 bits (321),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 63/132 (48%), Positives = 88/132 (67%), Gaps = 6/132 (5%)
 Frame = +1

Query  190  YLQ---SVIPKRISLFESIKsqqqlqrlslsPD---PIKIELPNGSVKEGKKWNTTPLDI  351
            YLQ   S I  R+ L+E++K +        + +   PIKI L +G + EG+ W TTP  +
Sbjct  31   YLQCEPSFIEDRLKLYEALKKEHDALLAYRAANQSKPIKITLADGKMAEGQSWKTTPYQL  90

Query  352  AKELSKSLASNALISKVNGVLWDMSRPLEGDCKLELFTFDSDEGRDTFWHSSAHILGQSV  531
            A  +S+ LASNA+I+KVNG LWD+ RPLEG C +EL TFD++E +  +WHSSAHILG+++
Sbjct  91   AVGISQVLASNAVIAKVNGELWDLDRPLEGACTVELLTFDNEEAKAVYWHSSAHILGEAM  150

Query  532  EMKYGCKLCIGP  567
            E  +G  LC GP
Sbjct  151  EGYFGGCLCYGP  162



>ref|XP_006811408.1| PREDICTED: threonine--tRNA ligase, cytoplasmic-like [Saccoglossus 
kowalevskii]
Length=681

 Score =   130 bits (326),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 61/132 (46%), Positives = 85/132 (64%), Gaps = 0/132 (0%)
 Frame = +1

Query  172  HPKDDAYLQSVIPKRISLFESIKsqqqlqrlslsPDPIKIELPNGSVKEGKKWNTTPLDI  351
            HP + +     I  RI +FE +KS+   +  +    PIK+ LP+G   + + W TTP  +
Sbjct  61   HPVELSPWPDYIQSRIEMFEKLKSEYNDEISAKEKTPIKVTLPDGKEVDAQAWLTTPYMV  120

Query  352  AKELSKSLASNALISKVNGVLWDMSRPLEGDCKLELFTFDSDEGRDTFWHSSAHILGQSV  531
            A+ +S+ LA N +I KVNGVLWD+ RPLE +C L+L  FD DEG+  FWHSSAH+LG+++
Sbjct  121  AQGISQGLADNTVIGKVNGVLWDLDRPLEENCSLQLLKFDDDEGQQVFWHSSAHMLGEAM  180

Query  532  EMKYGCKLCIGP  567
            E  YG  LC GP
Sbjct  181  ERHYGGCLCYGP  192



>ref|XP_002771785.1| threonyl-tRNA synthetase, putative [Perkinsus marinus ATCC 50983]
 gb|EER03601.1| threonyl-tRNA synthetase, putative [Perkinsus marinus ATCC 50983]
Length=820

 Score =   130 bits (328),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 65/124 (52%), Positives = 89/124 (72%), Gaps = 9/124 (7%)
 Frame = +1

Query  223  LFESIKsqqqlqrlslsPDPIKIELPNGSVKEGKKWNTTPLDIAKELSKSLASNALISKV  402
            LF+ + + Q+ +  +L  DPI I LP+G+ KEG+K+ TTPLDIA  +SK LA++ + +K+
Sbjct  62   LFDKLYAAQEERLAALPKDPITIVLPDGTQKEGRKFETTPLDIAIGISKGLANSVVAAKI  121

Query  403  ---------NGVLWDMSRPLEGDCKLELFTFDSDEGRDTFWHSSAHILGQSVEMKYGCKL  555
                     +  +WD+SRPLEG CKLEL  FDS EG+DTFWHSSAHILG+++E +YGC L
Sbjct  122  LYTEPVDSMDQTVWDLSRPLEGSCKLELLKFDSPEGKDTFWHSSAHILGEAMEQEYGCYL  181

Query  556  CIGP  567
             IGP
Sbjct  182  TIGP  185



>emb|CBY35782.1| unnamed protein product [Oikopleura dioica]
Length=800

 Score =   130 bits (328),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 59/121 (49%), Positives = 86/121 (71%), Gaps = 0/121 (0%)
 Frame = +1

Query  205  IPKRISLFESIKsqqqlqrlslsPDPIKIELPNGSVKEGKKWNTTPLDIAKELSKSLASN  384
            +  R+ +F+ + S Q+ +  ++  +PIK+ LP+G+VKEG  W TTPLDIAK +S  LA+ 
Sbjct  114  VAYRLKMFDELFSAQEERIAAMPKNPIKVTLPDGAVKEGTSWETTPLDIAKSISSGLANV  173

Query  385  ALISKVNGVLWDMSRPLEGDCKLELFTFDSDEGRDTFWHSSAHILGQSVEMKYGCKLCIG  564
             + +KVNG +WD++R LEGDC +EL  F   EG++T+WHSSAHILG+ +E  +G  LC G
Sbjct  174  VVCAKVNGQVWDLTRKLEGDCSIELLKFSDKEGKETYWHSSAHILGECMERYFGGALCYG  233

Query  565  P  567
            P
Sbjct  234  P  234



>gb|KGK38420.1| hypothetical protein JL09_g2427 [Pichia kudriavzevii]
Length=725

 Score =   130 bits (327),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 61/123 (50%), Positives = 82/123 (67%), Gaps = 0/123 (0%)
 Frame = +1

Query  205  IPKRISLFESIKsqqqlqrlslsPDPIKIELPNGSVKEGKKWNTTPLDIAKELSKSLASN  384
            I  RI +FE IK++++ +  +    PIKI L +G+VKEG  W T+P DIAKE+ KS +  
Sbjct  54   IDHRIKIFEQIKAKREAEIAAKERKPIKITLKDGTVKEGVSWETSPADIAKEIGKSFSER  113

Query  385  ALISKVNGVLWDMSRPLEGDCKLELFTFDSDEGRDTFWHSSAHILGQSVEMKYGCKLCIG  564
             +ISKV+G LWD+ RPLE D +LE   F+  EG+  FWHSSAH+LG+  E  +G  LC G
Sbjct  114  QVISKVDGELWDLERPLEKDSQLEFLDFEHPEGKAVFWHSSAHVLGEGCECHFGAHLCFG  173

Query  565  PCT  573
            P T
Sbjct  174  PPT  176



>gb|KFV00689.1| putative threonine--tRNA ligase 2, cytoplasmic, partial [Tauraco 
erythrolophus]
Length=673

 Score =   130 bits (326),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 60/126 (48%), Positives = 85/126 (67%), Gaps = 3/126 (2%)
 Frame = +1

Query  199  SVIPKRISLFESIKsqqqlqrlslsPD---PIKIELPNGSVKEGKKWNTTPLDIAKELSK  369
            S I  R+ L++ +K +        + +   PIKI L +G + EG+ W TTP  +A  +S+
Sbjct  2    SFIEDRLKLYKELKKEHDALLAYRAANQSKPIKINLTDGKIAEGESWKTTPYQLAAGISQ  61

Query  370  SLASNALISKVNGVLWDMSRPLEGDCKLELFTFDSDEGRDTFWHSSAHILGQSVEMKYGC  549
             LASNA+++KVNG LWD+ RPLEGDC LEL TFD++E +  +WHSSAHILG+++E  +G 
Sbjct  62   VLASNAVVAKVNGELWDLDRPLEGDCTLELLTFDNEEAKAVYWHSSAHILGEAMEGYFGG  121

Query  550  KLCIGP  567
             LC GP
Sbjct  122  CLCYGP  127



>gb|KIM27789.1| hypothetical protein M408DRAFT_329743 [Serendipita vermifera 
MAFF 305830]
Length=688

 Score =   130 bits (326),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 61/120 (51%), Positives = 78/120 (65%), Gaps = 0/120 (0%)
 Frame = +1

Query  214  RISLFESIKsqqqlqrlslsPDPIKIELPNGSVKEGKKWNTTPLDIAKELSKSLASNALI  393
            RI +F+  K++      S     I I L +G+ K G  W TTP+D+AKE+SKSL    +I
Sbjct  19   RIEMFDKYKAEYDEMVKSKPRQEIHITLKDGNKKTGTSWETTPMDVAKEISKSLPEKLVI  78

Query  394  SKVNGVLWDMSRPLEGDCKLELFTFDSDEGRDTFWHSSAHILGQSVEMKYGCKLCIGPCT  573
            +KV+GVLWD+ RPLEG   LEL  F+  EG+  FWHSSAHILG++ E  YGC LC GP T
Sbjct  79   AKVDGVLWDLDRPLEGSVNLELLDFEHPEGKQVFWHSSAHILGEAAEKHYGCHLCFGPPT  138



>gb|AAU89472.1| theronyl tRNA synthatase-like protein [Aedes aegypti]
Length=301

 Score =   125 bits (315),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 56/121 (46%), Positives = 80/121 (66%), Gaps = 0/121 (0%)
 Frame = +1

Query  205  IPKRISLFESIKsqqqlqrlslsPDPIKIELPNGSVKEGKKWNTTPLDIAKELSKSLASN  384
            I  RI +++ +K+Q   +      +PIK+ LP+G   +   W +TP D+AK +S  LA N
Sbjct  30   IDHRIKIYDELKAQYLEELAKKPKNPIKVTLPDGKEVDATSWESTPYDVAKGISXGLADN  89

Query  385  ALISKVNGVLWDMSRPLEGDCKLELFTFDSDEGRDTFWHSSAHILGQSVEMKYGCKLCIG  564
             +I++VN  LWD+ RPLEGDCKL+L  FD  + +  FWHSSAHILG+++E +YG  LC G
Sbjct  90   TVIARVNNELWDLDRPLEGDCKLQLLKFDDPDAQAVFWHSSAHILGEAMEKRYGGHLCYG  149

Query  565  P  567
            P
Sbjct  150  P  150



>gb|KIK68334.1| hypothetical protein GYMLUDRAFT_35720 [Gymnopus luxurians FD-317 
M1]
Length=724

 Score =   130 bits (326),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 60/120 (50%), Positives = 83/120 (69%), Gaps = 0/120 (0%)
 Frame = +1

Query  214  RISLFESIKsqqqlqrlslsPDPIKIELPNGSVKEGKKWNTTPLDIAKELSKSLASNALI  393
            RI LFE +K++   Q  S   + I I L +G+ ++G  W T+P+DIA E+SKS +   +I
Sbjct  52   RIKLFEQLKAEYDEQVKSKPREEITITLKDGAQRKGTSWETSPMDIATEISKSFSEKLVI  111

Query  394  SKVNGVLWDMSRPLEGDCKLELFTFDSDEGRDTFWHSSAHILGQSVEMKYGCKLCIGPCT  573
            +KV+G L+D+ RPLE  CKL+L TFD  EG+  FWHSSAH+LG++ E  YGC LC+GP T
Sbjct  112  AKVDGELYDLERPLEKSCKLDLLTFDEPEGKKVFWHSSAHVLGEAAERHYGCHLCLGPPT  171



>gb|KIL94540.1| hypothetical protein FAVG1_01471 [Fusarium avenaceum]
Length=980

 Score =   130 bits (328),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 63/123 (51%), Positives = 83/123 (67%), Gaps = 0/123 (0%)
 Frame = +1

Query  205  IPKRISLFESIKsqqqlqrlslsPDPIKIELPNGSVKEGKKWNTTPLDIAKELSKSLASN  384
            I  R+ LF+ IK++Q  +  +   + I I LPNG  ++G  W TTP  IAK +SKSL   
Sbjct  290  IQHRLDLFDKIKARQDAEIAAKPREEITISLPNGKEEKGTSWETTPGAIAKGISKSLFER  349

Query  385  ALISKVNGVLWDMSRPLEGDCKLELFTFDSDEGRDTFWHSSAHILGQSVEMKYGCKLCIG  564
             +IS+V+G LWD++RPLE  CKLEL  FD  EG+  FWHSSAHILG++ E ++GC LC G
Sbjct  350  TVISRVDGELWDLTRPLEKSCKLELLDFDHTEGKKVFWHSSAHILGEAAERRFGCYLCNG  409

Query  565  PCT  573
            P T
Sbjct  410  PPT  412



>ref|XP_004531260.1| PREDICTED: threonine--tRNA ligase, cytoplasmic-like isoform X1 
[Ceratitis capitata]
Length=785

 Score =   130 bits (327),  Expect = 3e-31, Method: Composition-based stats.
 Identities = 64/164 (39%), Positives = 101/164 (62%), Gaps = 3/164 (2%)
 Frame = +1

Query  76   PSNSIFIRRFSLRPSQMGKADKssaannsaPDHPKDDAYLQSVIPKRISLFESIKsqqql  255
            P +  F RR++   ++M K  + ++   +     K+   L S I +R +L+E +K++++ 
Sbjct  81   PQHETFCRRYATLANKMKKEKQKNSPAVAGK---KELEPLPSYIEERNALWEKLKAEREA  137

Query  256  qrlslsPDPIKIELPNGSVKEGKKWNTTPLDIAKELSKSLASNALISKVNGVLWDMSRPL  435
            +  +    PIK+ LP+G   +   W TTP D+AK +S+ LA N +++KVNG +WD+ R L
Sbjct  138  ELAAKPRTPIKVTLPDGKQVDATSWETTPYDVAKGISQGLADNTVVAKVNGEVWDLDRVL  197

Query  436  EGDCKLELFTFDSDEGRDTFWHSSAHILGQSVEMKYGCKLCIGP  567
            E DC L+L  FD  EG+  FWHSSAHI+G+++E  YG  LC GP
Sbjct  198  EEDCNLQLLKFDDPEGQAVFWHSSAHIMGEAMERIYGGHLCYGP  241



>emb|CCK69517.1| hypothetical protein KNAG_0C04150 [Kazachstania naganishii CBS 
8797]
Length=732

 Score =   130 bits (326),  Expect = 3e-31, Method: Composition-based stats.
 Identities = 61/129 (47%), Positives = 89/129 (69%), Gaps = 4/129 (3%)
 Frame = +1

Query  199  SVIPKRISLFESIKsqqqlqrlslsPDPIKIELPNGSVKEGKKWNTTPLDIAKELSKSLA  378
            + I +R +LF++++ Q + +  ++    +K+ L +G+VKE   W TTP+D+AKE+SKSL+
Sbjct  43   AFIAERGALFDALQEQYKEKVAAMPRHTLKVVLKDGAVKEATSWETTPMDVAKEISKSLS  102

Query  379  SNALISKVNGVLWDMSRPLEGDC----KLELFTFDSDEGRDTFWHSSAHILGQSVEMKYG  546
                I+KVNG LWD+ RPLEGD     KLEL  F+S+EGR  FWHSSAH+LG++ E   G
Sbjct  103  DRLCIAKVNGQLWDLERPLEGDANEEIKLELLDFESEEGRKVFWHSSAHVLGEACECNLG  162

Query  547  CKLCIGPCT  573
              +C+GP T
Sbjct  163  AHICLGPPT  171



>gb|KFV55285.1| putative threonine--tRNA ligase 2, cytoplasmic, partial [Tyto 
alba]
Length=673

 Score =   129 bits (325),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 62/126 (49%), Positives = 85/126 (67%), Gaps = 3/126 (2%)
 Frame = +1

Query  199  SVIPKRISLFESIKsqqqlqrlslsPD---PIKIELPNGSVKEGKKWNTTPLDIAKELSK  369
            S I  R+ L+E++K +        + +   PIKI L +G V EG+ W TTP  +A  +S+
Sbjct  2    SFIEDRLKLYEALKKEHDALLAYRAANQSKPIKIMLTDGKVAEGESWKTTPYQLAIGISQ  61

Query  370  SLASNALISKVNGVLWDMSRPLEGDCKLELFTFDSDEGRDTFWHSSAHILGQSVEMKYGC  549
             LASNA+I+KVNG LWD+ RPLEGDC LEL  FD++E +  +WHSSAHILG+++E  +G 
Sbjct  62   VLASNAVIAKVNGELWDLDRPLEGDCTLELLMFDNEEAKAVYWHSSAHILGEAMEGYFGG  121

Query  550  KLCIGP  567
             LC GP
Sbjct  122  CLCYGP  127



>ref|XP_003848298.1| threonine--tRNA ligase, partial [Zymoseptoria tritici IPO323]
 gb|EGP83274.1| hypothetical protein MYCGRDRAFT_106070 [Zymoseptoria tritici 
IPO323]
Length=509

 Score =   128 bits (321),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 59/118 (50%), Positives = 82/118 (69%), Gaps = 0/118 (0%)
 Frame = +1

Query  214  RISLFESIKsqqqlqrlslsPDPIKIELPNGSVKEGKKWNTTPLDIAKELSKSLASNALI  393
            R ++F+ +K++Q   +     + I++ L NGS K+GK W TTP  IA+++SKSL    +I
Sbjct  29   RNAIFDRLKAEQDAWKAKQPREDIQVTLGNGSSKDGKSWETTPSQIARDISKSLFERTVI  88

Query  394  SKVNGVLWDMSRPLEGDCKLELFTFDSDEGRDTFWHSSAHILGQSVEMKYGCKLCIGP  567
            ++V+G LWD+ RPLE  C LEL  FD  EG+  FWHSSAHILG++ E +YGC LCIGP
Sbjct  89   ARVDGELWDLDRPLEKSCSLELLDFDHPEGKKVFWHSSAHILGEACERRYGCSLCIGP  146



>ref|XP_005521510.1| PREDICTED: probable threonine--tRNA ligase 2, cytoplasmic [Pseudopodoces 
humilis]
Length=791

 Score =   130 bits (326),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 64/135 (47%), Positives = 87/135 (64%), Gaps = 3/135 (2%)
 Frame = +1

Query  172  HPKDDAYLQSVIPKRISLFESIKsqqqlqrlslsPDP---IKIELPNGSVKEGKKWNTTP  342
            H  D   + S I  R+ L+E++K +        + +    IKI L +G   EG+ W TTP
Sbjct  111  HQNDLQCVPSFIEDRLKLYEALKKEHDALLAYRAANQSKSIKITLTDGETVEGESWKTTP  170

Query  343  LDIAKELSKSLASNALISKVNGVLWDMSRPLEGDCKLELFTFDSDEGRDTFWHSSAHILG  522
              IA  +S+ LASNA+I+KVNG LWD+ RPLEGDC LEL TFD++E +  +WHSSAHILG
Sbjct  171  YQIAVGISQVLASNAVIAKVNGELWDLDRPLEGDCTLELLTFDNEEAKTVYWHSSAHILG  230

Query  523  QSVEMKYGCKLCIGP  567
            +++E  +G  LC GP
Sbjct  231  EAMEGYFGGCLCYGP  245



>ref|XP_009968247.1| PREDICTED: probable threonine--tRNA ligase 2, cytoplasmic, partial 
[Tyto alba]
Length=708

 Score =   129 bits (325),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 62/126 (49%), Positives = 85/126 (67%), Gaps = 3/126 (2%)
 Frame = +1

Query  199  SVIPKRISLFESIKsqqqlqrlslsPD---PIKIELPNGSVKEGKKWNTTPLDIAKELSK  369
            S I  R+ L+E++K +        + +   PIKI L +G V EG+ W TTP  +A  +S+
Sbjct  37   SFIEDRLKLYEALKKEHDALLAYRAANQSKPIKIMLTDGKVAEGESWKTTPYQLAIGISQ  96

Query  370  SLASNALISKVNGVLWDMSRPLEGDCKLELFTFDSDEGRDTFWHSSAHILGQSVEMKYGC  549
             LASNA+I+KVNG LWD+ RPLEGDC LEL  FD++E +  +WHSSAHILG+++E  +G 
Sbjct  97   VLASNAVIAKVNGELWDLDRPLEGDCTLELLMFDNEEAKAVYWHSSAHILGEAMEGYFGG  156

Query  550  KLCIGP  567
             LC GP
Sbjct  157  CLCYGP  162



>ref|XP_008601338.1| threonyl-tRNA synthetase [Beauveria bassiana ARSEF 2860]
 gb|EJP63008.1| threonyl-tRNA synthetase [Beauveria bassiana ARSEF 2860]
Length=737

 Score =   129 bits (325),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 61/123 (50%), Positives = 84/123 (68%), Gaps = 0/123 (0%)
 Frame = +1

Query  205  IPKRISLFESIKsqqqlqrlslsPDPIKIELPNGSVKEGKKWNTTPLDIAKELSKSLASN  384
            I  R+ LF+ IK++Q  +  +   + I + +PNG+  +G  W TTPL IAK +SKSL   
Sbjct  48   IQFRLDLFDKIKARQDAEIAAKPREEITVTMPNGNETKGTSWETTPLAIAKGISKSLVER  107

Query  385  ALISKVNGVLWDMSRPLEGDCKLELFTFDSDEGRDTFWHSSAHILGQSVEMKYGCKLCIG  564
             +I++V+G LWD++RPLE  CKLEL  FD  EG+  FWHSSAHILG++ E ++GC LC G
Sbjct  108  TVIAQVDGELWDLTRPLEKSCKLELLDFDHTEGKKVFWHSSAHILGEACERRFGCYLCNG  167

Query  565  PCT  573
            P T
Sbjct  168  PPT  170



>gb|KIN00956.1| hypothetical protein OIDMADRAFT_103659 [Oidiodendron maius Zn]
Length=733

 Score =   129 bits (325),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 62/124 (50%), Positives = 84/124 (68%), Gaps = 3/124 (2%)
 Frame = +1

Query  205  IPKRISLFESIKsqqqlqrlslsPDPIKIELPNGSVKEGKKWNTTPLDIAKELSKSLASN  384
            I  RI +F+ +K++   +  S   +PI I L +GS+K G  W TTP DIAK +S SL   
Sbjct  54   ISHRIEVFDKLKAKYDTEIASKPREPITITLADGSIKPGTSWETTPADIAKGISNSLLKR  113

Query  385  ALISKVNG---VLWDMSRPLEGDCKLELFTFDSDEGRDTFWHSSAHILGQSVEMKYGCKL  555
             +++K+NG    LWD+ RPLE DCKLEL +FD + G+  FWHSSAHILG++ E ++GC L
Sbjct  114  TVVAKLNGDPEQLWDLERPLEKDCKLELLSFDDELGKKVFWHSSAHILGEASERRFGCSL  173

Query  556  CIGP  567
            CIGP
Sbjct  174  CIGP  177



>gb|KFP24546.1| putative threonine--tRNA ligase 2, cytoplasmic, partial [Colius 
striatus]
Length=424

 Score =   127 bits (319),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 60/126 (48%), Positives = 85/126 (67%), Gaps = 3/126 (2%)
 Frame = +1

Query  199  SVIPKRISLFESIKsqqqlqrlslsPD---PIKIELPNGSVKEGKKWNTTPLDIAKELSK  369
            S I  R+ L+E++K +        + +   PIKI L +G + EG+ W TTP  +A  +S+
Sbjct  2    SFIEDRLKLYEALKKEHDALLAYRAANQSKPIKITLADGKMAEGQSWKTTPYQLAVGISQ  61

Query  370  SLASNALISKVNGVLWDMSRPLEGDCKLELFTFDSDEGRDTFWHSSAHILGQSVEMKYGC  549
             LASNA+I+KVNG LWD+ RPLEG C +EL TFD++E +  +WHSSAHILG+++E  +G 
Sbjct  62   VLASNAVIAKVNGELWDLDRPLEGACTVELLTFDNEEAKAVYWHSSAHILGEAMEGYFGG  121

Query  550  KLCIGP  567
             LC GP
Sbjct  122  CLCYGP  127



>ref|XP_011397153.1| Threonine-tRNA ligase, mitochondrial [Auxenochlorella protothecoides]
 gb|KFM24266.1| Threonine-tRNA ligase, mitochondrial [Auxenochlorella protothecoides]
Length=727

 Score =   129 bits (325),  Expect = 5e-31, Method: Composition-based stats.
 Identities = 57/96 (59%), Positives = 76/96 (79%), Gaps = 0/96 (0%)
 Frame = +1

Query  280  PIKIELPNGSVKEGKKWNTTPLDIAKELSKSLASNALISKVNGVLWDMSRPLEGDCKLEL  459
            P++I LP+G V++G K  TTPLDIA  LSKSLA  A++++V+G  WD+ RPLE DC L +
Sbjct  77   PVQITLPDGHVRDGVKDVTTPLDIAAALSKSLAKKAVVAEVDGKPWDLFRPLEQDCNLAI  136

Query  460  FTFDSDEGRDTFWHSSAHILGQSVEMKYGCKLCIGP  567
             TFDS +G+D FWHSSAHILGQS+E+++G +L IGP
Sbjct  137  HTFDSPKGKDAFWHSSAHILGQSLELEFGAELTIGP  172



>gb|EHK45204.1| hypothetical protein TRIATDRAFT_128075 [Trichoderma atroviride 
IMI 206040]
Length=738

 Score =   129 bits (325),  Expect = 5e-31, Method: Compositional matrix adjust.
 Identities = 61/128 (48%), Positives = 86/128 (67%), Gaps = 0/128 (0%)
 Frame = +1

Query  193  LQSVIPKRISLFESIKsqqqlqrlslsPDPIKIELPNGSVKEGKKWNTTPLDIAKELSKS  372
            L   I  RI++F+ IK+++  +  +   + I + LPNG   +G  W TTP  IAK +SKS
Sbjct  45   LPDFIQHRIAIFDKIKAKRDAEIAAKPREEITVSLPNGKEAKGISWETTPGAIAKGISKS  104

Query  373  LASNALISKVNGVLWDMSRPLEGDCKLELFTFDSDEGRDTFWHSSAHILGQSVEMKYGCK  552
            L    +IS V+G LWD++RPLE  CKLEL  F+++EG+  FWHSSAH+LG++ E ++GC 
Sbjct  105  LFERTVISMVDGELWDLTRPLEKSCKLELIDFENEEGKKVFWHSSAHVLGEAAERRFGCY  164

Query  553  LCIGPCTT  576
            LC GP TT
Sbjct  165  LCNGPPTT  172



>gb|EKG10485.1| hypothetical protein MPH_12343 [Macrophomina phaseolina MS6]
Length=763

 Score =   129 bits (325),  Expect = 5e-31, Method: Compositional matrix adjust.
 Identities = 59/118 (50%), Positives = 80/118 (68%), Gaps = 0/118 (0%)
 Frame = +1

Query  214  RISLFESIKsqqqlqrlslsPDPIKIELPNGSVKEGKKWNTTPLDIAKELSKSLASNALI  393
            RI +FE +K++   +  S   +PI I LP+G V  G+ W T+P DIA+ +SKSL    +I
Sbjct  56   RIKIFEELKAKYDAEIASKPREPINITLPDGKVHVGESWVTSPADIARAISKSLFERTVI  115

Query  394  SKVNGVLWDMSRPLEGDCKLELFTFDSDEGRDTFWHSSAHILGQSVEMKYGCKLCIGP  567
            S+V+G LWD+ RPLE  C LE   F+  EG+  FWHSSAHILG++ E ++GC LCIGP
Sbjct  116  SRVDGELWDLERPLEKSCSLEFLDFEHPEGKKVFWHSSAHILGEAAERRFGCDLCIGP  173



>ref|XP_009319874.1| PREDICTED: probable threonine--tRNA ligase 2, cytoplasmic [Pygoscelis 
adeliae]
Length=712

 Score =   129 bits (324),  Expect = 5e-31, Method: Compositional matrix adjust.
 Identities = 61/126 (48%), Positives = 85/126 (67%), Gaps = 3/126 (2%)
 Frame = +1

Query  199  SVIPKRISLFESIKsqqqlqrlslsPD---PIKIELPNGSVKEGKKWNTTPLDIAKELSK  369
            S I  R+ L+E++K +        + +   PIKI L +G + EG+ W TTP  +A  +S+
Sbjct  41   SFIEDRLKLYEALKKEHDALLAYRAANQSKPIKISLADGKMAEGESWKTTPYQLAVGISQ  100

Query  370  SLASNALISKVNGVLWDMSRPLEGDCKLELFTFDSDEGRDTFWHSSAHILGQSVEMKYGC  549
             LASNA+I+KVNG LWD+ RPLEGDC LEL  FD++E +  +WHSSAHILG+++E  +G 
Sbjct  101  MLASNAVIAKVNGELWDLDRPLEGDCTLELLMFDNEEAKAVYWHSSAHILGEAMEGYFGG  160

Query  550  KLCIGP  567
             LC GP
Sbjct  161  CLCYGP  166



>gb|KFW65406.1| putative threonine--tRNA ligase 2, cytoplasmic, partial [Pygoscelis 
adeliae]
Length=673

 Score =   129 bits (323),  Expect = 5e-31, Method: Compositional matrix adjust.
 Identities = 61/126 (48%), Positives = 85/126 (67%), Gaps = 3/126 (2%)
 Frame = +1

Query  199  SVIPKRISLFESIKsqqqlqrlslsPD---PIKIELPNGSVKEGKKWNTTPLDIAKELSK  369
            S I  R+ L+E++K +        + +   PIKI L +G + EG+ W TTP  +A  +S+
Sbjct  2    SFIEDRLKLYEALKKEHDALLAYRAANQSKPIKISLADGKMAEGESWKTTPYQLAVGISQ  61

Query  370  SLASNALISKVNGVLWDMSRPLEGDCKLELFTFDSDEGRDTFWHSSAHILGQSVEMKYGC  549
             LASNA+I+KVNG LWD+ RPLEGDC LEL  FD++E +  +WHSSAHILG+++E  +G 
Sbjct  62   MLASNAVIAKVNGELWDLDRPLEGDCTLELLMFDNEEAKAVYWHSSAHILGEAMEGYFGG  121

Query  550  KLCIGP  567
             LC GP
Sbjct  122  CLCYGP  127



>ref|XP_002550936.1| threonyl-tRNA synthetase [Candida tropicalis MYA-3404]
 gb|EER30782.1| threonyl-tRNA synthetase [Candida tropicalis MYA-3404]
Length=1059

 Score =   130 bits (327),  Expect = 5e-31, Method: Compositional matrix adjust.
 Identities = 64/136 (47%), Positives = 84/136 (62%), Gaps = 3/136 (2%)
 Frame = +1

Query  175  PKDDAYLQ---SVIPKRISLFESIKsqqqlqrlslsPDPIKIELPNGSVKEGKKWNTTPL  345
            P +  YL      I +RI++FE  K +   +       PIK+ L +GS+KEG  + T+P+
Sbjct  28   PSNALYLDPQPEFIDQRIAMFEHFKQKYDEEISKKEKVPIKVTLKDGSIKEGTAYETSPM  87

Query  346  DIAKELSKSLASNALISKVNGVLWDMSRPLEGDCKLELFTFDSDEGRDTFWHSSAHILGQ  525
            DIA  + KS A   +I+KV+G LWDM RPLEGD KLE   F+  EG+  FWHSSAHILG+
Sbjct  88   DIASSIGKSFAERQVIAKVDGKLWDMPRPLEGDAKLEFLDFEHPEGKAVFWHSSAHILGE  147

Query  526  SVEMKYGCKLCIGPCT  573
            + E  YGC L  GP T
Sbjct  148  ACECHYGCHLTHGPPT  163



>ref|XP_007056480.1| PREDICTED: probable threonine--tRNA ligase 2, cytoplasmic [Chelonia 
mydas]
Length=766

 Score =   129 bits (325),  Expect = 6e-31, Method: Compositional matrix adjust.
 Identities = 61/126 (48%), Positives = 84/126 (67%), Gaps = 3/126 (2%)
 Frame = +1

Query  199  SVIPKRISLFESIKsqqqlqrlslsPD---PIKIELPNGSVKEGKKWNTTPLDIAKELSK  369
            S I  R+ L+E++K +        + +   PIK+ L +G V EG+ W  TP  +A  +S+
Sbjct  95   SFIEDRLKLYETLKKEHDALLAYRAANQSKPIKVILTDGKVIEGESWKMTPYQLAAGISR  154

Query  370  SLASNALISKVNGVLWDMSRPLEGDCKLELFTFDSDEGRDTFWHSSAHILGQSVEMKYGC  549
             LA NA+I+KVNG LWD+ RPLEGDC LEL TFD++E +  +WHSSAHILG+++E  YG 
Sbjct  155  GLADNAVIAKVNGELWDLDRPLEGDCSLELLTFDNEEAQAVYWHSSAHILGEAMESYYGG  214

Query  550  KLCIGP  567
             LC GP
Sbjct  215  CLCYGP  220



>ref|XP_005145729.1| PREDICTED: probable threonine--tRNA ligase 2, cytoplasmic [Melopsittacus 
undulatus]
Length=790

 Score =   129 bits (325),  Expect = 6e-31, Method: Compositional matrix adjust.
 Identities = 62/135 (46%), Positives = 87/135 (64%), Gaps = 3/135 (2%)
 Frame = +1

Query  172  HPKDDAYLQSVIPKRISLFESIKsqqqlqrlslsPD---PIKIELPNGSVKEGKKWNTTP  342
            H  D  +  S I  R+ L+E++K +          +   PIKI L +G V EG+ W TTP
Sbjct  110  HQNDLQHEPSFIEDRLKLYEALKKEHDALLAYRVANQSKPIKITLTDGKVAEGESWKTTP  169

Query  343  LDIAKELSKSLASNALISKVNGVLWDMSRPLEGDCKLELFTFDSDEGRDTFWHSSAHILG  522
              +A  +S++LA +A+I+KVNG LWD+ RPLEGDC LEL  FD++E +  +WHSSAHILG
Sbjct  170  YQLAVGISQALAGDAVIAKVNGELWDLDRPLEGDCTLELLMFDNEEAKAVYWHSSAHILG  229

Query  523  QSVEMKYGCKLCIGP  567
            +++E  +G  LC GP
Sbjct  230  EAMEDYFGGCLCYGP  244



>gb|EFZ18882.1| hypothetical protein SINV_16250 [Solenopsis invicta]
Length=807

 Score =   129 bits (325),  Expect = 6e-31, Method: Compositional matrix adjust.
 Identities = 60/123 (49%), Positives = 80/123 (65%), Gaps = 0/123 (0%)
 Frame = +1

Query  199  SVIPKRISLFESIKsqqqlqrlslsPDPIKIELPNGSVKEGKKWNTTPLDIAKELSKSLA  378
            S I  RI L++ +K +      + +P  I + LP+G    GK W TTP D+AK +S+ LA
Sbjct  205  SYIQDRIVLWDKLKKEYDDSVAAKTPANITVTLPDGKKISGKSWRTTPYDVAKGISQGLA  264

Query  379  SNALISKVNGVLWDMSRPLEGDCKLELFTFDSDEGRDTFWHSSAHILGQSVEMKYGCKLC  558
             N +I+KVN  LWD+ RPLE DCKL+L  FD  EG+  FWHSSAH+LG+++E  YG  LC
Sbjct  265  DNTVIAKVNNELWDLDRPLESDCKLQLLKFDEPEGQQVFWHSSAHVLGEAMERVYGGCLC  324

Query  559  IGP  567
             GP
Sbjct  325  YGP  327



>gb|KFQ76650.1| putative threonine--tRNA ligase 2, cytoplasmic, partial [Phaethon 
lepturus]
Length=673

 Score =   129 bits (323),  Expect = 6e-31, Method: Compositional matrix adjust.
 Identities = 61/126 (48%), Positives = 86/126 (68%), Gaps = 3/126 (2%)
 Frame = +1

Query  199  SVIPKRISLFESIKsqqqlqrlslsPD---PIKIELPNGSVKEGKKWNTTPLDIAKELSK  369
            S I  R+ L+E++K +        + +   PIKI L +G + EG+ W TTP  +A  +S+
Sbjct  2    SFIEDRLKLYEALKKEHDALLAYRAANQSKPIKIILTDGKMAEGESWKTTPYQLAVGISQ  61

Query  370  SLASNALISKVNGVLWDMSRPLEGDCKLELFTFDSDEGRDTFWHSSAHILGQSVEMKYGC  549
            +LASNA+I+KVNG LWD+ RPLEGDC LEL  FD++E +  +WHSSAHILG+++E  +G 
Sbjct  62   ALASNAVIAKVNGELWDLDRPLEGDCTLELLMFDNEEAKAVYWHSSAHILGEAMEGYFGG  121

Query  550  KLCIGP  567
             LC GP
Sbjct  122  CLCYGP  127



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 696633491985