BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFF036F14

Length=557
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009783020.1|  PREDICTED: endoglucanase 2                         121   8e-29   Nicotiana sylvestris
ref|XP_009610927.1|  PREDICTED: endoglucanase 2-like                    119   3e-28   Nicotiana tomentosiformis
emb|CDP07412.1|  unnamed protein product                                116   6e-27   Coffea canephora [robusta coffee]
gb|AGV22125.1|  endo-1,4-beta-glucanase 3                               114   3e-26   Betula luminifera [liang ye hua]
ref|XP_003527686.1|  PREDICTED: endoglucanase 10-like                   113   6e-26   Glycine max [soybeans]
ref|XP_004238345.1|  PREDICTED: endoglucanase 2-like                    112   8e-26   Solanum lycopersicum
ref|XP_003523541.1|  PREDICTED: endoglucanase 10                        112   1e-25   Glycine max [soybeans]
ref|XP_007136082.1|  hypothetical protein PHAVU_009G016100g             111   3e-25   Phaseolus vulgaris [French bean]
gb|AES73992.2|  glycosyl hydrolase family 9 protein                     110   5e-25   Medicago truncatula
ref|XP_003603741.1|  Endoglucanase                                      110   6e-25   
ref|XP_006302134.1|  hypothetical protein CARUB_v10020139mg             108   3e-24   Capsella rubella
ref|XP_010104437.1|  Endoglucanase 24                                   108   5e-24   Morus notabilis
ref|XP_004136389.1|  PREDICTED: endoglucanase 2-like                    107   8e-24   Cucumis sativus [cucumbers]
ref|XP_010244092.1|  PREDICTED: endoglucanase 24-like                   107   1e-23   Nelumbo nucifera [Indian lotus]
ref|XP_008466493.1|  PREDICTED: endoglucanase 10                        107   1e-23   Cucumis melo [Oriental melon]
gb|KHF97947.1|  hypothetical protein F383_10892                         106   2e-23   Gossypium arboreum [tree cotton]
gb|KJB58118.1|  hypothetical protein B456_009G195400                    105   3e-23   Gossypium raimondii
gb|ADU15552.1|  EG                                                      105   3e-23   Gossypium hirsutum [American cotton]
gb|AID55377.1|  glycoside hydrolase family 9 B5                         105   3e-23   Gossypium hirsutum [American cotton]
ref|XP_007017777.1|  EG isoform 3                                       103   6e-23   
ref|XP_010471690.1|  PREDICTED: endoglucanase 10                        103   2e-22   Camelina sativa [gold-of-pleasure]
ref|XP_006342034.1|  PREDICTED: endoglucanase 10-like                   103   2e-22   Solanum tuberosum [potatoes]
ref|XP_010416457.1|  PREDICTED: endoglucanase 10-like                   103   3e-22   Camelina sativa [gold-of-pleasure]
ref|XP_010539853.1|  PREDICTED: endoglucanase 10                        103   4e-22   Tarenaya hassleriana [spider flower]
ref|XP_007017776.1|  EG isoform 2                                       103   4e-22   Theobroma cacao [chocolate]
ref|XP_010428595.1|  PREDICTED: endoglucanase 10-like                   102   4e-22   Camelina sativa [gold-of-pleasure]
gb|EYU36779.1|  hypothetical protein MIMGU_mgv1a004472mg                102   4e-22   Erythranthe guttata [common monkey flower]
ref|XP_007017775.1|  EG isoform 1                                       102   4e-22   
ref|XP_004500948.1|  PREDICTED: endoglucanase 10-like                   102   4e-22   Cicer arietinum [garbanzo]
ref|XP_010667385.1|  PREDICTED: endoglucanase 2-like                    102   5e-22   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_009103373.1|  PREDICTED: endoglucanase 2                         102   7e-22   Brassica rapa
ref|XP_008364934.1|  PREDICTED: endoglucanase 10-like                   102   7e-22   
emb|CDY66396.1|  BnaAnng22170D                                          102   7e-22   Brassica napus [oilseed rape]
ref|XP_009128120.1|  PREDICTED: endoglucanase 10                        102   9e-22   Brassica rapa
ref|XP_009335173.1|  PREDICTED: endoglucanase 2-like                    101   1e-21   
gb|EPS64495.1|  hypothetical protein M569_10284                         101   1e-21   Genlisea aurea
ref|XP_002889037.1|  hypothetical protein ARALYDRAFT_895440             101   1e-21   Arabidopsis lyrata subsp. lyrata
emb|CDY39048.1|  BnaA02g17370D                                          101   1e-21   Brassica napus [oilseed rape]
ref|XP_011074667.1|  PREDICTED: endoglucanase 10-like                   100   3e-21   Sesamum indicum [beniseed]
ref|XP_010536354.1|  PREDICTED: endoglucanase 10-like                   100   3e-21   Tarenaya hassleriana [spider flower]
gb|EYU38839.1|  hypothetical protein MIMGU_mgv1a004578mg                100   3e-21   Erythranthe guttata [common monkey flower]
ref|XP_008221286.1|  PREDICTED: endoglucanase 10-like                   100   4e-21   Prunus mume [ume]
emb|CDY43425.1|  BnaC07g14920D                                          100   4e-21   Brassica napus [oilseed rape]
ref|XP_010061046.1|  PREDICTED: endoglucanase 10-like                   100   4e-21   Eucalyptus grandis [rose gum]
ref|XP_002276739.1|  PREDICTED: endoglucanase 10                        100   5e-21   Vitis vinifera
emb|CDY13546.1|  BnaC02g23570D                                        98.6    5e-21   Brassica napus [oilseed rape]
gb|KFK44119.1|  hypothetical protein AALP_AA1G218000                  99.0    9e-21   Arabis alpina [alpine rockcress]
ref|XP_006390284.1|  hypothetical protein EUTSA_v10018397mg           99.0    1e-20   Eutrema salsugineum [saltwater cress]
emb|CDX73186.1|  BnaC06g36340D                                        99.0    1e-20   
ref|XP_008387935.1|  PREDICTED: endoglucanase 2                       99.0    1e-20   Malus domestica [apple tree]
dbj|BAF42037.1|  cellulase2                                           99.0    1e-20   Pyrus communis
ref|XP_010459672.1|  PREDICTED: endoglucanase 2                       98.2    2e-20   Camelina sativa [gold-of-pleasure]
gb|AAM63477.1|  endo-beta-1,4-glucanase, putative                     97.8    3e-20   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010501531.1|  PREDICTED: endoglucanase 2                       97.8    3e-20   
ref|XP_010649048.1|  PREDICTED: endoglucanase 24-like                 96.7    6e-20   Vitis vinifera
ref|XP_009106216.1|  PREDICTED: endoglucanase 10-like                 96.3    9e-20   Brassica rapa
ref|XP_010477219.1|  PREDICTED: endoglucanase 2-like                  96.3    9e-20   Camelina sativa [gold-of-pleasure]
ref|XP_002510516.1|  endo-1,4-beta-glucanase, putative                96.3    9e-20   Ricinus communis
ref|XP_004291374.1|  PREDICTED: endoglucanase 10-like                 96.3    9e-20   Fragaria vesca subsp. vesca
ref|XP_006473639.1|  PREDICTED: endoglucanase 10-like                 95.9    1e-19   Citrus sinensis [apfelsine]
gb|KDO84820.1|  hypothetical protein CISIN_1g009846mg                 95.9    1e-19   Citrus sinensis [apfelsine]
ref|XP_006435157.1|  hypothetical protein CICLE_v10000849mg           95.9    1e-19   Citrus clementina [clementine]
gb|AFZ78647.1|  korrigan                                              95.9    1e-19   Populus tomentosa [Chinese white poplar]
ref|XP_004957464.1|  PREDICTED: endoglucanase 24-like                 95.9    1e-19   Setaria italica
ref|XP_011045112.1|  PREDICTED: endoglucanase 2                       95.9    1e-19   Populus euphratica
ref|XP_006416450.1|  hypothetical protein EUTSA_v10007364mg           95.5    2e-19   Eutrema salsugineum [saltwater cress]
ref|XP_007046716.1|  EG                                               95.5    2e-19   
emb|CDY29381.1|  BnaA06g14150D                                        95.5    2e-19   Brassica napus [oilseed rape]
gb|EEC84946.1|  hypothetical protein OsI_32163                        95.1    2e-19   Oryza sativa Indica Group [Indian rice]
ref|NP_177697.1|  glycosyl hydrolase 9B7                              95.1    2e-19   Arabidopsis thaliana [mouse-ear cress]
emb|CDP04112.1|  unnamed protein product                              93.2    3e-19   Coffea canephora [robusta coffee]
gb|KJB14408.1|  hypothetical protein B456_002G123700                  94.7    3e-19   Gossypium raimondii
ref|NP_001063771.1|  Os09g0533900                                     94.7    3e-19   
gb|EEE70113.1|  hypothetical protein OsJ_30126                        94.4    4e-19   Oryza sativa Japonica Group [Japonica rice]
ref|XP_006307252.1|  hypothetical protein CARUB_v10008868mg           94.4    4e-19   Capsella rubella
ref|XP_011083520.1|  PREDICTED: endoglucanase 10                      94.4    5e-19   Sesamum indicum [beniseed]
gb|KHN21266.1|  Endoglucanase 24                                      90.5    5e-19   Glycine soja [wild soybean]
ref|XP_011100152.1|  PREDICTED: endoglucanase 24-like                 94.0    7e-19   
gb|KJB43353.1|  hypothetical protein B456_007G195700                  93.6    8e-19   Gossypium raimondii
gb|KDP36939.1|  hypothetical protein JCGZ_08230                       93.6    8e-19   Jatropha curcas
gb|AAF79918.1|AC022472_27  Contains similarity to beta-1,4-glucan...  91.3    9e-19   Arabidopsis thaliana [mouse-ear cress]
gb|KJB63540.1|  hypothetical protein B456_010G005200                  93.2    1e-18   Gossypium raimondii
gb|AID55379.1|  glycoside hydrolase family 9 B7                       93.2    1e-18   Gossypium hirsutum [American cotton]
ref|XP_002307711.1|  glycosyl hydrolase family 9 family protein       93.2    1e-18   Populus trichocarpa [western balsam poplar]
ref|XP_002462729.1|  hypothetical protein SORBIDRAFT_02g030990        92.8    2e-18   Sorghum bicolor [broomcorn]
emb|CDY47506.1|  BnaAnng09040D                                        92.4    2e-18   Brassica napus [oilseed rape]
ref|XP_009398708.1|  PREDICTED: endoglucanase 24-like                 92.4    2e-18   Musa acuminata subsp. malaccensis [pisang utan]
ref|NP_001145749.1|  hypothetical protein                             92.4    2e-18   Zea mays [maize]
ref|XP_010029690.1|  PREDICTED: endoglucanase 2-like                  92.4    2e-18   Eucalyptus grandis [rose gum]
gb|KCW56649.1|  hypothetical protein EUGRSUZ_I02356                   92.4    2e-18   Eucalyptus grandis [rose gum]
gb|KDP46724.1|  hypothetical protein JCGZ_06512                       92.4    2e-18   Jatropha curcas
gb|KJB58120.1|  hypothetical protein B456_009G195400                  92.4    2e-18   Gossypium raimondii
ref|XP_002893081.1|  glycosyl hydrolase family 9 protein              92.0    3e-18   Arabidopsis lyrata subsp. lyrata
ref|NP_173423.1|  glycosyl hydrolase 9B5                              92.0    3e-18   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009149490.1|  PREDICTED: endoglucanase 2                       91.3    5e-18   Brassica rapa
ref|XP_003563568.1|  PREDICTED: endoglucanase 18-like                 90.9    7e-18   Brachypodium distachyon [annual false brome]
gb|KDO84821.1|  hypothetical protein CISIN_1g036398mg                 90.9    7e-18   Citrus sinensis [apfelsine]
ref|XP_011043209.1|  PREDICTED: endoglucanase 2-like                  90.5    1e-17   Populus euphratica
ref|XP_004232483.1|  PREDICTED: endoglucanase 2-like                  90.5    1e-17   Solanum lycopersicum
ref|XP_006340729.1|  PREDICTED: endoglucanase 2-like                  90.1    1e-17   Solanum tuberosum [potatoes]
ref|XP_008799407.1|  PREDICTED: endoglucanase 24-like                 89.7    2e-17   Phoenix dactylifera
ref|XP_006435158.1|  hypothetical protein CICLE_v10003402mg           89.4    2e-17   
ref|XP_010113364.1|  Endoglucanase 24                                 89.7    2e-17   
ref|XP_010935039.1|  PREDICTED: endoglucanase 24-like                 89.4    2e-17   Elaeis guineensis
ref|XP_009624009.1|  PREDICTED: endoglucanase 2-like                  89.0    4e-17   Nicotiana tomentosiformis
ref|XP_003519870.1|  PREDICTED: endoglucanase 24-like                 89.0    4e-17   Glycine max [soybeans]
ref|XP_008241905.1|  PREDICTED: endoglucanase 24-like                 88.6    5e-17   Prunus mume [ume]
dbj|BAJ93299.1|  predicted protein                                    88.6    5e-17   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_010530451.1|  PREDICTED: endoglucanase 2-like                  87.8    7e-17   
ref|XP_008788648.1|  PREDICTED: endoglucanase 24                      87.8    8e-17   Phoenix dactylifera
ref|XP_010941260.1|  PREDICTED: endoglucanase 24-like                 87.8    9e-17   Elaeis guineensis
ref|XP_009803640.1|  PREDICTED: endoglucanase 2-like                  87.8    9e-17   Nicotiana sylvestris
ref|XP_009378180.1|  PREDICTED: endoglucanase 2-like                  87.8    1e-16   Pyrus x bretschneideri [bai li]
ref|XP_006656489.1|  PREDICTED: endoglucanase 18-like                 87.4    1e-16   Oryza brachyantha
ref|XP_008372790.1|  PREDICTED: endoglucanase 24-like                 87.0    2e-16   
gb|KHN00484.1|  Endoglucanase 24                                      87.0    2e-16   Glycine soja [wild soybean]
gb|EAZ02358.1|  hypothetical protein OsI_24462                        86.7    2e-16   Oryza sativa Indica Group [Indian rice]
ref|XP_006383120.1|  hypothetical protein POPTR_0005s11750g           86.7    2e-16   
ref|NP_001058583.1|  Os06g0715300                                     86.7    2e-16   
gb|AEO97190.1|  endo-1,4-beta-glucanase                               86.7    2e-16   Populus trichocarpa [western balsam poplar]
ref|XP_009386441.1|  PREDICTED: endoglucanase 24-like                 86.7    2e-16   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_006466419.1|  PREDICTED: endoglucanase 2-like                  85.9    5e-16   Citrus sinensis [apfelsine]
ref|XP_006426144.1|  hypothetical protein CICLE_v10025306mg           85.5    5e-16   
gb|KDO78852.1|  hypothetical protein CISIN_1g048736mg                 85.5    5e-16   Citrus sinensis [apfelsine]
gb|ACC63522.1|  putative glucanase/cellulase                          81.6    9e-16   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_003578508.1|  PREDICTED: endoglucanase 24                      84.7    9e-16   Brachypodium distachyon [annual false brome]
gb|ABE02649.1|  putative glucanase/cellulase                          81.3    1e-15   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_002439027.1|  hypothetical protein SORBIDRAFT_10g030140        84.7    1e-15   Sorghum bicolor [broomcorn]
ref|XP_002300715.1|  glycosyl hydrolase family 9 family protein       84.3    1e-15   Populus trichocarpa [western balsam poplar]
ref|XP_004966453.1|  PREDICTED: endoglucanase 18-like                 84.0    2e-15   Setaria italica
ref|NP_001288527.1|  uncharacterized protein LOC103626453 precursor   84.0    2e-15   Zea mays [maize]
ref|XP_004509346.1|  PREDICTED: endoglucanase 10-like                 84.0    2e-15   Cicer arietinum [garbanzo]
ref|XP_011462352.1|  PREDICTED: endoglucanase 2-like                  83.6    2e-15   Fragaria vesca subsp. vesca
ref|XP_006661478.1|  PREDICTED: endoglucanase 24-like                 83.2    3e-15   
ref|XP_007156152.1|  hypothetical protein PHAVU_003G262600g           82.8    5e-15   Phaseolus vulgaris [French bean]
emb|CDY44194.1|  BnaC05g15510D                                        83.6    6e-15   Brassica napus [oilseed rape]
ref|XP_011028991.1|  PREDICTED: endoglucanase 2-like                  82.4    6e-15   Populus euphratica
dbj|BAK04397.1|  predicted protein                                    81.6    1e-14   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_003629333.1|  Endoglucanase                                    81.3    2e-14   Medicago truncatula
gb|KHN45917.1|  Endoglucanase 2                                       80.5    3e-14   Glycine soja [wild soybean]
gb|ABK24648.1|  unknown                                               77.4    3e-13   Picea sitchensis
ref|XP_002971269.1|  hypothetical protein SELMODRAFT_94888            77.4    3e-13   
ref|XP_002961546.1|  hypothetical protein SELMODRAFT_77612            77.4    3e-13   
ref|WP_033435023.1|  endoglucanase                                    71.6    4e-11   
ref|XP_002978046.1|  hypothetical protein SELMODRAFT_417952           70.9    5e-11   Selaginella moellendorffii
ref|WP_037655280.1|  endoglucanase                                    69.3    2e-10   Streptomyces achromogenes
ref|WP_030479897.1|  endoglucanase                                    68.9    3e-10   Lentzea albidocapillata
ref|WP_037701830.1|  endoglucanase                                    67.4    8e-10   
gb|ADZ85350.1|  Cellulase                                             67.8    9e-10   Cellulosilyticum lentocellum DSM 5427
ref|WP_018552941.1|  hypothetical protein                             67.4    9e-10   Streptomyces sp. ATexAB-D23
ref|WP_018105029.1|  MULTISPECIES: hypothetical protein               67.4    9e-10   Streptomyces
ref|XP_001772307.1|  predicted protein                                67.0    1e-09   
gb|AHL27899.1|  cellulase                                             66.6    2e-09   uncultured bacterium
ref|WP_037256689.1|  endoglucanase                                    66.6    2e-09   
ref|WP_033300787.1|  endoglucanase                                    66.6    2e-09   
ref|WP_013732376.1|  endoglucanase                                    66.6    2e-09   Verrucosispora maris
ref|WP_033388930.1|  endoglucanase                                    65.1    2e-09   
ref|WP_026163194.1|  endoglucanase                                    66.2    2e-09   Kribbella catacumbae
ref|WP_014256118.1|  cellulose 1,4-beta-cellobiosidase [              66.2    3e-09   Hungateiclostridium clariflavum
ref|WP_041713952.1|  endoglucanase                                    65.9    3e-09   
ref|WP_027621856.1|  cellulose 1,4-beta-cellobiosidase [              66.2    3e-09   Hungateiclostridium clariflavum
ref|WP_030488613.1|  endoglucanase                                    65.9    3e-09   
pdb|1JS4|A  Chain A, EndoEXOCELLULASE:CELLOBIOSE FROM THERMOMONOS...  65.5    3e-09   Thermobifida fusca
ref|WP_010251308.1|  endoglucanase                                    65.9    3e-09   Hungateiclostridium cellulolyticum
ref|WP_015942124.1|  endoglucanase                                    65.9    3e-09   Chloroflexus aggregans
ref|WP_027622694.1|  endoglucanase [                                  65.5    3e-09   Hungateiclostridium clariflavum
ref|WP_034836413.1|  endoglucanase [                                  65.9    3e-09   
sp|P23659.1|GUNZ_CLOSR  RecName: Full=Endoglucanase Z; AltName: F...  65.9    3e-09   Thermoclostridium stercorarium
ref|WP_036329993.1|  endoglucanase                                    65.9    3e-09   Microbispora sp. ATCC PTA-5024
emb|CAA39010.1|  endo-beta-1,4-glucanase (Avicelase I) [ [            65.9    3e-09   Thermoclostridium stercorarium
ref|WP_014254351.1|  endoglucanase [                                  65.5    3e-09   Hungateiclostridium clariflavum
ref|WP_015359553.1|  endoglucanase Z [                                65.9    3e-09   Thermoclostridium stercorarium
ref|WP_030336140.1|  endoglucanase                                    65.5    4e-09   Micromonospora parva
ref|NP_181984.1|  glycosyl hydrolase 9B11                             65.1    4e-09   Arabidopsis thaliana [mouse-ear cress]
ref|WP_026214358.1|  endoglucanase                                    65.5    4e-09   
ref|WP_033441521.1|  endoglucanase                                    65.5    4e-09   
ref|XP_002881963.1|  glycosyl hydrolase family 9 protein              65.1    4e-09   Arabidopsis lyrata subsp. lyrata
gb|ACZ83939.1|  hypothetical protein Sros_0935                        65.5    4e-09   Streptosporangium roseum DSM 43021
dbj|BAK07919.1|  predicted protein                                    64.7    5e-09   Hordeum vulgare subsp. vulgare [two-rowed barley]
dbj|BAK07001.1|  predicted protein                                    64.7    5e-09   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|KFK37261.1|  hypothetical protein AALP_AA4G234600                  65.1    5e-09   Arabis alpina [alpine rockcress]
ref|WP_030924458.1|  endoglucanase                                    65.1    5e-09   
ref|WP_043651319.1|  endoglucanase                                    65.1    5e-09   
ref|WP_030468638.1|  endoglucanase                                    65.1    5e-09   Lechevalieria aerocolonigenes
gb|EOD65654.1|  endoglucanase                                         65.1    5e-09   Amycolatopsis vancoresmycina DSM 44592
ref|WP_033261197.1|  endoglucanase                                    65.1    5e-09   Amycolatopsis vancoresmycina
ref|WP_011292599.1|  endoglucanase                                    65.1    6e-09   Thermobifida fusca
gb|EDX71299.1|  Glycosyl hydrolase family 9                           64.7    6e-09   Coleofasciculus chthonoplastes PCC 7420
gb|ADX41578.1|  Cel9A                                                 65.1    6e-09   synthetic construct
ref|WP_026468148.1|  endoglucanase                                    64.7    6e-09   Amycolatopsis balhimycina
ref|NP_001288415.1|  endoglucanase 4-like                             64.3    6e-09   Zea mays [maize]
ref|WP_007457075.1|  endoglucanase                                    64.7    6e-09   Micromonospora lupini
emb|CAZ96116.1|  endoglucanase 4 precursor                            64.3    6e-09   Saccharum hybrid cultivar R570
ref|XP_006826915.1|  hypothetical protein AMTR_s00010p00165730        64.3    7e-09   Amborella trichopoda
ref|WP_026418585.1|  glycosyl hydrolase family 9                      64.3    7e-09   Actinoalloteichus cyanogriseus
ref|WP_016698150.1|  hypothetical protein                             64.3    7e-09   Actinoalloteichus spitiensis
ref|WP_036944358.1|  endoglucanase                                    64.3    7e-09   
ref|XP_001775325.1|  predicted protein                                64.3    7e-09   
gb|EMT15618.1|  Endoglucanase 8                                       64.3    7e-09   
ref|WP_044210906.1|  endoglucanase                                    64.3    8e-09   
ref|WP_033257952.1|  endoglucanase                                    64.3    8e-09   
dbj|BAJ32778.1|  putative endoglucanase precursor                     64.3    8e-09   Kitasatospora setae KM-6054
ref|XP_001774444.1|  predicted protein                                64.3    8e-09   
ref|NP_181982.1|  glycosyl hydrolase 9B9                              63.9    9e-09   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002966695.1|  hypothetical protein SELMODRAFT_144066           63.9    1e-08   
ref|NP_181983.1|  glycosyl hydrolase 9B10                             63.5    1e-08   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006413937.1|  hypothetical protein EUTSA_v10027553mg           63.5    1e-08   
ref|WP_033252637.1|  endoglucanase                                    63.9    1e-08   Kitasatospora phosalacinea
gb|AEH04391.1|  endo-beta-1,4-glucanase                               63.9    1e-08   Thermobifida halotolerans
ref|NP_001048297.1|  Os02g0778600                                     63.5    1e-08   
gb|EAZ07843.1|  hypothetical protein OsI_30101                        63.5    1e-08   Oryza sativa Indica Group [Indian rice]
ref|XP_004301501.1|  PREDICTED: endoglucanase 5                       63.5    1e-08   Fragaria vesca subsp. vesca
ref|XP_011085126.1|  PREDICTED: LOW QUALITY PROTEIN: endoglucanas...  63.2    1e-08   Sesamum indicum [beniseed]
ref|XP_002451429.1|  hypothetical protein SORBIDRAFT_04g001960        63.5    1e-08   Sorghum bicolor [broomcorn]
ref|WP_033222782.1|  endoglucanase                                    63.5    1e-08   
ref|XP_009049941.1|  hypothetical protein LOTGIDRAFT_113537           63.5    1e-08   Lottia gigantea
ref|XP_007043306.1|  Glycosyl hydrolase 9C1 isoform 2                 63.5    1e-08   
ref|XP_003570500.1|  PREDICTED: endoglucanase 8                       63.2    2e-08   
ref|XP_007043305.1|  Glycosyl hydrolase 9C1 isoform 1                 63.5    2e-08   
ref|WP_043779176.1|  endoglucanase                                    63.5    2e-08   Amycolatopsis rifamycinica
emb|CDY47674.1|  BnaC04g03850D                                        63.2    2e-08   Brassica napus [oilseed rape]
ref|XP_002881965.1|  glycosyl hydrolase family 9 protein              63.2    2e-08   
ref|XP_009143046.1|  PREDICTED: endoglucanase 14-like                 63.2    2e-08   Brassica rapa
ref|WP_024834593.1|  endoglucanase [                                  63.5    2e-08   Ruminiclostridium josui
emb|CDX74668.1|  BnaA05g04140D                                        63.2    2e-08   
ref|WP_024632469.1|  MULTISPECIES: glycoside hydrolase                63.5    2e-08   
ref|XP_006385809.1|  hypothetical protein POPTR_0003s14740g           63.2    2e-08   
gb|ABC70312.1|  endo-1,4-beta-glucanase precursor                     59.7    2e-08   Glycine max [soybeans]
ref|XP_006294088.1|  hypothetical protein CARUB_v10023082mg           63.2    2e-08   Capsella rubella
gb|AEO97202.1|  endo-1,4-beta-glucanase                               63.2    2e-08   Populus trichocarpa [western balsam poplar]
emb|CAZ96212.1|  endoglucanase 4 precursor                            63.2    2e-08   Saccharum hybrid cultivar R570
gb|AIW39765.1|  putative endoglucanase 4 precursor                    63.2    2e-08   Saccharum spontaneum [fodder cane]
emb|CAZ96155.1|  endoglucanase 4 precursor                            63.2    2e-08   Saccharum hybrid cultivar R570
ref|XP_002881964.1|  glycosyl hydrolase family 9 protein              62.8    2e-08   Arabidopsis lyrata subsp. lyrata
emb|CAZ96131.1|  endoglucanase 4 precursor                            63.2    2e-08   Saccharum hybrid cultivar R570
ref|WP_003518379.1|  endoglucanase                                    63.2    2e-08   Hungateiclostridium thermocellum
emb|CAZ96184.1|  endoglucanase 4 precursor                            62.8    2e-08   Saccharum hybrid cultivar R570
ref|XP_004954110.1|  PREDICTED: endoglucanase 8-like                  62.8    2e-08   Setaria italica
ref|WP_003517595.1|  endoglucanase                                    63.2    2e-08   Hungateiclostridium thermocellum
gb|AFZ78636.1|  korrigan                                              62.8    2e-08   Populus tomentosa [Chinese white poplar]
gb|ADZ82224.1|  Cellulase                                             63.2    2e-08   Cellulosilyticum lentocellum DSM 5427
ref|XP_007220712.1|  hypothetical protein PRUPE_ppa021556mg           62.8    2e-08   
emb|CDY47675.1|  BnaC04g03840D                                        62.8    2e-08   Brassica napus [oilseed rape]
gb|AAV50042.1|  cellulase                                             58.9    2e-08   Saccharum hybrid cultivar Pindar
emb|CDX74666.1|  BnaA05g04120D                                        62.8    2e-08   
gb|AIW39772.1|  putative endoglucanase 4 precursor                    62.8    2e-08   Saccharum officinarum [noble cane]
emb|CAZ96123.1|  endoglucanase 4 precursor                            62.8    2e-08   Saccharum hybrid cultivar R570
ref|WP_041713262.1|  hypothetical protein                             63.2    2e-08   
ref|XP_009143044.1|  PREDICTED: endoglucanase 12-like                 62.8    2e-08   Brassica rapa
emb|CAZ96081.1|  endoglucanase 4 precursor (Sh142J21g280-g330 mod...  62.8    2e-08   Saccharum hybrid cultivar R570
ref|XP_009143042.1|  PREDICTED: endoglucanase 14-like                 62.8    2e-08   Brassica rapa
ref|XP_008232258.1|  PREDICTED: endoglucanase 14-like                 62.8    2e-08   Prunus mume [ume]
emb|CDX74667.1|  BnaA05g04130D                                        62.4    2e-08   
ref|WP_010248355.1|  cellulose 1,4-beta-cellobiosidase                63.2    2e-08   Hungateiclostridium cellulolyticum
emb|CDX74664.1|  BnaA05g04100D                                        62.8    2e-08   
ref|WP_043175218.1|  endoglucanase                                    63.2    2e-08   Streptomyces sp. NRRL B-24484
ref|XP_008232281.1|  PREDICTED: endoglucanase 14-like                 61.6    2e-08   Prunus mume [ume]
dbj|BAF01119.1|  putative glucanase                                   62.4    3e-08   Arabidopsis thaliana [mouse-ear cress]
ref|WP_036707429.1|  hypothetical protein                             60.5    3e-08   
gb|KDP43311.1|  hypothetical protein JCGZ_24232                       62.8    3e-08   Jatropha curcas
gb|AAA20892.1|  endo-1,3-beta-glucanase                               62.8    3e-08   Hungateiclostridium thermocellum
ref|WP_003511958.1|  endoglucanase                                    62.8    3e-08   Hungateiclostridium thermocellum
ref|WP_011837740.1|  endoglucanase                                    62.8    3e-08   Hungateiclostridium thermocellum
ref|XP_008220580.1|  PREDICTED: endoglucanase 16                      62.4    3e-08   Prunus mume [ume]
ref|XP_006648003.1|  PREDICTED: endoglucanase 8-like                  62.4    3e-08   Oryza brachyantha
gb|AID55387.1|  glycoside hydrolase family 9 A4                       62.4    3e-08   Gossypium hirsutum [American cotton]
ref|XP_009064976.1|  hypothetical protein LOTGIDRAFT_132347           62.8    3e-08   Lottia gigantea
ref|XP_006825348.1|  PREDICTED: endoglucanase 16-like                 62.8    3e-08   Saccoglossus kowalevskii
ref|XP_001759537.1|  predicted protein                                62.4    3e-08   
ref|NP_181985.1|  glycosyl hydrolase 9B12                             62.4    3e-08   Arabidopsis thaliana [mouse-ear cress]
ref|XP_011022404.1|  PREDICTED: endoglucanase 1-like isoform X1       62.4    3e-08   Populus euphratica
ref|XP_011022406.1|  PREDICTED: endoglucanase 1-like isoform X2       62.4    3e-08   Populus euphratica
ref|WP_037937108.1|  endoglucanase                                    62.4    3e-08   Streptosporangium roseum
gb|EYU33248.1|  hypothetical protein MIMGU_mgv1a018124mg              59.3    3e-08   Erythranthe guttata [common monkey flower]
ref|WP_029387306.1|  endoglucanase                                    62.4    3e-08   
ref|WP_036942443.1|  endoglucanase                                    62.4    3e-08   
gb|EMT32027.1|  Endoglucanase 24                                      62.0    3e-08   
emb|CBI27137.3|  unnamed protein product                              62.4    4e-08   Vitis vinifera
ref|XP_002277177.2|  PREDICTED: LOW QUALITY PROTEIN: endoglucanase 5  62.4    4e-08   
ref|XP_008374126.1|  PREDICTED: LOW QUALITY PROTEIN: endoglucanas...  62.0    4e-08   
gb|AGO86843.1|  endo-1,4-beta-glucanase                               62.0    4e-08   
gb|EWM10299.1|  endoglucanase                                         62.4    4e-08   
ref|WP_035956234.1|  endoglucanase                                    62.4    4e-08   
ref|WP_013225782.1|  endoglucanase                                    62.4    4e-08   
ref|WP_039835859.1|  endoglucanase                                    59.7    4e-08   
ref|XP_010448686.1|  PREDICTED: endoglucanase 20                      62.0    4e-08   
ref|XP_002973718.1|  hypothetical protein SELMODRAFT_99802            62.0    4e-08   
ref|WP_037875105.1|  endoglucanase                                    62.0    4e-08   
gb|KGM14108.1|  endoglucanase                                         62.0    4e-08   
ref|WP_044387517.1|  endoglucanase                                    62.0    4e-08   
gb|EAZ24519.1|  hypothetical protein OsJ_08281                        61.6    4e-08   
sp|Q5YLG1.1|GUNA_BACPU  RecName: Full=Endoglucanase A; AltName: F...  62.0    5e-08   
gb|ABD62089.1|  endo-1,4-beta-glucancase precursor                    58.5    5e-08   
ref|WP_015391952.1|  celCCG: endoglucanase G                          62.0    5e-08   
ref|NP_001048033.1|  Os02g0733300                                     61.6    5e-08   
ref|WP_033165790.1|  endoglucanase                                    62.0    5e-08   
ref|WP_035057437.1|  endoglucanase                                    62.0    5e-08   
ref|WP_037782374.1|  endoglucanase                                    61.6    5e-08   
gb|ACY72380.1|  cellulose hydrolase                                   61.6    5e-08   
ref|WP_009328502.1|  endoglucanase                                    61.6    5e-08   
ref|WP_044219275.1|  hypothetical protein                             62.0    6e-08   
gb|AHE15442.1|  cellulase family protein 9                            61.6    6e-08   
ref|WP_011197979.1|  endoglucanase                                    61.6    6e-08   
ref|WP_003181854.1|  MULTISPECIES: endoglucanase                      61.6    6e-08   
gb|KDP22411.1|  hypothetical protein JCGZ_26242                       61.6    6e-08   
ref|XP_004974509.1|  PREDICTED: endoglucanase 19-like                 61.6    6e-08   
ref|WP_020814342.1|  endoglucanase [                                  61.6    6e-08   
ref|XP_006286136.1|  hypothetical protein CARUB_v10007690mg           61.2    6e-08   
gb|AAR29083.1|  cellulase                                             61.6    6e-08   
gb|EYU26800.1|  hypothetical protein MIMGU_mgv1a019325mg              61.2    6e-08   
ref|XP_009771552.1|  PREDICTED: endoglucanase 13-like                 61.2    6e-08   
ref|NP_001234323.1|  endo-1,4-beta-D-glucanase precursor              61.2    6e-08   
ref|XP_009393121.1|  PREDICTED: endoglucanase 1-like                  61.2    6e-08   
ref|XP_006343479.1|  PREDICTED: endoglucanase 3-like                  61.2    6e-08   
ref|XP_010094077.1|  Endoglucanase 13                                 61.2    6e-08   
ref|XP_008340449.1|  PREDICTED: endoglucanase 5                       61.6    6e-08   
prf||2113326C  ORF 2 [                                                61.2    6e-08
ref|XP_009115552.1|  PREDICTED: endoglucanase 4                       61.2    7e-08   
ref|WP_035789720.1|  hypothetical protein                             61.2    7e-08   
ref|WP_036628587.1|  endoglucanase                                    61.6    7e-08   
ref|XP_010506383.1|  PREDICTED: endoglucanase 15-like                 61.2    7e-08   
ref|WP_014313404.1|  endoglucanase                                    61.6    7e-08   
ref|XP_010512853.1|  PREDICTED: endoglucanase 14                      61.2    7e-08   
gb|AIA83890.1|  Glyco_hydro_9                                         57.8    7e-08   
ref|WP_010076628.1|  endoglucanase                                    61.6    7e-08   
ref|WP_008045668.1|  glycosyl hydrolase family 5                      61.6    7e-08   
pdb|2XFG|A  Chain A, Reassembly And Co-Crystallization Of A Famil...  61.2    7e-08   
ref|XP_004135956.1|  PREDICTED: endoglucanase 5-like                  61.2    7e-08   
gb|AFZ78644.1|  korrigan                                              61.2    7e-08   
gb|KGN45077.1|  hypothetical protein Csa_7G420700                     61.2    7e-08   
ref|XP_010452662.1|  PREDICTED: endoglucanase 15-like                 61.2    7e-08   
ref|NP_001151937.1|  LOC100285574 precursor                           61.2    7e-08   
ref|XP_008643822.1|  PREDICTED: LOC100285574 isoform X1               61.2    7e-08   
ref|XP_010693008.1|  PREDICTED: endoglucanase 16                      61.2    8e-08   
ref|WP_010074616.1|  endoglucanase                                    61.2    8e-08   
ref|XP_003601448.1|  Endo-1 4-beta-glucanase                          61.2    8e-08   
ref|XP_004158222.1|  PREDICTED: LOW QUALITY PROTEIN: endoglucanas...  61.2    8e-08   
gb|KDP25379.1|  hypothetical protein JCGZ_20535                       61.2    8e-08   
ref|WP_026587001.1|  endoglucanase                                    61.2    8e-08   
dbj|BAI52926.1|  hypothetical protein [ [                             61.2    8e-08   
ref|WP_025807828.1|  endoglucanase                                    61.2    8e-08   
ref|XP_004168441.1|  PREDICTED: endoglucanase 13-like                 60.8    8e-08   
dbj|BAA77239.1|  endo-1,4-beta glucanase                              60.8    8e-08   
ref|WP_004463236.1|  endoglucanase                                    61.2    9e-08   
ref|XP_009105740.1|  PREDICTED: endoglucanase 8                       60.8    9e-08   
ref|XP_006285075.1|  hypothetical protein CARUB_v10006388mg           60.8    9e-08   
ref|WP_034598902.1|  endoglucanase, partial [                         61.2    9e-08   
emb|CDY11552.1|  BnaC06g31870D                                        60.8    9e-08   
gb|EGJ33758.1|  glycosyl hydrolase family 9                           60.8    9e-08   
ref|XP_010031904.1|  PREDICTED: endoglucanase 5                       60.8    9e-08   
ref|WP_029503320.1|  endoglucanase                                    61.2    9e-08   
emb|CDX68334.1|  BnaA07g23740D                                        60.8    9e-08   
emb|CAB39641.1|  cellulase-like protein                               60.8    9e-08   
ref|XP_006484545.1|  PREDICTED: endoglucanase 5-like                  60.8    9e-08   
dbj|GAE90678.1|  endoglucanase [ [                                    60.8    9e-08   
gb|EXX69981.1|  hypothetical protein RirG_091480                      60.8    9e-08   
ref|XP_006437568.1|  hypothetical protein CICLE_v10033912mg           60.8    9e-08   
ref|NP_849349.1|  glycosyl hydrolase 9B14                             60.8    1e-07   
ref|XP_009104944.1|  PREDICTED: endoglucanase 8                       60.8    1e-07   
gb|ESA07070.1|  hypothetical protein GLOINDRAFT_45754                 60.5    1e-07   
ref|WP_011837874.1|  endoglucanase                                    60.8    1e-07   
ref|WP_003517663.1|  endoglucanase                                    60.8    1e-07   
emb|CAE51308.1|  beta-1,4-glucanase                                   60.8    1e-07   
ref|WP_036948358.1|  hypothetical protein                             60.8    1e-07   
gb|KCW73253.1|  hypothetical protein EUGRSUZ_E01715                   60.8    1e-07   
ref|XP_010058567.1|  PREDICTED: endoglucanase 13-like                 60.8    1e-07   
ref|XP_010271277.1|  PREDICTED: endoglucanase 8-like                  60.8    1e-07   
ref|WP_042257752.1|  hypothetical protein                             60.8    1e-07   
ref|XP_006390849.1|  hypothetical protein EUTSA_v10018439mg           60.8    1e-07   
emb|CDY23486.1|  BnaC06g24550D                                        60.8    1e-07   
gb|ABC94541.1|  endo-1,4-beta-glucanase                               57.4    1e-07   
gb|AAD28258.1|AF128404_1  cellulase homolog                           60.5    1e-07   
gb|KCW51302.1|  hypothetical protein EUGRSUZ_J00862                   60.8    1e-07   
gb|EWM20555.1|  beta- -endoglucanase                                  60.8    1e-07   
ref|WP_035096198.1|  hypothetical protein                             60.8    1e-07   
ref|XP_005855791.1|  beta- -endoglucanase                             60.5    1e-07   
emb|CDP12234.1|  unnamed protein product                              60.5    1e-07   
ref|WP_034475014.1|  hypothetical protein                             60.8    1e-07   
gb|ETW14522.1|  cellobiohydrolase A (1,4-beta-cellobiosidase A)       60.8    1e-07   
ref|WP_036404735.1|  endoglucanase                                    60.8    1e-07   
ref|XP_004505716.1|  PREDICTED: endoglucanase 5-like                  60.8    1e-07   
ref|XP_010930836.1|  PREDICTED: LOW QUALITY PROTEIN: endoglucanas...  60.5    1e-07   
ref|XP_009607784.1|  PREDICTED: endoglucanase 12-like                 60.5    1e-07   
ref|XP_002975769.1|  hypothetical protein SELMODRAFT_232575           60.8    1e-07   
ref|WP_036732328.1|  endoglucanase                                    60.8    1e-07   
ref|WP_036690521.1|  endoglucanase                                    60.8    1e-07   
ref|XP_006850530.1|  hypothetical protein AMTR_s00159p00033510        60.8    1e-07   
ref|WP_035318119.1|  endoglucanase                                    60.8    1e-07   
sp|P05522.1|GUN1_PERAE  RecName: Full=Endoglucanase 1; AltName: F...  60.5    1e-07   
ref|XP_010098378.1|  Endoglucanase 16                                 60.5    1e-07   
ref|WP_044492536.1|  glycosyl hydrolase family 9                      60.5    1e-07   
ref|XP_010433888.1|  PREDICTED: endoglucanase 20-like                 60.5    1e-07   
emb|CDP00818.1|  unnamed protein product                              60.5    1e-07   
ref|XP_002452914.1|  hypothetical protein SORBIDRAFT_04g034920        60.5    1e-07   
ref|WP_035086727.1|  hypothetical protein                             61.2    1e-07   
gb|EYU26799.1|  hypothetical protein MIMGU_mgv1a020424mg              60.5    1e-07   
ref|XP_004153697.1|  PREDICTED: endoglucanase 12-like                 60.5    1e-07   
ref|XP_001772986.1|  predicted protein                                60.5    1e-07   
ref|WP_041084840.1|  endoglucanase                                    60.5    1e-07   
ref|NP_001289234.1|  endoglucanase 8                                  60.5    1e-07   
gb|KIL18226.1|  Endoglucanase 4 precursor                             60.5    1e-07   
gb|ADL34237.1|  endo-1,4-beta-glucanase Cel9C                         60.8    1e-07   
gb|KGN46280.1|  hypothetical protein Csa_6G079740                     60.5    1e-07   
emb|CAB83158.1|  cellulase-like protein                               60.5    1e-07   
ref|WP_043179538.1|  endoglucanase                                    60.8    1e-07   
ref|WP_010522082.1|  glycoside hydrolase                              60.8    1e-07   
ref|XP_007222661.1|  hypothetical protein PRUPE_ppa004970mg           60.5    1e-07   
ref|WP_044202405.1|  hypothetical protein                             60.8    1e-07   
ref|NP_189972.2|  glycosyl hydrolase 9A4                              60.5    1e-07   
ref|WP_043431762.1|  glycoside hydrolase                              60.8    1e-07   
gb|ABC70311.1|  endo-1,4-beta-glucanase precursor                     57.0    1e-07   
ref|XP_002310080.1|  endo-1 family protein                            60.5    1e-07   
ref|WP_043841865.1|  hypothetical protein                             60.1    1e-07   
gb|KHN32282.1|  Endoglucanase 5                                       60.5    1e-07   
gb|AAC78293.1|  cellulase                                             60.5    1e-07   
ref|XP_008805729.1|  PREDICTED: endoglucanase 13                      60.5    1e-07   
ref|WP_039178590.1|  endoglucanase                                    60.5    1e-07   
ref|WP_025092594.1|  endoglucanase                                    60.5    1e-07   
gb|AEX68682.1|  endoglucanase                                         60.5    1e-07   
ref|XP_004241769.1|  PREDICTED: endoglucanase 16                      60.1    1e-07   
emb|CDP12078.1|  unnamed protein product                              60.5    1e-07   
ref|XP_002875629.1|  glycosyl hydrolase family 9 protein              60.1    1e-07   
ref|XP_006590804.1|  PREDICTED: endoglucanase 5-like                  60.5    1e-07   
ref|WP_024426995.1|  endoglucanase                                    60.5    1e-07   
gb|AIQ70583.1|  endoglucanase                                         60.5    1e-07   
ref|XP_009351718.1|  PREDICTED: endoglucanase 5                       60.5    1e-07   
ref|WP_041109021.1|  endoglucanase                                    60.5    1e-07   
ref|XP_010314503.1|  PREDICTED: endoglucanase 6-like                  60.5    1e-07   
ref|WP_034623616.1|  endoglucanase                                    60.5    1e-07   
ref|XP_006360711.1|  PREDICTED: endoglucanase 6-like                  60.5    1e-07   
ref|WP_034841617.1|  hypothetical protein [                           60.5    1e-07   
ref|XP_006290429.1|  hypothetical protein CARUB_v10019329mg           60.1    1e-07   
ref|XP_007163509.1|  hypothetical protein PHAVU_001G239900g           60.1    1e-07   
gb|EPX59407.1|  Endo-1,4-beta-xylanase A precursor                    60.5    1e-07   
gb|EWM26157.1|  beta- -endoglucanase                                  60.1    1e-07   
ref|XP_002131623.1|  PREDICTED: endoglucanase 22                      60.5    1e-07   
emb|CDZ24787.1|  Endoglucanase Z [ [                                  60.5    2e-07   
ref|XP_009360195.1|  PREDICTED: endoglucanase CX-like                 60.1    2e-07   
ref|XP_008369029.1|  PREDICTED: endoglucanase 17-like                 60.1    2e-07   
ref|WP_044330588.1|  endoglucanase                                    60.5    2e-07   
gb|AJH76970.1|  cellulase                                             60.5    2e-07   
ref|WP_034281815.1|  endoglucanase                                    60.5    2e-07   
ref|WP_010248941.1|  endoglucanase                                    60.5    2e-07   
ref|XP_010909434.1|  PREDICTED: endoglucanase 23-like                 60.1    2e-07   
ref|XP_004240228.2|  PREDICTED: endoglucanase 13-like                 60.1    2e-07   
ref|XP_010448714.1|  PREDICTED: endoglucanase 20-like                 60.1    2e-07   
ref|XP_008386675.1|  PREDICTED: endoglucanase 17-like                 60.1    2e-07   
ref|XP_010433913.1|  PREDICTED: endoglucanase 20-like                 60.1    2e-07   
ref|WP_041117396.1|  endoglucanase                                    60.1    2e-07   
ref|WP_042268322.1|  endoglucanase                                    60.5    2e-07   
ref|XP_009378750.1|  PREDICTED: endoglucanase 17                      60.1    2e-07   
ref|XP_004953832.1|  PREDICTED: endoglucanase 6-like                  60.1    2e-07   
emb|CAB38941.1|  cellulase                                            60.5    2e-07   
gb|KHN05445.1|  Endoglucanase 5                                       60.1    2e-07   
ref|XP_010471073.1|  PREDICTED: endoglucanase 8-like                  60.1    2e-07   
ref|XP_003540637.2|  PREDICTED: endoglucanase 5                       60.1    2e-07   
ref|WP_012201369.1|  endoglucanase                                    60.5    2e-07   
ref|XP_006829372.1|  hypothetical protein AMTR_s02175p00005920        58.5    2e-07   
emb|CAA52343.1|  cellulase                                            60.1    2e-07   
ref|XP_010427855.1|  PREDICTED: endoglucanase 8                       60.1    2e-07   
ref|WP_043615544.1|  endoglucanase                                    60.1    2e-07   
ref|XP_006302180.1|  hypothetical protein CARUB_v10020190mg           59.7    2e-07   
ref|XP_003537478.1|  PREDICTED: endoglucanase 1-like                  57.0    2e-07   
ref|XP_002888789.1|  hypothetical protein ARALYDRAFT_894888           59.7    2e-07   
ref|XP_001783755.1|  predicted protein                                59.7    2e-07   
ref|XP_010439178.1|  PREDICTED: endoglucanase 20-like                 59.7    2e-07   
ref|XP_010413050.1|  PREDICTED: endoglucanase 14-like                 59.7    2e-07   
ref|NP_177228.1|  endo-1,4-beta-glucanase                             59.7    2e-07   
ref|XP_008366122.1|  PREDICTED: endoglucanase 14-like                 59.7    2e-07   
ref|XP_010552688.1|  PREDICTED: endoglucanase 8 isoform X2            59.7    2e-07   
ref|XP_010552685.1|  PREDICTED: endoglucanase 8 isoform X1            59.7    2e-07   
emb|CBI20730.3|  unnamed protein product                              60.1    2e-07   
ref|XP_006343864.1|  PREDICTED: endoglucanase 6-like                  60.1    2e-07   
ref|XP_010662406.1|  PREDICTED: endoglucanase 24-like                 59.7    2e-07   
emb|CAA67157.1|  endo-1,4-beta-glucanase                              59.7    2e-07   
gb|EFX86822.1|  endoglucanase                                         59.7    2e-07   
ref|XP_009399740.1|  PREDICTED: endoglucanase 6-like                  59.7    2e-07   
ref|WP_044479589.1|  endoglucanase                                    60.1    2e-07   
gb|EMT07479.1|  Endoglucanase 18                                      56.2    2e-07   
ref|XP_003611061.1|  Cellulase                                        59.7    2e-07   
ref|XP_010932722.1|  PREDICTED: endoglucanase 8-like                  59.7    2e-07   
ref|XP_006298937.1|  hypothetical protein CARUB_v10015060mg           59.7    2e-07   
ref|WP_018751213.1|  hypothetical protein                             60.1    2e-07   
ref|XP_002126063.1|  PREDICTED: endoglucanase 15-like                 59.7    2e-07   
ref|NP_001234172.1|  endo-beta-1,4-D-glucanase precursor              59.7    2e-07   
ref|XP_010508282.1|  PREDICTED: endoglucanase 15-like                 59.7    2e-07   
ref|XP_006649019.1|  PREDICTED: endoglucanase 6-like                  59.7    2e-07   
ref|XP_010503056.1|  PREDICTED: endoglucanase 16-like                 59.7    2e-07   
gb|KFK41496.1|  hypothetical protein AALP_AA2G137600                  59.7    2e-07   
ref|WP_026100730.1|  hypothetical protein                             59.7    2e-07   
dbj|BAJ85886.1|  predicted protein                                    59.7    2e-07   
gb|AGJ94736.1|  endo-beta-1,4-glucanase 1                             57.0    2e-07   
ref|XP_010425824.1|  PREDICTED: endoglucanase 16-like                 59.7    2e-07   
ref|XP_008461371.1|  PREDICTED: endoglucanase 5                       59.7    2e-07   
ref|XP_009150280.1|  PREDICTED: endoglucanase 16-like                 59.7    2e-07   
emb|CDY30943.1|  BnaA06g19700D                                        59.7    2e-07   
ref|XP_003530757.1|  PREDICTED: endoglucanase 8-like                  59.7    2e-07   
emb|CBI24578.3|  unnamed protein product                              59.7    2e-07   
gb|AGE09591.1|  CEL2-like protein                                     56.6    2e-07   
ref|XP_009060290.1|  hypothetical protein LOTGIDRAFT_106859           59.7    2e-07   



>ref|XP_009783020.1| PREDICTED: endoglucanase 2 [Nicotiana sylvestris]
Length=525

 Score =   121 bits (303),  Expect = 8e-29, Method: Compositional matrix adjust.
 Identities = 84/111 (76%), Positives = 93/111 (84%), Gaps = 4/111 (4%)
 Frame = +1

Query  223  MGDKSRSKGGWCGWLLvvivaaaigvsifvLVKKKHGGGGSSEPDaapvpgppgavTQKY  402
            MG+KSR KGGWCGW++V+IV AA   +I VLVKKKH G   S PDAAPVPGPPG+ T+KY
Sbjct  1    MGEKSR-KGGWCGWIIVLIVVAAAAGAIVVLVKKKHNG---SSPDAAPVPGPPGSPTKKY  56

Query  403  GDALKIAMQFFDVQKSGKLVDNKISWRGDSGLKDGKSASLDLSKGMYDAGD  555
             DALK AMQFFDVQKSGKLV+NKISWRGDS +KDG  A LDLSKGMYDAGD
Sbjct  57   ADALKTAMQFFDVQKSGKLVNNKISWRGDSAVKDGSPAKLDLSKGMYDAGD  107



>ref|XP_009610927.1| PREDICTED: endoglucanase 2-like [Nicotiana tomentosiformis]
Length=525

 Score =   119 bits (299),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 83/111 (75%), Positives = 93/111 (84%), Gaps = 4/111 (4%)
 Frame = +1

Query  223  MGDKSRSKGGWCGWLLvvivaaaigvsifvLVKKKHGGGGSSEPDaapvpgppgavTQKY  402
            MG+KSR KGGWCGW++V+IV AA   +I VLVKKKH G   S PDAAPVPGPPG+ T+KY
Sbjct  1    MGEKSR-KGGWCGWIIVLIVVAAAAGAIVVLVKKKHNG---SSPDAAPVPGPPGSPTKKY  56

Query  403  GDALKIAMQFFDVQKSGKLVDNKISWRGDSGLKDGKSASLDLSKGMYDAGD  555
             DALK AMQFFDVQKSGKLV+NKISWRGDS +KDG  A +DLSKGMYDAGD
Sbjct  57   ADALKTAMQFFDVQKSGKLVNNKISWRGDSAVKDGSQAKVDLSKGMYDAGD  107



>emb|CDP07412.1| unnamed protein product [Coffea canephora]
Length=526

 Score =   116 bits (290),  Expect = 6e-27, Method: Compositional matrix adjust.
 Identities = 81/112 (72%), Positives = 87/112 (78%), Gaps = 5/112 (4%)
 Frame = +1

Query  223  MGDKSRSKGGWCGWLLvvivaaaigvsifvLVKKKHGGG-GSSEPDaapvpgppgavTQK  399
            MG+KSRSKGGWCGWLLV+IVAAAI   IFV +KKKH    G + P    VPGPPGAVT+K
Sbjct  1    MGEKSRSKGGWCGWLLVLIVAAAIAFGIFVTIKKKHHASKGEAAP----VPGPPGAVTKK  56

Query  400  YGDALKIAMQFFDVQKSGKLVDNKISWRGDSGLKDGKSASLDLSKGMYDAGD  555
            Y DAL  AMQF DVQKSGKLV NKI WRGDS L DG  A +DLSKGMYDAGD
Sbjct  57   YADALHAAMQFLDVQKSGKLVHNKIPWRGDSALDDGSPAKVDLSKGMYDAGD  108



>gb|AGV22125.1| endo-1,4-beta-glucanase 3 [Betula luminifera]
Length=527

 Score =   114 bits (285),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 74/111 (67%), Positives = 86/111 (77%), Gaps = 4/111 (4%)
 Frame = +1

Query  223  MGDKSRSKGGWCGWLLvvivaaaigvsifvLVKKKHGGGGSSEPDaapvpgppgavTQKY  402
            MG+KSRS  GWCGW LV+++ A +  ++ + +KKK     S    A PVPGPPGA+ +KY
Sbjct  1    MGEKSRSSKGWCGWFLVLVILALVVGAVVITIKKK----TSHSDKAPPVPGPPGAIVKKY  56

Query  403  GDALKIAMQFFDVQKSGKLVDNKISWRGDSGLKDGKSASLDLSKGMYDAGD  555
             DALKIAMQFFDVQKSGKLVDN ISWRGDS LKDG  A+LDLSKGMYDAGD
Sbjct  57   SDALKIAMQFFDVQKSGKLVDNPISWRGDSALKDGSEATLDLSKGMYDAGD  107



>ref|XP_003527686.1| PREDICTED: endoglucanase 10-like [Glycine max]
 gb|KHN09095.1| Endoglucanase 24 [Glycine soja]
Length=529

 Score =   113 bits (283),  Expect = 6e-26, Method: Compositional matrix adjust.
 Identities = 75/111 (68%), Positives = 84/111 (76%), Gaps = 2/111 (2%)
 Frame = +1

Query  223  MGDKSRSKGGWCGWLLvvivaaaigvsifvLVKKKHGGGGSSEPDaapvpgppgavTQKY  402
            MG+KSRSKGG CGW +  ++ A +  +I   VKKK    GS +   APVPGPPGAV QKY
Sbjct  1    MGEKSRSKGGCCGWFIAFVILALVVGAIVFTVKKKFSHSGSDK--PAPVPGPPGAVDQKY  58

Query  403  GDALKIAMQFFDVQKSGKLVDNKISWRGDSGLKDGKSASLDLSKGMYDAGD  555
              ALK AMQFFDVQKSG+LVDNKISWRG+S LKDG  A LDLSKGMYDAGD
Sbjct  59   STALKTAMQFFDVQKSGRLVDNKISWRGNSALKDGSQAKLDLSKGMYDAGD  109



>ref|XP_004238345.1| PREDICTED: endoglucanase 2-like [Solanum lycopersicum]
 ref|XP_010320423.1| PREDICTED: endoglucanase 2-like [Solanum lycopersicum]
Length=519

 Score =   112 bits (281),  Expect = 8e-26, Method: Compositional matrix adjust.
 Identities = 70/111 (63%), Positives = 81/111 (73%), Gaps = 9/111 (8%)
 Frame = +1

Query  223  MGDKSRSKGGWCGWLLvvivaaaigvsifvLVKKKHGGGGSSEPDaapvpgppgavTQKY  402
            MG+KS+ KGGWCGW++ ++V AA   +I VL  KKH G GS            GA  +KY
Sbjct  1    MGEKSK-KGGWCGWIIALVVVAAAAGAIVVLFMKKHNGSGSD--------AASGASEKKY  51

Query  403  GDALKIAMQFFDVQKSGKLVDNKISWRGDSGLKDGKSASLDLSKGMYDAGD  555
            GDALKIAMQFFDVQKSGKLV+NKISWRGDS +KDG    LDLS+GMYDAGD
Sbjct  52   GDALKIAMQFFDVQKSGKLVNNKISWRGDSAVKDGSQEKLDLSQGMYDAGD  102



>ref|XP_003523541.1| PREDICTED: endoglucanase 10 [Glycine max]
Length=529

 Score =   112 bits (280),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 75/111 (68%), Positives = 84/111 (76%), Gaps = 2/111 (2%)
 Frame = +1

Query  223  MGDKSRSKGGWCGWLLvvivaaaigvsifvLVKKKHGGGGSSEPDaapvpgppgavTQKY  402
            MG+KSRSKGG CGW +  I+ A +  +I   VKKK    GS +   APVPGPPGAV QKY
Sbjct  1    MGEKSRSKGGCCGWFIAFIILALVVGAIVFTVKKKFSHSGSDK--PAPVPGPPGAVDQKY  58

Query  403  GDALKIAMQFFDVQKSGKLVDNKISWRGDSGLKDGKSASLDLSKGMYDAGD  555
              ALK AMQFFD+QKSGKLVDNKISWRG+S LKDG  A LDL+KGMYDAGD
Sbjct  59   STALKTAMQFFDIQKSGKLVDNKISWRGNSALKDGSQAKLDLTKGMYDAGD  109



>ref|XP_007136082.1| hypothetical protein PHAVU_009G016100g [Phaseolus vulgaris]
 gb|ESW08076.1| hypothetical protein PHAVU_009G016100g [Phaseolus vulgaris]
Length=529

 Score =   111 bits (277),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 72/111 (65%), Positives = 86/111 (77%), Gaps = 2/111 (2%)
 Frame = +1

Query  223  MGDKSRSKGGWCGWLLvvivaaaigvsifvLVKKKHGGGGSSEPDaapvpgppgavTQKY  402
            MG+KS+SKGG CGW +  ++ A +  ++   VKKK G  GS +  AAPVPGPPGAV QKY
Sbjct  1    MGEKSKSKGGCCGWFIAFVILAIVVGAVVYTVKKKFGHSGSDK--AAPVPGPPGAVDQKY  58

Query  403  GDALKIAMQFFDVQKSGKLVDNKISWRGDSGLKDGKSASLDLSKGMYDAGD  555
              ALK ++QFFD+QKSGKLV+NKI WRGDSGLKDG  A LDL+KGMYDAGD
Sbjct  59   ATALKTSLQFFDIQKSGKLVNNKIPWRGDSGLKDGSQAKLDLTKGMYDAGD  109



>gb|AES73992.2| glycosyl hydrolase family 9 protein [Medicago truncatula]
Length=529

 Score =   110 bits (276),  Expect = 5e-25, Method: Compositional matrix adjust.
 Identities = 65/111 (59%), Positives = 76/111 (68%), Gaps = 2/111 (2%)
 Frame = +1

Query  223  MGDKSRSKGGWCGWLLvvivaaaigvsifvLVKKKHGGGGSSEPDaapvpgppgavTQKY  402
            M +KS+SKGG CGW +  ++ A +  +I   VKKK     S +P+  P P       QKY
Sbjct  1    MREKSKSKGGCCGWFIAFVILALVVGAIVYAVKKKIDNSNSDKPEPVPGPPGAID--QKY  58

Query  403  GDALKIAMQFFDVQKSGKLVDNKISWRGDSGLKDGKSASLDLSKGMYDAGD  555
              ALK AMQFFDVQKSGKL +NKISWRGDS LKDGK A LDL+KGMYDAGD
Sbjct  59   ASALKTAMQFFDVQKSGKLENNKISWRGDSALKDGKQADLDLTKGMYDAGD  109



>ref|XP_003603741.1| Endoglucanase [Medicago truncatula]
Length=535

 Score =   110 bits (276),  Expect = 6e-25, Method: Compositional matrix adjust.
 Identities = 65/111 (59%), Positives = 76/111 (68%), Gaps = 2/111 (2%)
 Frame = +1

Query  223  MGDKSRSKGGWCGWLLvvivaaaigvsifvLVKKKHGGGGSSEPDaapvpgppgavTQKY  402
            M +KS+SKGG CGW +  ++ A +  +I   VKKK     S +P+  P P       QKY
Sbjct  1    MREKSKSKGGCCGWFIAFVILALVVGAIVYAVKKKIDNSNSDKPEPVPGPPGAID--QKY  58

Query  403  GDALKIAMQFFDVQKSGKLVDNKISWRGDSGLKDGKSASLDLSKGMYDAGD  555
              ALK AMQFFDVQKSGKL +NKISWRGDS LKDGK A LDL+KGMYDAGD
Sbjct  59   ASALKTAMQFFDVQKSGKLENNKISWRGDSALKDGKQADLDLTKGMYDAGD  109



>ref|XP_006302134.1| hypothetical protein CARUB_v10020139mg [Capsella rubella]
 gb|EOA35032.1| hypothetical protein CARUB_v10020139mg [Capsella rubella]
Length=525

 Score =   108 bits (270),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 71/111 (64%), Positives = 89/111 (80%), Gaps = 2/111 (2%)
 Frame = +1

Query  223  MGDKSRSKGGWCGWLLvvivaaaigvsifvLVKKKHGGGGSSEPDaapvpgppgavTQKY  402
            MG+KS+S+G WCGWL+ +IV A++ +++   VK +    G  E  A PVPGPPGA+ +KY
Sbjct  1    MGEKSKSRG-WCGWLIAIIVLASVVLAVVYTVKSRMKKSGDDE-GAGPVPGPPGAIDKKY  58

Query  403  GDALKIAMQFFDVQKSGKLVDNKISWRGDSGLKDGKSASLDLSKGMYDAGD  555
             DALK+A+QFFD+QKSGKLV+NKISWRGDSGLKDG  A LDLSKG+YDAGD
Sbjct  59   ADALKMALQFFDIQKSGKLVNNKISWRGDSGLKDGSEADLDLSKGLYDAGD  109



>ref|XP_010104437.1| Endoglucanase 24 [Morus notabilis]
 gb|EXC00970.1| Endoglucanase 24 [Morus notabilis]
Length=525

 Score =   108 bits (269),  Expect = 5e-24, Method: Compositional matrix adjust.
 Identities = 71/114 (62%), Positives = 85/114 (75%), Gaps = 10/114 (9%)
 Frame = +1

Query  223  MGDKSRSKGGWCGWLLvvivaaaigvsifvLVKKK---HGGGGSSEPDaapvpgppgavT  393
            MG+KS SKG WCGW LV+++ A +  +I + +KKK   H    +  P      GPPGA++
Sbjct  1    MGEKSSSKG-WCGWFLVLVILALVVGAIVITIKKKQSDHSDKAAPVP------GPPGAIS  53

Query  394  QKYGDALKIAMQFFDVQKSGKLVDNKISWRGDSGLKDGKSASLDLSKGMYDAGD  555
            QKY DALKIA+QFFDVQKSGKL DNKISWRGDSGL+DG  A +DLSKGMYDAGD
Sbjct  54   QKYADALKIAIQFFDVQKSGKLEDNKISWRGDSGLRDGSDAKVDLSKGMYDAGD  107



>ref|XP_004136389.1| PREDICTED: endoglucanase 2-like [Cucumis sativus]
 ref|XP_004162553.1| PREDICTED: endoglucanase 2-like [Cucumis sativus]
 gb|KGN60025.1| hypothetical protein Csa_3G872070 [Cucumis sativus]
Length=523

 Score =   107 bits (268),  Expect = 8e-24, Method: Compositional matrix adjust.
 Identities = 77/111 (69%), Positives = 89/111 (80%), Gaps = 4/111 (4%)
 Frame = +1

Query  223  MGDKSRSKGGWCGWLLvvivaaaigvsifvLVKKKHGGGGSSEPDaapvpgppgavTQKY  402
            MG+KSRS+G  CGW LV++V A I  +I   VKKK      S+ D APVPGPPGA+ +KY
Sbjct  1    MGEKSRSRGC-CGWFLVLVVLALIAGAIVFAVKKK---SSHSDDDPAPVPGPPGAIEKKY  56

Query  403  GDALKIAMQFFDVQKSGKLVDNKISWRGDSGLKDGKSASLDLSKGMYDAGD  555
             DALK+AM+FFDVQKSGKLVDN+ISWRGDSGLKDG  A+LDLSKGMYDAGD
Sbjct  57   SDALKMAMKFFDVQKSGKLVDNQISWRGDSGLKDGSDANLDLSKGMYDAGD  107



>ref|XP_010244092.1| PREDICTED: endoglucanase 24-like [Nelumbo nucifera]
 ref|XP_010244093.1| PREDICTED: endoglucanase 24-like [Nelumbo nucifera]
Length=527

 Score =   107 bits (266),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 69/111 (62%), Positives = 83/111 (75%), Gaps = 4/111 (4%)
 Frame = +1

Query  223  MGDKSRSKGGWCGWLLvvivaaaigvsifvLVKKKHGGGGSSEPDaapvpgppgavTQKY  402
            MG K +SKG +CGWL+  +V   +   I + V+ KH    S +P  AP+PGPPGA+ +KY
Sbjct  1    MGGKEKSKG-YCGWLIAFVVLGIVVAVIVLTVRHKHS---SHKPVPAPIPGPPGAIEKKY  56

Query  403  GDALKIAMQFFDVQKSGKLVDNKISWRGDSGLKDGKSASLDLSKGMYDAGD  555
             DAL +AMQFFDVQKSGKLV+NKISWRGDS L+DGK   LDLSKGMYDAGD
Sbjct  57   ADALGVAMQFFDVQKSGKLVNNKISWRGDSALQDGKEKKLDLSKGMYDAGD  107



>ref|XP_008466493.1| PREDICTED: endoglucanase 10 [Cucumis melo]
Length=523

 Score =   107 bits (266),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 75/111 (68%), Positives = 88/111 (79%), Gaps = 4/111 (4%)
 Frame = +1

Query  223  MGDKSRSKGGWCGWLLvvivaaaigvsifvLVKKKHGGGGSSEPDaapvpgppgavTQKY  402
            MG+KSRS+G  CGW LV+++   I  +I   VKKK      S+ D APVPGPPGA+ +KY
Sbjct  1    MGEKSRSRGC-CGWFLVLVILGLIAGAIVFAVKKK---SSHSDDDPAPVPGPPGAIQKKY  56

Query  403  GDALKIAMQFFDVQKSGKLVDNKISWRGDSGLKDGKSASLDLSKGMYDAGD  555
             DALK+A++FFDVQKSGKLVDNKISWRGDSGLKDG  A+LDLSKGMYDAGD
Sbjct  57   SDALKMALRFFDVQKSGKLVDNKISWRGDSGLKDGSEANLDLSKGMYDAGD  107



>gb|KHF97947.1| hypothetical protein F383_10892 [Gossypium arboreum]
Length=526

 Score =   106 bits (265),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 65/111 (59%), Positives = 79/111 (71%), Gaps = 3/111 (3%)
 Frame = +1

Query  223  MGDKSRSKGGWCGWLLvvivaaaigvsifvLVKKKHGGGGSSEPDaapvpgppgavTQKY  402
            MG +S+S GG  GWLL +++ A +  +I   VK+K      ++P   P P       +KY
Sbjct  1    MGKESKS-GGCLGWLLAIVILALVVGAIVYAVKQKMDHANDNKPSPVPGPPGAID--KKY  57

Query  403  GDALKIAMQFFDVQKSGKLVDNKISWRGDSGLKDGKSASLDLSKGMYDAGD  555
             DALKIAMQFFD+QKSGKLV+NKISWRGDSGLKDG  A+LDLSKGMYDAGD
Sbjct  58   ADALKIAMQFFDIQKSGKLVNNKISWRGDSGLKDGNEANLDLSKGMYDAGD  108



>gb|KJB58118.1| hypothetical protein B456_009G195400 [Gossypium raimondii]
Length=526

 Score =   105 bits (263),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 65/111 (59%), Positives = 79/111 (71%), Gaps = 3/111 (3%)
 Frame = +1

Query  223  MGDKSRSKGGWCGWLLvvivaaaigvsifvLVKKKHGGGGSSEPDaapvpgppgavTQKY  402
            MG +S+S GG  GWLL +++ A +  +I   VK+K      ++P   P P       +KY
Sbjct  1    MGKESKS-GGCLGWLLAIVILALVVGAIVYAVKQKIDHANDNKPSPVPGPPGAID--KKY  57

Query  403  GDALKIAMQFFDVQKSGKLVDNKISWRGDSGLKDGKSASLDLSKGMYDAGD  555
             DALKIAMQFFD+QKSGKLV+NKISWRGDSGLKDG  A+LDLSKGMYDAGD
Sbjct  58   ADALKIAMQFFDIQKSGKLVNNKISWRGDSGLKDGNEANLDLSKGMYDAGD  108



>gb|ADU15552.1| EG [Gossypium hirsutum]
Length=526

 Score =   105 bits (263),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 65/111 (59%), Positives = 79/111 (71%), Gaps = 3/111 (3%)
 Frame = +1

Query  223  MGDKSRSKGGWCGWLLvvivaaaigvsifvLVKKKHGGGGSSEPDaapvpgppgavTQKY  402
            MG +S+S GG  GWLL +++ A +  +I   VK+K      ++P   P P       +KY
Sbjct  1    MGKESKS-GGCLGWLLAIVILALVVGAIVYAVKQKIDHANDNKPSPVPGPPGAID--KKY  57

Query  403  GDALKIAMQFFDVQKSGKLVDNKISWRGDSGLKDGKSASLDLSKGMYDAGD  555
             DALKIAMQFFD+QKSGKLV+NKISWRGDSGLKDG  A+LDLSKGMYDAGD
Sbjct  58   ADALKIAMQFFDIQKSGKLVNNKISWRGDSGLKDGNEANLDLSKGMYDAGD  108



>gb|AID55377.1| glycoside hydrolase family 9 B5 [Gossypium hirsutum]
Length=526

 Score =   105 bits (263),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 65/111 (59%), Positives = 79/111 (71%), Gaps = 3/111 (3%)
 Frame = +1

Query  223  MGDKSRSKGGWCGWLLvvivaaaigvsifvLVKKKHGGGGSSEPDaapvpgppgavTQKY  402
            MG +S+S GG  GWLL +++ A +  +I   VK+K      ++P   P P       +KY
Sbjct  1    MGKQSKS-GGCLGWLLAIVILALVVGAIVYAVKQKIDHANDNKPSPVPGPPGAID--KKY  57

Query  403  GDALKIAMQFFDVQKSGKLVDNKISWRGDSGLKDGKSASLDLSKGMYDAGD  555
             DALKIAMQFFD+QKSGKLV+NKISWRGDSGLKDG  A+LDLSKGMYDAGD
Sbjct  58   ADALKIAMQFFDIQKSGKLVNNKISWRGDSGLKDGNEANLDLSKGMYDAGD  108



>ref|XP_007017777.1| EG isoform 3 [Theobroma cacao]
 gb|EOY15002.1| EG isoform 3 [Theobroma cacao]
Length=365

 Score =   103 bits (257),  Expect = 6e-23, Method: Compositional matrix adjust.
 Identities = 71/113 (63%), Positives = 84/113 (74%), Gaps = 7/113 (6%)
 Frame = +1

Query  223  MGDKSRSKGGWCGWLLvvivaaaigvsifvLVKKK--HGGGGSSEPDaapvpgppgavTQ  396
            MG +S+SKG   GW LV+++ A +  ++   +K+K  H     + P    VPGPPGA+ +
Sbjct  1    MGKESKSKGC-LGWFLVIVILALVVGAVVYAIKQKMDHSDDDKAAP----VPGPPGAIDK  55

Query  397  KYGDALKIAMQFFDVQKSGKLVDNKISWRGDSGLKDGKSASLDLSKGMYDAGD  555
            KY DALKIAMQFFDVQKSGKLVDNKISWRGDSGLKDG  A LDLSKGMYDAGD
Sbjct  56   KYADALKIAMQFFDVQKSGKLVDNKISWRGDSGLKDGSEAKLDLSKGMYDAGD  108



>ref|XP_010471690.1| PREDICTED: endoglucanase 10 [Camelina sativa]
Length=525

 Score =   103 bits (258),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 68/111 (61%), Positives = 88/111 (79%), Gaps = 2/111 (2%)
 Frame = +1

Query  223  MGDKSRSKGGWCGWLLvvivaaaigvsifvLVKKKHGGGGSSEPDaapvpgppgavTQKY  402
            MG+KS+SKG WCGW + +IV AA+ +++   VK +    G ++  + PVPGPPGA+ +KY
Sbjct  1    MGEKSKSKG-WCGWFIAIIVLAAVVLAVVYTVKSRMKKSGEAD-GSGPVPGPPGAIDKKY  58

Query  403  GDALKIAMQFFDVQKSGKLVDNKISWRGDSGLKDGKSASLDLSKGMYDAGD  555
             DALK+++QFFD+QKSGKLV+NKI WRGDSGLKDG  A LDLSKG+YDAGD
Sbjct  59   ADALKLSLQFFDIQKSGKLVNNKIPWRGDSGLKDGSEADLDLSKGLYDAGD  109



>ref|XP_006342034.1| PREDICTED: endoglucanase 10-like [Solanum tuberosum]
Length=519

 Score =   103 bits (257),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 71/111 (64%), Positives = 81/111 (73%), Gaps = 9/111 (8%)
 Frame = +1

Query  223  MGDKSRSKGGWCGWLLvvivaaaigvsifvLVKKKHGGGGSSEPDaapvpgppgavTQKY  402
            MG+KS+ KGGWCGW++V+IVAAA   +I VLV KKH    S            GA  +KY
Sbjct  1    MGEKSK-KGGWCGWIIVLIVAAAAAGAIVVLVMKKHKDSSSDA--------ASGASEKKY  51

Query  403  GDALKIAMQFFDVQKSGKLVDNKISWRGDSGLKDGKSASLDLSKGMYDAGD  555
            GDALKIAMQFFDVQKSGKLV+NKI WRGDS +KDG    LDLS+GMYDAGD
Sbjct  52   GDALKIAMQFFDVQKSGKLVNNKIPWRGDSAIKDGSQEKLDLSQGMYDAGD  102



>ref|XP_010416457.1| PREDICTED: endoglucanase 10-like [Camelina sativa]
Length=525

 Score =   103 bits (256),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 67/111 (60%), Positives = 87/111 (78%), Gaps = 2/111 (2%)
 Frame = +1

Query  223  MGDKSRSKGGWCGWLLvvivaaaigvsifvLVKKKHGGGGSSEPDaapvpgppgavTQKY  402
            MG+KS+SKG WCGW + +IV A + +++   VK +    G ++  + PVPGPPGA+ +KY
Sbjct  1    MGEKSKSKG-WCGWFIAIIVLAVVVLAVVYTVKSRMKKSGEAD-GSGPVPGPPGAIDKKY  58

Query  403  GDALKIAMQFFDVQKSGKLVDNKISWRGDSGLKDGKSASLDLSKGMYDAGD  555
             DALK+++QFFD+QKSGKLV+NKI WRGDSGLKDG  A LDLSKG+YDAGD
Sbjct  59   ADALKLSLQFFDIQKSGKLVNNKIPWRGDSGLKDGSEADLDLSKGLYDAGD  109



>ref|XP_010539853.1| PREDICTED: endoglucanase 10 [Tarenaya hassleriana]
Length=524

 Score =   103 bits (256),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 67/111 (60%), Positives = 85/111 (77%), Gaps = 3/111 (3%)
 Frame = +1

Query  223  MGDKSRSKGGWCGWLLvvivaaaigvsifvLVKKKHGGGGSSEPDaapvpgppgavTQKY  402
            MG+KS+S+G WCGW + ++V A + V++   ++ K   G S +    PVPGPPGA+ +KY
Sbjct  1    MGEKSQSRG-WCGWFIALVVLAVVVVAVVFTIRAK--TGHSDDGGDGPVPGPPGAIDKKY  57

Query  403  GDALKIAMQFFDVQKSGKLVDNKISWRGDSGLKDGKSASLDLSKGMYDAGD  555
             DALKIAMQFFD+QKSGKL +NKI WRGDSGLKDG   +LDLSKG+YDAGD
Sbjct  58   SDALKIAMQFFDIQKSGKLENNKIPWRGDSGLKDGNEVNLDLSKGLYDAGD  108



>ref|XP_007017776.1| EG isoform 2 [Theobroma cacao]
 gb|EOY15001.1| EG isoform 2 [Theobroma cacao]
Length=526

 Score =   103 bits (256),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 71/113 (63%), Positives = 84/113 (74%), Gaps = 7/113 (6%)
 Frame = +1

Query  223  MGDKSRSKGGWCGWLLvvivaaaigvsifvLVKKK--HGGGGSSEPDaapvpgppgavTQ  396
            MG +S+SKG   GW LV+++ A +  ++   +K+K  H     + P    VPGPPGA+ +
Sbjct  1    MGKESKSKGC-LGWFLVIVILALVVGAVVYAIKQKMDHSDDDKAAP----VPGPPGAIDK  55

Query  397  KYGDALKIAMQFFDVQKSGKLVDNKISWRGDSGLKDGKSASLDLSKGMYDAGD  555
            KY DALKIAMQFFDVQKSGKLVDNKISWRGDSGLKDG  A LDLSKGMYDAGD
Sbjct  56   KYADALKIAMQFFDVQKSGKLVDNKISWRGDSGLKDGSEAKLDLSKGMYDAGD  108



>ref|XP_010428595.1| PREDICTED: endoglucanase 10-like [Camelina sativa]
Length=525

 Score =   102 bits (255),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 68/111 (61%), Positives = 88/111 (79%), Gaps = 2/111 (2%)
 Frame = +1

Query  223  MGDKSRSKGGWCGWLLvvivaaaigvsifvLVKKKHGGGGSSEPDaapvpgppgavTQKY  402
            MG+KS+SKG WCGW + +IV AA+ +++   VK +    G ++  + PVPGPPGA+ +KY
Sbjct  1    MGEKSKSKG-WCGWFIAIIVLAAVVLAVVYTVKSRMKKSGDAD-GSGPVPGPPGAIDKKY  58

Query  403  GDALKIAMQFFDVQKSGKLVDNKISWRGDSGLKDGKSASLDLSKGMYDAGD  555
             DALK+++QFFD+QKSGKLV+NKI WRGDSGLKDG  A LDLSKG+YDAGD
Sbjct  59   ADALKLSLQFFDIQKSGKLVNNKIPWRGDSGLKDGSEADLDLSKGLYDAGD  109



>gb|EYU36779.1| hypothetical protein MIMGU_mgv1a004472mg [Erythranthe guttata]
Length=525

 Score =   102 bits (255),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 67/112 (60%), Positives = 85/112 (76%), Gaps = 6/112 (5%)
 Frame = +1

Query  223  MGDKSRSKGGWCGWLLvvivaaaigvsifvLVKKK-HGGGGSSEPDaapvpgppgavTQK  399
            MG+K++S+G WCGW L  IV AA+  ++F  +++K H     + P    +PGPPGA+T+K
Sbjct  1    MGEKNKSRG-WCGWFLAFIVLAAVAFALFFTLRQKFHKSDSGAAP----IPGPPGAITKK  55

Query  400  YGDALKIAMQFFDVQKSGKLVDNKISWRGDSGLKDGKSASLDLSKGMYDAGD  555
            Y DALKIA QF D+QKSGKLV+N+ISWRGDS LKDG   +LDLSKGMYDAGD
Sbjct  56   YADALKIASQFLDIQKSGKLVNNQISWRGDSALKDGNQENLDLSKGMYDAGD  107



>ref|XP_007017775.1| EG isoform 1 [Theobroma cacao]
 gb|EOY15000.1| EG isoform 1 [Theobroma cacao]
Length=533

 Score =   102 bits (255),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 71/113 (63%), Positives = 84/113 (74%), Gaps = 7/113 (6%)
 Frame = +1

Query  223  MGDKSRSKGGWCGWLLvvivaaaigvsifvLVKKK--HGGGGSSEPDaapvpgppgavTQ  396
            MG +S+SKG   GW LV+++ A +  ++   +K+K  H     + P    VPGPPGA+ +
Sbjct  1    MGKESKSKGC-LGWFLVIVILALVVGAVVYAIKQKMDHSDDDKAAP----VPGPPGAIDK  55

Query  397  KYGDALKIAMQFFDVQKSGKLVDNKISWRGDSGLKDGKSASLDLSKGMYDAGD  555
            KY DALKIAMQFFDVQKSGKLVDNKISWRGDSGLKDG  A LDLSKGMYDAGD
Sbjct  56   KYADALKIAMQFFDVQKSGKLVDNKISWRGDSGLKDGSEAKLDLSKGMYDAGD  108



>ref|XP_004500948.1| PREDICTED: endoglucanase 10-like [Cicer arietinum]
Length=528

 Score =   102 bits (255),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 70/111 (63%), Positives = 82/111 (74%), Gaps = 3/111 (3%)
 Frame = +1

Query  223  MGDKSRSKGGWCGWLLvvivaaaigvsifvLVKKKHGGGGSSEPDaapvpgppgavTQKY  402
            MG KSRS+G  CGW +  ++ A +  ++   +KKK     S +   APVPGPPGA+ QKY
Sbjct  1    MGGKSRSRGC-CGWFIAFVIFALVVGAVVYTIKKKIDNSDSDK--PAPVPGPPGAIEQKY  57

Query  403  GDALKIAMQFFDVQKSGKLVDNKISWRGDSGLKDGKSASLDLSKGMYDAGD  555
              ALK AMQFFDVQKSGKL +NKISWRGDS LKDGK A+LDLSKGMYDAGD
Sbjct  58   STALKTAMQFFDVQKSGKLENNKISWRGDSALKDGKQANLDLSKGMYDAGD  108



>ref|XP_010667385.1| PREDICTED: endoglucanase 2-like [Beta vulgaris subsp. vulgaris]
Length=523

 Score =   102 bits (254),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 71/112 (63%), Positives = 83/112 (74%), Gaps = 5/112 (4%)
 Frame = +1

Query  223  MGDKSRSKGG-WCGWLLvvivaaaigvsifvLVKKKHGGGGSSEPDaapvpgppgavTQK  399
            MG +  SKGG  CGW LV+IVA+AI   I + V+ K      +EP    VPGPPGA+  K
Sbjct  1    MGKEKESKGGGCCGWFLVIIVASAIVAGIVIAVRSKFHHSDKAEP----VPGPPGAIVTK  56

Query  400  YGDALKIAMQFFDVQKSGKLVDNKISWRGDSGLKDGKSASLDLSKGMYDAGD  555
            Y DALK+A+QFFDVQKSG+LVDNKISWRG+S L+DG  A LDLSKGMYDAGD
Sbjct  57   YSDALKLALQFFDVQKSGRLVDNKISWRGNSALEDGSEAKLDLSKGMYDAGD  108



>ref|XP_009103373.1| PREDICTED: endoglucanase 2 [Brassica rapa]
Length=533

 Score =   102 bits (254),  Expect = 7e-22, Method: Compositional matrix adjust.
 Identities = 62/116 (53%), Positives = 76/116 (66%), Gaps = 9/116 (8%)
 Frame = +1

Query  208  KGGEKMGDKSRSKGGWCGWLLvvivaaaigvsifvLVKKKHGGGGSSEPDaapvpgppga  387
            KGGEKM  KS S+   C W L +IV  A+ +++   ++ +        P         G+
Sbjct  11   KGGEKMVAKSGSRCCCCCWFLGIIVVIAVVLAVVFTIRHRANHSDDVAP---------GS  61

Query  388  vTQKYGDALKIAMQFFDVQKSGKLVDNKISWRGDSGLKDGKSASLDLSKGMYDAGD  555
              +KY DALKIAMQFFD+QKSGKL +NKI WRGDSGLKDG  ASLDLSKG+YDAGD
Sbjct  62   TDKKYADALKIAMQFFDIQKSGKLENNKIPWRGDSGLKDGSEASLDLSKGLYDAGD  117



>ref|XP_008364934.1| PREDICTED: endoglucanase 10-like [Malus domestica]
Length=526

 Score =   102 bits (253),  Expect = 7e-22, Method: Compositional matrix adjust.
 Identities = 74/115 (64%), Positives = 84/115 (73%), Gaps = 11/115 (10%)
 Frame = +1

Query  223  MGDKSRSKGGWCGWLLvvi----vaaaigvsifvLVKKKHGGGGSSEPDaapvpgppgav  390
            MG KSR KG W  WLLV+     V  A+ +++   VKK  GG  S+ P      GPPGA+
Sbjct  1    MGAKSRCKG-WWAWLLVLAILGLVVGAVVLAVVKKVKKNSGGDDSAVP------GPPGAI  53

Query  391  TQKYGDALKIAMQFFDVQKSGKLVDNKISWRGDSGLKDGKSASLDLSKGMYDAGD  555
            TQKY DALK+A+QFFDVQKSG+LVDNKISWRGDSGLKDG  A LDLSKGMYDAGD
Sbjct  54   TQKYSDALKLAVQFFDVQKSGQLVDNKISWRGDSGLKDGSDAKLDLSKGMYDAGD  108



>emb|CDY66396.1| BnaAnng22170D [Brassica napus]
Length=533

 Score =   102 bits (254),  Expect = 7e-22, Method: Compositional matrix adjust.
 Identities = 62/116 (53%), Positives = 76/116 (66%), Gaps = 9/116 (8%)
 Frame = +1

Query  208  KGGEKMGDKSRSKGGWCGWLLvvivaaaigvsifvLVKKKHGGGGSSEPDaapvpgppga  387
            KGGEKM  KS S+   C W L +IV  A+ +++   ++ +        P         G+
Sbjct  11   KGGEKMVAKSGSRCCCCCWFLGIIVVIAVVLAVVFTIRHRANHSDDVAP---------GS  61

Query  388  vTQKYGDALKIAMQFFDVQKSGKLVDNKISWRGDSGLKDGKSASLDLSKGMYDAGD  555
              +KY DALKIAMQFFD+QKSGKL +NKI WRGDSGLKDG  ASLDLSKG+YDAGD
Sbjct  62   TDKKYADALKIAMQFFDIQKSGKLENNKIPWRGDSGLKDGSEASLDLSKGLYDAGD  117



>ref|XP_009128120.1| PREDICTED: endoglucanase 10 [Brassica rapa]
 ref|XP_009128121.1| PREDICTED: endoglucanase 10 [Brassica rapa]
Length=526

 Score =   102 bits (253),  Expect = 9e-22, Method: Compositional matrix adjust.
 Identities = 66/111 (59%), Positives = 84/111 (76%), Gaps = 1/111 (1%)
 Frame = +1

Query  223  MGDKSRSKGGWCGWLLvvivaaaigvsifvLVKKKHGGGGSSEPDaapvpgppgavTQKY  402
            MG++     GWCGW + +IV AA+ +++  +VK K       +  A PVPGPPGA+ +KY
Sbjct  1    MGEEKSKSRGWCGWFIALIVLAAVILAVVYMVKSKMKKSDDGD-GAGPVPGPPGAIDKKY  59

Query  403  GDALKIAMQFFDVQKSGKLVDNKISWRGDSGLKDGKSASLDLSKGMYDAGD  555
             DALK+++QFFD+QKSGKLV+NKISWRGDSGLKDG  A LDLSKG+YDAGD
Sbjct  60   ADALKLSLQFFDIQKSGKLVNNKISWRGDSGLKDGSEADLDLSKGLYDAGD  110



>ref|XP_009335173.1| PREDICTED: endoglucanase 2-like [Pyrus x bretschneideri]
Length=526

 Score =   101 bits (252),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 49/55 (89%), Positives = 51/55 (93%), Gaps = 0/55 (0%)
 Frame = +1

Query  391  TQKYGDALKIAMQFFDVQKSGKLVDNKISWRGDSGLKDGKSASLDLSKGMYDAGD  555
            TQKY DALK+A+QFFDVQKSGKLVDNKISWRGDSGLKDG  A LDLSKGMYDAGD
Sbjct  54   TQKYSDALKVAVQFFDVQKSGKLVDNKISWRGDSGLKDGSDAKLDLSKGMYDAGD  108



>gb|EPS64495.1| hypothetical protein M569_10284, partial [Genlisea aurea]
Length=530

 Score =   101 bits (252),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 72/111 (65%), Positives = 92/111 (83%), Gaps = 7/111 (6%)
 Frame = +1

Query  232  KSRSKGGWCGWLLvvivaaaigvsifvLVKKK-HGGGGSSEP--DaapvpgppgavTQKY  402
            + R  GGWCGW LV+IV A++G+++F++VK+K H     S+P  +AAPVPGPPGAV  KY
Sbjct  1    EKRGGGGWCGWFLVLIVLASVGLAVFLVVKQKIH----KSQPPGEAAPVPGPPGAVVAKY  56

Query  403  GDALKIAMQFFDVQKSGKLVDNKISWRGDSGLKDGKSASLDLSKGMYDAGD  555
             DALKIAMQF D+QKSGKL++N+++WRGDSGL+DG  A+LDLSKGMYDAGD
Sbjct  57   SDALKIAMQFLDIQKSGKLMNNEVAWRGDSGLQDGSEANLDLSKGMYDAGD  107



>ref|XP_002889037.1| hypothetical protein ARALYDRAFT_895440 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH65296.1| hypothetical protein ARALYDRAFT_895440 [Arabidopsis lyrata subsp. 
lyrata]
Length=525

 Score =   101 bits (251),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 67/111 (60%), Positives = 86/111 (77%), Gaps = 2/111 (2%)
 Frame = +1

Query  223  MGDKSRSKGGWCGWLLvvivaaaigvsifvLVKKKHGGGGSSEPDaapvpgppgavTQKY  402
            MG+KS+S+G WCGW + +IV A++ +++   VK +    G       PVPGPPGA+ +KY
Sbjct  1    MGEKSKSRG-WCGWFIAIIVLASVVLAVVYTVKLRMKKSGDDG-GGGPVPGPPGAIDKKY  58

Query  403  GDALKIAMQFFDVQKSGKLVDNKISWRGDSGLKDGKSASLDLSKGMYDAGD  555
             DALK+A+QFFD+QKSGKL +NKISWRGDSGLKDG  A+LDLSKG+YDAGD
Sbjct  59   ADALKLALQFFDIQKSGKLANNKISWRGDSGLKDGSEANLDLSKGLYDAGD  109



>emb|CDY39048.1| BnaA02g17370D [Brassica napus]
Length=526

 Score =   101 bits (251),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 65/111 (59%), Positives = 84/111 (76%), Gaps = 1/111 (1%)
 Frame = +1

Query  223  MGDKSRSKGGWCGWLLvvivaaaigvsifvLVKKKHGGGGSSEPDaapvpgppgavTQKY  402
            MG++     GWCGW + +IV AA+ +++  +VK K       +  A PVPGPPGA+ +KY
Sbjct  1    MGEEKSKSRGWCGWFIALIVLAAVILAVVYMVKSKMKKSDDGD-GAGPVPGPPGAIDKKY  59

Query  403  GDALKIAMQFFDVQKSGKLVDNKISWRGDSGLKDGKSASLDLSKGMYDAGD  555
             DALK+++QFFD+QKSG+LV+NKISWRGDSGLKDG  A LDLSKG+YDAGD
Sbjct  60   ADALKLSLQFFDIQKSGRLVNNKISWRGDSGLKDGSEADLDLSKGLYDAGD  110



>ref|XP_011074667.1| PREDICTED: endoglucanase 10-like [Sesamum indicum]
Length=525

 Score =   100 bits (249),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 73/109 (67%), Positives = 84/109 (77%), Gaps = 3/109 (3%)
 Frame = +1

Query  229  DKSRSKGGWCGWLLvvivaaaigvsifvLVKKKHGGGGSSEPDaapvpgppgavTQKYGD  408
            ++ R   GWCGW LV+IV AAI  +IF  V++K      SEP AAPVPGPPGAVT+KY D
Sbjct  2    EEKRGSRGWCGWFLVLIVLAAIAFAIFYAVRQKQH---KSEPGAAPVPGPPGAVTKKYAD  58

Query  409  ALKIAMQFFDVQKSGKLVDNKISWRGDSGLKDGKSASLDLSKGMYDAGD  555
            ALK+AMQF D+QKSGKL +N I WRGDSGLKDG  A +DLSKGMYDAGD
Sbjct  59   ALKVAMQFLDIQKSGKLENNNIPWRGDSGLKDGSEAQVDLSKGMYDAGD  107



>ref|XP_010536354.1| PREDICTED: endoglucanase 10-like [Tarenaya hassleriana]
Length=524

 Score =   100 bits (249),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 70/113 (62%), Positives = 87/113 (77%), Gaps = 7/113 (6%)
 Frame = +1

Query  223  MGDKSRSKGGWCGWLLvvivaaaigvsifvLVKKK--HGGGGSSEPDaapvpgppgavTQ  396
            MG KSR +G  CGW + +IV AA+ +++   ++KK  H   G  +P    VPGPPGAV +
Sbjct  1    MGAKSRRRG-LCGWFIALIVLAAVVLAVVYTIRKKTGHSDDGGDDP----VPGPPGAVDK  55

Query  397  KYGDALKIAMQFFDVQKSGKLVDNKISWRGDSGLKDGKSASLDLSKGMYDAGD  555
            KY DAL+IA+QFFD+QKSGKL +NKISWRGDSGLKDGK A+LDLSKG+YDAGD
Sbjct  56   KYADALEIALQFFDIQKSGKLGNNKISWRGDSGLKDGKEANLDLSKGLYDAGD  108



>gb|EYU38839.1| hypothetical protein MIMGU_mgv1a004578mg [Erythranthe guttata]
Length=519

 Score =   100 bits (248),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 61/111 (55%), Positives = 72/111 (65%), Gaps = 10/111 (9%)
 Frame = +1

Query  223  MGDKSRSKGGWCGWLLvvivaaaigvsifvLVKKKHGGGGSSEPDaapvpgppgavTQKY  402
            M  + RS  G CGW LV+IV A I  ++F ++K K  G GS                +KY
Sbjct  1    MKQRKRSSSGCCGWFLVIIVLAGIAFAVFAVLKHKTWGSGSP----------ALGDPKKY  50

Query  403  GDALKIAMQFFDVQKSGKLVDNKISWRGDSGLKDGKSASLDLSKGMYDAGD  555
             DALKIAMQFFD+QKSGKL +N+I WRGDS LKDG  A +DLSKGMYDAGD
Sbjct  51   SDALKIAMQFFDIQKSGKLDENQIPWRGDSALKDGSEAKIDLSKGMYDAGD  101



>ref|XP_008221286.1| PREDICTED: endoglucanase 10-like [Prunus mume]
Length=526

 Score =   100 bits (248),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 74/111 (67%), Positives = 86/111 (77%), Gaps = 3/111 (3%)
 Frame = +1

Query  223  MGDKSRSKGGWCGWLLvvivaaaigvsifvLVKKKHGGGGSSEPDaapvpgppgavTQKY  402
            MG KSRSKG W   L++V++A  +   +  +VKKK     SS+ D  PVPGPPGA+TQKY
Sbjct  1    MGAKSRSKGCWAWLLVLVVLALVVTAIVVAIVKKK---SNSSDDDNGPVPGPPGAITQKY  57

Query  403  GDALKIAMQFFDVQKSGKLVDNKISWRGDSGLKDGKSASLDLSKGMYDAGD  555
             DALK+A+QFFD+QKSGKLVDNKISWRGDSGLKDG    LDLSKGMYDAGD
Sbjct  58   SDALKLAVQFFDIQKSGKLVDNKISWRGDSGLKDGSDEKLDLSKGMYDAGD  108



>emb|CDY43425.1| BnaC07g14920D [Brassica napus]
Length=533

 Score =   100 bits (248),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 61/116 (53%), Positives = 76/116 (66%), Gaps = 9/116 (8%)
 Frame = +1

Query  208  KGGEKMGDKSRSKGGWCGWLLvvivaaaigvsifvLVKKKHGGGGSSEPDaapvpgppga  387
            KGGEKM  KS S+   C W L +IV  A+ +++   ++ +        P         G+
Sbjct  11   KGGEKMVAKSGSRCCCCCWFLGIIVVIAVVLAVVFTIRHRANHSDDIAP---------GS  61

Query  388  vTQKYGDALKIAMQFFDVQKSGKLVDNKISWRGDSGLKDGKSASLDLSKGMYDAGD  555
              +KY DALKIAMQFF++QKSGKL +NKI WRGDSGLKDG  ASLDLSKG+YDAGD
Sbjct  62   TDKKYADALKIAMQFFNIQKSGKLENNKIPWRGDSGLKDGSEASLDLSKGLYDAGD  117



>ref|XP_010061046.1| PREDICTED: endoglucanase 10-like [Eucalyptus grandis]
 gb|KCW67943.1| hypothetical protein EUGRSUZ_F01640 [Eucalyptus grandis]
Length=528

 Score =   100 bits (248),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 74/113 (65%), Positives = 89/113 (79%), Gaps = 6/113 (5%)
 Frame = +1

Query  223  MGDKSRSKGGWCGWLLvvivaaaigvsifvLVKKK--HGGGGSSEPDaapvpgppgavTQ  396
            MG + RS GGWCGWLLV+++ A +  ++ V VKK+  HGGGG    +AAPVPGPPGAV +
Sbjct  1    MGAEKRS-GGWCGWLLVLLILAVVAAAVVVTVKKRSGHGGGGD---EAAPVPGPPGAVQK  56

Query  397  KYGDALKIAMQFFDVQKSGKLVDNKISWRGDSGLKDGKSASLDLSKGMYDAGD  555
            KY DALK+A QFFD+QKSGKL DN ISWRG+S LKDG  A +DLSKGM+DAGD
Sbjct  57   KYADALKLATQFFDIQKSGKLEDNPISWRGNSALKDGSDADIDLSKGMFDAGD  109



>ref|XP_002276739.1| PREDICTED: endoglucanase 10 [Vitis vinifera]
 emb|CBI19843.3| unnamed protein product [Vitis vinifera]
Length=525

 Score =   100 bits (248),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 66/111 (59%), Positives = 84/111 (76%), Gaps = 5/111 (5%)
 Frame = +1

Query  223  MGDKSRSKGGWCGWLLvvivaaaigvsifvLVKKKHGGGGSSEPDaapvpgppgavTQKY  402
            MG +S+SKG WCGW +V++VAA +   I + ++K+      + P    VPGPPGA+ +KY
Sbjct  1    MGQRSKSKG-WCGWFIVLVVAALVAAVIVISIRKRSDHSDKAAP----VPGPPGAIDKKY  55

Query  403  GDALKIAMQFFDVQKSGKLVDNKISWRGDSGLKDGKSASLDLSKGMYDAGD  555
             DALK+AMQFFD+QKSGKL +NKISWRG+S L+DG  A LDLSKGMYDAGD
Sbjct  56   SDALKLAMQFFDIQKSGKLENNKISWRGNSALQDGSEAKLDLSKGMYDAGD  106



>emb|CDY13546.1| BnaC02g23570D [Brassica napus]
Length=422

 Score = 98.6 bits (244),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 65/111 (59%), Positives = 83/111 (75%), Gaps = 1/111 (1%)
 Frame = +1

Query  223  MGDKSRSKGGWCGWLLvvivaaaigvsifvLVKKKHGGGGSSEPDaapvpgppgavTQKY  402
            MG++     G CGW + +IV  A+ +++  +VK K       +  A PVPGPPGA+ +KY
Sbjct  1    MGEEKSKSRGRCGWFIALIVLTAVILAVVYMVKSKMKKSDDGD-GAGPVPGPPGAIDKKY  59

Query  403  GDALKIAMQFFDVQKSGKLVDNKISWRGDSGLKDGKSASLDLSKGMYDAGD  555
             DALK+++QFFD+QKSGKLVDNKISWRGDSGLKDG  A+LDLSKG+YDAGD
Sbjct  60   ADALKLSLQFFDIQKSGKLVDNKISWRGDSGLKDGSEANLDLSKGLYDAGD  110



>gb|KFK44119.1| hypothetical protein AALP_AA1G218000 [Arabis alpina]
Length=517

 Score = 99.0 bits (245),  Expect = 9e-21, Method: Compositional matrix adjust.
 Identities = 47/54 (87%), Positives = 51/54 (94%), Gaps = 0/54 (0%)
 Frame = +1

Query  394  QKYGDALKIAMQFFDVQKSGKLVDNKISWRGDSGLKDGKSASLDLSKGMYDAGD  555
            +KY DALKIAMQFFD+QKSGKLV+NKISWRGDSGLKDG  ASLDLSKG+YDAGD
Sbjct  48   KKYSDALKIAMQFFDIQKSGKLVNNKISWRGDSGLKDGSEASLDLSKGLYDAGD  101



>ref|XP_006390284.1| hypothetical protein EUTSA_v10018397mg [Eutrema salsugineum]
 gb|ESQ27570.1| hypothetical protein EUTSA_v10018397mg [Eutrema salsugineum]
Length=524

 Score = 99.0 bits (245),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 70/111 (63%), Positives = 88/111 (79%), Gaps = 3/111 (3%)
 Frame = +1

Query  223  MGDKSRSKGGWCGWLLvvivaaaigvsifvLVKKKHGGGGSSEPDaapvpgppgavTQKY  402
            MG+KS+S+G WCGWL+ +IV AA+ +++   VK +     S +  A PVPGPPGA+ +KY
Sbjct  1    MGEKSKSRG-WCGWLIAIIVLAAVVLAVVYTVKSRMKK--SDDDGAGPVPGPPGAIDKKY  57

Query  403  GDALKIAMQFFDVQKSGKLVDNKISWRGDSGLKDGKSASLDLSKGMYDAGD  555
             DALKIA+QFFD+QKSGKL  NK+SWRGDSGLKDG  A+LDLSKG+YDAGD
Sbjct  58   ADALKIALQFFDIQKSGKLEKNKLSWRGDSGLKDGSEANLDLSKGLYDAGD  108



>emb|CDX73186.1| BnaC06g36340D [Brassica napus]
Length=527

 Score = 99.0 bits (245),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 61/112 (54%), Positives = 82/112 (73%), Gaps = 2/112 (2%)
 Frame = +1

Query  223  MGDKSRSKGGWCGWLLvvivaaaigvsifvLVKKKHGGGGSSEPDaapvpgppg-avTQK  399
            MG+KS+S+G + GW + +IV AA+ +++  +VK K      ++ D A     P  A+ +K
Sbjct  1    MGEKSKSRGCF-GWFIALIVLAAVILAVVYMVKSKMNKSDDNDDDEAGPVPGPPGAIDKK  59

Query  400  YGDALKIAMQFFDVQKSGKLVDNKISWRGDSGLKDGKSASLDLSKGMYDAGD  555
            Y DALK+A+QFFD+QKSGKLV+N I WRGDSGLKDG  A+LDLSKG+YDAGD
Sbjct  60   YADALKLALQFFDIQKSGKLVNNTIPWRGDSGLKDGSEANLDLSKGLYDAGD  111



>ref|XP_008387935.1| PREDICTED: endoglucanase 2 [Malus domestica]
Length=526

 Score = 99.0 bits (245),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 48/55 (87%), Positives = 50/55 (91%), Gaps = 0/55 (0%)
 Frame = +1

Query  391  TQKYGDALKIAMQFFDVQKSGKLVDNKISWRGDSGLKDGKSASLDLSKGMYDAGD  555
            TQKY  ALK+A+QFFDVQKSGKLVDNKISWRGDSGLKDG  A LDLSKGMYDAGD
Sbjct  54   TQKYSAALKVAVQFFDVQKSGKLVDNKISWRGDSGLKDGSDAKLDLSKGMYDAGD  108



>dbj|BAF42037.1| cellulase2 [Pyrus communis]
Length=526

 Score = 99.0 bits (245),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 72/115 (63%), Positives = 82/115 (71%), Gaps = 11/115 (10%)
 Frame = +1

Query  223  MGDKSRSKGGWCGWLLvvi----vaaaigvsifvLVKKKHGGGGSSEPDaapvpgppgav  390
            MG KSR KG W  WLLV+     V  A+ +++   VKK  GG   + P      GPPGA+
Sbjct  1    MGAKSRCKG-WWAWLLVLAIFGLVVGAVVLAVVKKVKKNSGGDDGAVP------GPPGAI  53

Query  391  TQKYGDALKIAMQFFDVQKSGKLVDNKISWRGDSGLKDGKSASLDLSKGMYDAGD  555
            TQKY DALK+A+QFFDVQKSG+LVDNKISWRGDSGLKDG    LDLSKGMYDAGD
Sbjct  54   TQKYSDALKLAVQFFDVQKSGQLVDNKISWRGDSGLKDGSDVRLDLSKGMYDAGD  108



>ref|XP_010459672.1| PREDICTED: endoglucanase 2 [Camelina sativa]
 ref|XP_010459674.1| PREDICTED: endoglucanase 2 [Camelina sativa]
Length=518

 Score = 98.2 bits (243),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 57/111 (51%), Positives = 76/111 (68%), Gaps = 9/111 (8%)
 Frame = +1

Query  223  MGDKSRSKGGWCGWLLvvivaaaigvsifvLVKKKHGGGGSSEPDaapvpgppgavTQKY  402
            M  K +S+   C WL+ +IV  A+ +++ +  + +    G  +P         G++ +KY
Sbjct  1    MVAKPKSRCCCCTWLIGIIVLIAVILAVVLTFRHRSNHSGDDQP---------GSIDKKY  51

Query  403  GDALKIAMQFFDVQKSGKLVDNKISWRGDSGLKDGKSASLDLSKGMYDAGD  555
             DALKIAMQFFD+QKSGKL +NKISWRGDSGLKDG  AS+DLSKG+YDAGD
Sbjct  52   ADALKIAMQFFDIQKSGKLENNKISWRGDSGLKDGSEASIDLSKGLYDAGD  102



>gb|AAM63477.1| endo-beta-1,4-glucanase, putative [Arabidopsis thaliana]
Length=525

 Score = 97.8 bits (242),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 64/111 (58%), Positives = 84/111 (76%), Gaps = 2/111 (2%)
 Frame = +1

Query  223  MGDKSRSKGGWCGWLLvvivaaaigvsifvLVKKKHGGGGSSEPDaapvpgppgavTQKY  402
            M +KS+S+G WCGW + +IV A++ +++   VK +    G  +    PVPGPPGA+ +KY
Sbjct  1    MEEKSKSRG-WCGWFIAIIVLASVILAVVYTVKLRTKKSGDDD-GGCPVPGPPGAIDKKY  58

Query  403  GDALKIAMQFFDVQKSGKLVDNKISWRGDSGLKDGKSASLDLSKGMYDAGD  555
             DALK+A+QFFD+QKSGKL +NKI WRGDSGLKDG   +LDLSKG+YDAGD
Sbjct  59   ADALKLALQFFDIQKSGKLENNKIPWRGDSGLKDGSEDNLDLSKGLYDAGD  109



>ref|XP_010501531.1| PREDICTED: endoglucanase 2 [Camelina sativa]
Length=517

 Score = 97.8 bits (242),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 58/111 (52%), Positives = 74/111 (67%), Gaps = 9/111 (8%)
 Frame = +1

Query  223  MGDKSRSKGGWCGWLLvvivaaaigvsifvLVKKKHGGGGSSEPDaapvpgppgavTQKY  402
            M  K RS+   C W + +IV  A+ +++ +  K +       +P         G++ +KY
Sbjct  1    MVAKPRSRCCCCTWFIGIIVLIAVILAVVLTFKHRSNHSDDDQP---------GSIDKKY  51

Query  403  GDALKIAMQFFDVQKSGKLVDNKISWRGDSGLKDGKSASLDLSKGMYDAGD  555
             DALKIAMQFFD+QKSGKL +NKISWRGDSGLKDG  ASLDLSKG+YDAGD
Sbjct  52   ADALKIAMQFFDIQKSGKLENNKISWRGDSGLKDGSEASLDLSKGLYDAGD  102



>ref|XP_010649048.1| PREDICTED: endoglucanase 24-like [Vitis vinifera]
 emb|CBI17386.3| unnamed protein product [Vitis vinifera]
Length=526

 Score = 96.7 bits (239),  Expect = 6e-20, Method: Compositional matrix adjust.
 Identities = 56/112 (50%), Positives = 70/112 (63%), Gaps = 7/112 (6%)
 Frame = +1

Query  223  MGDKSRSKGGWCGWLLvvivaaaigvsifvLVKKK-HGGGGSSEPDaapvpgppgavTQK  399
            M  + +   GWC W+LV+ +AA +  S  + +         SS PD            + 
Sbjct  1    METEPKKSKGWCWWILVLAIAAMVVASATLTIWSNGRHSKVSSVPDRPGKI------AEN  54

Query  400  YGDALKIAMQFFDVQKSGKLVDNKISWRGDSGLKDGKSASLDLSKGMYDAGD  555
            Y DALKIA+QFFD+QKSGKLV+NKI WRGDSGL+DG+   LDLSKGMYDAGD
Sbjct  55   YADALKIAIQFFDIQKSGKLVNNKIDWRGDSGLEDGREEMLDLSKGMYDAGD  106



>ref|XP_009106216.1| PREDICTED: endoglucanase 10-like [Brassica rapa]
Length=527

 Score = 96.3 bits (238),  Expect = 9e-20, Method: Compositional matrix adjust.
 Identities = 60/112 (54%), Positives = 82/112 (73%), Gaps = 2/112 (2%)
 Frame = +1

Query  223  MGDKSRSKGGWCGWLLvvivaaaigvsifvLVKKKHGGGGSSEPDaapvpgppg-avTQK  399
            MG+KS+S+G + GW + +IV AA+ +++  +VK K      ++ + A     P  A+ +K
Sbjct  1    MGEKSKSRGCF-GWFIALIVLAAVILAVVYMVKSKMKKPDDNDDNEAGPVPGPPGAIDKK  59

Query  400  YGDALKIAMQFFDVQKSGKLVDNKISWRGDSGLKDGKSASLDLSKGMYDAGD  555
            Y DALK+A+QFFD+QKSGKLV+N I WRGDSGLKDG  A+LDLSKG+YDAGD
Sbjct  60   YADALKLALQFFDIQKSGKLVNNTIPWRGDSGLKDGSEANLDLSKGLYDAGD  111



>ref|XP_010477219.1| PREDICTED: endoglucanase 2-like [Camelina sativa]
Length=517

 Score = 96.3 bits (238),  Expect = 9e-20, Method: Compositional matrix adjust.
 Identities = 45/54 (83%), Positives = 50/54 (93%), Gaps = 0/54 (0%)
 Frame = +1

Query  394  QKYGDALKIAMQFFDVQKSGKLVDNKISWRGDSGLKDGKSASLDLSKGMYDAGD  555
            +KY DALKIAMQFFD+QKSGKL +NKISWRGDSGLKDG  AS+DLSKG+YDAGD
Sbjct  49   KKYADALKIAMQFFDIQKSGKLENNKISWRGDSGLKDGSEASIDLSKGLYDAGD  102



>ref|XP_002510516.1| endo-1,4-beta-glucanase, putative [Ricinus communis]
 gb|EEF52703.1| endo-1,4-beta-glucanase, putative [Ricinus communis]
Length=523

 Score = 96.3 bits (238),  Expect = 9e-20, Method: Compositional matrix adjust.
 Identities = 70/111 (63%), Positives = 81/111 (73%), Gaps = 5/111 (5%)
 Frame = +1

Query  223  MGDKSRSKGGWCGWLLvvivaaaigvsifvLVKKKHGGGGSSEPDaapvpgppgavTQKY  402
            MG+KSRS+G +CGW +V +V   + V++   VKKK    G + P    VPGPPGAV +KY
Sbjct  1    MGEKSRSRG-FCGWFIVAVVLTIVVVAVVYTVKKKTHNSGDASP----VPGPPGAVEKKY  55

Query  403  GDALKIAMQFFDVQKSGKLVDNKISWRGDSGLKDGKSASLDLSKGMYDAGD  555
             DAL IAMQFFD+QKSGKLVDN ISWRGDS L DG  A  DLSKGMYDAGD
Sbjct  56   ADALNIAMQFFDIQKSGKLVDNGISWRGDSALDDGNEAKRDLSKGMYDAGD  106



>ref|XP_004291374.1| PREDICTED: endoglucanase 10-like [Fragaria vesca subsp. vesca]
Length=529

 Score = 96.3 bits (238),  Expect = 9e-20, Method: Compositional matrix adjust.
 Identities = 67/113 (59%), Positives = 76/113 (67%), Gaps = 6/113 (5%)
 Frame = +1

Query  223  MGDKSRSKG-GWCGWLLvvivaaaig-vsifvLVKKKHGGGGSSEPDaapvpgppgavTQ  396
            MG K  SKG  W  W +V +V A I      V++KKK     +  P      GPPGAV  
Sbjct  1    MGAKQDSKGCKWLSWFIVFVVLAVIAGAVALVMIKKKQNDKDNEVP----TMGPPGAVVD  56

Query  397  KYGDALKIAMQFFDVQKSGKLVDNKISWRGDSGLKDGKSASLDLSKGMYDAGD  555
            KY DALK AMQFFD+QKSGKLV+NKISWRGDSGLKDG+   +DLSKGMYDAGD
Sbjct  57   KYSDALKTAMQFFDIQKSGKLVNNKISWRGDSGLKDGEDVKVDLSKGMYDAGD  109



>ref|XP_006473639.1| PREDICTED: endoglucanase 10-like [Citrus sinensis]
Length=524

 Score = 95.9 bits (237),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 62/112 (55%), Positives = 78/112 (70%), Gaps = 7/112 (6%)
 Frame = +1

Query  223  MGDKSRSKGGWCGWLLvvivaaaigvsifvLVKKKHGGGGSSEPDaapvpgppgavTQK-  399
            MG+KS+SKG + GW LV+++ A +  +I   +KKK     +S  D       P    +K 
Sbjct  1    MGEKSKSKGCF-GWFLVLVLLALVVGAIVYTIKKK-----TSHSDKPAPVPGPPGAVEKK  54

Query  400  YGDALKIAMQFFDVQKSGKLVDNKISWRGDSGLKDGKSASLDLSKGMYDAGD  555
            Y +ALK+AMQFFDVQKSGKLV+NKISWRGDS LKDG+   LDL+KGMYDAGD
Sbjct  55   YAEALKVAMQFFDVQKSGKLVNNKISWRGDSALKDGRDMGLDLTKGMYDAGD  106



>gb|KDO84820.1| hypothetical protein CISIN_1g009846mg [Citrus sinensis]
Length=524

 Score = 95.9 bits (237),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 62/112 (55%), Positives = 78/112 (70%), Gaps = 7/112 (6%)
 Frame = +1

Query  223  MGDKSRSKGGWCGWLLvvivaaaigvsifvLVKKKHGGGGSSEPDaapvpgppgavTQK-  399
            MG+KS+SKG + GW LV+++ A +  +I   +KKK     +S  D       P    +K 
Sbjct  1    MGEKSKSKGCF-GWFLVLVLLALVVGAIVYTIKKK-----TSHSDKPAPVPGPPGAVEKK  54

Query  400  YGDALKIAMQFFDVQKSGKLVDNKISWRGDSGLKDGKSASLDLSKGMYDAGD  555
            Y +ALK+AMQFFDVQKSGKLV+NKISWRGDS LKDG+   LDL+KGMYDAGD
Sbjct  55   YAEALKVAMQFFDVQKSGKLVNNKISWRGDSALKDGRDMGLDLTKGMYDAGD  106



>ref|XP_006435157.1| hypothetical protein CICLE_v10000849mg [Citrus clementina]
 gb|ESR48397.1| hypothetical protein CICLE_v10000849mg [Citrus clementina]
Length=524

 Score = 95.9 bits (237),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 62/112 (55%), Positives = 78/112 (70%), Gaps = 7/112 (6%)
 Frame = +1

Query  223  MGDKSRSKGGWCGWLLvvivaaaigvsifvLVKKKHGGGGSSEPDaapvpgppgavTQK-  399
            MG+KS+SKG + GW LV+++ A +  +I   +KKK     +S  D       P    +K 
Sbjct  1    MGEKSKSKGCF-GWFLVLVLLALVVGAIVYTIKKK-----TSHSDKPAPVPGPPGAVEKK  54

Query  400  YGDALKIAMQFFDVQKSGKLVDNKISWRGDSGLKDGKSASLDLSKGMYDAGD  555
            Y +ALK+AMQFFDVQKSGKLV+NKISWRGDS LKDG+   LDL+KGMYDAGD
Sbjct  55   YAEALKVAMQFFDVQKSGKLVNNKISWRGDSALKDGRDMGLDLTKGMYDAGD  106



>gb|AFZ78647.1| korrigan [Populus tomentosa]
Length=523

 Score = 95.9 bits (237),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 45/54 (83%), Positives = 48/54 (89%), Gaps = 0/54 (0%)
 Frame = +1

Query  394  QKYGDALKIAMQFFDVQKSGKLVDNKISWRGDSGLKDGKSASLDLSKGMYDAGD  555
            +KY DALKIA QFFD+QKSGKLVDNKISWRGDS L+DG  A LDLSKGMYDAGD
Sbjct  53   KKYADALKIATQFFDIQKSGKLVDNKISWRGDSALRDGSQAKLDLSKGMYDAGD  106



>ref|XP_004957464.1| PREDICTED: endoglucanase 24-like [Setaria italica]
Length=528

 Score = 95.9 bits (237),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 62/107 (58%), Positives = 75/107 (70%), Gaps = 0/107 (0%)
 Frame = +1

Query  235  SRSKGGWCGWLLvvivaaaigvsifvLVKKKHGGGGSSEPDaapvpgppgavTQKYGDAL  414
            S+   G CGWL+V ++AA +  +    + K+  GGG       PVPGPPGA+  KYGDAL
Sbjct  3    SKYTRGCCGWLIVALIAALVATAAMFAIMKRKPGGGGKHLKPLPVPGPPGAIDSKYGDAL  62

Query  415  KIAMQFFDVQKSGKLVDNKISWRGDSGLKDGKSASLDLSKGMYDAGD  555
             +A+QFF VQKSGKL +N+I WRGDS L DGK A LDLSKGMYDAGD
Sbjct  63   GVALQFFQVQKSGKLENNQIPWRGDSALTDGKEAGLDLSKGMYDAGD  109



>ref|XP_011045112.1| PREDICTED: endoglucanase 2 [Populus euphratica]
Length=523

 Score = 95.9 bits (237),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 45/54 (83%), Positives = 48/54 (89%), Gaps = 0/54 (0%)
 Frame = +1

Query  394  QKYGDALKIAMQFFDVQKSGKLVDNKISWRGDSGLKDGKSASLDLSKGMYDAGD  555
            +KY DALKIA QFFD+QKSGKLVDNKISWRGDS L+DG  A LDLSKGMYDAGD
Sbjct  53   KKYADALKIATQFFDIQKSGKLVDNKISWRGDSALRDGSQAKLDLSKGMYDAGD  106



>ref|XP_006416450.1| hypothetical protein EUTSA_v10007364mg [Eutrema salsugineum]
 gb|ESQ34803.1| hypothetical protein EUTSA_v10007364mg [Eutrema salsugineum]
Length=523

 Score = 95.5 bits (236),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 45/54 (83%), Positives = 49/54 (91%), Gaps = 0/54 (0%)
 Frame = +1

Query  394  QKYGDALKIAMQFFDVQKSGKLVDNKISWRGDSGLKDGKSASLDLSKGMYDAGD  555
            +KY DALKIAMQFFD+QKSGKL +NKI WRGDSGLKDG  ASLDLSKG+YDAGD
Sbjct  54   KKYADALKIAMQFFDIQKSGKLENNKIPWRGDSGLKDGNEASLDLSKGLYDAGD  107



>ref|XP_007046716.1| EG [Theobroma cacao]
 gb|EOX90873.1| EG [Theobroma cacao]
Length=527

 Score = 95.5 bits (236),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 43/55 (78%), Positives = 51/55 (93%), Gaps = 0/55 (0%)
 Frame = +1

Query  391  TQKYGDALKIAMQFFDVQKSGKLVDNKISWRGDSGLKDGKSASLDLSKGMYDAGD  555
            ++KY DAL+IA+QFFD+QKSGKLVDN+ISWRGDSGL+DG   +LDLSKGMYDAGD
Sbjct  53   SKKYADALEIALQFFDIQKSGKLVDNRISWRGDSGLQDGSEGNLDLSKGMYDAGD  107



>emb|CDY29381.1| BnaA06g14150D [Brassica napus]
Length=548

 Score = 95.5 bits (236),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 58/111 (52%), Positives = 76/111 (68%), Gaps = 2/111 (2%)
 Frame = +1

Query  223  MGDKSRSKGGWCGWLLvvivaaaigvsifvLVKKKHGGGGSSEPDaapvpgppgavTQKY  402
            MG+KS S+   C W + +IV  A+ ++I   ++  H        D A +   PG++ + Y
Sbjct  1    MGEKSSSRCCCCIWFIGIIVLIAVVLAIVFTIR--HNKSNKHPDDGADIVPLPGSIDKNY  58

Query  403  GDALKIAMQFFDVQKSGKLVDNKISWRGDSGLKDGKSASLDLSKGMYDAGD  555
             DALKIAMQFFD+QKSGKL +NKI+WRGDSGL+DG  A LDLSKG+YDAGD
Sbjct  59   ADALKIAMQFFDIQKSGKLENNKITWRGDSGLEDGSEAGLDLSKGLYDAGD  109



>gb|EEC84946.1| hypothetical protein OsI_32163 [Oryza sativa Indica Group]
Length=528

 Score = 95.1 bits (235),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 65/112 (58%), Positives = 81/112 (72%), Gaps = 4/112 (4%)
 Frame = +1

Query  223  MGDKSRSKGGWCGWLLvvivaa-aigvsifvLVKKKHGGGGSSEPDaapvpgppgavTQK  399
            MG K++   G CGWL+V +VA+     ++  ++KKK GGG   +    PVPGPPGA+  K
Sbjct  1    MGSKTK---GCCGWLIVALVASLVATAAVVAIMKKKAGGGSGRKLKPLPVPGPPGAIDSK  57

Query  400  YGDALKIAMQFFDVQKSGKLVDNKISWRGDSGLKDGKSASLDLSKGMYDAGD  555
            YGDAL +A+QFF VQK+GKL +N+I WRGDS L DGK A LDLSKGMYDAGD
Sbjct  58   YGDALGVALQFFQVQKAGKLENNQIPWRGDSALDDGKPAGLDLSKGMYDAGD  109



>ref|NP_177697.1| glycosyl hydrolase 9B7 [Arabidopsis thaliana]
 sp|Q8LCP6.2|GUN10_ARATH RecName: Full=Endoglucanase 10; AltName: Full=Endo-1,4-beta glucanase 
10; Flags: Precursor [Arabidopsis thaliana]
 gb|AAF87112.1|AC006434_8 F10A5.13 [Arabidopsis thaliana]
 gb|AAK64042.1| putative endo-beta-1,4-glucanase [Arabidopsis thaliana]
 gb|AAN12892.1| putative endo-beta-1,4-glucanase [Arabidopsis thaliana]
 gb|AEE35745.1| glycosyl hydrolase 9B7 [Arabidopsis thaliana]
Length=525

 Score = 95.1 bits (235),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 64/111 (58%), Positives = 84/111 (76%), Gaps = 2/111 (2%)
 Frame = +1

Query  223  MGDKSRSKGGWCGWLLvvivaaaigvsifvLVKKKHGGGGSSEPDaapvpgppgavTQKY  402
            M +KS+S+G WCGW + +IV A++ +++   VK +    G  +    PVPGPPGA+ +KY
Sbjct  1    MEEKSKSRG-WCGWFIAIIVLASVILAVVYTVKLRTKKSGDDD-GGGPVPGPPGAIDKKY  58

Query  403  GDALKIAMQFFDVQKSGKLVDNKISWRGDSGLKDGKSASLDLSKGMYDAGD  555
             DALK+A+QFFD+QKSGKL +NKI WRGDSGLKDG   +LDLSKG+YDAGD
Sbjct  59   ADALKLALQFFDIQKSGKLENNKIPWRGDSGLKDGSEDNLDLSKGLYDAGD  109



>emb|CDP04112.1| unnamed protein product [Coffea canephora]
Length=373

 Score = 93.2 bits (230),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 42/54 (78%), Positives = 50/54 (93%), Gaps = 0/54 (0%)
 Frame = +1

Query  394  QKYGDALKIAMQFFDVQKSGKLVDNKISWRGDSGLKDGKSASLDLSKGMYDAGD  555
            +KY +AL +AMQFF+VQKSGKLVDNKI+WRGDSGL+DG+  +LDLSKGMYDAGD
Sbjct  59   EKYANALGVAMQFFEVQKSGKLVDNKIAWRGDSGLQDGREENLDLSKGMYDAGD  112



>gb|KJB14408.1| hypothetical protein B456_002G123700 [Gossypium raimondii]
Length=529

 Score = 94.7 bits (234),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 67/111 (60%), Positives = 84/111 (76%), Gaps = 3/111 (3%)
 Frame = +1

Query  223  MGDKSRSKGGWCGWLLvvivaaaigvsifvLVKKKHGGGGSSEPDaapvpgppgavTQKY  402
            MG +S+S+G + GWLLV+++ A +  ++  ++KKK   G  ++P   PVPGPPGA+  KY
Sbjct  1    MGKESKSRG-FFGWLLVLVILALVVGAVVYIIKKKLDHGNDNKP--TPVPGPPGAIDHKY  57

Query  403  GDALKIAMQFFDVQKSGKLVDNKISWRGDSGLKDGKSASLDLSKGMYDAGD  555
              AL+IAMQFFDVQKSG+LVDNKISWRGDS L DG  A LDLSKGMY AGD
Sbjct  58   AYALEIAMQFFDVQKSGRLVDNKISWRGDSALTDGSEAKLDLSKGMYVAGD  108



>ref|NP_001063771.1| Os09g0533900 [Oryza sativa Japonica Group]
 sp|Q69SG5.1|GUN24_ORYSJ RecName: Full=Endoglucanase 24; AltName: Full=Endo-1,4-beta glucanase 
24; Flags: Precursor [Oryza sativa Japonica Group]
 dbj|BAD33331.1| putative cellulase [Oryza sativa Japonica Group]
 dbj|BAF25685.1| Os09g0533900 [Oryza sativa Japonica Group]
 dbj|BAG94612.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|AGW30395.1| cellulase [Oryza sativa]
Length=528

 Score = 94.7 bits (234),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 65/112 (58%), Positives = 81/112 (72%), Gaps = 4/112 (4%)
 Frame = +1

Query  223  MGDKSRSKGGWCGWLLvvivaa-aigvsifvLVKKKHGGGGSSEPDaapvpgppgavTQK  399
            MG K++   G CGWL+V +VA+     ++  ++KKK GGG   +    PVPGPPGA+  K
Sbjct  1    MGSKTK---GCCGWLIVALVASLVATAAVVAIMKKKVGGGSGRKLKPLPVPGPPGAIDSK  57

Query  400  YGDALKIAMQFFDVQKSGKLVDNKISWRGDSGLKDGKSASLDLSKGMYDAGD  555
            YGDAL +A+QFF VQK+GKL +N+I WRGDS L DGK A LDLSKGMYDAGD
Sbjct  58   YGDALGVALQFFQVQKAGKLENNQIPWRGDSALDDGKPAGLDLSKGMYDAGD  109



>gb|EEE70113.1| hypothetical protein OsJ_30126 [Oryza sativa Japonica Group]
Length=528

 Score = 94.4 bits (233),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 65/112 (58%), Positives = 81/112 (72%), Gaps = 4/112 (4%)
 Frame = +1

Query  223  MGDKSRSKGGWCGWLLvvivaaaigvsi-fvLVKKKHGGGGSSEPDaapvpgppgavTQK  399
            MG K++   G CGWL+V +VA+ +  +    ++KKK GGG   +    PVPGPPGA+  K
Sbjct  1    MGSKTK---GCCGWLIVALVASLVATAALVAIMKKKVGGGSGRKLKPLPVPGPPGAIDSK  57

Query  400  YGDALKIAMQFFDVQKSGKLVDNKISWRGDSGLKDGKSASLDLSKGMYDAGD  555
            YGDAL +A+QFF VQK+GKL +N+I WRGDS L DGK A LDLSKGMYDAGD
Sbjct  58   YGDALGVALQFFQVQKAGKLENNQIPWRGDSALDDGKPAGLDLSKGMYDAGD  109



>ref|XP_006307252.1| hypothetical protein CARUB_v10008868mg [Capsella rubella]
 gb|EOA40150.1| hypothetical protein CARUB_v10008868mg [Capsella rubella]
Length=517

 Score = 94.4 bits (233),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 44/54 (81%), Positives = 50/54 (93%), Gaps = 0/54 (0%)
 Frame = +1

Query  394  QKYGDALKIAMQFFDVQKSGKLVDNKISWRGDSGLKDGKSASLDLSKGMYDAGD  555
            +KY DALKIA+QFFD+QKSGKL +NKISWRGDSGLKDG  AS+DLSKG+YDAGD
Sbjct  48   KKYADALKIALQFFDIQKSGKLENNKISWRGDSGLKDGSDASIDLSKGLYDAGD  101



>ref|XP_011083520.1| PREDICTED: endoglucanase 10 [Sesamum indicum]
Length=518

 Score = 94.4 bits (233),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 60/113 (53%), Positives = 70/113 (62%), Gaps = 15/113 (13%)
 Frame = +1

Query  223  MGDKSRSKGGWCGW--LLvvivaaaigvsifvLVKKKHGGGGSSEPDaapvpgppgavTQ  396
            M  K +SKG  C W  L +V++A    + + V+VK   G G    P             +
Sbjct  1    MRQKKKSKGV-CCWSMLALVVLAIVAVILLVVMVKTDEGSGSPGAP------------VK  47

Query  397  KYGDALKIAMQFFDVQKSGKLVDNKISWRGDSGLKDGKSASLDLSKGMYDAGD  555
            KY DALK+AMQFFDVQKSGKL  N+I WRGDSGLKDG  A LDLSKGMYDAGD
Sbjct  48   KYADALKLAMQFFDVQKSGKLEKNQIDWRGDSGLKDGSEAKLDLSKGMYDAGD  100



>gb|KHN21266.1| Endoglucanase 24 [Glycine soja]
Length=185

 Score = 90.5 bits (223),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 44/54 (81%), Positives = 47/54 (87%), Gaps = 0/54 (0%)
 Frame = +1

Query  394  QKYGDALKIAMQFFDVQKSGKLVDNKISWRGDSGLKDGKSASLDLSKGMYDAGD  555
            QKY  ALK AMQFFDVQKSG+LVD+KISWRG+S LKDG  A LDLSKGMYDAGD
Sbjct  66   QKYRTALKTAMQFFDVQKSGRLVDSKISWRGNSALKDGSQAKLDLSKGMYDAGD  119



>ref|XP_011100152.1| PREDICTED: endoglucanase 24-like [Sesamum indicum]
Length=528

 Score = 94.0 bits (232),  Expect = 7e-19, Method: Compositional matrix adjust.
 Identities = 43/55 (78%), Positives = 50/55 (91%), Gaps = 0/55 (0%)
 Frame = +1

Query  391  TQKYGDALKIAMQFFDVQKSGKLVDNKISWRGDSGLKDGKSASLDLSKGMYDAGD  555
             +KY DAL IA+QFFDVQKSGKLV N+ISWRGDSGL+DG+ A+LDLSKG+YDAGD
Sbjct  55   VEKYSDALAIALQFFDVQKSGKLVKNRISWRGDSGLEDGQDANLDLSKGLYDAGD  109



>gb|KJB43353.1| hypothetical protein B456_007G195700, partial [Gossypium raimondii]
Length=521

 Score = 93.6 bits (231),  Expect = 8e-19, Method: Compositional matrix adjust.
 Identities = 42/54 (78%), Positives = 49/54 (91%), Gaps = 0/54 (0%)
 Frame = +1

Query  394  QKYGDALKIAMQFFDVQKSGKLVDNKISWRGDSGLKDGKSASLDLSKGMYDAGD  555
            +KY DAL++A+QFFDVQKSGKLVDN+I WRGDSGL+DG   +LDLSKGMYDAGD
Sbjct  55   KKYADALELALQFFDVQKSGKLVDNRIPWRGDSGLQDGSEENLDLSKGMYDAGD  108



>gb|KDP36939.1| hypothetical protein JCGZ_08230 [Jatropha curcas]
Length=523

 Score = 93.6 bits (231),  Expect = 8e-19, Method: Compositional matrix adjust.
 Identities = 69/112 (62%), Positives = 81/112 (72%), Gaps = 7/112 (6%)
 Frame = +1

Query  223  MGDKSRSKGGWCGWLLvvivaaaigvsifvLVKKK-HGGGGSSEPDaapvpgppgavTQK  399
            MG KSRS+G + GW +V IV A +  ++   VKKK H        DA  VPGPPGA+ +K
Sbjct  1    MGKKSRSRGCF-GWFIVAIVLAVVVAAVVYTVKKKIHKSD-----DAGAVPGPPGAIDKK  54

Query  400  YGDALKIAMQFFDVQKSGKLVDNKISWRGDSGLKDGKSASLDLSKGMYDAGD  555
            Y DALK+AMQFFDVQKSG L DN+ISWRGDSG+ DG  A +DLSKGMYDAGD
Sbjct  55   YADALKVAMQFFDVQKSGNLEDNEISWRGDSGINDGSQAKVDLSKGMYDAGD  106



>gb|AAF79918.1|AC022472_27 Contains similarity to beta-1,4-glucanase 1 (EG1) from Mastotermes 
darwiniensis gb|AF220593 and is a member of glycosyl hydrolase 
family 9 PF|00759. This gene may be cut off, partial 
[Arabidopsis thaliana]
Length=300

 Score = 91.3 bits (225),  Expect = 9e-19, Method: Compositional matrix adjust.
 Identities = 42/54 (78%), Positives = 49/54 (91%), Gaps = 0/54 (0%)
 Frame = +1

Query  394  QKYGDALKIAMQFFDVQKSGKLVDNKISWRGDSGLKDGKSASLDLSKGMYDAGD  555
            + Y +ALKIAMQFFD+QKSGKL +N+ISWRGDSGLKDG  AS+DLSKG+YDAGD
Sbjct  47   KNYANALKIAMQFFDIQKSGKLENNEISWRGDSGLKDGSEASIDLSKGLYDAGD  100



>gb|KJB63540.1| hypothetical protein B456_010G005200 [Gossypium raimondii]
Length=525

 Score = 93.2 bits (230),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 45/53 (85%), Positives = 47/53 (89%), Gaps = 0/53 (0%)
 Frame = +1

Query  397  KYGDALKIAMQFFDVQKSGKLVDNKISWRGDSGLKDGKSASLDLSKGMYDAGD  555
            KY DALKIAMQFFDVQKSGKLVD+KI WRG+SGLKDG  A LDLS GMYDAGD
Sbjct  53   KYSDALKIAMQFFDVQKSGKLVDDKIPWRGNSGLKDGSEAKLDLSMGMYDAGD  105



>gb|AID55379.1| glycoside hydrolase family 9 B7 [Gossypium hirsutum]
Length=525

 Score = 93.2 bits (230),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 45/53 (85%), Positives = 47/53 (89%), Gaps = 0/53 (0%)
 Frame = +1

Query  397  KYGDALKIAMQFFDVQKSGKLVDNKISWRGDSGLKDGKSASLDLSKGMYDAGD  555
            KY DALKIAMQFFDVQKSGKLVD+KI WRG+SGLKDG  A LDLS GMYDAGD
Sbjct  53   KYSDALKIAMQFFDVQKSGKLVDDKIPWRGNSGLKDGSEAKLDLSMGMYDAGD  105



>ref|XP_002307711.1| glycosyl hydrolase family 9 family protein [Populus trichocarpa]
 gb|EEE94707.1| glycosyl hydrolase family 9 family protein [Populus trichocarpa]
 gb|AEO97189.1| endo-1,4-beta-glucanase [Populus trichocarpa]
 gb|AEO97216.1| endo-1,4-beta-glucanase [Populus trichocarpa]
Length=523

 Score = 93.2 bits (230),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 44/54 (81%), Positives = 47/54 (87%), Gaps = 0/54 (0%)
 Frame = +1

Query  394  QKYGDALKIAMQFFDVQKSGKLVDNKISWRGDSGLKDGKSASLDLSKGMYDAGD  555
            +KY DALKIA QFFD+QKSGKLVD KISWRGDS L+DG  A LDLSKGMYDAGD
Sbjct  53   KKYADALKIATQFFDIQKSGKLVDKKISWRGDSALRDGSQAKLDLSKGMYDAGD  106



>ref|XP_002462729.1| hypothetical protein SORBIDRAFT_02g030990 [Sorghum bicolor]
 gb|EER99250.1| hypothetical protein SORBIDRAFT_02g030990 [Sorghum bicolor]
Length=525

 Score = 92.8 bits (229),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 63/111 (57%), Positives = 78/111 (70%), Gaps = 5/111 (5%)
 Frame = +1

Query  223  MGDKSRSKGGWCGWLLvvivaaaigvsifvLVKKKHGGGGSSEPDaapvpgppgavTQKY  402
            MG  +R   G CGWL+V ++AA +  +    + K+  GG   +P   PVPGPPGA+  KY
Sbjct  1    MGKYTR---GCCGWLIVALIAALVATAAMFAIMKRKPGGRHIKP--LPVPGPPGAIDSKY  55

Query  403  GDALKIAMQFFDVQKSGKLVDNKISWRGDSGLKDGKSASLDLSKGMYDAGD  555
            GDAL +A+QFF VQK+GKL +N+I WRGDS L DGK A LDLSKGMYDAGD
Sbjct  56   GDALGVALQFFQVQKAGKLENNQIPWRGDSALTDGKEAGLDLSKGMYDAGD  106



>emb|CDY47506.1| BnaAnng09040D [Brassica napus]
Length=499

 Score = 92.4 bits (228),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 42/53 (79%), Positives = 48/53 (91%), Gaps = 0/53 (0%)
 Frame = +1

Query  397  KYGDALKIAMQFFDVQKSGKLVDNKISWRGDSGLKDGKSASLDLSKGMYDAGD  555
            KY DALK+A+QFFD+QKSGKLV+N I WRGDSGLKDG  A+LDLSKG+YDAGD
Sbjct  31   KYADALKLALQFFDIQKSGKLVNNTIPWRGDSGLKDGSEANLDLSKGLYDAGD  83



>ref|XP_009398708.1| PREDICTED: endoglucanase 24-like [Musa acuminata subsp. malaccensis]
Length=524

 Score = 92.4 bits (228),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 44/54 (81%), Positives = 47/54 (87%), Gaps = 0/54 (0%)
 Frame = +1

Query  394  QKYGDALKIAMQFFDVQKSGKLVDNKISWRGDSGLKDGKSASLDLSKGMYDAGD  555
            QKY DAL +A+QFF VQKSGKLVDNKI+WRGDS L DGK A LDLSKGMYDAGD
Sbjct  52   QKYADALGVALQFFQVQKSGKLVDNKITWRGDSALHDGKDAGLDLSKGMYDAGD  105



>ref|NP_001145749.1| hypothetical protein [Zea mays]
 gb|ACL52523.1| unknown [Zea mays]
 tpg|DAA62473.1| TPA: hypothetical protein ZEAMMB73_855274 [Zea mays]
Length=526

 Score = 92.4 bits (228),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 61/107 (57%), Positives = 76/107 (71%), Gaps = 2/107 (2%)
 Frame = +1

Query  235  SRSKGGWCGWLLvvivaaaigvsifvLVKKKHGGGGSSEPDaapvpgppgavTQKYGDAL  414
            S+   G CGWL+V ++AA +  +    + K+  GG   +P   PVPGPPGA+  KYGDAL
Sbjct  3    SKYTRGCCGWLIVALIAALVATAAMFAIMKRKPGGRHIKP--LPVPGPPGAIDSKYGDAL  60

Query  415  KIAMQFFDVQKSGKLVDNKISWRGDSGLKDGKSASLDLSKGMYDAGD  555
             +A+QFF VQK+GKL +N+I WRGDS L DGK A LDLSKGMYDAGD
Sbjct  61   GVALQFFQVQKAGKLENNQIPWRGDSALTDGKEAGLDLSKGMYDAGD  107



>ref|XP_010029690.1| PREDICTED: endoglucanase 2-like [Eucalyptus grandis]
Length=527

 Score = 92.4 bits (228),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 44/54 (81%), Positives = 47/54 (87%), Gaps = 0/54 (0%)
 Frame = +1

Query  394  QKYGDALKIAMQFFDVQKSGKLVDNKISWRGDSGLKDGKSASLDLSKGMYDAGD  555
            QKY DAL IAMQFFDVQKSG+LV+N+ISWRGDSGL DG    LDLSKGMYDAGD
Sbjct  54   QKYADALGIAMQFFDVQKSGQLVNNRISWRGDSGLMDGSGEGLDLSKGMYDAGD  107



>gb|KCW56649.1| hypothetical protein EUGRSUZ_I02356 [Eucalyptus grandis]
Length=523

 Score = 92.4 bits (228),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 44/54 (81%), Positives = 47/54 (87%), Gaps = 0/54 (0%)
 Frame = +1

Query  394  QKYGDALKIAMQFFDVQKSGKLVDNKISWRGDSGLKDGKSASLDLSKGMYDAGD  555
            QKY DAL IAMQFFDVQKSG+LV+N+ISWRGDSGL DG    LDLSKGMYDAGD
Sbjct  50   QKYADALGIAMQFFDVQKSGQLVNNRISWRGDSGLMDGSGEGLDLSKGMYDAGD  103



>gb|KDP46724.1| hypothetical protein JCGZ_06512 [Jatropha curcas]
Length=538

 Score = 92.4 bits (228),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 41/55 (75%), Positives = 50/55 (91%), Gaps = 0/55 (0%)
 Frame = +1

Query  391  TQKYGDALKIAMQFFDVQKSGKLVDNKISWRGDSGLKDGKSASLDLSKGMYDAGD  555
             +KY DAL++A+QFFDVQKSGKLVDN+I+WRGDSGL+DG+   LDLSKG+YDAGD
Sbjct  64   VKKYADALEVALQFFDVQKSGKLVDNRIAWRGDSGLQDGRQQGLDLSKGIYDAGD  118



>gb|KJB58120.1| hypothetical protein B456_009G195400 [Gossypium raimondii]
Length=522

 Score = 92.4 bits (228),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 60/111 (54%), Positives = 75/111 (68%), Gaps = 7/111 (6%)
 Frame = +1

Query  223  MGDKSRSKGGWCGWLLvvivaaaigvsifvLVKKKHGGGGSSEPDaapvpgppgavTQKY  402
            MG +S+S GG  GWLL +++ A +  +I   VK+K      ++P   P P       +KY
Sbjct  1    MGKESKS-GGCLGWLLAIVILALVVGAIVYAVKQKIDHANDNKPSPVPGPPGAID--KKY  57

Query  403  GDALKIAMQFFDVQKSGKLVDNKISWRGDSGLKDGKSASLDLSKGMYDAGD  555
             DALKIAMQFFD+QK    ++NKISWRGDSGLKDG  A+LDLSKGMYDAGD
Sbjct  58   ADALKIAMQFFDIQK----LNNKISWRGDSGLKDGNEANLDLSKGMYDAGD  104



>ref|XP_002893081.1| glycosyl hydrolase family 9 protein [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH69340.1| glycosyl hydrolase family 9 protein [Arabidopsis lyrata subsp. 
lyrata]
Length=516

 Score = 92.0 bits (227),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 42/54 (78%), Positives = 49/54 (91%), Gaps = 0/54 (0%)
 Frame = +1

Query  394  QKYGDALKIAMQFFDVQKSGKLVDNKISWRGDSGLKDGKSASLDLSKGMYDAGD  555
            + Y +ALKIAMQFFD+QKSGKL +NKISWRGDSGLKDG  A++DLSKG+YDAGD
Sbjct  48   KNYANALKIAMQFFDIQKSGKLENNKISWRGDSGLKDGSEANIDLSKGLYDAGD  101



>ref|NP_173423.1| glycosyl hydrolase 9B5 [Arabidopsis thaliana]
 sp|Q9FXI9.1|GUN2_ARATH RecName: Full=Endoglucanase 2; AltName: Full=Endo-1,4-beta glucanase 
2; Flags: Precursor [Arabidopsis thaliana]
 gb|AAG12562.1|AC007797_22 Similar to endo-beta-1,4-glucanase [Arabidopsis thaliana]
 gb|AAK82507.1| At1g19940/F6F9_1 [Arabidopsis thaliana]
 gb|AAM47371.1| At1g19940/F6F9_1 [Arabidopsis thaliana]
 gb|AEE29915.1| probably endoglucanase [Arabidopsis thaliana]
Length=515

 Score = 92.0 bits (227),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 42/54 (78%), Positives = 49/54 (91%), Gaps = 0/54 (0%)
 Frame = +1

Query  394  QKYGDALKIAMQFFDVQKSGKLVDNKISWRGDSGLKDGKSASLDLSKGMYDAGD  555
            + Y +ALKIAMQFFD+QKSGKL +N+ISWRGDSGLKDG  AS+DLSKG+YDAGD
Sbjct  47   KNYANALKIAMQFFDIQKSGKLENNEISWRGDSGLKDGSEASIDLSKGLYDAGD  100



>ref|XP_009149490.1| PREDICTED: endoglucanase 2 [Brassica rapa]
 ref|XP_009149491.1| PREDICTED: endoglucanase 2 [Brassica rapa]
Length=525

 Score = 91.3 bits (225),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 42/54 (78%), Positives = 48/54 (89%), Gaps = 0/54 (0%)
 Frame = +1

Query  394  QKYGDALKIAMQFFDVQKSGKLVDNKISWRGDSGLKDGKSASLDLSKGMYDAGD  555
            + Y DALKIAMQFFD+QKSGKL +NKI+WRGDSGL+DG  A LDLSKG+YDAGD
Sbjct  56   KNYADALKIAMQFFDIQKSGKLENNKITWRGDSGLEDGSEAGLDLSKGLYDAGD  109



>ref|XP_003563568.1| PREDICTED: endoglucanase 18-like [Brachypodium distachyon]
Length=516

 Score = 90.9 bits (224),  Expect = 7e-18, Method: Compositional matrix adjust.
 Identities = 53/103 (51%), Positives = 65/103 (63%), Gaps = 17/103 (17%)
 Frame = +1

Query  256  CGWLLvvivaaaigvsifvLVKKKHGGGG---SSEPDaapvpgppgavTQKYGDALKIAM  426
            C WLLV+ + A    +  V V+ K+GGGG   S +P              KY +AL +A+
Sbjct  8    CCWLLVLTLVALGITAAVVFVRHKNGGGGVPGSVDP--------------KYAEALAVAL  53

Query  427  QFFDVQKSGKLVDNKISWRGDSGLKDGKSASLDLSKGMYDAGD  555
            QFF VQKSGKLV N+I WRGDS + DG+ A LDLSKGMYDAGD
Sbjct  54   QFFQVQKSGKLVKNEIPWRGDSAVDDGQEAGLDLSKGMYDAGD  96



>gb|KDO84821.1| hypothetical protein CISIN_1g036398mg [Citrus sinensis]
Length=514

 Score = 90.9 bits (224),  Expect = 7e-18, Method: Compositional matrix adjust.
 Identities = 43/54 (80%), Positives = 46/54 (85%), Gaps = 0/54 (0%)
 Frame = +1

Query  394  QKYGDALKIAMQFFDVQKSGKLVDNKISWRGDSGLKDGKSASLDLSKGMYDAGD  555
              Y  ALKIAMQFFD+QKSGKLV+N+I WRGDSGLKDGK   LDLSKGMYDAGD
Sbjct  43   HNYVAALKIAMQFFDIQKSGKLVNNQIKWRGDSGLKDGKEVDLDLSKGMYDAGD  96



>ref|XP_011043209.1| PREDICTED: endoglucanase 2-like [Populus euphratica]
Length=530

 Score = 90.5 bits (223),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 42/55 (76%), Positives = 48/55 (87%), Gaps = 0/55 (0%)
 Frame = +1

Query  391  TQKYGDALKIAMQFFDVQKSGKLVDNKISWRGDSGLKDGKSASLDLSKGMYDAGD  555
             +KY DAL+IA+QFFDVQKSGKLV+N+I WRGDSGL DG   +LDLSKGMYDAGD
Sbjct  56   VKKYADALEIALQFFDVQKSGKLVNNRIVWRGDSGLLDGIEMNLDLSKGMYDAGD  110



>ref|XP_004232483.1| PREDICTED: endoglucanase 2-like [Solanum lycopersicum]
Length=526

 Score = 90.5 bits (223),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 40/55 (73%), Positives = 47/55 (85%), Gaps = 0/55 (0%)
 Frame = +1

Query  391  TQKYGDALKIAMQFFDVQKSGKLVDNKISWRGDSGLKDGKSASLDLSKGMYDAGD  555
             +KY +AL IAMQFFDVQKSGKLV+NKI+WRGDS + DG   +LDLS+GMYDAGD
Sbjct  50   VEKYANALSIAMQFFDVQKSGKLVNNKIAWRGDSAMGDGSEVNLDLSRGMYDAGD  104



>ref|XP_006340729.1| PREDICTED: endoglucanase 2-like [Solanum tuberosum]
Length=526

 Score = 90.1 bits (222),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 41/53 (77%), Positives = 46/53 (87%), Gaps = 0/53 (0%)
 Frame = +1

Query  397  KYGDALKIAMQFFDVQKSGKLVDNKISWRGDSGLKDGKSASLDLSKGMYDAGD  555
            KY +AL IAMQFFDVQKSGKLV+NKI+WRGDS L DG   +LDLS+GMYDAGD
Sbjct  52   KYANALSIAMQFFDVQKSGKLVNNKIAWRGDSALGDGSEVNLDLSRGMYDAGD  104



>ref|XP_008799407.1| PREDICTED: endoglucanase 24-like [Phoenix dactylifera]
Length=524

 Score = 89.7 bits (221),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 41/55 (75%), Positives = 47/55 (85%), Gaps = 0/55 (0%)
 Frame = +1

Query  391  TQKYGDALKIAMQFFDVQKSGKLVDNKISWRGDSGLKDGKSASLDLSKGMYDAGD  555
            TQKY +AL +A+QFF VQKSGKLV+NKI+WRGDS L DGK   +DLSKGMYDAGD
Sbjct  51   TQKYAEALSVALQFFQVQKSGKLVNNKITWRGDSALDDGKEEGVDLSKGMYDAGD  105



>ref|XP_006435158.1| hypothetical protein CICLE_v10003402mg, partial [Citrus clementina]
 gb|ESR48398.1| hypothetical protein CICLE_v10003402mg, partial [Citrus clementina]
Length=480

 Score = 89.4 bits (220),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 42/54 (78%), Positives = 46/54 (85%), Gaps = 0/54 (0%)
 Frame = +1

Query  394  QKYGDALKIAMQFFDVQKSGKLVDNKISWRGDSGLKDGKSASLDLSKGMYDAGD  555
              Y  ALKIAMQFFD+QKSGKLV+N+I WRGDSGLKDGK   L+LSKGMYDAGD
Sbjct  9    HNYVAALKIAMQFFDIQKSGKLVNNQIKWRGDSGLKDGKEVDLELSKGMYDAGD  62



>ref|XP_010113364.1| Endoglucanase 24 [Morus notabilis]
 gb|EXC35371.1| Endoglucanase 24 [Morus notabilis]
Length=544

 Score = 89.7 bits (221),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 42/53 (79%), Positives = 47/53 (89%), Gaps = 0/53 (0%)
 Frame = +1

Query  397  KYGDALKIAMQFFDVQKSGKLVDNKISWRGDSGLKDGKSASLDLSKGMYDAGD  555
            +Y  AL+IAMQFFDVQKSGKLVDN+I WRGDSGL+DG   +LDLSKGMYDAGD
Sbjct  61   QYAKALEIAMQFFDVQKSGKLVDNRIWWRGDSGLQDGIDQNLDLSKGMYDAGD  113



>ref|XP_010935039.1| PREDICTED: endoglucanase 24-like [Elaeis guineensis]
Length=520

 Score = 89.4 bits (220),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 41/54 (76%), Positives = 46/54 (85%), Gaps = 0/54 (0%)
 Frame = +1

Query  394  QKYGDALKIAMQFFDVQKSGKLVDNKISWRGDSGLKDGKSASLDLSKGMYDAGD  555
            QKY +AL +A+QFF VQKSGKLV+NKI WRGDSGL DGK   +DLSKGMYDAGD
Sbjct  48   QKYAEALSVALQFFQVQKSGKLVNNKIPWRGDSGLDDGKEEKVDLSKGMYDAGD  101



>ref|XP_009624009.1| PREDICTED: endoglucanase 2-like [Nicotiana tomentosiformis]
Length=527

 Score = 89.0 bits (219),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 39/53 (74%), Positives = 46/53 (87%), Gaps = 0/53 (0%)
 Frame = +1

Query  397  KYGDALKIAMQFFDVQKSGKLVDNKISWRGDSGLKDGKSASLDLSKGMYDAGD  555
            KY +AL IAMQFFD+QKSGKLV+NKI+WRGDS + DG   +LDL+KGMYDAGD
Sbjct  53   KYANALSIAMQFFDIQKSGKLVNNKIAWRGDSAMGDGSEVNLDLTKGMYDAGD  105



>ref|XP_003519870.1| PREDICTED: endoglucanase 24-like [Glycine max]
Length=535

 Score = 89.0 bits (219),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 54/116 (47%), Positives = 71/116 (61%), Gaps = 3/116 (3%)
 Frame = +1

Query  208  KGGEKMGDKSRSKGGWCGWLLvvivaaaigvsifvLVKKKHGGGGSSEPDaapvpgppga  387
            K  +K  +K    G  C WL V I+A  + V+  + +  K   G S+ P+    P     
Sbjct  4    KVNDKEPNKKHYVGALCWWLTVSIIAVLVVVAGVLSLITKFKFGHSNSPEFTSHPTNV--  61

Query  388  vTQKYGDALKIAMQFFDVQKSGKLVDNKISWRGDSGLKDGKSASLDLSKGMYDAGD  555
              QKY  AL++A+QFFDVQKSGKL + ++ WRGDSGL+DG   +LDLSKGMYDAGD
Sbjct  62   -VQKYASALELALQFFDVQKSGKLENKRVWWRGDSGLRDGSEENLDLSKGMYDAGD  116



>ref|XP_008241905.1| PREDICTED: endoglucanase 24-like [Prunus mume]
Length=533

 Score = 88.6 bits (218),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 39/55 (71%), Positives = 47/55 (85%), Gaps = 0/55 (0%)
 Frame = +1

Query  391  TQKYGDALKIAMQFFDVQKSGKLVDNKISWRGDSGLKDGKSASLDLSKGMYDAGD  555
             QKY +AL+++MQFFD+QKSGKLVDN I WRGDSGL+DG    LDLSKG+YD+GD
Sbjct  59   VQKYSEALQLSMQFFDIQKSGKLVDNPIPWRGDSGLQDGSEEDLDLSKGLYDSGD  113



>dbj|BAJ93299.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=531

 Score = 88.6 bits (218),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 41/53 (77%), Positives = 46/53 (87%), Gaps = 0/53 (0%)
 Frame = +1

Query  397  KYGDALKIAMQFFDVQKSGKLVDNKISWRGDSGLKDGKSASLDLSKGMYDAGD  555
            KYGDAL +A+QFF VQK+GKLVDN+I WRGDS L DGK A LDLSKG+YDAGD
Sbjct  60   KYGDALGVALQFFQVQKAGKLVDNQIPWRGDSALTDGKEAKLDLSKGLYDAGD  112



>ref|XP_010530451.1| PREDICTED: endoglucanase 2-like [Tarenaya hassleriana]
Length=501

 Score = 87.8 bits (216),  Expect = 7e-17, Method: Compositional matrix adjust.
 Identities = 38/53 (72%), Positives = 47/53 (89%), Gaps = 0/53 (0%)
 Frame = +1

Query  397  KYGDALKIAMQFFDVQKSGKLVDNKISWRGDSGLKDGKSASLDLSKGMYDAGD  555
            +Y DAL +A++FFDVQ+SGKLV N+ISWRGDSGL+DG+   +DLSKGMYDAGD
Sbjct  49   EYTDALSVALEFFDVQRSGKLVKNRISWRGDSGLRDGREEKVDLSKGMYDAGD  101



>ref|XP_008788648.1| PREDICTED: endoglucanase 24 [Phoenix dactylifera]
Length=524

 Score = 87.8 bits (216),  Expect = 8e-17, Method: Compositional matrix adjust.
 Identities = 40/54 (74%), Positives = 46/54 (85%), Gaps = 0/54 (0%)
 Frame = +1

Query  394  QKYGDALKIAMQFFDVQKSGKLVDNKISWRGDSGLKDGKSASLDLSKGMYDAGD  555
            QKY +AL +A+QFF VQKSGKLV+N+I WRGDSGL DGK   +DLSKGMYDAGD
Sbjct  52   QKYAEALSVALQFFQVQKSGKLVNNEIPWRGDSGLDDGKEEKVDLSKGMYDAGD  105



>ref|XP_010941260.1| PREDICTED: endoglucanase 24-like [Elaeis guineensis]
 ref|XP_010941261.1| PREDICTED: endoglucanase 24-like [Elaeis guineensis]
 ref|XP_010941262.1| PREDICTED: endoglucanase 24-like [Elaeis guineensis]
 ref|XP_010941263.1| PREDICTED: endoglucanase 24-like [Elaeis guineensis]
 ref|XP_010941264.1| PREDICTED: endoglucanase 24-like [Elaeis guineensis]
Length=524

 Score = 87.8 bits (216),  Expect = 9e-17, Method: Compositional matrix adjust.
 Identities = 40/55 (73%), Positives = 46/55 (84%), Gaps = 0/55 (0%)
 Frame = +1

Query  391  TQKYGDALKIAMQFFDVQKSGKLVDNKISWRGDSGLKDGKSASLDLSKGMYDAGD  555
            TQKY DAL +A+QFF VQKSG+LV+NKI WRG+S L DGK   +DLSKGMYDAGD
Sbjct  51   TQKYADALSVALQFFQVQKSGQLVNNKIPWRGNSALDDGKEEGVDLSKGMYDAGD  105



>ref|XP_009803640.1| PREDICTED: endoglucanase 2-like [Nicotiana sylvestris]
Length=527

 Score = 87.8 bits (216),  Expect = 9e-17, Method: Compositional matrix adjust.
 Identities = 39/55 (71%), Positives = 47/55 (85%), Gaps = 0/55 (0%)
 Frame = +1

Query  391  TQKYGDALKIAMQFFDVQKSGKLVDNKISWRGDSGLKDGKSASLDLSKGMYDAGD  555
              KY +AL IAM+FFDVQKSGKLV+NKI+WRGDS + DG  A+LDL+KGM+DAGD
Sbjct  51   VNKYANALSIAMRFFDVQKSGKLVNNKIAWRGDSAMGDGSEANLDLTKGMFDAGD  105



>ref|XP_009378180.1| PREDICTED: endoglucanase 2-like [Pyrus x bretschneideri]
 ref|XP_009378181.1| PREDICTED: endoglucanase 2-like [Pyrus x bretschneideri]
Length=537

 Score = 87.8 bits (216),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 40/53 (75%), Positives = 45/53 (85%), Gaps = 0/53 (0%)
 Frame = +1

Query  397  KYGDALKIAMQFFDVQKSGKLVDNKISWRGDSGLKDGKSASLDLSKGMYDAGD  555
            KY +AL+I+MQFFD QKSGKLVDN I WRGDSGL+DG    LDLSKG+YDAGD
Sbjct  65   KYSEALQISMQFFDAQKSGKLVDNPIPWRGDSGLQDGSEEDLDLSKGLYDAGD  117



>ref|XP_006656489.1| PREDICTED: endoglucanase 18-like [Oryza brachyantha]
Length=519

 Score = 87.4 bits (215),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 59/100 (59%), Positives = 67/100 (67%), Gaps = 6/100 (6%)
 Frame = +1

Query  256  CGWLLvvivaaaigvsifvLVKKKHGGGGSSEPDaapvpgppgavTQKYGDALKIAMQFF  435
            C WLLV+ + A    +  V V+ K+GG G   P      G PGAV  KY DAL +A+QFF
Sbjct  8    CCWLLVLALMALAVTAAVVFVRYKNGGQGFPFP------GVPGAVDHKYTDALGVALQFF  61

Query  436  DVQKSGKLVDNKISWRGDSGLKDGKSASLDLSKGMYDAGD  555
             VQKSGKLV+N I WRGDS L DGK A LDLSKGMYDAGD
Sbjct  62   QVQKSGKLVNNTIHWRGDSALDDGKEAGLDLSKGMYDAGD  101



>ref|XP_008372790.1| PREDICTED: endoglucanase 24-like [Malus domestica]
Length=537

 Score = 87.0 bits (214),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 40/53 (75%), Positives = 45/53 (85%), Gaps = 0/53 (0%)
 Frame = +1

Query  397  KYGDALKIAMQFFDVQKSGKLVDNKISWRGDSGLKDGKSASLDLSKGMYDAGD  555
            KY +AL+I+MQFFD QKSGKLVDN I WRGDSGL+DG    LDLSKG+YDAGD
Sbjct  65   KYSEALQISMQFFDAQKSGKLVDNPIPWRGDSGLQDGSEDDLDLSKGLYDAGD  117



>gb|KHN00484.1| Endoglucanase 24 [Glycine soja]
Length=509

 Score = 87.0 bits (214),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 53/116 (46%), Positives = 70/116 (60%), Gaps = 3/116 (3%)
 Frame = +1

Query  208  KGGEKMGDKSRSKGGWCGWLLvvivaaaigvsifvLVKKKHGGGGSSEPDaapvpgppga  387
            K  +K  +K       C WL V I+A  + V+  + +  K   G S+ P+    P     
Sbjct  4    KVNDKEPNKKHYVSALCWWLTVSIIAVLVVVAGVLSLITKFKFGHSNSPEFTSHPTNV--  61

Query  388  vTQKYGDALKIAMQFFDVQKSGKLVDNKISWRGDSGLKDGKSASLDLSKGMYDAGD  555
              QKY  AL++A+QFFDVQKSGKL + ++ WRGDSGL+DG   +LDLSKGMYDAGD
Sbjct  62   -VQKYASALELALQFFDVQKSGKLENKRVWWRGDSGLRDGSEENLDLSKGMYDAGD  116



>gb|EAZ02358.1| hypothetical protein OsI_24462 [Oryza sativa Indica Group]
Length=518

 Score = 86.7 bits (213),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 40/54 (74%), Positives = 44/54 (81%), Gaps = 0/54 (0%)
 Frame = +1

Query  394  QKYGDALKIAMQFFDVQKSGKLVDNKISWRGDSGLKDGKSASLDLSKGMYDAGD  555
             KY DAL +A+QFF VQKSGKLV+N I WRGDS L DGK A +DLSKGMYDAGD
Sbjct  48   HKYADALAVALQFFQVQKSGKLVNNTIHWRGDSALDDGKEAGIDLSKGMYDAGD  101



>ref|XP_006383120.1| hypothetical protein POPTR_0005s11750g [Populus trichocarpa]
 gb|ERP60917.1| hypothetical protein POPTR_0005s11750g [Populus trichocarpa]
Length=530

 Score = 86.7 bits (213),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 41/55 (75%), Positives = 47/55 (85%), Gaps = 0/55 (0%)
 Frame = +1

Query  391  TQKYGDALKIAMQFFDVQKSGKLVDNKISWRGDSGLKDGKSASLDLSKGMYDAGD  555
             +KY DAL+IA+QFFD QKSGKLV+N+I WRGDSGL DG   +LDLSKGMYDAGD
Sbjct  56   VKKYADALEIALQFFDGQKSGKLVNNRIGWRGDSGLLDGIEMNLDLSKGMYDAGD  110



>ref|NP_001058583.1| Os06g0715300 [Oryza sativa Japonica Group]
 sp|Q5Z9P8.1|GUN18_ORYSJ RecName: Full=Endoglucanase 18; AltName: Full=Endo-1,4-beta glucanase 
18 [Oryza sativa Japonica Group]
 dbj|BAD53575.1| putative endo-beta-1,4-D-glucanase [Oryza sativa Japonica Group]
 dbj|BAF20497.1| Os06g0715300 [Oryza sativa Japonica Group]
Length=518

 Score = 86.7 bits (213),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 40/54 (74%), Positives = 44/54 (81%), Gaps = 0/54 (0%)
 Frame = +1

Query  394  QKYGDALKIAMQFFDVQKSGKLVDNKISWRGDSGLKDGKSASLDLSKGMYDAGD  555
             KY DAL +A+QFF VQKSGKLV+N I WRGDS L DGK A +DLSKGMYDAGD
Sbjct  48   HKYADALAVALQFFQVQKSGKLVNNTIHWRGDSALDDGKEAGIDLSKGMYDAGD  101



>gb|AEO97190.1| endo-1,4-beta-glucanase [Populus trichocarpa]
 gb|AEO97217.1| endo-1,4-beta-glucanase [Populus trichocarpa]
Length=530

 Score = 86.7 bits (213),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 41/55 (75%), Positives = 47/55 (85%), Gaps = 0/55 (0%)
 Frame = +1

Query  391  TQKYGDALKIAMQFFDVQKSGKLVDNKISWRGDSGLKDGKSASLDLSKGMYDAGD  555
             +KY DAL+IA+QFFD QKSGKLV+N+I WRGDSGL DG   +LDLSKGMYDAGD
Sbjct  56   VKKYADALEIALQFFDGQKSGKLVNNRIGWRGDSGLLDGIEMNLDLSKGMYDAGD  110



>ref|XP_009386441.1| PREDICTED: endoglucanase 24-like [Musa acuminata subsp. malaccensis]
Length=523

 Score = 86.7 bits (213),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 40/54 (74%), Positives = 45/54 (83%), Gaps = 0/54 (0%)
 Frame = +1

Query  394  QKYGDALKIAMQFFDVQKSGKLVDNKISWRGDSGLKDGKSASLDLSKGMYDAGD  555
            QKY  AL +A+QFF +QKSGKLV+NK SWRGDS L DGK A LDLSKGMYD+GD
Sbjct  51   QKYASALAVALQFFQLQKSGKLVNNKFSWRGDSALDDGKEAGLDLSKGMYDSGD  104



>ref|XP_006466419.1| PREDICTED: endoglucanase 2-like [Citrus sinensis]
Length=551

 Score = 85.9 bits (211),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 39/55 (71%), Positives = 45/55 (82%), Gaps = 0/55 (0%)
 Frame = +1

Query  391  TQKYGDALKIAMQFFDVQKSGKLVDNKISWRGDSGLKDGKSASLDLSKGMYDAGD  555
             + Y +AL I+MQFFDVQKSGKLV+NKI WRGDS L DG   +LDLSKG+YDAGD
Sbjct  77   VENYANALGISMQFFDVQKSGKLVNNKIVWRGDSALHDGSEENLDLSKGLYDAGD  131



>ref|XP_006426144.1| hypothetical protein CICLE_v10025306mg [Citrus clementina]
 gb|ESR39384.1| hypothetical protein CICLE_v10025306mg [Citrus clementina]
Length=550

 Score = 85.5 bits (210),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 39/55 (71%), Positives = 45/55 (82%), Gaps = 0/55 (0%)
 Frame = +1

Query  391  TQKYGDALKIAMQFFDVQKSGKLVDNKISWRGDSGLKDGKSASLDLSKGMYDAGD  555
             + Y +AL I+MQFFDVQKSGKLV+NKI WRGDS L DG   +LDLSKG+YDAGD
Sbjct  76   VENYANALGISMQFFDVQKSGKLVNNKIVWRGDSALHDGSEENLDLSKGLYDAGD  130



>gb|KDO78852.1| hypothetical protein CISIN_1g048736mg [Citrus sinensis]
Length=550

 Score = 85.5 bits (210),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 39/55 (71%), Positives = 45/55 (82%), Gaps = 0/55 (0%)
 Frame = +1

Query  391  TQKYGDALKIAMQFFDVQKSGKLVDNKISWRGDSGLKDGKSASLDLSKGMYDAGD  555
             + Y +AL I+MQFFDVQKSGKLV+NKI WRGDS L DG   +LDLSKG+YDAGD
Sbjct  76   VENYANALGISMQFFDVQKSGKLVNNKIVWRGDSALHDGSEENLDLSKGLYDAGD  130



>gb|ACC63522.1| putative glucanase/cellulase [Hordeum vulgare subsp. vulgare]
Length=179

 Score = 81.6 bits (200),  Expect = 9e-16, Method: Compositional matrix adjust.
 Identities = 43/81 (53%), Positives = 54/81 (67%), Gaps = 9/81 (11%)
 Frame = +1

Query  313  LVKKKHGGGGSSEPDaapvpgppgavTQKYGDALKIAMQFFDVQKSGKLVDNKISWRGDS  492
             V+ ++GGG    P         G+V  KY +AL +A+QFF VQKSGKLV  +I WRGDS
Sbjct  27   FVRNRNGGGDRPVP---------GSVDHKYAEALAVALQFFQVQKSGKLVKKEIPWRGDS  77

Query  493  GLKDGKSASLDLSKGMYDAGD  555
             + DG+ A LDLS+GMYDAGD
Sbjct  78   AVDDGQEAGLDLSRGMYDAGD  98



>ref|XP_003578508.1| PREDICTED: endoglucanase 24 [Brachypodium distachyon]
Length=529

 Score = 84.7 bits (208),  Expect = 9e-16, Method: Compositional matrix adjust.
 Identities = 40/53 (75%), Positives = 45/53 (85%), Gaps = 0/53 (0%)
 Frame = +1

Query  397  KYGDALKIAMQFFDVQKSGKLVDNKISWRGDSGLKDGKSASLDLSKGMYDAGD  555
            KYGDAL IA+QFF VQK+GKL +N+I WRGDS L DGK A LDLSKG+YDAGD
Sbjct  58   KYGDALGIALQFFQVQKAGKLENNEIPWRGDSALDDGKEAKLDLSKGLYDAGD  110



>gb|ABE02649.1| putative glucanase/cellulase [Hordeum vulgare subsp. vulgare]
 gb|ABE02656.1| putative glucanase/cellulase [Hordeum vulgare]
Length=179

 Score = 81.3 bits (199),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 43/81 (53%), Positives = 54/81 (67%), Gaps = 9/81 (11%)
 Frame = +1

Query  313  LVKKKHGGGGSSEPDaapvpgppgavTQKYGDALKIAMQFFDVQKSGKLVDNKISWRGDS  492
             V+ ++GGG    P         G+V  KY +AL +A+QFF VQKSGKLV  +I WRGDS
Sbjct  27   FVRNRNGGGDRPVP---------GSVDHKYAEALAVALQFFQVQKSGKLVKKEIPWRGDS  77

Query  493  GLKDGKSASLDLSKGMYDAGD  555
             + DG+ A LDLS+GMYDAGD
Sbjct  78   AVDDGQEAGLDLSRGMYDAGD  98



>ref|XP_002439027.1| hypothetical protein SORBIDRAFT_10g030140 [Sorghum bicolor]
 gb|EER90394.1| hypothetical protein SORBIDRAFT_10g030140 [Sorghum bicolor]
Length=522

 Score = 84.7 bits (208),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 38/53 (72%), Positives = 45/53 (85%), Gaps = 0/53 (0%)
 Frame = +1

Query  397  KYGDALKIAMQFFDVQKSGKLVDNKISWRGDSGLKDGKSASLDLSKGMYDAGD  555
            KY +AL +A++FF VQKSGKLV+N I WRGDS L+DG+ A LDLSKGMYDAGD
Sbjct  52   KYAEALAVALRFFQVQKSGKLVNNTIPWRGDSALRDGEDAKLDLSKGMYDAGD  104



>ref|XP_002300715.1| glycosyl hydrolase family 9 family protein [Populus trichocarpa]
 gb|EEE79988.1| glycosyl hydrolase family 9 family protein [Populus trichocarpa]
 gb|AEO97188.1| endo-1,4-beta-glucanase [Populus trichocarpa]
 gb|AEO97215.1| endo-1,4-beta-glucanase [Populus trichocarpa]
Length=523

 Score = 84.3 bits (207),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 59/106 (56%), Positives = 70/106 (66%), Gaps = 5/106 (5%)
 Frame = +1

Query  241  SKGGWCGWLLvvivaaaigvsifvLVKKKHGGGGSSEPDaapvpgppgavTQKYGDALKI  420
            S  G C W LVV+  A +  +I   V+KK      + P    + GPPGA+ +KY DALKI
Sbjct  6    SSRGCCWWFLVVVTLALVYDAIVYTVQKKTEKSEGAAP----ITGPPGAIEKKYADALKI  61

Query  421  AMQFFDVQKSGKL-VDNKISWRGDSGLKDGKSASLDLSKGMYDAGD  555
            AMQFFD+Q+SG+L   NK SWRGDS L DG  A LDLSKGMYDAGD
Sbjct  62   AMQFFDIQRSGELGYSNKFSWRGDSTLTDGSQAKLDLSKGMYDAGD  107



>ref|XP_004966453.1| PREDICTED: endoglucanase 18-like [Setaria italica]
Length=521

 Score = 84.0 bits (206),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 39/53 (74%), Positives = 44/53 (83%), Gaps = 0/53 (0%)
 Frame = +1

Query  397  KYGDALKIAMQFFDVQKSGKLVDNKISWRGDSGLKDGKSASLDLSKGMYDAGD  555
            KY +AL +A+QFF VQKSGKLV N+I WRGDS L DG+ A LDLSKGMYDAGD
Sbjct  51   KYAEALAVALQFFQVQKSGKLVRNEIPWRGDSALDDGEEAKLDLSKGMYDAGD  103



>ref|NP_001288527.1| uncharacterized protein LOC103626453 precursor [Zea mays]
 gb|AFW69494.1| hypothetical protein ZEAMMB73_138975 [Zea mays]
 gb|AGG19095.1| cellulase [Zea mays]
Length=521

 Score = 84.0 bits (206),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 37/53 (70%), Positives = 45/53 (85%), Gaps = 0/53 (0%)
 Frame = +1

Query  397  KYGDALKIAMQFFDVQKSGKLVDNKISWRGDSGLKDGKSASLDLSKGMYDAGD  555
            KY +AL +A++FF VQKSGKLV+N I WRGDS L+DG+ A LDLS+GMYDAGD
Sbjct  51   KYAEALAVALRFFQVQKSGKLVNNTIPWRGDSALRDGEDAKLDLSRGMYDAGD  103



>ref|XP_004509346.1| PREDICTED: endoglucanase 10-like [Cicer arietinum]
Length=533

 Score = 84.0 bits (206),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 37/53 (70%), Positives = 47/53 (89%), Gaps = 0/53 (0%)
 Frame = +1

Query  397  KYGDALKIAMQFFDVQKSGKLVDNKISWRGDSGLKDGKSASLDLSKGMYDAGD  555
            KY  +L++A+QFFDVQKSGK+ +N++ WRGDSGL+DG  A+LDLSKGMYDAGD
Sbjct  62   KYASSLQLALQFFDVQKSGKVQNNRVWWRGDSGLRDGIEANLDLSKGMYDAGD  114



>ref|XP_011462352.1| PREDICTED: endoglucanase 2-like [Fragaria vesca subsp. vesca]
Length=531

 Score = 83.6 bits (205),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 39/55 (71%), Positives = 43/55 (78%), Gaps = 0/55 (0%)
 Frame = +1

Query  391  TQKYGDALKIAMQFFDVQKSGKLVDNKISWRGDSGLKDGKSASLDLSKGMYDAGD  555
             Q Y DAL +A QFFD QKSGKLV N++ WRGDSGL+DG    LDLSKGMYDAGD
Sbjct  58   VQNYSDALGLATQFFDAQKSGKLVVNRVGWRGDSGLRDGSEEGLDLSKGMYDAGD  112



>ref|XP_006661478.1| PREDICTED: endoglucanase 24-like [Oryza brachyantha]
Length=498

 Score = 83.2 bits (204),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 39/53 (74%), Positives = 44/53 (83%), Gaps = 0/53 (0%)
 Frame = +1

Query  397  KYGDALKIAMQFFDVQKSGKLVDNKISWRGDSGLKDGKSASLDLSKGMYDAGD  555
            KYGDAL +A+QFF VQK+GKL +N+I WRGDS   DGK A LDLSKGMYDAGD
Sbjct  27   KYGDALGVALQFFQVQKAGKLENNQIPWRGDSATDDGKQAGLDLSKGMYDAGD  79



>ref|XP_007156152.1| hypothetical protein PHAVU_003G262600g [Phaseolus vulgaris]
 gb|ESW28146.1| hypothetical protein PHAVU_003G262600g [Phaseolus vulgaris]
Length=534

 Score = 82.8 bits (203),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 37/55 (67%), Positives = 45/55 (82%), Gaps = 0/55 (0%)
 Frame = +1

Query  391  TQKYGDALKIAMQFFDVQKSGKLVDNKISWRGDSGLKDGKSASLDLSKGMYDAGD  555
             QKY  AL++A+QFF VQKSGK+ + ++ WRGDSGL+DG  A LDLSKGMYDAGD
Sbjct  61   VQKYASALQLALQFFYVQKSGKVENQRVLWRGDSGLRDGSEADLDLSKGMYDAGD  115



>emb|CDY44194.1| BnaC05g15510D [Brassica napus]
Length=1131

 Score = 83.6 bits (205),  Expect = 6e-15, Method: Composition-based stats.
 Identities = 41/69 (59%), Positives = 48/69 (70%), Gaps = 15/69 (22%)
 Frame = +1

Query  394  QKYGDALKIAMQFFDVQK---------------SGKLVDNKISWRGDSGLKDGKSASLDL  528
            + Y DALKIAMQFFD+QK               +GKL +NKI+WRGDSGL+DG  A LDL
Sbjct  56   KNYADALKIAMQFFDIQKCKSSTLLAEHTHLTPAGKLENNKITWRGDSGLEDGSEAGLDL  115

Query  529  SKGMYDAGD  555
            SKG+YDAGD
Sbjct  116  SKGLYDAGD  124



>ref|XP_011028991.1| PREDICTED: endoglucanase 2-like [Populus euphratica]
Length=523

 Score = 82.4 bits (202),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 58/106 (55%), Positives = 69/106 (65%), Gaps = 5/106 (5%)
 Frame = +1

Query  241  SKGGWCGWLLvvivaaaigvsifvLVKKKHGGGGSSEPDaapvpgppgavTQKYGDALKI  420
            S  G C W LVV+  A +  +I   V+KK      + P    + GPPGA+ +KY DALKI
Sbjct  6    SSRGCCWWFLVVVTLALVYDAIVYTVQKKTEESEGAAP----ITGPPGAIEKKYADALKI  61

Query  421  AMQFFDVQKSGKL-VDNKISWRGDSGLKDGKSASLDLSKGMYDAGD  555
            AMQFFD+Q+S +L   NK SWRGDS L DG  A LDLSKGMYDAGD
Sbjct  62   AMQFFDIQRSAELGYCNKFSWRGDSALTDGSQAKLDLSKGMYDAGD  107



>dbj|BAK04397.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=519

 Score = 81.6 bits (200),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 43/81 (53%), Positives = 54/81 (67%), Gaps = 9/81 (11%)
 Frame = +1

Query  313  LVKKKHGGGGSSEPDaapvpgppgavTQKYGDALKIAMQFFDVQKSGKLVDNKISWRGDS  492
             V+ ++GGG    P         G+V  KY +AL +A+QFF VQKSGKLV  +I WRGDS
Sbjct  27   FVRNRNGGGDRPVP---------GSVDHKYAEALAVALQFFQVQKSGKLVKKEIPWRGDS  77

Query  493  GLKDGKSASLDLSKGMYDAGD  555
             + DG+ A LDLS+GMYDAGD
Sbjct  78   AVDDGQEAGLDLSRGMYDAGD  98



>ref|XP_003629333.1| Endoglucanase [Medicago truncatula]
 gb|AET03809.1| glycosyl hydrolase family 9 protein [Medicago truncatula]
Length=534

 Score = 81.3 bits (199),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 35/53 (66%), Positives = 46/53 (87%), Gaps = 0/53 (0%)
 Frame = +1

Query  397  KYGDALKIAMQFFDVQKSGKLVDNKISWRGDSGLKDGKSASLDLSKGMYDAGD  555
            KY  +L++A+QFFDVQKSGK+ +N++ WRGDSGL+DG   +LDLSKG+YDAGD
Sbjct  63   KYASSLQLALQFFDVQKSGKVQNNRVWWRGDSGLRDGSEENLDLSKGLYDAGD  115



>gb|KHN45917.1| Endoglucanase 2 [Glycine soja]
Length=570

 Score = 80.5 bits (197),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 37/44 (84%), Positives = 40/44 (91%), Gaps = 0/44 (0%)
 Frame = +1

Query  424  MQFFDVQKSGKLVDNKISWRGDSGLKDGKSASLDLSKGMYDAGD  555
            MQFFD+QKSGKLVDNKISWRG+S LKDG  A LDL+KGMYDAGD
Sbjct  1    MQFFDIQKSGKLVDNKISWRGNSALKDGSQAKLDLTKGMYDAGD  44


 Score = 58.2 bits (139),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 28/41 (68%), Positives = 32/41 (78%), Gaps = 0/41 (0%)
 Frame = +1

Query  433  FDVQKSGKLVDNKISWRGDSGLKDGKSASLDLSKGMYDAGD  555
            F    +G+LVD+KISWRG+S LKDG  A LDLSKGMYDA D
Sbjct  110  FRFFATGRLVDSKISWRGNSALKDGSQAKLDLSKGMYDARD  150



>gb|ABK24648.1| unknown [Picea sitchensis]
Length=532

 Score = 77.4 bits (189),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 55/114 (48%), Positives = 69/114 (61%), Gaps = 8/114 (7%)
 Frame = +1

Query  223  MGDKSRSKGGWCGWLLv--vivaaaigvsifvLVKKKHGGGGSSEPDaapvpgppgavTQ  396
            MG  ++S  GW  WLL   +         + +L  +KH     S    +PVPGPPGA++Q
Sbjct  1    MGAVAKSSKGWIWWLLSLGIAAFVVTAAVLTILHSRKH-----SHHHVSPVPGPPGAISQ  55

Query  397  KYGDALKIAMQFFDVQKSGKLV-DNKISWRGDSGLKDGKSASLDLSKGMYDAGD  555
            KY  ALK+A+ FF +QK+GKL  DN I WRGDS L DG    +DLS GMYDAGD
Sbjct  56   KYAQALKVALTFFPIQKAGKLPNDNPIPWRGDSALSDGNDVGVDLSGGMYDAGD  109



>ref|XP_002971269.1| hypothetical protein SELMODRAFT_94888 [Selaginella moellendorffii]
 gb|EFJ27867.1| hypothetical protein SELMODRAFT_94888 [Selaginella moellendorffii]
Length=561

 Score = 77.4 bits (189),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 37/54 (69%), Positives = 42/54 (78%), Gaps = 1/54 (2%)
 Frame = +1

Query  397  KYGDALKIAMQFFDVQKSGKLV-DNKISWRGDSGLKDGKSASLDLSKGMYDAGD  555
            KY + LKI++QFFD+QKSGKL  DN I WRGDS L DG  A +DLS GMYDAGD
Sbjct  90   KYAEPLKISLQFFDIQKSGKLPPDNPIEWRGDSALSDGSDAHVDLSGGMYDAGD  143



>ref|XP_002961546.1| hypothetical protein SELMODRAFT_77612 [Selaginella moellendorffii]
 gb|EFJ36806.1| hypothetical protein SELMODRAFT_77612 [Selaginella moellendorffii]
Length=562

 Score = 77.4 bits (189),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 37/54 (69%), Positives = 42/54 (78%), Gaps = 1/54 (2%)
 Frame = +1

Query  397  KYGDALKIAMQFFDVQKSGKLV-DNKISWRGDSGLKDGKSASLDLSKGMYDAGD  555
            KY + LKI++QFFD+QKSGKL  DN I WRGDS L DG  A +DLS GMYDAGD
Sbjct  90   KYAEPLKISLQFFDIQKSGKLPPDNPIEWRGDSALSDGSDAHVDLSGGMYDAGD  143



>ref|WP_033435023.1| endoglucanase, partial [Saccharothrix syringae]
Length=738

 Score = 71.6 bits (174),  Expect = 4e-11, Method: Composition-based stats.
 Identities = 32/53 (60%), Positives = 43/53 (81%), Gaps = 1/53 (2%)
 Frame = +1

Query  400  YGDALKIAMQFFDVQKSGKL-VDNKISWRGDSGLKDGKSASLDLSKGMYDAGD  555
            YG+AL+ ++ F+D Q+SGKL  DN+++WRGDS L+DG+ A LDLS G YDAGD
Sbjct  38   YGEALQKSIWFYDAQRSGKLPADNRVNWRGDSALRDGQDAGLDLSGGFYDAGD  90



>ref|XP_002978046.1| hypothetical protein SELMODRAFT_417952 [Selaginella moellendorffii]
 gb|EFJ20703.1| hypothetical protein SELMODRAFT_417952 [Selaginella moellendorffii]
Length=551

 Score = 70.9 bits (172),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 34/56 (61%), Positives = 41/56 (73%), Gaps = 1/56 (2%)
 Frame = +1

Query  391  TQKYGDALKIAMQFFDVQKSGKLV-DNKISWRGDSGLKDGKSASLDLSKGMYDAGD  555
             +++   L++AM+F D QKSGKL  DN I WRGDS L DGK   LDLSKGM+DAGD
Sbjct  69   VERFSKPLELAMRFLDAQKSGKLPKDNPIPWRGDSALLDGKDVGLDLSKGMFDAGD  124



>ref|WP_037655280.1| endoglucanase [Streptomyces achromogenes]
Length=779

 Score = 69.3 bits (168),  Expect = 2e-10, Method: Composition-based stats.
 Identities = 33/53 (62%), Positives = 42/53 (79%), Gaps = 1/53 (2%)
 Frame = +1

Query  400  YGDALKIAMQFFDVQKSGKLVD-NKISWRGDSGLKDGKSASLDLSKGMYDAGD  555
            YG+AL+ ++ F+D Q+SGKL D N++SWRGDS L DGK A LDL+ G YDAGD
Sbjct  34   YGEALQKSLWFYDAQRSGKLPDDNRVSWRGDSALDDGKDAGLDLTGGWYDAGD  86



>ref|WP_030479897.1| endoglucanase [Lentzea albidocapillata]
Length=888

 Score = 68.9 bits (167),  Expect = 3e-10, Method: Composition-based stats.
 Identities = 32/53 (60%), Positives = 41/53 (77%), Gaps = 1/53 (2%)
 Frame = +1

Query  400  YGDALKIAMQFFDVQKSGKL-VDNKISWRGDSGLKDGKSASLDLSKGMYDAGD  555
            YG+AL+ ++ F+D Q+SGKL   N++SWRGDS L+DG  A LDLS G YDAGD
Sbjct  40   YGEALQKSVWFYDAQRSGKLPAGNRVSWRGDSALRDGSDAGLDLSGGFYDAGD  92



>ref|WP_037701830.1| endoglucanase [Streptomyces lavenduligriseus]
Length=776

 Score = 67.4 bits (163),  Expect = 8e-10, Method: Composition-based stats.
 Identities = 32/53 (60%), Positives = 41/53 (77%), Gaps = 1/53 (2%)
 Frame = +1

Query  400  YGDALKIAMQFFDVQKSGKLVD-NKISWRGDSGLKDGKSASLDLSKGMYDAGD  555
            YG+AL+ ++ F+D Q+SGKL D N++SWRGDS L DGK   LDL+ G YDAGD
Sbjct  33   YGEALQKSLWFYDAQRSGKLPDGNRVSWRGDSALGDGKDVGLDLTGGWYDAGD  85



>gb|ADZ85350.1| Cellulase [Clostridium lentocellum DSM 5427]
Length=1131

 Score = 67.8 bits (164),  Expect = 9e-10, Method: Composition-based stats.
 Identities = 32/53 (60%), Positives = 39/53 (74%), Gaps = 1/53 (2%)
 Frame = +1

Query  400  YGDALKIAMQFFDVQKSGKLVDN-KISWRGDSGLKDGKSASLDLSKGMYDAGD  555
            YGDA + A+ F++ QKSG L DN + +WRGDSGLKDG    LDL+ G YDAGD
Sbjct  40   YGDAFQKALMFYEFQKSGDLPDNQRNNWRGDSGLKDGADVGLDLTGGWYDAGD  92



>ref|WP_018552941.1| hypothetical protein [Streptomyces sp. ATexAB-D23]
Length=800

 Score = 67.4 bits (163),  Expect = 9e-10, Method: Composition-based stats.
 Identities = 32/53 (60%), Positives = 42/53 (79%), Gaps = 1/53 (2%)
 Frame = +1

Query  400  YGDALKIAMQFFDVQKSGKLVD-NKISWRGDSGLKDGKSASLDLSKGMYDAGD  555
            YG+AL+ ++ F++ Q+SGKL D N++SWRGDS L DGK A LDL+ G YDAGD
Sbjct  55   YGEALQKSVLFYEAQQSGKLPDTNRVSWRGDSALDDGKDAGLDLTGGWYDAGD  107



>ref|WP_018105029.1| MULTISPECIES: hypothetical protein [Streptomyces]
Length=790

 Score = 67.4 bits (163),  Expect = 9e-10, Method: Composition-based stats.
 Identities = 32/53 (60%), Positives = 42/53 (79%), Gaps = 1/53 (2%)
 Frame = +1

Query  400  YGDALKIAMQFFDVQKSGKLVD-NKISWRGDSGLKDGKSASLDLSKGMYDAGD  555
            YG+AL+ ++ F++ Q+SGKL D N++SWRGDS L DGK A LDL+ G YDAGD
Sbjct  51   YGEALQKSVLFYEAQQSGKLPDTNRVSWRGDSALDDGKDAGLDLTGGWYDAGD  103



>ref|XP_001772307.1| predicted protein [Physcomitrella patens]
 gb|EDQ62778.1| predicted protein [Physcomitrella patens]
Length=629

 Score = 67.0 bits (162),  Expect = 1e-09, Method: Composition-based stats.
 Identities = 31/53 (58%), Positives = 41/53 (77%), Gaps = 1/53 (2%)
 Frame = +1

Query  400  YGDALKIAMQFFDVQKSGKLV-DNKISWRGDSGLKDGKSASLDLSKGMYDAGD  555
            YGDAL  A+++F+ Q+SG+L   +++SWRGDSGL DG+   LDLS G YDAGD
Sbjct  29   YGDALDKAVKYFEAQRSGRLPPGHRVSWRGDSGLHDGQQEGLDLSGGYYDAGD  81



>gb|AHL27899.1| cellulase [uncultured bacterium]
Length=782

 Score = 66.6 bits (161),  Expect = 2e-09, Method: Composition-based stats.
 Identities = 30/53 (57%), Positives = 40/53 (75%), Gaps = 1/53 (2%)
 Frame = +1

Query  400  YGDALKIAMQFFDVQKSGKL-VDNKISWRGDSGLKDGKSASLDLSKGMYDAGD  555
            YG+AL+ A+ F+D Q+SG+L   N+++WRGDSGL DG    LDL+ G YDAGD
Sbjct  31   YGEALQKAIWFYDAQRSGRLPAGNRVNWRGDSGLNDGADVGLDLTGGWYDAGD  83



>ref|WP_037256689.1| endoglucanase, partial [Rhodococcus rhodnii]
Length=634

 Score = 66.6 bits (161),  Expect = 2e-09, Method: Composition-based stats.
 Identities = 30/56 (54%), Positives = 42/56 (75%), Gaps = 1/56 (2%)
 Frame = +1

Query  391  TQKYGDALKIAMQFFDVQKSGKL-VDNKISWRGDSGLKDGKSASLDLSKGMYDAGD  555
            T  YG+AL+ ++ F+D Q+SG+L  +N++SWRGDS + DG+   LDLS G YDAGD
Sbjct  31   TFNYGEALQKSVWFYDAQRSGRLPANNRVSWRGDSAVTDGQDVGLDLSGGFYDAGD  86



>ref|WP_033300787.1| endoglucanase [Streptomyces atroolivaceus]
Length=773

 Score = 66.6 bits (161),  Expect = 2e-09, Method: Composition-based stats.
 Identities = 31/53 (58%), Positives = 42/53 (79%), Gaps = 1/53 (2%)
 Frame = +1

Query  400  YGDALKIAMQFFDVQKSGKLV-DNKISWRGDSGLKDGKSASLDLSKGMYDAGD  555
            YG+AL+ ++ F+D Q+SG+L  DN++SWRGDSG+ DGK   LDL+ G YDAGD
Sbjct  32   YGEALQKSLFFYDAQRSGELPEDNRVSWRGDSGMDDGKDVGLDLTGGWYDAGD  84



>ref|WP_013732376.1| endoglucanase [Verrucosispora maris]
 gb|AEB43708.1| glycoside hydrolase family 9 [Verrucosispora maris AB-18-032]
Length=972

 Score = 66.6 bits (161),  Expect = 2e-09, Method: Composition-based stats.
 Identities = 32/75 (43%), Positives = 46/75 (61%), Gaps = 1/75 (1%)
 Frame = +1

Query  334  GGGSSEPDaapvpgppgavTQKYGDALKIAMQFFDVQKSGKLVD-NKISWRGDSGLKDGK  510
              G + P +        A    Y +AL+ ++ F++ Q+SGKL D N++SWRGDSGL+DG 
Sbjct  44   AAGVAAPTSGDASTSAAAPAFNYAEALQKSLLFYEAQQSGKLPDWNRVSWRGDSGLRDGS  103

Query  511  SASLDLSKGMYDAGD  555
               +DL+ G YDAGD
Sbjct  104  DVGIDLTGGWYDAGD  118



>ref|WP_033388930.1| endoglucanase, partial [Kibdelosporangium aridum]
Length=321

 Score = 65.1 bits (157),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 30/56 (54%), Positives = 42/56 (75%), Gaps = 1/56 (2%)
 Frame = +1

Query  391  TQKYGDALKIAMQFFDVQKSGKL-VDNKISWRGDSGLKDGKSASLDLSKGMYDAGD  555
            T  YG+AL+ ++ F+D Q+SG+L  +N++SWRGDS + DG+   LDLS G YDAGD
Sbjct  31   TFNYGEALQKSVWFYDAQRSGRLPANNRVSWRGDSAVTDGQDVGLDLSGGFYDAGD  86



>ref|WP_026163194.1| endoglucanase [Kribbella catacumbae]
Length=882

 Score = 66.2 bits (160),  Expect = 2e-09, Method: Composition-based stats.
 Identities = 30/53 (57%), Positives = 41/53 (77%), Gaps = 1/53 (2%)
 Frame = +1

Query  400  YGDALKIAMQFFDVQKSGKL-VDNKISWRGDSGLKDGKSASLDLSKGMYDAGD  555
            YG+AL+ A+ F+D Q+SG L  DN++SWRG+S L+DG  A L+L+ G YDAGD
Sbjct  36   YGEALQKAIWFYDAQRSGVLPADNRVSWRGNSALQDGSDAGLNLTGGFYDAGD  88



>ref|WP_014256118.1| cellulose 1,4-beta-cellobiosidase [[Clostridium] clariflavum]
 gb|AEV69573.1| Cellulose binding domain-containing protein [ [[Clostridium] 
clariflavum DSM 19732]
Length=1541

 Score = 66.2 bits (160),  Expect = 3e-09, Method: Composition-based stats.
 Identities = 31/54 (57%), Positives = 40/54 (74%), Gaps = 2/54 (4%)
 Frame = +1

Query  400  YGDALKIAMQFFDVQKSGKLVDN--KISWRGDSGLKDGKSASLDLSKGMYDAGD  555
            YG+AL+ A+ F+D Q+SGKL     +++WRGDSGL DGK   LDL+ G YDAGD
Sbjct  735  YGEALQKAIFFYDCQRSGKLSSTVLRLNWRGDSGLNDGKDVGLDLTGGFYDAGD  788



>ref|WP_041713952.1| endoglucanase, partial [Cellulosilyticum lentocellum]
Length=656

 Score = 65.9 bits (159),  Expect = 3e-09, Method: Composition-based stats.
 Identities = 32/53 (60%), Positives = 39/53 (74%), Gaps = 1/53 (2%)
 Frame = +1

Query  400  YGDALKIAMQFFDVQKSGKLVDN-KISWRGDSGLKDGKSASLDLSKGMYDAGD  555
            YGDA + A+ F++ QKSG L DN + +WRGDSGLKDG    LDL+ G YDAGD
Sbjct  40   YGDAFQKALMFYEFQKSGDLPDNQRNNWRGDSGLKDGADVGLDLTGGWYDAGD  92



>ref|WP_027621856.1| cellulose 1,4-beta-cellobiosidase [[Clostridium] clariflavum]
Length=1541

 Score = 66.2 bits (160),  Expect = 3e-09, Method: Composition-based stats.
 Identities = 31/54 (57%), Positives = 40/54 (74%), Gaps = 2/54 (4%)
 Frame = +1

Query  400  YGDALKIAMQFFDVQKSGKLVDN--KISWRGDSGLKDGKSASLDLSKGMYDAGD  555
            YG+AL+ A+ F+D Q+SGKL     +++WRGDSGL DGK   LDL+ G YDAGD
Sbjct  735  YGEALQKAIFFYDCQRSGKLSSTVLRLNWRGDSGLNDGKDVGLDLTGGFYDAGD  788



>ref|WP_030488613.1| endoglucanase [Micromonospora chokoriensis]
Length=967

 Score = 65.9 bits (159),  Expect = 3e-09, Method: Composition-based stats.
 Identities = 30/56 (54%), Positives = 42/56 (75%), Gaps = 1/56 (2%)
 Frame = +1

Query  391  TQKYGDALKIAMQFFDVQKSGKLVD-NKISWRGDSGLKDGKSASLDLSKGMYDAGD  555
            T  Y +AL+ ++ F++ Q+SG+L D N++SWRGDS L DG SA +DL+ G YDAGD
Sbjct  56   TYNYAEALQKSLLFYEAQQSGRLPDWNRVSWRGDSALTDGASAGVDLTGGWYDAGD  111



>pdb|1JS4|A Chain A, EndoEXOCELLULASE:CELLOBIOSE FROM THERMOMONOSPORA
 pdb|1JS4|B Chain B, EndoEXOCELLULASE:CELLOBIOSE FROM THERMOMONOSPORA
 pdb|4TF4|A Chain A, EndoEXOCELLULASE:CELLOPENTAOSE FROM THERMOMONOSPORA
 pdb|4TF4|B Chain B, EndoEXOCELLULASE:CELLOPENTAOSE FROM THERMOMONOSPORA
 pdb|3TF4|A Chain A, EndoEXOCELLULASE:CELLOTRIOSE FROM THERMOMONOSPORA
 pdb|3TF4|B Chain B, EndoEXOCELLULASE:CELLOTRIOSE FROM THERMOMONOSPORA
 pdb|1TF4|A Chain A, EndoEXOCELLULASE FROM THERMOMONOSPORA
 pdb|1TF4|B Chain B, EndoEXOCELLULASE FROM THERMOMONOSPORA
Length=605

 Score = 65.5 bits (158),  Expect = 3e-09, Method: Composition-based stats.
 Identities = 30/53 (57%), Positives = 40/53 (75%), Gaps = 1/53 (2%)
 Frame = +1

Query  400  YGDALKIAMQFFDVQKSGKLVDN-KISWRGDSGLKDGKSASLDLSKGMYDAGD  555
            Y +AL+ +M F++ Q+SGKL +N ++SWRGDSGL DG    LDL+ G YDAGD
Sbjct  6    YAEALQKSMFFYEAQRSGKLPENNRVSWRGDSGLNDGADVGLDLTGGWYDAGD  58



>ref|WP_010251308.1| endoglucanase [Acetivibrio cellulolyticus]
Length=733

 Score = 65.9 bits (159),  Expect = 3e-09, Method: Composition-based stats.
 Identities = 31/53 (58%), Positives = 41/53 (77%), Gaps = 1/53 (2%)
 Frame = +1

Query  400  YGDALKIAMQFFDVQKSGKLVD-NKISWRGDSGLKDGKSASLDLSKGMYDAGD  555
            YG+AL+ A+ F++ Q+SG L D N+++WRGDSGL DG  A LDL+ G YDAGD
Sbjct  32   YGEALQKAIIFYECQRSGDLPDDNRVNWRGDSGLADGSDAGLDLTGGWYDAGD  84



>ref|WP_015942124.1| endoglucanase [Chloroflexus aggregans]
 gb|ACL26277.1| glycoside hydrolase family 9 [Chloroflexus aggregans DSM 9485]
Length=794

 Score = 65.9 bits (159),  Expect = 3e-09, Method: Composition-based stats.
 Identities = 28/53 (53%), Positives = 41/53 (77%), Gaps = 1/53 (2%)
 Frame = +1

Query  400  YGDALKIAMQFFDVQKSGKLV-DNKISWRGDSGLKDGKSASLDLSKGMYDAGD  555
            YG+AL+ ++ F+++Q+SG+L  DN++ WRGDSGL DG    +DL+ G YDAGD
Sbjct  32   YGEALQKSIFFYEIQRSGRLPPDNRVRWRGDSGLNDGADVGIDLTGGWYDAGD  84



>ref|WP_027622694.1| endoglucanase [[Clostridium] clariflavum]
Length=732

 Score = 65.5 bits (158),  Expect = 3e-09, Method: Composition-based stats.
 Identities = 29/53 (55%), Positives = 43/53 (81%), Gaps = 1/53 (2%)
 Frame = +1

Query  400  YGDALKIAMQFFDVQKSGKLVDN-KISWRGDSGLKDGKSASLDLSKGMYDAGD  555
            YG+AL+ ++ F+++Q+SG+L +N +++WRGDSGL DG  A LDL+ G YDAGD
Sbjct  31   YGEALQKSIIFYEMQRSGRLPENNRVNWRGDSGLNDGADAGLDLTGGWYDAGD  83



>ref|WP_034836413.1| endoglucanase [[Clostridium] cellulosi]
Length=986

 Score = 65.9 bits (159),  Expect = 3e-09, Method: Composition-based stats.
 Identities = 31/53 (58%), Positives = 40/53 (75%), Gaps = 1/53 (2%)
 Frame = +1

Query  400  YGDALKIAMQFFDVQKSGKLVDNKI-SWRGDSGLKDGKSASLDLSKGMYDAGD  555
            YG+AL+ A+ F++ Q+SGKL +NK  +WRGDSGL DG    LDL+ G YDAGD
Sbjct  32   YGEALQKAIMFYEFQRSGKLPENKRDNWRGDSGLNDGADVGLDLTGGWYDAGD  84



>sp|P23659.1|GUNZ_CLOSR RecName: Full=Endoglucanase Z; AltName: Full=Avicelase I; AltName: 
Full=Endo-1,4-beta-glucanase; AltName: Full=Thermoactive 
cellulase; Flags: Precursor [[Clostridium] stercorarium]
Length=986

 Score = 65.9 bits (159),  Expect = 3e-09, Method: Composition-based stats.
 Identities = 31/53 (58%), Positives = 40/53 (75%), Gaps = 1/53 (2%)
 Frame = +1

Query  400  YGDALKIAMQFFDVQKSGKLVDNKI-SWRGDSGLKDGKSASLDLSKGMYDAGD  555
            YG+AL+ A+ F++ Q+SGKL +NK  +WRGDSGL DG    LDL+ G YDAGD
Sbjct  32   YGEALQKAIMFYEFQRSGKLPENKRDNWRGDSGLNDGADVGLDLTGGWYDAGD  84



>ref|WP_036329993.1| endoglucanase [Microbispora sp. ATCC PTA-5024]
 gb|ETK32597.1| endoglucanase [Microbispora sp. ATCC PTA-5024]
Length=795

 Score = 65.9 bits (159),  Expect = 3e-09, Method: Composition-based stats.
 Identities = 31/53 (58%), Positives = 41/53 (77%), Gaps = 1/53 (2%)
 Frame = +1

Query  400  YGDALKIAMQFFDVQKSGKLVD-NKISWRGDSGLKDGKSASLDLSKGMYDAGD  555
            YG+AL+ ++ F++ Q+SGKL   N++SWRGDSGL DGK   LDL+ G YDAGD
Sbjct  30   YGEALQKSLFFYEAQQSGKLPSTNRVSWRGDSGLNDGKDVGLDLTGGWYDAGD  82



>emb|CAA39010.1| endo-beta-1,4-glucanase (Avicelase I) [ [[Clostridium] stercorarium]
Length=946

 Score = 65.9 bits (159),  Expect = 3e-09, Method: Composition-based stats.
 Identities = 31/53 (58%), Positives = 40/53 (75%), Gaps = 1/53 (2%)
 Frame = +1

Query  400  YGDALKIAMQFFDVQKSGKLVDNKI-SWRGDSGLKDGKSASLDLSKGMYDAGD  555
            YG+AL+ A+ F++ Q+SGKL +NK  +WRGDSGL DG    LDL+ G YDAGD
Sbjct  32   YGEALQKAIMFYEFQRSGKLPENKRDNWRGDSGLNDGADVGLDLTGGWYDAGD  84



>ref|WP_014254351.1| endoglucanase [[Clostridium] clariflavum]
 gb|AEV67733.1| Cellulose binding domain-containing protein,dockerin-like protein 
[ [[Clostridium] clariflavum DSM 19732]
Length=732

 Score = 65.5 bits (158),  Expect = 3e-09, Method: Composition-based stats.
 Identities = 29/53 (55%), Positives = 43/53 (81%), Gaps = 1/53 (2%)
 Frame = +1

Query  400  YGDALKIAMQFFDVQKSGKLVDN-KISWRGDSGLKDGKSASLDLSKGMYDAGD  555
            YG+AL+ ++ F+++Q+SG+L +N +++WRGDSGL DG  A LDL+ G YDAGD
Sbjct  31   YGEALQKSIIFYEMQRSGRLPENNRVNWRGDSGLNDGADAGLDLTGGWYDAGD  83



>ref|WP_015359553.1| endoglucanase Z [[Clostridium] stercorarium]
 ref|YP_007679888.1| CelZ [ [[Clostridium] stercorarium subsp. stercorarium DSM 8532]
 gb|AGC68873.1| endoglucanase Z [ [[Clostridium] stercorarium subsp. stercorarium 
DSM 8532]
 gb|AGI39870.1| CelZ [ [[Clostridium] stercorarium subsp. stercorarium DSM 8532]
Length=986

 Score = 65.9 bits (159),  Expect = 3e-09, Method: Composition-based stats.
 Identities = 31/53 (58%), Positives = 40/53 (75%), Gaps = 1/53 (2%)
 Frame = +1

Query  400  YGDALKIAMQFFDVQKSGKLVDNKI-SWRGDSGLKDGKSASLDLSKGMYDAGD  555
            YG+AL+ A+ F++ Q+SGKL +NK  +WRGDSGL DG    LDL+ G YDAGD
Sbjct  32   YGEALQKAIMFYEFQRSGKLPENKRDNWRGDSGLNDGADVGLDLTGGWYDAGD  84



>ref|WP_030336140.1| endoglucanase [Micromonospora parva]
Length=967

 Score = 65.5 bits (158),  Expect = 4e-09, Method: Composition-based stats.
 Identities = 30/56 (54%), Positives = 42/56 (75%), Gaps = 1/56 (2%)
 Frame = +1

Query  391  TQKYGDALKIAMQFFDVQKSGKLVD-NKISWRGDSGLKDGKSASLDLSKGMYDAGD  555
            T  Y +AL+ ++ F++ Q+SG+L D N++SWRGDS L DG SA +DL+ G YDAGD
Sbjct  56   TYNYAEALQKSLLFYEAQQSGRLPDWNRVSWRGDSALTDGASAGVDLTGGWYDAGD  111



>ref|NP_181984.1| glycosyl hydrolase 9B11 [Arabidopsis thaliana]
 sp|Q8S8Q4.2|GUN14_ARATH RecName: Full=Endoglucanase 14; AltName: Full=Endo-1,4-beta glucanase 
14; Flags: Precursor [Arabidopsis thaliana]
 gb|AAC27458.1| putative glucanase [Arabidopsis thaliana]
 dbj|BAD43652.1| putative glucanase [Arabidopsis thaliana]
 gb|AEC10438.1| glycosyl hydrolase 9B11 [Arabidopsis thaliana]
Length=491

 Score = 65.1 bits (157),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 29/56 (52%), Positives = 42/56 (75%), Gaps = 1/56 (2%)
 Frame = +1

Query  391  TQKYGDALKIAMQFFDVQKSGKLVDN-KISWRGDSGLKDGKSASLDLSKGMYDAGD  555
            ++ YGDAL  ++ +F+ Q+SGKL  N +++WRGDS L+DG  A +DL+ G YDAGD
Sbjct  31   SRNYGDALTKSLLYFEAQRSGKLPSNQRVTWRGDSALRDGSDAHVDLTGGYYDAGD  86



>ref|WP_026214358.1| endoglucanase [Nonomuraea coxensis]
Length=860

 Score = 65.5 bits (158),  Expect = 4e-09, Method: Composition-based stats.
 Identities = 31/53 (58%), Positives = 41/53 (77%), Gaps = 1/53 (2%)
 Frame = +1

Query  400  YGDALKIAMQFFDVQKSGKLVD-NKISWRGDSGLKDGKSASLDLSKGMYDAGD  555
            YG+AL+ ++ F++ Q+SG L   N++SWRGDSGL DGK A LDL+ G YDAGD
Sbjct  56   YGEALQKSLWFYEAQQSGDLPAWNRVSWRGDSGLNDGKDAGLDLTGGWYDAGD  108



>ref|WP_033441521.1| endoglucanase, partial [Saccharothrix sp. NRRL B-16314]
Length=828

 Score = 65.5 bits (158),  Expect = 4e-09, Method: Composition-based stats.
 Identities = 29/53 (55%), Positives = 39/53 (74%), Gaps = 1/53 (2%)
 Frame = +1

Query  400  YGDALKIAMQFFDVQKSGKL-VDNKISWRGDSGLKDGKSASLDLSKGMYDAGD  555
            Y +AL+ ++ F+D Q+SG L  DN+++WRGDS L+DG    LDLS G YDAGD
Sbjct  37   YAEALQKSIWFYDAQRSGALPADNRVNWRGDSALRDGSDVGLDLSGGFYDAGD  89



>ref|XP_002881963.1| glycosyl hydrolase family 9 protein [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH58222.1| glycosyl hydrolase family 9 protein [Arabidopsis lyrata subsp. 
lyrata]
Length=490

 Score = 65.1 bits (157),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 28/56 (50%), Positives = 42/56 (75%), Gaps = 1/56 (2%)
 Frame = +1

Query  391  TQKYGDALKIAMQFFDVQKSGKLVDN-KISWRGDSGLKDGKSASLDLSKGMYDAGD  555
            +  YG+AL+ ++ +F+ Q+SGKL  N +++WRGDS L+DG  A +DL+ G YDAGD
Sbjct  31   STNYGEALRNSLLYFEAQRSGKLPSNQRVTWRGDSALRDGSDAHIDLTGGYYDAGD  86



>gb|ACZ83939.1| hypothetical protein Sros_0935 [Streptosporangium roseum DSM 
43021]
Length=847

 Score = 65.5 bits (158),  Expect = 4e-09, Method: Composition-based stats.
 Identities = 30/53 (57%), Positives = 41/53 (77%), Gaps = 1/53 (2%)
 Frame = +1

Query  400  YGDALKIAMQFFDVQKSGKLVD-NKISWRGDSGLKDGKSASLDLSKGMYDAGD  555
            YG+AL+ ++ F++ Q+SG+L   N++ WRGDSGL DGK A LDL+ G YDAGD
Sbjct  40   YGEALQKSIWFYEAQQSGRLPSWNRVGWRGDSGLDDGKDAGLDLTGGWYDAGD  92



>dbj|BAK07919.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=496

 Score = 64.7 bits (156),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 31/54 (57%), Positives = 40/54 (74%), Gaps = 1/54 (2%)
 Frame = +1

Query  397  KYGDALKIAMQFFDVQKSGKLV-DNKISWRGDSGLKDGKSASLDLSKGMYDAGD  555
             Y DAL  ++ F + Q+SGKL  DN+I WRGDSG++DGK A +DL+ G YDAGD
Sbjct  37   NYKDALTKSIMFLEAQRSGKLPPDNRIKWRGDSGMEDGKLAHVDLTGGYYDAGD  90



>dbj|BAK07001.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=485

 Score = 64.7 bits (156),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 31/54 (57%), Positives = 40/54 (74%), Gaps = 1/54 (2%)
 Frame = +1

Query  397  KYGDALKIAMQFFDVQKSGKLV-DNKISWRGDSGLKDGKSASLDLSKGMYDAGD  555
             Y DAL  ++ F + Q+SGKL  DN+I WRGDSG++DGK A +DL+ G YDAGD
Sbjct  26   NYKDALTKSIMFLEAQRSGKLPPDNRIKWRGDSGMEDGKLAHVDLTGGYYDAGD  79



>gb|KFK37261.1| hypothetical protein AALP_AA4G234600 [Arabis alpina]
Length=688

 Score = 65.1 bits (157),  Expect = 5e-09, Method: Composition-based stats.
 Identities = 27/53 (51%), Positives = 40/53 (75%), Gaps = 1/53 (2%)
 Frame = +1

Query  400  YGDALKIAMQFFDVQKSGKL-VDNKISWRGDSGLKDGKSASLDLSKGMYDAGD  555
            YG+AL  ++ +F+ Q+SGKL ++ ++ WRGDS L+DG  A +DL+ G YDAGD
Sbjct  227  YGEALTKSLLYFEAQRSGKLPLNQRVDWRGDSALRDGSDAHIDLTGGYYDAGD  279



>ref|WP_030924458.1| endoglucanase [Streptosporangium amethystogenes]
Length=851

 Score = 65.1 bits (157),  Expect = 5e-09, Method: Composition-based stats.
 Identities = 30/53 (57%), Positives = 41/53 (77%), Gaps = 1/53 (2%)
 Frame = +1

Query  400  YGDALKIAMQFFDVQKSGKLVD-NKISWRGDSGLKDGKSASLDLSKGMYDAGD  555
            YG+AL+ ++ F++ Q+SGKL   N++SWRGDSGL DG+   LDL+ G YDAGD
Sbjct  44   YGEALQKSIWFYEAQQSGKLPSWNRVSWRGDSGLTDGQDVGLDLTGGWYDAGD  96



>ref|WP_043651319.1| endoglucanase [Streptosporangium roseum]
Length=860

 Score = 65.1 bits (157),  Expect = 5e-09, Method: Composition-based stats.
 Identities = 30/53 (57%), Positives = 41/53 (77%), Gaps = 1/53 (2%)
 Frame = +1

Query  400  YGDALKIAMQFFDVQKSGKLVD-NKISWRGDSGLKDGKSASLDLSKGMYDAGD  555
            YG+AL+ ++ F++ Q+SG+L   N++ WRGDSGL DGK A LDL+ G YDAGD
Sbjct  53   YGEALQKSIWFYEAQQSGRLPSWNRVGWRGDSGLDDGKDAGLDLTGGWYDAGD  105



>ref|WP_030468638.1| endoglucanase [Lechevalieria aerocolonigenes]
Length=884

 Score = 65.1 bits (157),  Expect = 5e-09, Method: Composition-based stats.
 Identities = 30/53 (57%), Positives = 39/53 (74%), Gaps = 1/53 (2%)
 Frame = +1

Query  400  YGDALKIAMQFFDVQKSGKLV-DNKISWRGDSGLKDGKSASLDLSKGMYDAGD  555
            Y +AL+ ++ F+D Q+SGKL  DN++SWR DS L+DG    LDLS G YDAGD
Sbjct  36   YAEALQKSVWFYDAQRSGKLSPDNRVSWRADSALRDGSDVGLDLSGGFYDAGD  88



>gb|EOD65654.1| endoglucanase [Amycolatopsis vancoresmycina DSM 44592]
Length=884

 Score = 65.1 bits (157),  Expect = 5e-09, Method: Composition-based stats.
 Identities = 31/53 (58%), Positives = 39/53 (74%), Gaps = 1/53 (2%)
 Frame = +1

Query  400  YGDALKIAMQFFDVQKSGKL-VDNKISWRGDSGLKDGKSASLDLSKGMYDAGD  555
            YG+AL+ A+ F+D Q+SG L   N++SWRG S L DGK A LDL+ G YDAGD
Sbjct  30   YGEALQKAVWFYDAQRSGALPAGNRVSWRGPSALNDGKDAGLDLTGGFYDAGD  82



>ref|WP_033261197.1| endoglucanase [Amycolatopsis vancoresmycina]
Length=892

 Score = 65.1 bits (157),  Expect = 5e-09, Method: Composition-based stats.
 Identities = 31/53 (58%), Positives = 39/53 (74%), Gaps = 1/53 (2%)
 Frame = +1

Query  400  YGDALKIAMQFFDVQKSGKL-VDNKISWRGDSGLKDGKSASLDLSKGMYDAGD  555
            YG+AL+ A+ F+D Q+SG L   N++SWRG S L DGK A LDL+ G YDAGD
Sbjct  38   YGEALQKAVWFYDAQRSGALPAGNRVSWRGPSALNDGKDAGLDLTGGFYDAGD  90



>ref|WP_011292599.1| endoglucanase [Thermobifida fusca]
 sp|P26221.2|GUN4_THEFU RecName: Full=Endoglucanase E-4; AltName: Full=Cellulase E-4; 
AltName: Full=Cellulase E4; AltName: Full=Endo-1,4-beta-glucanase 
E-4; Flags: Precursor [Thermobifida fusca]
 gb|AAB42155.1| beta-1,4-endoglucanase precursor [Thermobifida fusca YX]
 gb|AAZ56209.1| endoglucanase. Glycosyl Hydrolase family 9 [Thermobifida fusca 
YX]
 gb|EOR70746.1| endoglucanase [Thermobifida fusca TM51]
Length=880

 Score = 65.1 bits (157),  Expect = 6e-09, Method: Composition-based stats.
 Identities = 30/53 (57%), Positives = 40/53 (75%), Gaps = 1/53 (2%)
 Frame = +1

Query  400  YGDALKIAMQFFDVQKSGKLVDN-KISWRGDSGLKDGKSASLDLSKGMYDAGD  555
            Y +AL+ +M F++ Q+SGKL +N ++SWRGDSGL DG    LDL+ G YDAGD
Sbjct  52   YAEALQKSMFFYEAQRSGKLPENNRVSWRGDSGLNDGADVGLDLTGGWYDAGD  104



>gb|EDX71299.1| Glycosyl hydrolase family 9 [Coleofasciculus chthonoplastes PCC 
7420]
Length=658

 Score = 64.7 bits (156),  Expect = 6e-09, Method: Composition-based stats.
 Identities = 29/53 (55%), Positives = 39/53 (74%), Gaps = 1/53 (2%)
 Frame = +1

Query  400  YGDALKIAMQFFDVQKSGKL-VDNKISWRGDSGLKDGKSASLDLSKGMYDAGD  555
            YG+ L+ A+ F+DVQ+SGKL  +N++ WRGDS L DG    +DL+ G YDAGD
Sbjct  49   YGEVLQKAVYFYDVQRSGKLPANNRVEWRGDSALTDGADNGIDLTGGWYDAGD  101



>gb|ADX41578.1| Cel9A [synthetic construct]
Length=835

 Score = 65.1 bits (157),  Expect = 6e-09, Method: Composition-based stats.
 Identities = 30/53 (57%), Positives = 40/53 (75%), Gaps = 1/53 (2%)
 Frame = +1

Query  400  YGDALKIAMQFFDVQKSGKLVDN-KISWRGDSGLKDGKSASLDLSKGMYDAGD  555
            Y +AL+ +M F++ Q+SGKL +N ++SWRGDSGL DG    LDL+ G YDAGD
Sbjct  7    YAEALQKSMFFYEAQRSGKLPENNRVSWRGDSGLNDGADVGLDLTGGWYDAGD  59



>ref|WP_026468148.1| endoglucanase [Amycolatopsis balhimycina]
Length=892

 Score = 64.7 bits (156),  Expect = 6e-09, Method: Composition-based stats.
 Identities = 31/53 (58%), Positives = 39/53 (74%), Gaps = 1/53 (2%)
 Frame = +1

Query  400  YGDALKIAMQFFDVQKSGKL-VDNKISWRGDSGLKDGKSASLDLSKGMYDAGD  555
            Y +AL+ A+ F+D Q+SG L  DN++SWRG S L DGK A LDL+ G YDAGD
Sbjct  40   YAEALQKAVWFYDAQRSGALPADNRVSWRGPSALDDGKDAGLDLTGGFYDAGD  92



>ref|NP_001288415.1| endoglucanase 4-like [Zea mays]
 gb|AFW69905.1| hypothetical protein ZEAMMB73_402804 [Zea mays]
 gb|AGG19099.1| cellulase [Zea mays]
Length=523

 Score = 64.3 bits (155),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 31/54 (57%), Positives = 39/54 (72%), Gaps = 1/54 (2%)
 Frame = +1

Query  397  KYGDALKIAMQFFDVQKSGKLVD-NKISWRGDSGLKDGKSASLDLSKGMYDAGD  555
             Y DAL  A+ FF+ Q+SGKL    +++WRGDSGL DG +A LDL+ G YDAGD
Sbjct  42   NYADALDKALLFFEAQRSGKLPPGQRVTWRGDSGLTDGSAAGLDLAGGYYDAGD  95



>ref|WP_007457075.1| endoglucanase [Micromonospora lupini]
 emb|CCH16859.1| Extracellular cellulase B [Micromonospora lupini str. Lupac 08]
Length=964

 Score = 64.7 bits (156),  Expect = 6e-09, Method: Composition-based stats.
 Identities = 30/53 (57%), Positives = 40/53 (75%), Gaps = 1/53 (2%)
 Frame = +1

Query  400  YGDALKIAMQFFDVQKSGKLVD-NKISWRGDSGLKDGKSASLDLSKGMYDAGD  555
            Y +AL+ ++ F++ Q+SGKL D N++SWRGDS L DG  A LDL+ G YDAGD
Sbjct  56   YAEALQKSLLFYEAQQSGKLPDWNRVSWRGDSALTDGAGAGLDLTGGWYDAGD  108



>emb|CAZ96116.1| endoglucanase 4 precursor [Saccharum hybrid cultivar R570]
Length=556

 Score = 64.3 bits (155),  Expect = 6e-09, Method: Composition-based stats.
 Identities = 30/54 (56%), Positives = 39/54 (72%), Gaps = 2/54 (4%)
 Frame = +1

Query  400  YGDALKIAMQFFDVQKSGKLV--DNKISWRGDSGLKDGKSASLDLSKGMYDAGD  555
            Y DAL  A+ FF+ Q+SGKL     +++WRGDSGL DG +A +DL+ G YDAGD
Sbjct  38   YADALDKALLFFEAQRSGKLPAGQQRVTWRGDSGLSDGSAAGVDLAGGYYDAGD  91



>ref|XP_006826915.1| hypothetical protein AMTR_s00010p00165730 [Amborella trichopoda]
 gb|ERM94152.1| hypothetical protein AMTR_s00010p00165730 [Amborella trichopoda]
Length=485

 Score = 64.3 bits (155),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 31/56 (55%), Positives = 41/56 (73%), Gaps = 1/56 (2%)
 Frame = +1

Query  391  TQKYGDALKIAMQFFDVQKSGKLVDN-KISWRGDSGLKDGKSASLDLSKGMYDAGD  555
            +  YGDALK  + FF+ Q+SGKL  N +++WR DS LKDG +A +DL+ G YDAGD
Sbjct  21   SHDYGDALKKCITFFEGQRSGKLPSNQRLTWRRDSALKDGSAAHVDLTGGYYDAGD  76



>ref|WP_026418585.1| glycosyl hydrolase family 9 [Actinoalloteichus cyanogriseus]
Length=499

 Score = 64.3 bits (155),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 30/54 (56%), Positives = 39/54 (72%), Gaps = 1/54 (2%)
 Frame = +1

Query  397  KYGDALKIAMQFFDVQKSGKL-VDNKISWRGDSGLKDGKSASLDLSKGMYDAGD  555
             YG+AL+ ++ F+D Q+SG L  DN++SWRGDS + DG    LDLS G YDAGD
Sbjct  45   NYGEALQKSIWFYDAQRSGVLPADNRVSWRGDSAVDDGSDVGLDLSGGFYDAGD  98



>ref|WP_016698150.1| hypothetical protein [Actinoalloteichus spitiensis]
Length=499

 Score = 64.3 bits (155),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 30/54 (56%), Positives = 39/54 (72%), Gaps = 1/54 (2%)
 Frame = +1

Query  397  KYGDALKIAMQFFDVQKSGKL-VDNKISWRGDSGLKDGKSASLDLSKGMYDAGD  555
             YG+AL+ ++ F+D Q+SG L  DN++SWRGDS + DG    LDLS G YDAGD
Sbjct  45   NYGEALQKSIWFYDAQRSGVLPADNRVSWRGDSAVDDGSDVGLDLSGGFYDAGD  98



>ref|WP_036944358.1| endoglucanase, partial [Pseudobacteroides cellulosolvens]
Length=653

 Score = 64.3 bits (155),  Expect = 7e-09, Method: Composition-based stats.
 Identities = 29/53 (55%), Positives = 40/53 (75%), Gaps = 1/53 (2%)
 Frame = +1

Query  400  YGDALKIAMQFFDVQKSGKLVDN-KISWRGDSGLKDGKSASLDLSKGMYDAGD  555
            YG+AL+  + F++ Q+SGKL DN + +WRGDSG+ DG  + LDL+ G YDAGD
Sbjct  38   YGEALQKGIMFYEFQRSGKLPDNMRTNWRGDSGMTDGADSGLDLTGGWYDAGD  90



>ref|XP_001775325.1| predicted protein [Physcomitrella patens]
 gb|EDQ59795.1| predicted protein [Physcomitrella patens]
Length=608

 Score = 64.3 bits (155),  Expect = 7e-09, Method: Composition-based stats.
 Identities = 31/53 (58%), Positives = 38/53 (72%), Gaps = 1/53 (2%)
 Frame = +1

Query  400  YGDALKIAMQFFDVQKSGKLV-DNKISWRGDSGLKDGKSASLDLSKGMYDAGD  555
            Y  ALK+A++FFD QKSG L   N ISWR  SGL DG+ A ++L+ G YDAGD
Sbjct  106  YTIALKMALKFFDAQKSGHLPPSNNISWRSHSGLNDGRDAGVNLTGGYYDAGD  158



>gb|EMT15618.1| Endoglucanase 8 [Aegilops tauschii]
Length=508

 Score = 64.3 bits (155),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 31/54 (57%), Positives = 40/54 (74%), Gaps = 1/54 (2%)
 Frame = +1

Query  397  KYGDALKIAMQFFDVQKSGKLV-DNKISWRGDSGLKDGKSASLDLSKGMYDAGD  555
             Y DAL  ++ F + Q+SGKL  DN+I WRGDSG++DGK A +DL+ G YDAGD
Sbjct  42   NYKDALTKSILFLEAQRSGKLPPDNRIKWRGDSGMEDGKLAHVDLTGGYYDAGD  95



>ref|WP_044210906.1| endoglucanase [Coleofasciculus chthonoplastes]
Length=629

 Score = 64.3 bits (155),  Expect = 8e-09, Method: Composition-based stats.
 Identities = 29/53 (55%), Positives = 39/53 (74%), Gaps = 1/53 (2%)
 Frame = +1

Query  400  YGDALKIAMQFFDVQKSGKL-VDNKISWRGDSGLKDGKSASLDLSKGMYDAGD  555
            YG+ L+ A+ F+DVQ+SGKL  +N++ WRGDS L DG    +DL+ G YDAGD
Sbjct  20   YGEVLQKAVYFYDVQRSGKLPANNRVEWRGDSALTDGADNGIDLTGGWYDAGD  72



>ref|WP_033257952.1| endoglucanase [Kitasatospora setae]
Length=805

 Score = 64.3 bits (155),  Expect = 8e-09, Method: Composition-based stats.
 Identities = 30/53 (57%), Positives = 40/53 (75%), Gaps = 1/53 (2%)
 Frame = +1

Query  400  YGDALKIAMQFFDVQKSGKL-VDNKISWRGDSGLKDGKSASLDLSKGMYDAGD  555
            YG+AL+ ++ F++ Q+SGKL   N++SWRGDS L DGK   LDL+ G YDAGD
Sbjct  42   YGEALQKSLLFYEAQQSGKLPATNRVSWRGDSALDDGKDVGLDLTGGWYDAGD  94



>dbj|BAJ32778.1| putative endoglucanase precursor [Kitasatospora setae KM-6054]
Length=840

 Score = 64.3 bits (155),  Expect = 8e-09, Method: Composition-based stats.
 Identities = 30/53 (57%), Positives = 40/53 (75%), Gaps = 1/53 (2%)
 Frame = +1

Query  400  YGDALKIAMQFFDVQKSGKL-VDNKISWRGDSGLKDGKSASLDLSKGMYDAGD  555
            YG+AL+ ++ F++ Q+SGKL   N++SWRGDS L DGK   LDL+ G YDAGD
Sbjct  77   YGEALQKSLLFYEAQQSGKLPATNRVSWRGDSALDDGKDVGLDLTGGWYDAGD  129



>ref|XP_001774444.1| predicted protein [Physcomitrella patens]
 gb|EDQ60807.1| predicted protein [Physcomitrella patens]
Length=622

 Score = 64.3 bits (155),  Expect = 8e-09, Method: Composition-based stats.
 Identities = 31/53 (58%), Positives = 38/53 (72%), Gaps = 1/53 (2%)
 Frame = +1

Query  400  YGDALKIAMQFFDVQKSGKLVDN-KISWRGDSGLKDGKSASLDLSKGMYDAGD  555
            YGDAL  +  F + Q+SGKL  N +++WRGDSGL DG SA +DL  G YDAGD
Sbjct  32   YGDALHKSFLFLEAQRSGKLPANQRVNWRGDSGLSDGSSAGVDLVGGYYDAGD  84



>ref|NP_181982.1| glycosyl hydrolase 9B9 [Arabidopsis thaliana]
 sp|O64889.1|GUN12_ARATH RecName: Full=Endoglucanase 12; AltName: Full=Endo-1,4-beta glucanase 
12; Flags: Precursor [Arabidopsis thaliana]
 gb|AAC27456.1| putative cellulase [Arabidopsis thaliana]
 gb|AAM14965.1| putative cellulase [Arabidopsis thaliana]
 gb|AEC10436.1| glycosyl hydrolase 9B9 [Arabidopsis thaliana]
Length=491

 Score = 63.9 bits (154),  Expect = 9e-09, Method: Compositional matrix adjust.
 Identities = 29/56 (52%), Positives = 41/56 (73%), Gaps = 1/56 (2%)
 Frame = +1

Query  391  TQKYGDALKIAMQFFDVQKSGKLVDN-KISWRGDSGLKDGKSASLDLSKGMYDAGD  555
            +  Y +AL+ ++ +F+ Q+SGKL  N K++WRGDS LKDG  A +DL+ G YDAGD
Sbjct  31   STNYAEALQKSLLYFEAQRSGKLPPNQKVTWRGDSALKDGSDAHIDLTGGYYDAGD  86



>ref|XP_002966695.1| hypothetical protein SELMODRAFT_144066 [Selaginella moellendorffii]
 gb|EFJ32722.1| hypothetical protein SELMODRAFT_144066 [Selaginella moellendorffii]
Length=472

 Score = 63.9 bits (154),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 32/45 (71%), Positives = 34/45 (76%), Gaps = 1/45 (2%)
 Frame = +1

Query  424  MQFFDVQKSGKLV-DNKISWRGDSGLKDGKSASLDLSKGMYDAGD  555
            M+F D QKSGKL  DN I WRGDS L DGK   LDLSKGM+DAGD
Sbjct  1    MRFLDAQKSGKLPKDNPIPWRGDSALLDGKDVGLDLSKGMFDAGD  45



>ref|NP_181983.1| glycosyl hydrolase 9B10 [Arabidopsis thaliana]
 sp|O64890.1|GUN13_ARATH RecName: Full=Endoglucanase 13; AltName: Full=Endo-1,4-beta glucanase 
13; Flags: Precursor [Arabidopsis thaliana]
 gb|AAC27457.1| putative glucanase [Arabidopsis thaliana]
 gb|AAM14964.1| putative glucanase [Arabidopsis thaliana]
 gb|AEC10437.1| glycosyl hydrolase 9B10 [Arabidopsis thaliana]
Length=490

 Score = 63.5 bits (153),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 28/56 (50%), Positives = 41/56 (73%), Gaps = 1/56 (2%)
 Frame = +1

Query  391  TQKYGDALKIAMQFFDVQKSGKLVDN-KISWRGDSGLKDGKSASLDLSKGMYDAGD  555
            +  Y +ALK ++ +F+ Q+SGKL  N +++WRGDS L+DG  A +DL+ G YDAGD
Sbjct  31   STNYAEALKNSLLYFEAQRSGKLPPNQRVTWRGDSALRDGSDAHIDLTGGYYDAGD  86



>ref|XP_006413937.1| hypothetical protein EUTSA_v10027553mg [Eutrema salsugineum]
 gb|ESQ55390.1| hypothetical protein EUTSA_v10027553mg [Eutrema salsugineum]
Length=494

 Score = 63.5 bits (153),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 28/56 (50%), Positives = 41/56 (73%), Gaps = 1/56 (2%)
 Frame = +1

Query  391  TQKYGDALKIAMQFFDVQKSGKLVDN-KISWRGDSGLKDGKSASLDLSKGMYDAGD  555
            +  YG+AL  ++ +F+ Q+SGKL  N +++WRGDS L+DG  A +DL+ G YDAGD
Sbjct  31   STNYGEALTNSLLYFEAQRSGKLPSNQRVNWRGDSALRDGSDAHIDLTGGYYDAGD  86



>ref|WP_033252637.1| endoglucanase [Kitasatospora phosalacinea]
Length=809

 Score = 63.9 bits (154),  Expect = 1e-08, Method: Composition-based stats.
 Identities = 30/53 (57%), Positives = 40/53 (75%), Gaps = 1/53 (2%)
 Frame = +1

Query  400  YGDALKIAMQFFDVQKSGKL-VDNKISWRGDSGLKDGKSASLDLSKGMYDAGD  555
            YG+AL+ ++ F++ Q+SGKL   N++SWRGDS L DGK   LDL+ G YDAGD
Sbjct  51   YGEALQKSLLFYEAQQSGKLPATNRVSWRGDSALDDGKDVGLDLTGGWYDAGD  103



>gb|AEH04391.1| endo-beta-1,4-glucanase [Thermobifida halotolerans]
Length=964

 Score = 63.9 bits (154),  Expect = 1e-08, Method: Composition-based stats.
 Identities = 30/53 (57%), Positives = 39/53 (74%), Gaps = 1/53 (2%)
 Frame = +1

Query  400  YGDALKIAMQFFDVQKSGKLVD-NKISWRGDSGLKDGKSASLDLSKGMYDAGD  555
            Y +AL+ +M F++ Q+SG L D N++SWRGDSGL DG    LDL+ G YDAGD
Sbjct  52   YAEALQKSMFFYEAQRSGALPDDNRVSWRGDSGLTDGADVGLDLTGGWYDAGD  104



>ref|NP_001048297.1| Os02g0778600 [Oryza sativa Japonica Group]
 sp|Q6K7G9.1|GUN8_ORYSJ RecName: Full=Endoglucanase 8; AltName: Full=Endo-1,4-beta glucanase 
8; Flags: Precursor [Oryza sativa Japonica Group]
 dbj|BAD19513.1| putative cellulase [Oryza sativa Japonica Group]
 dbj|BAF10211.1| Os02g0778600 [Oryza sativa Japonica Group]
 gb|EAZ24816.1| hypothetical protein OsJ_08594 [Oryza sativa Japonica Group]
 dbj|BAG94487.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG97900.1| unnamed protein product [Oryza sativa Japonica Group]
Length=501

 Score = 63.5 bits (153),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 30/54 (56%), Positives = 40/54 (74%), Gaps = 1/54 (2%)
 Frame = +1

Query  397  KYGDALKIAMQFFDVQKSGKLVD-NKISWRGDSGLKDGKSASLDLSKGMYDAGD  555
             Y DAL  ++ F + Q+SGKL   N+I WRGDSG++DGK A++DL+ G YDAGD
Sbjct  42   NYKDALTKSIMFLEAQRSGKLPPTNRIKWRGDSGMEDGKLANVDLTGGYYDAGD  95



>gb|EAZ07843.1| hypothetical protein OsI_30101 [Oryza sativa Indica Group]
Length=501

 Score = 63.5 bits (153),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 30/54 (56%), Positives = 40/54 (74%), Gaps = 1/54 (2%)
 Frame = +1

Query  397  KYGDALKIAMQFFDVQKSGKLVD-NKISWRGDSGLKDGKSASLDLSKGMYDAGD  555
             Y DAL  ++ F + Q+SGKL   N+I WRGDSG++DGK A++DL+ G YDAGD
Sbjct  42   NYKDALTKSIMFLEAQRSGKLPPTNRIKWRGDSGMEDGKLANVDLTGGYYDAGD  95



>ref|XP_004301501.1| PREDICTED: endoglucanase 5 [Fragaria vesca subsp. vesca]
Length=625

 Score = 63.5 bits (153),  Expect = 1e-08, Method: Composition-based stats.
 Identities = 30/53 (57%), Positives = 39/53 (74%), Gaps = 1/53 (2%)
 Frame = +1

Query  400  YGDALKIAMQFFDVQKSGKLVDN-KISWRGDSGLKDGKSASLDLSKGMYDAGD  555
            YG+AL  ++ FF+ Q+SGKL  N ++ WRGDSGLKDG +  +DL  G YDAGD
Sbjct  33   YGEALDKSLLFFEAQRSGKLPPNQRVKWRGDSGLKDGLAQGVDLVGGYYDAGD  85



>ref|XP_011085126.1| PREDICTED: LOW QUALITY PROTEIN: endoglucanase 14-like [Sesamum 
indicum]
Length=489

 Score = 63.2 bits (152),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 32/56 (57%), Positives = 39/56 (70%), Gaps = 1/56 (2%)
 Frame = +1

Query  391  TQKYGDALKIAMQFFDVQKSGKLVDN-KISWRGDSGLKDGKSASLDLSKGMYDAGD  555
            T  YG AL  ++ F++ Q+SGKL  N +I WRGDS L DGKSA +DL  G YDAGD
Sbjct  26   TVDYGAALTKSLLFYEAQRSGKLPPNQRIRWRGDSALSDGKSARIDLVGGYYDAGD  81



>ref|XP_002451429.1| hypothetical protein SORBIDRAFT_04g001960 [Sorghum bicolor]
 gb|EES04405.1| hypothetical protein SORBIDRAFT_04g001960 [Sorghum bicolor]
 emb|CAZ96044.1| endoglucanase 4 precursor [Sorghum bicolor]
Length=514

 Score = 63.5 bits (153),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 31/56 (55%), Positives = 39/56 (70%), Gaps = 3/56 (5%)
 Frame = +1

Query  397  KYGDALKIAMQFFDVQKSGKLVDN---KISWRGDSGLKDGKSASLDLSKGMYDAGD  555
             Y DAL  A+ FF+ Q+SGKL      +++WRGDSGL DG +A +DLS G YDAGD
Sbjct  37   NYADALDKALLFFEAQRSGKLPPRPLQRVTWRGDSGLSDGSAAGVDLSGGYYDAGD  92



>ref|WP_033222782.1| endoglucanase [Kitasatospora phosalacinea]
Length=811

 Score = 63.5 bits (153),  Expect = 1e-08, Method: Composition-based stats.
 Identities = 30/53 (57%), Positives = 40/53 (75%), Gaps = 1/53 (2%)
 Frame = +1

Query  400  YGDALKIAMQFFDVQKSGKL-VDNKISWRGDSGLKDGKSASLDLSKGMYDAGD  555
            YG+AL+ ++ F++ Q+SGKL   N++SWRGDS L DGK   LDL+ G YDAGD
Sbjct  51   YGEALQKSLLFYEAQQSGKLPATNRVSWRGDSALDDGKDVGLDLTGGWYDAGD  103



>ref|XP_009049941.1| hypothetical protein LOTGIDRAFT_113537 [Lottia gigantea]
 gb|ESO99454.1| hypothetical protein LOTGIDRAFT_113537 [Lottia gigantea]
Length=580

 Score = 63.5 bits (153),  Expect = 1e-08, Method: Composition-based stats.
 Identities = 29/53 (55%), Positives = 39/53 (74%), Gaps = 1/53 (2%)
 Frame = +1

Query  400  YGDALKIAMQFFDVQKSGKL-VDNKISWRGDSGLKDGKSASLDLSKGMYDAGD  555
            Y D L+ ++ F++ Q+SGKL  +N+I WRGDSGLKDG    +DL+ G YDAGD
Sbjct  154  YDDVLRKSILFYEAQRSGKLPANNRIPWRGDSGLKDGSDVGVDLTGGWYDAGD  206



>ref|XP_007043306.1| Glycosyl hydrolase 9C1 isoform 2 [Theobroma cacao]
 gb|EOX99137.1| Glycosyl hydrolase 9C1 isoform 2 [Theobroma cacao]
Length=627

 Score = 63.5 bits (153),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 31/54 (57%), Positives = 37/54 (69%), Gaps = 1/54 (2%)
 Frame = +1

Query  397  KYGDALKIAMQFFDVQKSGKL-VDNKISWRGDSGLKDGKSASLDLSKGMYDAGD  555
             YG+AL     FF+ Q+SGKL VD ++ WRGDSGLKDG    +DL  G YDAGD
Sbjct  29   NYGEALDKTFMFFEAQRSGKLPVDQRVKWRGDSGLKDGSHQGVDLVGGYYDAGD  82



>ref|XP_003570500.1| PREDICTED: endoglucanase 8 [Brachypodium distachyon]
Length=502

 Score = 63.2 bits (152),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 30/54 (56%), Positives = 40/54 (74%), Gaps = 1/54 (2%)
 Frame = +1

Query  397  KYGDALKIAMQFFDVQKSGKLV-DNKISWRGDSGLKDGKSASLDLSKGMYDAGD  555
             Y DAL  ++ F + Q+SGKL  +N+I WRGDSG++DGK A +DL+ G YDAGD
Sbjct  42   NYKDALSKSIMFLEAQRSGKLPPNNRIKWRGDSGMEDGKLAHVDLTGGYYDAGD  95



>ref|XP_007043305.1| Glycosyl hydrolase 9C1 isoform 1 [Theobroma cacao]
 gb|EOX99136.1| Glycosyl hydrolase 9C1 isoform 1 [Theobroma cacao]
Length=626

 Score = 63.5 bits (153),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 31/54 (57%), Positives = 37/54 (69%), Gaps = 1/54 (2%)
 Frame = +1

Query  397  KYGDALKIAMQFFDVQKSGKL-VDNKISWRGDSGLKDGKSASLDLSKGMYDAGD  555
             YG+AL     FF+ Q+SGKL VD ++ WRGDSGLKDG    +DL  G YDAGD
Sbjct  29   NYGEALDKTFMFFEAQRSGKLPVDQRVKWRGDSGLKDGSHQGVDLVGGYYDAGD  82



>ref|WP_043779176.1| endoglucanase [Amycolatopsis rifamycinica]
 gb|KDN22010.1| endoglucanase [Amycolatopsis rifamycinica]
Length=893

 Score = 63.5 bits (153),  Expect = 2e-08, Method: Composition-based stats.
 Identities = 30/53 (57%), Positives = 39/53 (74%), Gaps = 1/53 (2%)
 Frame = +1

Query  400  YGDALKIAMQFFDVQKSGKLVD-NKISWRGDSGLKDGKSASLDLSKGMYDAGD  555
            YG+AL+ A+ F+D Q+SG L D N++SWRG S L DGK   +DL+ G YDAGD
Sbjct  39   YGEALQKAVWFYDAQRSGALPDGNRVSWRGPSALDDGKDVGVDLTGGFYDAGD  91



>emb|CDY47674.1| BnaC04g03850D [Brassica napus]
Length=493

 Score = 63.2 bits (152),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 28/56 (50%), Positives = 41/56 (73%), Gaps = 1/56 (2%)
 Frame = +1

Query  391  TQKYGDALKIAMQFFDVQKSGKLVDN-KISWRGDSGLKDGKSASLDLSKGMYDAGD  555
            ++ YG+AL   + +F+ Q+SGKL  N +++WRGDS L+DG  A +DL+ G YDAGD
Sbjct  33   SRHYGEALTKTLLYFEAQRSGKLPSNQRVNWRGDSALRDGSDAHVDLTGGYYDAGD  88



>ref|XP_002881965.1| glycosyl hydrolase family 9 protein [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH58224.1| glycosyl hydrolase family 9 protein [Arabidopsis lyrata subsp. 
lyrata]
Length=494

 Score = 63.2 bits (152),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 28/54 (52%), Positives = 40/54 (74%), Gaps = 1/54 (2%)
 Frame = +1

Query  397  KYGDALKIAMQFFDVQKSGKLVDN-KISWRGDSGLKDGKSASLDLSKGMYDAGD  555
             YG+AL  ++ +F+ Q+SGKL  N +++WRGDS L+DG  A +DL+ G YDAGD
Sbjct  35   NYGEALTKSLLYFEAQRSGKLPSNQRVTWRGDSALRDGSDAHIDLTGGYYDAGD  88



>ref|XP_009143046.1| PREDICTED: endoglucanase 14-like [Brassica rapa]
Length=493

 Score = 63.2 bits (152),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 28/56 (50%), Positives = 42/56 (75%), Gaps = 1/56 (2%)
 Frame = +1

Query  391  TQKYGDALKIAMQFFDVQKSGKLVDN-KISWRGDSGLKDGKSASLDLSKGMYDAGD  555
            ++ YG+AL  ++ +F+ Q+SGKL  N +++WRGDS L+DG  A +DL+ G YDAGD
Sbjct  33   SRHYGEALTKSLFYFEAQRSGKLPSNQRVNWRGDSALRDGSDAHVDLTGGYYDAGD  88



>ref|WP_024834593.1| endoglucanase [[Clostridium] josui]
Length=725

 Score = 63.5 bits (153),  Expect = 2e-08, Method: Composition-based stats.
 Identities = 30/56 (54%), Positives = 41/56 (73%), Gaps = 1/56 (2%)
 Frame = +1

Query  391  TQKYGDALKIAMQFFDVQKSGKLVDNKI-SWRGDSGLKDGKSASLDLSKGMYDAGD  555
            T  YG+AL+ ++ F++ Q+SG L D+K  +WRGDSG+KDG    LDL+ G YDAGD
Sbjct  38   TYNYGEALQKSIMFYEFQRSGDLPDDKRDNWRGDSGMKDGSDVGLDLTGGWYDAGD  93



>emb|CDX74668.1| BnaA05g04140D [Brassica napus]
Length=493

 Score = 63.2 bits (152),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 28/56 (50%), Positives = 42/56 (75%), Gaps = 1/56 (2%)
 Frame = +1

Query  391  TQKYGDALKIAMQFFDVQKSGKLVDN-KISWRGDSGLKDGKSASLDLSKGMYDAGD  555
            ++ YG+AL  ++ +F+ Q+SGKL  N +++WRGDS L+DG  A +DL+ G YDAGD
Sbjct  33   SRHYGEALTKSLFYFEAQRSGKLPSNQRVNWRGDSALRDGSDAHVDLTGGYYDAGD  88



>ref|WP_024632469.1| MULTISPECIES: glycoside hydrolase [Paenibacillus]
 gb|KGP79838.1| glycoside hydrolase [Paenibacillus sp. MAEPY2]
 gb|KGP83340.1| glycoside hydrolase [Paenibacillus sp. MAEPY1]
Length=987

 Score = 63.5 bits (153),  Expect = 2e-08, Method: Composition-based stats.
 Identities = 29/55 (53%), Positives = 39/55 (71%), Gaps = 1/55 (2%)
 Frame = +1

Query  394  QKYGDALKIAMQFFDVQKSGKLV-DNKISWRGDSGLKDGKSASLDLSKGMYDAGD  555
              Y +AL+ A+ F++ Q+SGKL  DN++ WRGDSGL DG    +DL+ G YDAGD
Sbjct  29   HNYAEALQKAVYFYETQRSGKLPEDNRVEWRGDSGLNDGADVGVDLTGGWYDAGD  83



>ref|XP_006385809.1| hypothetical protein POPTR_0003s14740g [Populus trichocarpa]
 gb|ERP63606.1| hypothetical protein POPTR_0003s14740g [Populus trichocarpa]
Length=511

 Score = 63.2 bits (152),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 29/56 (52%), Positives = 43/56 (77%), Gaps = 1/56 (2%)
 Frame = +1

Query  391  TQKYGDALKIAMQFFDVQKSGKL-VDNKISWRGDSGLKDGKSASLDLSKGMYDAGD  555
            +Q Y DAL+I++ FF+ Q+SGKL ++ +++WRGDSGL DG +  ++L  G YDAGD
Sbjct  60   SQDYADALEISILFFEGQRSGKLPLNQRLTWRGDSGLSDGSAYHVNLVGGYYDAGD  115



>gb|ABC70312.1| endo-1,4-beta-glucanase precursor [Glycine max]
Length=114

 Score = 59.7 bits (143),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 30/56 (54%), Positives = 38/56 (68%), Gaps = 1/56 (2%)
 Frame = +1

Query  391  TQKYGDALKIAMQFFDVQKSGKLVDN-KISWRGDSGLKDGKSASLDLSKGMYDAGD  555
            T  Y DAL  ++ FF+ Q+SGKL  N ++SWR DSGL DG +  +DL  G YDAGD
Sbjct  36   THNYRDALTKSIIFFEGQRSGKLPSNQRMSWRRDSGLSDGSAMHVDLVGGYYDAGD  91



>ref|XP_006294088.1| hypothetical protein CARUB_v10023082mg [Capsella rubella]
 gb|EOA26986.1| hypothetical protein CARUB_v10023082mg [Capsella rubella]
Length=494

 Score = 63.2 bits (152),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 29/54 (54%), Positives = 40/54 (74%), Gaps = 1/54 (2%)
 Frame = +1

Query  397  KYGDALKIAMQFFDVQKSGKLVDN-KISWRGDSGLKDGKSASLDLSKGMYDAGD  555
             YG+AL  ++ +F+ Q+SGKL  N +++WRGDS L+DG  A +DLS G YDAGD
Sbjct  35   NYGEALTKSLLYFEAQRSGKLPSNQRVTWRGDSALRDGFDAHIDLSGGYYDAGD  88



>gb|AEO97202.1| endo-1,4-beta-glucanase [Populus trichocarpa]
 gb|AEO97229.1| endo-1,4-beta-glucanase [Populus trichocarpa]
Length=494

 Score = 63.2 bits (152),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 29/56 (52%), Positives = 43/56 (77%), Gaps = 1/56 (2%)
 Frame = +1

Query  391  TQKYGDALKIAMQFFDVQKSGKL-VDNKISWRGDSGLKDGKSASLDLSKGMYDAGD  555
            +Q Y DAL+I++ FF+ Q+SGKL ++ +++WRGDSGL DG +  ++L  G YDAGD
Sbjct  30   SQDYADALEISILFFEGQRSGKLPLNQRLTWRGDSGLSDGSAYHVNLVGGYYDAGD  85



>emb|CAZ96212.1| endoglucanase 4 precursor [Saccharum hybrid cultivar R570]
Length=512

 Score = 63.2 bits (152),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 30/55 (55%), Positives = 39/55 (71%), Gaps = 2/55 (4%)
 Frame = +1

Query  397  KYGDALKIAMQFFDVQKSGKLV--DNKISWRGDSGLKDGKSASLDLSKGMYDAGD  555
             Y DAL  A+ FF+ Q+SGKL     +++WRGDSGL DG +A +DL+ G YDAGD
Sbjct  37   NYADALDKALLFFEAQRSGKLPAGQQRVTWRGDSGLSDGSAAGVDLAGGYYDAGD  91



>gb|AIW39765.1| putative endoglucanase 4 precursor [Saccharum spontaneum]
Length=511

 Score = 63.2 bits (152),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 30/55 (55%), Positives = 39/55 (71%), Gaps = 2/55 (4%)
 Frame = +1

Query  397  KYGDALKIAMQFFDVQKSGKLV--DNKISWRGDSGLKDGKSASLDLSKGMYDAGD  555
             Y DAL  A+ FF+ Q+SGKL     +++WRGDSGL DG +A +DL+ G YDAGD
Sbjct  37   NYADALDKALLFFEAQRSGKLPAGQQRVTWRGDSGLSDGSAAGVDLAGGYYDAGD  91



>emb|CAZ96155.1| endoglucanase 4 precursor [Saccharum hybrid cultivar R570]
Length=512

 Score = 63.2 bits (152),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 30/55 (55%), Positives = 39/55 (71%), Gaps = 2/55 (4%)
 Frame = +1

Query  397  KYGDALKIAMQFFDVQKSGKLV--DNKISWRGDSGLKDGKSASLDLSKGMYDAGD  555
             Y DAL  A+ FF+ Q+SGKL     +++WRGDSGL DG +A +DL+ G YDAGD
Sbjct  37   NYADALDKALLFFEAQRSGKLPAGQQRVTWRGDSGLSDGSAAGVDLAGGYYDAGD  91



>ref|XP_002881964.1| glycosyl hydrolase family 9 protein [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH58223.1| glycosyl hydrolase family 9 protein [Arabidopsis lyrata subsp. 
lyrata]
Length=491

 Score = 62.8 bits (151),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 28/56 (50%), Positives = 41/56 (73%), Gaps = 1/56 (2%)
 Frame = +1

Query  391  TQKYGDALKIAMQFFDVQKSGKLVDN-KISWRGDSGLKDGKSASLDLSKGMYDAGD  555
            +  YG+AL  ++ +F+ Q+SGKL  N +++WRGDS L+DG  A +DL+ G YDAGD
Sbjct  31   STNYGEALTKSLLYFEAQRSGKLPSNQRVTWRGDSALRDGSDAHVDLTGGYYDAGD  86



>emb|CAZ96131.1| endoglucanase 4 precursor [Saccharum hybrid cultivar R570]
Length=536

 Score = 63.2 bits (152),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 30/55 (55%), Positives = 39/55 (71%), Gaps = 2/55 (4%)
 Frame = +1

Query  397  KYGDALKIAMQFFDVQKSGKLV--DNKISWRGDSGLKDGKSASLDLSKGMYDAGD  555
             Y DAL  A+ FF+ Q+SGKL     +++WRGDSGL DG +A +DL+ G YDAGD
Sbjct  37   NYADALDKALLFFEAQRSGKLPAGQQRVTWRGDSGLSDGSAAGVDLAGGYYDAGD  91



>ref|WP_003518379.1| endoglucanase [Ruminiclostridium thermocellum]
 gb|EEU00986.1| glycoside hydrolase family 9 [Ruminiclostridium thermocellum 
DSM 2360]
 gb|ADU75232.1| glycoside hydrolase family 9 [Ruminiclostridium thermocellum 
DSM 1313]
 gb|EIC04926.1| glycoside hydrolase family 9 [Ruminiclostridium thermocellum 
YS]
 gb|EIC09719.1| glycoside hydrolase family 9 [Ruminiclostridium thermocellum 
AD2]
Length=887

 Score = 63.2 bits (152),  Expect = 2e-08, Method: Composition-based stats.
 Identities = 30/54 (56%), Positives = 42/54 (78%), Gaps = 2/54 (4%)
 Frame = +1

Query  400  YGDALKIAMQFFDVQKSGKLVDN--KISWRGDSGLKDGKSASLDLSKGMYDAGD  555
            YG+AL+ A+ F++ Q+SGKL  +  +++WRGDSGL DGK A +DL+ G YDAGD
Sbjct  78   YGEALQKAIFFYECQRSGKLDSSTLRLNWRGDSGLDDGKDAGIDLTGGWYDAGD  131



>emb|CAZ96184.1| endoglucanase 4 precursor [Saccharum hybrid cultivar R570]
Length=511

 Score = 62.8 bits (151),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 30/55 (55%), Positives = 39/55 (71%), Gaps = 2/55 (4%)
 Frame = +1

Query  397  KYGDALKIAMQFFDVQKSGKLV--DNKISWRGDSGLKDGKSASLDLSKGMYDAGD  555
             Y DAL  A+ FF+ Q+SGKL     +++WRGDSGL DG +A +DL+ G YDAGD
Sbjct  37   NYADALDKALLFFEAQRSGKLPAGQQRVTWRGDSGLSDGSAAGVDLAGGYYDAGD  91



>ref|XP_004954110.1| PREDICTED: endoglucanase 8-like [Setaria italica]
Length=495

 Score = 62.8 bits (151),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 30/53 (57%), Positives = 40/53 (75%), Gaps = 1/53 (2%)
 Frame = +1

Query  400  YGDALKIAMQFFDVQKSGKLV-DNKISWRGDSGLKDGKSASLDLSKGMYDAGD  555
            Y DAL   + F + Q+SGKL  +N++ WRGDSGL+DGK A++DL+ G YDAGD
Sbjct  37   YKDALTKTIIFLEAQRSGKLPPNNRVKWRGDSGLEDGKLANVDLTGGYYDAGD  89



>ref|WP_003517595.1| endoglucanase [Ruminiclostridium thermocellum]
 sp|P26224.1|GUNF_CLOTH RecName: Full=Endoglucanase F; Short=EGF; AltName: Full=Cellulase 
F; AltName: Full=Endo-1,4-beta-glucanase; Flags: Precursor 
[Ruminiclostridium thermocellum ATCC 27405]
 emb|CAA43035.1| cellulase [Ruminiclostridium thermocellum]
 gb|ABN51779.1| glycoside hydrolase family 9 [Ruminiclostridium thermocellum 
ATCC 27405]
 gb|EEU01541.1| glycoside hydrolase family 9 [Ruminiclostridium thermocellum 
DSM 2360]
 gb|EFB38917.1| glycoside hydrolase family 9 [Ruminiclostridium thermocellum 
JW20]
 gb|ADU74751.1| glycoside hydrolase family 9 [Ruminiclostridium thermocellum 
DSM 1313]
 gb|EIC05344.1| glycoside hydrolase family 9 [Ruminiclostridium thermocellum 
YS]
 gb|EIC12107.1| glycoside hydrolase family 9 [Ruminiclostridium thermocellum 
AD2]
 emb|CDG35236.1| Endoglucanase F [Ruminiclostridium thermocellum BC1]
Length=739

 Score = 63.2 bits (152),  Expect = 2e-08, Method: Composition-based stats.
 Identities = 30/53 (57%), Positives = 39/53 (74%), Gaps = 1/53 (2%)
 Frame = +1

Query  400  YGDALKIAMQFFDVQKSGKLVDNKIS-WRGDSGLKDGKSASLDLSKGMYDAGD  555
            YG+AL+ A+ F++ Q+SGKL +NK + WRGDS L DG    LDL+ G YDAGD
Sbjct  32   YGEALQKAIMFYEFQRSGKLPENKRNNWRGDSALNDGADNGLDLTGGWYDAGD  84



>gb|AFZ78636.1| korrigan [Populus tomentosa]
Length=494

 Score = 62.8 bits (151),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 29/56 (52%), Positives = 43/56 (77%), Gaps = 1/56 (2%)
 Frame = +1

Query  391  TQKYGDALKIAMQFFDVQKSGKL-VDNKISWRGDSGLKDGKSASLDLSKGMYDAGD  555
            +Q Y DAL+I++ FF+ Q+SGKL ++ +++WRGDSGL DG +  ++L  G YDAGD
Sbjct  30   SQDYADALEISILFFEGQRSGKLPLNQRLTWRGDSGLSDGSAYHVNLVGGYYDAGD  85



>gb|ADZ82224.1| Cellulase [Clostridium lentocellum DSM 5427]
Length=877

 Score = 63.2 bits (152),  Expect = 2e-08, Method: Composition-based stats.
 Identities = 29/53 (55%), Positives = 40/53 (75%), Gaps = 1/53 (2%)
 Frame = +1

Query  400  YGDALKIAMQFFDVQKSGKLVDN-KISWRGDSGLKDGKSASLDLSKGMYDAGD  555
            YG+AL+ A+ F+++Q+SG L +  + +WRGDSGL DGK   LDL+ G YDAGD
Sbjct  74   YGEALQKAILFYELQRSGDLTEQIRCNWRGDSGLSDGKDVGLDLTGGWYDAGD  126



>ref|XP_007220712.1| hypothetical protein PRUPE_ppa021556mg, partial [Prunus persica]
 gb|EMJ21911.1| hypothetical protein PRUPE_ppa021556mg, partial [Prunus persica]
Length=463

 Score = 62.8 bits (151),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 30/53 (57%), Positives = 39/53 (74%), Gaps = 1/53 (2%)
 Frame = +1

Query  400  YGDALKIAMQFFDVQKSGKLVDN-KISWRGDSGLKDGKSASLDLSKGMYDAGD  555
            YGDAL  ++ +++ Q+SGKL  N ++ WRGDSGLKDG  A +DL  G YDAGD
Sbjct  6    YGDALTKSLLYYEAQRSGKLPPNQRVQWRGDSGLKDGSDAGVDLVGGYYDAGD  58



>emb|CDY47675.1| BnaC04g03840D [Brassica napus]
Length=489

 Score = 62.8 bits (151),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 28/54 (52%), Positives = 40/54 (74%), Gaps = 1/54 (2%)
 Frame = +1

Query  397  KYGDALKIAMQFFDVQKSGKLVDN-KISWRGDSGLKDGKSASLDLSKGMYDAGD  555
             YG+AL  ++ +F+ Q+SGKL  N +++WRGDS L+DG  A +DL+ G YDAGD
Sbjct  31   NYGEALTKSLLYFEAQRSGKLPPNQRVNWRGDSALRDGSDAHVDLTGGYYDAGD  84



>gb|AAV50042.1| cellulase [Saccharum hybrid cultivar Pindar]
Length=84

 Score = 58.9 bits (141),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 28/36 (78%), Positives = 30/36 (83%), Gaps = 0/36 (0%)
 Frame = +1

Query  448  SGKLVDNKISWRGDSGLKDGKSASLDLSKGMYDAGD  555
            SGKL +N+I WRGDS L DGK A LDLSKGMYDAGD
Sbjct  1    SGKLENNQIPWRGDSALTDGKEAGLDLSKGMYDAGD  36



>emb|CDX74666.1| BnaA05g04120D [Brassica napus]
Length=489

 Score = 62.8 bits (151),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 28/54 (52%), Positives = 40/54 (74%), Gaps = 1/54 (2%)
 Frame = +1

Query  397  KYGDALKIAMQFFDVQKSGKLVDN-KISWRGDSGLKDGKSASLDLSKGMYDAGD  555
             YG+AL  ++ +F+ Q+SGKL  N +++WRGDS L+DG  A +DL+ G YDAGD
Sbjct  31   NYGEALTKSLLYFEAQRSGKLPPNQRVNWRGDSALRDGSDAHVDLTGGYYDAGD  84



>gb|AIW39772.1| putative endoglucanase 4 precursor [Saccharum officinarum]
Length=512

 Score = 62.8 bits (151),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 30/55 (55%), Positives = 39/55 (71%), Gaps = 2/55 (4%)
 Frame = +1

Query  397  KYGDALKIAMQFFDVQKSGKLV--DNKISWRGDSGLKDGKSASLDLSKGMYDAGD  555
             Y DAL  A+ FF+ Q+SGKL     +++WRGDSGL DG +A +DL+ G YDAGD
Sbjct  37   NYADALDKALLFFEAQRSGKLPAGQQRVTWRGDSGLSDGSAAGVDLAGGYYDAGD  91



>emb|CAZ96123.1| endoglucanase 4 precursor [Saccharum hybrid cultivar R570]
Length=536

 Score = 62.8 bits (151),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 30/55 (55%), Positives = 39/55 (71%), Gaps = 2/55 (4%)
 Frame = +1

Query  397  KYGDALKIAMQFFDVQKSGKLV--DNKISWRGDSGLKDGKSASLDLSKGMYDAGD  555
             Y DAL  A+ FF+ Q+SGKL     +++WRGDSGL DG +A +DL+ G YDAGD
Sbjct  37   NYADALDKALLFFEAQRSGKLPAGQQRVTWRGDSGLSDGSAAGVDLAGGYYDAGD  91



>ref|WP_041713262.1| hypothetical protein, partial [Cellulosilyticum lentocellum]
Length=813

 Score = 63.2 bits (152),  Expect = 2e-08, Method: Composition-based stats.
 Identities = 29/53 (55%), Positives = 40/53 (75%), Gaps = 1/53 (2%)
 Frame = +1

Query  400  YGDALKIAMQFFDVQKSGKLVDN-KISWRGDSGLKDGKSASLDLSKGMYDAGD  555
            YG+AL+ A+ F+++Q+SG L +  + +WRGDSGL DGK   LDL+ G YDAGD
Sbjct  10   YGEALQKAILFYELQRSGDLTEQIRCNWRGDSGLSDGKDVGLDLTGGWYDAGD  62



>ref|XP_009143044.1| PREDICTED: endoglucanase 12-like [Brassica rapa]
Length=489

 Score = 62.8 bits (151),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 28/54 (52%), Positives = 40/54 (74%), Gaps = 1/54 (2%)
 Frame = +1

Query  397  KYGDALKIAMQFFDVQKSGKLVDN-KISWRGDSGLKDGKSASLDLSKGMYDAGD  555
             YG+AL  ++ +F+ Q+SGKL  N +++WRGDS L+DG  A +DL+ G YDAGD
Sbjct  31   NYGEALTKSLLYFEAQRSGKLPPNQRVNWRGDSALRDGSDAHVDLTGGYYDAGD  84



>emb|CAZ96081.1| endoglucanase 4 precursor (Sh142J21g280-g330 modules) [Saccharum 
hybrid cultivar R570]
Length=594

 Score = 62.8 bits (151),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 30/55 (55%), Positives = 39/55 (71%), Gaps = 2/55 (4%)
 Frame = +1

Query  397  KYGDALKIAMQFFDVQKSGKLV--DNKISWRGDSGLKDGKSASLDLSKGMYDAGD  555
             Y DAL  A+ FF+ Q+SGKL     +++WRGDSGL DG +A +DL+ G YDAGD
Sbjct  37   NYADALDKALLFFEAQRSGKLPAGQQRVTWRGDSGLSDGSAAGVDLAGGYYDAGD  91



Lambda      K        H        a         alpha
   0.317    0.136    0.415    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 617525281800