BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFF036E19

Length=489
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

gb|AGL96414.1|  9-lipoxygenase                                          236   1e-69   Nicotiana benthamiana
ref|XP_009774053.1|  PREDICTED: probable linoleate 9S-lipoxygenase 5    236   1e-69   Nicotiana sylvestris
emb|CAA58859.1|  lipoxygenase                                           234   5e-69   Nicotiana tabacum [American tobacco]
ref|XP_009610900.1|  PREDICTED: probable linoleate 9S-lipoxygenase 5    234   5e-69   Nicotiana tomentosiformis
gb|ADN92993.2|  lipoxygenase LOX1                                       234   1e-68   Ipomoea nil [qian niu]
gb|ABW75772.2|  lipoxygenase                                            231   1e-67   Camellia sinensis [black tea]
ref|XP_004302420.1|  PREDICTED: probable linoleate 9S-lipoxygenase 5    230   2e-67   Fragaria vesca subsp. vesca
ref|NP_001234098.1|  lipoxygenase                                       229   7e-67   Solanum lycopersicum
gb|ABF19102.2|  9-lipoxygenase                                          226   5e-66   Capsicum annuum
ref|XP_006344623.1|  PREDICTED: probable linoleate 9S-lipoxygenas...    226   6e-66   Solanum tuberosum [potatoes]
ref|XP_006344621.1|  PREDICTED: probable linoleate 9S-lipoxygenas...    226   7e-66   Solanum tuberosum [potatoes]
emb|CDP15504.1|  unnamed protein product                                222   2e-64   Coffea canephora [robusta coffee]
ref|XP_011092040.1|  PREDICTED: probable linoleate 9S-lipoxygenas...    221   3e-64   Sesamum indicum [beniseed]
ref|XP_011092039.1|  PREDICTED: probable linoleate 9S-lipoxygenas...    221   3e-64   Sesamum indicum [beniseed]
gb|ACG56281.1|  lipoxygenase                                            221   3e-64   Olea europaea
ref|XP_009376659.1|  PREDICTED: probable linoleate 9S-lipoxygenase 5    221   4e-64   Pyrus x bretschneideri [bai li]
ref|XP_011092038.1|  PREDICTED: probable linoleate 9S-lipoxygenas...    221   5e-64   Sesamum indicum [beniseed]
emb|CDP20618.1|  unnamed protein product                                221   5e-64   Coffea canephora [robusta coffee]
ref|XP_011092037.1|  PREDICTED: probable linoleate 9S-lipoxygenas...    221   5e-64   Sesamum indicum [beniseed]
gb|AHX56187.1|  lipoxygenase                                            221   7e-64   Diospyros kaki [Japanese persimmon]
ref|NP_001281030.1|  probable linoleate 9S-lipoxygenase 5               220   9e-64   Malus domestica [apple tree]
ref|XP_002512386.1|  lipoxygenase, putative                             220   1e-63   Ricinus communis
emb|CAB94852.1|  lipoxygenase                                           218   3e-63   Prunus dulcis [sweet almond]
ref|XP_007208096.1|  hypothetical protein PRUPE_ppa001287mg             218   4e-63   
gb|AFU51542.1|  lipoxygenase 3                                          218   4e-63   Capsicum annuum
ref|XP_004244890.1|  PREDICTED: probable linoleate 9S-lipoxygenase 5    218   6e-63   Solanum lycopersicum
emb|CBI36801.3|  unnamed protein product                                217   7e-63   Vitis vinifera
gb|EYU42168.1|  hypothetical protein MIMGU_mgv1a001215mg                217   9e-63   Erythranthe guttata [common monkey flower]
emb|CAD10779.2|  lipoxygenase                                           217   1e-62   Prunus dulcis [sweet almond]
gb|KCW61796.1|  hypothetical protein EUGRSUZ_H04495                     214   1e-62   Eucalyptus grandis [rose gum]
ref|XP_010905215.1|  PREDICTED: probable linoleate 9S-lipoxygenase 4    217   1e-62   Elaeis guineensis
ref|XP_010659819.1|  PREDICTED: lipoxygenase isoform X1                 217   1e-62   
ref|NP_001268178.1|  lipoxygenase                                       216   2e-62   Vitis vinifera
ref|XP_008246455.1|  PREDICTED: probable linoleate 9S-lipoxygenase 5    216   2e-62   Prunus mume [ume]
ref|XP_008246456.1|  PREDICTED: probable linoleate 9S-lipoxygenase 5    217   2e-62   Prunus mume [ume]
ref|XP_007208098.1|  hypothetical protein PRUPE_ppa001293mg             216   2e-62   Prunus persica
ref|XP_007204937.1|  hypothetical protein PRUPE_ppa001311mg             216   2e-62   
gb|AGU28274.1|  lipoxygenase 1                                          216   2e-62   Vitis vinifera
emb|CAA64769.1|  lipoxygenase                                           214   2e-62   Solanum tuberosum [potatoes]
ref|XP_010659859.1|  PREDICTED: probable linoleate 9S-lipoxygenase 5    216   3e-62   Vitis vinifera
ref|NP_001274916.1|  probable linoleate 9S-lipoxygenase 5               216   3e-62   Solanum tuberosum [potatoes]
emb|CBI36802.3|  unnamed protein product                                216   3e-62   Vitis vinifera
ref|XP_009376663.1|  PREDICTED: probable linoleate 9S-lipoxygenase 5    215   4e-62   Pyrus x bretschneideri [bai li]
ref|NP_001275357.1|  linoleate 9S-lipoxygenase 2                        215   4e-62   Solanum tuberosum [potatoes]
sp|P37831.1|LOX11_SOLTU  RecName: Full=Linoleate 9S-lipoxygenase ...    215   4e-62   Solanum tuberosum [potatoes]
ref|NP_001281026.1|  probable linoleate 9S-lipoxygenase 5               216   4e-62   Malus domestica [apple tree]
sp|O22507.1|LOX17_SOLTU  RecName: Full=Probable linoleate 9S-lipo...    215   6e-62   Solanum tuberosum [potatoes]
sp|O22508.1|LOX18_SOLTU  RecName: Full=Probable linoleate 9S-lipo...    215   6e-62   Solanum tuberosum [potatoes]
gb|AGK82779.1|  lipoxygenase                                            215   6e-62   Malus domestica [apple tree]
ref|NP_001275169.1|  probable linoleate 9S-lipoxygenase 8-like          215   6e-62   Solanum tuberosum [potatoes]
ref|XP_006355846.1|  PREDICTED: LOW QUALITY PROTEIN: probable lin...    214   7e-62   
ref|XP_008370478.1|  PREDICTED: probable linoleate 9S-lipoxygenas...    214   7e-62   
ref|XP_006382593.1|  hypothetical protein POPTR_0005s03550g             214   7e-62   
ref|XP_008370477.1|  PREDICTED: probable linoleate 9S-lipoxygenas...    215   8e-62   
sp|Q41238.1|LOX16_SOLTU  RecName: Full=Linoleate 9S-lipoxygenase ...    214   8e-62   Solanum tuberosum [potatoes]
sp|Q43190.1|LOX14_SOLTU  RecName: Full=Probable linoleate 9S-lipo...    214   1e-61   Solanum tuberosum [potatoes]
ref|XP_008340970.1|  PREDICTED: linoleate 9S-lipoxygenase 5, chlo...    214   1e-61   
ref|XP_009366923.1|  PREDICTED: probable linoleate 9S-lipoxygenase 5    214   1e-61   Pyrus x bretschneideri [bai li]
ref|XP_010025196.1|  PREDICTED: probable linoleate 9S-lipoxygenase 5    214   1e-61   Eucalyptus grandis [rose gum]
ref|NP_001275351.1|  5-lipoxygenase                                     214   2e-61   Solanum tuberosum [potatoes]
ref|XP_008454481.1|  PREDICTED: linoleate 9S-lipoxygenase 6-like        213   2e-61   Cucumis melo [Oriental melon]
ref|NP_001234856.1|  linoleate 9S-lipoxygenase A                        213   2e-61   Solanum lycopersicum
ref|XP_009376660.1|  PREDICTED: probable linoleate 9S-lipoxygenase 5    213   3e-61   
ref|XP_011036799.1|  PREDICTED: probable linoleate 9S-lipoxygenase 5    213   3e-61   Populus euphratica
gb|EYU26430.1|  hypothetical protein MIMGU_mgv1a023655mg                213   3e-61   Erythranthe guttata [common monkey flower]
gb|ACO57136.1|  lipoxygenase 1                                          213   4e-61   Capsicum annuum
ref|XP_002319014.2|  lipoxygenase family protein                        213   4e-61   
emb|CAA64765.1|  lipoxygenase                                           213   4e-61   Solanum tuberosum [potatoes]
sp|Q43189.1|LOX13_SOLTU  RecName: Full=Probable linoleate 9S-lipo...    212   5e-61   Solanum tuberosum [potatoes]
ref|XP_004302419.1|  PREDICTED: probable linoleate 9S-lipoxygenase 5    213   5e-61   Fragaria vesca subsp. vesca
gb|AAZ04411.1|  lipoxygenase                                            212   5e-61   Cynanchum gracillimum
ref|XP_004230206.1|  PREDICTED: lipoxygenase isoform X2                 212   6e-61   
ref|XP_010323952.1|  PREDICTED: lipoxygenase isoform X3                 212   6e-61   
gb|AAK50778.4|AF361893_1  bacterial-induced lipoxygenase                212   6e-61   Gossypium hirsutum [American cotton]
ref|XP_010323943.1|  PREDICTED: lipoxygenase isoform X1                 212   7e-61   
ref|XP_009376681.1|  PREDICTED: probable linoleate 9S-lipoxygenas...    212   7e-61   Pyrus x bretschneideri [bai li]
ref|XP_008246453.1|  PREDICTED: probable linoleate 9S-lipoxygenase 5    212   7e-61   
ref|XP_009376680.1|  PREDICTED: probable linoleate 9S-lipoxygenas...    212   8e-61   Pyrus x bretschneideri [bai li]
ref|XP_008388563.1|  PREDICTED: probable linoleate 9S-lipoxygenase 5    212   8e-61   
gb|AGI16415.1|  lipoxygenase                                            212   8e-61   Malus domestica [apple tree]
ref|XP_011087404.1|  PREDICTED: probable linoleate 9S-lipoxygenase 5    212   9e-61   Sesamum indicum [beniseed]
gb|ABZ05753.1|  lipoxygenase                                            209   9e-61   Prunus armeniaca
gb|AAP83135.1|  lipoxygenase                                            212   9e-61   Nicotiana attenuata
ref|XP_011023611.1|  PREDICTED: probable linoleate 9S-lipoxygenase 5    211   9e-61   Populus euphratica
gb|AAP83134.1|  lipoxygenase                                            211   1e-60   Nicotiana attenuata
gb|AGI16414.1|  lipoxygenase                                            211   1e-60   Malus domestica [apple tree]
ref|NP_001281022.1|  probable linoleate 9S-lipoxygenase 5               211   1e-60   Malus domestica [apple tree]
gb|AGI16413.1|  lipoxygenase                                            211   1e-60   Malus domestica [apple tree]
gb|AGI16382.1|  lipoxygenase                                            211   1e-60   Malus domestica [apple tree]
ref|XP_011023610.1|  PREDICTED: probable linoleate 9S-lipoxygenase 5    211   1e-60   Populus euphratica
ref|XP_008801705.1|  PREDICTED: probable linoleate 9S-lipoxygenase 4    211   2e-60   Phoenix dactylifera
emb|CAD10740.1|  lipoxygenase                                           211   2e-60   Corylus avellana [European hazelnut]
ref|XP_010094672.1|  putative linoleate 9S-lipoxygenase 5               211   2e-60   
ref|XP_007208174.1|  hypothetical protein PRUPE_ppa001016mg             211   2e-60   Prunus persica
ref|XP_009787604.1|  PREDICTED: linoleate 9S-lipoxygenase 6             211   2e-60   Nicotiana sylvestris
ref|XP_010414944.1|  PREDICTED: linoleate 9S-lipoxygenase 1-like        211   2e-60   Camelina sativa [gold-of-pleasure]
gb|ACH91370.1|  lipoxygenase LOX-3                                      211   2e-60   Prunus persica
ref|XP_006382594.1|  hypothetical protein POPTR_0005s03560g             211   2e-60   Populus trichocarpa [western balsam poplar]
emb|CBI16430.3|  unnamed protein product                                201   2e-60   Vitis vinifera
ref|XP_008388961.1|  PREDICTED: probable linoleate 9S-lipoxygenase 5    210   3e-60   
ref|XP_007030817.1|  Lipoxygenase 1                                     210   3e-60   
ref|XP_010025195.1|  PREDICTED: probable linoleate 9S-lipoxygenase 5    210   4e-60   Eucalyptus grandis [rose gum]
ref|XP_011026284.1|  PREDICTED: probable linoleate 9S-lipoxygenas...    210   4e-60   Populus euphratica
ref|XP_011026291.1|  PREDICTED: probable linoleate 9S-lipoxygenas...    210   4e-60   Populus euphratica
gb|AGI16416.1|  lipoxygenase                                            210   4e-60   Malus domestica [apple tree]
ref|XP_009407551.1|  PREDICTED: probable linoleate 9S-lipoxygenase 5    209   5e-60   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010651467.1|  PREDICTED: probable linoleate 9S-lipoxygenase 5    201   6e-60   
gb|KJB80991.1|  hypothetical protein B456_013G124500                    208   6e-60   Gossypium raimondii
gb|AES82497.2|  linoleate 9S-lipoxygenase-like protein                  209   7e-60   Medicago truncatula
ref|XP_010511239.1|  PREDICTED: linoleate 9S-lipoxygenase 1-like        209   7e-60   Camelina sativa [gold-of-pleasure]
ref|XP_008246454.1|  PREDICTED: probable linoleate 9S-lipoxygenase 5    209   1e-59   Prunus mume [ume]
ref|XP_009119596.1|  PREDICTED: linoleate 9S-lipoxygenase 1             209   1e-59   Brassica rapa
ref|XP_006392468.1|  hypothetical protein EUTSA_v10023267mg             208   1e-59   Eutrema salsugineum [saltwater cress]
ref|XP_008246452.1|  PREDICTED: probable linoleate 9S-lipoxygenase 5    209   1e-59   Prunus mume [ume]
gb|KDO74650.1|  hypothetical protein CISIN_1g002776mg                   205   1e-59   Citrus sinensis [apfelsine]
ref|XP_007144726.1|  hypothetical protein PHAVU_007G179600g             208   1e-59   Phaseolus vulgaris [French bean]
ref|XP_008245950.1|  PREDICTED: probable linoleate 9S-lipoxygenase 5    209   1e-59   Prunus mume [ume]
ref|XP_008246451.1|  PREDICTED: probable linoleate 9S-lipoxygenase 5    209   1e-59   Prunus mume [ume]
ref|XP_009626059.1|  PREDICTED: probable linoleate 9S-lipoxygenas...    208   1e-59   Nicotiana tomentosiformis
ref|XP_010480214.1|  PREDICTED: linoleate 9S-lipoxygenase 1             208   1e-59   Camelina sativa [gold-of-pleasure]
ref|XP_010326551.1|  PREDICTED: probable linoleate 9S-lipoxygenas...    208   1e-59   Solanum lycopersicum
gb|AGK82783.1|  lipoxygenase                                            208   1e-59   Malus domestica [apple tree]
ref|XP_010326548.1|  PREDICTED: probable linoleate 9S-lipoxygenas...    208   2e-59   
ref|XP_009626058.1|  PREDICTED: probable linoleate 9S-lipoxygenas...    208   2e-59   Nicotiana tomentosiformis
gb|AGK82774.1|  lipoxygenase                                            208   2e-59   Malus domestica [apple tree]
gb|AGK82776.1|  lipoxygenase                                            208   2e-59   Malus domestica [apple tree]
gb|KJB80990.1|  hypothetical protein B456_013G124500                    208   2e-59   Gossypium raimondii
gb|KJB80989.1|  hypothetical protein B456_013G124500                    207   2e-59   Gossypium raimondii
ref|XP_002311617.1|  lipoxygenase family protein                        208   2e-59   Populus trichocarpa [western balsam poplar]
ref|XP_009344082.1|  PREDICTED: probable linoleate 9S-lipoxygenase 5    207   2e-59   
gb|ABV32552.1|  lipoxygenase                                            208   3e-59   Prunus persica
ref|XP_002319015.2|  hypothetical protein POPTR_0013s02310g             207   3e-59   
ref|XP_010935040.1|  PREDICTED: LOW QUALITY PROTEIN: probable lin...    207   3e-59   
gb|ABF19103.2|  9-lipoxygenase                                          207   3e-59   Capsicum annuum
ref|XP_009365900.1|  PREDICTED: probable linoleate 9S-lipoxygenase 5    207   3e-59   Pyrus x bretschneideri [bai li]
gb|AGI16380.1|  lipoxygenase                                            207   3e-59   Malus domestica [apple tree]
gb|KDP23508.1|  hypothetical protein JCGZ_23341                         207   3e-59   Jatropha curcas
ref|XP_006419896.1|  hypothetical protein CICLE_v10004281mg             205   3e-59   
gb|AGI16379.1|  lipoxygenase                                            207   3e-59   Malus domestica [apple tree]
gb|KDO74649.1|  hypothetical protein CISIN_1g002776mg                   205   3e-59   Citrus sinensis [apfelsine]
gb|AGI16377.1|  lipoxygenase                                            207   4e-59   Malus domestica [apple tree]
ref|XP_004156417.1|  PREDICTED: LOW QUALITY PROTEIN: probable lin...    207   4e-59   
ref|XP_008348093.1|  PREDICTED: probable linoleate 9S-lipoxygenase 5    207   5e-59   
gb|AGI16378.1|  lipoxygenase                                            207   5e-59   Malus domestica [apple tree]
ref|XP_002891934.1|  hypothetical protein ARALYDRAFT_474776             206   6e-59   
gb|AIR74673.1|  lipoxygenase                                            205   6e-59   Lilium regale
ref|NP_001280815.1|  probable linoleate 9S-lipoxygenase 5               206   6e-59   Malus domestica [apple tree]
ref|XP_006419897.1|  hypothetical protein CICLE_v10004281mg             205   6e-59   
ref|XP_011090733.1|  PREDICTED: probable linoleate 9S-lipoxygenas...    206   6e-59   Sesamum indicum [beniseed]
gb|AAD09202.1|  lipoxygenase                                            206   7e-59   Solanum tuberosum [potatoes]
ref|XP_011090735.1|  PREDICTED: probable linoleate 9S-lipoxygenas...    206   7e-59   Sesamum indicum [beniseed]
ref|XP_009774054.1|  PREDICTED: probable linoleate 9S-lipoxygenase 5    206   7e-59   Nicotiana sylvestris
ref|XP_008359870.1|  PREDICTED: probable linoleate 9S-lipoxygenase 5    206   8e-59   
ref|XP_007208102.1|  hypothetical protein PRUPE_ppa001216mg             206   9e-59   
emb|CDY43490.1|  BnaA01g21450D                                          208   1e-58   Brassica napus [oilseed rape]
gb|AGK82775.1|  lipoxygenase                                            206   1e-58   Malus domestica [apple tree]
ref|XP_010674744.1|  PREDICTED: probable linoleate 9S-lipoxygenase 5    206   1e-58   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_004309944.1|  PREDICTED: probable linoleate 9S-lipoxygenase 5    206   1e-58   Fragaria vesca subsp. vesca
ref|NP_001280980.1|  probable linoleate 9S-lipoxygenase 5               206   1e-58   Malus domestica [apple tree]
ref|XP_009597615.1|  PREDICTED: linoleate 9S-lipoxygenase 6             206   1e-58   Nicotiana tomentosiformis
ref|XP_002315780.1|  lipoxygenase family protein                        206   1e-58   
ref|XP_004139172.1|  PREDICTED: probable linoleate 9S-lipoxygenas...    205   1e-58   Cucumis sativus [cucumbers]
ref|XP_008224534.1|  PREDICTED: linoleate 9S-lipoxygenase 5, chlo...    205   2e-58   Prunus mume [ume]
gb|KDO74648.1|  hypothetical protein CISIN_1g002776mg                   205   2e-58   Citrus sinensis [apfelsine]
ref|XP_006419898.1|  hypothetical protein CICLE_v10004281mg             205   2e-58   Citrus clementina [clementine]
gb|KDO74647.1|  hypothetical protein CISIN_1g002776mg                   205   2e-58   Citrus sinensis [apfelsine]
gb|AAO03558.1|  lipoxygenase 1                                          205   2e-58   Brassica napus [oilseed rape]
ref|XP_004156418.1|  PREDICTED: probable linoleate 9S-lipoxygenas...    205   2e-58   
emb|CDP20620.1|  unnamed protein product                                204   2e-58   Coffea canephora [robusta coffee]
gb|AHX56188.1|  lipoxygenase                                            205   2e-58   Diospyros kaki [Japanese persimmon]
ref|XP_006359918.1|  PREDICTED: probable linoleate 9S-lipoxygenas...    205   2e-58   Solanum tuberosum [potatoes]
ref|XP_010934565.1|  PREDICTED: probable linoleate 9S-lipoxygenase 5    205   2e-58   Elaeis guineensis
ref|XP_006344622.1|  PREDICTED: linoleate 9S-lipoxygenase B-like        205   2e-58   Solanum tuberosum [potatoes]
ref|XP_010102744.1|  putative linoleate 9S-lipoxygenase 5               205   3e-58   
ref|XP_006359917.1|  PREDICTED: probable linoleate 9S-lipoxygenas...    204   3e-58   Solanum tuberosum [potatoes]
gb|KHN16119.1|  Putative linoleate 9S-lipoxygenase 5                    204   3e-58   Glycine soja [wild soybean]
ref|NP_175900.1|  lipoxygenase 1                                        204   3e-58   Arabidopsis thaliana [mouse-ear cress]
ref|XP_003536076.1|  PREDICTED: probable linoleate 9S-lipoxygenas...    204   3e-58   Glycine max [soybeans]
ref|XP_010667400.1|  PREDICTED: probable linoleate 9S-lipoxygenase 5    204   4e-58   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_003521704.2|  PREDICTED: probable linoleate 9S-lipoxygenas...    204   4e-58   Glycine max [soybeans]
ref|XP_004494612.1|  PREDICTED: probable linoleate 9S-lipoxygenas...    204   4e-58   Cicer arietinum [garbanzo]
ref|XP_006300394.1|  hypothetical protein CARUB_v10019783mg             204   5e-58   Capsella rubella
gb|ABF60002.1|  lipoxygenase 2                                          204   6e-58   Actinidia deliciosa [Chinese gooseberry]
gb|KJB28315.1|  hypothetical protein B456_005G041900                    204   7e-58   Gossypium raimondii
gb|AEQ30071.1|  lipoxygenase                                            203   7e-58   Litchi chinensis [litchi]
ref|XP_004495725.1|  PREDICTED: probable linoleate 9S-lipoxygenas...    203   8e-58   Cicer arietinum [garbanzo]
gb|AGK82798.1|  lipoxygenase                                            203   8e-58   Malus domestica [apple tree]
ref|XP_007143236.1|  hypothetical protein PHAVU_007G055600g             203   9e-58   Phaseolus vulgaris [French bean]
gb|AAA74393.1|  lipoxygenase                                            203   9e-58   Solanum lycopersicum
ref|NP_001234873.1|  linoleate 9S-lipoxygenase B                        203   9e-58   
ref|XP_010324011.1|  PREDICTED: linoleate 9S-lipoxygenase B isofo...    203   9e-58   
ref|XP_006344836.1|  PREDICTED: probable linoleate 9S-lipoxygenas...    203   1e-57   Solanum tuberosum [potatoes]
gb|AGN75068.1|  lipoxygenase 2                                          203   1e-57   Momordica charantia [balsam pear]
gb|KHN15782.1|  Linoleate 9S-lipoxygenase 5, chloroplastic              203   1e-57   Glycine soja [wild soybean]
ref|XP_011021548.1|  PREDICTED: probable linoleate 9S-lipoxygenas...    203   1e-57   Populus euphratica
ref|XP_006382595.1|  hypothetical protein POPTR_0005s03580g             202   1e-57   Populus trichocarpa [western balsam poplar]
ref|XP_011021549.1|  PREDICTED: probable linoleate 9S-lipoxygenas...    203   1e-57   Populus euphratica
gb|AIC82456.1|  lipoxygenase                                            202   1e-57   Cocos nucifera
gb|KHF98566.1|  Linoleate 9S-lipoxygenase 5, chloroplastic              202   2e-57   Gossypium arboreum [tree cotton]
gb|KHF98567.1|  Linoleate 9S-lipoxygenase 5, chloroplastic              202   2e-57   Gossypium arboreum [tree cotton]
ref|XP_007147045.1|  hypothetical protein PHAVU_006G091400g             202   2e-57   Phaseolus vulgaris [French bean]
ref|XP_003556040.1|  PREDICTED: linoleate 9S-lipoxygenase 5, chlo...    202   2e-57   Glycine max [soybeans]
ref|XP_009763875.1|  PREDICTED: probable linoleate 9S-lipoxygenas...    202   2e-57   Nicotiana sylvestris
ref|XP_009763870.1|  PREDICTED: probable linoleate 9S-lipoxygenas...    202   2e-57   Nicotiana sylvestris
ref|XP_004139356.1|  PREDICTED: probable linoleate 9S-lipoxygenas...    202   3e-57   Cucumis sativus [cucumbers]
ref|XP_008454526.1|  PREDICTED: probable linoleate 9S-lipoxygenase 5    201   3e-57   
ref|XP_009376662.1|  PREDICTED: probable linoleate 9S-lipoxygenase 5    202   4e-57   Pyrus x bretschneideri [bai li]
ref|XP_010553735.1|  PREDICTED: linoleate 9S-lipoxygenase 1-like        201   5e-57   Tarenaya hassleriana [spider flower]
ref|XP_010674738.1|  PREDICTED: probable linoleate 9S-lipoxygenas...    201   6e-57   Beta vulgaris subsp. vulgaris [field beet]
gb|KDO56302.1|  hypothetical protein CISIN_1g002839mg                   201   7e-57   Citrus sinensis [apfelsine]
ref|XP_006472029.1|  PREDICTED: probable linoleate 9S-lipoxygenas...    200   8e-57   Citrus sinensis [apfelsine]
ref|XP_006433338.1|  hypothetical protein CICLE_v10000236mg             201   8e-57   Citrus clementina [clementine]
ref|XP_011036801.1|  PREDICTED: probable linoleate 9S-lipoxygenase 5    200   1e-56   Populus euphratica
ref|XP_004139173.1|  PREDICTED: probable linoleate 9S-lipoxygenas...    200   1e-56   Cucumis sativus [cucumbers]
dbj|BAH57745.1|  lipoxygenase                                           200   1e-56   Actinidia arguta
ref|NP_001237323.1|  lipoxygenase-9                                     200   1e-56   
ref|XP_008777614.1|  PREDICTED: linoleate 9S-lipoxygenase 6-like        200   1e-56   Phoenix dactylifera
gb|KHN01371.1|  Linoleate 9S-lipoxygenase 1                             200   1e-56   Glycine soja [wild soybean]
ref|XP_003591120.1|  Lipoxygenase                                       200   1e-56   Medicago truncatula
ref|XP_007225308.1|  hypothetical protein PRUPE_ppa001207mg             200   1e-56   Prunus persica
gb|AIQ86601.1|  lipoxygenase                                            187   1e-56   Prunus armeniaca
ref|XP_004169780.1|  PREDICTED: LOW QUALITY PROTEIN: probable lin...    200   2e-56   
ref|XP_007143238.1|  hypothetical protein PHAVU_007G055800g             199   2e-56   Phaseolus vulgaris [French bean]
gb|EYU41500.1|  hypothetical protein MIMGU_mgv1a001165mg                199   2e-56   Erythranthe guttata [common monkey flower]
ref|XP_003592410.1|  Lipoxygenase                                       199   3e-56   
gb|KCW61799.1|  hypothetical protein EUGRSUZ_H04497                     197   3e-56   Eucalyptus grandis [rose gum]
gb|EPS73037.1|  lipoxygenase                                            194   3e-56   Genlisea aurea
gb|KHN02707.1|  Linoleate 9S-lipoxygenase 5, chloroplastic              199   4e-56   Glycine soja [wild soybean]
gb|ADG03095.1|  lipoxygenase 3                                          199   4e-56   Glycine max [soybeans]
ref|XP_008454500.1|  PREDICTED: probable linoleate 9S-lipoxygenase 5    198   4e-56   Cucumis melo [Oriental melon]
gb|AGH13205.1|  lipoxygenase                                            198   4e-56   Salvia miltiorrhiza [Chinese salvia]
gb|AGS94394.3|  lipoxygenase                                            198   4e-56   Vigna radiata [mung bean]
ref|XP_007135516.1|  hypothetical protein PHAVU_010G135900g             198   5e-56   Phaseolus vulgaris [French bean]
ref|XP_007150490.1|  hypothetical protein PHAVU_005G157000g             198   5e-56   Phaseolus vulgaris [French bean]
ref|XP_007034721.1|  PLAT/LH2 domain-containing lipoxygenase fami...    197   5e-56   
gb|AAF15296.2|AF204210_1  lipoxygenase                                  198   5e-56   Phaseolus vulgaris [French bean]
gb|KHN32710.1|  Seed linoleate 9S-lipoxygenase-3                        197   8e-56   Glycine soja [wild soybean]
gb|ABX60408.1|  lipoxygenase L-3                                        197   8e-56   Glycine max [soybeans]
pdb|1ROV|A  Chain A, Lipoxygenase-3 Treated With Cumene Hydropero...    197   8e-56   Glycine max [soybeans]
ref|NP_001235383.1|  seed linoleate 9S-lipoxygenase-3                   197   8e-56   
ref|XP_007135506.1|  hypothetical protein PHAVU_010G134900g             197   9e-56   Phaseolus vulgaris [French bean]
ref|XP_004231274.1|  PREDICTED: probable linoleate 9S-lipoxygenase 5    197   1e-55   Solanum lycopersicum
ref|XP_009625817.1|  PREDICTED: probable linoleate 9S-lipoxygenase 5    197   1e-55   
ref|XP_009387657.1|  PREDICTED: linoleate 9S-lipoxygenase A-like        197   1e-55   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_003597559.1|  Seed lipoxygenase-3                                197   2e-55   Medicago truncatula
emb|CAP59449.1|  lipoxygenase                                           197   2e-55   Momordica charantia [balsam pear]
gb|KHN03989.1|  Putative linoleate 9S-lipoxygenase 5                    197   2e-55   Glycine soja [wild soybean]
emb|CAA31664.1|  unnamed protein product                                196   3e-55   Glycine max [soybeans]
prf||1502333A  lipoxygenase 3                                           196   3e-55
ref|XP_010277588.1|  PREDICTED: probable linoleate 9S-lipoxygenas...    195   3e-55   
sp|P09186.1|LOX3_SOYBN  RecName: Full=Seed linoleate 9S-lipoxygen...    196   3e-55   Glycine max [soybeans]
gb|KHN11255.1|  Linoleate 9S-lipoxygenase                               196   3e-55   Glycine soja [wild soybean]
ref|NP_001237338.1|  lipoxygenase-10                                    196   4e-55   
ref|XP_008370473.1|  PREDICTED: probable linoleate 9S-lipoxygenase 5    196   5e-55   
ref|XP_010256003.1|  PREDICTED: probable linoleate 9S-lipoxygenase 5    196   5e-55   Nelumbo nucifera [Indian lotus]
ref|XP_004496744.1|  PREDICTED: linoleate 9S-lipoxygenase 5, chlo...    195   6e-55   
gb|AAG42354.1|  lipoxygenase                                            195   8e-55   Phaseolus vulgaris [French bean]
ref|XP_010277584.1|  PREDICTED: probable linoleate 9S-lipoxygenas...    195   8e-55   Nelumbo nucifera [Indian lotus]
ref|XP_007135514.1|  hypothetical protein PHAVU_010G135700g             195   9e-55   Phaseolus vulgaris [French bean]
gb|AHI86055.1|  lipoxygenase                                            194   1e-54   Cucumis melo var. makuwa
ref|XP_008449553.1|  PREDICTED: probable linoleate 9S-lipoxygenase 5    194   1e-54   Cucumis melo [Oriental melon]
gb|KEH35161.1|  seed linoleate 9S-lipoxygenase                          194   1e-54   Medicago truncatula
ref|XP_009418148.1|  PREDICTED: probable linoleate 9S-lipoxygenase 5    194   1e-54   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009790810.1|  PREDICTED: probable linoleate 9S-lipoxygenase 5    194   2e-54   Nicotiana sylvestris
ref|XP_010549787.1|  PREDICTED: linoleate 9S-lipoxygenase 1-like        194   2e-54   Tarenaya hassleriana [spider flower]
gb|KEH35160.1|  seed linoleate 9S-lipoxygenase                          194   2e-54   Medicago truncatula
ref|XP_010674739.1|  PREDICTED: probable linoleate 9S-lipoxygenas...    194   2e-54   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_010674740.1|  PREDICTED: probable linoleate 9S-lipoxygenas...    194   2e-54   Beta vulgaris subsp. vulgaris [field beet]
sp|P27481.1|LOXB_PHAVU  RecName: Full=Linoleate 9S-lipoxygenase; ...    193   2e-54   Phaseolus vulgaris [French bean]
ref|XP_003626279.1|  Chalcone synthase                                  196   2e-54   
gb|AGL76509.1|  lipoxygenase                                            193   2e-54   Phaseolus coccineus [scarlet runner bean]
ref|XP_004486857.1|  PREDICTED: seed linoleate 9S-lipoxygenase-3-...    194   3e-54   Cicer arietinum [garbanzo]
gb|KHN32712.1|  Linoleate 9S-lipoxygenase-4                             192   3e-54   Glycine soja [wild soybean]
ref|XP_007150489.1|  hypothetical protein PHAVU_005G156900g             193   3e-54   Phaseolus vulgaris [French bean]
gb|AEU04516.1|  lipoxygenase 1                                          193   3e-54   Taxus wallichiana var. chinensis [Chinese yew]
ref|NP_001267584.1|  probable linoleate 9S-lipoxygenase 5-like          193   3e-54   Cucumis sativus [cucumbers]
gb|KHN11257.1|  Linoleate 9S-lipoxygenase                               193   3e-54   Glycine soja [wild soybean]
ref|XP_007030814.1|  Lipoxygenase 1                                     193   4e-54   
ref|XP_010025193.1|  PREDICTED: probable linoleate 9S-lipoxygenase 5    193   4e-54   Eucalyptus grandis [rose gum]
ref|XP_010024349.1|  PREDICTED: probable linoleate 9S-lipoxygenase 5    193   5e-54   
ref|XP_003627173.1|  Seed lipoxygenase-3                                192   6e-54   
ref|XP_004296897.1|  PREDICTED: probable linoleate 9S-lipoxygenase 5    192   6e-54   
gb|ABF98393.1|  Lipoxygenase 3, putative, expressed                     189   7e-54   
ref|XP_008454442.1|  PREDICTED: probable linoleate 9S-lipoxygenase 5    192   7e-54   
emb|CAE17327.1|  lipoxygenase                                           192   8e-54   
ref|XP_003627182.1|  Lipoxygenase                                       192   9e-54   
gb|AET01658.2|  seed linoleate 9S-lipoxygenase                          192   1e-53   
gb|KJB26433.1|  hypothetical protein B456_004G241400                    191   1e-53   
ref|NP_001238203.1|  lipoxygenase L-5                                   191   2e-53   
gb|AAB20898.1|  lipoxygenase                                            189   2e-53   
gb|KJB26434.1|  hypothetical protein B456_004G241400                    191   2e-53   
ref|XP_010674736.1|  PREDICTED: probable linoleate 9S-lipoxygenase 5    191   2e-53   
ref|XP_003531600.2|  PREDICTED: LOW QUALITY PROTEIN: linoleate 9S...    193   4e-53   
gb|AEI71780.1|  bacterial-induced lipoxygenase                          190   4e-53   
gb|AAD09861.1|  lipoxygenase                                            190   5e-53   
ref|XP_009625816.1|  PREDICTED: probable linoleate 9S-lipoxygenase 5    190   5e-53   
gb|KCW61801.1|  hypothetical protein EUGRSUZ_H044981                    189   6e-53   
emb|CDO99039.1|  unnamed protein product                                190   6e-53   
gb|AEZ50136.1|  lipoxygenase                                            190   8e-53   
ref|XP_004169568.1|  PREDICTED: LOW QUALITY PROTEIN: linoleate 9S...    189   8e-53   
gb|KFK35599.1|  hypothetical protein AALP_AA4G012300                    189   8e-53   
ref|XP_004150982.1|  PREDICTED: linoleate 9S-lipoxygenase 6-like        189   8e-53   
gb|KFK35600.1|  hypothetical protein AALP_AA4G012300                    189   8e-53   
ref|XP_004486858.1|  PREDICTED: seed linoleate 9S-lipoxygenase-2-...    189   9e-53   
ref|NP_001050995.2|  Os03g0700700                                       189   9e-53   
ref|NP_001238676.1|  seed linoleate 9S-lipoxygenase                     189   1e-52   
sp|P24095.1|LOXX_SOYBN  RecName: Full=Seed linoleate 9S-lipoxygen...    189   1e-52   
ref|XP_010025194.1|  PREDICTED: probable linoleate 9S-lipoxygenase 5    189   1e-52   
ref|XP_004144826.1|  PREDICTED: probable linoleate 9S-lipoxygenas...    189   1e-52   
sp|P27480.1|LOXA_PHAVU  RecName: Full=Linoleate 9S-lipoxygenase 1...    189   1e-52   
sp|Q53RB0.1|LOX4_ORYSJ  RecName: Full=Probable linoleate 9S-lipox...    189   1e-52   
ref|XP_004158761.1|  PREDICTED: probable linoleate 9S-lipoxygenas...    189   2e-52   
ref|XP_007135505.1|  hypothetical protein PHAVU_010G134800g             189   2e-52   
gb|KHG06114.1|  putative linoleate 9S-lipoxygenase 5                    189   2e-52   
gb|EAY91532.1|  hypothetical protein OsI_13165                          189   2e-52   
gb|AAY87056.1|  13-lipoxygenase                                         188   2e-52   
gb|ACU81176.1|  13S-lipoxygenase                                        189   2e-52   
gb|ADL41189.1|  lipoxygenase                                            188   2e-52   
ref|XP_003627185.1|  Lipoxygenase                                       188   2e-52   
gb|AAY87057.1|  13-lipoxygenase                                         188   2e-52   
gb|AFU25451.1|  lipoxygenase 1.1                                        181   2e-52   
gb|KHG15901.1|  putative linoleate 9S-lipoxygenase 5                    188   3e-52   
ref|XP_003597558.1|  Lipoxygenase                                       188   3e-52   
ref|XP_007030815.1|  Lipoxygenase 1                                     188   3e-52   
gb|ABD47523.1|  dual positional specificity lipoxygenase                188   3e-52   
sp|P09918.1|LOX3_PEA  RecName: Full=Seed linoleate 9S-lipoxygenas...    188   3e-52   
sp|P38417.1|LOX4_SOYBN  RecName: Full=Linoleate 9S-lipoxygenase-4...    187   3e-52   
dbj|BAJ97592.1|  predicted protein                                      187   3e-52   
ref|XP_006650444.1|  PREDICTED: probable linoleate 9S-lipoxygenas...    188   3e-52   
gb|ABX60409.1|  lipoxygease L-4                                         187   3e-52   
ref|NP_001238692.1|  lipoxygenase                                       187   3e-52   
gb|ABB82552.1|  13S-lipoxygenase                                        187   4e-52   
dbj|BAJ97226.1|  predicted protein                                      187   6e-52   
gb|ADZ31265.1|  lipoxygenase 3                                          187   7e-52   
emb|CAG44503.1|  lipoxygenase LOXN3                                     187   8e-52   
ref|XP_009406046.1|  PREDICTED: linoleate 9S-lipoxygenase 6-like        187   8e-52   
ref|XP_002458905.1|  hypothetical protein SORBIDRAFT_03g042440          187   8e-52   
ref|XP_006296682.1|  hypothetical protein CARUB_v10012957mg             187   9e-52   
ref|XP_002521992.1|  lipoxygenase, putative                             186   9e-52   
tpg|DAA50838.1|  TPA: lipoxygenase3                                     186   9e-52   
gb|ABQ10187.1|  lipoxygenase                                            186   9e-52   
ref|XP_008454470.1|  PREDICTED: linoleate 9S-lipoxygenase 6-like        186   1e-51   
ref|XP_008454503.1|  PREDICTED: linoleate 9S-lipoxygenase 6-like ...    186   1e-51   
ref|XP_008454513.1|  PREDICTED: linoleate 9S-lipoxygenase 6-like ...    186   1e-51   
ref|XP_009406999.1|  PREDICTED: probable linoleate 9S-lipoxygenase 4    185   1e-51   
ref|XP_003627174.1|  Lipoxygenase                                       186   1e-51   
ref|XP_004151736.1|  PREDICTED: probable linoleate 9S-lipoxygenas...    183   1e-51   
gb|AAG61118.1|  lipoxygenase                                            186   1e-51   
ref|XP_003560916.1|  PREDICTED: probable linoleate 9S-lipoxygenase 4    186   1e-51   
ref|NP_001105515.1|  lipoxygenase                                       186   1e-51   
emb|CAB76909.1|  lipoxygenase                                           183   2e-51   
ref|XP_004510412.1|  PREDICTED: linoleate 9S-lipoxygenase-like          186   2e-51   
gb|AGL76510.1|  lipoxygenase                                            185   2e-51   
ref|XP_009406047.1|  PREDICTED: linoleate 9S-lipoxygenase 6-like        186   2e-51   
gb|KJB38135.1|  hypothetical protein B456_006G238200                    183   2e-51   
gb|KEH18416.1|  seed linoleate 9S-lipoxygenase                          183   2e-51   
gb|EMS61461.1|  Lipoxygenase 2                                          185   3e-51   
ref|XP_007135515.1|  hypothetical protein PHAVU_010G135800g             185   3e-51   
gb|AFU25452.1|  lipoxygenase 1.2                                        178   3e-51   
gb|AAA79186.1|  lipoxygenase                                            185   3e-51   
gb|AET01657.2|  seed linoleate 9S-lipoxygenase                          185   4e-51   
dbj|BAK01348.1|  predicted protein                                      184   4e-51   
ref|XP_003627181.1|  Lipoxygenase                                       185   4e-51   
gb|KJB38136.1|  hypothetical protein B456_006G238200                    183   4e-51   
emb|CAC04380.1|  lipoxygenase                                           185   4e-51   
ref|XP_010511287.1|  PREDICTED: linoleate 9S-lipoxygenase 5, chlo...    185   4e-51   
emb|CAA97845.1|  lipoxygenase                                           184   4e-51   
emb|CAG44501.1|  lipoxygenase LOXN3                                     185   4e-51   
ref|XP_008454430.1|  PREDICTED: linoleate 9S-lipoxygenase 6-like        185   4e-51   
ref|XP_003612346.1|  Seed lipoxygenase                                  181   6e-51   
ref|XP_010470259.1|  PREDICTED: linoleate 9S-lipoxygenase 5, chlo...    183   7e-51   
ref|XP_009415714.1|  PREDICTED: probable linoleate 9S-lipoxygenase 5    184   7e-51   
gb|KFK39531.1|  hypothetical protein AALP_AA3G256400                    184   7e-51   
gb|KHN01373.1|  Linoleate 9S-lipoxygenase 1                             179   8e-51   
ref|XP_006850111.1|  hypothetical protein AMTR_s00022p00225700          182   9e-51   
gb|EAY91529.1|  hypothetical protein OsI_13162                          184   9e-51   
gb|ABN09736.1|  lipoxygenase LOX-2                                      175   9e-51   
gb|ABX60410.1|  lipoxygenase L-5                                        183   9e-51   
ref|XP_006406169.1|  hypothetical protein EUTSA_v10020023mg             184   9e-51   
ref|XP_007135512.1|  hypothetical protein PHAVU_010G135500g             184   1e-50   
ref|XP_003627310.1|  Lipoxygenase                                       184   1e-50   
gb|KJB38138.1|  hypothetical protein B456_006G238200                    184   1e-50   
sp|P29114.2|LOX1_HORVU  RecName: Full=Linoleate 9S-lipoxygenase 1...    183   1e-50   
gb|KJB38137.1|  hypothetical protein B456_006G238200                    184   1e-50   
ref|XP_007150486.1|  hypothetical protein PHAVU_005G156700g             183   1e-50   
pdb|2IUK|A  Chain A, Crystal Structure Of Soybean Lipoxygenase-D        183   1e-50   
ref|XP_009387658.1|  PREDICTED: probable linoleate 9S-lipoxygenase 5    183   1e-50   
emb|CAA75609.1|  lipoxygenase                                           183   1e-50   
gb|AHG59314.1|  lipoxygenase-1                                          177   2e-50   
gb|KHN30072.1|  Seed linoleate 9S-lipoxygenase-2                        183   2e-50   
gb|AET01678.2|  seed linoleate 9S-lipoxygenase                          183   2e-50   
ref|XP_004156415.1|  PREDICTED: linoleate 9S-lipoxygenase 6-like        183   2e-50   
gb|AAB71759.1|  lipoxygenase                                            183   2e-50   
ref|XP_004156414.1|  PREDICTED: probable linoleate 9S-lipoxygenas...    183   2e-50   
ref|XP_003531596.1|  PREDICTED: seed linoleate 9S-lipoxygenase-3        183   2e-50   
ref|XP_010040715.1|  PREDICTED: probable linoleate 9S-lipoxygenase 5    182   2e-50   
gb|ADR71856.1|  lipoxygenase-1                                          183   2e-50   
ref|XP_010470260.1|  PREDICTED: linoleate 9S-lipoxygenase 5, chlo...    182   2e-50   
gb|AET01677.2|  seed linoleate 9S-lipoxygenase                          182   2e-50   
ref|XP_004510414.1|  PREDICTED: seed linoleate 9S-lipoxygenase-like     182   2e-50   
ref|XP_008245951.1|  PREDICTED: probable linoleate 9S-lipoxygenase 5    179   2e-50   
ref|XP_009626060.1|  PREDICTED: probable linoleate 9S-lipoxygenase 5    182   2e-50   
ref|XP_009407000.1|  PREDICTED: probable linoleate 9S-lipoxygenase 4    184   2e-50   
gb|KHG03761.1|  Linoleate 9S-lipoxygenase 5, chloroplastic -like ...    182   3e-50   
emb|CAA55318.1|  lipoxygenase                                           182   3e-50   
ref|XP_003627187.1|  Lipoxygenase                                       182   3e-50   
gb|ABX60407.1|  lipoxygease L-2                                         182   3e-50   
sp|P09439.1|LOX2_SOYBN  RecName: Full=Seed linoleate 9S-lipoxygen...    182   3e-50   
gb|ADG03092.1|  lipoxygenase 2                                          182   3e-50   
gb|ADG03091.1|  lipoxygenase 2                                          182   3e-50   
sp|P14856.1|LOX2_PEA  RecName: Full=Seed linoleate 9S-lipoxygenas...    182   3e-50   
ref|NP_001237685.1|  seed linoleate 9S-lipoxygenase-2                   182   3e-50   
gb|AFK32352.1|  lipoxygenase-2                                          182   3e-50   
emb|CAC19365.1|  lipoxygenase                                           182   3e-50   
gb|AAC61785.1|  lipoxygenase 1                                          182   3e-50   
ref|XP_010108010.1|  Linoleate 9S-lipoxygenase 5                        182   3e-50   
gb|ACL53478.1|  unknown                                                 182   3e-50   
ref|NP_188879.2|  lipoxygenase 5                                        182   4e-50   
emb|CAA64768.1|  lipoxygenase                                           169   4e-50   
gb|KEH18418.1|  seed linoleate 9S-lipoxygenase                          181   4e-50   
gb|KHN11256.1|  Linoleate 9S-lipoxygenase                               179   4e-50   
ref|NP_001050993.1|  Os03g0700400                                       182   4e-50   
ref|XP_002516771.1|  lipoxygenase, putative                             182   5e-50   
emb|CDY38326.1|  BnaC05g30190D                                          182   6e-50   
gb|EPS73035.1|  hypothetical protein M569_01717                         184   6e-50   
ref|XP_002466614.1|  hypothetical protein SORBIDRAFT_01g011050          181   6e-50   
ref|XP_004970878.1|  PREDICTED: linoleate 9S-lipoxygenase 2-like        181   7e-50   
gb|ACG43480.1|  lipoxygenase 2                                          181   7e-50   
ref|XP_006650559.1|  PREDICTED: linoleate 9S-lipoxygenase 2-like        181   7e-50   
ref|NP_001105003.1|  lipoxygenase                                       181   7e-50   
ref|XP_003612345.1|  Seed lipoxygenase                                  181   7e-50   
tpg|DAA56392.1|  TPA: lipoxygenase1                                     181   8e-50   
emb|CAA63483.1|  lipoxygenase                                           181   8e-50   
ref|XP_010466519.1|  PREDICTED: linoleate 9S-lipoxygenase 5, chlo...    181   8e-50   
ref|XP_009108895.1|  PREDICTED: linoleate 9S-lipoxygenase 5, chlo...    181   9e-50   
ref|XP_009145332.1|  PREDICTED: linoleate 9S-lipoxygenase 5, chlo...    181   9e-50   
ref|XP_004512262.1|  PREDICTED: seed linoleate 9S-lipoxygenase-like     181   1e-49   
gb|EAZ28267.1|  hypothetical protein OsJ_12238                          182   1e-49   
ref|XP_003560911.1|  PREDICTED: linoleate 9S-lipoxygenase 1             181   1e-49   
gb|AHG59375.1|  lipoxygenase                                            177   1e-49   
emb|CDY64191.1|  BnaA01g36630D                                          181   1e-49   
ref|XP_004510413.1|  PREDICTED: linoleate 9S-lipoxygenase-like          181   1e-49   
ref|XP_004510411.1|  PREDICTED: linoleate 9S-lipoxygenase-like          181   1e-49   
gb|AHG59315.1|  lipoxygenase                                            180   1e-49   
ref|XP_003627201.1|  Seed lipoxygenase                                  183   2e-49   
gb|KEH18417.1|  seed linoleate 9S-lipoxygenase                          180   2e-49   
ref|XP_003627202.1|  Seed lipoxygenase                                  183   2e-49   
ref|XP_004982083.1|  PREDICTED: putative linoleate 9S-lipoxygenas...    180   2e-49   
gb|ADR71858.1|  lipoxygenase-1                                          180   2e-49   
gb|KDP23726.1|  hypothetical protein JCGZ_23559                         180   2e-49   
ref|XP_003528382.1|  PREDICTED: linoleate 9S-lipoxygenase 1-like ...    180   2e-49   
gb|ADP02185.1|  putative lipoxygenase                                   180   2e-49   
gb|KHN11254.1|  Seed linoleate 9S-lipoxygenase                          180   3e-49   
ref|XP_003531597.1|  PREDICTED: seed linoleate 9S-lipoxygenase-li...    180   3e-49   
ref|XP_006650443.1|  PREDICTED: putative linoleate 9S-lipoxygenas...    180   3e-49   
tpg|DAA56391.1|  TPA: lipoxygenase1                                     179   3e-49   
ref|XP_004970879.1|  PREDICTED: linoleate 9S-lipoxygenase 2-like        179   3e-49   
gb|KHN39332.1|  Seed linoleate 9S-lipoxygenase                          179   3e-49   
gb|ADG03094.1|  mutant lipoxygenase 1                                   176   5e-49   
ref|XP_009774215.1|  PREDICTED: probable linoleate 9S-lipoxygenase 5    179   5e-49   
gb|AEB70990.1|  lipoxygenase 3                                          179   5e-49   
gb|ACS34909.1|  lipoxygenase 1                                          179   6e-49   
gb|AEB70991.1|  lipoxygenase 4                                          179   6e-49   
ref|XP_010674737.1|  PREDICTED: probable linoleate 9S-lipoxygenase 5    179   6e-49   
gb|EMT09206.1|  Lipoxygenase 1                                          179   6e-49   
ref|XP_010511294.1|  PREDICTED: linoleate 9S-lipoxygenase 5, chlo...    179   6e-49   
ref|XP_004513384.1|  PREDICTED: linoleate 9S-lipoxygenase-like          176   6e-49   
ref|XP_009779646.1|  PREDICTED: probable linoleate 9S-lipoxygenas...    178   6e-49   
ref|XP_003627197.1|  Lipoxygenase                                       178   7e-49   
sp|P38414.1|LOX1_LENCU  RecName: Full=Linoleate 9S-lipoxygenase; ...    179   7e-49   
ref|XP_003559944.1|  PREDICTED: linoleate 9S-lipoxygenase 2-like        179   7e-49   
ref|XP_003627196.1|  Lipoxygenase                                       178   8e-49   
ref|XP_009779645.1|  PREDICTED: probable linoleate 9S-lipoxygenas...    178   8e-49   
ref|XP_010488264.1|  PREDICTED: linoleate 9S-lipoxygenase 5, chlo...    178   1e-48   
emb|CDY46325.1|  BnaC01g31590D                                          178   1e-48   
gb|KCW44986.1|  hypothetical protein EUGRSUZ_L01433                     176   1e-48   
ref|XP_010488263.1|  PREDICTED: linoleate 9S-lipoxygenase 5, chlo...    178   1e-48   
gb|KHN39331.1|  Seed linoleate 9S-lipoxygenase                          177   1e-48   
ref|XP_002458908.1|  hypothetical protein SORBIDRAFT_03g042450          178   2e-48   
ref|NP_001105973.1|  lipoxygenase                                       177   2e-48   
ref|NP_001235189.1|  lipoxygenase                                       177   2e-48   
gb|EAY91797.1|  hypothetical protein OsI_13441                          177   2e-48   
dbj|BAJ91632.1|  predicted protein                                      177   2e-48   
gb|ADR71857.1|  lipoxygenase-1                                          177   2e-48   
dbj|BAJ87153.1|  predicted protein                                      177   2e-48   
gb|AHG59316.1|  lipoxygenase                                            177   2e-48   
emb|CAA64764.1|  lipoxygenase                                           173   2e-48   
gb|EMS64854.1|  Putative lipoxygenase 3                                 176   2e-48   
emb|CBI26229.3|  unnamed protein product                                176   3e-48   
gb|AAA33988.1|  lipoxygenase-1                                          175   3e-48   
gb|ACE79245.1|  lipoxygenase-1                                          177   3e-48   
emb|CAA64767.1|  lipoxygenase                                           173   3e-48   
emb|CAA53730.1|  lipoxygenase                                           177   3e-48   
gb|ABS72447.1|  lipoxygenase-1                                          177   3e-48   
dbj|BAD02945.1|  9-lipoxigenase                                         177   3e-48   
gb|ACS34908.1|  lipoxygenase 2                                          177   3e-48   
gb|EAY91521.1|  hypothetical protein OsI_13155                          177   3e-48   
ref|XP_010431179.1|  PREDICTED: linoleate 9S-lipoxygenase 5, chlo...    176   3e-48   
ref|NP_001050990.1|  Os03g0699700                                       177   3e-48   
gb|EMT25349.1|  Lipoxygenase 2                                          177   3e-48   



>gb|AGL96414.1| 9-lipoxygenase, partial [Nicotiana benthamiana]
Length=862

 Score =   236 bits (603),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 111/162 (69%), Positives = 134/162 (83%), Gaps = 0/162 (0%)
 Frame = +2

Query  2    PILEHIQKNTPLEMIKELLRSDGEKMFKFPTPQVIADNKTAWRTDEEFAREMLAGVNPVS  181
            P+L+ I  N PLE++KELLRSDGE +FK+PTPQVI ++KTAWRTDEEF REMLAGVNPV 
Sbjct  321  PLLKAITDNIPLEILKELLRSDGEGLFKYPTPQVIQEDKTAWRTDEEFGREMLAGVNPVV  380

Query  182  ISRLQMFPQRSTLDPKVYGDHTCTITREDIADKLDGLTVEQAIESKRLFILDHHDAITLY  361
            ISRLQ FP +S LDPK YG+   TITRE I DKLDGLT+++AI++ +LFIL+HHD +  Y
Sbjct  381  ISRLQEFPPKSKLDPKTYGNQNSTITREQIEDKLDGLTIDEAIKTNKLFILNHHDILMPY  440

Query  362  ARRINDNTDRKIYATRTLLFLLKDGTLRPIAIELSKPHPDGD  487
             RRIN +TD K YA+RTLLFL  +GTL+P+AIELS PHPDGD
Sbjct  441  LRRINTSTDTKTYASRTLLFLQDNGTLKPLAIELSLPHPDGD  482



>ref|XP_009774053.1| PREDICTED: probable linoleate 9S-lipoxygenase 5 [Nicotiana sylvestris]
Length=862

 Score =   236 bits (602),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 111/162 (69%), Positives = 135/162 (83%), Gaps = 0/162 (0%)
 Frame = +2

Query  2    PILEHIQKNTPLEMIKELLRSDGEKMFKFPTPQVIADNKTAWRTDEEFAREMLAGVNPVS  181
            P+L+ I  + PLE++KELLRSDGE +FK+PTPQVI ++KTAWRTDEEF REMLAGVNPV+
Sbjct  321  PLLKAITDSIPLEILKELLRSDGEGLFKYPTPQVIQEDKTAWRTDEEFGREMLAGVNPVT  380

Query  182  ISRLQMFPQRSTLDPKVYGDHTCTITREDIADKLDGLTVEQAIESKRLFILDHHDAITLY  361
            ISRLQ FP +S LDPK YG+   TITRE I DKLDGLT+++AI++ RLFIL+HHD +  Y
Sbjct  381  ISRLQEFPPKSKLDPKTYGNQNSTITREQIEDKLDGLTIDEAIKTNRLFILNHHDILMPY  440

Query  362  ARRINDNTDRKIYATRTLLFLLKDGTLRPIAIELSKPHPDGD  487
             RRIN +TD K YA+RTLLFL  +GTL+P+AIELS PHPDGD
Sbjct  441  LRRINTSTDTKTYASRTLLFLQDNGTLKPLAIELSLPHPDGD  482



>emb|CAA58859.1| lipoxygenase [Nicotiana tabacum]
Length=862

 Score =   234 bits (598),  Expect = 5e-69, Method: Compositional matrix adjust.
 Identities = 111/162 (69%), Positives = 134/162 (83%), Gaps = 0/162 (0%)
 Frame = +2

Query  2    PILEHIQKNTPLEMIKELLRSDGEKMFKFPTPQVIADNKTAWRTDEEFAREMLAGVNPVS  181
            P+L+ I  + PLE++KELLRSDGE +FK+PTPQVI ++KTAWRTDEEF REMLAGVNPV 
Sbjct  321  PLLKAITDSIPLEILKELLRSDGEGLFKYPTPQVIQEDKTAWRTDEEFGREMLAGVNPVI  380

Query  182  ISRLQMFPQRSTLDPKVYGDHTCTITREDIADKLDGLTVEQAIESKRLFILDHHDAITLY  361
            ISRLQ FP +S LDPK+YG+   TITRE I DKLDGLT+++AI++ RLFIL+HHD +  Y
Sbjct  381  ISRLQEFPPKSKLDPKIYGNQNSTITREQIEDKLDGLTIDEAIKTNRLFILNHHDILMPY  440

Query  362  ARRINDNTDRKIYATRTLLFLLKDGTLRPIAIELSKPHPDGD  487
             RRIN +TD K YA+RTLLFL  +GTL+P AIELS PHPDGD
Sbjct  441  LRRINTSTDTKTYASRTLLFLQDNGTLKPSAIELSLPHPDGD  482



>ref|XP_009610900.1| PREDICTED: probable linoleate 9S-lipoxygenase 5 [Nicotiana tomentosiformis]
Length=862

 Score =   234 bits (598),  Expect = 5e-69, Method: Compositional matrix adjust.
 Identities = 111/162 (69%), Positives = 134/162 (83%), Gaps = 0/162 (0%)
 Frame = +2

Query  2    PILEHIQKNTPLEMIKELLRSDGEKMFKFPTPQVIADNKTAWRTDEEFAREMLAGVNPVS  181
            P+L+ I  + PLE++KELLRSDGE +FK+PTPQVI ++KTAWRTDEEF REMLAGVNPV 
Sbjct  321  PLLKAITDSIPLEILKELLRSDGEGLFKYPTPQVIQEDKTAWRTDEEFGREMLAGVNPVI  380

Query  182  ISRLQMFPQRSTLDPKVYGDHTCTITREDIADKLDGLTVEQAIESKRLFILDHHDAITLY  361
            ISRLQ FP +S LDPK+YG+   TITRE I DKLDGLT+++AI++ RLFIL+HHD +  Y
Sbjct  381  ISRLQEFPPKSKLDPKIYGNQNSTITREQIEDKLDGLTIDEAIKTNRLFILNHHDILMPY  440

Query  362  ARRINDNTDRKIYATRTLLFLLKDGTLRPIAIELSKPHPDGD  487
             RRIN +TD K YA+RTLLFL  +GTL+P AIELS PHPDGD
Sbjct  441  LRRINTSTDTKTYASRTLLFLQDNGTLKPSAIELSLPHPDGD  482



>gb|ADN92993.2| lipoxygenase LOX1 [Ipomoea nil]
Length=857

 Score =   234 bits (596),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 114/162 (70%), Positives = 130/162 (80%), Gaps = 1/162 (1%)
 Frame = +2

Query  2    PILEHIQKNTPLEMIKELLRSDGEKMFKFPTPQVIADNKTAWRTDEEFAREMLAGVNPVS  181
            P+L  I  N PLEM+KEL+RSDGE +FKFPTPQVI ++KTAWRTDEEF REMLAGVNPV 
Sbjct  317  PLLTAIADNIPLEMLKELIRSDGEGLFKFPTPQVIQEDKTAWRTDEEFGREMLAGVNPVV  376

Query  182  ISRLQMFPQRSTLDPKVYGDHTCTITREDIADKLDGLTVEQAIESKRLFILDHHDAITLY  361
            ISRLQ FP +S LDPK YGD T TIT+E I   LDGLTVE+AI + RLFIL+HHD +  Y
Sbjct  377  ISRLQEFPPKSKLDPKAYGDQTSTITKEHIQQNLDGLTVEEAIANNRLFILNHHDTLMPY  436

Query  362  ARRINDNTDRKIYATRTLLFLLKDGTLRPIAIELSKPHPDGD  487
             RRIN  T+ KIYA+RTLLFL  DGTL+P+AIELS PHP GD
Sbjct  437  LRRIN-TTNNKIYASRTLLFLNTDGTLKPVAIELSLPHPLGD  477



>gb|ABW75772.2| lipoxygenase [Camellia sinensis]
Length=861

 Score =   231 bits (589),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 111/162 (69%), Positives = 134/162 (83%), Gaps = 1/162 (1%)
 Frame = +2

Query  2    PILEHIQKNTPLEMIKELLRSDGEKMFKFPTPQVIADNKTAWRTDEEFAREMLAGVNPVS  181
            P+L+ I++N PLEM+KEL+R+DGE   KFP PQVI ++KTAWRTDEEFAREMLAGV+PV 
Sbjct  321  PLLDKIKENIPLEMLKELVRTDGEGYLKFPMPQVIKEDKTAWRTDEEFAREMLAGVDPVI  380

Query  182  ISRLQMFPQRSTLDPKVYGDHTCTITREDIADKLDGLTVEQAIESKRLFILDHHDAITLY  361
            ISRLQ FP RSTLDPK+YG+   +IT + I + LDG T+E+AI++ RLFILDHHDA+  Y
Sbjct  381  ISRLQEFPPRSTLDPKLYGNQNSSITEDHIKNNLDGFTIEEAIKNNRLFILDHHDALMPY  440

Query  362  ARRINDNTDRKIYATRTLLFLLKDGTLRPIAIELSKPHPDGD  487
             RRIN  T  KIYATRTLLFL KDGTL+P+AIELS PHP+GD
Sbjct  441  VRRIN-ATSTKIYATRTLLFLQKDGTLKPLAIELSLPHPNGD  481



>ref|XP_004302420.1| PREDICTED: probable linoleate 9S-lipoxygenase 5 [Fragaria vesca 
subsp. vesca]
Length=863

 Score =   230 bits (587),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 110/161 (68%), Positives = 127/161 (79%), Gaps = 0/161 (0%)
 Frame = +2

Query  5    ILEHIQKNTPLEMIKELLRSDGEKMFKFPTPQVIADNKTAWRTDEEFAREMLAGVNPVSI  184
             L+ I  N PLEMIKE+ R+DG +  KFPTPQVI +N+ AWRTDEEFAREMLAGVNPV+I
Sbjct  323  FLKDIGDNIPLEMIKEIFRTDGAQFLKFPTPQVIKENRLAWRTDEEFAREMLAGVNPVNI  382

Query  185  SRLQMFPQRSTLDPKVYGDHTCTITREDIADKLDGLTVEQAIESKRLFILDHHDAITLYA  364
            S LQ FP  STLD  VYGD + TIT E I + LDGLTVE+A++S +LFILDHHDA+  Y 
Sbjct  383  SLLQAFPPVSTLDQNVYGDQSSTITEEHIKNNLDGLTVEKALKSNKLFILDHHDALMPYV  442

Query  365  RRINDNTDRKIYATRTLLFLLKDGTLRPIAIELSKPHPDGD  487
            RRIN NT  KIYA+RTLLFL  DGTL+P+ IELS PHPDGD
Sbjct  443  RRINSNTSSKIYASRTLLFLKSDGTLKPLVIELSLPHPDGD  483



>ref|NP_001234098.1| lipoxygenase [Solanum lycopersicum]
 gb|AAG21691.1| lipoxygenase [Solanum lycopersicum]
Length=862

 Score =   229 bits (583),  Expect = 7e-67, Method: Compositional matrix adjust.
 Identities = 106/162 (65%), Positives = 132/162 (81%), Gaps = 0/162 (0%)
 Frame = +2

Query  2    PILEHIQKNTPLEMIKELLRSDGEKMFKFPTPQVIADNKTAWRTDEEFAREMLAGVNPVS  181
            P+ + I    PLE++K+LL +DGE + K+PTPQVI ++K+AWRTDEEF REMLAG+NPV 
Sbjct  320  PLFKAIVDAIPLEILKQLLSTDGEGLLKYPTPQVIQEDKSAWRTDEEFGREMLAGINPVI  379

Query  182  ISRLQMFPQRSTLDPKVYGDHTCTITREDIADKLDGLTVEQAIESKRLFILDHHDAITLY  361
            ISRLQ FP +S LDPK+YG+ T TITRE I DKLDGLTV++A+++ RLFIL+HHD +  Y
Sbjct  380  ISRLQEFPPKSKLDPKIYGNQTSTITREQIEDKLDGLTVDEAVKTNRLFILNHHDILMPY  439

Query  362  ARRINDNTDRKIYATRTLLFLLKDGTLRPIAIELSKPHPDGD  487
             RRIN  T+ K+YATRTLLFL  DGTL+P+AIELS PHPDGD
Sbjct  440  VRRINTTTNTKMYATRTLLFLQDDGTLKPLAIELSLPHPDGD  481



>gb|ABF19102.2| 9-lipoxygenase [Capsicum annuum]
Length=862

 Score =   226 bits (577),  Expect = 5e-66, Method: Compositional matrix adjust.
 Identities = 105/162 (65%), Positives = 133/162 (82%), Gaps = 0/162 (0%)
 Frame = +2

Query  2    PILEHIQKNTPLEMIKELLRSDGEKMFKFPTPQVIADNKTAWRTDEEFAREMLAGVNPVS  181
            P+L+ I    PLE+++ELL++DGE +FK+PTPQVI ++KTAWRTD+EF REMLAG+NPV 
Sbjct  320  PLLKAITDGIPLEILRELLQTDGEGLFKYPTPQVIQEDKTAWRTDDEFGREMLAGLNPVI  379

Query  182  ISRLQMFPQRSTLDPKVYGDHTCTITREDIADKLDGLTVEQAIESKRLFILDHHDAITLY  361
            IS+LQ FP +S LDPK YG+ + TITRE I DKLDGLTV++AI++ RLFIL+HHD +  Y
Sbjct  380  ISKLQEFPPKSKLDPKTYGNQSSTITREQIEDKLDGLTVDEAIKTNRLFILNHHDTLMPY  439

Query  362  ARRINDNTDRKIYATRTLLFLLKDGTLRPIAIELSKPHPDGD  487
             RRIN  T+ K YA+RTLLFL  +GTL+P+AIELS PHPDGD
Sbjct  440  LRRINTTTNTKTYASRTLLFLQDNGTLKPLAIELSLPHPDGD  481



>ref|XP_006344623.1| PREDICTED: probable linoleate 9S-lipoxygenase 5-like [Solanum 
tuberosum]
Length=864

 Score =   226 bits (576),  Expect = 6e-66, Method: Compositional matrix adjust.
 Identities = 105/162 (65%), Positives = 131/162 (81%), Gaps = 0/162 (0%)
 Frame = +2

Query  2    PILEHIQKNTPLEMIKELLRSDGEKMFKFPTPQVIADNKTAWRTDEEFAREMLAGVNPVS  181
            P+L+ +  + PLE++K++  SDGE +FKFPTPQVI ++KTAWRTDEEF REMLAG+NPV 
Sbjct  322  PLLKALIDSIPLEILKDVFHSDGEGLFKFPTPQVIQEDKTAWRTDEEFGREMLAGINPVL  381

Query  182  ISRLQMFPQRSTLDPKVYGDHTCTITREDIADKLDGLTVEQAIESKRLFILDHHDAITLY  361
            ISRLQ FP +S LDPK+YG+   TITRE I DKLDGLTV++AI++  LFIL+HHD +  Y
Sbjct  382  ISRLQEFPPKSNLDPKIYGNQNSTITREQIGDKLDGLTVDEAIKANMLFILNHHDIVMPY  441

Query  362  ARRINDNTDRKIYATRTLLFLLKDGTLRPIAIELSKPHPDGD  487
             RRIN  T+ K YA+RTLLFL  +GTL+P+AIELS PHPDGD
Sbjct  442  LRRINATTNTKTYASRTLLFLQDNGTLKPLAIELSLPHPDGD  483



>ref|XP_006344621.1| PREDICTED: probable linoleate 9S-lipoxygenase 5-like [Solanum 
tuberosum]
Length=862

 Score =   226 bits (576),  Expect = 7e-66, Method: Compositional matrix adjust.
 Identities = 105/152 (69%), Positives = 128/152 (84%), Gaps = 0/152 (0%)
 Frame = +2

Query  32   PLEMIKELLRSDGEKMFKFPTPQVIADNKTAWRTDEEFAREMLAGVNPVSISRLQMFPQR  211
            PLE++K+LL +DGE + K+PTPQVI ++K+AWRTDEEF REMLAGVNPV ISRLQ FP +
Sbjct  330  PLEILKQLLSTDGEGLLKYPTPQVIQEDKSAWRTDEEFGREMLAGVNPVIISRLQEFPPK  389

Query  212  STLDPKVYGDHTCTITREDIADKLDGLTVEQAIESKRLFILDHHDAITLYARRINDNTDR  391
            S LDPK+YG+ T TITRE I DKLDGLTV++AI++ RLFIL+HHD +  Y RRIN  T+ 
Sbjct  390  SKLDPKIYGNQTSTITREQIEDKLDGLTVDEAIKTNRLFILNHHDILMPYVRRINTTTNT  449

Query  392  KIYATRTLLFLLKDGTLRPIAIELSKPHPDGD  487
            K+YA+RTLLFL  DGTL+P+AIELS PHPDGD
Sbjct  450  KMYASRTLLFLQDDGTLKPLAIELSLPHPDGD  481



>emb|CDP15504.1| unnamed protein product [Coffea canephora]
Length=856

 Score =   222 bits (565),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 105/162 (65%), Positives = 130/162 (80%), Gaps = 1/162 (1%)
 Frame = +2

Query  2    PILEHIQKNTPLEMIKELLRSDGEKMFKFPTPQVIADNKTAWRTDEEFAREMLAGVNPVS  181
            P+L+ I  N P E++KE+LR+DGE + KFPTPQ+I ++K+AWRTDEEF REMLAG+NPV 
Sbjct  316  PLLQSITDNIPFELLKEILRTDGEAILKFPTPQIIQEDKSAWRTDEEFGREMLAGLNPVI  375

Query  182  ISRLQMFPQRSTLDPKVYGDHTCTITREDIADKLDGLTVEQAIESKRLFILDHHDAITLY  361
            IS LQ FP +S LDPKVYG    TIT+E I DKLDGLTV+QA+++ +LFIL+HHD +  Y
Sbjct  376  ISLLQEFPPKSKLDPKVYGSQDSTITKEQIEDKLDGLTVDQALKANQLFILNHHDTLMPY  435

Query  362  ARRINDNTDRKIYATRTLLFLLKDGTLRPIAIELSKPHPDGD  487
             RRIN  T  K+YA+RTLLFL KDGTL+P+AIELS PHPD D
Sbjct  436  VRRIN-TTSTKLYASRTLLFLQKDGTLKPLAIELSLPHPDDD  476



>ref|XP_011092040.1| PREDICTED: probable linoleate 9S-lipoxygenase 5 isoform X4 [Sesamum 
indicum]
Length=866

 Score =   221 bits (564),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 108/161 (67%), Positives = 129/161 (80%), Gaps = 1/161 (1%)
 Frame = +2

Query  5    ILEHIQKNTPLEMIKELLRSDGEKMFKFPTPQVIADNKTAWRTDEEFAREMLAGVNPVSI  184
            ++E I++  PLEMIKELLRSDGEK FKFP PQVI ++KTAWR+DEEFAREMLAG+NPV I
Sbjct  327  LMEKIRERIPLEMIKELLRSDGEKGFKFPLPQVIKEDKTAWRSDEEFAREMLAGINPVVI  386

Query  185  SRLQMFPQRSTLDPKVYGDHTCTITREDIADKLDGLTVEQAIESKRLFILDHHDAITLYA  364
             RLQ FP  S LDP+VYG  + TI+ E I + LDGLT+ +AI++ +LFILDHHD +  Y 
Sbjct  387  RRLQEFPPESKLDPEVYGKQSSTISEEHIINSLDGLTILEAIQNNKLFILDHHDNLMPYL  446

Query  365  RRINDNTDRKIYATRTLLFLLKDGTLRPIAIELSKPHPDGD  487
            RRIN  T  K YATRT+LFL KDGTL+P+AIELS PHPDGD
Sbjct  447  RRIN-TTATKTYATRTILFLQKDGTLKPLAIELSLPHPDGD  486



>ref|XP_011092039.1| PREDICTED: probable linoleate 9S-lipoxygenase 5 isoform X3 [Sesamum 
indicum]
Length=867

 Score =   221 bits (564),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 108/161 (67%), Positives = 129/161 (80%), Gaps = 1/161 (1%)
 Frame = +2

Query  5    ILEHIQKNTPLEMIKELLRSDGEKMFKFPTPQVIADNKTAWRTDEEFAREMLAGVNPVSI  184
            ++E I++  PLEMIKELLRSDGEK FKFP PQVI ++KTAWR+DEEFAREMLAG+NPV I
Sbjct  328  LMEKIRERIPLEMIKELLRSDGEKGFKFPLPQVIKEDKTAWRSDEEFAREMLAGINPVVI  387

Query  185  SRLQMFPQRSTLDPKVYGDHTCTITREDIADKLDGLTVEQAIESKRLFILDHHDAITLYA  364
             RLQ FP  S LDP+VYG  + TI+ E I + LDGLT+ +AI++ +LFILDHHD +  Y 
Sbjct  388  RRLQEFPPESKLDPEVYGKQSSTISEEHIINSLDGLTILEAIQNNKLFILDHHDNLMPYL  447

Query  365  RRINDNTDRKIYATRTLLFLLKDGTLRPIAIELSKPHPDGD  487
            RRIN  T  K YATRT+LFL KDGTL+P+AIELS PHPDGD
Sbjct  448  RRIN-TTATKTYATRTILFLQKDGTLKPLAIELSLPHPDGD  487



>gb|ACG56281.1| lipoxygenase [Olea europaea]
Length=864

 Score =   221 bits (564),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 107/161 (66%), Positives = 130/161 (81%), Gaps = 1/161 (1%)
 Frame = +2

Query  2    PILEHIQKNTPLEMIKELLRSDGEKMFKFPTPQVIADNKTAWRTDEEFAREMLAGVNPVS  181
            P+L++I +N P EM+K LLRSDGE +FKFP PQVI D+K+AWRTDEEFAREMLAGVNPV 
Sbjct  324  PLLKNIFENIPFEMLKVLLRSDGEGLFKFPLPQVIKDDKSAWRTDEEFAREMLAGVNPVI  383

Query  182  ISRLQMFPQRSTLDPKVYGDHTCTITREDIADKLDGLTVEQAIESKRLFILDHHDAITLY  361
            ISRLQ FP  S LDP +YGD T TI+   I +KLDGLT+++AI + +LFIL+HHDA+  Y
Sbjct  384  ISRLQEFPPTSKLDPNLYGDQTSTISGGHIENKLDGLTIDEAIRTNKLFILNHHDALMPY  443

Query  362  ARRINDNTDRKIYATRTLLFLLKDGTLRPIAIELSKPHPDG  484
             +RIN  T  K YA+RTLLFL KDG+L+P+AIELS PHPDG
Sbjct  444  LKRINSTT-TKTYASRTLLFLQKDGSLKPLAIELSLPHPDG  483



>ref|XP_009376659.1| PREDICTED: probable linoleate 9S-lipoxygenase 5 [Pyrus x bretschneideri]
 ref|XP_009376682.1| PREDICTED: probable linoleate 9S-lipoxygenase 5 [Pyrus x bretschneideri]
Length=862

 Score =   221 bits (563),  Expect = 4e-64, Method: Compositional matrix adjust.
 Identities = 104/161 (65%), Positives = 129/161 (80%), Gaps = 1/161 (1%)
 Frame = +2

Query  5    ILEHIQKNTPLEMIKELLRSDGEKMFKFPTPQVIADNKTAWRTDEEFAREMLAGVNPVSI  184
            +L+ I  N P EM+KE+ R+DG ++ KFPTPQVI ++K+AWRTDEEFAREMLAGVNPV+I
Sbjct  323  LLKDIGDNIPAEMLKEIFRTDGAQLLKFPTPQVIKEDKSAWRTDEEFAREMLAGVNPVNI  382

Query  185  SRLQMFPQRSTLDPKVYGDHTCTITREDIADKLDGLTVEQAIESKRLFILDHHDAITLYA  364
            +RLQ+FP  S LDPKVYGD   TIT E I + LDGLTV++A++  +LFILDHHD++  Y 
Sbjct  383  ARLQVFPPASKLDPKVYGDQNSTITEEHIKNNLDGLTVDEALKKNKLFILDHHDSLMPYL  442

Query  365  RRINDNTDRKIYATRTLLFLLKDGTLRPIAIELSKPHPDGD  487
            RRIN +T  KIY +RTLLFL  DGTL+P+ IELS PHPDGD
Sbjct  443  RRIN-STSNKIYGSRTLLFLQNDGTLKPLVIELSLPHPDGD  482



>ref|XP_011092038.1| PREDICTED: probable linoleate 9S-lipoxygenase 5 isoform X2 [Sesamum 
indicum]
Length=906

 Score =   221 bits (563),  Expect = 5e-64, Method: Compositional matrix adjust.
 Identities = 108/161 (67%), Positives = 129/161 (80%), Gaps = 1/161 (1%)
 Frame = +2

Query  5    ILEHIQKNTPLEMIKELLRSDGEKMFKFPTPQVIADNKTAWRTDEEFAREMLAGVNPVSI  184
            ++E I++  PLEMIKELLRSDGEK FKFP PQVI ++KTAWR+DEEFAREMLAG+NPV I
Sbjct  367  LMEKIRERIPLEMIKELLRSDGEKGFKFPLPQVIKEDKTAWRSDEEFAREMLAGINPVVI  426

Query  185  SRLQMFPQRSTLDPKVYGDHTCTITREDIADKLDGLTVEQAIESKRLFILDHHDAITLYA  364
             RLQ FP  S LDP+VYG  + TI+ E I + LDGLT+ +AI++ +LFILDHHD +  Y 
Sbjct  427  RRLQEFPPESKLDPEVYGKQSSTISEEHIINSLDGLTILEAIQNNKLFILDHHDNLMPYL  486

Query  365  RRINDNTDRKIYATRTLLFLLKDGTLRPIAIELSKPHPDGD  487
            RRIN  T  K YATRT+LFL KDGTL+P+AIELS PHPDGD
Sbjct  487  RRIN-TTATKTYATRTILFLQKDGTLKPLAIELSLPHPDGD  526



>emb|CDP20618.1| unnamed protein product [Coffea canephora]
Length=857

 Score =   221 bits (562),  Expect = 5e-64, Method: Compositional matrix adjust.
 Identities = 107/162 (66%), Positives = 130/162 (80%), Gaps = 1/162 (1%)
 Frame = +2

Query  2    PILEHIQKNTPLEMIKELLRSDGEKMFKFPTPQVIADNKTAWRTDEEFAREMLAGVNPVS  181
            P+L++I  N PLE++K+LL+SDGE+  K+PTPQVI D+K+AWRTDEEF REMLAGVNPV 
Sbjct  317  PLLKNIVDNIPLELLKQLLQSDGEEFLKYPTPQVIKDDKSAWRTDEEFTREMLAGVNPVI  376

Query  182  ISRLQMFPQRSTLDPKVYGDHTCTITREDIADKLDGLTVEQAIESKRLFILDHHDAITLY  361
            ISRLQ FP RS L+  VYG+   TITR+ I  +LDGLT+++A++   LFILDHHDAI  Y
Sbjct  377  ISRLQEFPPRSKLNSAVYGNQNSTITRQQIEQRLDGLTIDEALKMNSLFILDHHDAIMPY  436

Query  362  ARRINDNTDRKIYATRTLLFLLKDGTLRPIAIELSKPHPDGD  487
             RRIN  T  K YATRTLLFL KDGTL+P+AIELS PHP+GD
Sbjct  437  LRRIN-TTSTKTYATRTLLFLQKDGTLKPLAIELSLPHPNGD  477



>ref|XP_011092037.1| PREDICTED: probable linoleate 9S-lipoxygenase 5 isoform X1 [Sesamum 
indicum]
Length=907

 Score =   221 bits (563),  Expect = 5e-64, Method: Compositional matrix adjust.
 Identities = 108/161 (67%), Positives = 129/161 (80%), Gaps = 1/161 (1%)
 Frame = +2

Query  5    ILEHIQKNTPLEMIKELLRSDGEKMFKFPTPQVIADNKTAWRTDEEFAREMLAGVNPVSI  184
            ++E I++  PLEMIKELLRSDGEK FKFP PQVI ++KTAWR+DEEFAREMLAG+NPV I
Sbjct  368  LMEKIRERIPLEMIKELLRSDGEKGFKFPLPQVIKEDKTAWRSDEEFAREMLAGINPVVI  427

Query  185  SRLQMFPQRSTLDPKVYGDHTCTITREDIADKLDGLTVEQAIESKRLFILDHHDAITLYA  364
             RLQ FP  S LDP+VYG  + TI+ E I + LDGLT+ +AI++ +LFILDHHD +  Y 
Sbjct  428  RRLQEFPPESKLDPEVYGKQSSTISEEHIINSLDGLTILEAIQNNKLFILDHHDNLMPYL  487

Query  365  RRINDNTDRKIYATRTLLFLLKDGTLRPIAIELSKPHPDGD  487
            RRIN  T  K YATRT+LFL KDGTL+P+AIELS PHPDGD
Sbjct  488  RRIN-TTATKTYATRTILFLQKDGTLKPLAIELSLPHPDGD  527



>gb|AHX56187.1| lipoxygenase [Diospyros kaki]
Length=872

 Score =   221 bits (562),  Expect = 7e-64, Method: Compositional matrix adjust.
 Identities = 106/162 (65%), Positives = 131/162 (81%), Gaps = 1/162 (1%)
 Frame = +2

Query  2    PILEHIQKNTPLEMIKELLRSDGEKMFKFPTPQVIADNKTAWRTDEEFAREMLAGVNPVS  181
            P+L+ I+KN P E++K+LLR+DGE  F FP PQVI ++K+AWRTDEEFAREMLAG+NP+ 
Sbjct  332  PLLDSIRKNIPSELLKQLLRTDGEGYFSFPMPQVIKEDKSAWRTDEEFAREMLAGLNPLV  391

Query  182  ISRLQMFPQRSTLDPKVYGDHTCTITREDIADKLDGLTVEQAIESKRLFILDHHDAITLY  361
            I  L+ FP  S+LDP+ YG+ + +ITR+ I + LDGLTVE+AIES RLFILDHHDA   Y
Sbjct  392  IRCLKEFPPASSLDPEAYGNQSSSITRDHIKNNLDGLTVEEAIESSRLFILDHHDAFMPY  451

Query  362  ARRINDNTDRKIYATRTLLFLLKDGTLRPIAIELSKPHPDGD  487
             RRIN +T  K YATRTLLFL KDGTL+P+AIELS PHP+GD
Sbjct  452  LRRIN-STSTKTYATRTLLFLQKDGTLKPLAIELSLPHPEGD  492



>ref|NP_001281030.1| probable linoleate 9S-lipoxygenase 5 [Malus domestica]
 gb|AGK82778.1| lipoxygenase [Malus domestica]
Length=862

 Score =   220 bits (560),  Expect = 9e-64, Method: Compositional matrix adjust.
 Identities = 104/161 (65%), Positives = 128/161 (80%), Gaps = 1/161 (1%)
 Frame = +2

Query  5    ILEHIQKNTPLEMIKELLRSDGEKMFKFPTPQVIADNKTAWRTDEEFAREMLAGVNPVSI  184
            +L+ I  N P EM+KE+ R+DG ++ KFPTPQVI ++K+AWRTDEEFAREMLAGVNPV+I
Sbjct  323  LLKDIGDNIPAEMLKEIFRTDGAQLLKFPTPQVIKEDKSAWRTDEEFAREMLAGVNPVNI  382

Query  185  SRLQMFPQRSTLDPKVYGDHTCTITREDIADKLDGLTVEQAIESKRLFILDHHDAITLYA  364
            +RLQ FP  S LDPKVYGD   TIT E I + LDGLTV++A++  +LFILDHHD++  Y 
Sbjct  383  ARLQEFPPASKLDPKVYGDQNSTITEEHIKNNLDGLTVDEALKENKLFILDHHDSLMPYL  442

Query  365  RRINDNTDRKIYATRTLLFLLKDGTLRPIAIELSKPHPDGD  487
            RRIN +T  KIY +RTLLFL  DGTL+P+ IELS PHPDGD
Sbjct  443  RRIN-STSNKIYGSRTLLFLQNDGTLKPLVIELSLPHPDGD  482



>ref|XP_002512386.1| lipoxygenase, putative [Ricinus communis]
 gb|EEF49838.1| lipoxygenase, putative [Ricinus communis]
Length=871

 Score =   220 bits (560),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 103/162 (64%), Positives = 129/162 (80%), Gaps = 1/162 (1%)
 Frame = +2

Query  2    PILEHIQKNTPLEMIKELLRSDGEKMFKFPTPQVIADNKTAWRTDEEFAREMLAGVNPVS  181
            P+L++I KN PLEM+KE+ R+DGE++FKFP PQVI +NKTAWRTDEEF REMLAGVNPV 
Sbjct  330  PLLDNIIKNIPLEMLKEIFRTDGERLFKFPMPQVIKENKTAWRTDEEFGREMLAGVNPVL  389

Query  182  ISRLQMFPQRSTLDPKVYGDHTCTITREDIADKLDGLTVEQAIESKRLFILDHHDAITLY  361
            I RLQ FP +S LD K YGD   ++T E I   LDGLT+++A+E+ +L+ILDHHD +  Y
Sbjct  390  ICRLQEFPPKSNLDSKRYGDQNSSVTEEHIKHNLDGLTIQEALENNKLYILDHHDTVMPY  449

Query  362  ARRINDNTDRKIYATRTLLFLLKDGTLRPIAIELSKPHPDGD  487
             R+IN  T  K YA+RTLLFL +DGTL+P+AIELS PHP+GD
Sbjct  450  LRQIN-ATSTKTYASRTLLFLKEDGTLKPVAIELSLPHPEGD  490



>emb|CAB94852.1| lipoxygenase [Prunus dulcis]
Length=862

 Score =   218 bits (556),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 104/161 (65%), Positives = 128/161 (80%), Gaps = 1/161 (1%)
 Frame = +2

Query  5    ILEHIQKNTPLEMIKELLRSDGEKMFKFPTPQVIADNKTAWRTDEEFAREMLAGVNPVSI  184
            +L+ I  N P EM+KE+ R+DG ++ +FP PQVI ++K+AWRTDEEFAREMLAGVNPV+I
Sbjct  323  LLKDIGDNIPAEMLKEIFRTDGAQLLRFPMPQVIEEDKSAWRTDEEFAREMLAGVNPVNI  382

Query  185  SRLQMFPQRSTLDPKVYGDHTCTITREDIADKLDGLTVEQAIESKRLFILDHHDAITLYA  364
            S LQ FP  S LDPKVYGD T  IT +DI +KLDGLTV +A++  +LFILDHHDA+  Y 
Sbjct  383  SLLQEFPPASKLDPKVYGDQTSRITEQDIGNKLDGLTVHEALKQNKLFILDHHDALMPYL  442

Query  365  RRINDNTDRKIYATRTLLFLLKDGTLRPIAIELSKPHPDGD  487
            RRIN +T  KIYA+RT+LFL  DGTL+P+ IELS PHPDGD
Sbjct  443  RRIN-STSNKIYASRTVLFLKSDGTLKPLVIELSLPHPDGD  482



>ref|XP_007208096.1| hypothetical protein PRUPE_ppa001287mg [Prunus persica]
 gb|EMJ09295.1| hypothetical protein PRUPE_ppa001287mg [Prunus persica]
Length=862

 Score =   218 bits (556),  Expect = 4e-63, Method: Compositional matrix adjust.
 Identities = 104/161 (65%), Positives = 128/161 (80%), Gaps = 1/161 (1%)
 Frame = +2

Query  5    ILEHIQKNTPLEMIKELLRSDGEKMFKFPTPQVIADNKTAWRTDEEFAREMLAGVNPVSI  184
            +L+ I  N P EM+KE+ R+DG ++ +FP PQVI ++K+AWRTDEEFAREMLAGVNPV+I
Sbjct  323  LLKDIGDNIPAEMLKEIFRTDGAQLLRFPMPQVIEEDKSAWRTDEEFAREMLAGVNPVNI  382

Query  185  SRLQMFPQRSTLDPKVYGDHTCTITREDIADKLDGLTVEQAIESKRLFILDHHDAITLYA  364
            S LQ FP  S LDPKVYGD T  IT +DI +KLDGLTV +A++  +LFILDHHDA+  Y 
Sbjct  383  SLLQEFPPASKLDPKVYGDQTSRITEQDIGNKLDGLTVHEALKQNKLFILDHHDALMPYL  442

Query  365  RRINDNTDRKIYATRTLLFLLKDGTLRPIAIELSKPHPDGD  487
            RRIN +T  KIYA+RT+LFL  DGTL+P+ IELS PHPDGD
Sbjct  443  RRIN-STSNKIYASRTVLFLKSDGTLKPLVIELSLPHPDGD  482



>gb|AFU51542.1| lipoxygenase 3 [Capsicum annuum]
Length=859

 Score =   218 bits (556),  Expect = 4e-63, Method: Compositional matrix adjust.
 Identities = 106/162 (65%), Positives = 128/162 (79%), Gaps = 1/162 (1%)
 Frame = +2

Query  2    PILEHIQKNTPLEMIKELLRSDGEKMFKFPTPQVIADNKTAWRTDEEFAREMLAGVNPVS  181
            P+ + +    PLEMI+ELLR+DGE + +FPTP VI D+K+AWRTDEEFAREMLAGVNPV 
Sbjct  319  PLFKALTDAIPLEMIRELLRTDGEGILRFPTPLVIKDSKSAWRTDEEFAREMLAGVNPVI  378

Query  182  ISRLQMFPQRSTLDPKVYGDHTCTITREDIADKLDGLTVEQAIESKRLFILDHHDAITLY  361
            ISRLQ FP +S LDP VYG+   TIT E I DKLDGLT++QAI + +LFIL+HHD +T Y
Sbjct  379  ISRLQEFPPKSKLDPNVYGNQDSTITAEHIQDKLDGLTIDQAINNNKLFILNHHDILTPY  438

Query  362  ARRINDNTDRKIYATRTLLFLLKDGTLRPIAIELSKPHPDGD  487
             RRIN  T  K YA+RTLLFL  +G+L+P+AIELS PHPDGD
Sbjct  439  LRRIN-TTTTKTYASRTLLFLQDNGSLKPLAIELSLPHPDGD  479



>ref|XP_004244890.1| PREDICTED: probable linoleate 9S-lipoxygenase 5 [Solanum lycopersicum]
Length=861

 Score =   218 bits (554),  Expect = 6e-63, Method: Compositional matrix adjust.
 Identities = 101/162 (62%), Positives = 132/162 (81%), Gaps = 1/162 (1%)
 Frame = +2

Query  2    PILEHIQKNTPLEMIKELLRSDGEKMFKFPTPQVIADNKTAWRTDEEFAREMLAGVNPVS  181
            P L+ +  + PLE++KE++R+DGE  FKFPTPQV+ ++K++WRTDEEFAREMLAGVNPV 
Sbjct  321  PFLKALTDSIPLEILKEIIRTDGEGKFKFPTPQVLQEDKSSWRTDEEFAREMLAGVNPVI  380

Query  182  ISRLQMFPQRSTLDPKVYGDHTCTITREDIADKLDGLTVEQAIESKRLFILDHHDAITLY  361
            ISRLQ FP +S LDP+VYG+   TIT+E I + LDGLT++ AI++ RL+IL+HHD +  Y
Sbjct  381  ISRLQEFPPKSELDPEVYGNQNSTITKEHIENTLDGLTIDDAIKTNRLYILNHHDILMPY  440

Query  362  ARRINDNTDRKIYATRTLLFLLKDGTLRPIAIELSKPHPDGD  487
             RRIN  T+ K+YA+RTLLFL  DGT++P+AIELS PHPDGD
Sbjct  441  VRRIN-TTNTKLYASRTLLFLQDDGTMKPVAIELSLPHPDGD  481



>emb|CBI36801.3| unnamed protein product [Vitis vinifera]
Length=738

 Score =   217 bits (552),  Expect = 7e-63, Method: Compositional matrix adjust.
 Identities = 104/162 (64%), Positives = 128/162 (79%), Gaps = 1/162 (1%)
 Frame = +2

Query  2    PILEHIQKNTPLEMIKELLRSDGEKMFKFPTPQVIADNKTAWRTDEEFAREMLAGVNPVS  181
            P+L+ I+ N PLEM+KEL+R+DGE +FKFP PQVI ++K+AWRTDEEFAREMLAG+NPV 
Sbjct  319  PLLDKIKDNIPLEMLKELVRTDGEHLFKFPMPQVIKEDKSAWRTDEEFAREMLAGLNPVV  378

Query  182  ISRLQMFPQRSTLDPKVYGDHTCTITREDIADKLDGLTVEQAIESKRLFILDHHDAITLY  361
            I  LQ FP +S LDP+VYG+   +IT+E I + LD LT+ +A+E KRLFILDHHD    Y
Sbjct  379  IRLLQEFPPKSKLDPEVYGNQNSSITKEHIENHLDDLTINEAMEKKRLFILDHHDVFMPY  438

Query  362  ARRINDNTDRKIYATRTLLFLLKDGTLRPIAIELSKPHPDGD  487
             RRIN  T  K YA+RTLLFL  DGTL+P+AIELS PHP+GD
Sbjct  439  LRRIN-TTSTKTYASRTLLFLKDDGTLKPLAIELSLPHPNGD  479



>gb|EYU42168.1| hypothetical protein MIMGU_mgv1a001215mg [Erythranthe guttata]
Length=864

 Score =   217 bits (553),  Expect = 9e-63, Method: Compositional matrix adjust.
 Identities = 105/161 (65%), Positives = 125/161 (78%), Gaps = 1/161 (1%)
 Frame = +2

Query  5    ILEHIQKNTPLEMIKELLRSDGEKMFKFPTPQVIADNKTAWRTDEEFAREMLAGVNPVSI  184
            +LE I ++ P EMIKELLRSDGEK FKFP PQVI ++KTAWR+DEEF REMLAG+NPV I
Sbjct  325  LLEKISEHIPFEMIKELLRSDGEKSFKFPLPQVIKEDKTAWRSDEEFGREMLAGLNPVVI  384

Query  185  SRLQMFPQRSTLDPKVYGDHTCTITREDIADKLDGLTVEQAIESKRLFILDHHDAITLYA  364
             RLQ FP  STLDP++YG  + TI+ E I + LDG T+ +AIE  +LFILDHHD +  Y 
Sbjct  385  RRLQEFPPASTLDPELYGKQSSTISEEHIVNSLDGFTITEAIEKNKLFILDHHDNLMPYL  444

Query  365  RRINDNTDRKIYATRTLLFLLKDGTLRPIAIELSKPHPDGD  487
            RRIN  T  K YATRT+LFL  DGTL+P+AIELS PHP+GD
Sbjct  445  RRIN-TTAAKTYATRTVLFLKSDGTLKPLAIELSLPHPNGD  484



>emb|CAD10779.2| lipoxygenase [Prunus dulcis]
 gb|AGT02046.1| lipoxygenase [synthetic construct]
Length=862

 Score =   217 bits (552),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 103/161 (64%), Positives = 128/161 (80%), Gaps = 1/161 (1%)
 Frame = +2

Query  5    ILEHIQKNTPLEMIKELLRSDGEKMFKFPTPQVIADNKTAWRTDEEFAREMLAGVNPVSI  184
            +L+ I  N P EM+KE+ R+DG ++ +FP PQVI ++K+AWRTDEEFAREMLAGVNPV+I
Sbjct  323  LLKDIGDNIPAEMLKEIFRTDGAQLLRFPMPQVIEEDKSAWRTDEEFAREMLAGVNPVNI  382

Query  185  SRLQMFPQRSTLDPKVYGDHTCTITREDIADKLDGLTVEQAIESKRLFILDHHDAITLYA  364
            S LQ FP  S L+PKVYGD T  IT +DI +KLDGLTV +A++  +LFILDHHDA+  Y 
Sbjct  383  SLLQEFPPASKLNPKVYGDQTSRITEQDIGNKLDGLTVHEALKQNKLFILDHHDALMPYL  442

Query  365  RRINDNTDRKIYATRTLLFLLKDGTLRPIAIELSKPHPDGD  487
            RRIN +T  KIYA+RT+LFL  DGTL+P+ IELS PHPDGD
Sbjct  443  RRIN-STSNKIYASRTVLFLKSDGTLKPLVIELSLPHPDGD  482



>gb|KCW61796.1| hypothetical protein EUGRSUZ_H04495 [Eucalyptus grandis]
Length=614

 Score =   214 bits (545),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 104/162 (64%), Positives = 128/162 (79%), Gaps = 1/162 (1%)
 Frame = +2

Query  2    PILEHIQKNTPLEMIKELLRSDGEKMFKFPTPQVIADNKTAWRTDEEFAREMLAGVNPVS  181
            P+LE ++++ PLEMIKEL+R+DGE + ++P PQVI +N+TAWRTD EF REMLAGVNPV 
Sbjct  324  PLLESLEESIPLEMIKELVRTDGEGLLEYPIPQVIKENETAWRTDVEFGREMLAGVNPVL  383

Query  182  ISRLQMFPQRSTLDPKVYGDHTCTITREDIADKLDGLTVEQAIESKRLFILDHHDAITLY  361
            I RL+ FP  S LDPK+YG+   TI  E I  +L+GLTV+QAI+  +LFILDHHDAI  Y
Sbjct  384  IRRLEEFPPASKLDPKIYGNQNSTIREELIQKQLNGLTVKQAIKMNKLFILDHHDAIMPY  443

Query  362  ARRINDNTDRKIYATRTLLFLLKDGTLRPIAIELSKPHPDGD  487
             RRIN  T+ K YATRTLLFL  DGTL+P+AIELS PHP+GD
Sbjct  444  LRRIN-TTNTKTYATRTLLFLKDDGTLKPLAIELSLPHPEGD  484



>ref|XP_010905215.1| PREDICTED: probable linoleate 9S-lipoxygenase 4 [Elaeis guineensis]
Length=866

 Score =   217 bits (552),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 107/162 (66%), Positives = 126/162 (78%), Gaps = 1/162 (1%)
 Frame = +2

Query  2    PILEHIQKNTPLEMIKELLRSDGEKMFKFPTPQVIADNKTAWRTDEEFAREMLAGVNPVS  181
            P LE I+   PLEMIKEL+RSDGE++ K P PQVI ++K AWRTDEEF REMLAGVNPV 
Sbjct  321  PALEEIKDRIPLEMIKELVRSDGEQVLKLPLPQVIKEDKDAWRTDEEFGREMLAGVNPVI  380

Query  182  ISRLQMFPQRSTLDPKVYGDHTCTITREDIADKLDGLTVEQAIESKRLFILDHHDAITLY  361
            I RL+ FP  S LDPK YGDHT +IT   I   L+GLTV+QA++S RLFILDHHDA+  Y
Sbjct  381  IRRLEEFPPTSKLDPKTYGDHTSSITAAHIEKNLEGLTVDQALKSNRLFILDHHDALFPY  440

Query  362  ARRINDNTDRKIYATRTLLFLLKDGTLRPIAIELSKPHPDGD  487
              RIN +T  KIYA+RT+L L  DGTL+P+AIELSKPHPDG+
Sbjct  441  LNRIN-STSHKIYASRTILLLKDDGTLKPLAIELSKPHPDGE  481



>ref|XP_010659819.1| PREDICTED: lipoxygenase isoform X1 [Vitis vinifera]
Length=859

 Score =   217 bits (552),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 104/162 (64%), Positives = 128/162 (79%), Gaps = 1/162 (1%)
 Frame = +2

Query  2    PILEHIQKNTPLEMIKELLRSDGEKMFKFPTPQVIADNKTAWRTDEEFAREMLAGVNPVS  181
            P+L+ I+ N PLEM+KEL+R+DGE +FKFP PQVI ++K+AWRTDEEFAREMLAG+NPV 
Sbjct  319  PLLDKIKDNIPLEMLKELVRTDGEHLFKFPMPQVIKEDKSAWRTDEEFAREMLAGLNPVV  378

Query  182  ISRLQMFPQRSTLDPKVYGDHTCTITREDIADKLDGLTVEQAIESKRLFILDHHDAITLY  361
            I  LQ FP +S LDP+VYG+   +IT+E I + LD LT+ +A+E KRLFILDHHD    Y
Sbjct  379  IRLLQEFPPKSKLDPEVYGNQNSSITKEHIENHLDDLTINEAMEKKRLFILDHHDVFMPY  438

Query  362  ARRINDNTDRKIYATRTLLFLLKDGTLRPIAIELSKPHPDGD  487
             RRIN  T  K YA+RTLLFL  DGTL+P+AIELS PHP+GD
Sbjct  439  LRRIN-TTSTKTYASRTLLFLKDDGTLKPLAIELSLPHPNGD  479



>ref|NP_001268178.1| lipoxygenase [Vitis vinifera]
 gb|ACZ17392.1| lipoxygenase [Vitis vinifera]
Length=859

 Score =   216 bits (551),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 104/162 (64%), Positives = 128/162 (79%), Gaps = 1/162 (1%)
 Frame = +2

Query  2    PILEHIQKNTPLEMIKELLRSDGEKMFKFPTPQVIADNKTAWRTDEEFAREMLAGVNPVS  181
            P+L+ I+ N PLEM+KEL+R+DGE +FKFP PQVI ++K+AWRTDEEFAREMLAG+NPV 
Sbjct  319  PLLDKIKDNIPLEMLKELVRTDGEHLFKFPMPQVIKEDKSAWRTDEEFAREMLAGLNPVV  378

Query  182  ISRLQMFPQRSTLDPKVYGDHTCTITREDIADKLDGLTVEQAIESKRLFILDHHDAITLY  361
            I  LQ FP +S LDP+VYG+   +IT+E I + LD LT+ +A+E KRLFILDHHD    Y
Sbjct  379  IRLLQEFPPKSKLDPEVYGNQNSSITKEHIENHLDDLTINEAMEKKRLFILDHHDVFMPY  438

Query  362  ARRINDNTDRKIYATRTLLFLLKDGTLRPIAIELSKPHPDGD  487
             RRIN  T  K YA+RTLLFL  DGTL+P+AIELS PHP+GD
Sbjct  439  LRRIN-TTSTKTYASRTLLFLKDDGTLKPLAIELSLPHPNGD  479



>ref|XP_008246455.1| PREDICTED: probable linoleate 9S-lipoxygenase 5 [Prunus mume]
Length=849

 Score =   216 bits (551),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 103/161 (64%), Positives = 127/161 (79%), Gaps = 1/161 (1%)
 Frame = +2

Query  5    ILEHIQKNTPLEMIKELLRSDGEKMFKFPTPQVIADNKTAWRTDEEFAREMLAGVNPVSI  184
            +L+ I  N P EM+KE+ R+DG ++ +FP PQVI ++K+AWRTDEEFAREMLAGVNPV+I
Sbjct  323  LLKDIGDNIPAEMLKEIFRTDGAQLLRFPMPQVIEEDKSAWRTDEEFAREMLAGVNPVNI  382

Query  185  SRLQMFPQRSTLDPKVYGDHTCTITREDIADKLDGLTVEQAIESKRLFILDHHDAITLYA  364
            S LQ FP  S LDPKVYGD T  IT +DI + LDGLTV +A++  +LFILDHHDA+  Y 
Sbjct  383  SLLQEFPPASKLDPKVYGDQTSRITEQDIGNNLDGLTVHEALKQNKLFILDHHDALMPYL  442

Query  365  RRINDNTDRKIYATRTLLFLLKDGTLRPIAIELSKPHPDGD  487
            RRIN +T  KIYA+RT+LFL  DGTL+P+ IELS PHPDGD
Sbjct  443  RRIN-STSNKIYASRTVLFLKSDGTLKPLVIELSLPHPDGD  482



>ref|XP_008246456.1| PREDICTED: probable linoleate 9S-lipoxygenase 5 [Prunus mume]
Length=915

 Score =   217 bits (552),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 103/161 (64%), Positives = 127/161 (79%), Gaps = 1/161 (1%)
 Frame = +2

Query  5    ILEHIQKNTPLEMIKELLRSDGEKMFKFPTPQVIADNKTAWRTDEEFAREMLAGVNPVSI  184
            +L+ I  N P EM+KE+ R+DG ++ +FP PQVI ++K+AWRTDEEFAREMLAGVNPV+I
Sbjct  376  LLKDIGDNIPAEMLKEIFRTDGAQLLRFPMPQVIEEDKSAWRTDEEFAREMLAGVNPVNI  435

Query  185  SRLQMFPQRSTLDPKVYGDHTCTITREDIADKLDGLTVEQAIESKRLFILDHHDAITLYA  364
            S LQ FP  S LDPKVYGD T  IT +DI + LDGLTV +A++  +LFILDHHDA+  Y 
Sbjct  436  SLLQEFPPASKLDPKVYGDQTSGITEQDIGNNLDGLTVHEALKQNKLFILDHHDALMPYL  495

Query  365  RRINDNTDRKIYATRTLLFLLKDGTLRPIAIELSKPHPDGD  487
            RRIN +T  KIYA+RT+LFL  DGTL+P+ IELS PHPDGD
Sbjct  496  RRIN-STSNKIYASRTVLFLKSDGTLKPLVIELSLPHPDGD  535



>ref|XP_007208098.1| hypothetical protein PRUPE_ppa001293mg [Prunus persica]
 gb|EMJ09297.1| hypothetical protein PRUPE_ppa001293mg [Prunus persica]
Length=862

 Score =   216 bits (551),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 103/161 (64%), Positives = 127/161 (79%), Gaps = 1/161 (1%)
 Frame = +2

Query  5    ILEHIQKNTPLEMIKELLRSDGEKMFKFPTPQVIADNKTAWRTDEEFAREMLAGVNPVSI  184
            +L+ I  N P EM+KE+ R+DG ++ +FP PQVI ++K+AWRTDEEFAREMLAGVNPV+I
Sbjct  323  LLKDIGDNIPAEMLKEIFRTDGAQLLRFPMPQVIEEDKSAWRTDEEFAREMLAGVNPVNI  382

Query  185  SRLQMFPQRSTLDPKVYGDHTCTITREDIADKLDGLTVEQAIESKRLFILDHHDAITLYA  364
            S LQ FP  S LDPKVYGD T  IT +DI + LDGLTV +A++  +LFILDHHDA+  Y 
Sbjct  383  SLLQEFPPASKLDPKVYGDQTSRITEQDIGNNLDGLTVHEALKQNKLFILDHHDALMPYL  442

Query  365  RRINDNTDRKIYATRTLLFLLKDGTLRPIAIELSKPHPDGD  487
            RRIN +T  KIYA+RT+LFL  DGTL+P+ IELS PHPDGD
Sbjct  443  RRIN-STSNKIYASRTVLFLKSDGTLKPLVIELSLPHPDGD  482



>ref|XP_007204937.1| hypothetical protein PRUPE_ppa001311mg [Prunus persica]
 gb|EMJ06136.1| hypothetical protein PRUPE_ppa001311mg [Prunus persica]
Length=856

 Score =   216 bits (550),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 102/161 (63%), Positives = 127/161 (79%), Gaps = 1/161 (1%)
 Frame = +2

Query  5    ILEHIQKNTPLEMIKELLRSDGEKMFKFPTPQVIADNKTAWRTDEEFAREMLAGVNPVSI  184
            +L+ I  N P EM+KE+ R+D  ++ +FP PQVI ++K+AWRTDEEFAREMLAGVNPV+I
Sbjct  318  LLKDIGDNIPAEMLKEIFRTDSAQLLRFPMPQVIKEDKSAWRTDEEFAREMLAGVNPVNI  377

Query  185  SRLQMFPQRSTLDPKVYGDHTCTITREDIADKLDGLTVEQAIESKRLFILDHHDAITLYA  364
             RLQ FP  S LDPKVYGD T TIT +DI + +DGLTV++A +  +LFILDHHDA+  Y 
Sbjct  378  RRLQEFPPASKLDPKVYGDQTSTITEQDIGNTMDGLTVDEAFKQNKLFILDHHDALMPYL  437

Query  365  RRINDNTDRKIYATRTLLFLLKDGTLRPIAIELSKPHPDGD  487
            RRIN +T  KIYA+RT+LFL  DGTL+P+ IELS PHPDGD
Sbjct  438  RRIN-STSNKIYASRTILFLKSDGTLKPLVIELSLPHPDGD  477



>gb|AGU28274.1| lipoxygenase 1 [Vitis vinifera]
Length=859

 Score =   216 bits (550),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 104/162 (64%), Positives = 127/162 (78%), Gaps = 1/162 (1%)
 Frame = +2

Query  2    PILEHIQKNTPLEMIKELLRSDGEKMFKFPTPQVIADNKTAWRTDEEFAREMLAGVNPVS  181
            P+L+ I+ N PLEM+KEL+R+DGE +FKFP PQVI ++K+AWRTDEEFAREMLAG+NPV 
Sbjct  319  PLLDKIKDNIPLEMLKELVRTDGEHLFKFPMPQVIKEDKSAWRTDEEFAREMLAGLNPVV  378

Query  182  ISRLQMFPQRSTLDPKVYGDHTCTITREDIADKLDGLTVEQAIESKRLFILDHHDAITLY  361
            I  LQ FP +S LDP+VYG+   +IT+E I + LD LT+ +A+E KRLFILDHHD    Y
Sbjct  379  IRLLQEFPPKSKLDPEVYGNQNSSITKEHIENHLDDLTINEAMEKKRLFILDHHDVFMPY  438

Query  362  ARRINDNTDRKIYATRTLLFLLKDGTLRPIAIELSKPHPDGD  487
             RRIN  T  K YA+RTLLFL  DGTL+P+AIELS PHP GD
Sbjct  439  LRRIN-TTSTKTYASRTLLFLKDDGTLKPLAIELSLPHPSGD  479



>emb|CAA64769.1| lipoxygenase [Solanum tuberosum]
Length=697

 Score =   214 bits (546),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 104/162 (64%), Positives = 127/162 (78%), Gaps = 1/162 (1%)
 Frame = +2

Query  2    PILEHIQKNTPLEMIKELLRSDGEKMFKFPTPQVIADNKTAWRTDEEFAREMLAGVNPVS  181
            P+ + +    PLEMI+ELLR+DGE + +FPTP VI D+KTAWRTDEEFAREMLAGVNP+ 
Sbjct  157  PLFKALTAAIPLEMIRELLRTDGEGILRFPTPLVIKDSKTAWRTDEEFAREMLAGVNPII  216

Query  182  ISRLQMFPQRSTLDPKVYGDHTCTITREDIADKLDGLTVEQAIESKRLFILDHHDAITLY  361
            ISRLQ FP +S LDP+ YG+   TIT E I DKLDGLTV++A+ + +LFIL+HHD I  Y
Sbjct  217  ISRLQEFPPKSKLDPEAYGNQNSTITAEHIEDKLDGLTVDEAMNNNKLFILNHHDVIIPY  276

Query  362  ARRINDNTDRKIYATRTLLFLLKDGTLRPIAIELSKPHPDGD  487
             RRIN  T  K YA+RTLLFL  +G+L+P+AIELS PHPDGD
Sbjct  277  LRRIN-TTITKTYASRTLLFLQDNGSLKPLAIELSLPHPDGD  317



>ref|XP_010659859.1| PREDICTED: probable linoleate 9S-lipoxygenase 5 [Vitis vinifera]
Length=875

 Score =   216 bits (550),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 103/162 (64%), Positives = 127/162 (78%), Gaps = 1/162 (1%)
 Frame = +2

Query  2    PILEHIQKNTPLEMIKELLRSDGEKMFKFPTPQVIADNKTAWRTDEEFAREMLAGVNPVS  181
            P+L+ I+ N PLEM+KEL+R+DGE +FKFP PQVI ++K+AWRTDEEFAREMLAG+NPV 
Sbjct  335  PLLDKIKDNIPLEMLKELVRTDGEHLFKFPMPQVIKEDKSAWRTDEEFAREMLAGLNPVV  394

Query  182  ISRLQMFPQRSTLDPKVYGDHTCTITREDIADKLDGLTVEQAIESKRLFILDHHDAITLY  361
            I  LQ FP +S LDP++YG+   +IT+E I + LD LT+ +A+E KRLFILDHHD    Y
Sbjct  395  IRLLQEFPPKSKLDPEIYGNQNSSITKEHIENHLDDLTINEAMEKKRLFILDHHDVFMQY  454

Query  362  ARRINDNTDRKIYATRTLLFLLKDGTLRPIAIELSKPHPDGD  487
             RRIN  T  K YA+RTLLFL  DGTL+P+AIELS PHP GD
Sbjct  455  LRRIN-TTSTKTYASRTLLFLKDDGTLKPLAIELSLPHPSGD  495



>ref|NP_001274916.1| probable linoleate 9S-lipoxygenase 5 [Solanum tuberosum]
 sp|Q43191.1|LOX15_SOLTU RecName: Full=Probable linoleate 9S-lipoxygenase 5; AltName: 
Full=Leaf lipoxygenase [Solanum tuberosum]
 gb|AAB67865.1| lipoxygenase [Solanum tuberosum]
Length=862

 Score =   216 bits (550),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 101/162 (62%), Positives = 131/162 (81%), Gaps = 1/162 (1%)
 Frame = +2

Query  2    PILEHIQKNTPLEMIKELLRSDGEKMFKFPTPQVIADNKTAWRTDEEFAREMLAGVNPVS  181
            P L+ +  + PLE++KE++R+DGE  FKFPTPQVI ++K++WRTDEEFAREMLAGVNPV 
Sbjct  322  PFLKALTDSIPLEILKEIIRTDGEGKFKFPTPQVIQEDKSSWRTDEEFAREMLAGVNPVI  381

Query  182  ISRLQMFPQRSTLDPKVYGDHTCTITREDIADKLDGLTVEQAIESKRLFILDHHDAITLY  361
            ISRLQ FP +S LD +VYG+   TIT+E I + LDGLT++ AI++ RL+IL+HHD +  Y
Sbjct  382  ISRLQEFPPKSQLDSEVYGNQNSTITKEHIENTLDGLTIDDAIKTNRLYILNHHDILMPY  441

Query  362  ARRINDNTDRKIYATRTLLFLLKDGTLRPIAIELSKPHPDGD  487
             RRIN  T+ K+YA+RTLLFL  DGT++P+AIELS PHPDGD
Sbjct  442  VRRIN-TTNTKLYASRTLLFLQDDGTMKPVAIELSLPHPDGD  482



>emb|CBI36802.3| unnamed protein product [Vitis vinifera]
Length=900

 Score =   216 bits (550),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 103/162 (64%), Positives = 127/162 (78%), Gaps = 1/162 (1%)
 Frame = +2

Query  2    PILEHIQKNTPLEMIKELLRSDGEKMFKFPTPQVIADNKTAWRTDEEFAREMLAGVNPVS  181
            P+L+ I+ N PLEM+KEL+R+DGE +FKFP PQVI ++K+AWRTDEEFAREMLAG+NPV 
Sbjct  360  PLLDKIKDNIPLEMLKELVRTDGEHLFKFPMPQVIKEDKSAWRTDEEFAREMLAGLNPVV  419

Query  182  ISRLQMFPQRSTLDPKVYGDHTCTITREDIADKLDGLTVEQAIESKRLFILDHHDAITLY  361
            I  LQ FP +S LDP++YG+   +IT+E I + LD LT+ +A+E KRLFILDHHD    Y
Sbjct  420  IRLLQEFPPKSKLDPEIYGNQNSSITKEHIENHLDDLTINEAMEKKRLFILDHHDVFMQY  479

Query  362  ARRINDNTDRKIYATRTLLFLLKDGTLRPIAIELSKPHPDGD  487
             RRIN  T  K YA+RTLLFL  DGTL+P+AIELS PHP GD
Sbjct  480  LRRIN-TTSTKTYASRTLLFLKDDGTLKPLAIELSLPHPSGD  520



>ref|XP_009376663.1| PREDICTED: probable linoleate 9S-lipoxygenase 5 [Pyrus x bretschneideri]
 ref|XP_009376684.1| PREDICTED: probable linoleate 9S-lipoxygenase 5 [Pyrus x bretschneideri]
Length=868

 Score =   215 bits (548),  Expect = 4e-62, Method: Compositional matrix adjust.
 Identities = 106/161 (66%), Positives = 124/161 (77%), Gaps = 1/161 (1%)
 Frame = +2

Query  5    ILEHIQKNTPLEMIKELLRSDGEKMFKFPTPQVIADNKTAWRTDEEFAREMLAGVNPVSI  184
            IL+HI  +TP EM KEL R+DGE+  KFP PQVI ++K+AWRTDEEFARE+LAGVNPV+I
Sbjct  329  ILKHISDSTPEEMFKELFRTDGERFLKFPVPQVIKEDKSAWRTDEEFARELLAGVNPVTI  388

Query  185  SRLQMFPQRSTLDPKVYGDHTCTITREDIADKLDGLTVEQAIESKRLFILDHHDAITLYA  364
             RLQ FP  S LD + YGD T  IT+E I   L+GLT+++AI S +LFILDHHDA   Y 
Sbjct  389  RRLQEFPPSSELDREAYGDQTSQITKEHIEHNLNGLTIDEAIMSNKLFILDHHDAWMPYL  448

Query  365  RRINDNTDRKIYATRTLLFLLKDGTLRPIAIELSKPHPDGD  487
            RRIN  T  K YA+RTLLFL  DGTL+PIAIELS PHPDGD
Sbjct  449  RRIN-TTSTKAYASRTLLFLNNDGTLKPIAIELSLPHPDGD  488



>ref|NP_001275357.1| linoleate 9S-lipoxygenase 2 [Solanum tuberosum]
 sp|O24379.1|LOX12_SOLTU RecName: Full=Linoleate 9S-lipoxygenase 2; AltName: Full=Lipoxygenase 
1-2 [Solanum tuberosum]
 emb|CAA64766.1| lipoxygenase [Solanum tuberosum]
Length=861

 Score =   215 bits (548),  Expect = 4e-62, Method: Compositional matrix adjust.
 Identities = 104/162 (64%), Positives = 127/162 (78%), Gaps = 1/162 (1%)
 Frame = +2

Query  2    PILEHIQKNTPLEMIKELLRSDGEKMFKFPTPQVIADNKTAWRTDEEFAREMLAGVNPVS  181
            P+ + +    PLEMI+ELLR+DGE + +FPTP VI D+KTAWRTDEEFAREMLAGVNPV 
Sbjct  321  PLFKALTAAIPLEMIRELLRTDGEGILRFPTPLVIKDSKTAWRTDEEFAREMLAGVNPVI  380

Query  182  ISRLQMFPQRSTLDPKVYGDHTCTITREDIADKLDGLTVEQAIESKRLFILDHHDAITLY  361
            ISRLQ FP +S LDP+ YG+   TIT E I DKLDGLTV++A+ + +LFIL+HHD +  Y
Sbjct  381  ISRLQEFPPKSKLDPEAYGNQNSTITAEHIEDKLDGLTVDEAMNNNKLFILNHHDVLIPY  440

Query  362  ARRINDNTDRKIYATRTLLFLLKDGTLRPIAIELSKPHPDGD  487
             RRIN  T  K YA+RTLLFL  +G+L+P+AIELS PHPDGD
Sbjct  441  LRRIN-TTTTKTYASRTLLFLQDNGSLKPLAIELSLPHPDGD  481



>sp|P37831.1|LOX11_SOLTU RecName: Full=Linoleate 9S-lipoxygenase 1; AltName: Full=Lipoxygenase 
1; Short=StLOX1 [Solanum tuberosum]
 emb|CAA55724.1| lipoxygenase [Solanum tuberosum]
Length=861

 Score =   215 bits (548),  Expect = 4e-62, Method: Compositional matrix adjust.
 Identities = 105/162 (65%), Positives = 127/162 (78%), Gaps = 1/162 (1%)
 Frame = +2

Query  2    PILEHIQKNTPLEMIKELLRSDGEKMFKFPTPQVIADNKTAWRTDEEFAREMLAGVNPVS  181
            P+ + +    PLEMI+ELLR+DGE + +FPTP VI D+KTAWRTDEEFAREMLAGVNPV 
Sbjct  321  PLFKALTAAIPLEMIRELLRTDGEGILRFPTPLVIKDSKTAWRTDEEFAREMLAGVNPVI  380

Query  182  ISRLQMFPQRSTLDPKVYGDHTCTITREDIADKLDGLTVEQAIESKRLFILDHHDAITLY  361
            ISRLQ FP +S LDP+ YG+   TIT E I DKLDGLTV++A+ + +LFIL+HHD I  Y
Sbjct  381  ISRLQEFPPKSKLDPEAYGNQNSTITAEHIEDKLDGLTVDEAMNNNKLFILNHHDVIIPY  440

Query  362  ARRINDNTDRKIYATRTLLFLLKDGTLRPIAIELSKPHPDGD  487
             RRIN  T  K YA+RTLLFL  +G+L+P+AIELS PHPDGD
Sbjct  441  LRRIN-TTITKAYASRTLLFLQDNGSLKPLAIELSFPHPDGD  481



>ref|NP_001281026.1| probable linoleate 9S-lipoxygenase 5 [Malus domestica]
 gb|AGK82794.1| lipoxygenase [Malus domestica]
Length=933

 Score =   216 bits (549),  Expect = 4e-62, Method: Compositional matrix adjust.
 Identities = 104/161 (65%), Positives = 126/161 (78%), Gaps = 1/161 (1%)
 Frame = +2

Query  5    ILEHIQKNTPLEMIKELLRSDGEKMFKFPTPQVIADNKTAWRTDEEFAREMLAGVNPVSI  184
            +L+ ++ N P+E IKEL R+DGEK  KFP PQVI ++K+AWRTDEEFAREMLAG+NPVSI
Sbjct  394  LLKSVRDNIPVETIKELFRTDGEKFLKFPVPQVIKEDKSAWRTDEEFAREMLAGINPVSI  453

Query  185  SRLQMFPQRSTLDPKVYGDHTCTITREDIADKLDGLTVEQAIESKRLFILDHHDAITLYA  364
             RLQ FP  S LD K YGD T  IT+E IA  L GL++++AI++ +LFILDHHD+I  Y 
Sbjct  454  RRLQEFPPASKLDRKAYGDQTSRITKEQIAHNLKGLSIDEAIDNNKLFILDHHDSIMPYL  513

Query  365  RRINDNTDRKIYATRTLLFLLKDGTLRPIAIELSKPHPDGD  487
            RRIN  T  K YA+RTLLFL  DGTL+P+AIELS PHPDGD
Sbjct  514  RRIN-ATSTKTYASRTLLFLQDDGTLKPLAIELSLPHPDGD  553



>sp|O22507.1|LOX17_SOLTU RecName: Full=Probable linoleate 9S-lipoxygenase 7 [Solanum tuberosum]
 gb|AAB81594.1| lipoxygenase [Solanum tuberosum]
Length=861

 Score =   215 bits (547),  Expect = 6e-62, Method: Compositional matrix adjust.
 Identities = 104/162 (64%), Positives = 127/162 (78%), Gaps = 1/162 (1%)
 Frame = +2

Query  2    PILEHIQKNTPLEMIKELLRSDGEKMFKFPTPQVIADNKTAWRTDEEFAREMLAGVNPVS  181
            P+ + +    PLEMI+ELLR+DGE + +FPTP VI D+KTAWRTDEEFAREMLAGVNP+ 
Sbjct  321  PLFKALTAAIPLEMIRELLRTDGEGILRFPTPLVIKDSKTAWRTDEEFAREMLAGVNPII  380

Query  182  ISRLQMFPQRSTLDPKVYGDHTCTITREDIADKLDGLTVEQAIESKRLFILDHHDAITLY  361
            ISRLQ FP +S LDP+ YG+   TIT E I DKLDGLTV++A+ + +LFIL+HHD I  Y
Sbjct  381  ISRLQEFPPKSKLDPEAYGNQNSTITAEHIEDKLDGLTVDEAMNNNKLFILNHHDVIIPY  440

Query  362  ARRINDNTDRKIYATRTLLFLLKDGTLRPIAIELSKPHPDGD  487
             RRIN  T  K YA+RTLLFL  +G+L+P+AIELS PHPDGD
Sbjct  441  LRRIN-TTITKTYASRTLLFLQDNGSLKPLAIELSLPHPDGD  481



>sp|O22508.1|LOX18_SOLTU RecName: Full=Probable linoleate 9S-lipoxygenase 8 [Solanum tuberosum]
 gb|AAB81595.1| lipoxygenase [Solanum tuberosum]
Length=861

 Score =   215 bits (547),  Expect = 6e-62, Method: Compositional matrix adjust.
 Identities = 104/162 (64%), Positives = 127/162 (78%), Gaps = 1/162 (1%)
 Frame = +2

Query  2    PILEHIQKNTPLEMIKELLRSDGEKMFKFPTPQVIADNKTAWRTDEEFAREMLAGVNPVS  181
            P+ + +    PLEMI+ELLR+DGE + +FPTP VI D+KTAWRTDEEFAREMLAGVNP+ 
Sbjct  321  PLFKALTAAIPLEMIRELLRTDGEGILRFPTPLVIKDSKTAWRTDEEFAREMLAGVNPII  380

Query  182  ISRLQMFPQRSTLDPKVYGDHTCTITREDIADKLDGLTVEQAIESKRLFILDHHDAITLY  361
            ISRLQ FP +S LDP+ YG+   TIT E I DKLDGLTV++A+ + +LFIL+HHD I  Y
Sbjct  381  ISRLQEFPPKSKLDPEAYGNQNSTITAEHIEDKLDGLTVDEAMNNNKLFILNHHDVIIPY  440

Query  362  ARRINDNTDRKIYATRTLLFLLKDGTLRPIAIELSKPHPDGD  487
             RRIN  T  K YA+RTLLFL  +G+L+P+AIELS PHPDGD
Sbjct  441  LRRIN-TTITKTYASRTLLFLQDNGSLKPLAIELSLPHPDGD  481



>gb|AGK82779.1| lipoxygenase [Malus domestica]
Length=952

 Score =   215 bits (548),  Expect = 6e-62, Method: Compositional matrix adjust.
 Identities = 102/161 (63%), Positives = 127/161 (79%), Gaps = 1/161 (1%)
 Frame = +2

Query  5    ILEHIQKNTPLEMIKELLRSDGEKMFKFPTPQVIADNKTAWRTDEEFAREMLAGVNPVSI  184
            +L+HI  + P EM KE+ R+D  K+ KFP PQVI ++K+AWRTDEEFAREMLAGVNPV+I
Sbjct  413  LLQHIGDSIPSEMFKEIFRTDDAKLLKFPMPQVIKEDKSAWRTDEEFAREMLAGVNPVNI  472

Query  185  SRLQMFPQRSTLDPKVYGDHTCTITREDIADKLDGLTVEQAIESKRLFILDHHDAITLYA  364
             RLQ FP  S LDPKVYGD T TIT E I + LDGL+V++A+++ +LFILDHHD++  Y 
Sbjct  473  RRLQEFPPASKLDPKVYGDQTSTITEEHIKNNLDGLSVDEALKNNKLFILDHHDSLMPYL  532

Query  365  RRINDNTDRKIYATRTLLFLLKDGTLRPIAIELSKPHPDGD  487
            RRIN +T  KIY +RTLLFL  DGTL+P+ IELS PHP+GD
Sbjct  533  RRIN-STSNKIYGSRTLLFLQNDGTLKPLVIELSLPHPNGD  572



>ref|NP_001275169.1| probable linoleate 9S-lipoxygenase 8-like [Solanum tuberosum]
 emb|CAB65460.1| lipoxygenase [Solanum tuberosum]
Length=861

 Score =   215 bits (547),  Expect = 6e-62, Method: Compositional matrix adjust.
 Identities = 104/162 (64%), Positives = 127/162 (78%), Gaps = 1/162 (1%)
 Frame = +2

Query  2    PILEHIQKNTPLEMIKELLRSDGEKMFKFPTPQVIADNKTAWRTDEEFAREMLAGVNPVS  181
            P+ + +    PLEMI+ELLR+DGE + +FPTP VI D+KTAWRTDEEFAREMLAGVNP+ 
Sbjct  321  PLFKALTAAIPLEMIRELLRTDGEGILRFPTPLVIKDSKTAWRTDEEFAREMLAGVNPII  380

Query  182  ISRLQMFPQRSTLDPKVYGDHTCTITREDIADKLDGLTVEQAIESKRLFILDHHDAITLY  361
            ISRLQ FP +S LDP+ YG+   TIT E I DKLDGLTV++A+ + +LFIL+HHD I  Y
Sbjct  381  ISRLQEFPPKSKLDPEAYGNQNSTITAEHIEDKLDGLTVDEAMNNNKLFILNHHDVIIPY  440

Query  362  ARRINDNTDRKIYATRTLLFLLKDGTLRPIAIELSKPHPDGD  487
             RRIN  T  K YA+RTLLFL  +G+L+P+AIELS PHPDGD
Sbjct  441  LRRIN-TTITKTYASRTLLFLQDNGSLKPLAIELSLPHPDGD  481



>ref|XP_006355846.1| PREDICTED: LOW QUALITY PROTEIN: probable linoleate 9S-lipoxygenase 
8-like [Solanum tuberosum]
Length=737

 Score =   214 bits (544),  Expect = 7e-62, Method: Compositional matrix adjust.
 Identities = 104/162 (64%), Positives = 126/162 (78%), Gaps = 1/162 (1%)
 Frame = +2

Query  2    PILEHIQKNTPLEMIKELLRSDGEKMFKFPTPQVIADNKTAWRTDEEFAREMLAGVNPVS  181
            P+ + +    PLEMIKELLR+DGE + +FPTP VI D+KTAWRTDEEFAREMLAGVNP+ 
Sbjct  198  PLFKALTAAIPLEMIKELLRTDGEGILRFPTPLVIKDSKTAWRTDEEFAREMLAGVNPII  257

Query  182  ISRLQMFPQRSTLDPKVYGDHTCTITREDIADKLDGLTVEQAIESKRLFILDHHDAITLY  361
            I RLQ FP +S LDP+ YG+   TIT E I DKLDGLTV++A+ + +LFIL+HHD I  Y
Sbjct  258  IRRLQEFPPKSKLDPEAYGNQNSTITAEHIEDKLDGLTVDEAMNNNKLFILNHHDVIIPY  317

Query  362  ARRINDNTDRKIYATRTLLFLLKDGTLRPIAIELSKPHPDGD  487
             RRIN  T  K YA+RTLLFL  +G+L+P+AIELS PHPDGD
Sbjct  318  LRRIN-TTITKTYASRTLLFLQDNGSLKPLAIELSLPHPDGD  358



>ref|XP_008370478.1| PREDICTED: probable linoleate 9S-lipoxygenase 5 isoform X2 [Malus 
domestica]
Length=835

 Score =   214 bits (546),  Expect = 7e-62, Method: Compositional matrix adjust.
 Identities = 101/161 (63%), Positives = 127/161 (79%), Gaps = 1/161 (1%)
 Frame = +2

Query  5    ILEHIQKNTPLEMIKELLRSDGEKMFKFPTPQVIADNKTAWRTDEEFAREMLAGVNPVSI  184
            +L+ I    P EM+KE+ R+DG ++ KFP PQVI ++K+AWRTDEEFAREMLAGVNPV+I
Sbjct  296  LLKDIGDKIPAEMLKEIFRTDGAQLLKFPKPQVIKEDKSAWRTDEEFAREMLAGVNPVNI  355

Query  185  SRLQMFPQRSTLDPKVYGDHTCTITREDIADKLDGLTVEQAIESKRLFILDHHDAITLYA  364
            +RLQ FP  S LDPKVYGD   TIT+E I + LDGLTV++A++  +LFILDHHD++  Y 
Sbjct  356  ARLQEFPPASKLDPKVYGDQNSTITKEHIKNNLDGLTVDEALKKNKLFILDHHDSLMPYL  415

Query  365  RRINDNTDRKIYATRTLLFLLKDGTLRPIAIELSKPHPDGD  487
            RRIN +T  KIY +RTLLFL  DGTL+P+ IELS PHP+GD
Sbjct  416  RRIN-STSNKIYGSRTLLFLQNDGTLKPLVIELSLPHPEGD  455



>ref|XP_006382593.1| hypothetical protein POPTR_0005s03550g [Populus trichocarpa]
 gb|ERP60390.1| hypothetical protein POPTR_0005s03550g [Populus trichocarpa]
Length=847

 Score =   214 bits (546),  Expect = 7e-62, Method: Compositional matrix adjust.
 Identities = 100/162 (62%), Positives = 128/162 (79%), Gaps = 1/162 (1%)
 Frame = +2

Query  2    PILEHIQKNTPLEMIKELLRSDGEKMFKFPTPQVIADNKTAWRTDEEFAREMLAGVNPVS  181
            P+LE+++KN P+EM+KE++R+DGE +F+FP PQVI ++ +AWRTDEEF REML+GVNPV 
Sbjct  307  PLLENLKKNIPVEMLKEIIRTDGEGLFRFPKPQVIQESNSAWRTDEEFGREMLSGVNPVI  366

Query  182  ISRLQMFPQRSTLDPKVYGDHTCTITREDIADKLDGLTVEQAIESKRLFILDHHDAITLY  361
            I RL+ FP +S LD K+YGD   TIT E I D LDGL++++AIE  R+FILDHHDA+  Y
Sbjct  367  IRRLEEFPPKSKLDSKLYGDQNSTITEEHIKDSLDGLSIDEAIEKNRMFILDHHDALMPY  426

Query  362  ARRINDNTDRKIYATRTLLFLLKDGTLRPIAIELSKPHPDGD  487
             RRIN  T  K YA+RTLLFL  DGTL+P+ IELS PH +GD
Sbjct  427  LRRIN-TTTTKTYASRTLLFLKDDGTLKPLVIELSLPHEEGD  467



>ref|XP_008370477.1| PREDICTED: probable linoleate 9S-lipoxygenase 5 isoform X1 [Malus 
domestica]
Length=963

 Score =   215 bits (547),  Expect = 8e-62, Method: Compositional matrix adjust.
 Identities = 101/161 (63%), Positives = 127/161 (79%), Gaps = 1/161 (1%)
 Frame = +2

Query  5    ILEHIQKNTPLEMIKELLRSDGEKMFKFPTPQVIADNKTAWRTDEEFAREMLAGVNPVSI  184
            +L+ I    P EM+KE+ R+DG ++ KFP PQVI ++K+AWRTDEEFAREMLAGVNPV+I
Sbjct  424  LLKDIGDKIPAEMLKEIFRTDGAQLLKFPKPQVIKEDKSAWRTDEEFAREMLAGVNPVNI  483

Query  185  SRLQMFPQRSTLDPKVYGDHTCTITREDIADKLDGLTVEQAIESKRLFILDHHDAITLYA  364
            +RLQ FP  S LDPKVYGD   TIT+E I + LDGLTV++A++  +LFILDHHD++  Y 
Sbjct  484  ARLQEFPPASKLDPKVYGDQNSTITKEHIKNNLDGLTVDEALKKNKLFILDHHDSLMPYL  543

Query  365  RRINDNTDRKIYATRTLLFLLKDGTLRPIAIELSKPHPDGD  487
            RRIN +T  KIY +RTLLFL  DGTL+P+ IELS PHP+GD
Sbjct  544  RRIN-STSNKIYGSRTLLFLQNDGTLKPLVIELSLPHPEGD  583



>sp|Q41238.1|LOX16_SOLTU RecName: Full=Linoleate 9S-lipoxygenase 6; AltName: Full=Lipoxygenase 
1-5; Short=StLOX1; Short=lox1:St:3, partial [Solanum 
tuberosum]
 gb|AAB31252.1| linoleate:oxygen oxidoreductase, partial [Solanum tuberosum]
Length=857

 Score =   214 bits (546),  Expect = 8e-62, Method: Compositional matrix adjust.
 Identities = 103/162 (64%), Positives = 127/162 (78%), Gaps = 1/162 (1%)
 Frame = +2

Query  2    PILEHIQKNTPLEMIKELLRSDGEKMFKFPTPQVIADNKTAWRTDEEFAREMLAGVNPVS  181
            P+ + +    PLEM+KELLR+DGE + +FPTP VI D+KTAWRTDEEFAREMLAGVNP+ 
Sbjct  317  PLFKALTAAIPLEMMKELLRTDGEGILRFPTPLVIKDSKTAWRTDEEFAREMLAGVNPII  376

Query  182  ISRLQMFPQRSTLDPKVYGDHTCTITREDIADKLDGLTVEQAIESKRLFILDHHDAITLY  361
            ISRLQ FP +S LDP+ YG+   TIT E I DKLDGLTV++A+ + +LFIL+HHD +  Y
Sbjct  377  ISRLQEFPPKSKLDPEAYGNQNSTITAEHIEDKLDGLTVDEAMNNNKLFILNHHDVLIPY  436

Query  362  ARRINDNTDRKIYATRTLLFLLKDGTLRPIAIELSKPHPDGD  487
             RRIN  T  K YA+RTLLFL  +G+L+P+AIELS PHPDGD
Sbjct  437  LRRIN-TTTTKTYASRTLLFLQDNGSLKPLAIELSLPHPDGD  477



>sp|Q43190.1|LOX14_SOLTU RecName: Full=Probable linoleate 9S-lipoxygenase 4; AltName: 
Full=Root lipoxygenase [Solanum tuberosum]
 gb|AAB67860.1| lipoxygenase [Solanum tuberosum]
Length=860

 Score =   214 bits (545),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 103/162 (64%), Positives = 127/162 (78%), Gaps = 1/162 (1%)
 Frame = +2

Query  2    PILEHIQKNTPLEMIKELLRSDGEKMFKFPTPQVIADNKTAWRTDEEFAREMLAGVNPVS  181
            P+ + +    PLEMI+ELLR+DGE + +FPTP VI D+KTAWRTDEEFAREMLAGVNP+ 
Sbjct  320  PLFKALTDAIPLEMIRELLRTDGEGILRFPTPLVIKDSKTAWRTDEEFAREMLAGVNPII  379

Query  182  ISRLQMFPQRSTLDPKVYGDHTCTITREDIADKLDGLTVEQAIESKRLFILDHHDAITLY  361
            ISRLQ FP +S LDP+ YG+   TIT E I DKLDGLTV++A+ + +LFIL+HHD +  Y
Sbjct  380  ISRLQEFPPKSKLDPEAYGNQNSTITAEHIEDKLDGLTVDEAMNNNKLFILNHHDVLIPY  439

Query  362  ARRINDNTDRKIYATRTLLFLLKDGTLRPIAIELSKPHPDGD  487
             RRIN  T  K YA+RTLLFL  +G+L+P+AIELS PHPDGD
Sbjct  440  LRRIN-TTTTKTYASRTLLFLQDNGSLKPLAIELSLPHPDGD  480



>ref|XP_008340970.1| PREDICTED: linoleate 9S-lipoxygenase 5, chloroplastic-like [Malus 
domestica]
Length=850

 Score =   214 bits (545),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 104/162 (64%), Positives = 126/162 (78%), Gaps = 1/162 (1%)
 Frame = +2

Query  2    PILEHIQKNTPLEMIKELLRSDGEKMFKFPTPQVIADNKTAWRTDEEFAREMLAGVNPVS  181
            P L+ I++  P E++KEL+RSDGE+  KFP P VI  +++AWRTDEEFAREMLAGVNPV+
Sbjct  302  PTLKKIRECIPWELLKELIRSDGERFLKFPMPDVIKRDRSAWRTDEEFAREMLAGVNPVN  361

Query  182  ISRLQMFPQRSTLDPKVYGDHTCTITREDIADKLDGLTVEQAIESKRLFILDHHDAITLY  361
            I+RLQ FP  S LDPKVYG+   +I  E IA  ++GLTV +AIES RLFILDHHDA+  Y
Sbjct  362  ITRLQEFPPVSKLDPKVYGNQNSSIREEHIASNMNGLTVNEAIESNRLFILDHHDALXXY  421

Query  362  ARRINDNTDRKIYATRTLLFLLKDGTLRPIAIELSKPHPDGD  487
             RRIN +T  K YATRTLL L +DGTL+P+AIELS PHP GD
Sbjct  422  LRRIN-STHTKTYATRTLLLLQEDGTLKPLAIELSLPHPQGD  462



>ref|XP_009366923.1| PREDICTED: probable linoleate 9S-lipoxygenase 5 [Pyrus x bretschneideri]
Length=884

 Score =   214 bits (546),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 104/162 (64%), Positives = 127/162 (78%), Gaps = 1/162 (1%)
 Frame = +2

Query  2    PILEHIQKNTPLEMIKELLRSDGEKMFKFPTPQVIADNKTAWRTDEEFAREMLAGVNPVS  181
            P L+ I++  P E++KEL+RSDGE+  KFP P VI  +++AWRTDEEFAREMLAGVNPV+
Sbjct  336  PTLKKIRECIPWELLKELIRSDGERFLKFPMPDVIKKDRSAWRTDEEFAREMLAGVNPVN  395

Query  182  ISRLQMFPQRSTLDPKVYGDHTCTITREDIADKLDGLTVEQAIESKRLFILDHHDAITLY  361
            I+RLQ FP  S LDPKVYG+   +I  E IA  ++GLTV +AIES RLFILDHHDA+ +Y
Sbjct  396  ITRLQEFPPVSKLDPKVYGNQHSSIREEHIASNMNGLTVREAIESNRLFILDHHDALMIY  455

Query  362  ARRINDNTDRKIYATRTLLFLLKDGTLRPIAIELSKPHPDGD  487
             RRIN +T  K YATRTLL L +DGTL+P+AIELS PHP GD
Sbjct  456  LRRIN-STHTKTYATRTLLLLQEDGTLKPLAIELSLPHPQGD  496



>ref|XP_010025196.1| PREDICTED: probable linoleate 9S-lipoxygenase 5 [Eucalyptus grandis]
 gb|KCW61795.1| hypothetical protein EUGRSUZ_H04495 [Eucalyptus grandis]
Length=864

 Score =   214 bits (545),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 104/162 (64%), Positives = 128/162 (79%), Gaps = 1/162 (1%)
 Frame = +2

Query  2    PILEHIQKNTPLEMIKELLRSDGEKMFKFPTPQVIADNKTAWRTDEEFAREMLAGVNPVS  181
            P+LE ++++ PLEMIKEL+R+DGE + ++P PQVI +N+TAWRTD EF REMLAGVNPV 
Sbjct  324  PLLESLEESIPLEMIKELVRTDGEGLLEYPIPQVIKENETAWRTDVEFGREMLAGVNPVL  383

Query  182  ISRLQMFPQRSTLDPKVYGDHTCTITREDIADKLDGLTVEQAIESKRLFILDHHDAITLY  361
            I RL+ FP  S LDPK+YG+   TI  E I  +L+GLTV+QAI+  +LFILDHHDAI  Y
Sbjct  384  IRRLEEFPPASKLDPKIYGNQNSTIREELIQKQLNGLTVKQAIKMNKLFILDHHDAIMPY  443

Query  362  ARRINDNTDRKIYATRTLLFLLKDGTLRPIAIELSKPHPDGD  487
             RRIN  T+ K YATRTLLFL  DGTL+P+AIELS PHP+GD
Sbjct  444  LRRIN-TTNTKTYATRTLLFLKDDGTLKPLAIELSLPHPEGD  484



>ref|NP_001275351.1| 5-lipoxygenase [Solanum tuberosum]
 gb|AAD04258.1| 5-lipoxygenase [Solanum tuberosum]
Length=864

 Score =   214 bits (544),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 104/162 (64%), Positives = 127/162 (78%), Gaps = 1/162 (1%)
 Frame = +2

Query  2    PILEHIQKNTPLEMIKELLRSDGEKMFKFPTPQVIADNKTAWRTDEEFAREMLAGVNPVS  181
            P+ + +    PLEMIKELLR+DGE + +FPTP VI D+KTAWRTDEEFAREMLAGVNP+ 
Sbjct  324  PLFKALTAAIPLEMIKELLRTDGEGILRFPTPLVIKDSKTAWRTDEEFAREMLAGVNPII  383

Query  182  ISRLQMFPQRSTLDPKVYGDHTCTITREDIADKLDGLTVEQAIESKRLFILDHHDAITLY  361
            ISRLQ FP +S LDP+ YG+   TIT E I DKLDGLTV++A+ + +LFIL+HHD +  Y
Sbjct  384  ISRLQEFPPKSKLDPEAYGNQNSTITAEHIEDKLDGLTVDEAMNNNKLFILNHHDLLIPY  443

Query  362  ARRINDNTDRKIYATRTLLFLLKDGTLRPIAIELSKPHPDGD  487
             RRIN  T  K YA+RTLLFL  +G+L+P+AIELS PHPDGD
Sbjct  444  LRRIN-TTITKSYASRTLLFLQDNGSLKPLAIELSLPHPDGD  484



>ref|XP_008454481.1| PREDICTED: linoleate 9S-lipoxygenase 6-like [Cucumis melo]
Length=863

 Score =   213 bits (543),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 101/161 (63%), Positives = 127/161 (79%), Gaps = 1/161 (1%)
 Frame = +2

Query  5    ILEHIQKNTPLEMIKELLRSDGEKMFKFPTPQVIADNKTAWRTDEEFAREMLAGVNPVSI  184
            +L+ I +N P  ++KE+ R+DGE+  +FPTPQ+I ++KTAW TDEEFAREMLAGVNPV I
Sbjct  323  LLQGITENIPAPLLKEIFRTDGERFLRFPTPQLIHEDKTAWSTDEEFAREMLAGVNPVVI  382

Query  185  SRLQMFPQRSTLDPKVYGDHTCTITREDIADKLDGLTVEQAIESKRLFILDHHDAITLYA  364
            +RLQ FP +STLDP +YGD T  IT E I D LDGLTV++A+E K+L+IL+HHD++  Y 
Sbjct  383  ARLQEFPPKSTLDPNIYGDQTSKITEEHIQDGLDGLTVDEALEKKKLYILNHHDSLIPYL  442

Query  365  RRINDNTDRKIYATRTLLFLLKDGTLRPIAIELSKPHPDGD  487
            RRIN  T  K YATRT+LFL  DGTL+P+AIELS PHP GD
Sbjct  443  RRIN-TTPTKTYATRTVLFLKNDGTLKPLAIELSLPHPQGD  482



>ref|NP_001234856.1| linoleate 9S-lipoxygenase A [Solanum lycopersicum]
 sp|P38415.1|LOXA_SOLLC RecName: Full=Linoleate 9S-lipoxygenase A; AltName: Full=Lipoxygenase 
A [Solanum lycopersicum]
 gb|AAA53184.1| lipoxygenase [Solanum lycopersicum]
Length=860

 Score =   213 bits (543),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 103/162 (64%), Positives = 127/162 (78%), Gaps = 1/162 (1%)
 Frame = +2

Query  2    PILEHIQKNTPLEMIKELLRSDGEKMFKFPTPQVIADNKTAWRTDEEFAREMLAGVNPVS  181
            P+ + +    PLEMI+ELLR+DGE + +FPTP VI D+KTAWRTDEEFAREMLAGVNPV 
Sbjct  320  PLFKALTDAIPLEMIRELLRTDGEGILRFPTPLVIKDSKTAWRTDEEFAREMLAGVNPVI  379

Query  182  ISRLQMFPQRSTLDPKVYGDHTCTITREDIADKLDGLTVEQAIESKRLFILDHHDAITLY  361
            ISRL+ FP +S LDP++YG+   TIT E I  KLDGLT+++AI S +LFIL+HHD +  Y
Sbjct  380  ISRLEEFPPKSKLDPELYGNQNSTITAEHIEGKLDGLTIDEAINSNKLFILNHHDVLIPY  439

Query  362  ARRINDNTDRKIYATRTLLFLLKDGTLRPIAIELSKPHPDGD  487
             RRIN  T  K YA+RTLLFL  +G+L+P+AIELS PHPDGD
Sbjct  440  LRRIN-TTTTKTYASRTLLFLQDNGSLKPLAIELSLPHPDGD  480



>ref|XP_009376660.1| PREDICTED: probable linoleate 9S-lipoxygenase 5 [Pyrus x bretschneideri]
Length=931

 Score =   213 bits (543),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 103/161 (64%), Positives = 126/161 (78%), Gaps = 1/161 (1%)
 Frame = +2

Query  5    ILEHIQKNTPLEMIKELLRSDGEKMFKFPTPQVIADNKTAWRTDEEFAREMLAGVNPVSI  184
            +L+ ++ N P+E IKELLR+DGEK  KFP PQVI ++K+AWRTDEEFAREMLAG+NPV+I
Sbjct  392  LLKSVRDNIPVETIKELLRTDGEKFLKFPVPQVIKEDKSAWRTDEEFAREMLAGINPVTI  451

Query  185  SRLQMFPQRSTLDPKVYGDHTCTITREDIADKLDGLTVEQAIESKRLFILDHHDAITLYA  364
             RLQ FP  S LD K YGD T  IT+E IA  L GL++++AI++ +LFILDHHD+I  Y 
Sbjct  452  RRLQEFPPASKLDQKAYGDQTSRITKEHIAHNLKGLSIDEAIDNNKLFILDHHDSIMPYL  511

Query  365  RRINDNTDRKIYATRTLLFLLKDGTLRPIAIELSKPHPDGD  487
            R IN  T  K YA+RTLLFL  DGTL+P+AIELS PHPDGD
Sbjct  512  RGIN-TTSTKTYASRTLLFLQDDGTLKPLAIELSLPHPDGD  551



>ref|XP_011036799.1| PREDICTED: probable linoleate 9S-lipoxygenase 5 [Populus euphratica]
Length=866

 Score =   213 bits (542),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 99/162 (61%), Positives = 128/162 (79%), Gaps = 1/162 (1%)
 Frame = +2

Query  2    PILEHIQKNTPLEMIKELLRSDGEKMFKFPTPQVIADNKTAWRTDEEFAREMLAGVNPVS  181
            P+LE+++KN P+EM+KE++R+DGE +F+FP PQVI ++ +AWRTDEEF REML+GVNPV 
Sbjct  326  PLLENLKKNIPVEMLKEIIRTDGEGLFRFPKPQVIQESNSAWRTDEEFGREMLSGVNPVI  385

Query  182  ISRLQMFPQRSTLDPKVYGDHTCTITREDIADKLDGLTVEQAIESKRLFILDHHDAITLY  361
            I RL+ FP +S LD K+YGD   TIT E I D LDGL++++AI+  R+FILDHHDA+  Y
Sbjct  386  IRRLEEFPPKSKLDSKLYGDQNSTITEEHIKDSLDGLSIDEAIKKNRMFILDHHDALMPY  445

Query  362  ARRINDNTDRKIYATRTLLFLLKDGTLRPIAIELSKPHPDGD  487
             RRIN  T  K YA+RTLLFL  DGTL+P+ IELS PH +GD
Sbjct  446  LRRIN-TTTTKTYASRTLLFLKDDGTLKPLVIELSLPHEEGD  486



>gb|EYU26430.1| hypothetical protein MIMGU_mgv1a023655mg [Erythranthe guttata]
Length=963

 Score =   213 bits (543),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 103/161 (64%), Positives = 124/161 (77%), Gaps = 1/161 (1%)
 Frame = +2

Query  5    ILEHIQKNTPLEMIKELLRSDGEKMFKFPTPQVIADNKTAWRTDEEFAREMLAGVNPVSI  184
            +LE I ++ P E IKEL+RSDGEK FKFP PQVI ++KTAWR+DEEF REMLAG+NPV I
Sbjct  424  LLEKISEHIPFETIKELIRSDGEKSFKFPLPQVIKEDKTAWRSDEEFGREMLAGLNPVVI  483

Query  185  SRLQMFPQRSTLDPKVYGDHTCTITREDIADKLDGLTVEQAIESKRLFILDHHDAITLYA  364
             RLQ FP  STLDP++YG  + TI+ E I + LDG T+ +AIE  +LFILDHHD +  Y 
Sbjct  484  RRLQEFPPASTLDPELYGKQSSTISEEHIVNSLDGFTIPEAIEKNKLFILDHHDNLMPYL  543

Query  365  RRINDNTDRKIYATRTLLFLLKDGTLRPIAIELSKPHPDGD  487
            RRIN  T  K YATRT+LFL  DGTL+P+AIELS PHP+GD
Sbjct  544  RRIN-TTAAKTYATRTVLFLKSDGTLKPLAIELSLPHPNGD  583



>gb|ACO57136.1| lipoxygenase 1 [Capsicum annuum]
Length=861

 Score =   213 bits (541),  Expect = 4e-61, Method: Compositional matrix adjust.
 Identities = 101/162 (62%), Positives = 129/162 (80%), Gaps = 1/162 (1%)
 Frame = +2

Query  2    PILEHIQKNTPLEMIKELLRSDGEKMFKFPTPQVIADNKTAWRTDEEFAREMLAGVNPVS  181
            P L+ +  + PL ++KE++R+DGE  FKFPTPQVI  +K++WRTDEEFAREMLAGVNPV 
Sbjct  321  PFLKALTDSIPLSILKEIIRTDGEGKFKFPTPQVIQADKSSWRTDEEFAREMLAGVNPVI  380

Query  182  ISRLQMFPQRSTLDPKVYGDHTCTITREDIADKLDGLTVEQAIESKRLFILDHHDAITLY  361
            ISRLQ FP +S LD +VYG+   TIT+E I + LDGLT++ AI++ RL+IL+HHD +  Y
Sbjct  381  ISRLQEFPPKSKLDTEVYGNQNSTITKEHIENALDGLTIDDAIKTNRLYILNHHDMLMPY  440

Query  362  ARRINDNTDRKIYATRTLLFLLKDGTLRPIAIELSKPHPDGD  487
             RRIN  T+ K+YA+RTLLFL  DGT++PIAIELS PHPDGD
Sbjct  441  VRRIN-TTNTKLYASRTLLFLQDDGTMKPIAIELSLPHPDGD  481



>ref|XP_002319014.2| lipoxygenase family protein [Populus trichocarpa]
 gb|EEE94937.2| lipoxygenase family protein [Populus trichocarpa]
Length=836

 Score =   213 bits (541),  Expect = 4e-61, Method: Compositional matrix adjust.
 Identities = 101/162 (62%), Positives = 125/162 (77%), Gaps = 1/162 (1%)
 Frame = +2

Query  2    PILEHIQKNTPLEMIKELLRSDGEKMFKFPTPQVIADNKTAWRTDEEFAREMLAGVNPVS  181
            P+L++++KN PLEM+KE+ R+DGE +FKFP PQVI DN +AWRTDEEF REMLAGVNPV 
Sbjct  296  PLLDNLRKNIPLEMLKEIFRTDGENLFKFPKPQVIQDNHSAWRTDEEFGREMLAGVNPVI  355

Query  182  ISRLQMFPQRSTLDPKVYGDHTCTITREDIADKLDGLTVEQAIESKRLFILDHHDAITLY  361
            I RL+ FP +S L+ K YGD   +IT E I D LDGLT+++AI++ R+FILDHHD +  Y
Sbjct  356  IRRLEEFPPKSKLNSKQYGDQNSSITEEHIKDNLDGLTIDEAIKNNRMFILDHHDELMPY  415

Query  362  ARRINDNTDRKIYATRTLLFLLKDGTLRPIAIELSKPHPDGD  487
             RRIN  T  K YA+RTLLFL  DGTL+P+ IELS PH  GD
Sbjct  416  LRRINSTT-TKTYASRTLLFLKDDGTLKPLVIELSLPHDKGD  456



>emb|CAA64765.1| lipoxygenase [Solanum tuberosum]
Length=844

 Score =   213 bits (541),  Expect = 4e-61, Method: Compositional matrix adjust.
 Identities = 103/162 (64%), Positives = 126/162 (78%), Gaps = 1/162 (1%)
 Frame = +2

Query  2    PILEHIQKNTPLEMIKELLRSDGEKMFKFPTPQVIADNKTAWRTDEEFAREMLAGVNPVS  181
            P+ + +    PLEMI+ELLR+DGE + +FPTP VI D+KTAWRTDEEFAREMLAG NPV 
Sbjct  304  PLFKALTAAIPLEMIRELLRTDGEGILRFPTPLVIKDSKTAWRTDEEFAREMLAGTNPVI  363

Query  182  ISRLQMFPQRSTLDPKVYGDHTCTITREDIADKLDGLTVEQAIESKRLFILDHHDAITLY  361
            ISRLQ FP +S LDP+ YG+   TIT E I DKLDGLTV++A+ + +LFIL+HHD +  Y
Sbjct  364  ISRLQEFPPKSKLDPEAYGNQNSTITAEHIEDKLDGLTVDEAMNNNKLFILNHHDLLIPY  423

Query  362  ARRINDNTDRKIYATRTLLFLLKDGTLRPIAIELSKPHPDGD  487
             RRIN  T  K YA+RTLLFL  +G+L+P+AIELS PHPDGD
Sbjct  424  LRRIN-TTITKTYASRTLLFLQDNGSLKPLAIELSLPHPDGD  464



>sp|Q43189.1|LOX13_SOLTU RecName: Full=Probable linoleate 9S-lipoxygenase 3 [Solanum tuberosum]
 gb|AAB67858.1| lipoxygenase [Solanum tuberosum]
Length=861

 Score =   212 bits (540),  Expect = 5e-61, Method: Compositional matrix adjust.
 Identities = 103/162 (64%), Positives = 126/162 (78%), Gaps = 1/162 (1%)
 Frame = +2

Query  2    PILEHIQKNTPLEMIKELLRSDGEKMFKFPTPQVIADNKTAWRTDEEFAREMLAGVNPVS  181
            P+ + +    PLEMI+ELLR+DGE + +FPTP VI D+KTAWRTDEEFAREMLAG NPV 
Sbjct  321  PLFKALTAAIPLEMIRELLRTDGEGILRFPTPLVIKDSKTAWRTDEEFAREMLAGTNPVI  380

Query  182  ISRLQMFPQRSTLDPKVYGDHTCTITREDIADKLDGLTVEQAIESKRLFILDHHDAITLY  361
            ISRLQ FP +S LDP+ YG+   TIT E I DKLDGLTV++A+ + +LFIL+HHD +  Y
Sbjct  381  ISRLQEFPPKSKLDPEAYGNQNSTITAEHIEDKLDGLTVDEAMNNNKLFILNHHDLLIPY  440

Query  362  ARRINDNTDRKIYATRTLLFLLKDGTLRPIAIELSKPHPDGD  487
             RRIN  T  K YA+RTLLFL  +G+L+P+AIELS PHPDGD
Sbjct  441  LRRIN-TTITKTYASRTLLFLQDNGSLKPLAIELSLPHPDGD  481



>ref|XP_004302419.1| PREDICTED: probable linoleate 9S-lipoxygenase 5 [Fragaria vesca 
subsp. vesca]
Length=919

 Score =   213 bits (541),  Expect = 5e-61, Method: Compositional matrix adjust.
 Identities = 101/160 (63%), Positives = 125/160 (78%), Gaps = 1/160 (1%)
 Frame = +2

Query  5    ILEHIQKNTPLEMIKELLRSDGEKMFKFPTPQVIADNKTAWRTDEEFAREMLAGVNPVSI  184
            +L+ ++  TP E +KEL R+DGE++ KFP PQVI ++K+AWRTDEEFAREMLAG+NPVSI
Sbjct  381  LLKFVRSTTPAETVKELFRTDGERLLKFPVPQVIKEDKSAWRTDEEFAREMLAGLNPVSI  440

Query  185  SRLQMFPQRSTLDPKVYGDHTCTITREDIADKLDGLTVEQAIESKRLFILDHHDAITLYA  364
             RLQ FP  S LDP VYGD T  IT+E IADKLDGL++++AI   +LFILDHHD++  Y 
Sbjct  441  HRLQEFPPASKLDPNVYGDQTSKITKEHIADKLDGLSIDEAINKNKLFILDHHDSLMPYL  500

Query  365  RRINDNTDRKIYATRTLLFLLKDGTLRPIAIELSKPHPDG  484
             RIN  T  K YA+RTLLFL  DGTL+P+AIELS P+P G
Sbjct  501  ERIN-ATSVKGYASRTLLFLKNDGTLKPVAIELSVPNPGG  539



>gb|AAZ04411.1| lipoxygenase [Adelostemma gracillimum]
Length=863

 Score =   212 bits (540),  Expect = 5e-61, Method: Compositional matrix adjust.
 Identities = 99/154 (64%), Positives = 126/154 (82%), Gaps = 1/154 (1%)
 Frame = +2

Query  26   NTPLEMIKELLRSDGEKMFKFPTPQVIADNKTAWRTDEEFAREMLAGVNPVSISRLQMFP  205
            N PLE+I+E+ RSDGE   KFPTP +I ++K+AWRTDEEFAREMLAGV+P+ ISRLQ FP
Sbjct  331  NLPLELIREIFRSDGEGFLKFPTPAIIKEDKSAWRTDEEFAREMLAGVDPIIISRLQEFP  390

Query  206  QRSTLDPKVYGDHTCTITREDIADKLDGLTVEQAIESKRLFILDHHDAITLYARRINDNT  385
             +S LDPK+YG+ T TIT + + +K DGLT+++AI++ RL++LDHHD +  Y RRIN  T
Sbjct  391  PKSKLDPKLYGNQTSTITIDQVENKPDGLTIDEAIKTNRLYVLDHHDMLMPYVRRIN-TT  449

Query  386  DRKIYATRTLLFLLKDGTLRPIAIELSKPHPDGD  487
              KIYA+RTLLFL KDGTL+P+AIELS PHP+GD
Sbjct  450  STKIYASRTLLFLQKDGTLKPLAIELSLPHPNGD  483



>ref|XP_004230206.1| PREDICTED: lipoxygenase isoform X2 [Solanum lycopersicum]
Length=854

 Score =   212 bits (540),  Expect = 6e-61, Method: Compositional matrix adjust.
 Identities = 100/162 (62%), Positives = 126/162 (78%), Gaps = 0/162 (0%)
 Frame = +2

Query  2    PILEHIQKNTPLEMIKELLRSDGEKMFKFPTPQVIADNKTAWRTDEEFAREMLAGVNPVS  181
            P+L+ I    PLE++K++  SDGE +FKFPTPQVI ++KTAWR DEEF RE+LAG+NPV 
Sbjct  312  PLLKAITDTIPLEILKDVFHSDGEGLFKFPTPQVIQEDKTAWRMDEEFGREILAGINPVL  371

Query  182  ISRLQMFPQRSTLDPKVYGDHTCTITREDIADKLDGLTVEQAIESKRLFILDHHDAITLY  361
            I+RLQ FP +S LDP +YG+   TITRE I DKLDGLTV++AI++  LFIL+ HD I  Y
Sbjct  372  ITRLQEFPPKSNLDPNIYGNQNSTITREQIEDKLDGLTVDEAIKANMLFILNLHDIIMPY  431

Query  362  ARRINDNTDRKIYATRTLLFLLKDGTLRPIAIELSKPHPDGD  487
             R+IN  T+ + YA+RTLL L  +GTL+PIAIELS PHPDGD
Sbjct  432  LRKINTTTNTETYASRTLLLLQDNGTLKPIAIELSLPHPDGD  473



>ref|XP_010323952.1| PREDICTED: lipoxygenase isoform X3 [Solanum lycopersicum]
Length=853

 Score =   212 bits (540),  Expect = 6e-61, Method: Compositional matrix adjust.
 Identities = 100/162 (62%), Positives = 126/162 (78%), Gaps = 0/162 (0%)
 Frame = +2

Query  2    PILEHIQKNTPLEMIKELLRSDGEKMFKFPTPQVIADNKTAWRTDEEFAREMLAGVNPVS  181
            P+L+ I    PLE++K++  SDGE +FKFPTPQVI ++KTAWR DEEF RE+LAG+NPV 
Sbjct  311  PLLKAITDTIPLEILKDVFHSDGEGLFKFPTPQVIQEDKTAWRMDEEFGREILAGINPVL  370

Query  182  ISRLQMFPQRSTLDPKVYGDHTCTITREDIADKLDGLTVEQAIESKRLFILDHHDAITLY  361
            I+RLQ FP +S LDP +YG+   TITRE I DKLDGLTV++AI++  LFIL+ HD I  Y
Sbjct  371  ITRLQEFPPKSNLDPNIYGNQNSTITREQIEDKLDGLTVDEAIKANMLFILNLHDIIMPY  430

Query  362  ARRINDNTDRKIYATRTLLFLLKDGTLRPIAIELSKPHPDGD  487
             R+IN  T+ + YA+RTLL L  +GTL+PIAIELS PHPDGD
Sbjct  431  LRKINTTTNTETYASRTLLLLQDNGTLKPIAIELSLPHPDGD  472



>gb|AAK50778.4|AF361893_1 bacterial-induced lipoxygenase [Gossypium hirsutum]
Length=865

 Score =   212 bits (540),  Expect = 6e-61, Method: Compositional matrix adjust.
 Identities = 102/162 (63%), Positives = 124/162 (77%), Gaps = 1/162 (1%)
 Frame = +2

Query  2    PILEHIQKNTPLEMIKELLRSDGEKMFKFPTPQVIADNKTAWRTDEEFAREMLAGVNPVS  181
            P+L++I  N PLEM+KE+ R+DG ++ KFP PQVI D+KTAWRTDEEFAREMLAGVNPV 
Sbjct  325  PLLDNIINNIPLEMLKEIFRTDGAQLLKFPVPQVIQDSKTAWRTDEEFAREMLAGVNPVI  384

Query  182  ISRLQMFPQRSTLDPKVYGDHTCTITREDIADKLDGLTVEQAIESKRLFILDHHDAITLY  361
            I  LQ FP  S LDPKVYG+    IT+E I   L+GLTVE+A+ + RLFILDHHD++  Y
Sbjct  385  IRLLQEFPPTSNLDPKVYGNQNSAITKEHIEHNLEGLTVEEALRTNRLFILDHHDSLMPY  444

Query  362  ARRINDNTDRKIYATRTLLFLLKDGTLRPIAIELSKPHPDGD  487
             RRIN  T  K YA+RT+L L  DGTL+P+ IELS PHP+GD
Sbjct  445  LRRIN-TTTTKTYASRTILLLRNDGTLKPLVIELSLPHPNGD  485



>ref|XP_010323943.1| PREDICTED: lipoxygenase isoform X1 [Solanum lycopersicum]
Length=862

 Score =   212 bits (539),  Expect = 7e-61, Method: Compositional matrix adjust.
 Identities = 100/162 (62%), Positives = 126/162 (78%), Gaps = 0/162 (0%)
 Frame = +2

Query  2    PILEHIQKNTPLEMIKELLRSDGEKMFKFPTPQVIADNKTAWRTDEEFAREMLAGVNPVS  181
            P+L+ I    PLE++K++  SDGE +FKFPTPQVI ++KTAWR DEEF RE+LAG+NPV 
Sbjct  320  PLLKAITDTIPLEILKDVFHSDGEGLFKFPTPQVIQEDKTAWRMDEEFGREILAGINPVL  379

Query  182  ISRLQMFPQRSTLDPKVYGDHTCTITREDIADKLDGLTVEQAIESKRLFILDHHDAITLY  361
            I+RLQ FP +S LDP +YG+   TITRE I DKLDGLTV++AI++  LFIL+ HD I  Y
Sbjct  380  ITRLQEFPPKSNLDPNIYGNQNSTITREQIEDKLDGLTVDEAIKANMLFILNLHDIIMPY  439

Query  362  ARRINDNTDRKIYATRTLLFLLKDGTLRPIAIELSKPHPDGD  487
             R+IN  T+ + YA+RTLL L  +GTL+PIAIELS PHPDGD
Sbjct  440  LRKINTTTNTETYASRTLLLLQDNGTLKPIAIELSLPHPDGD  481



>ref|XP_009376681.1| PREDICTED: probable linoleate 9S-lipoxygenase 5 isoform X2 [Pyrus 
x bretschneideri]
Length=927

 Score =   212 bits (540),  Expect = 7e-61, Method: Compositional matrix adjust.
 Identities = 102/161 (63%), Positives = 125/161 (78%), Gaps = 1/161 (1%)
 Frame = +2

Query  5    ILEHIQKNTPLEMIKELLRSDGEKMFKFPTPQVIADNKTAWRTDEEFAREMLAGVNPVSI  184
            +L+ ++ N P+E IKEL R+DGEK  KFP PQVI ++K+AWRTDEEFAREMLAG+NPV+I
Sbjct  388  LLKSVRDNIPVETIKELFRTDGEKFLKFPVPQVIKEDKSAWRTDEEFAREMLAGINPVTI  447

Query  185  SRLQMFPQRSTLDPKVYGDHTCTITREDIADKLDGLTVEQAIESKRLFILDHHDAITLYA  364
             RLQ FP  S LD K YGD T  IT+E IA  L GL++++AI++ +LFILDHHD+I  Y 
Sbjct  448  RRLQEFPPASKLDQKAYGDQTSRITKEHIAHNLKGLSIDEAIDNNKLFILDHHDSIMPYL  507

Query  365  RRINDNTDRKIYATRTLLFLLKDGTLRPIAIELSKPHPDGD  487
            R IN  T  K YA+RTLLFL  DGTL+P+AIELS PHPDGD
Sbjct  508  RGIN-TTSTKTYASRTLLFLQDDGTLKPLAIELSLPHPDGD  547



>ref|XP_008246453.1| PREDICTED: probable linoleate 9S-lipoxygenase 5 [Prunus mume]
Length=947

 Score =   212 bits (540),  Expect = 7e-61, Method: Compositional matrix adjust.
 Identities = 100/161 (62%), Positives = 125/161 (78%), Gaps = 1/161 (1%)
 Frame = +2

Query  5    ILEHIQKNTPLEMIKELLRSDGEKMFKFPTPQVIADNKTAWRTDEEFAREMLAGVNPVSI  184
            +L+ I  N P EM+KE+ R+D  ++  FP PQVI ++K+AWRTDEEFAREMLAGVNPV+I
Sbjct  408  LLKDIGDNIPAEMLKEIFRTDSAQLLSFPMPQVIKEDKSAWRTDEEFAREMLAGVNPVNI  467

Query  185  SRLQMFPQRSTLDPKVYGDHTCTITREDIADKLDGLTVEQAIESKRLFILDHHDAITLYA  364
             RLQ FP  S LDPKVYGD T TIT +D+ + +DGL V++A +  +LFILDHHDA+  Y 
Sbjct  468  RRLQEFPPASKLDPKVYGDQTSTITEQDLGNTMDGLLVDEAFKQNKLFILDHHDALMPYL  527

Query  365  RRINDNTDRKIYATRTLLFLLKDGTLRPIAIELSKPHPDGD  487
            RRIN +T  KIYA+RT+LFL  DGTL+P+ IELS PHPDGD
Sbjct  528  RRIN-STSNKIYASRTVLFLKSDGTLKPLVIELSLPHPDGD  567



>ref|XP_009376680.1| PREDICTED: probable linoleate 9S-lipoxygenase 5 isoform X1 [Pyrus 
x bretschneideri]
Length=931

 Score =   212 bits (540),  Expect = 8e-61, Method: Compositional matrix adjust.
 Identities = 102/161 (63%), Positives = 125/161 (78%), Gaps = 1/161 (1%)
 Frame = +2

Query  5    ILEHIQKNTPLEMIKELLRSDGEKMFKFPTPQVIADNKTAWRTDEEFAREMLAGVNPVSI  184
            +L+ ++ N P+E IKEL R+DGEK  KFP PQVI ++K+AWRTDEEFAREMLAG+NPV+I
Sbjct  392  LLKSVRDNIPVETIKELFRTDGEKFLKFPVPQVIKEDKSAWRTDEEFAREMLAGINPVTI  451

Query  185  SRLQMFPQRSTLDPKVYGDHTCTITREDIADKLDGLTVEQAIESKRLFILDHHDAITLYA  364
             RLQ FP  S LD K YGD T  IT+E IA  L GL++++AI++ +LFILDHHD+I  Y 
Sbjct  452  RRLQEFPPASKLDQKAYGDQTSRITKEHIAHNLKGLSIDEAIDNNKLFILDHHDSIMPYL  511

Query  365  RRINDNTDRKIYATRTLLFLLKDGTLRPIAIELSKPHPDGD  487
            R IN  T  K YA+RTLLFL  DGTL+P+AIELS PHPDGD
Sbjct  512  RGIN-TTSTKTYASRTLLFLQDDGTLKPLAIELSLPHPDGD  551



>ref|XP_008388563.1| PREDICTED: probable linoleate 9S-lipoxygenase 5 [Malus domestica]
Length=912

 Score =   212 bits (539),  Expect = 8e-61, Method: Compositional matrix adjust.
 Identities = 101/161 (63%), Positives = 125/161 (78%), Gaps = 1/161 (1%)
 Frame = +2

Query  5    ILEHIQKNTPLEMIKELLRSDGEKMFKFPTPQVIADNKTAWRTDEEFAREMLAGVNPVSI  184
            +L HI  + P E  KE+ R+D  K+ KFP PQVI ++K+AWRTDEEFAREMLAGVNPV+I
Sbjct  413  LLXHIGDSIPSEXFKEIFRTDDAKLLKFPMPQVIKEDKSAWRTDEEFAREMLAGVNPVNI  472

Query  185  SRLQMFPQRSTLDPKVYGDHTCTITREDIADKLDGLTVEQAIESKRLFILDHHDAITLYA  364
             RLQ FP  S LDPKVYGD T TIT E I + LDGL+V++A+++ +LFILDHHD++  Y 
Sbjct  473  RRLQEFPPASKLDPKVYGDQTSTITEEHIKNNLDGLSVDEALKNNKLFILDHHDSLMPYL  532

Query  365  RRINDNTDRKIYATRTLLFLLKDGTLRPIAIELSKPHPDGD  487
            RRIN +T  KIY +RTLLFL  DGTL+P+ IELS PHP+GD
Sbjct  533  RRIN-STSNKIYGSRTLLFLQNDGTLKPLVIELSLPHPNGD  572



>gb|AGI16415.1| lipoxygenase [Malus domestica]
Length=868

 Score =   212 bits (539),  Expect = 8e-61, Method: Compositional matrix adjust.
 Identities = 104/161 (65%), Positives = 125/161 (78%), Gaps = 1/161 (1%)
 Frame = +2

Query  5    ILEHIQKNTPLEMIKELLRSDGEKMFKFPTPQVIADNKTAWRTDEEFAREMLAGVNPVSI  184
            IL++I  +TP E+ KEL R+DGEK  KFP PQVI ++K+AWRTDEEFARE+LAGVNPV+I
Sbjct  329  ILKYISDSTPGEIFKELFRTDGEKFLKFPVPQVIKEDKSAWRTDEEFARELLAGVNPVTI  388

Query  185  SRLQMFPQRSTLDPKVYGDHTCTITREDIADKLDGLTVEQAIESKRLFILDHHDAITLYA  364
             RLQ FP  S LD +VYGD T  IT+E I   L+GLT+++AI + +LFIL+HHDA   Y 
Sbjct  389  RRLQEFPPSSELDREVYGDQTSQITKEHIEHNLNGLTIDEAIMNNKLFILNHHDAWMPYL  448

Query  365  RRINDNTDRKIYATRTLLFLLKDGTLRPIAIELSKPHPDGD  487
            RRIN  T  K YA+RTLLFL  DGTL+PIAIELS PHPDGD
Sbjct  449  RRIN-TTSTKAYASRTLLFLNNDGTLKPIAIELSLPHPDGD  488



>ref|XP_011087404.1| PREDICTED: probable linoleate 9S-lipoxygenase 5 [Sesamum indicum]
Length=867

 Score =   212 bits (539),  Expect = 9e-61, Method: Compositional matrix adjust.
 Identities = 100/162 (62%), Positives = 130/162 (80%), Gaps = 1/162 (1%)
 Frame = +2

Query  2    PILEHIQKNTPLEMIKELLRSDGEKMFKFPTPQVIADNKTAWRTDEEFAREMLAGVNPVS  181
            P+L+ I  N PLE++K+LL SDGE +FKFP P+VI ++K+AWRTDEEFAREM+AG+NP+ 
Sbjct  327  PLLKSIYDNIPLELLKQLLPSDGEGLFKFPMPKVIQEDKSAWRTDEEFAREMVAGLNPMI  386

Query  182  ISRLQMFPQRSTLDPKVYGDHTCTITREDIADKLDGLTVEQAIESKRLFILDHHDAITLY  361
            ISRLQ FP  S LDP++YG+ T TI    I ++LDGLT+++AI++ RL+IL+HHD++  Y
Sbjct  387  ISRLQEFPPTSNLDPELYGNQTSTIAPHHIQNQLDGLTIDEAIKTNRLYILNHHDSLMPY  446

Query  362  ARRINDNTDRKIYATRTLLFLLKDGTLRPIAIELSKPHPDGD  487
             RRIN  T  K YA+RTLLFL  DG LRP+AIELS+PHPDGD
Sbjct  447  LRRIN-TTTTKTYASRTLLFLQNDGRLRPLAIELSQPHPDGD  487



>gb|ABZ05753.1| lipoxygenase [Prunus armeniaca]
Length=603

 Score =   209 bits (532),  Expect = 9e-61, Method: Compositional matrix adjust.
 Identities = 102/161 (63%), Positives = 123/161 (76%), Gaps = 1/161 (1%)
 Frame = +2

Query  5    ILEHIQKNTPLEMIKELLRSDGEKMFKFPTPQVIADNKTAWRTDEEFAREMLAGVNPVSI  184
            IL++I+ +   E+ KEL R+DG K  KFP PQVI DNK+AWRTDEEFAREMLAGVNPV+I
Sbjct  64   ILKYIRDSIYEELFKELFRTDGGKFLKFPVPQVIQDNKSAWRTDEEFAREMLAGVNPVAI  123

Query  185  SRLQMFPQRSTLDPKVYGDHTCTITREDIADKLDGLTVEQAIESKRLFILDHHDAITLYA  364
             RLQ FP  S LD K YGD T  IT+E I   L GL++++AI++ +LFILDHHDA+  Y 
Sbjct  124  RRLQEFPPASKLDQKAYGDQTSQITKEHIEHNLKGLSIDEAIKNNKLFILDHHDALMPYL  183

Query  365  RRINDNTDRKIYATRTLLFLLKDGTLRPIAIELSKPHPDGD  487
            RRIN  T  K Y++RTLLFL  DGTL+P+AIELS PHPDGD
Sbjct  184  RRIN-TTSTKTYSSRTLLFLENDGTLKPLAIELSLPHPDGD  223



>gb|AAP83135.1| lipoxygenase [Nicotiana attenuata]
Length=861

 Score =   212 bits (539),  Expect = 9e-61, Method: Compositional matrix adjust.
 Identities = 103/162 (64%), Positives = 126/162 (78%), Gaps = 1/162 (1%)
 Frame = +2

Query  2    PILEHIQKNTPLEMIKELLRSDGEKMFKFPTPQVIADNKTAWRTDEEFAREMLAGVNPVS  181
            P+ + +  + PLEM+KELLR+DGE + KFPTP VI ++KTAWRTDEEF REMLAGVNPV 
Sbjct  321  PLFKALISSIPLEMVKELLRTDGEGIMKFPTPLVIKEDKTAWRTDEEFGREMLAGVNPVI  380

Query  182  ISRLQMFPQRSTLDPKVYGDHTCTITREDIADKLDGLTVEQAIESKRLFILDHHDAITLY  361
            I  LQ FP +S LDP+VYG+   TIT + I D+LDGLT+++AI+S RLFIL+HHD I  Y
Sbjct  381  IRNLQEFPPKSKLDPQVYGNQDSTITIQHIEDRLDGLTIDEAIKSNRLFILNHHDTIMPY  440

Query  362  ARRINDNTDRKIYATRTLLFLLKDGTLRPIAIELSKPHPDGD  487
             RRIN  T  K YA+RTLLFL  +G L+P+AIELS PHPDGD
Sbjct  441  LRRIN-TTTTKTYASRTLLFLQDNGCLKPLAIELSLPHPDGD  481



>ref|XP_011023611.1| PREDICTED: probable linoleate 9S-lipoxygenase 5 [Populus euphratica]
Length=861

 Score =   211 bits (538),  Expect = 9e-61, Method: Compositional matrix adjust.
 Identities = 100/162 (62%), Positives = 126/162 (78%), Gaps = 1/162 (1%)
 Frame = +2

Query  2    PILEHIQKNTPLEMIKELLRSDGEKMFKFPTPQVIADNKTAWRTDEEFAREMLAGVNPVS  181
            P+L++I+KN PLE ++E+ R+DGE+ F+FP PQVI DN +AWRTDEEF REMLAGVNPV 
Sbjct  321  PLLDNIRKNFPLEFLEEIFRTDGERFFEFPKPQVIKDNHSAWRTDEEFGREMLAGVNPVL  380

Query  182  ISRLQMFPQRSTLDPKVYGDHTCTITREDIADKLDGLTVEQAIESKRLFILDHHDAITLY  361
            I RL+ FP +S L+ ++YGD    IT E I + LDGLT+++AI + R+FILDHHDA+  Y
Sbjct  381  IRRLEEFPPKSKLNTELYGDQNSKITEEHIQNSLDGLTIDEAIRNNRMFILDHHDALMPY  440

Query  362  ARRINDNTDRKIYATRTLLFLLKDGTLRPIAIELSKPHPDGD  487
             RRIN  T  K YATRTLLFL  DGTL+P+AIELS PH +GD
Sbjct  441  LRRIN-TTSTKTYATRTLLFLKDDGTLKPLAIELSSPHEEGD  481



>gb|AAP83134.1| lipoxygenase [Nicotiana attenuata]
 gb|AAP83136.1| lipoxygenase [Nicotiana attenuata]
Length=861

 Score =   211 bits (538),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 103/162 (64%), Positives = 126/162 (78%), Gaps = 1/162 (1%)
 Frame = +2

Query  2    PILEHIQKNTPLEMIKELLRSDGEKMFKFPTPQVIADNKTAWRTDEEFAREMLAGVNPVS  181
            P+ + +  + PLEM+KELLR+DGE + KFPTP VI ++KTAWRTDEEF REMLAGVNPV 
Sbjct  321  PLFKALISSIPLEMVKELLRTDGEGIMKFPTPLVIKEDKTAWRTDEEFGREMLAGVNPVI  380

Query  182  ISRLQMFPQRSTLDPKVYGDHTCTITREDIADKLDGLTVEQAIESKRLFILDHHDAITLY  361
            I  LQ FP +S LDP+VYG+   TIT + I D+LDGLT+++AI+S RLFIL+HHD I  Y
Sbjct  381  IRNLQEFPPKSKLDPQVYGNQDSTITIQHIEDRLDGLTIDEAIKSNRLFILNHHDTIMPY  440

Query  362  ARRINDNTDRKIYATRTLLFLLKDGTLRPIAIELSKPHPDGD  487
             RRIN  T  K YA+RTLLFL  +G L+P+AIELS PHPDGD
Sbjct  441  LRRIN-TTTTKTYASRTLLFLQDNGCLKPLAIELSLPHPDGD  481



>gb|AGI16414.1| lipoxygenase [Malus domestica]
Length=868

 Score =   211 bits (538),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 104/161 (65%), Positives = 125/161 (78%), Gaps = 1/161 (1%)
 Frame = +2

Query  5    ILEHIQKNTPLEMIKELLRSDGEKMFKFPTPQVIADNKTAWRTDEEFAREMLAGVNPVSI  184
            IL++I  +TP E+ KEL R+DGEK  KFP PQVI ++K+AWRTDEEFARE+LAGVNPV+I
Sbjct  329  ILKYISDSTPGEIFKELFRTDGEKFLKFPVPQVIKEDKSAWRTDEEFARELLAGVNPVTI  388

Query  185  SRLQMFPQRSTLDPKVYGDHTCTITREDIADKLDGLTVEQAIESKRLFILDHHDAITLYA  364
             RLQ FP  S LD +VYGD T  IT+E I   L+GLT+++AI + +LFIL+HHDA   Y 
Sbjct  389  RRLQEFPPSSELDREVYGDQTSQITKEHIEHNLNGLTIDEAIMNNKLFILNHHDAWMPYL  448

Query  365  RRINDNTDRKIYATRTLLFLLKDGTLRPIAIELSKPHPDGD  487
            RRIN  T  K YA+RTLLFL  DGTL+PIAIELS PHPDGD
Sbjct  449  RRIN-RTSTKAYASRTLLFLNNDGTLKPIAIELSLPHPDGD  488



>ref|NP_001281022.1| probable linoleate 9S-lipoxygenase 5 [Malus domestica]
 gb|AGI16411.1| lipoxygenase [Malus domestica]
 gb|AGI16412.1| lipoxygenase [Malus domestica]
 gb|AGK82792.1| lipoxygenase [Malus domestica]
Length=868

 Score =   211 bits (538),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 104/161 (65%), Positives = 125/161 (78%), Gaps = 1/161 (1%)
 Frame = +2

Query  5    ILEHIQKNTPLEMIKELLRSDGEKMFKFPTPQVIADNKTAWRTDEEFAREMLAGVNPVSI  184
            IL++I  +TP E+ KEL R+DGEK  KFP PQVI ++K+AWRTDEEFARE+LAGVNPV+I
Sbjct  329  ILKYISDSTPGEIFKELFRTDGEKFLKFPVPQVIKEDKSAWRTDEEFARELLAGVNPVTI  388

Query  185  SRLQMFPQRSTLDPKVYGDHTCTITREDIADKLDGLTVEQAIESKRLFILDHHDAITLYA  364
             RLQ FP  S LD +VYGD T  IT+E I   L+GLT+++AI + +LFIL+HHDA   Y 
Sbjct  389  RRLQEFPPSSELDREVYGDQTSQITKEHIEHNLNGLTIDEAIMNNKLFILNHHDAWMPYL  448

Query  365  RRINDNTDRKIYATRTLLFLLKDGTLRPIAIELSKPHPDGD  487
            RRIN  T  K YA+RTLLFL  DGTL+PIAIELS PHPDGD
Sbjct  449  RRIN-TTSTKAYASRTLLFLNNDGTLKPIAIELSLPHPDGD  488



>gb|AGI16413.1| lipoxygenase [Malus domestica]
Length=868

 Score =   211 bits (538),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 104/161 (65%), Positives = 125/161 (78%), Gaps = 1/161 (1%)
 Frame = +2

Query  5    ILEHIQKNTPLEMIKELLRSDGEKMFKFPTPQVIADNKTAWRTDEEFAREMLAGVNPVSI  184
            IL++I  +TP E+ KEL R+DGEK  KFP PQVI ++K+AWRTDEEFARE+LAGVNPV+I
Sbjct  329  ILKYISDSTPGEIFKELFRTDGEKFLKFPVPQVIKEDKSAWRTDEEFARELLAGVNPVTI  388

Query  185  SRLQMFPQRSTLDPKVYGDHTCTITREDIADKLDGLTVEQAIESKRLFILDHHDAITLYA  364
             RLQ FP  S LD +VYGD T  IT+E I   L+GLT+++AI + +LFIL+HHDA   Y 
Sbjct  389  RRLQEFPPSSELDREVYGDQTSQITKEHIEHNLNGLTIDEAIMNNKLFILNHHDAWMPYL  448

Query  365  RRINDNTDRKIYATRTLLFLLKDGTLRPIAIELSKPHPDGD  487
            RRIN  T  K YA+RTLLFL  DGTL+PIAIELS PHPDGD
Sbjct  449  RRIN-RTSTKAYASRTLLFLNNDGTLKPIAIELSLPHPDGD  488



>gb|AGI16382.1| lipoxygenase [Malus domestica]
Length=863

 Score =   211 bits (537),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 102/161 (63%), Positives = 125/161 (78%), Gaps = 1/161 (1%)
 Frame = +2

Query  5    ILEHIQKNTPLEMIKELLRSDGEKMFKFPTPQVIADNKTAWRTDEEFAREMLAGVNPVSI  184
            + + I  N P EM+KE+ R+DG +  +FPTP+VI  +KTAWRTDEEFAREMLAGVNPV+I
Sbjct  324  LFKEIGDNIPAEMLKEIFRTDGAQFLRFPTPEVIKVDKTAWRTDEEFAREMLAGVNPVNI  383

Query  185  SRLQMFPQRSTLDPKVYGDHTCTITREDIADKLDGLTVEQAIESKRLFILDHHDAITLYA  364
              LQ FP  S LDPKVYGD T TIT + I + LDGLTV++A+++K+LFILDHHDA+  Y 
Sbjct  384  RLLQEFPPASKLDPKVYGDQTSTITEQHIKNNLDGLTVDEALKNKKLFILDHHDALMPYL  443

Query  365  RRINDNTDRKIYATRTLLFLLKDGTLRPIAIELSKPHPDGD  487
            RRIN +T  KIY +RTLLFL  DGTL+ + IELS PHPDGD
Sbjct  444  RRIN-STSNKIYGSRTLLFLKSDGTLKILVIELSLPHPDGD  483



>ref|XP_011023610.1| PREDICTED: probable linoleate 9S-lipoxygenase 5 [Populus euphratica]
Length=871

 Score =   211 bits (537),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 100/162 (62%), Positives = 125/162 (77%), Gaps = 1/162 (1%)
 Frame = +2

Query  2    PILEHIQKNTPLEMIKELLRSDGEKMFKFPTPQVIADNKTAWRTDEEFAREMLAGVNPVS  181
            P+L++++KN PLEM+KE+ R+DGE +F+FP PQVI DN +AWRTDEEF REMLAGVNPV 
Sbjct  331  PLLDNLRKNIPLEMLKEIFRTDGENLFQFPKPQVIQDNHSAWRTDEEFGREMLAGVNPVI  390

Query  182  ISRLQMFPQRSTLDPKVYGDHTCTITREDIADKLDGLTVEQAIESKRLFILDHHDAITLY  361
            I RL+ FP +S L+ K YGD   +IT E I D LDGLT+++AI++ R+FILDHHD +  Y
Sbjct  391  IRRLEKFPPKSKLNSKQYGDQNSSITEEHIKDNLDGLTIDEAIKNNRMFILDHHDELMPY  450

Query  362  ARRINDNTDRKIYATRTLLFLLKDGTLRPIAIELSKPHPDGD  487
             RRIN  T  K YA+RTLLFL  DGTL+P+ IELS PH  GD
Sbjct  451  LRRIN-TTTTKTYASRTLLFLKDDGTLKPLVIELSLPHDKGD  491



>ref|XP_008801705.1| PREDICTED: probable linoleate 9S-lipoxygenase 4 [Phoenix dactylifera]
Length=867

 Score =   211 bits (537),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 102/162 (63%), Positives = 124/162 (77%), Gaps = 1/162 (1%)
 Frame = +2

Query  2    PILEHIQKNTPLEMIKELLRSDGEKMFKFPTPQVIADNKTAWRTDEEFAREMLAGVNPVS  181
            P L+ I+   P EMIKEL+RSDGE++ K P PQVI ++K AWRTDEEF REMLAG+NPV 
Sbjct  322  PELDEIRDRIPFEMIKELIRSDGEQVLKLPLPQVIKEDKYAWRTDEEFGREMLAGLNPVM  381

Query  182  ISRLQMFPQRSTLDPKVYGDHTCTITREDIADKLDGLTVEQAIESKRLFILDHHDAITLY  361
            I RL  FP  S LDPK YGDHT +IT   I   L+GLTV+QA++S RLFILDHHDA+  Y
Sbjct  382  IRRLGEFPPTSKLDPKTYGDHTSSITAAQIEKNLEGLTVDQALKSNRLFILDHHDALIPY  441

Query  362  ARRINDNTDRKIYATRTLLFLLKDGTLRPIAIELSKPHPDGD  487
              R+N +T  K+YA+RT+LFL  DGTL+P+AIELS PHPDG+
Sbjct  442  LNRVN-STSNKVYASRTILFLKDDGTLKPLAIELSLPHPDGE  482



>emb|CAD10740.1| lipoxygenase [Corylus avellana]
Length=873

 Score =   211 bits (537),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 98/161 (61%), Positives = 128/161 (80%), Gaps = 1/161 (1%)
 Frame = +2

Query  5    ILEHIQKNTPLEMIKELLRSDGEKMFKFPTPQVIADNKTAWRTDEEFAREMLAGVNPVSI  184
            +L++I+++ P EM+KE+  ++GE + K+P PQVI ++K+AWRTDEEF REMLAGVNPV+I
Sbjct  334  LLQNIREDIPAEMLKEIFPTEGEGLLKYPMPQVIKEDKSAWRTDEEFGREMLAGVNPVNI  393

Query  185  SRLQMFPQRSTLDPKVYGDHTCTITREDIADKLDGLTVEQAIESKRLFILDHHDAITLYA  364
             RLQ FP  S LDPKVYGD   TIT+E I + +DGL++++AI  K+LFILDHHDAI  Y 
Sbjct  394  RRLQEFPPASKLDPKVYGDQASTITKEHIENNIDGLSIDEAINKKKLFILDHHDAIMPYL  453

Query  365  RRINDNTDRKIYATRTLLFLLKDGTLRPIAIELSKPHPDGD  487
            RRIN +T  K YA+RT+LFL  DGTL+P+ IELS PHP+GD
Sbjct  454  RRIN-STSTKTYASRTILFLKNDGTLKPLVIELSLPHPEGD  493



>ref|XP_010094672.1| putative linoleate 9S-lipoxygenase 5 [Morus notabilis]
 gb|EXB56580.1| putative linoleate 9S-lipoxygenase 5 [Morus notabilis]
Length=792

 Score =   211 bits (536),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 101/161 (63%), Positives = 129/161 (80%), Gaps = 1/161 (1%)
 Frame = +2

Query  5    ILEHIQKNTPLEMIKELLRSDGEKMFKFPTPQVIADNKTAWRTDEEFAREMLAGVNPVSI  184
            +L+ I+ +TP E+IKE+ R+DGE++ KFP PQVI ++KTAW TDEEFAREMLAG+NPV I
Sbjct  253  LLKSIRDSTPAEIIKEIFRTDGERLLKFPVPQVIKEDKTAWSTDEEFAREMLAGINPVMI  312

Query  185  SRLQMFPQRSTLDPKVYGDHTCTITREDIADKLDGLTVEQAIESKRLFILDHHDAITLYA  364
              LQ FP  S LDPKVYGDHT TIT+E I   L+GL+V++AI++ +LFILDHHD +  + 
Sbjct  313  RCLQQFPPTSKLDPKVYGDHTSTITKEHIEHNLNGLSVDEAIKNSKLFILDHHDTLMPFL  372

Query  365  RRINDNTDRKIYATRTLLFLLKDGTLRPIAIELSKPHPDGD  487
            RRIN +T  KIYA+RT+L L +DGTL+P+AIELS PHP GD
Sbjct  373  RRIN-STSTKIYASRTILSLQEDGTLKPLAIELSLPHPRGD  412



>ref|XP_007208174.1| hypothetical protein PRUPE_ppa001016mg [Prunus persica]
 gb|EMJ09373.1| hypothetical protein PRUPE_ppa001016mg [Prunus persica]
Length=933

 Score =   211 bits (537),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 102/161 (63%), Positives = 123/161 (76%), Gaps = 1/161 (1%)
 Frame = +2

Query  5    ILEHIQKNTPLEMIKELLRSDGEKMFKFPTPQVIADNKTAWRTDEEFAREMLAGVNPVSI  184
            IL+ ++ N P E IKEL R+DGEK  KFP PQVI  +K+AW+TDEEFAREMLAG+NPV I
Sbjct  394  ILKSVRDNIPAETIKELFRTDGEKFLKFPVPQVIKVDKSAWKTDEEFAREMLAGINPVVI  453

Query  185  SRLQMFPQRSTLDPKVYGDHTCTITREDIADKLDGLTVEQAIESKRLFILDHHDAITLYA  364
             RLQ FP  S LD  +YGD T  IT+E I   LDGL++++AI++K+LFILDHHDA+  Y 
Sbjct  454  RRLQEFPPASKLDQNIYGDQTSQITKEHIGHNLDGLSIDEAIKNKKLFILDHHDALMPYL  513

Query  365  RRINDNTDRKIYATRTLLFLLKDGTLRPIAIELSKPHPDGD  487
            RRIN  T  K YA+RTLLFL  DGTL+P+AIELS PHP GD
Sbjct  514  RRIN-TTSTKTYASRTLLFLENDGTLKPLAIELSLPHPGGD  553



>ref|XP_009787604.1| PREDICTED: linoleate 9S-lipoxygenase 6 [Nicotiana sylvestris]
Length=861

 Score =   211 bits (536),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 102/162 (63%), Positives = 126/162 (78%), Gaps = 1/162 (1%)
 Frame = +2

Query  2    PILEHIQKNTPLEMIKELLRSDGEKMFKFPTPQVIADNKTAWRTDEEFAREMLAGVNPVS  181
            P+ + +  + PLEM+KELLR+DGE + KFPTP VI ++KTAWRTDEEF REMLAGVNPV 
Sbjct  321  PLFKALISSIPLEMVKELLRTDGEGIMKFPTPLVIKEDKTAWRTDEEFGREMLAGVNPVI  380

Query  182  ISRLQMFPQRSTLDPKVYGDHTCTITREDIADKLDGLTVEQAIESKRLFILDHHDAITLY  361
            I  LQ FP +S LDP+VYG+   TIT + I D+LDGLT+++AI+S RLFIL+HHD I  Y
Sbjct  381  IRNLQEFPPKSKLDPQVYGNQDSTITIQHIEDRLDGLTIDEAIKSNRLFILNHHDTIMPY  440

Query  362  ARRINDNTDRKIYATRTLLFLLKDGTLRPIAIELSKPHPDGD  487
             RRIN  T  K YA+RTLLF   +G+L+P+AIELS PHPDGD
Sbjct  441  LRRINATT-TKTYASRTLLFFQDNGSLKPLAIELSLPHPDGD  481



>ref|XP_010414944.1| PREDICTED: linoleate 9S-lipoxygenase 1-like [Camelina sativa]
Length=860

 Score =   211 bits (536),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 101/161 (63%), Positives = 124/161 (77%), Gaps = 1/161 (1%)
 Frame = +2

Query  5    ILEHIQKNTPLEMIKELLRSDGEKMFKFPTPQVIADNKTAWRTDEEFAREMLAGVNPVSI  184
            +++ I KN PLEM+KE+ R+DG+K  K+P PQVI ++KTAWRTDEEFAREMLAG+NPV I
Sbjct  321  LIDSIVKNIPLEMLKEIFRTDGQKFLKYPVPQVIKEDKTAWRTDEEFAREMLAGLNPVVI  380

Query  185  SRLQMFPQRSTLDPKVYGDHTCTITREDIADKLDGLTVEQAIESKRLFILDHHDAITLYA  364
              LQ FP +S LD ++YG+   TIT+  I   LDGLTVE+A+E +RLFILDHHD +  Y 
Sbjct  381  QLLQEFPPKSKLDSELYGNQNSTITKSHIEKSLDGLTVEEALEKERLFILDHHDTLMPYL  440

Query  365  RRINDNTDRKIYATRTLLFLLKDGTLRPIAIELSKPHPDGD  487
            RRIN  T  K YA+RTLLFL  DGTL+P+ IELS PHPDGD
Sbjct  441  RRIN-TTTTKTYASRTLLFLKDDGTLKPLVIELSLPHPDGD  480



>gb|ACH91370.1| lipoxygenase LOX-3 [Prunus persica]
Length=933

 Score =   211 bits (536),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 102/161 (63%), Positives = 123/161 (76%), Gaps = 1/161 (1%)
 Frame = +2

Query  5    ILEHIQKNTPLEMIKELLRSDGEKMFKFPTPQVIADNKTAWRTDEEFAREMLAGVNPVSI  184
            IL+ ++ N P E IKEL R+DGEK  KFP PQVI  +K+AW+TDEEFAREMLAG+NPV I
Sbjct  394  ILKSVRDNIPAETIKELFRTDGEKFLKFPVPQVIKVDKSAWKTDEEFAREMLAGINPVVI  453

Query  185  SRLQMFPQRSTLDPKVYGDHTCTITREDIADKLDGLTVEQAIESKRLFILDHHDAITLYA  364
             RLQ FP  S LD  +YGD T  IT+E I   LDGL++++AI++K+LFILDHHDA+  Y 
Sbjct  454  RRLQEFPPASKLDQNIYGDQTSQITKEHIGHNLDGLSIDEAIKNKKLFILDHHDALMPYL  513

Query  365  RRINDNTDRKIYATRTLLFLLKDGTLRPIAIELSKPHPDGD  487
            RRIN  T  K YA+RTLLFL  DGTL+P+AIELS PHP GD
Sbjct  514  RRIN-TTSTKTYASRTLLFLENDGTLKPLAIELSLPHPGGD  553



>ref|XP_006382594.1| hypothetical protein POPTR_0005s03560g [Populus trichocarpa]
 gb|ERP60391.1| hypothetical protein POPTR_0005s03560g [Populus trichocarpa]
Length=866

 Score =   211 bits (536),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 99/162 (61%), Positives = 126/162 (78%), Gaps = 1/162 (1%)
 Frame = +2

Query  2    PILEHIQKNTPLEMIKELLRSDGEKMFKFPTPQVIADNKTAWRTDEEFAREMLAGVNPVS  181
            P+LE++ KN P+EM+KE++ +DGE +F+FP PQVI ++ +AWRTDEEF REML+GVNPV 
Sbjct  326  PLLENLTKNIPVEMLKEIIPTDGEGLFRFPKPQVIQESNSAWRTDEEFGREMLSGVNPVI  385

Query  182  ISRLQMFPQRSTLDPKVYGDHTCTITREDIADKLDGLTVEQAIESKRLFILDHHDAITLY  361
            I RL+ FP +S LD K+YGD   TIT E I D LDGL++++AIE  R+FILDHHDA+  Y
Sbjct  386  IRRLEEFPPKSKLDSKLYGDQNSTITEEHIKDSLDGLSIDEAIEKNRMFILDHHDALMPY  445

Query  362  ARRINDNTDRKIYATRTLLFLLKDGTLRPIAIELSKPHPDGD  487
             RRIN  T  K YA+RTLLFL  DGTL+P+ IELS PH +GD
Sbjct  446  LRRIN-TTTTKTYASRTLLFLKDDGTLKPLVIELSLPHEEGD  486



>emb|CBI16430.3| unnamed protein product [Vitis vinifera]
Length=335

 Score =   201 bits (512),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 99/160 (62%), Positives = 124/160 (78%), Gaps = 1/160 (1%)
 Frame = +2

Query  5    ILEHIQKNTPLEMIKELLRSDGEKMFKFPTPQVIADNKTAWRTDEEFAREMLAGVNPVSI  184
            +L+ I+ N PLEM+KEL+R+DGE +FKFP PQVI ++K+AWRTDEEFAREMLAG+NPV I
Sbjct  168  LLDKIKDNIPLEMLKELVRTDGEHLFKFPMPQVIKEDKSAWRTDEEFAREMLAGLNPVVI  227

Query  185  SRLQMFPQRSTLDPKVYGDHTCTITREDIADKLDGLTVEQAIESKRLFILDHHDAITLYA  364
              LQ FP +S LD +VYG+   +IT+E I + LDGLT+ +A++ KRLFILD HD    Y 
Sbjct  228  RLLQEFPPKSKLDLEVYGNQNSSITKEHIENHLDGLTINKAMKKKRLFILDDHDVFMPYR  287

Query  365  RRINDNTDRKIYATRTLLFLLKDGTLRPIAIELSKPHPDG  484
            RRIN  T  K YA+RTLLFL  D TL+P+AIELS PHP+G
Sbjct  288  RRIN-TTSMKTYASRTLLFLKDDRTLKPLAIELSLPHPNG  326



>ref|XP_008388961.1| PREDICTED: probable linoleate 9S-lipoxygenase 5 [Malus domestica]
Length=922

 Score =   210 bits (535),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 104/161 (65%), Positives = 124/161 (77%), Gaps = 1/161 (1%)
 Frame = +2

Query  5    ILEHIQKNTPLEMIKELLRSDGEKMFKFPTPQVIADNKTAWRTDEEFAREMLAGVNPVSI  184
            IL+HI  + P EM KEL R+DGEK  KFP PQVI ++K+AWRTDEEFARE+LAGVNPV+I
Sbjct  383  ILKHISDSIPEEMFKELFRTDGEKFLKFPVPQVIKEDKSAWRTDEEFARELLAGVNPVTI  442

Query  185  SRLQMFPQRSTLDPKVYGDHTCTITREDIADKLDGLTVEQAIESKRLFILDHHDAITLYA  364
             RLQ FP  S LD + YGD T  IT+E I   L+GL++++AI++K+LFILDHHDA   Y 
Sbjct  443  RRLQEFPPASKLDREAYGDQTSQITKEHIEHNLNGLSIDEAIKNKQLFILDHHDAWMPYL  502

Query  365  RRINDNTDRKIYATRTLLFLLKDGTLRPIAIELSKPHPDGD  487
            RRIN  T  K YA+RTLLFL  DGTL+PIAIELS PH DGD
Sbjct  503  RRIN-TTSTKAYASRTLLFLKNDGTLKPIAIELSLPHLDGD  542



>ref|XP_007030817.1| Lipoxygenase 1 [Theobroma cacao]
 gb|EOY11319.1| Lipoxygenase 1 [Theobroma cacao]
Length=866

 Score =   210 bits (534),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 99/162 (61%), Positives = 126/162 (78%), Gaps = 1/162 (1%)
 Frame = +2

Query  2    PILEHIQKNTPLEMIKELLRSDGEKMFKFPTPQVIADNKTAWRTDEEFAREMLAGVNPVS  181
            P+L++I KN PLEM+KE+ R+DGE++ KFP PQVI +++TAWRTDEEFAREMLAGV+PV 
Sbjct  326  PLLDNIIKNIPLEMLKEIFRTDGEQLLKFPVPQVIQNSRTAWRTDEEFAREMLAGVDPVI  385

Query  182  ISRLQMFPQRSTLDPKVYGDHTCTITREDIADKLDGLTVEQAIESKRLFILDHHDAITLY  361
            I  L+ FP  S LDPKVYG+    IT+E I   L+GLT+E+A+ + RLFILDHHD +  Y
Sbjct  386  IRLLEEFPPTSKLDPKVYGNQNSAITKEHIEHNLEGLTIEEALRTNRLFILDHHDTLMPY  445

Query  362  ARRINDNTDRKIYATRTLLFLLKDGTLRPIAIELSKPHPDGD  487
             RR+N  T  K YA+RT+L L  DGTL+P+AIELS PHP+GD
Sbjct  446  LRRVNSTT-TKTYASRTVLLLRNDGTLKPLAIELSLPHPNGD  486



>ref|XP_010025195.1| PREDICTED: probable linoleate 9S-lipoxygenase 5 [Eucalyptus grandis]
 gb|KCW61798.1| hypothetical protein EUGRSUZ_H04496 [Eucalyptus grandis]
Length=871

 Score =   210 bits (534),  Expect = 4e-60, Method: Compositional matrix adjust.
 Identities = 102/162 (63%), Positives = 127/162 (78%), Gaps = 1/162 (1%)
 Frame = +2

Query  2    PILEHIQKNTPLEMIKELLRSDGEKMFKFPTPQVIADNKTAWRTDEEFAREMLAGVNPVS  181
            P+LE ++++ PLEM+KEL+R+DGE + ++P PQVI ++KTAWRTD EF REMLAGVNPV 
Sbjct  331  PLLESLKEHIPLEMLKELVRTDGEGLLEYPMPQVIKEDKTAWRTDLEFGREMLAGVNPVV  390

Query  182  ISRLQMFPQRSTLDPKVYGDHTCTITREDIADKLDGLTVEQAIESKRLFILDHHDAITLY  361
            I RL+ FP  S LDPK+YG+   ++  E I  +L+GLTVEQAI+  RLFILDHHD I  Y
Sbjct  391  IRRLEEFPPASKLDPKIYGNQRSSLREELIQKQLNGLTVEQAIKMNRLFILDHHDTIMPY  450

Query  362  ARRINDNTDRKIYATRTLLFLLKDGTLRPIAIELSKPHPDGD  487
             RRIN  T  K+YATRTLLFL  DGTL+P+AIELS PHP+GD
Sbjct  451  LRRIN-MTATKMYATRTLLFLKDDGTLKPLAIELSMPHPEGD  491



>ref|XP_011026284.1| PREDICTED: probable linoleate 9S-lipoxygenase 5 isoform X1 [Populus 
euphratica]
Length=881

 Score =   210 bits (534),  Expect = 4e-60, Method: Compositional matrix adjust.
 Identities = 103/162 (64%), Positives = 125/162 (77%), Gaps = 1/162 (1%)
 Frame = +2

Query  2    PILEHIQKNTPLEMIKELLRSDGEKMFKFPTPQVIADNKTAWRTDEEFAREMLAGVNPVS  181
            P +  I+ + P EM+KEL+R+DGE++FKFP P VI  +K+AWRTDEEFAREMLAGVNPV 
Sbjct  336  PTISKIRDHIPWEMLKELVRNDGERLFKFPKPDVIKADKSAWRTDEEFAREMLAGVNPVI  395

Query  182  ISRLQMFPQRSTLDPKVYGDHTCTITREDIADKLDGLTVEQAIESKRLFILDHHDAITLY  361
            ISRLQ FP  S LDPKVYG+   +I +E I + +DGLTV QAI+  RLFILDHHDA+  Y
Sbjct  396  ISRLQDFPPASKLDPKVYGNQNSSIRKELIEENMDGLTVVQAIKRNRLFILDHHDALMPY  455

Query  362  ARRINDNTDRKIYATRTLLFLLKDGTLRPIAIELSKPHPDGD  487
             RRIN +T  K YA+RT+L L  DGTL+P+AIELS PHP GD
Sbjct  456  LRRIN-STSTKTYASRTILLLQDDGTLKPLAIELSLPHPQGD  496



>ref|XP_011026291.1| PREDICTED: probable linoleate 9S-lipoxygenase 5 isoform X2 [Populus 
euphratica]
Length=880

 Score =   210 bits (534),  Expect = 4e-60, Method: Compositional matrix adjust.
 Identities = 103/162 (64%), Positives = 125/162 (77%), Gaps = 1/162 (1%)
 Frame = +2

Query  2    PILEHIQKNTPLEMIKELLRSDGEKMFKFPTPQVIADNKTAWRTDEEFAREMLAGVNPVS  181
            P +  I+ + P EM+KEL+R+DGE++FKFP P VI  +K+AWRTDEEFAREMLAGVNPV 
Sbjct  335  PTISKIRDHIPWEMLKELVRNDGERLFKFPKPDVIKADKSAWRTDEEFAREMLAGVNPVI  394

Query  182  ISRLQMFPQRSTLDPKVYGDHTCTITREDIADKLDGLTVEQAIESKRLFILDHHDAITLY  361
            ISRLQ FP  S LDPKVYG+   +I +E I + +DGLTV QAI+  RLFILDHHDA+  Y
Sbjct  395  ISRLQDFPPASKLDPKVYGNQNSSIRKELIEENMDGLTVVQAIKRNRLFILDHHDALMPY  454

Query  362  ARRINDNTDRKIYATRTLLFLLKDGTLRPIAIELSKPHPDGD  487
             RRIN +T  K YA+RT+L L  DGTL+P+AIELS PHP GD
Sbjct  455  LRRIN-STSTKTYASRTILLLQDDGTLKPLAIELSLPHPQGD  495



>gb|AGI16416.1| lipoxygenase [Malus domestica]
Length=868

 Score =   210 bits (534),  Expect = 4e-60, Method: Compositional matrix adjust.
 Identities = 103/161 (64%), Positives = 124/161 (77%), Gaps = 1/161 (1%)
 Frame = +2

Query  5    ILEHIQKNTPLEMIKELLRSDGEKMFKFPTPQVIADNKTAWRTDEEFAREMLAGVNPVSI  184
            IL++I  +TP E+ KEL R+DGEK  KFP PQVI ++K+AWRTDEEFARE+LAGVNPV+I
Sbjct  329  ILKYISDSTPGEIFKELFRTDGEKFLKFPVPQVIKEDKSAWRTDEEFARELLAGVNPVTI  388

Query  185  SRLQMFPQRSTLDPKVYGDHTCTITREDIADKLDGLTVEQAIESKRLFILDHHDAITLYA  364
             RLQ FP  S LD + YGD T  IT+E I   L+GLT+++AI + +LFIL+HHDA   Y 
Sbjct  389  RRLQEFPPSSELDREAYGDQTSQITKEHIEHNLNGLTIDEAIMNNKLFILNHHDAWMPYL  448

Query  365  RRINDNTDRKIYATRTLLFLLKDGTLRPIAIELSKPHPDGD  487
            RRIN  T  K YA+RTLLFL  DGTL+PIAIELS PHPDGD
Sbjct  449  RRIN-TTSTKAYASRTLLFLNNDGTLKPIAIELSLPHPDGD  488



>ref|XP_009407551.1| PREDICTED: probable linoleate 9S-lipoxygenase 5 [Musa acuminata 
subsp. malaccensis]
Length=872

 Score =   209 bits (533),  Expect = 5e-60, Method: Compositional matrix adjust.
 Identities = 100/162 (62%), Positives = 125/162 (77%), Gaps = 1/162 (1%)
 Frame = +2

Query  2    PILEHIQKNTPLEMIKELLRSDGEKMFKFPTPQVIADNKTAWRTDEEFAREMLAGVNPVS  181
            P L+ I+ + P EM+KEL+R+DGE++ K P PQVI +++ AWRTDEEF REMLAGVNPV 
Sbjct  327  PELDEIRSHLPFEMLKELVRTDGERVLKLPLPQVIQEDRNAWRTDEEFGREMLAGVNPVI  386

Query  182  ISRLQMFPQRSTLDPKVYGDHTCTITREDIADKLDGLTVEQAIESKRLFILDHHDAITLY  361
            ISR+Q FP  S LDPKVYGDHT +I    I   L+GLTV++A++  +LFILDHHDA+  Y
Sbjct  387  ISRVQEFPPVSKLDPKVYGDHTSSINASHIEKNLEGLTVQKAMKENKLFILDHHDALMPY  446

Query  362  ARRINDNTDRKIYATRTLLFLLKDGTLRPIAIELSKPHPDGD  487
             RRIN  ++ KIYA+RTLL L  DGTL+P+ IELS PHPDGD
Sbjct  447  LRRINSGSN-KIYASRTLLLLKDDGTLKPLVIELSLPHPDGD  487



>ref|XP_010651467.1| PREDICTED: probable linoleate 9S-lipoxygenase 5 [Vitis vinifera]
Length=372

 Score =   201 bits (512),  Expect = 6e-60, Method: Compositional matrix adjust.
 Identities = 99/160 (62%), Positives = 124/160 (78%), Gaps = 1/160 (1%)
 Frame = +2

Query  5    ILEHIQKNTPLEMIKELLRSDGEKMFKFPTPQVIADNKTAWRTDEEFAREMLAGVNPVSI  184
            +L+ I+ N PLEM+KEL+R+DGE +FKFP PQVI ++K+AWRTDEEFAREMLAG+NPV I
Sbjct  205  LLDKIKDNIPLEMLKELVRTDGEHLFKFPMPQVIKEDKSAWRTDEEFAREMLAGLNPVVI  264

Query  185  SRLQMFPQRSTLDPKVYGDHTCTITREDIADKLDGLTVEQAIESKRLFILDHHDAITLYA  364
              LQ FP +S LD +VYG+   +IT+E I + LDGLT+ +A++ KRLFILD HD    Y 
Sbjct  265  RLLQEFPPKSKLDLEVYGNQNSSITKEHIENHLDGLTINKAMKKKRLFILDDHDVFMPYR  324

Query  365  RRINDNTDRKIYATRTLLFLLKDGTLRPIAIELSKPHPDG  484
            RRIN  T  K YA+RTLLFL  D TL+P+AIELS PHP+G
Sbjct  325  RRIN-TTSMKTYASRTLLFLKDDRTLKPLAIELSLPHPNG  363



>gb|KJB80991.1| hypothetical protein B456_013G124500 [Gossypium raimondii]
Length=693

 Score =   208 bits (529),  Expect = 6e-60, Method: Compositional matrix adjust.
 Identities = 100/162 (62%), Positives = 123/162 (76%), Gaps = 1/162 (1%)
 Frame = +2

Query  2    PILEHIQKNTPLEMIKELLRSDGEKMFKFPTPQVIADNKTAWRTDEEFAREMLAGVNPVS  181
            P+ ++I  N PLEM+KE+ R+DG ++ KFP P+VI D+KTAWRTDEEFAREMLAGVNPV 
Sbjct  153  PLRDNIINNIPLEMLKEIFRTDGAQLLKFPVPRVIQDSKTAWRTDEEFAREMLAGVNPVI  212

Query  182  ISRLQMFPQRSTLDPKVYGDHTCTITREDIADKLDGLTVEQAIESKRLFILDHHDAITLY  361
            I  LQ FP  S LDPKVYG+    IT+E I   L+GLTVE+A+ + RLFILDHHD++  Y
Sbjct  213  IRLLQEFPPTSNLDPKVYGNQNSAITKEHIEHNLEGLTVEEALRTNRLFILDHHDSLMPY  272

Query  362  ARRINDNTDRKIYATRTLLFLLKDGTLRPIAIELSKPHPDGD  487
             RRIN  T  K YA+RT+L L  DGTL+P+ IELS PHP+GD
Sbjct  273  LRRINTTTT-KTYASRTILLLRNDGTLKPLVIELSLPHPNGD  313



>gb|AES82497.2| linoleate 9S-lipoxygenase-like protein [Medicago truncatula]
Length=867

 Score =   209 bits (532),  Expect = 7e-60, Method: Compositional matrix adjust.
 Identities = 99/160 (62%), Positives = 125/160 (78%), Gaps = 1/160 (1%)
 Frame = +2

Query  8    LEHIQKNTPLEMIKELLRSDGEKMFKFPTPQVIADNKTAWRTDEEFAREMLAGVNPVSIS  187
            ++ I+   P EM+KE+LR+DG+K+ K+P P VI ++K+AWRTDEEFAREMLAGVNPV I 
Sbjct  329  VKRIRDKIPAEMLKEILRTDGQKLLKYPVPHVIKEDKSAWRTDEEFAREMLAGVNPVIIR  388

Query  188  RLQMFPQRSTLDPKVYGDHTCTITREDIADKLDGLTVEQAIESKRLFILDHHDAITLYAR  367
             LQ FP  S LDP VYGD + TI + DI   LDGLTV++AI  K+LFILDHHDA+  Y R
Sbjct  389  GLQEFPPTSKLDPNVYGDQSSTIRKSDIESNLDGLTVDEAIAQKKLFILDHHDALMTYLR  448

Query  368  RINDNTDRKIYATRTLLFLLKDGTLRPIAIELSKPHPDGD  487
            RIN +T  K YA+RT+LFL ++GTL+P+AIELS PHP+GD
Sbjct  449  RIN-STSTKTYASRTILFLQQNGTLKPLAIELSLPHPNGD  487



>ref|XP_010511239.1| PREDICTED: linoleate 9S-lipoxygenase 1-like [Camelina sativa]
Length=860

 Score =   209 bits (532),  Expect = 7e-60, Method: Compositional matrix adjust.
 Identities = 100/161 (62%), Positives = 124/161 (77%), Gaps = 1/161 (1%)
 Frame = +2

Query  5    ILEHIQKNTPLEMIKELLRSDGEKMFKFPTPQVIADNKTAWRTDEEFAREMLAGVNPVSI  184
            +++ I KN PLEM+KE+ R+DG+K  K+P PQVI ++KTAWRTDEEFAREMLAG+NPV I
Sbjct  321  LIDSIVKNIPLEMLKEIFRTDGQKFLKYPVPQVIKEDKTAWRTDEEFAREMLAGLNPVVI  380

Query  185  SRLQMFPQRSTLDPKVYGDHTCTITREDIADKLDGLTVEQAIESKRLFILDHHDAITLYA  364
              LQ FP +S LD ++YG+   TIT+  I   LDGLTV++A+E +RLFILDHHD +  Y 
Sbjct  381  QLLQEFPPKSKLDSELYGNQNSTITKSHIEKSLDGLTVDEALEKERLFILDHHDTLMPYL  440

Query  365  RRINDNTDRKIYATRTLLFLLKDGTLRPIAIELSKPHPDGD  487
            RRIN  T  K YA+RTLLFL  DGTL+P+ IELS PHPDGD
Sbjct  441  RRIN-TTTTKTYASRTLLFLKDDGTLKPLVIELSLPHPDGD  480



>ref|XP_008246454.1| PREDICTED: probable linoleate 9S-lipoxygenase 5 [Prunus mume]
Length=934

 Score =   209 bits (532),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 102/161 (63%), Positives = 122/161 (76%), Gaps = 1/161 (1%)
 Frame = +2

Query  5    ILEHIQKNTPLEMIKELLRSDGEKMFKFPTPQVIADNKTAWRTDEEFAREMLAGVNPVSI  184
            IL+ ++ N P E IKEL R+DGEK  KFP PQVI  +K+AW+TDEEFAREMLAG+NPV I
Sbjct  395  ILKSVRDNIPAETIKELFRTDGEKFLKFPVPQVIKVDKSAWKTDEEFAREMLAGINPVLI  454

Query  185  SRLQMFPQRSTLDPKVYGDHTCTITREDIADKLDGLTVEQAIESKRLFILDHHDAITLYA  364
             RLQ FP  S LD   YGD T  IT+E I   LDGL++++AI++ +LFILDHHDA+  Y 
Sbjct  455  RRLQEFPPASELDQNTYGDQTSQITKEHIGHYLDGLSIDEAIKNNKLFILDHHDALMPYL  514

Query  365  RRINDNTDRKIYATRTLLFLLKDGTLRPIAIELSKPHPDGD  487
            RRIN  T  K YA+RTLLFL  DGTL+P+AIELS PHPDGD
Sbjct  515  RRIN-RTSTKTYASRTLLFLENDGTLKPLAIELSLPHPDGD  554



>ref|XP_009119596.1| PREDICTED: linoleate 9S-lipoxygenase 1 [Brassica rapa]
Length=857

 Score =   209 bits (531),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 99/161 (61%), Positives = 124/161 (77%), Gaps = 1/161 (1%)
 Frame = +2

Query  5    ILEHIQKNTPLEMIKELLRSDGEKMFKFPTPQVIADNKTAWRTDEEFAREMLAGVNPVSI  184
            +++ I KN PLEM+KE+ R+DG+K  K+P PQVI ++KTAWRTDEEFAREMLAG+NPV I
Sbjct  318  LIDSIVKNIPLEMLKEIFRTDGQKFLKYPVPQVIKEDKTAWRTDEEFAREMLAGLNPVVI  377

Query  185  SRLQMFPQRSTLDPKVYGDHTCTITREDIADKLDGLTVEQAIESKRLFILDHHDAITLYA  364
              L+ FP +S L+ + YGD   TIT+  I + LDGLTVE+A+E +RLFILDHHD +  Y 
Sbjct  378  QLLKEFPPKSKLERETYGDQNSTITKSHIEESLDGLTVEEALEKERLFILDHHDTLMPYV  437

Query  365  RRINDNTDRKIYATRTLLFLLKDGTLRPIAIELSKPHPDGD  487
             RIN  T  K+YA+RTLLFL  DGTL+P+ IELS PHPDGD
Sbjct  438  GRIN-TTGNKVYASRTLLFLKDDGTLKPLVIELSLPHPDGD  477



>ref|XP_006392468.1| hypothetical protein EUTSA_v10023267mg [Eutrema salsugineum]
 gb|ESQ29754.1| hypothetical protein EUTSA_v10023267mg [Eutrema salsugineum]
Length=856

 Score =   208 bits (530),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 100/161 (62%), Positives = 122/161 (76%), Gaps = 1/161 (1%)
 Frame = +2

Query  5    ILEHIQKNTPLEMIKELLRSDGEKMFKFPTPQVIADNKTAWRTDEEFAREMLAGVNPVSI  184
            +++ I KN PLEM+KE+ R+DG+K  K+P PQVI ++KTAWRTDEEFAREMLAG+NPV I
Sbjct  317  MIDSIVKNIPLEMLKEIFRTDGQKFLKYPVPQVIKEDKTAWRTDEEFAREMLAGLNPVVI  376

Query  185  SRLQMFPQRSTLDPKVYGDHTCTITREDIADKLDGLTVEQAIESKRLFILDHHDAITLYA  364
              LQ FP +S LD + YG+   TIT+  I   LDGLTVE+A+E +RLFILDHHD +  Y 
Sbjct  377  QLLQEFPPKSKLDSETYGNQNSTITKSHIEQSLDGLTVEEALEKERLFILDHHDTLMPYL  436

Query  365  RRINDNTDRKIYATRTLLFLLKDGTLRPIAIELSKPHPDGD  487
             RIN  T  K YA+RTLLFL  DGTL+P+ IELS PHPDGD
Sbjct  437  GRIN-TTGNKTYASRTLLFLKDDGTLKPLVIELSLPHPDGD  476



>ref|XP_008246452.1| PREDICTED: probable linoleate 9S-lipoxygenase 5 [Prunus mume]
Length=896

 Score =   209 bits (531),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 102/161 (63%), Positives = 123/161 (76%), Gaps = 1/161 (1%)
 Frame = +2

Query  5    ILEHIQKNTPLEMIKELLRSDGEKMFKFPTPQVIADNKTAWRTDEEFAREMLAGVNPVSI  184
            IL++I+ +   E+ KEL R+DGEK  KFP PQVI DNK+AWRTDEEFAREMLAGVNPV+I
Sbjct  384  ILKYIRDSIHEELFKELFRTDGEKFLKFPVPQVIQDNKSAWRTDEEFAREMLAGVNPVAI  443

Query  185  SRLQMFPQRSTLDPKVYGDHTCTITREDIADKLDGLTVEQAIESKRLFILDHHDAITLYA  364
             RLQ FP  S LD K YGD T  IT+E I   L GL++++AI++ +LFILDHHD +  Y 
Sbjct  444  RRLQEFPPASKLDQKAYGDQTSQITKEHIEHNLKGLSIDEAIKNNKLFILDHHDELMPYL  503

Query  365  RRINDNTDRKIYATRTLLFLLKDGTLRPIAIELSKPHPDGD  487
            RRIN  T  K Y++RTLLFL  DGTL+P+AIELS PHPDGD
Sbjct  504  RRIN-TTSTKTYSSRTLLFLENDGTLKPLAIELSLPHPDGD  543



>gb|KDO74650.1| hypothetical protein CISIN_1g002776mg [Citrus sinensis]
 gb|KDO74651.1| hypothetical protein CISIN_1g002776mg [Citrus sinensis]
Length=555

 Score =   205 bits (521),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 99/157 (63%), Positives = 123/157 (78%), Gaps = 1/157 (1%)
 Frame = +2

Query  17   IQKNTPLEMIKELLRSDGEKMFKFPTPQVIADNKTAWRTDEEFAREMLAGVNPVSISRLQ  196
            I+   P EM+KEL+R+DGE+  KFP P VI ++++AWRTDEEFAREMLAGVNPV ISRLQ
Sbjct  342  IRDRIPWEMLKELVRNDGERFLKFPMPDVIKEDRSAWRTDEEFAREMLAGVNPVIISRLQ  401

Query  197  MFPQRSTLDPKVYGDHTCTITREDIADKLDGLTVEQAIESKRLFILDHHDAITLYARRIN  376
             FP  S LDPKVYG+   +ITR DI   ++ LT+++AIE+K+LF LDHHDA+  Y RRIN
Sbjct  402  EFPPASNLDPKVYGNQHSSITRADIERNMNELTIDEAIENKKLFTLDHHDALMPYLRRIN  461

Query  377  DNTDRKIYATRTLLFLLKDGTLRPIAIELSKPHPDGD  487
             +T+ K YA+RTLL L  DGTL+P+AIELS PHP GD
Sbjct  462  -STNTKTYASRTLLLLQNDGTLKPLAIELSLPHPQGD  497



>ref|XP_007144726.1| hypothetical protein PHAVU_007G179600g [Phaseolus vulgaris]
 gb|ESW16720.1| hypothetical protein PHAVU_007G179600g [Phaseolus vulgaris]
Length=861

 Score =   208 bits (530),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 100/161 (62%), Positives = 126/161 (78%), Gaps = 1/161 (1%)
 Frame = +2

Query  5    ILEHIQKNTPLEMIKELLRSDGEKMFKFPTPQVIADNKTAWRTDEEFAREMLAGVNPVSI  184
            IL  ++ N P EM+KE+ RSDG+++ KFP PQVIA +K+AW+TDEEFAREMLAG+NPV I
Sbjct  322  ILTEVRDNIPAEMLKEIFRSDGQRLLKFPVPQVIAVDKSAWQTDEEFAREMLAGINPVII  381

Query  185  SRLQMFPQRSTLDPKVYGDHTCTITREDIADKLDGLTVEQAIESKRLFILDHHDAITLYA  364
              LQ FP  S LDPK+YG+ T TIT+E I   L+GLTV++AI  +RLFILD H+A+  Y 
Sbjct  382  RGLQEFPPGSKLDPKIYGNQTSTITKEHIESNLEGLTVDEAIRERRLFILDLHEAVIPYI  441

Query  365  RRINDNTDRKIYATRTLLFLLKDGTLRPIAIELSKPHPDGD  487
            RRIN +T  K YA+RT+LFL K GTL+P+AIELS PHP+GD
Sbjct  442  RRIN-STSTKTYASRTILFLQKKGTLKPLAIELSLPHPNGD  481



>ref|XP_008245950.1| PREDICTED: probable linoleate 9S-lipoxygenase 5 [Prunus mume]
Length=923

 Score =   209 bits (531),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 102/161 (63%), Positives = 123/161 (76%), Gaps = 1/161 (1%)
 Frame = +2

Query  5    ILEHIQKNTPLEMIKELLRSDGEKMFKFPTPQVIADNKTAWRTDEEFAREMLAGVNPVSI  184
            IL++I+ +   E+ KEL R+DGEK  KFP PQVI DNK+AWRTDEEFAREMLAGVNPV+I
Sbjct  384  ILKYIRDSIHEELFKELFRTDGEKFLKFPVPQVIQDNKSAWRTDEEFAREMLAGVNPVAI  443

Query  185  SRLQMFPQRSTLDPKVYGDHTCTITREDIADKLDGLTVEQAIESKRLFILDHHDAITLYA  364
             RLQ FP  S LD K YGD T  IT+E I   L GL++++AI++ +LFILDHHD +  Y 
Sbjct  444  RRLQEFPPASKLDQKAYGDQTSQITKEHIEHNLKGLSIDEAIKNNKLFILDHHDELMPYL  503

Query  365  RRINDNTDRKIYATRTLLFLLKDGTLRPIAIELSKPHPDGD  487
            RRIN  T  K Y++RTLLFL  DGTL+P+AIELS PHPDGD
Sbjct  504  RRIN-TTSTKTYSSRTLLFLENDGTLKPLAIELSLPHPDGD  543



>ref|XP_008246451.1| PREDICTED: probable linoleate 9S-lipoxygenase 5 [Prunus mume]
Length=923

 Score =   209 bits (531),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 102/161 (63%), Positives = 123/161 (76%), Gaps = 1/161 (1%)
 Frame = +2

Query  5    ILEHIQKNTPLEMIKELLRSDGEKMFKFPTPQVIADNKTAWRTDEEFAREMLAGVNPVSI  184
            IL++I+ +   E+ KEL R+DGEK  KFP PQVI DNK+AWRTDEEFAREMLAGVNPV+I
Sbjct  384  ILKYIRDSIHEELFKELFRTDGEKFLKFPVPQVIQDNKSAWRTDEEFAREMLAGVNPVAI  443

Query  185  SRLQMFPQRSTLDPKVYGDHTCTITREDIADKLDGLTVEQAIESKRLFILDHHDAITLYA  364
             RLQ FP  S LD K YGD T  IT+E I   L GL++++AI++ +LFILDHHD +  Y 
Sbjct  444  RRLQEFPPASKLDQKAYGDQTSQITKEHIEHNLKGLSIDEAIKNNKLFILDHHDELMPYL  503

Query  365  RRINDNTDRKIYATRTLLFLLKDGTLRPIAIELSKPHPDGD  487
            RRIN  T  K Y++RTLLFL  DGTL+P+AIELS PHPDGD
Sbjct  504  RRIN-TTSTKTYSSRTLLFLENDGTLKPLAIELSLPHPDGD  543



>ref|XP_009626059.1| PREDICTED: probable linoleate 9S-lipoxygenase 5 isoform X2 [Nicotiana 
tomentosiformis]
Length=876

 Score =   208 bits (530),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 103/160 (64%), Positives = 122/160 (76%), Gaps = 1/160 (1%)
 Frame = +2

Query  8    LEHIQKNTPLEMIKELLRSDGEKMFKFPTPQVIADNKTAWRTDEEFAREMLAGVNPVSIS  187
            L  +++  P EM+KEL+RSDGE   KFP P VI  +++AWRTDEEF REMLAGVNPV I 
Sbjct  333  LNKLRQCIPWEMLKELVRSDGEPFLKFPMPDVIKVDRSAWRTDEEFGREMLAGVNPVIIR  392

Query  188  RLQMFPQRSTLDPKVYGDHTCTITREDIADKLDGLTVEQAIESKRLFILDHHDAITLYAR  367
            RLQ FP  S LDPKVYG+ T +ITREDI   +D LTV++AIE  +LFILDHHDA+  Y R
Sbjct  393  RLQEFPPASKLDPKVYGNQTSSITREDIEKNMDELTVDEAIEYNKLFILDHHDALMPYLR  452

Query  368  RINDNTDRKIYATRTLLFLLKDGTLRPIAIELSKPHPDGD  487
            RIN  T+ K YA+RTLLFL  +GTLRP+AIELS PHP GD
Sbjct  453  RIN-TTNTKTYASRTLLFLQDNGTLRPLAIELSLPHPQGD  491



>ref|XP_010480214.1| PREDICTED: linoleate 9S-lipoxygenase 1 [Camelina sativa]
Length=860

 Score =   208 bits (530),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 100/161 (62%), Positives = 123/161 (76%), Gaps = 1/161 (1%)
 Frame = +2

Query  5    ILEHIQKNTPLEMIKELLRSDGEKMFKFPTPQVIADNKTAWRTDEEFAREMLAGVNPVSI  184
            +++ I KN PLEM+KE+ R+DG+K  K+P PQVI ++KTAWRTDEEFAREMLAG+NPV I
Sbjct  321  LIDSIVKNIPLEMLKEIFRTDGQKFLKYPVPQVIKEDKTAWRTDEEFAREMLAGLNPVVI  380

Query  185  SRLQMFPQRSTLDPKVYGDHTCTITREDIADKLDGLTVEQAIESKRLFILDHHDAITLYA  364
              LQ FP +S LD ++YG+   TIT+  I   LDGLTVE+A+E +RLFILDHHD +  Y 
Sbjct  381  QLLQEFPPKSKLDSELYGNQNSTITKSHIEKSLDGLTVEEALEKERLFILDHHDTLMPYL  440

Query  365  RRINDNTDRKIYATRTLLFLLKDGTLRPIAIELSKPHPDGD  487
             RIN  T  K YA+RTLLFL  DGTL+P+ IELS PHPDGD
Sbjct  441  GRIN-TTTTKTYASRTLLFLKNDGTLKPLVIELSLPHPDGD  480



>ref|XP_010326551.1| PREDICTED: probable linoleate 9S-lipoxygenase 5 isoform X2 [Solanum 
lycopersicum]
 ref|XP_010326552.1| PREDICTED: probable linoleate 9S-lipoxygenase 5 isoform X2 [Solanum 
lycopersicum]
Length=874

 Score =   208 bits (530),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 102/160 (64%), Positives = 122/160 (76%), Gaps = 1/160 (1%)
 Frame = +2

Query  8    LEHIQKNTPLEMIKELLRSDGEKMFKFPTPQVIADNKTAWRTDEEFAREMLAGVNPVSIS  187
            L+ +++  P EM+KEL+RSDGE   KFP P VI  +++AWRTDEEF REMLAGVNPV I 
Sbjct  331  LKKLRQCIPWEMLKELVRSDGEPFLKFPMPDVIKVDRSAWRTDEEFGREMLAGVNPVIIR  390

Query  188  RLQMFPQRSTLDPKVYGDHTCTITREDIADKLDGLTVEQAIESKRLFILDHHDAITLYAR  367
            RLQ FP  STLDP+VYG+ T +I RE I   +DG+TV++AIE  RLFILDHHDA+  Y R
Sbjct  391  RLQEFPPASTLDPEVYGNQTSSIKREHIEKNMDGVTVDEAIEGNRLFILDHHDALLPYLR  450

Query  368  RINDNTDRKIYATRTLLFLLKDGTLRPIAIELSKPHPDGD  487
            RIN  T  K YA+RTLLFL  +GTLRP+AIELS PHP GD
Sbjct  451  RIN-TTKTKTYASRTLLFLQDNGTLRPVAIELSLPHPQGD  489



>gb|AGK82783.1| lipoxygenase [Malus domestica]
Length=879

 Score =   208 bits (530),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 100/162 (62%), Positives = 125/162 (77%), Gaps = 1/162 (1%)
 Frame = +2

Query  2    PILEHIQKNTPLEMIKELLRSDGEKMFKFPTPQVIADNKTAWRTDEEFAREMLAGVNPVS  181
            P L+ I++  P E++KEL+RSDGE+  KFP P VI  +++AWRTD+EF REMLAGVNPV+
Sbjct  331  PTLKKIRERIPWELLKELIRSDGERFLKFPMPDVIKKDRSAWRTDKEFGREMLAGVNPVN  390

Query  182  ISRLQMFPQRSTLDPKVYGDHTCTITREDIADKLDGLTVEQAIESKRLFILDHHDAITLY  361
            I+RL+ FP  S LDPKVYG+   +I  E I   ++GLTVE+A E  RLFILDHHDA+ LY
Sbjct  391  ITRLKEFPPVSKLDPKVYGNQNSSIREEYIKGNMNGLTVEEATEKNRLFILDHHDALMLY  450

Query  362  ARRINDNTDRKIYATRTLLFLLKDGTLRPIAIELSKPHPDGD  487
             R+IN +TD K YATRTLL L +DGTL+P+AIELS PHP GD
Sbjct  451  LRQIN-STDTKTYATRTLLLLQEDGTLKPLAIELSLPHPQGD  491



>ref|XP_010326548.1| PREDICTED: probable linoleate 9S-lipoxygenase 5 isoform X1 [Solanum 
lycopersicum]
 ref|XP_010326549.1| PREDICTED: probable linoleate 9S-lipoxygenase 5 isoform X1 [Solanum 
lycopersicum]
 ref|XP_010326550.1| PREDICTED: probable linoleate 9S-lipoxygenase 5 isoform X1 [Solanum 
lycopersicum]
Length=891

 Score =   208 bits (530),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 102/160 (64%), Positives = 122/160 (76%), Gaps = 1/160 (1%)
 Frame = +2

Query  8    LEHIQKNTPLEMIKELLRSDGEKMFKFPTPQVIADNKTAWRTDEEFAREMLAGVNPVSIS  187
            L+ +++  P EM+KEL+RSDGE   KFP P VI  +++AWRTDEEF REMLAGVNPV I 
Sbjct  348  LKKLRQCIPWEMLKELVRSDGEPFLKFPMPDVIKVDRSAWRTDEEFGREMLAGVNPVIIR  407

Query  188  RLQMFPQRSTLDPKVYGDHTCTITREDIADKLDGLTVEQAIESKRLFILDHHDAITLYAR  367
            RLQ FP  STLDP+VYG+ T +I RE I   +DG+TV++AIE  RLFILDHHDA+  Y R
Sbjct  408  RLQEFPPASTLDPEVYGNQTSSIKREHIEKNMDGVTVDEAIEGNRLFILDHHDALLPYLR  467

Query  368  RINDNTDRKIYATRTLLFLLKDGTLRPIAIELSKPHPDGD  487
            RIN  T  K YA+RTLLFL  +GTLRP+AIELS PHP GD
Sbjct  468  RIN-TTKTKTYASRTLLFLQDNGTLRPVAIELSLPHPQGD  506



>ref|XP_009626058.1| PREDICTED: probable linoleate 9S-lipoxygenase 5 isoform X1 [Nicotiana 
tomentosiformis]
Length=886

 Score =   208 bits (530),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 103/160 (64%), Positives = 122/160 (76%), Gaps = 1/160 (1%)
 Frame = +2

Query  8    LEHIQKNTPLEMIKELLRSDGEKMFKFPTPQVIADNKTAWRTDEEFAREMLAGVNPVSIS  187
            L  +++  P EM+KEL+RSDGE   KFP P VI  +++AWRTDEEF REMLAGVNPV I 
Sbjct  343  LNKLRQCIPWEMLKELVRSDGEPFLKFPMPDVIKVDRSAWRTDEEFGREMLAGVNPVIIR  402

Query  188  RLQMFPQRSTLDPKVYGDHTCTITREDIADKLDGLTVEQAIESKRLFILDHHDAITLYAR  367
            RLQ FP  S LDPKVYG+ T +ITREDI   +D LTV++AIE  +LFILDHHDA+  Y R
Sbjct  403  RLQEFPPASKLDPKVYGNQTSSITREDIEKNMDELTVDEAIEYNKLFILDHHDALMPYLR  462

Query  368  RINDNTDRKIYATRTLLFLLKDGTLRPIAIELSKPHPDGD  487
            RIN  T+ K YA+RTLLFL  +GTLRP+AIELS PHP GD
Sbjct  463  RIN-TTNTKTYASRTLLFLQDNGTLRPLAIELSLPHPQGD  501



>gb|AGK82774.1| lipoxygenase [Malus domestica]
Length=900

 Score =   208 bits (530),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 100/162 (62%), Positives = 125/162 (77%), Gaps = 1/162 (1%)
 Frame = +2

Query  2    PILEHIQKNTPLEMIKELLRSDGEKMFKFPTPQVIADNKTAWRTDEEFAREMLAGVNPVS  181
            P L+ I++  P E++KEL+RSDGE+  KFP P VI  +++AWRTD+EF REMLAGVNPV+
Sbjct  352  PTLKKIRERIPWELLKELIRSDGERFLKFPMPDVIKKDRSAWRTDKEFGREMLAGVNPVN  411

Query  182  ISRLQMFPQRSTLDPKVYGDHTCTITREDIADKLDGLTVEQAIESKRLFILDHHDAITLY  361
            I+RL+ FP  S LDPKVYG+   +I  E I   ++GLTVE+A E  RLFILDHHDA+ LY
Sbjct  412  ITRLKEFPPVSKLDPKVYGNQNSSIREEYIKGNMNGLTVEEATEKNRLFILDHHDALMLY  471

Query  362  ARRINDNTDRKIYATRTLLFLLKDGTLRPIAIELSKPHPDGD  487
             R+IN +TD K YATRTLL L +DGTL+P+AIELS PHP GD
Sbjct  472  LRQIN-STDTKTYATRTLLLLQEDGTLKPLAIELSLPHPQGD  512



>gb|AGK82776.1| lipoxygenase [Malus domestica]
Length=900

 Score =   208 bits (529),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 100/162 (62%), Positives = 125/162 (77%), Gaps = 1/162 (1%)
 Frame = +2

Query  2    PILEHIQKNTPLEMIKELLRSDGEKMFKFPTPQVIADNKTAWRTDEEFAREMLAGVNPVS  181
            P L+ I++  P E++KEL+RSDGE+  KFP P VI  +++AWRTD+EF REMLAGVNPV+
Sbjct  352  PTLKKIRERIPWELLKELIRSDGERFLKFPMPDVIKKDRSAWRTDKEFGREMLAGVNPVN  411

Query  182  ISRLQMFPQRSTLDPKVYGDHTCTITREDIADKLDGLTVEQAIESKRLFILDHHDAITLY  361
            I+RL+ FP  S LDPKVYG+   +I  E I   ++GLTVE+A E  RLFILDHHDA+ LY
Sbjct  412  ITRLKEFPPVSKLDPKVYGNQNSSIREEYIKGNMNGLTVEEATEKNRLFILDHHDALMLY  471

Query  362  ARRINDNTDRKIYATRTLLFLLKDGTLRPIAIELSKPHPDGD  487
             R+IN +TD K YATRTLL L +DGTL+P+AIELS PHP GD
Sbjct  472  LRQIN-STDTKTYATRTLLLLQEDGTLKPLAIELSLPHPQGD  512



>gb|KJB80990.1| hypothetical protein B456_013G124500 [Gossypium raimondii]
Length=860

 Score =   208 bits (529),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 100/162 (62%), Positives = 123/162 (76%), Gaps = 1/162 (1%)
 Frame = +2

Query  2    PILEHIQKNTPLEMIKELLRSDGEKMFKFPTPQVIADNKTAWRTDEEFAREMLAGVNPVS  181
            P+ ++I  N PLEM+KE+ R+DG ++ KFP P+VI D+KTAWRTDEEFAREMLAGVNPV 
Sbjct  320  PLRDNIINNIPLEMLKEIFRTDGAQLLKFPVPRVIQDSKTAWRTDEEFAREMLAGVNPVI  379

Query  182  ISRLQMFPQRSTLDPKVYGDHTCTITREDIADKLDGLTVEQAIESKRLFILDHHDAITLY  361
            I  LQ FP  S LDPKVYG+    IT+E I   L+GLTVE+A+ + RLFILDHHD++  Y
Sbjct  380  IRLLQEFPPTSNLDPKVYGNQNSAITKEHIEHNLEGLTVEEALRTNRLFILDHHDSLMPY  439

Query  362  ARRINDNTDRKIYATRTLLFLLKDGTLRPIAIELSKPHPDGD  487
             RRIN  T  K YA+RT+L L  DGTL+P+ IELS PHP+GD
Sbjct  440  LRRIN-TTTTKTYASRTILLLRNDGTLKPLVIELSLPHPNGD  480



>gb|KJB80989.1| hypothetical protein B456_013G124500 [Gossypium raimondii]
Length=865

 Score =   207 bits (528),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 100/162 (62%), Positives = 123/162 (76%), Gaps = 1/162 (1%)
 Frame = +2

Query  2    PILEHIQKNTPLEMIKELLRSDGEKMFKFPTPQVIADNKTAWRTDEEFAREMLAGVNPVS  181
            P+ ++I  N PLEM+KE+ R+DG ++ KFP P+VI D+KTAWRTDEEFAREMLAGVNPV 
Sbjct  325  PLRDNIINNIPLEMLKEIFRTDGAQLLKFPVPRVIQDSKTAWRTDEEFAREMLAGVNPVI  384

Query  182  ISRLQMFPQRSTLDPKVYGDHTCTITREDIADKLDGLTVEQAIESKRLFILDHHDAITLY  361
            I  LQ FP  S LDPKVYG+    IT+E I   L+GLTVE+A+ + RLFILDHHD++  Y
Sbjct  385  IRLLQEFPPTSNLDPKVYGNQNSAITKEHIEHNLEGLTVEEALRTNRLFILDHHDSLMPY  444

Query  362  ARRINDNTDRKIYATRTLLFLLKDGTLRPIAIELSKPHPDGD  487
             RRIN  T  K YA+RT+L L  DGTL+P+ IELS PHP+GD
Sbjct  445  LRRIN-TTTTKTYASRTILLLRNDGTLKPLVIELSLPHPNGD  485



>ref|XP_002311617.1| lipoxygenase family protein [Populus trichocarpa]
 gb|EEE88984.1| lipoxygenase family protein [Populus trichocarpa]
Length=880

 Score =   208 bits (529),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 101/162 (62%), Positives = 125/162 (77%), Gaps = 1/162 (1%)
 Frame = +2

Query  2    PILEHIQKNTPLEMIKELLRSDGEKMFKFPTPQVIADNKTAWRTDEEFAREMLAGVNPVS  181
            P +  I+ + P EM+KEL+R+DGE++ KFP P VI  +K+AWRTDEEFAREMLAGVNPV 
Sbjct  335  PTISKIRDHIPWEMLKELVRNDGERLLKFPKPDVIKADKSAWRTDEEFAREMLAGVNPVI  394

Query  182  ISRLQMFPQRSTLDPKVYGDHTCTITREDIADKLDGLTVEQAIESKRLFILDHHDAITLY  361
            ISRLQ FP  S LDPKVYG+   +I +E I + +DGLTV QAI+  RL+ILDHHDA+  Y
Sbjct  395  ISRLQDFPPASKLDPKVYGNQNSSIGKELIEENMDGLTVVQAIKRNRLYILDHHDALMPY  454

Query  362  ARRINDNTDRKIYATRTLLFLLKDGTLRPIAIELSKPHPDGD  487
             RRIN +T  K YA+RT+LFL  DGTL+P++IELS PHP GD
Sbjct  455  LRRIN-STSTKTYASRTILFLQDDGTLKPLSIELSLPHPQGD  495



>ref|XP_009344082.1| PREDICTED: probable linoleate 9S-lipoxygenase 5 [Pyrus x bretschneideri]
Length=894

 Score =   207 bits (528),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 99/162 (61%), Positives = 125/162 (77%), Gaps = 1/162 (1%)
 Frame = +2

Query  2    PILEHIQKNTPLEMIKELLRSDGEKMFKFPTPQVIADNKTAWRTDEEFAREMLAGVNPVS  181
            P L+ I++  P E++KEL+RSDGE+  KFP P VI  +++AWRTDEEF REMLAGVNPV+
Sbjct  346  PTLKKIRERIPWELLKELIRSDGERFLKFPMPDVIKKDRSAWRTDEEFGREMLAGVNPVN  405

Query  182  ISRLQMFPQRSTLDPKVYGDHTCTITREDIADKLDGLTVEQAIESKRLFILDHHDAITLY  361
            I+RL+ FP  S L+P+VYG+   +I  E I   ++GLTVE+A E  RLFILDHHDA+ LY
Sbjct  406  ITRLEEFPPVSKLNPEVYGNQNSSIREEHIKGNMNGLTVEEATEKNRLFILDHHDALMLY  465

Query  362  ARRINDNTDRKIYATRTLLFLLKDGTLRPIAIELSKPHPDGD  487
             R+IN +TD K YATRTLL L +DGTL+P+AIELS PHP GD
Sbjct  466  LRQIN-STDTKTYATRTLLLLQEDGTLKPLAIELSLPHPQGD  506



>gb|ABV32552.1| lipoxygenase [Prunus persica]
Length=933

 Score =   208 bits (529),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 103/161 (64%), Positives = 122/161 (76%), Gaps = 1/161 (1%)
 Frame = +2

Query  5    ILEHIQKNTPLEMIKELLRSDGEKMFKFPTPQVIADNKTAWRTDEEFAREMLAGVNPVSI  184
            IL+ ++ N P E IKEL R+DGEK  KFP PQVI  +K AWRTDEEFAREMLAGVNPV+I
Sbjct  394  ILKSVRDNIPAETIKELFRTDGEKFPKFPVPQVIKVDKPAWRTDEEFAREMLAGVNPVAI  453

Query  185  SRLQMFPQRSTLDPKVYGDHTCTITREDIADKLDGLTVEQAIESKRLFILDHHDAITLYA  364
             RLQ FP  S LD K YGD T  IT+E I   L GL++++AI++ +LFILDHHDA+  Y 
Sbjct  454  RRLQEFPPASKLDQKAYGDQTSQITKEHIEHNLKGLSIDEAIKNNKLFILDHHDALMPYL  513

Query  365  RRINDNTDRKIYATRTLLFLLKDGTLRPIAIELSKPHPDGD  487
            RRIN  T  K Y++RTLLFL  DGTL+P+AIELS PHPDGD
Sbjct  514  RRIN-TTSTKTYSSRTLLFLENDGTLKPLAIELSLPHPDGD  553



>ref|XP_002319015.2| hypothetical protein POPTR_0013s02310g [Populus trichocarpa]
 gb|EEE94938.2| hypothetical protein POPTR_0013s02310g [Populus trichocarpa]
Length=862

 Score =   207 bits (527),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 99/162 (61%), Positives = 126/162 (78%), Gaps = 1/162 (1%)
 Frame = +2

Query  2    PILEHIQKNTPLEMIKELLRSDGEKMFKFPTPQVIADNKTAWRTDEEFAREMLAGVNPVS  181
            P+L++I+K  PLE ++E+ R+DGE+ F+FP PQVI DN +AWRTDEEF REMLAGVNPV 
Sbjct  322  PLLDNIRKIFPLEFLEEIFRTDGERFFEFPKPQVIKDNHSAWRTDEEFGREMLAGVNPVL  381

Query  182  ISRLQMFPQRSTLDPKVYGDHTCTITREDIADKLDGLTVEQAIESKRLFILDHHDAITLY  361
            I RL+ FP +S L+ ++YGD    IT E I + LDGLT+++AI + R+FILDHHDA+  Y
Sbjct  382  IRRLEEFPPKSKLNRELYGDQNSKITEEHIQNSLDGLTIDEAIRNNRMFILDHHDALMPY  441

Query  362  ARRINDNTDRKIYATRTLLFLLKDGTLRPIAIELSKPHPDGD  487
             RRIN +T  K YATRTLLFL  DGTL+P+AIELS PH +GD
Sbjct  442  LRRIN-STSTKTYATRTLLFLKDDGTLKPLAIELSWPHEEGD  482



>ref|XP_010935040.1| PREDICTED: LOW QUALITY PROTEIN: probable linoleate 9S-lipoxygenase 
5 [Elaeis guineensis]
Length=851

 Score =   207 bits (527),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 102/162 (63%), Positives = 121/162 (75%), Gaps = 1/162 (1%)
 Frame = +2

Query  2    PILEHIQKNTPLEMIKELLRSDGEKMFKFPTPQVIADNKTAWRTDEEFAREMLAGVNPVS  181
            P L+ I+   P EMIKEL+R+DGE + K P PQVI  +K AWRTDEEF REMLAGVNPV 
Sbjct  306  PELDKIKDRIPFEMIKELVRTDGEHLLKLPMPQVIQADKFAWRTDEEFGREMLAGVNPVI  365

Query  182  ISRLQMFPQRSTLDPKVYGDHTCTITREDIADKLDGLTVEQAIESKRLFILDHHDAITLY  361
            ISRL+ FP  S LDPK+YG+HT +IT   I   +DGLTVEQA++S RLFILDHHD +  Y
Sbjct  366  ISRLEEFPPTSKLDPKIYGNHTSSITASQIEKNMDGLTVEQALKSNRLFILDHHDTLVPY  425

Query  362  ARRINDNTDRKIYATRTLLFLLKDGTLRPIAIELSKPHPDGD  487
              RIN  T  KIYA+RTLL L  DG+L+P+AIELS  HPDG+
Sbjct  426  LNRIN-TTSSKIYASRTLLLLKDDGSLKPLAIELSLLHPDGE  466



>gb|ABF19103.2| 9-lipoxygenase [Capsicum annuum]
Length=876

 Score =   207 bits (527),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 103/160 (64%), Positives = 121/160 (76%), Gaps = 1/160 (1%)
 Frame = +2

Query  8    LEHIQKNTPLEMIKELLRSDGEKMFKFPTPQVIADNKTAWRTDEEFAREMLAGVNPVSIS  187
            L  +++  P EM+KEL+RSDGE   KFP P VI  +++AWRTDEEF REMLAGVNPV I 
Sbjct  333  LNKLRQCIPWEMLKELIRSDGEPPLKFPMPDVIKADRSAWRTDEEFGREMLAGVNPVIIR  392

Query  188  RLQMFPQRSTLDPKVYGDHTCTITREDIADKLDGLTVEQAIESKRLFILDHHDAITLYAR  367
            RLQ FP  S LDPKVYG+ T +ITRE I   LDGLTV++AIE  +LFILDHHDA+  Y R
Sbjct  393  RLQEFPPASKLDPKVYGNQTSSITREHIEKNLDGLTVDEAIEYNKLFILDHHDALMPYLR  452

Query  368  RINDNTDRKIYATRTLLFLLKDGTLRPIAIELSKPHPDGD  487
            RIN  T  K YA+RTLLFL  +GTL+P+AIELS PHP GD
Sbjct  453  RIN-TTKTKTYASRTLLFLQDNGTLKPLAIELSLPHPQGD  491



>ref|XP_009365900.1| PREDICTED: probable linoleate 9S-lipoxygenase 5 [Pyrus x bretschneideri]
Length=863

 Score =   207 bits (527),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 100/161 (62%), Positives = 124/161 (77%), Gaps = 1/161 (1%)
 Frame = +2

Query  5    ILEHIQKNTPLEMIKELLRSDGEKMFKFPTPQVIADNKTAWRTDEEFAREMLAGVNPVSI  184
            + + I  N P EM+KE+ R+DG +  +FP P+VI ++KTAWRTDEEFAREMLAGVNPV+I
Sbjct  324  LFKEIGDNIPAEMLKEIFRTDGAQFLRFPMPEVIKEDKTAWRTDEEFAREMLAGVNPVNI  383

Query  185  SRLQMFPQRSTLDPKVYGDHTCTITREDIADKLDGLTVEQAIESKRLFILDHHDAITLYA  364
              LQ FP  S LDPKVYGD T TIT + I + LDGLTV++A+++K+LFILDHHDA+  Y 
Sbjct  384  RLLQEFPPASKLDPKVYGDQTSTITEQHIRNNLDGLTVDEALKNKKLFILDHHDALMPYL  443

Query  365  RRINDNTDRKIYATRTLLFLLKDGTLRPIAIELSKPHPDGD  487
            RRIN +T  KIY +RTLLFL  DGTL+ + IELS P PDGD
Sbjct  444  RRIN-STSNKIYGSRTLLFLRSDGTLKILVIELSLPRPDGD  483



>gb|AGI16380.1| lipoxygenase [Malus domestica]
Length=863

 Score =   207 bits (527),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 100/161 (62%), Positives = 124/161 (77%), Gaps = 1/161 (1%)
 Frame = +2

Query  5    ILEHIQKNTPLEMIKELLRSDGEKMFKFPTPQVIADNKTAWRTDEEFAREMLAGVNPVSI  184
            + + I  + P EM+KE+ R+DG +  +FP P+VI  +KTAWRTDEEFAREMLAGVNPV+I
Sbjct  324  LFKEIGDSIPAEMLKEIFRTDGAQFLRFPMPEVIKVDKTAWRTDEEFAREMLAGVNPVNI  383

Query  185  SRLQMFPQRSTLDPKVYGDHTCTITREDIADKLDGLTVEQAIESKRLFILDHHDAITLYA  364
              LQ FP  S LDPKVYGD T TIT + I + LDGLTV++A+++K+LFILDHHDA+  Y 
Sbjct  384  RLLQEFPPASKLDPKVYGDQTSTITEQHIKNNLDGLTVDEALKNKKLFILDHHDALMPYL  443

Query  365  RRINDNTDRKIYATRTLLFLLKDGTLRPIAIELSKPHPDGD  487
            RRIN +T  KIY +RTLLFL  DGTL+ + IELS PHPDGD
Sbjct  444  RRIN-STSNKIYGSRTLLFLKSDGTLKILVIELSLPHPDGD  483



>gb|KDP23508.1| hypothetical protein JCGZ_23341 [Jatropha curcas]
Length=870

 Score =   207 bits (527),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 96/162 (59%), Positives = 127/162 (78%), Gaps = 1/162 (1%)
 Frame = +2

Query  2    PILEHIQKNTPLEMIKELLRSDGEKMFKFPTPQVIADNKTAWRTDEEFAREMLAGVNPVS  181
            P+L+++ KN P EM+KE+ R+DGE++FKFP PQVI ++KTAWRTDEEF REMLAG+NPV 
Sbjct  330  PLLDNVMKNIPFEMLKEIFRTDGERLFKFPMPQVIKESKTAWRTDEEFGREMLAGINPVI  389

Query  182  ISRLQMFPQRSTLDPKVYGDHTCTITREDIADKLDGLTVEQAIESKRLFILDHHDAITLY  361
            I RL+ FP +S L+ K YG+   +IT + I + LDGLTV++A+++ +L+ILDHHD +  Y
Sbjct  390  IRRLEEFPPKSKLNNKQYGNQNSSITEDHIKNNLDGLTVDEALKNNKLYILDHHDTVMPY  449

Query  362  ARRINDNTDRKIYATRTLLFLLKDGTLRPIAIELSKPHPDGD  487
             RRIN  T  K YA+RTLLFL  D TL+P+AIELS PHP+GD
Sbjct  450  LRRIN-ATSTKTYASRTLLFLKADETLKPLAIELSLPHPEGD  490



>ref|XP_006419896.1| hypothetical protein CICLE_v10004281mg [Citrus clementina]
 gb|ESR33136.1| hypothetical protein CICLE_v10004281mg [Citrus clementina]
Length=627

 Score =   205 bits (522),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 99/157 (63%), Positives = 123/157 (78%), Gaps = 1/157 (1%)
 Frame = +2

Query  17   IQKNTPLEMIKELLRSDGEKMFKFPTPQVIADNKTAWRTDEEFAREMLAGVNPVSISRLQ  196
            I+   P EM+KEL+R+DGE+  KFP P VI ++++AWRTDEEFAREMLAGVNPV ISRLQ
Sbjct  342  IRDRIPWEMLKELVRNDGERFLKFPMPDVIKEDRSAWRTDEEFAREMLAGVNPVIISRLQ  401

Query  197  MFPQRSTLDPKVYGDHTCTITREDIADKLDGLTVEQAIESKRLFILDHHDAITLYARRIN  376
             FP  S LDPKVYG+   +ITR DI   ++ LT+++AIE+K+LF LDHHDA+  Y RRIN
Sbjct  402  EFPPASNLDPKVYGNQHSSITRADIERNMNELTIDEAIENKKLFTLDHHDALMPYLRRIN  461

Query  377  DNTDRKIYATRTLLFLLKDGTLRPIAIELSKPHPDGD  487
             +T+ K YA+RTLL L  DGTL+P+AIELS PHP GD
Sbjct  462  -STNTKTYASRTLLLLQNDGTLKPLAIELSLPHPQGD  497



>gb|AGI16379.1| lipoxygenase [Malus domestica]
 gb|AGK82797.1| lipoxygenase [Malus domestica]
Length=863

 Score =   207 bits (527),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 100/161 (62%), Positives = 124/161 (77%), Gaps = 1/161 (1%)
 Frame = +2

Query  5    ILEHIQKNTPLEMIKELLRSDGEKMFKFPTPQVIADNKTAWRTDEEFAREMLAGVNPVSI  184
            + + I  + P EM+KE+ R+DG +  +FP P+VI  +KTAWRTDEEFAREMLAGVNPV+I
Sbjct  324  LFKEIGDSIPAEMLKEIFRTDGAQFLRFPMPEVIKVDKTAWRTDEEFAREMLAGVNPVNI  383

Query  185  SRLQMFPQRSTLDPKVYGDHTCTITREDIADKLDGLTVEQAIESKRLFILDHHDAITLYA  364
              LQ FP  S LDPKVYGD T TIT + I + LDGLTV++A+++K+LFILDHHDA+  Y 
Sbjct  384  RLLQEFPPASKLDPKVYGDQTSTITEQHIKNNLDGLTVDEALKNKKLFILDHHDALMPYL  443

Query  365  RRINDNTDRKIYATRTLLFLLKDGTLRPIAIELSKPHPDGD  487
            RRIN +T  KIY +RTLLFL  DGTL+ + IELS PHPDGD
Sbjct  444  RRIN-STSNKIYGSRTLLFLKSDGTLKILVIELSLPHPDGD  483



>gb|KDO74649.1| hypothetical protein CISIN_1g002776mg [Citrus sinensis]
Length=627

 Score =   205 bits (521),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 99/157 (63%), Positives = 123/157 (78%), Gaps = 1/157 (1%)
 Frame = +2

Query  17   IQKNTPLEMIKELLRSDGEKMFKFPTPQVIADNKTAWRTDEEFAREMLAGVNPVSISRLQ  196
            I+   P EM+KEL+R+DGE+  KFP P VI ++++AWRTDEEFAREMLAGVNPV ISRLQ
Sbjct  342  IRDRIPWEMLKELVRNDGERFLKFPMPDVIKEDRSAWRTDEEFAREMLAGVNPVIISRLQ  401

Query  197  MFPQRSTLDPKVYGDHTCTITREDIADKLDGLTVEQAIESKRLFILDHHDAITLYARRIN  376
             FP  S LDPKVYG+   +ITR DI   ++ LT+++AIE+K+LF LDHHDA+  Y RRIN
Sbjct  402  EFPPASNLDPKVYGNQHSSITRADIERNMNELTIDEAIENKKLFTLDHHDALMPYLRRIN  461

Query  377  DNTDRKIYATRTLLFLLKDGTLRPIAIELSKPHPDGD  487
             +T+ K YA+RTLL L  DGTL+P+AIELS PHP GD
Sbjct  462  -STNTKTYASRTLLLLQNDGTLKPLAIELSLPHPQGD  497



>gb|AGI16377.1| lipoxygenase [Malus domestica]
Length=863

 Score =   207 bits (526),  Expect = 4e-59, Method: Compositional matrix adjust.
 Identities = 100/161 (62%), Positives = 124/161 (77%), Gaps = 1/161 (1%)
 Frame = +2

Query  5    ILEHIQKNTPLEMIKELLRSDGEKMFKFPTPQVIADNKTAWRTDEEFAREMLAGVNPVSI  184
            + + I  + P EM+KE+ R+DG +  +FP P+VI  +KTAWRTDEEFAREMLAGVNPV+I
Sbjct  324  LFKEIGDSIPAEMLKEIFRTDGAQFLRFPMPEVIKVDKTAWRTDEEFAREMLAGVNPVNI  383

Query  185  SRLQMFPQRSTLDPKVYGDHTCTITREDIADKLDGLTVEQAIESKRLFILDHHDAITLYA  364
              LQ FP  S LDPKVYGD T TIT + I + LDGLTV++A+++K+LFILDHHDA+  Y 
Sbjct  384  RLLQEFPPASKLDPKVYGDQTSTITEQHIKNNLDGLTVDEALKNKKLFILDHHDALMPYL  443

Query  365  RRINDNTDRKIYATRTLLFLLKDGTLRPIAIELSKPHPDGD  487
            RRIN +T  KIY +RTLLFL  DGTL+ + IELS PHPDGD
Sbjct  444  RRIN-STSNKIYGSRTLLFLKSDGTLKILVIELSLPHPDGD  483



>ref|XP_004156417.1| PREDICTED: LOW QUALITY PROTEIN: probable linoleate 9S-lipoxygenase 
5-like [Cucumis sativus]
Length=864

 Score =   207 bits (526),  Expect = 4e-59, Method: Compositional matrix adjust.
 Identities = 98/161 (61%), Positives = 124/161 (77%), Gaps = 1/161 (1%)
 Frame = +2

Query  5    ILEHIQKNTPLEMIKELLRSDGEKMFKFPTPQVIADNKTAWRTDEEFAREMLAGVNPVSI  184
            +L+ I +N P  ++KE+ R+DGE+  +FPTPQ++ ++KTAW TDEEFAREMLAGVNPV I
Sbjct  323  LLQGITENIPAPLLKEIFRTDGERFLRFPTPQLVHEDKTAWSTDEEFAREMLAGVNPVVI  382

Query  185  SRLQMFPQRSTLDPKVYGDHTCTITREDIADKLDGLTVEQAIESKRLFILDHHDAITLYA  364
            +RL  FP +STLD  +YGD T  IT E I D LDGLTV +A+E K+L+IL+HHD++  Y 
Sbjct  383  ARLDEFPPKSTLDTNIYGDQTSKITEEHIKDGLDGLTVNEAVEKKKLYILNHHDSLIPYL  442

Query  365  RRINDNTDRKIYATRTLLFLLKDGTLRPIAIELSKPHPDGD  487
            RRIN  T  K YATRT+LFL  DGTL+P+AIELS PHP GD
Sbjct  443  RRIN-TTPTKXYATRTVLFLKNDGTLKPLAIELSLPHPQGD  482



>ref|XP_008348093.1| PREDICTED: probable linoleate 9S-lipoxygenase 5 [Malus domestica]
Length=863

 Score =   207 bits (526),  Expect = 5e-59, Method: Compositional matrix adjust.
 Identities = 100/161 (62%), Positives = 124/161 (77%), Gaps = 1/161 (1%)
 Frame = +2

Query  5    ILEHIQKNTPLEMIKELLRSDGEKMFKFPTPQVIADNKTAWRTDEEFAREMLAGVNPVSI  184
            + + I  + P EM+KE+ R+DG +  +FP P+VI  +KTAWRTDEEFAREMLAGVNPV+I
Sbjct  324  LFKEIGDSIPAEMLKEIFRTDGAQFLRFPMPEVIKVDKTAWRTDEEFAREMLAGVNPVNI  383

Query  185  SRLQMFPQRSTLDPKVYGDHTCTITREDIADKLDGLTVEQAIESKRLFILDHHDAITLYA  364
              LQ FP  S LDPKVYGD T TIT + I + LDGLTV++A+++K+LFILDHHDA+  Y 
Sbjct  384  RLLQEFPPASKLDPKVYGDQTSTITEQHIRNNLDGLTVDEALKNKKLFILDHHDALMPYL  443

Query  365  RRINDNTDRKIYATRTLLFLLKDGTLRPIAIELSKPHPDGD  487
            RRIN +T  KIY +RTLLFL  DGTL+ + IELS PHPDGD
Sbjct  444  RRIN-STSNKIYGSRTLLFLKSDGTLKILVIELSLPHPDGD  483



>gb|AGI16378.1| lipoxygenase [Malus domestica]
 gb|AGI16381.1| lipoxygenase [Malus domestica]
 gb|AGK82777.1| lipoxygenase [Malus domestica]
 gb|AGK82799.1| lipoxygenase [Malus domestica]
Length=863

 Score =   207 bits (526),  Expect = 5e-59, Method: Compositional matrix adjust.
 Identities = 100/161 (62%), Positives = 124/161 (77%), Gaps = 1/161 (1%)
 Frame = +2

Query  5    ILEHIQKNTPLEMIKELLRSDGEKMFKFPTPQVIADNKTAWRTDEEFAREMLAGVNPVSI  184
            + + I  + P EM+KE+ R+DG +  +FP P+VI  +KTAWRTDEEFAREMLAGVNPV+I
Sbjct  324  LFKEIGDSIPAEMLKEIFRTDGAQFLRFPMPEVIKVDKTAWRTDEEFAREMLAGVNPVNI  383

Query  185  SRLQMFPQRSTLDPKVYGDHTCTITREDIADKLDGLTVEQAIESKRLFILDHHDAITLYA  364
              LQ FP  S LDPKVYGD T TIT + I + LDGLTV++A+++K+LFILDHHDA+  Y 
Sbjct  384  RLLQEFPPASKLDPKVYGDQTSTITEQHIRNNLDGLTVDEALKNKKLFILDHHDALMPYL  443

Query  365  RRINDNTDRKIYATRTLLFLLKDGTLRPIAIELSKPHPDGD  487
            RRIN +T  KIY +RTLLFL  DGTL+ + IELS PHPDGD
Sbjct  444  RRIN-STSNKIYGSRTLLFLKSDGTLKILVIELSLPHPDGD  483



>ref|XP_002891934.1| hypothetical protein ARALYDRAFT_474776 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH68193.1| hypothetical protein ARALYDRAFT_474776 [Arabidopsis lyrata subsp. 
lyrata]
Length=857

 Score =   206 bits (525),  Expect = 6e-59, Method: Compositional matrix adjust.
 Identities = 100/161 (62%), Positives = 122/161 (76%), Gaps = 1/161 (1%)
 Frame = +2

Query  5    ILEHIQKNTPLEMIKELLRSDGEKMFKFPTPQVIADNKTAWRTDEEFAREMLAGVNPVSI  184
            +++ I KN PLEM+KE+ R+DG+K  KFP PQVI ++KTAWRTDEEFAREMLAG+NPV I
Sbjct  318  LIDSIVKNIPLEMLKEIFRTDGQKFLKFPVPQVIKEDKTAWRTDEEFAREMLAGLNPVVI  377

Query  185  SRLQMFPQRSTLDPKVYGDHTCTITREDIADKLDGLTVEQAIESKRLFILDHHDAITLYA  364
              LQ FP +S LD + YG+   TIT+  I   LDGLTVE+A+E +RLFILDHHD +  Y 
Sbjct  378  QLLQEFPPKSKLDSESYGNQNSTITKSHIEHNLDGLTVEEALEKERLFILDHHDTLMPYL  437

Query  365  RRINDNTDRKIYATRTLLFLLKDGTLRPIAIELSKPHPDGD  487
             RIN  T  K YA+RTLLFL  DGTL+P+ IELS PHP+GD
Sbjct  438  GRIN-TTPTKTYASRTLLFLKDDGTLKPLVIELSLPHPNGD  477



>gb|AIR74673.1| lipoxygenase, partial [Lilium regale]
Length=657

 Score =   205 bits (521),  Expect = 6e-59, Method: Compositional matrix adjust.
 Identities = 95/162 (59%), Positives = 121/162 (75%), Gaps = 0/162 (0%)
 Frame = +2

Query  2    PILEHIQKNTPLEMIKELLRSDGEKMFKFPTPQVIADNKTAWRTDEEFAREMLAGVNPVS  181
            P +  + +  P EM KE++RSDGE++ ++PTPQ+I D+   WRTDE+F REMLAG +P+ 
Sbjct  125  PNIPGLSQLIPFEMFKEIVRSDGERLLRYPTPQIIKDDHLIWRTDEQFVREMLAGSHPLM  184

Query  182  ISRLQMFPQRSTLDPKVYGDHTCTITREDIADKLDGLTVEQAIESKRLFILDHHDAITLY  361
            I RLQ FP +S LDP +YG+   TIT   I + LDGLTV+QA+E+K+LFILDHHD    Y
Sbjct  185  IKRLQEFPPKSKLDPSLYGNQDSTITEAQIENNLDGLTVDQALENKKLFILDHHDFFMPY  244

Query  362  ARRINDNTDRKIYATRTLLFLLKDGTLRPIAIELSKPHPDGD  487
             +RIN NT   IYATRTLLFL  DGTL+P+AIELS PHPDG+
Sbjct  245  VKRINTNTPNNIYATRTLLFLKDDGTLKPLAIELSLPHPDGE  286



>ref|NP_001280815.1| probable linoleate 9S-lipoxygenase 5 [Malus domestica]
 gb|AGK82793.1| lipoxygenase [Malus domestica]
Length=885

 Score =   206 bits (525),  Expect = 6e-59, Method: Compositional matrix adjust.
 Identities = 100/161 (62%), Positives = 124/161 (77%), Gaps = 1/161 (1%)
 Frame = +2

Query  5    ILEHIQKNTPLEMIKELLRSDGEKMFKFPTPQVIADNKTAWRTDEEFAREMLAGVNPVSI  184
            +L+ ++ N PLE IKEL R DGE   KFP PQVI ++K+AWRTDEEFAREMLAG+NPV+I
Sbjct  346  LLKSVRDNIPLETIKELFRLDGENFLKFPVPQVIREDKSAWRTDEEFAREMLAGINPVAI  405

Query  185  SRLQMFPQRSTLDPKVYGDHTCTITREDIADKLDGLTVEQAIESKRLFILDHHDAITLYA  364
              L+ FP  S LD K YGD T  IT+E+IA  L GL++++AI++ +LFILDHHD+I  Y 
Sbjct  406  RLLKEFPPASKLDRKAYGDQTSLITKENIAHNLKGLSIDEAIDNNKLFILDHHDSIMPYL  465

Query  365  RRINDNTDRKIYATRTLLFLLKDGTLRPIAIELSKPHPDGD  487
            RRIN  T  K YA+RTLLFL  DGTL+P+AIELS PHP+GD
Sbjct  466  RRIN-TTSTKTYASRTLLFLQDDGTLKPLAIELSLPHPNGD  505



>ref|XP_006419897.1| hypothetical protein CICLE_v10004281mg [Citrus clementina]
 gb|ESR33137.1| hypothetical protein CICLE_v10004281mg [Citrus clementina]
Length=656

 Score =   205 bits (521),  Expect = 6e-59, Method: Compositional matrix adjust.
 Identities = 99/157 (63%), Positives = 123/157 (78%), Gaps = 1/157 (1%)
 Frame = +2

Query  17   IQKNTPLEMIKELLRSDGEKMFKFPTPQVIADNKTAWRTDEEFAREMLAGVNPVSISRLQ  196
            I+   P EM+KEL+R+DGE+  KFP P VI ++++AWRTDEEFAREMLAGVNPV ISRLQ
Sbjct  342  IRDRIPWEMLKELVRNDGERFLKFPMPDVIKEDRSAWRTDEEFAREMLAGVNPVIISRLQ  401

Query  197  MFPQRSTLDPKVYGDHTCTITREDIADKLDGLTVEQAIESKRLFILDHHDAITLYARRIN  376
             FP  S LDPKVYG+   +ITR DI   ++ LT+++AIE+K+LF LDHHDA+  Y RRIN
Sbjct  402  EFPPASNLDPKVYGNQHSSITRADIERNMNELTIDEAIENKKLFTLDHHDALMPYLRRIN  461

Query  377  DNTDRKIYATRTLLFLLKDGTLRPIAIELSKPHPDGD  487
             +T+ K YA+RTLL L  DGTL+P+AIELS PHP GD
Sbjct  462  -STNTKTYASRTLLLLQNDGTLKPLAIELSLPHPQGD  497



>ref|XP_011090733.1| PREDICTED: probable linoleate 9S-lipoxygenase 5 isoform X1 [Sesamum 
indicum]
Length=881

 Score =   206 bits (525),  Expect = 6e-59, Method: Compositional matrix adjust.
 Identities = 101/160 (63%), Positives = 121/160 (76%), Gaps = 1/160 (1%)
 Frame = +2

Query  8    LEHIQKNTPLEMIKELLRSDGEKMFKFPTPQVIADNKTAWRTDEEFAREMLAGVNPVSIS  187
            L  I++  P E+IKEL+RSDGE+  KFP P VI +++TAWRTDEEF REMLAGVNPV I 
Sbjct  338  LHKIRECVPWELIKELIRSDGERFLKFPMPDVIKEDRTAWRTDEEFGREMLAGVNPVVIR  397

Query  188  RLQMFPQRSTLDPKVYGDHTCTITREDIADKLDGLTVEQAIESKRLFILDHHDAITLYAR  367
            RLQ FP  S LDP+ YGD   TITRE I   ++GLTV++AIE+ +LFILDHHDA+  Y R
Sbjct  398  RLQEFPPTSKLDPQAYGDQNSTITREHIEKNMNGLTVDEAIENNKLFILDHHDALMPYLR  457

Query  368  RINDNTDRKIYATRTLLFLLKDGTLRPIAIELSKPHPDGD  487
            RIN  T  K YA+RT+L L  DGTL+P+AIELS PH DGD
Sbjct  458  RINTTTT-KTYASRTVLLLQDDGTLKPLAIELSLPHEDGD  496



>gb|AAD09202.1| lipoxygenase [Solanum tuberosum]
Length=876

 Score =   206 bits (525),  Expect = 7e-59, Method: Compositional matrix adjust.
 Identities = 102/160 (64%), Positives = 121/160 (76%), Gaps = 1/160 (1%)
 Frame = +2

Query  8    LEHIQKNTPLEMIKELLRSDGEKMFKFPTPQVIADNKTAWRTDEEFAREMLAGVNPVSIS  187
            L+ +++  P EM+KEL+RSDGE   KFP P VI  +++AWRTDEEF REMLAGVNPV I 
Sbjct  335  LKKLRQCIPWEMLKELVRSDGEPFLKFPMPDVIKVDRSAWRTDEEFGREMLAGVNPVIIR  394

Query  188  RLQMFPQRSTLDPKVYGDHTCTITREDIADKLDGLTVEQAIESKRLFILDHHDAITLYAR  367
            RLQ FP  S LDP+VYG+ T +I RE I   +DGLTV++AIE  RLFILDHHDA+  Y R
Sbjct  395  RLQEFPPASKLDPEVYGNQTSSIKREHIEKNMDGLTVDEAIECNRLFILDHHDALLPYLR  454

Query  368  RINDNTDRKIYATRTLLFLLKDGTLRPIAIELSKPHPDGD  487
            RIN  T  K YATRTLL+L  +GTLRP+AIELS PHP GD
Sbjct  455  RIN-TTKTKTYATRTLLYLQDNGTLRPLAIELSLPHPQGD  493



>ref|XP_011090735.1| PREDICTED: probable linoleate 9S-lipoxygenase 5 isoform X2 [Sesamum 
indicum]
Length=870

 Score =   206 bits (525),  Expect = 7e-59, Method: Compositional matrix adjust.
 Identities = 101/160 (63%), Positives = 121/160 (76%), Gaps = 1/160 (1%)
 Frame = +2

Query  8    LEHIQKNTPLEMIKELLRSDGEKMFKFPTPQVIADNKTAWRTDEEFAREMLAGVNPVSIS  187
            L  I++  P E+IKEL+RSDGE+  KFP P VI +++TAWRTDEEF REMLAGVNPV I 
Sbjct  327  LHKIRECVPWELIKELIRSDGERFLKFPMPDVIKEDRTAWRTDEEFGREMLAGVNPVVIR  386

Query  188  RLQMFPQRSTLDPKVYGDHTCTITREDIADKLDGLTVEQAIESKRLFILDHHDAITLYAR  367
            RLQ FP  S LDP+ YGD   TITRE I   ++GLTV++AIE+ +LFILDHHDA+  Y R
Sbjct  387  RLQEFPPTSKLDPQAYGDQNSTITREHIEKNMNGLTVDEAIENNKLFILDHHDALMPYLR  446

Query  368  RINDNTDRKIYATRTLLFLLKDGTLRPIAIELSKPHPDGD  487
            RIN  T  K YA+RT+L L  DGTL+P+AIELS PH DGD
Sbjct  447  RIN-TTTTKTYASRTVLLLQDDGTLKPLAIELSLPHEDGD  485



>ref|XP_009774054.1| PREDICTED: probable linoleate 9S-lipoxygenase 5 [Nicotiana sylvestris]
Length=844

 Score =   206 bits (525),  Expect = 7e-59, Method: Compositional matrix adjust.
 Identities = 96/149 (64%), Positives = 119/149 (80%), Gaps = 1/149 (1%)
 Frame = +2

Query  41   MIKELLRSDGEKMFKFPTPQVIADNKTAWRTDEEFAREMLAGVNPVSISRLQMFPQRSTL  220
            M+KE ++S G+   K+P PQVI ++K+AWRTDEEFAREMLAG+NPV I  L+ FP  S L
Sbjct  317  MLKEFIQSAGQGFLKYPMPQVIKEDKSAWRTDEEFAREMLAGINPVCICALKEFPPTSKL  376

Query  221  DPKVYGDHTCTITREDIADKLDGLTVEQAIESKRLFILDHHDAITLYARRINDNTDRKIY  400
            DPKVYGD TC ITRE I ++LDGL +E+AI++ +LFILDHHD I  Y R+IN  T  KIY
Sbjct  377  DPKVYGDQTCKITREQIQNQLDGLIIEEAIKANQLFILDHHDTIMPYVRQIN-MTSTKIY  435

Query  401  ATRTLLFLLKDGTLRPIAIELSKPHPDGD  487
            ++RT+LFL KDGTL+P+AIELS PHPDGD
Sbjct  436  SSRTILFLRKDGTLKPLAIELSLPHPDGD  464



>ref|XP_008359870.1| PREDICTED: probable linoleate 9S-lipoxygenase 5 [Malus domestica]
Length=885

 Score =   206 bits (525),  Expect = 8e-59, Method: Compositional matrix adjust.
 Identities = 100/161 (62%), Positives = 124/161 (77%), Gaps = 1/161 (1%)
 Frame = +2

Query  5    ILEHIQKNTPLEMIKELLRSDGEKMFKFPTPQVIADNKTAWRTDEEFAREMLAGVNPVSI  184
            +L+ ++ N PLE IKEL R DGE   KFP PQVI ++K+AWRTDEEFAREMLAG+NPV+I
Sbjct  346  LLKSVRDNIPLETIKELFRLDGENFLKFPVPQVIREDKSAWRTDEEFAREMLAGINPVAI  405

Query  185  SRLQMFPQRSTLDPKVYGDHTCTITREDIADKLDGLTVEQAIESKRLFILDHHDAITLYA  364
              L+ FP  S LD K YGD T  IT+E+IA  L GL++++AI++ +LFILDHHD+I  Y 
Sbjct  406  RLLKEFPPASKLDRKAYGDQTSLITKENIAHNLKGLSIDEAIDNXKLFILDHHDSIMPYL  465

Query  365  RRINDNTDRKIYATRTLLFLLKDGTLRPIAIELSKPHPDGD  487
            RRIN  T  K YA+RTLLFL  DGTL+P+AIELS PHP+GD
Sbjct  466  RRIN-TTSTKTYASRTLLFLQDDGTLKPLAIELSLPHPNGD  505



>ref|XP_007208102.1| hypothetical protein PRUPE_ppa001216mg [Prunus persica]
 gb|EMJ09301.1| hypothetical protein PRUPE_ppa001216mg [Prunus persica]
Length=879

 Score =   206 bits (524),  Expect = 9e-59, Method: Compositional matrix adjust.
 Identities = 101/161 (63%), Positives = 122/161 (76%), Gaps = 1/161 (1%)
 Frame = +2

Query  5    ILEHIQKNTPLEMIKELLRSDGEKMFKFPTPQVIADNKTAWRTDEEFAREMLAGVNPVSI  184
            IL++I+ +   E+ KEL  +DGE   KFP PQVI DNK+AWRTDEEFAREMLAGVNPV+I
Sbjct  340  ILKYIRDSIHEELFKELFPTDGENFLKFPVPQVIQDNKSAWRTDEEFAREMLAGVNPVAI  399

Query  185  SRLQMFPQRSTLDPKVYGDHTCTITREDIADKLDGLTVEQAIESKRLFILDHHDAITLYA  364
             RLQ FP  S LD K YGD T  IT+E I   L GL++++AI++ +LFILDHHDA+  Y 
Sbjct  400  RRLQEFPPASKLDQKAYGDQTSQITKEHIEHNLKGLSIDEAIKNNKLFILDHHDALMPYL  459

Query  365  RRINDNTDRKIYATRTLLFLLKDGTLRPIAIELSKPHPDGD  487
            RRIN  T  K Y++RTLLFL  DGTL+P+AIELS PHPDGD
Sbjct  460  RRIN-TTSTKTYSSRTLLFLENDGTLKPLAIELSLPHPDGD  499



>emb|CDY43490.1| BnaA01g21450D [Brassica napus]
Length=1203

 Score =   208 bits (529),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 99/161 (61%), Positives = 124/161 (77%), Gaps = 1/161 (1%)
 Frame = +2

Query  5    ILEHIQKNTPLEMIKELLRSDGEKMFKFPTPQVIADNKTAWRTDEEFAREMLAGVNPVSI  184
            +++ I KN PLEM+KE+ R+DG+K  K+P PQVI ++KTAWRTDEEFAREMLAG+NPV I
Sbjct  664  LIDSIVKNIPLEMLKEIFRTDGQKFLKYPVPQVIKEDKTAWRTDEEFAREMLAGLNPVVI  723

Query  185  SRLQMFPQRSTLDPKVYGDHTCTITREDIADKLDGLTVEQAIESKRLFILDHHDAITLYA  364
              L+ FP +S L+ + YGD   TIT+  I + LDGLTVE+A+E +RLFILDHHD +  Y 
Sbjct  724  QLLKEFPPKSKLERETYGDQNSTITKSHIEESLDGLTVEEALEKERLFILDHHDTLMPYL  783

Query  365  RRINDNTDRKIYATRTLLFLLKDGTLRPIAIELSKPHPDGD  487
             RIN  T  K+YA+RTLLFL  DGTL+P+ IELS PHPDGD
Sbjct  784  GRIN-TTGNKVYASRTLLFLKDDGTLKPLVIELSLPHPDGD  823


 Score = 96.3 bits (238),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 42/65 (65%), Positives = 54/65 (83%), Gaps = 0/65 (0%)
 Frame = +2

Query  5    ILEHIQKNTPLEMIKELLRSDGEKMFKFPTPQVIADNKTAWRTDEEFAREMLAGVNPVSI  184
            +++ I KN PLEM+KE+ R+DG+K  K+P PQVI ++KTAWRTDEEFAREMLAG+NPV I
Sbjct  318  LIDSIVKNIPLEMLKEIFRTDGQKFLKYPVPQVIKEDKTAWRTDEEFAREMLAGLNPVVI  377

Query  185  SRLQM  199
              L+M
Sbjct  378  QLLKM  382



>gb|AGK82775.1| lipoxygenase [Malus domestica]
Length=900

 Score =   206 bits (524),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 98/162 (60%), Positives = 125/162 (77%), Gaps = 1/162 (1%)
 Frame = +2

Query  2    PILEHIQKNTPLEMIKELLRSDGEKMFKFPTPQVIADNKTAWRTDEEFAREMLAGVNPVS  181
            P L+ +++  P E++KEL+RSDGE+  KFP P VI  +++AWRTD+EF REMLAGVNPV+
Sbjct  352  PTLKKLRERIPWELLKELIRSDGERFLKFPMPDVIKKDRSAWRTDKEFGREMLAGVNPVN  411

Query  182  ISRLQMFPQRSTLDPKVYGDHTCTITREDIADKLDGLTVEQAIESKRLFILDHHDAITLY  361
            I+RL+ FP  S LDPK+YG+   +I  E I   ++GLTVE+A E  RLFILDHHDA+ LY
Sbjct  412  ITRLKEFPPVSKLDPKLYGNQNSSIREEYIKGNMNGLTVEEATEKNRLFILDHHDALMLY  471

Query  362  ARRINDNTDRKIYATRTLLFLLKDGTLRPIAIELSKPHPDGD  487
             R+IN +TD K YATRTLL L +DGTL+P+AIELS PHP GD
Sbjct  472  LRQIN-STDTKTYATRTLLLLQEDGTLKPLAIELSLPHPQGD  512



>ref|XP_010674744.1| PREDICTED: probable linoleate 9S-lipoxygenase 5 [Beta vulgaris 
subsp. vulgaris]
Length=841

 Score =   206 bits (523),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 93/162 (57%), Positives = 126/162 (78%), Gaps = 0/162 (0%)
 Frame = +2

Query  2    PILEHIQKNTPLEMIKELLRSDGEKMFKFPTPQVIADNKTAWRTDEEFAREMLAGVNPVS  181
            P++ HI++N P   +K + RSDG ++ K+P P +I ++K+AWRTDEEFAREM+AG++P++
Sbjct  299  PLVNHIRENIPSAFLKAIFRSDGAQLLKYPLPDIIREDKSAWRTDEEFAREMVAGIHPLA  358

Query  182  ISRLQMFPQRSTLDPKVYGDHTCTITREDIADKLDGLTVEQAIESKRLFILDHHDAITLY  361
            I RL+ FP  S LDP  YG+   +IT+E I +KLDGLTV++AIES RLFILDHHD +  +
Sbjct  359  IRRLEEFPPVSKLDPIAYGNQKSSITKESIEEKLDGLTVDEAIESNRLFILDHHDTMMPF  418

Query  362  ARRINDNTDRKIYATRTLLFLLKDGTLRPIAIELSKPHPDGD  487
             R+IN +T  K+YATRT+LFL  D TL+P+AIELS PHPDGD
Sbjct  419  LRKINSSTPSKVYATRTILFLKDDETLKPLAIELSLPHPDGD  460



>ref|XP_004309944.1| PREDICTED: probable linoleate 9S-lipoxygenase 5 [Fragaria vesca 
subsp. vesca]
Length=860

 Score =   206 bits (523),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 98/161 (61%), Positives = 119/161 (74%), Gaps = 1/161 (1%)
 Frame = +2

Query  5    ILEHIQKNTPLEMIKELLRSDGEKMFKFPTPQVIADNKTAWRTDEEFAREMLAGVNPVSI  184
            + + +    PL M KE+ R+DGE+  KFP PQVI +++TAWRTD EF REMLAGVNPV+I
Sbjct  321  LFKDVGDKIPLTMFKEIFRTDGERFLKFPVPQVIKEDRTAWRTDAEFTREMLAGVNPVTI  380

Query  185  SRLQMFPQRSTLDPKVYGDHTCTITREDIADKLDGLTVEQAIESKRLFILDHHDAITLYA  364
             RLQ FP  S LDPKV+GDH  T+  E I + LDGLTV QA++  RLFILDHHD    Y 
Sbjct  381  RRLQEFPPASKLDPKVFGDHRSTVREEHIKNNLDGLTVHQALKDNRLFILDHHDHFMPYL  440

Query  365  RRINDNTDRKIYATRTLLFLLKDGTLRPIAIELSKPHPDGD  487
            RRIN+ TD +IYA+RTLLFL  DGTL+P+ IELS PHP+ D
Sbjct  441  RRINE-TDNRIYASRTLLFLQSDGTLKPLVIELSLPHPEKD  480



>ref|NP_001280980.1| probable linoleate 9S-lipoxygenase 5 [Malus domestica]
 gb|AGK82784.1| lipoxygenase [Malus domestica]
Length=879

 Score =   206 bits (523),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 99/162 (61%), Positives = 124/162 (77%), Gaps = 1/162 (1%)
 Frame = +2

Query  2    PILEHIQKNTPLEMIKELLRSDGEKMFKFPTPQVIADNKTAWRTDEEFAREMLAGVNPVS  181
            P L+ I++  P E++KEL+RSDGE+  KFP P VI  +++AWRTD+EF REMLAGVNPV+
Sbjct  331  PTLKKIRERIPWELLKELIRSDGERFLKFPMPDVIKKDRSAWRTDKEFGREMLAGVNPVN  390

Query  182  ISRLQMFPQRSTLDPKVYGDHTCTITREDIADKLDGLTVEQAIESKRLFILDHHDAITLY  361
            I+RL+ FP  S LDPKVYG+   +I  E I   ++ LTVE+A E  RLFILDHHDA+ LY
Sbjct  391  ITRLKEFPPVSKLDPKVYGNQNSSIREEHIKGNMNDLTVEEATEKNRLFILDHHDALMLY  450

Query  362  ARRINDNTDRKIYATRTLLFLLKDGTLRPIAIELSKPHPDGD  487
             R+IN +TD K YATRTLL L +DGTL+P+AIELS PHP GD
Sbjct  451  LRQIN-STDTKTYATRTLLLLQEDGTLKPLAIELSLPHPQGD  491



>ref|XP_009597615.1| PREDICTED: linoleate 9S-lipoxygenase 6 [Nicotiana tomentosiformis]
Length=861

 Score =   206 bits (523),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 100/162 (62%), Positives = 125/162 (77%), Gaps = 1/162 (1%)
 Frame = +2

Query  2    PILEHIQKNTPLEMIKELLRSDGEKMFKFPTPQVIADNKTAWRTDEEFAREMLAGVNPVS  181
            P+ + +    PLEM+KELLR+DGE + KFPTP VI ++KTAWRTDEEF REMLAGVNPV 
Sbjct  321  PLFKALISAIPLEMVKELLRTDGEGIMKFPTPLVIKEDKTAWRTDEEFGREMLAGVNPVI  380

Query  182  ISRLQMFPQRSTLDPKVYGDHTCTITREDIADKLDGLTVEQAIESKRLFILDHHDAITLY  361
            I  LQ FP +S LDP+VYG+   TIT + I D+LD LT+++AI++ RLFIL+HHD +  Y
Sbjct  381  IRNLQEFPPKSKLDPQVYGNQDSTITIQHIEDRLDRLTIDEAIKTNRLFILNHHDMVMPY  440

Query  362  ARRINDNTDRKIYATRTLLFLLKDGTLRPIAIELSKPHPDGD  487
             RRIN  T  K YA+RTLLFL  +G+L+P+AIELS PHPDGD
Sbjct  441  LRRIN-TTTTKTYASRTLLFLQDNGSLKPLAIELSLPHPDGD  481



>ref|XP_002315780.1| lipoxygenase family protein [Populus trichocarpa]
 gb|EEF01951.1| lipoxygenase family protein [Populus trichocarpa]
Length=880

 Score =   206 bits (523),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 99/162 (61%), Positives = 124/162 (77%), Gaps = 1/162 (1%)
 Frame = +2

Query  2    PILEHIQKNTPLEMIKELLRSDGEKMFKFPTPQVIADNKTAWRTDEEFAREMLAGVNPVS  181
            P L  I+ + P EM++EL+R+DGE+  KFP P VI  +K+AWRTDEEFAREMLAGVNPV 
Sbjct  335  PTLHKIRDHVPWEMLRELVRNDGERFLKFPKPDVIKADKSAWRTDEEFAREMLAGVNPVI  394

Query  182  ISRLQMFPQRSTLDPKVYGDHTCTITREDIADKLDGLTVEQAIESKRLFILDHHDAITLY  361
            ISRLQ FP  S LDPK YG+   +I +E I + ++GLTV+QA++S RL+ILDHHDA+  Y
Sbjct  395  ISRLQEFPPASKLDPKAYGNQNSSIRKELIEENMNGLTVDQALKSNRLYILDHHDALIPY  454

Query  362  ARRINDNTDRKIYATRTLLFLLKDGTLRPIAIELSKPHPDGD  487
             RRIN +T  K YA+RT+L L  DGTL+P+AIELS PHP GD
Sbjct  455  LRRIN-STSTKTYASRTILLLQDDGTLKPLAIELSLPHPQGD  495



>ref|XP_004139172.1| PREDICTED: probable linoleate 9S-lipoxygenase 5-like [Cucumis 
sativus]
Length=864

 Score =   205 bits (522),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 97/161 (60%), Positives = 124/161 (77%), Gaps = 1/161 (1%)
 Frame = +2

Query  5    ILEHIQKNTPLEMIKELLRSDGEKMFKFPTPQVIADNKTAWRTDEEFAREMLAGVNPVSI  184
            +L+ I +N P  ++KE+ R+DGE+  +FPTPQ++ ++KTAW +DEEFAREMLAGVNPV I
Sbjct  323  LLQGITENIPAPLLKEIFRTDGERFLRFPTPQLVHEDKTAWSSDEEFAREMLAGVNPVLI  382

Query  185  SRLQMFPQRSTLDPKVYGDHTCTITREDIADKLDGLTVEQAIESKRLFILDHHDAITLYA  364
            +RL  FP +STLD  +YGD T  IT E I D LDGLTV +A+E K+L+IL+HHD++  Y 
Sbjct  383  ARLDEFPPKSTLDTNIYGDQTSKITEEHIKDGLDGLTVNEAVEKKKLYILNHHDSLIPYL  442

Query  365  RRINDNTDRKIYATRTLLFLLKDGTLRPIAIELSKPHPDGD  487
            RRIN  T  K YATRT+LFL  DGTL+P+AIELS PHP GD
Sbjct  443  RRIN-TTPTKTYATRTVLFLKNDGTLKPLAIELSLPHPQGD  482



>ref|XP_008224534.1| PREDICTED: linoleate 9S-lipoxygenase 5, chloroplastic [Prunus 
mume]
Length=881

 Score =   205 bits (522),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 101/162 (62%), Positives = 122/162 (75%), Gaps = 1/162 (1%)
 Frame = +2

Query  2    PILEHIQKNTPLEMIKELLRSDGEKMFKFPTPQVIADNKTAWRTDEEFAREMLAGVNPVS  181
            P L+ I+   P E+ KEL+RSDGE+  KFP P VI  +++AWRTDEEFAREMLAGV+PV+
Sbjct  333  PTLKKIRDCIPWELFKELVRSDGERFLKFPLPDVINKDRSAWRTDEEFAREMLAGVSPVN  392

Query  182  ISRLQMFPQRSTLDPKVYGDHTCTITREDIADKLDGLTVEQAIESKRLFILDHHDAITLY  361
            I+RLQ FP  S L P VYG+   +I  E I   +DGLTVEQA++  RLFILDHHDA+  Y
Sbjct  393  IARLQEFPPTSKLKPDVYGNQNSSIREEHIEKNMDGLTVEQAMQWNRLFILDHHDALMPY  452

Query  362  ARRINDNTDRKIYATRTLLFLLKDGTLRPIAIELSKPHPDGD  487
             RRIN +T  K YATRTLLFL +DGTL+P+AIELS PHP GD
Sbjct  453  LRRIN-STHTKTYATRTLLFLKEDGTLKPLAIELSLPHPQGD  493



>gb|KDO74648.1| hypothetical protein CISIN_1g002776mg [Citrus sinensis]
Length=803

 Score =   205 bits (521),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 99/157 (63%), Positives = 123/157 (78%), Gaps = 1/157 (1%)
 Frame = +2

Query  17   IQKNTPLEMIKELLRSDGEKMFKFPTPQVIADNKTAWRTDEEFAREMLAGVNPVSISRLQ  196
            I+   P EM+KEL+R+DGE+  KFP P VI ++++AWRTDEEFAREMLAGVNPV ISRLQ
Sbjct  263  IRDRIPWEMLKELVRNDGERFLKFPMPDVIKEDRSAWRTDEEFAREMLAGVNPVIISRLQ  322

Query  197  MFPQRSTLDPKVYGDHTCTITREDIADKLDGLTVEQAIESKRLFILDHHDAITLYARRIN  376
             FP  S LDPKVYG+   +ITR DI   ++ LT+++AIE+K+LF LDHHDA+  Y RRIN
Sbjct  323  EFPPASNLDPKVYGNQHSSITRADIERNMNELTIDEAIENKKLFTLDHHDALMPYLRRIN  382

Query  377  DNTDRKIYATRTLLFLLKDGTLRPIAIELSKPHPDGD  487
             +T+ K YA+RTLL L  DGTL+P+AIELS PHP GD
Sbjct  383  -STNTKTYASRTLLLLQNDGTLKPLAIELSLPHPQGD  418



>ref|XP_006419898.1| hypothetical protein CICLE_v10004281mg [Citrus clementina]
 ref|XP_006489365.1| PREDICTED: linoleate 9S-lipoxygenase 5, chloroplastic-like [Citrus 
sinensis]
 gb|ESR33138.1| hypothetical protein CICLE_v10004281mg [Citrus clementina]
Length=882

 Score =   205 bits (522),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 99/157 (63%), Positives = 123/157 (78%), Gaps = 1/157 (1%)
 Frame = +2

Query  17   IQKNTPLEMIKELLRSDGEKMFKFPTPQVIADNKTAWRTDEEFAREMLAGVNPVSISRLQ  196
            I+   P EM+KEL+R+DGE+  KFP P VI ++++AWRTDEEFAREMLAGVNPV ISRLQ
Sbjct  342  IRDRIPWEMLKELVRNDGERFLKFPMPDVIKEDRSAWRTDEEFAREMLAGVNPVIISRLQ  401

Query  197  MFPQRSTLDPKVYGDHTCTITREDIADKLDGLTVEQAIESKRLFILDHHDAITLYARRIN  376
             FP  S LDPKVYG+   +ITR DI   ++ LT+++AIE+K+LF LDHHDA+  Y RRIN
Sbjct  402  EFPPASNLDPKVYGNQHSSITRADIERNMNELTIDEAIENKKLFTLDHHDALMPYLRRIN  461

Query  377  DNTDRKIYATRTLLFLLKDGTLRPIAIELSKPHPDGD  487
             +T+ K YA+RTLL L  DGTL+P+AIELS PHP GD
Sbjct  462  -STNTKTYASRTLLLLQNDGTLKPLAIELSLPHPQGD  497



>gb|KDO74647.1| hypothetical protein CISIN_1g002776mg [Citrus sinensis]
Length=882

 Score =   205 bits (522),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 99/157 (63%), Positives = 123/157 (78%), Gaps = 1/157 (1%)
 Frame = +2

Query  17   IQKNTPLEMIKELLRSDGEKMFKFPTPQVIADNKTAWRTDEEFAREMLAGVNPVSISRLQ  196
            I+   P EM+KEL+R+DGE+  KFP P VI ++++AWRTDEEFAREMLAGVNPV ISRLQ
Sbjct  342  IRDRIPWEMLKELVRNDGERFLKFPMPDVIKEDRSAWRTDEEFAREMLAGVNPVIISRLQ  401

Query  197  MFPQRSTLDPKVYGDHTCTITREDIADKLDGLTVEQAIESKRLFILDHHDAITLYARRIN  376
             FP  S LDPKVYG+   +ITR DI   ++ LT+++AIE+K+LF LDHHDA+  Y RRIN
Sbjct  402  EFPPASNLDPKVYGNQHSSITRADIERNMNELTIDEAIENKKLFTLDHHDALMPYLRRIN  461

Query  377  DNTDRKIYATRTLLFLLKDGTLRPIAIELSKPHPDGD  487
             +T+ K YA+RTLL L  DGTL+P+AIELS PHP GD
Sbjct  462  -STNTKTYASRTLLLLQNDGTLKPLAIELSLPHPQGD  497



>gb|AAO03558.1| lipoxygenase 1 [Brassica napus]
Length=857

 Score =   205 bits (521),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 98/161 (61%), Positives = 121/161 (75%), Gaps = 1/161 (1%)
 Frame = +2

Query  5    ILEHIQKNTPLEMIKELLRSDGEKMFKFPTPQVIADNKTAWRTDEEFAREMLAGVNPVSI  184
            +++ I KN PLEM+KE+ R+DG+K  K+P PQVI ++KTAWRTDEEFAREMLAG+NPV I
Sbjct  318  LIDSIVKNIPLEMLKEIFRTDGQKFLKYPVPQVIKEDKTAWRTDEEFAREMLAGLNPVVI  377

Query  185  SRLQMFPQRSTLDPKVYGDHTCTITREDIADKLDGLTVEQAIESKRLFILDHHDAITLYA  364
              L+ FP +S LD + YG    T T+  I   LDGLTVE+A+E +RLFILDHHD +  Y 
Sbjct  378  QLLKEFPPKSKLDRETYGGQNSTFTKSHIEQSLDGLTVEEALEKERLFILDHHDTLMPYL  437

Query  365  RRINDNTDRKIYATRTLLFLLKDGTLRPIAIELSKPHPDGD  487
             RIN  T  K+YA+RTLLFL  DGTL+P+ IELS PHPDGD
Sbjct  438  GRIN-TTGNKVYASRTLLFLKDDGTLKPLVIELSLPHPDGD  477



>ref|XP_004156418.1| PREDICTED: probable linoleate 9S-lipoxygenase 5-like [Cucumis 
sativus]
Length=852

 Score =   205 bits (521),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 99/161 (61%), Positives = 123/161 (76%), Gaps = 1/161 (1%)
 Frame = +2

Query  5    ILEHIQKNTPLEMIKELLRSDGEKMFKFPTPQVIADNKTAWRTDEEFAREMLAGVNPVSI  184
            + E I++N     +KE+ R+DGE++FKFP PQVI ++K+AWRTDEEF REMLAG+NPV I
Sbjct  313  LFEVIRENIAAPFLKEIFRTDGERLFKFPLPQVIKEDKSAWRTDEEFGREMLAGLNPVVI  372

Query  185  SRLQMFPQRSTLDPKVYGDHTCTITREDIADKLDGLTVEQAIESKRLFILDHHDAITLYA  364
             RLQ FP RS LDP+VYGD    IT E I   LDGLTVE+AI+  RLFILDHHD++  Y 
Sbjct  373  RRLQDFPPRSKLDPEVYGDQKSKITEEQIIHNLDGLTVEEAIKKNRLFILDHHDSLMPYL  432

Query  365  RRINDNTDRKIYATRTLLFLLKDGTLRPIAIELSKPHPDGD  487
            RRIN  T  K YA+RT+LFL ++GTL+P+AIELS P+P GD
Sbjct  433  RRIN-TTSTKTYASRTILFLQENGTLKPLAIELSLPNPQGD  472



>emb|CDP20620.1| unnamed protein product [Coffea canephora]
Length=772

 Score =   204 bits (520),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 98/157 (62%), Positives = 126/157 (80%), Gaps = 1/157 (1%)
 Frame = +2

Query  17   IQKNTPLEMIKELLRSDGEKMFKFPTPQVIADNKTAWRTDEEFAREMLAGVNPVSISRLQ  196
            + +N  LE++K++L +DGE + K+P P++I  +++AWRTDEEFAREMLAG+NPV IS L+
Sbjct  264  LTENISLEILKQVLPTDGEGLLKYPLPKIIEGDRSAWRTDEEFAREMLAGLNPVIISALK  323

Query  197  MFPQRSTLDPKVYGDHTCTITREDIADKLDGLTVEQAIESKRLFILDHHDAITLYARRIN  376
             FP  S +DP VYG+HT TITRE I +KLDGLTVE+AI++ RLFIL+HHD I  Y RRIN
Sbjct  324  EFPPVSKIDPNVYGNHTSTITREHIENKLDGLTVEEAIKTNRLFILNHHDTIMPYLRRIN  383

Query  377  DNTDRKIYATRTLLFLLKDGTLRPIAIELSKPHPDGD  487
              T  K YA+RTLLFL ++GTL+P+AIELS PHPDGD
Sbjct  384  -ATPTKTYASRTLLFLHENGTLKPVAIELSLPHPDGD  419



>gb|AHX56188.1| lipoxygenase [Diospyros kaki]
Length=876

 Score =   205 bits (521),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 99/161 (61%), Positives = 124/161 (77%), Gaps = 1/161 (1%)
 Frame = +2

Query  5    ILEHIQKNTPLEMIKELLRSDGEKMFKFPTPQVIADNKTAWRTDEEFAREMLAGVNPVSI  184
            +L  I++  P E++KEL+RSDGE++FKFP P VI ++K+AWR DEEFAREMLAGVNPV I
Sbjct  332  LLNKIREYIPCEILKELVRSDGERLFKFPMPDVIKEDKSAWRKDEEFAREMLAGVNPVVI  391

Query  185  SRLQMFPQRSTLDPKVYGDHTCTITREDIADKLDGLTVEQAIESKRLFILDHHDAITLYA  364
              LQ FP  S LDP +YG+ T T+TRE I   ++GLTV++AI++ +LFILDHHDA+  Y 
Sbjct  392  RGLQEFPPASKLDPIIYGNQTSTVTREQIEKNMNGLTVDKAIKNNKLFILDHHDALMPYL  451

Query  365  RRINDNTDRKIYATRTLLFLLKDGTLRPIAIELSKPHPDGD  487
            RRIN  T  K YA+RTLL L  DGTL+P+AIELS PHP GD
Sbjct  452  RRIN-TTSTKTYASRTLLLLQDDGTLKPLAIELSLPHPQGD  491



>ref|XP_006359918.1| PREDICTED: probable linoleate 9S-lipoxygenase 5-like isoform 
X2 [Solanum tuberosum]
 ref|XP_006359919.1| PREDICTED: probable linoleate 9S-lipoxygenase 5-like isoform 
X3 [Solanum tuberosum]
 ref|XP_006359920.1| PREDICTED: probable linoleate 9S-lipoxygenase 5-like isoform 
X4 [Solanum tuberosum]
 ref|XP_006359921.1| PREDICTED: probable linoleate 9S-lipoxygenase 5-like isoform 
X5 [Solanum tuberosum]
Length=877

 Score =   205 bits (521),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 101/160 (63%), Positives = 121/160 (76%), Gaps = 1/160 (1%)
 Frame = +2

Query  8    LEHIQKNTPLEMIKELLRSDGEKMFKFPTPQVIADNKTAWRTDEEFAREMLAGVNPVSIS  187
            L+ +++  P EM+KEL+RSDGE   KFP P VI  +++AWRTDEEF REMLAGVNPV I 
Sbjct  334  LKKLRQCIPWEMLKELVRSDGEPFLKFPMPDVIKVDRSAWRTDEEFGREMLAGVNPVIIR  393

Query  188  RLQMFPQRSTLDPKVYGDHTCTITREDIADKLDGLTVEQAIESKRLFILDHHDAITLYAR  367
            RLQ FP  S LDP+VYG+ T +I RE I   +DGLTV++AIE  RLFILDHHD++  Y R
Sbjct  394  RLQEFPPASKLDPEVYGNQTSSIKREHIDKNMDGLTVDEAIECNRLFILDHHDSLLPYLR  453

Query  368  RINDNTDRKIYATRTLLFLLKDGTLRPIAIELSKPHPDGD  487
            RIN  T  K YA+RTLLFL  +GTLRP+AIELS PHP GD
Sbjct  454  RIN-TTKTKTYASRTLLFLQDNGTLRPLAIELSLPHPQGD  492



>ref|XP_010934565.1| PREDICTED: probable linoleate 9S-lipoxygenase 5 [Elaeis guineensis]
Length=885

 Score =   205 bits (521),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 98/163 (60%), Positives = 124/163 (76%), Gaps = 1/163 (1%)
 Frame = +2

Query  2    PILEHIQKNTPLEMIKELLRSDG-EKMFKFPTPQVIADNKTAWRTDEEFAREMLAGVNPV  178
            P+L+ +++  P EM+KE+LR++G +++ KFP P V   +K AW++DEEFAREMLAGVNP+
Sbjct  343  PLLDELRERIPFEMVKEMLRTEGNQRLLKFPLPHVNRVDKYAWQSDEEFAREMLAGVNPL  402

Query  179  SISRLQMFPQRSTLDPKVYGDHTCTITREDIADKLDGLTVEQAIESKRLFILDHHDAITL  358
             ISRLQ+FP  S LDP  YG+ T +IT   I   LDGLTV+QA+ES RLFILDHHD +  
Sbjct  403  MISRLQVFPPTSKLDPNKYGNQTSSITAAHIQKNLDGLTVDQALESNRLFILDHHDTLMP  462

Query  359  YARRINDNTDRKIYATRTLLFLLKDGTLRPIAIELSKPHPDGD  487
            Y  RIN NT  K YATRTLLFL +D TL+P+AIELS PHPDG+
Sbjct  463  YINRINSNTSNKAYATRTLLFLKEDQTLKPVAIELSLPHPDGE  505



>ref|XP_006344622.1| PREDICTED: linoleate 9S-lipoxygenase B-like [Solanum tuberosum]
Length=860

 Score =   205 bits (521),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 95/162 (59%), Positives = 127/162 (78%), Gaps = 0/162 (0%)
 Frame = +2

Query  2    PILEHIQKNTPLEMIKELLRSDGEKMFKFPTPQVIADNKTAWRTDEEFAREMLAGVNPVS  181
            P+L+ I  + P E++K++L++DG+ + K+P P+VI D+KTAWRTDEEF REMLAG+NPV 
Sbjct  319  PLLKTITDSIPSEILKDILQTDGQGLLKYPIPRVIQDDKTAWRTDEEFGREMLAGINPVV  378

Query  182  ISRLQMFPQRSTLDPKVYGDHTCTITREDIADKLDGLTVEQAIESKRLFILDHHDAITLY  361
            ISRLQ FP +S LDP +YG+   TIT E + DKLDGLTV++AI++ RLFIL+HHD +   
Sbjct  379  ISRLQEFPPKSKLDPTIYGNQNSTITTEHVKDKLDGLTVDEAIKTNRLFILNHHDIVMPL  438

Query  362  ARRINDNTDRKIYATRTLLFLLKDGTLRPIAIELSKPHPDGD  487
             R+IN + + K YA+RTLLFL  + TL+P+AIELS PHPDGD
Sbjct  439  LRKINMSANTKAYASRTLLFLQDNRTLKPLAIELSLPHPDGD  480



>ref|XP_010102744.1| putative linoleate 9S-lipoxygenase 5 [Morus notabilis]
 gb|EXB94013.1| putative linoleate 9S-lipoxygenase 5 [Morus notabilis]
Length=882

 Score =   205 bits (521),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 102/180 (57%), Positives = 128/180 (71%), Gaps = 20/180 (11%)
 Frame = +2

Query  5    ILEHIQKNTPLEMIKELLR-------------------SDGEKMFKFPTPQVIADNKTAW  127
            +L+HI++  P E++KE+ R                   SDG ++ K+P PQV+ ++++AW
Sbjct  324  LLKHIREKIPAELLKEIFRTDGAQLLKYPLPQVVKGIISDGAQLLKYPLPQVVKEDRSAW  383

Query  128  RTDEEFAREMLAGVNPVSISRLQMFPQRSTLDPKVYGDHTCTITREDIADKLDGLTVEQA  307
            RTDEEFAREML+GVNPV ISRLQ FP RS LD +VYGDHT TIT + I + LDGLTV +A
Sbjct  384  RTDEEFAREMLSGVNPVIISRLQEFPPRSKLDQEVYGDHTSTITEQHIENNLDGLTVTEA  443

Query  308  IESKRLFILDHHDAITLYARRINDNTDRKIYATRTLLFLLKDGTLRPIAIELSKPHPDGD  487
            IE  +LFILDHHD +  Y RRIN +T  K YA+RTLLFL  DGTL+P+ IELS PHPDGD
Sbjct  444  IEKNKLFILDHHDTLFPYLRRIN-STSTKTYASRTLLFLKNDGTLKPLVIELSLPHPDGD  502



>ref|XP_006359917.1| PREDICTED: probable linoleate 9S-lipoxygenase 5-like isoform 
X1 [Solanum tuberosum]
Length=887

 Score =   204 bits (520),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 101/160 (63%), Positives = 121/160 (76%), Gaps = 1/160 (1%)
 Frame = +2

Query  8    LEHIQKNTPLEMIKELLRSDGEKMFKFPTPQVIADNKTAWRTDEEFAREMLAGVNPVSIS  187
            L+ +++  P EM+KEL+RSDGE   KFP P VI  +++AWRTDEEF REMLAGVNPV I 
Sbjct  344  LKKLRQCIPWEMLKELVRSDGEPFLKFPMPDVIKVDRSAWRTDEEFGREMLAGVNPVIIR  403

Query  188  RLQMFPQRSTLDPKVYGDHTCTITREDIADKLDGLTVEQAIESKRLFILDHHDAITLYAR  367
            RLQ FP  S LDP+VYG+ T +I RE I   +DGLTV++AIE  RLFILDHHD++  Y R
Sbjct  404  RLQEFPPASKLDPEVYGNQTSSIKREHIDKNMDGLTVDEAIECNRLFILDHHDSLLPYLR  463

Query  368  RINDNTDRKIYATRTLLFLLKDGTLRPIAIELSKPHPDGD  487
            RIN  T  K YA+RTLLFL  +GTLRP+AIELS PHP GD
Sbjct  464  RIN-TTKTKTYASRTLLFLQDNGTLRPLAIELSLPHPQGD  502



>gb|KHN16119.1| Putative linoleate 9S-lipoxygenase 5 [Glycine soja]
Length=852

 Score =   204 bits (520),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 96/161 (60%), Positives = 125/161 (78%), Gaps = 1/161 (1%)
 Frame = +2

Query  5    ILEHIQKNTPLEMIKELLRSDGEKMFKFPTPQVIADNKTAWRTDEEFAREMLAGVNPVSI  184
            IL  ++ N P EM+KE+ RSDG+++ KFP PQVIA +K+AW+TDEEF RE+LAG+NPV I
Sbjct  326  ILTEVRDNIPAEMLKEIFRSDGQRLLKFPVPQVIAVDKSAWQTDEEFGRELLAGINPVVI  385

Query  185  SRLQMFPQRSTLDPKVYGDHTCTITREDIADKLDGLTVEQAIESKRLFILDHHDAITLYA  364
              LQ FP  S LDPK+YG+ T TIT+E I   L+G TV++AI+ +RLFILD HDA+  Y 
Sbjct  386  RGLQEFPPASKLDPKIYGNQTSTITKEHIESNLEGFTVDEAIKERRLFILDLHDALIPYV  445

Query  365  RRINDNTDRKIYATRTLLFLLKDGTLRPIAIELSKPHPDGD  487
            +RIN +T  K+YA+RT+LFL   GTL+P+AIELS PHP+GD
Sbjct  446  KRIN-STSTKMYASRTILFLQDSGTLKPLAIELSLPHPEGD  485



>ref|NP_175900.1| lipoxygenase 1 [Arabidopsis thaliana]
 sp|Q06327.1|LOX1_ARATH RecName: Full=Linoleate 9S-lipoxygenase 1; AltName: Full=Lipoxygenase 
1; Short=AtLOX1 [Arabidopsis thaliana]
 gb|AAG51123.1|AC069144_20 lipoxygenase, putative [Arabidopsis thaliana]
 gb|AAA32827.1| lipoxygenase [Arabidopsis thaliana]
 gb|AAA17036.1| lipoxygenase 1 [Arabidopsis thaliana]
 gb|AAM13103.1| lipoxygenase, putative [Arabidopsis thaliana]
 gb|AAQ56801.1| At1g55020 [Arabidopsis thaliana]
 gb|AEE33175.1| lipoxygenase 1 [Arabidopsis thaliana]
Length=859

 Score =   204 bits (520),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 98/161 (61%), Positives = 122/161 (76%), Gaps = 1/161 (1%)
 Frame = +2

Query  5    ILEHIQKNTPLEMIKELLRSDGEKMFKFPTPQVIADNKTAWRTDEEFAREMLAGVNPVSI  184
            +++ I KN PLEM+KE+ R+DG+K  KFP PQVI ++KTAWRTDEEFAREMLAG+NPV I
Sbjct  320  LIDSIVKNIPLEMLKEIFRTDGQKFLKFPVPQVIKEDKTAWRTDEEFAREMLAGLNPVVI  379

Query  185  SRLQMFPQRSTLDPKVYGDHTCTITREDIADKLDGLTVEQAIESKRLFILDHHDAITLYA  364
              L+ FP +S LD + YG+   TIT+  I   LDGLTVE+A+E +RLFILDHHD +  Y 
Sbjct  380  QLLKEFPPKSKLDSESYGNQNSTITKSHIEHNLDGLTVEEALEKERLFILDHHDTLMPYL  439

Query  365  RRINDNTDRKIYATRTLLFLLKDGTLRPIAIELSKPHPDGD  487
             R+N  T  K YA+RTLLFL  DGTL+P+ IELS PHP+GD
Sbjct  440  GRVN-TTTTKTYASRTLLFLKDDGTLKPLVIELSLPHPNGD  479



>ref|XP_003536076.1| PREDICTED: probable linoleate 9S-lipoxygenase 5-like [Glycine 
max]
Length=865

 Score =   204 bits (520),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 96/161 (60%), Positives = 125/161 (78%), Gaps = 1/161 (1%)
 Frame = +2

Query  5    ILEHIQKNTPLEMIKELLRSDGEKMFKFPTPQVIADNKTAWRTDEEFAREMLAGVNPVSI  184
            IL  ++ N P EM+KE+ RSDG+++ KFP PQVIA +K+AW+TDEEF RE+LAG+NPV I
Sbjct  326  ILTEVRDNIPAEMLKEIFRSDGQRLLKFPVPQVIAVDKSAWQTDEEFGRELLAGINPVVI  385

Query  185  SRLQMFPQRSTLDPKVYGDHTCTITREDIADKLDGLTVEQAIESKRLFILDHHDAITLYA  364
              LQ FP  S LDPK+YG+ T TIT+E I   L+G TV++AI+ +RLFILD HDA+  Y 
Sbjct  386  RGLQEFPPASKLDPKIYGNQTSTITKEHIESNLEGFTVDEAIKERRLFILDLHDALIPYV  445

Query  365  RRINDNTDRKIYATRTLLFLLKDGTLRPIAIELSKPHPDGD  487
            +RIN +T  K+YA+RT+LFL   GTL+P+AIELS PHP+GD
Sbjct  446  KRIN-STSTKMYASRTILFLQDSGTLKPLAIELSLPHPEGD  485



>ref|XP_010667400.1| PREDICTED: probable linoleate 9S-lipoxygenase 5 [Beta vulgaris 
subsp. vulgaris]
Length=895

 Score =   204 bits (520),  Expect = 4e-58, Method: Compositional matrix adjust.
 Identities = 98/160 (61%), Positives = 121/160 (76%), Gaps = 1/160 (1%)
 Frame = +2

Query  8    LEHIQKNTPLEMIKELLRSDGEKMFKFPTPQVIADNKTAWRTDEEFAREMLAGVNPVSIS  187
            L+ ++   P EM+KEL R+DGE+  KFP P VI ++K+AWRTDEEF REMLAGVNPV I 
Sbjct  352  LKKLKDRIPWEMLKELFRTDGEQFLKFPMPDVIKEDKSAWRTDEEFGREMLAGVNPVLIR  411

Query  188  RLQMFPQRSTLDPKVYGDHTCTITREDIADKLDGLTVEQAIESKRLFILDHHDAITLYAR  367
            RL+ FP +S LDPKVYG+   +ITRE I   +DG + E+AIES RL+ILDHHD++  Y  
Sbjct  412  RLEEFPPKSKLDPKVYGNQNSSITREHIEKNMDGYSTEKAIESNRLYILDHHDSLMPYIT  471

Query  368  RINDNTDRKIYATRTLLFLLKDGTLRPIAIELSKPHPDGD  487
            RIN +T  K YATRT+LFL  DGTL+P+AIELS PHP GD
Sbjct  472  RIN-STPTKTYATRTILFLKHDGTLQPLAIELSLPHPQGD  510



>ref|XP_003521704.2| PREDICTED: probable linoleate 9S-lipoxygenase 5-like [Glycine 
max]
Length=858

 Score =   204 bits (519),  Expect = 4e-58, Method: Compositional matrix adjust.
 Identities = 100/161 (62%), Positives = 123/161 (76%), Gaps = 1/161 (1%)
 Frame = +2

Query  5    ILEHIQKNTPLEMIKELLRSDGEKMFKFPTPQVIADNKTAWRTDEEFAREMLAGVNPVSI  184
            IL++I+   P EM+KE+LR+DGE+  KFP PQVI ++K+AWRTDEEFAREMLAGVNPV I
Sbjct  319  ILKNIRDKIPAEMLKEILRTDGERFLKFPVPQVIKEDKSAWRTDEEFAREMLAGVNPVII  378

Query  185  SRLQMFPQRSTLDPKVYGDHTCTITREDIADKLDGLTVEQAIESKRLFILDHHDAITLYA  364
              L+ FP  S LD KVYGD T TI ++ I   +DGLTV +AI  K+LFILDHHDA+  Y 
Sbjct  379  RCLKEFPPESKLDSKVYGDQTSTIRKKHIESNMDGLTVNEAIRQKKLFILDHHDALIPYL  438

Query  365  RRINDNTDRKIYATRTLLFLLKDGTLRPIAIELSKPHPDGD  487
            RRIN +T  K YA+RT+LFL  DGTL+P+ IELS PHP+ D
Sbjct  439  RRIN-STSTKTYASRTILFLQNDGTLKPLVIELSLPHPEED  478



>ref|XP_004494612.1| PREDICTED: probable linoleate 9S-lipoxygenase 5-like [Cicer arietinum]
Length=863

 Score =   204 bits (519),  Expect = 4e-58, Method: Compositional matrix adjust.
 Identities = 98/161 (61%), Positives = 122/161 (76%), Gaps = 1/161 (1%)
 Frame = +2

Query  5    ILEHIQKNTPLEMIKELLRSDGEKMFKFPTPQVIADNKTAWRTDEEFAREMLAGVNPVSI  184
            +++ I+ N P +M+K++ R DGE   K+P PQVI ++K+AWRTDEEFAREMLAGVNPV I
Sbjct  324  LVKGIRDNIPAKMLKQIFRIDGENFLKYPVPQVIKEDKSAWRTDEEFAREMLAGVNPVII  383

Query  185  SRLQMFPQRSTLDPKVYGDHTCTITREDIADKLDGLTVEQAIESKRLFILDHHDAITLYA  364
              LQ FP  S LDP VYGD +  I +E I   LDGLTVE+AI  K+LFILDHHDA+  Y 
Sbjct  384  CCLQEFPPTSKLDPTVYGDQSSKIRKEHIESNLDGLTVEEAITQKKLFILDHHDALIPYL  443

Query  365  RRINDNTDRKIYATRTLLFLLKDGTLRPIAIELSKPHPDGD  487
            RRIN +T  K YA+RT+LFL  +GTL+P+AIELS PHP+GD
Sbjct  444  RRIN-STSTKTYASRTILFLQNNGTLKPLAIELSLPHPEGD  483



>ref|XP_006300394.1| hypothetical protein CARUB_v10019783mg [Capsella rubella]
 gb|EOA33292.1| hypothetical protein CARUB_v10019783mg [Capsella rubella]
Length=859

 Score =   204 bits (518),  Expect = 5e-58, Method: Compositional matrix adjust.
 Identities = 97/161 (60%), Positives = 123/161 (76%), Gaps = 1/161 (1%)
 Frame = +2

Query  5    ILEHIQKNTPLEMIKELLRSDGEKMFKFPTPQVIADNKTAWRTDEEFAREMLAGVNPVSI  184
            +++ I KN PLEM++E+ R+DG+K  K+P PQVI ++KTAWRTDEEFAREMLAG+NPV I
Sbjct  320  LIDSIVKNIPLEMLREIFRTDGQKFLKYPVPQVIKEDKTAWRTDEEFAREMLAGLNPVVI  379

Query  185  SRLQMFPQRSTLDPKVYGDHTCTITREDIADKLDGLTVEQAIESKRLFILDHHDAITLYA  364
              LQ FP +S L+ ++YG+   TIT+  I   LDGLTVE+A+E +RLFILDHHD +  Y 
Sbjct  380  QLLQEFPPKSKLESELYGNQNSTITKSHIEHNLDGLTVEEALEKERLFILDHHDTLMPYL  439

Query  365  RRINDNTDRKIYATRTLLFLLKDGTLRPIAIELSKPHPDGD  487
             RIN  T  K YA+RT+LFL  DGTL+P+ IELS PHPDGD
Sbjct  440  GRIN-TTTTKTYASRTVLFLKDDGTLKPLVIELSLPHPDGD  479



>gb|ABF60002.1| lipoxygenase 2 [Actinidia deliciosa]
Length=865

 Score =   204 bits (518),  Expect = 6e-58, Method: Compositional matrix adjust.
 Identities = 97/162 (60%), Positives = 127/162 (78%), Gaps = 1/162 (1%)
 Frame = +2

Query  2    PILEHIQKNTPLEMIKELLRSDGEKMFKFPTPQVIADNKTAWRTDEEFAREMLAGVNPVS  181
            P+LE I+   PL+ +KELLR+DGE+ F+FPTPQVI ++K+AWRTDEEFAREMLAG+NPV 
Sbjct  325  PLLESIRNQIPLQTLKELLRTDGEQPFRFPTPQVIKEDKSAWRTDEEFAREMLAGINPVV  384

Query  182  ISRLQMFPQRSTLDPKVYGDHTCTITREDIADKLDGLTVEQAIESKRLFILDHHDAITLY  361
            I RLQ FP  S L+P+VY +   + T+E I   L+GLT+++A+ +K+LF LD+HD +  Y
Sbjct  385  ICRLQEFPPNSKLNPQVYNNEASSKTKECIEKNLEGLTIDEALNNKKLFTLDYHDILMPY  444

Query  362  ARRINDNTDRKIYATRTLLFLLKDGTLRPIAIELSKPHPDGD  487
             RRIN +T  KIYATRTLLFL  DGTL+P+AIE+S PHP+ D
Sbjct  445  LRRIN-STSTKIYATRTLLFLKNDGTLKPLAIEMSLPHPEDD  485



>gb|KJB28315.1| hypothetical protein B456_005G041900 [Gossypium raimondii]
Length=877

 Score =   204 bits (518),  Expect = 7e-58, Method: Compositional matrix adjust.
 Identities = 99/160 (62%), Positives = 120/160 (75%), Gaps = 1/160 (1%)
 Frame = +2

Query  8    LEHIQKNTPLEMIKELLRSDGEKMFKFPTPQVIADNKTAWRTDEEFAREMLAGVNPVSIS  187
            L+ I+   P EMIKEL+R+DGE++ KFP P VI DN++AWRTDEEFARE LAGVNPV IS
Sbjct  334  LKKIKDCLPWEMIKELVRNDGERLMKFPMPAVINDNRSAWRTDEEFARETLAGVNPVVIS  393

Query  188  RLQMFPQRSTLDPKVYGDHTCTITREDIADKLDGLTVEQAIESKRLFILDHHDAITLYAR  367
            RL+ FP  S LDP VYG+   TIT+E I   ++GLT E+A++  +LFILDHHDA+  Y R
Sbjct  394  RLEEFPPASKLDPSVYGNQNSTITKEHIEMNMNGLTAEEALKGNKLFILDHHDALMPYIR  453

Query  368  RINDNTDRKIYATRTLLFLLKDGTLRPIAIELSKPHPDGD  487
            RIN +T  K YATRTL  L  DG L+P+AIELS PHP GD
Sbjct  454  RIN-STSTKTYATRTLFLLQDDGMLKPLAIELSLPHPQGD  492



>gb|AEQ30071.1| lipoxygenase [Litchi chinensis]
Length=872

 Score =   203 bits (517),  Expect = 7e-58, Method: Compositional matrix adjust.
 Identities = 96/161 (60%), Positives = 126/161 (78%), Gaps = 1/161 (1%)
 Frame = +2

Query  5    ILEHIQKNTPLEMIKELLRSDGEKMFKFPTPQVIADNKTAWRTDEEFAREMLAGVNPVSI  184
            +L+ I+KN PLE++KE+ ++DG ++F++P PQVI +N+TAWRTDEEFAREMLAGVNPV I
Sbjct  333  LLDDIRKNIPLELLKEIFQTDGARLFEYPMPQVIQNNRTAWRTDEEFAREMLAGVNPVII  392

Query  185  SRLQMFPQRSTLDPKVYGDHTCTITREDIADKLDGLTVEQAIESKRLFILDHHDAITLYA  364
             RL+ FP  S LD K+YG+   TIT + I   LDG+T+E+A+++ RLFILDHHD +T Y 
Sbjct  393  RRLEEFPPTSKLDSKLYGNQNSTITAKHIEGNLDGVTIEEALKNNRLFILDHHDILTPYL  452

Query  365  RRINDNTDRKIYATRTLLFLLKDGTLRPIAIELSKPHPDGD  487
            RRIN  T  K YA+RT+LFL  DGTL+P+ IELS+PH  GD
Sbjct  453  RRIN-TTTTKTYASRTILFLKDDGTLKPLVIELSRPHDKGD  492



>ref|XP_004495725.1| PREDICTED: probable linoleate 9S-lipoxygenase 5-like [Cicer arietinum]
Length=858

 Score =   203 bits (517),  Expect = 8e-58, Method: Compositional matrix adjust.
 Identities = 102/161 (63%), Positives = 122/161 (76%), Gaps = 1/161 (1%)
 Frame = +2

Query  5    ILEHIQKNTPLEMIKELLRSDGEKMFKFPTPQVIADNKTAWRTDEEFAREMLAGVNPVSI  184
            IL+ ++ N   EM KE+LR+DGE   KFP PQVIA +K+AWRTDEEFAREMLAGVNPV I
Sbjct  319  ILKGVRDNIHGEMFKEILRTDGENFLKFPLPQVIAADKSAWRTDEEFAREMLAGVNPVII  378

Query  185  SRLQMFPQRSTLDPKVYGDHTCTITREDIADKLDGLTVEQAIESKRLFILDHHDAITLYA  364
              LQ FP  S LD KVYGD +  IT+ED+   L+GLTV++AI  KRLFILDHHD +  Y 
Sbjct  379  CCLQKFPPSSKLDHKVYGDQSSKITKEDLDINLNGLTVDKAIREKRLFILDHHDTLMPYL  438

Query  365  RRINDNTDRKIYATRTLLFLLKDGTLRPIAIELSKPHPDGD  487
            RRIN +T  K YA+RT+LFL  +GTL+P+AIELS PH DGD
Sbjct  439  RRIN-STSTKTYASRTILFLQDNGTLKPLAIELSLPHSDGD  478



>gb|AGK82798.1| lipoxygenase [Malus domestica]
Length=864

 Score =   203 bits (517),  Expect = 8e-58, Method: Compositional matrix adjust.
 Identities = 100/162 (62%), Positives = 124/162 (77%), Gaps = 2/162 (1%)
 Frame = +2

Query  5    ILEHIQKNTPLEMIKELLRSDGEKMFKFPTPQVIADNKTAWRTDEEFAREMLAGVNPVSI  184
            + + I  + P EM+KE+ R+DG +  +FP P+VI  +KTAWRTDEEFAREMLAGVNPV+I
Sbjct  324  LFKEIGDSIPAEMLKEIFRTDGAQFLRFPMPEVIKVDKTAWRTDEEFAREMLAGVNPVNI  383

Query  185  SRLQM-FPQRSTLDPKVYGDHTCTITREDIADKLDGLTVEQAIESKRLFILDHHDAITLY  361
              LQ  FP  S LDPKVYGD T TIT + I + LDGLTV++A+++K+LFILDHHDA+  Y
Sbjct  384  RLLQQEFPPASKLDPKVYGDQTSTITEQHIKNNLDGLTVDEALKNKKLFILDHHDALMPY  443

Query  362  ARRINDNTDRKIYATRTLLFLLKDGTLRPIAIELSKPHPDGD  487
             RRIN +T  KIY +RTLLFL  DGTL+ + IELS PHPDGD
Sbjct  444  LRRIN-STSNKIYGSRTLLFLKSDGTLKILVIELSLPHPDGD  484



>ref|XP_007143236.1| hypothetical protein PHAVU_007G055600g [Phaseolus vulgaris]
 gb|ESW15230.1| hypothetical protein PHAVU_007G055600g [Phaseolus vulgaris]
Length=855

 Score =   203 bits (517),  Expect = 9e-58, Method: Compositional matrix adjust.
 Identities = 99/162 (61%), Positives = 123/162 (76%), Gaps = 1/162 (1%)
 Frame = +2

Query  2    PILEHIQKNTPLEMIKELLRSDGEKMFKFPTPQVIADNKTAWRTDEEFAREMLAGVNPVS  181
            P+   +++  P E+++EL+RSDGEK  KFP P VI  NKTAWRTD+EFAREMLAGVNPV 
Sbjct  310  PLAVKLRELVPYEIVRELIRSDGEKFLKFPVPDVIKANKTAWRTDDEFAREMLAGVNPVI  369

Query  182  ISRLQMFPQRSTLDPKVYGDHTCTITREDIADKLDGLTVEQAIESKRLFILDHHDAITLY  361
            I RLQ FP  S LDPK+YGD T +I    I + L+GLT+++AI+  RLFILDHHDA+  Y
Sbjct  370  IRRLQEFPPASKLDPKLYGDQTSSIREVHIENSLNGLTIDEAIQKMRLFILDHHDALMPY  429

Query  362  ARRINDNTDRKIYATRTLLFLLKDGTLRPIAIELSKPHPDGD  487
              RIN +T+ K YA+RTLLFL  DGTL+P+AIELS PHP G+
Sbjct  430  ISRIN-STNTKTYASRTLLFLQDDGTLKPLAIELSLPHPQGE  470



>gb|AAA74393.1| lipoxygenase [Solanum lycopersicum]
Length=859

 Score =   203 bits (516),  Expect = 9e-58, Method: Compositional matrix adjust.
 Identities = 97/162 (60%), Positives = 123/162 (76%), Gaps = 0/162 (0%)
 Frame = +2

Query  2    PILEHIQKNTPLEMIKELLRSDGEKMFKFPTPQVIADNKTAWRTDEEFAREMLAGVNPVS  181
            P L+ I  N   E++K++L++DG+ + K+PTPQVI  +KTAWRTDEEF REMLAG NPV 
Sbjct  319  PWLKAITDNISSEILKDILQTDGQGLLKYPTPQVIQGDKTAWRTDEEFGREMLAGSNPVL  378

Query  182  ISRLQMFPQRSTLDPKVYGDHTCTITREDIADKLDGLTVEQAIESKRLFILDHHDAITLY  361
            ISRLQ FP +S LDP +YG+   TIT E + DKL+GLTV +AI+S RLFIL+HHD +   
Sbjct  379  ISRLQEFPPKSKLDPTIYGNQNSTITTEHVQDKLNGLTVNEAIKSNRLFILNHHDIVMPL  438

Query  362  ARRINDNTDRKIYATRTLLFLLKDGTLRPIAIELSKPHPDGD  487
             R+IN + + K YA+RTLLFL  D TL+P+AIELS PHPDGD
Sbjct  439  LRKINMSANTKAYASRTLLFLQDDRTLKPLAIELSLPHPDGD  480



>ref|NP_001234873.1| linoleate 9S-lipoxygenase B [Solanum lycopersicum]
 sp|P38416.1|LOXB_SOLLC RecName: Full=Linoleate 9S-lipoxygenase B; AltName: Full=Lipoxygenase 
B [Solanum lycopersicum]
 gb|AAA53183.1| lipoxygenase [Solanum lycopersicum]
Length=859

 Score =   203 bits (516),  Expect = 9e-58, Method: Compositional matrix adjust.
 Identities = 97/162 (60%), Positives = 123/162 (76%), Gaps = 0/162 (0%)
 Frame = +2

Query  2    PILEHIQKNTPLEMIKELLRSDGEKMFKFPTPQVIADNKTAWRTDEEFAREMLAGVNPVS  181
            P L+ I  N   E++K++L++DG+ + K+PTPQVI  +KTAWRTDEEF REMLAG NPV 
Sbjct  319  PWLKAITDNISSEILKDILQTDGQGLLKYPTPQVIQGDKTAWRTDEEFGREMLAGSNPVL  378

Query  182  ISRLQMFPQRSTLDPKVYGDHTCTITREDIADKLDGLTVEQAIESKRLFILDHHDAITLY  361
            ISRLQ FP +S LDP +YG+   TIT E + DKL+GLTV +AI+S RLFIL+HHD +   
Sbjct  379  ISRLQEFPPKSKLDPTIYGNQNSTITTEHVQDKLNGLTVNEAIKSNRLFILNHHDIVMPL  438

Query  362  ARRINDNTDRKIYATRTLLFLLKDGTLRPIAIELSKPHPDGD  487
             R+IN + + K YA+RTLLFL  D TL+P+AIELS PHPDGD
Sbjct  439  LRKINMSANTKAYASRTLLFLQDDRTLKPLAIELSLPHPDGD  480



>ref|XP_010324011.1| PREDICTED: linoleate 9S-lipoxygenase B isoform X1 [Solanum lycopersicum]
Length=859

 Score =   203 bits (516),  Expect = 9e-58, Method: Compositional matrix adjust.
 Identities = 97/162 (60%), Positives = 123/162 (76%), Gaps = 0/162 (0%)
 Frame = +2

Query  2    PILEHIQKNTPLEMIKELLRSDGEKMFKFPTPQVIADNKTAWRTDEEFAREMLAGVNPVS  181
            P L+ I  N   E++K++L++DG+ + K+PTPQVI  +KTAWRTDEEF REMLAG NPV 
Sbjct  319  PWLKAITDNISSEILKDILQTDGQGLLKYPTPQVIQGDKTAWRTDEEFGREMLAGSNPVL  378

Query  182  ISRLQMFPQRSTLDPKVYGDHTCTITREDIADKLDGLTVEQAIESKRLFILDHHDAITLY  361
            ISRLQ FP +S LDP +YG+   TIT E + DKL+GLTV +AI+S RLFIL+HHD +   
Sbjct  379  ISRLQEFPPKSKLDPTIYGNQNSTITTEHVQDKLNGLTVNEAIKSNRLFILNHHDIVMPL  438

Query  362  ARRINDNTDRKIYATRTLLFLLKDGTLRPIAIELSKPHPDGD  487
             R+IN + + K YA+RTLLFL  D TL+P+AIELS PHPDGD
Sbjct  439  LRKINMSANTKAYASRTLLFLQDDRTLKPLAIELSLPHPDGD  480



>ref|XP_006344836.1| PREDICTED: probable linoleate 9S-lipoxygenase 5-like [Solanum 
tuberosum]
Length=845

 Score =   203 bits (516),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 97/159 (61%), Positives = 122/159 (77%), Gaps = 1/159 (1%)
 Frame = +2

Query  11   EHIQKNTPLEMIKELLRSDGEKMFKFPTPQVIADNKTAWRTDEEFAREMLAGVNPVSISR  190
            E + + +  EMIKE ++S G++  K+P PQVI ++K+AWRTDEEFAREMLAG+NPV I  
Sbjct  308  EDVLQRSSTEMIKEFIQSSGQEFLKYPMPQVIKEDKSAWRTDEEFAREMLAGINPVCICG  367

Query  191  LQMFPQRSTLDPKVYGDHTCTITREDIADKLDGLTVEQAIESKRLFILDHHDAITLYARR  370
            L+ FP  S LDPKVYGD T  ITRE I ++LDGLT+E+AI++ +LFIL+HHD    Y R+
Sbjct  368  LKEFPPTSKLDPKVYGDQTSNITREHIQNQLDGLTIEEAIKANQLFILNHHDTFMPYMRQ  427

Query  371  INDNTDRKIYATRTLLFLLKDGTLRPIAIELSKPHPDGD  487
            IN  T  KIYA+RTLLFL KDGTL+ + IELS PHPDGD
Sbjct  428  IN-MTSTKIYASRTLLFLQKDGTLKLLGIELSLPHPDGD  465



>gb|AGN75068.1| lipoxygenase 2 [Momordica charantia]
Length=845

 Score =   203 bits (516),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 98/161 (61%), Positives = 125/161 (78%), Gaps = 1/161 (1%)
 Frame = +2

Query  5    ILEHIQKNTPLEMIKELLRSDGEKMFKFPTPQVIADNKTAWRTDEEFAREMLAGVNPVSI  184
            + E I++N    ++KE+ R+DGE++FKFP PQVI ++++AWRTDEEF RE+LAGVNPV I
Sbjct  306  LFEAIRENIAAPLLKEIFRTDGERLFKFPLPQVIKEDRSAWRTDEEFGREILAGVNPVVI  365

Query  185  SRLQMFPQRSTLDPKVYGDHTCTITREDIADKLDGLTVEQAIESKRLFILDHHDAITLYA  364
             RLQ+FP  S LDP+VYGD    IT+E I DKLDGLTVE+AI+  RLFILD HD++  Y 
Sbjct  366  RRLQVFPPTSKLDPEVYGDQNSKITKEHIIDKLDGLTVEEAIKRNRLFILDPHDSLMPYL  425

Query  365  RRINDNTDRKIYATRTLLFLLKDGTLRPIAIELSKPHPDGD  487
            RRIN  T  K YA+RT+LFL +DGTL+P+AIELS  +P GD
Sbjct  426  RRIN-TTSTKTYASRTILFLKEDGTLKPLAIELSLRNPQGD  465



>gb|KHN15782.1| Linoleate 9S-lipoxygenase 5, chloroplastic [Glycine soja]
Length=858

 Score =   203 bits (516),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 98/162 (60%), Positives = 124/162 (77%), Gaps = 1/162 (1%)
 Frame = +2

Query  2    PILEHIQKNTPLEMIKELLRSDGEKMFKFPTPQVIADNKTAWRTDEEFAREMLAGVNPVS  181
            P+   ++K  P E+++EL+R+DGE+  KFP P VI  +KTAWRTDEEFAREMLAGVNPV 
Sbjct  313  PLTSKLRKLVPYELLRELIRNDGERFLKFPVPDVIKVSKTAWRTDEEFAREMLAGVNPVI  372

Query  182  ISRLQMFPQRSTLDPKVYGDHTCTITREDIADKLDGLTVEQAIESKRLFILDHHDAITLY  361
            I RLQ FP  S LDP+VYGD T +I    I + LDGLT+++AI++ RLFILDHHD++  Y
Sbjct  373  IRRLQEFPPASKLDPRVYGDQTSSIRATHIENSLDGLTIDEAIQNMRLFILDHHDSLMPY  432

Query  362  ARRINDNTDRKIYATRTLLFLLKDGTLRPIAIELSKPHPDGD  487
              RIN +T+ K YA+RTLLFL  DGTL+P+AIELS PHP G+
Sbjct  433  ISRIN-STNTKTYASRTLLFLQDDGTLKPLAIELSLPHPQGE  473



>ref|XP_011021548.1| PREDICTED: probable linoleate 9S-lipoxygenase 5 isoform X1 [Populus 
euphratica]
Length=881

 Score =   203 bits (516),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 99/162 (61%), Positives = 122/162 (75%), Gaps = 1/162 (1%)
 Frame = +2

Query  2    PILEHIQKNTPLEMIKELLRSDGEKMFKFPTPQVIADNKTAWRTDEEFAREMLAGVNPVS  181
            P L  I+ + P EM+ EL+R+DGE+  KFP P VI  +K+AWRTDEEFAREMLAGVNPV 
Sbjct  336  PTLHKIRDHIPWEMLGELVRNDGERFLKFPKPDVIKADKSAWRTDEEFAREMLAGVNPVI  395

Query  182  ISRLQMFPQRSTLDPKVYGDHTCTITREDIADKLDGLTVEQAIESKRLFILDHHDAITLY  361
            ISRLQ FP  S LDPK YG    +I +E I + ++GLTV+QA++S RL+ILDHHDA+  Y
Sbjct  396  ISRLQEFPPASKLDPKAYGHQKSSIRKELIEENMNGLTVDQALKSNRLYILDHHDALIPY  455

Query  362  ARRINDNTDRKIYATRTLLFLLKDGTLRPIAIELSKPHPDGD  487
             RRIN +T  K YA+RT+L L  DGTL+P+AIELS PHP GD
Sbjct  456  LRRIN-STSTKTYASRTILLLQDDGTLKPLAIELSLPHPQGD  496



>ref|XP_006382595.1| hypothetical protein POPTR_0005s03580g [Populus trichocarpa]
 gb|ERP60392.1| hypothetical protein POPTR_0005s03580g [Populus trichocarpa]
Length=863

 Score =   202 bits (515),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 95/162 (59%), Positives = 122/162 (75%), Gaps = 1/162 (1%)
 Frame = +2

Query  2    PILEHIQKNTPLEMIKELLRSDGEKMFKFPTPQVIADNKTAWRTDEEFAREMLAGVNPVS  181
            P++++I++  PL+M+KE+ R+DGE +F+FP PQVI  NKT WRTDEEF REMLAG+NPV 
Sbjct  323  PLVDNIREKIPLQMLKEIFRTDGENLFEFPMPQVIEGNKTGWRTDEEFGREMLAGLNPVV  382

Query  182  ISRLQMFPQRSTLDPKVYGDHTCTITREDIADKLDGLTVEQAIESKRLFILDHHDAITLY  361
            I RL+ FP +S LD K YGD    IT EDI + L+GLT ++AI+  R+FILDHHDA+  Y
Sbjct  383  IRRLEEFPPKSKLDSKQYGDQNSKITEEDIKNNLEGLTTDEAIKKNRMFILDHHDALMPY  442

Query  362  ARRINDNTDRKIYATRTLLFLLKDGTLRPIAIELSKPHPDGD  487
             R+IN    +  YATRTLLFL  DGTL+P+ IELS PH +GD
Sbjct  443  LRKIN-TPSKNTYATRTLLFLKDDGTLKPLVIELSLPHEEGD  483



>ref|XP_011021549.1| PREDICTED: probable linoleate 9S-lipoxygenase 5 isoform X2 [Populus 
euphratica]
Length=880

 Score =   203 bits (516),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 99/162 (61%), Positives = 122/162 (75%), Gaps = 1/162 (1%)
 Frame = +2

Query  2    PILEHIQKNTPLEMIKELLRSDGEKMFKFPTPQVIADNKTAWRTDEEFAREMLAGVNPVS  181
            P L  I+ + P EM+ EL+R+DGE+  KFP P VI  +K+AWRTDEEFAREMLAGVNPV 
Sbjct  335  PTLHKIRDHIPWEMLGELVRNDGERFLKFPKPDVIKADKSAWRTDEEFAREMLAGVNPVI  394

Query  182  ISRLQMFPQRSTLDPKVYGDHTCTITREDIADKLDGLTVEQAIESKRLFILDHHDAITLY  361
            ISRLQ FP  S LDPK YG    +I +E I + ++GLTV+QA++S RL+ILDHHDA+  Y
Sbjct  395  ISRLQEFPPASKLDPKAYGHQKSSIRKELIEENMNGLTVDQALKSNRLYILDHHDALIPY  454

Query  362  ARRINDNTDRKIYATRTLLFLLKDGTLRPIAIELSKPHPDGD  487
             RRIN +T  K YA+RT+L L  DGTL+P+AIELS PHP GD
Sbjct  455  LRRIN-STSTKTYASRTILLLQDDGTLKPLAIELSLPHPQGD  495



>gb|AIC82456.1| lipoxygenase [Cocos nucifera]
Length=852

 Score =   202 bits (515),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 99/160 (62%), Positives = 121/160 (76%), Gaps = 1/160 (1%)
 Frame = +2

Query  8    LEHIQKNTPLEMIKELLRSDGEKMFKFPTPQVIADNKTAWRTDEEFAREMLAGVNPVSIS  187
            L+ I+   P EMIKEL++++GE + K P PQVI  +K AWRTDEEF REMLAGVNPV IS
Sbjct  309  LDEIKDRIPFEMIKELVQTNGEHLLKLPMPQVIQADKFAWRTDEEFGREMLAGVNPVIIS  368

Query  188  RLQMFPQRSTLDPKVYGDHTCTITREDIADKLDGLTVEQAIESKRLFILDHHDAITLYAR  367
            RL+ FP  S LDPK+YG+HT +IT   I   +DGLTVEQA++S RLFILDHHD +  Y  
Sbjct  369  RLEEFPPTSKLDPKIYGNHTSSITAPQIEKNMDGLTVEQALKSNRLFILDHHDTLVPYLN  428

Query  368  RINDNTDRKIYATRTLLFLLKDGTLRPIAIELSKPHPDGD  487
            RIN +T  KIYA+RTLL L  DG+L+P+AIELS  HPDG+
Sbjct  429  RIN-STSSKIYASRTLLLLKDDGSLKPLAIELSLLHPDGE  467



>gb|KHF98566.1| Linoleate 9S-lipoxygenase 5, chloroplastic [Gossypium arboreum]
Length=845

 Score =   202 bits (515),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 99/160 (62%), Positives = 120/160 (75%), Gaps = 1/160 (1%)
 Frame = +2

Query  8    LEHIQKNTPLEMIKELLRSDGEKMFKFPTPQVIADNKTAWRTDEEFAREMLAGVNPVSIS  187
            L+ I+   P EMIKEL+R+DGE++ KFP P VI DN++AWRTDEEFARE LAGVNPV IS
Sbjct  302  LKKIKDCLPWEMIKELVRNDGERLMKFPMPAVINDNRSAWRTDEEFARETLAGVNPVVIS  361

Query  188  RLQMFPQRSTLDPKVYGDHTCTITREDIADKLDGLTVEQAIESKRLFILDHHDAITLYAR  367
            RL+ FP  S LDP VYG+   TIT+E I   ++GLTVE+A++  +LFILDHHDA+  Y R
Sbjct  362  RLEEFPPASKLDPSVYGNQNSTITKEHIEMNMNGLTVEEALKGNKLFILDHHDALMPYIR  421

Query  368  RINDNTDRKIYATRTLLFLLKDGTLRPIAIELSKPHPDGD  487
             IN +T  K YATRTL  L  DG L+P+AIELS PHP GD
Sbjct  422  WIN-STSTKTYATRTLFLLQDDGMLKPLAIELSLPHPQGD  460



>gb|KHF98567.1| Linoleate 9S-lipoxygenase 5, chloroplastic [Gossypium arboreum]
Length=832

 Score =   202 bits (514),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 99/160 (62%), Positives = 120/160 (75%), Gaps = 1/160 (1%)
 Frame = +2

Query  8    LEHIQKNTPLEMIKELLRSDGEKMFKFPTPQVIADNKTAWRTDEEFAREMLAGVNPVSIS  187
            L+ I+   P EMIKEL+R+DGE++ KFP P VI DN++AWRTDEEFARE LAGVNPV IS
Sbjct  289  LKKIKDCLPWEMIKELVRNDGERLMKFPMPAVINDNRSAWRTDEEFARETLAGVNPVVIS  348

Query  188  RLQMFPQRSTLDPKVYGDHTCTITREDIADKLDGLTVEQAIESKRLFILDHHDAITLYAR  367
            RL+ FP  S LDP VYG+   TIT+E I   ++GLTVE+A++  +LFILDHHDA+  Y R
Sbjct  349  RLEEFPPASKLDPSVYGNQNSTITKEHIEMNMNGLTVEEALKGNKLFILDHHDALMPYIR  408

Query  368  RINDNTDRKIYATRTLLFLLKDGTLRPIAIELSKPHPDGD  487
             IN +T  K YATRTL  L  DG L+P+AIELS PHP GD
Sbjct  409  WIN-STSTKTYATRTLFLLQDDGMLKPLAIELSLPHPQGD  447



>ref|XP_007147045.1| hypothetical protein PHAVU_006G091400g [Phaseolus vulgaris]
 gb|ESW19039.1| hypothetical protein PHAVU_006G091400g [Phaseolus vulgaris]
Length=863

 Score =   202 bits (515),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 97/161 (60%), Positives = 125/161 (78%), Gaps = 1/161 (1%)
 Frame = +2

Query  5    ILEHIQKNTPLEMIKELLRSDGEKMFKFPTPQVIADNKTAWRTDEEFAREMLAGVNPVSI  184
            I+++++   P E++KE+LR+DGE+  KFP PQVI ++K+AWRTDEEFAREMLAGVNPV I
Sbjct  324  IIKNVRDKIPAELLKEILRTDGERFLKFPVPQVIKEDKSAWRTDEEFAREMLAGVNPVII  383

Query  185  SRLQMFPQRSTLDPKVYGDHTCTITREDIADKLDGLTVEQAIESKRLFILDHHDAITLYA  364
              LQ FP  S LD KVYG+ T TI +E+I   ++GLTV++AI  K+LFILDHHD +  Y 
Sbjct  384  RCLQEFPPASKLDAKVYGNQTSTIRKENIERNMNGLTVDEAIRHKKLFILDHHDTLIPYL  443

Query  365  RRINDNTDRKIYATRTLLFLLKDGTLRPIAIELSKPHPDGD  487
            RRIN +T  K YA+RT+LFL  DGTL+P+AIELS PH +GD
Sbjct  444  RRIN-STSTKTYASRTILFLQNDGTLKPMAIELSLPHSEGD  483



>ref|XP_003556040.1| PREDICTED: linoleate 9S-lipoxygenase 5, chloroplastic-like isoform 
X1 [Glycine max]
 ref|XP_006606050.1| PREDICTED: linoleate 9S-lipoxygenase 5, chloroplastic-like isoform 
X2 [Glycine max]
Length=858

 Score =   202 bits (514),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 98/162 (60%), Positives = 123/162 (76%), Gaps = 1/162 (1%)
 Frame = +2

Query  2    PILEHIQKNTPLEMIKELLRSDGEKMFKFPTPQVIADNKTAWRTDEEFAREMLAGVNPVS  181
            P+   ++K  P E+++EL+R+DGE+  KFP P VI  +KTAWRTDEEFAREMLAGVNPV 
Sbjct  313  PLTSKLRKLVPYELLRELIRNDGERFLKFPVPDVIKVSKTAWRTDEEFAREMLAGVNPVI  372

Query  182  ISRLQMFPQRSTLDPKVYGDHTCTITREDIADKLDGLTVEQAIESKRLFILDHHDAITLY  361
            I RLQ FP  S LDP VYGD T +I    I + LDGLT+++AI++ RLFILDHHD++  Y
Sbjct  373  IRRLQEFPPASKLDPSVYGDQTSSIRATHIENSLDGLTIDEAIQNMRLFILDHHDSLMPY  432

Query  362  ARRINDNTDRKIYATRTLLFLLKDGTLRPIAIELSKPHPDGD  487
              RIN +T+ K YA+RTLLFL  DGTL+P+AIELS PHP G+
Sbjct  433  ISRIN-STNTKTYASRTLLFLQDDGTLKPLAIELSLPHPQGE  473



>ref|XP_009763875.1| PREDICTED: probable linoleate 9S-lipoxygenase 5 isoform X2 [Nicotiana 
sylvestris]
Length=873

 Score =   202 bits (514),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 101/160 (63%), Positives = 120/160 (75%), Gaps = 1/160 (1%)
 Frame = +2

Query  8    LEHIQKNTPLEMIKELLRSDGEKMFKFPTPQVIADNKTAWRTDEEFAREMLAGVNPVSIS  187
            L  +++  P EM+KEL+RSDGE   KFP P VI  +++AWRTDEEF REMLAGVNPV I 
Sbjct  330  LNKLRQCIPWEMLKELVRSDGEPFLKFPMPDVIKVDRSAWRTDEEFGREMLAGVNPVIIR  389

Query  188  RLQMFPQRSTLDPKVYGDHTCTITREDIADKLDGLTVEQAIESKRLFILDHHDAITLYAR  367
            RLQ FP  S LDP VYG+ T +ITREDI   +D LTV++AIE  +LFILDHHDA+  Y R
Sbjct  390  RLQEFPPASKLDPIVYGNQTSSITREDIEKNMDELTVDEAIEYNKLFILDHHDALMPYLR  449

Query  368  RINDNTDRKIYATRTLLFLLKDGTLRPIAIELSKPHPDGD  487
            RIN  T+ K YA+RTLLFL  +GTLRP+AIELS  HP GD
Sbjct  450  RIN-TTNTKTYASRTLLFLQDNGTLRPLAIELSLSHPQGD  488



>ref|XP_009763870.1| PREDICTED: probable linoleate 9S-lipoxygenase 5 isoform X1 [Nicotiana 
sylvestris]
Length=883

 Score =   202 bits (514),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 101/160 (63%), Positives = 120/160 (75%), Gaps = 1/160 (1%)
 Frame = +2

Query  8    LEHIQKNTPLEMIKELLRSDGEKMFKFPTPQVIADNKTAWRTDEEFAREMLAGVNPVSIS  187
            L  +++  P EM+KEL+RSDGE   KFP P VI  +++AWRTDEEF REMLAGVNPV I 
Sbjct  340  LNKLRQCIPWEMLKELVRSDGEPFLKFPMPDVIKVDRSAWRTDEEFGREMLAGVNPVIIR  399

Query  188  RLQMFPQRSTLDPKVYGDHTCTITREDIADKLDGLTVEQAIESKRLFILDHHDAITLYAR  367
            RLQ FP  S LDP VYG+ T +ITREDI   +D LTV++AIE  +LFILDHHDA+  Y R
Sbjct  400  RLQEFPPASKLDPIVYGNQTSSITREDIEKNMDELTVDEAIEYNKLFILDHHDALMPYLR  459

Query  368  RINDNTDRKIYATRTLLFLLKDGTLRPIAIELSKPHPDGD  487
            RIN  T+ K YA+RTLLFL  +GTLRP+AIELS  HP GD
Sbjct  460  RIN-TTNTKTYASRTLLFLQDNGTLRPLAIELSLSHPQGD  498



>ref|XP_004139356.1| PREDICTED: probable linoleate 9S-lipoxygenase 5-like [Cucumis 
sativus]
Length=860

 Score =   202 bits (513),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 98/161 (61%), Positives = 116/161 (72%), Gaps = 1/161 (1%)
 Frame = +2

Query  5    ILEHIQKNTPLEMIKELLRSDGEKMFKFPTPQVIADNKTAWRTDEEFAREMLAGVNPVSI  184
            +LE  ++N P  ++KE+ R+DGE   KFP PQVI DNK+ WRTDEEFAREMLAGVNP+ I
Sbjct  321  LLEKFRQNIPAPLLKEIFRTDGENFLKFPLPQVIQDNKSGWRTDEEFAREMLAGVNPIII  380

Query  185  SRLQMFPQRSTLDPKVYGDHTCTITREDIADKLDGLTVEQAIESKRLFILDHHDAITLYA  364
             RLQ FP  S LDP VYGD    I+ E I + LDGLTV++AIE  +L+ILDHHDA+  Y 
Sbjct  381  RRLQEFPPSSKLDPNVYGDQNSKISEEHIINSLDGLTVQEAIEQNKLYILDHHDALMPYL  440

Query  365  RRINDNTDRKIYATRTLLFLLKDGTLRPIAIELSKPHPDGD  487
             RIN +T  K YATRTLLFL  DGTLRP+ IELS P    D
Sbjct  441  NRIN-STSTKTYATRTLLFLNGDGTLRPLVIELSLPQSQKD  480



>ref|XP_008454526.1| PREDICTED: probable linoleate 9S-lipoxygenase 5 [Cucumis melo]
Length=852

 Score =   201 bits (512),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 98/161 (61%), Positives = 122/161 (76%), Gaps = 1/161 (1%)
 Frame = +2

Query  5    ILEHIQKNTPLEMIKELLRSDGEKMFKFPTPQVIADNKTAWRTDEEFAREMLAGVNPVSI  184
            + E I++N     +KE+ R+DGE++FKFP PQVI ++K+AWRTDEEF REMLAG+NPV I
Sbjct  313  LFEVIRENIAAPFLKEIFRTDGERLFKFPLPQVIKEDKSAWRTDEEFGREMLAGLNPVII  372

Query  185  SRLQMFPQRSTLDPKVYGDHTCTITREDIADKLDGLTVEQAIESKRLFILDHHDAITLYA  364
             RLQ FP RS LDPKVYGD    IT E I   LDGLTVE+AI+  RLFILDHHD++  Y 
Sbjct  373  RRLQDFPPRSKLDPKVYGDQKSKITEEQIIHNLDGLTVEEAIKKNRLFILDHHDSLMPYL  432

Query  365  RRINDNTDRKIYATRTLLFLLKDGTLRPIAIELSKPHPDGD  487
            RR+N  T  K YA+RT+LFL ++GTL+P+AIELS P+  GD
Sbjct  433  RRVN-TTSTKTYASRTILFLQENGTLKPLAIELSLPNLQGD  472



>ref|XP_009376662.1| PREDICTED: probable linoleate 9S-lipoxygenase 5 [Pyrus x bretschneideri]
 ref|XP_009376685.1| PREDICTED: probable linoleate 9S-lipoxygenase 5 [Pyrus x bretschneideri]
Length=929

 Score =   202 bits (513),  Expect = 4e-57, Method: Compositional matrix adjust.
 Identities = 98/161 (61%), Positives = 124/161 (77%), Gaps = 1/161 (1%)
 Frame = +2

Query  5    ILEHIQKNTPLEMIKELLRSDGEKMFKFPTPQVIADNKTAWRTDEEFAREMLAGVNPVSI  184
            +++ I+   P EM+KEL R+DGEK  KFP PQVI ++ +AWRTDEEFAREMLAGVNPV+I
Sbjct  390  LIKFIRDRIPAEMVKELFRTDGEKFPKFPMPQVIKEDDSAWRTDEEFAREMLAGVNPVAI  449

Query  185  SRLQMFPQRSTLDPKVYGDHTCTITREDIADKLDGLTVEQAIESKRLFILDHHDAITLYA  364
             RL+ FP  S LD K+YGD T  I RE I   L+GL++++AI++ +LFILDHHD +  Y 
Sbjct  450  RRLKEFPPVSKLDQKLYGDQTSKINREHIEHNLNGLSIDEAIKNNKLFILDHHDTLMPYL  509

Query  365  RRINDNTDRKIYATRTLLFLLKDGTLRPIAIELSKPHPDGD  487
            RRIN+ T  KIYA+RTLLFL  DGTL+P+AIELS PH +GD
Sbjct  510  RRINE-TSTKIYASRTLLFLQDDGTLKPLAIELSWPHDNGD  549



>ref|XP_010553735.1| PREDICTED: linoleate 9S-lipoxygenase 1-like [Tarenaya hassleriana]
Length=859

 Score =   201 bits (511),  Expect = 5e-57, Method: Compositional matrix adjust.
 Identities = 94/161 (58%), Positives = 123/161 (76%), Gaps = 1/161 (1%)
 Frame = +2

Query  5    ILEHIQKNTPLEMIKELLRSDGEKMFKFPTPQVIADNKTAWRTDEEFAREMLAGVNPVSI  184
              ++I+ N PLE+++E+ R+DG K+ K+P PQ+I ++K+AWRTDEEFAREMLAG+NPV I
Sbjct  320  FFDNIRNNIPLELLREIFRTDGAKLLKYPEPQIIKEDKSAWRTDEEFAREMLAGLNPVVI  379

Query  185  SRLQMFPQRSTLDPKVYGDHTCTITREDIADKLDGLTVEQAIESKRLFILDHHDAITLYA  364
              L+ FP +S LD ++YG+ T TIT+  I   L+GL VE+A+E  RLFILDHHD +  Y 
Sbjct  380  RLLEEFPPKSKLDSQMYGNQTSTITKTHIEHNLEGLNVEEALEKARLFILDHHDTLMPYL  439

Query  365  RRINDNTDRKIYATRTLLFLLKDGTLRPIAIELSKPHPDGD  487
            RR+N  T  K YATRTLLFL +DGTL+P+ IELS PHPDGD
Sbjct  440  RRVN-MTGTKTYATRTLLFLKEDGTLKPLVIELSLPHPDGD  479



>ref|XP_010674738.1| PREDICTED: probable linoleate 9S-lipoxygenase 5 isoform X1 [Beta 
vulgaris subsp. vulgaris]
Length=875

 Score =   201 bits (511),  Expect = 6e-57, Method: Compositional matrix adjust.
 Identities = 93/162 (57%), Positives = 121/162 (75%), Gaps = 0/162 (0%)
 Frame = +2

Query  2    PILEHIQKNTPLEMIKELLRSDGEKMFKFPTPQVIADNKTAWRTDEEFAREMLAGVNPVS  181
            P+L  +++N P E +K LLRSDG  + K+P P +I  +K+AW+TDEEF R+MLAG+NP+ 
Sbjct  335  PLLAKLRENIPTEFLKSLLRSDGAAILKYPMPDIIKVDKSAWKTDEEFVRQMLAGINPLV  394

Query  182  ISRLQMFPQRSTLDPKVYGDHTCTITREDIADKLDGLTVEQAIESKRLFILDHHDAITLY  361
            I RL+ FP  S LDP+ YG+   +IT+E I + LDGLTV +AI+S R+FILDHHD I  Y
Sbjct  395  IRRLEEFPPLSKLDPRAYGNQNSSITKEFIEEYLDGLTVLEAIQSNRMFILDHHDTIMPY  454

Query  362  ARRINDNTDRKIYATRTLLFLLKDGTLRPIAIELSKPHPDGD  487
             R IN +T  K+YATRTLL L  DGTL+P+ IELSKPHP+GD
Sbjct  455  LREINTDTSSKVYATRTLLLLKDDGTLKPLVIELSKPHPEGD  496



>gb|KDO56302.1| hypothetical protein CISIN_1g002839mg [Citrus sinensis]
Length=874

 Score =   201 bits (510),  Expect = 7e-57, Method: Compositional matrix adjust.
 Identities = 96/161 (60%), Positives = 126/161 (78%), Gaps = 2/161 (1%)
 Frame = +2

Query  5    ILEHIQKNTPLEMIKELLRSDGEKMFKFPTPQVIADNKTAWRTDEEFAREMLAGVNPVSI  184
            +L+ I+K+ P EM+KE+ R+DG+ + KFP PQVI ++++AWRTDEEF REMLAG+NPV I
Sbjct  336  LLDDIRKHIPFEMLKEIFRTDGD-LLKFPMPQVIKEDESAWRTDEEFTREMLAGLNPVVI  394

Query  185  SRLQMFPQRSTLDPKVYGDHTCTITREDIADKLDGLTVEQAIESKRLFILDHHDAITLYA  364
              L+ FP  S L+P++YG+   TIT+ DI + LDGLTV++AIE  +LFILDHHD++  Y 
Sbjct  395  CCLKEFPPTSKLNPELYGNQRSTITQNDIENNLDGLTVDEAIEKNKLFILDHHDSLMTYL  454

Query  365  RRINDNTDRKIYATRTLLFLLKDGTLRPIAIELSKPHPDGD  487
            RRIN  T  K YA+RT+LFL  DGTL+P+AIELS PHPDGD
Sbjct  455  RRIN-TTSTKTYASRTILFLKADGTLKPVAIELSLPHPDGD  494



>ref|XP_006472029.1| PREDICTED: probable linoleate 9S-lipoxygenase 5-like isoform 
X2 [Citrus sinensis]
Length=808

 Score =   200 bits (509),  Expect = 8e-57, Method: Compositional matrix adjust.
 Identities = 96/161 (60%), Positives = 126/161 (78%), Gaps = 2/161 (1%)
 Frame = +2

Query  5    ILEHIQKNTPLEMIKELLRSDGEKMFKFPTPQVIADNKTAWRTDEEFAREMLAGVNPVSI  184
            +L+ I+K+ P EM+KE+ R+DG+ + KFP PQVI ++++AWRTDEEF REMLAG+NPV I
Sbjct  270  LLDDIRKHIPFEMLKEIFRTDGD-LLKFPMPQVIKEDESAWRTDEEFTREMLAGLNPVII  328

Query  185  SRLQMFPQRSTLDPKVYGDHTCTITREDIADKLDGLTVEQAIESKRLFILDHHDAITLYA  364
              L+ FP  S L+P++YG+   TIT+ DI + LDGLTV++AIE  +LFILDHHD++  Y 
Sbjct  329  CCLKEFPPTSKLNPELYGNQRSTITQNDIENNLDGLTVDEAIEKNKLFILDHHDSLMTYL  388

Query  365  RRINDNTDRKIYATRTLLFLLKDGTLRPIAIELSKPHPDGD  487
            RRIN  T  K YA+RT+LFL  DGTL+P+AIELS PHPDGD
Sbjct  389  RRIN-TTSTKTYASRTILFLKADGTLKPVAIELSLPHPDGD  428



>ref|XP_006433338.1| hypothetical protein CICLE_v10000236mg [Citrus clementina]
 ref|XP_006472028.1| PREDICTED: probable linoleate 9S-lipoxygenase 5-like isoform 
X1 [Citrus sinensis]
 gb|ESR46578.1| hypothetical protein CICLE_v10000236mg [Citrus clementina]
Length=874

 Score =   201 bits (510),  Expect = 8e-57, Method: Compositional matrix adjust.
 Identities = 96/161 (60%), Positives = 126/161 (78%), Gaps = 2/161 (1%)
 Frame = +2

Query  5    ILEHIQKNTPLEMIKELLRSDGEKMFKFPTPQVIADNKTAWRTDEEFAREMLAGVNPVSI  184
            +L+ I+K+ P EM+KE+ R+DG+ + KFP PQVI ++++AWRTDEEF REMLAG+NPV I
Sbjct  336  LLDDIRKHIPFEMLKEIFRTDGD-LLKFPMPQVIKEDESAWRTDEEFTREMLAGLNPVII  394

Query  185  SRLQMFPQRSTLDPKVYGDHTCTITREDIADKLDGLTVEQAIESKRLFILDHHDAITLYA  364
              L+ FP  S L+P++YG+   TIT+ DI + LDGLTV++AIE  +LFILDHHD++  Y 
Sbjct  395  CCLKEFPPTSKLNPELYGNQRSTITQNDIENNLDGLTVDEAIEKNKLFILDHHDSLMTYL  454

Query  365  RRINDNTDRKIYATRTLLFLLKDGTLRPIAIELSKPHPDGD  487
            RRIN  T  K YA+RT+LFL  DGTL+P+AIELS PHPDGD
Sbjct  455  RRIN-TTSTKTYASRTILFLKADGTLKPVAIELSLPHPDGD  494



>ref|XP_011036801.1| PREDICTED: probable linoleate 9S-lipoxygenase 5 [Populus euphratica]
Length=863

 Score =   200 bits (509),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 94/161 (58%), Positives = 122/161 (76%), Gaps = 1/161 (1%)
 Frame = +2

Query  5    ILEHIQKNTPLEMIKELLRSDGEKMFKFPTPQVIADNKTAWRTDEEFAREMLAGVNPVSI  184
            ++++I++  PL+M+KE+ R+DGE +F+FP PQVI  NKT WRTDEEF REMLAG+NPV I
Sbjct  324  LVDNIREKIPLQMLKEIFRTDGENLFEFPMPQVIQGNKTGWRTDEEFGREMLAGLNPVVI  383

Query  185  SRLQMFPQRSTLDPKVYGDHTCTITREDIADKLDGLTVEQAIESKRLFILDHHDAITLYA  364
             RL+ FP +S LD + YGD    IT EDI + L+GLT ++AI+  R+FILDHHDA+  Y 
Sbjct  384  RRLEEFPPKSKLDSEKYGDQNSKITEEDIKNNLEGLTTDEAIKKNRMFILDHHDALMPYL  443

Query  365  RRINDNTDRKIYATRTLLFLLKDGTLRPIAIELSKPHPDGD  487
            R+IN    +  YATRTLLFL  DGTL+P+AIELS PH +GD
Sbjct  444  RKIN-TPSKNTYATRTLLFLKDDGTLKPLAIELSLPHEEGD  483



>ref|XP_004139173.1| PREDICTED: probable linoleate 9S-lipoxygenase 5-like [Cucumis 
sativus]
Length=852

 Score =   200 bits (509),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 97/161 (60%), Positives = 122/161 (76%), Gaps = 1/161 (1%)
 Frame = +2

Query  5    ILEHIQKNTPLEMIKELLRSDGEKMFKFPTPQVIADNKTAWRTDEEFAREMLAGVNPVSI  184
            + E I++N     +KE+ R+DGE++FKFP PQVI ++K+AWRTDEEF REMLAG+NPV I
Sbjct  313  LFEVIRENIAAPFLKEIFRTDGERLFKFPLPQVIKEDKSAWRTDEEFGREMLAGLNPVVI  372

Query  185  SRLQMFPQRSTLDPKVYGDHTCTITREDIADKLDGLTVEQAIESKRLFILDHHDAITLYA  364
             +LQ FP RS LDP+VYGD    IT E I   LD LTVE+AI+  RLFILDHHD++  Y 
Sbjct  373  RKLQDFPPRSKLDPEVYGDQKSKITEEQIIHNLDELTVEEAIKKNRLFILDHHDSLMPYL  432

Query  365  RRINDNTDRKIYATRTLLFLLKDGTLRPIAIELSKPHPDGD  487
            RRIN  T  K YA+RT+LFL ++GTL+P+AIELS P+P GD
Sbjct  433  RRIN-TTSTKTYASRTILFLQENGTLKPLAIELSLPNPQGD  472



>dbj|BAH57745.1| lipoxygenase [Actinidia arguta]
Length=886

 Score =   200 bits (509),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 99/160 (62%), Positives = 119/160 (74%), Gaps = 1/160 (1%)
 Frame = +2

Query  8    LEHIQKNTPLEMIKELLRSDGEKMFKFPTPQVIADNKTAWRTDEEFAREMLAGVNPVSIS  187
            +  I+   P EM+KELLRSDGE++ KFP P VI  +K+AWRTDEEF REMLAGV+PV I 
Sbjct  343  ISKIKDCIPWEMLKELLRSDGERLLKFPMPDVIKADKSAWRTDEEFGREMLAGVSPVIIR  402

Query  188  RLQMFPQRSTLDPKVYGDHTCTITREDIADKLDGLTVEQAIESKRLFILDHHDAITLYAR  367
            RLQ FP  S LD K YG+ T ++TRE I   ++GLTV +AIE+ R+FILDHHDA+  Y R
Sbjct  403  RLQEFPPASKLDHKKYGNQTSSMTREQIEKNMNGLTVYEAIENNRMFILDHHDALMPYLR  462

Query  368  RINDNTDRKIYATRTLLFLLKDGTLRPIAIELSKPHPDGD  487
            RIN  T  K YA+RTLL L  DGTL+P+AIELS PHP GD
Sbjct  463  RIN-TTSTKTYASRTLLLLQDDGTLKPLAIELSLPHPQGD  501



>ref|NP_001237323.1| lipoxygenase-9 [Glycine max]
 gb|ABS32275.1| lipoxygenase-9 [Glycine max]
Length=865

 Score =   200 bits (509),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 96/157 (61%), Positives = 116/157 (74%), Gaps = 0/157 (0%)
 Frame = +2

Query  17   IQKNTPLEMIKELLRSDGEKMFKFPTPQVIADNKTAWRTDEEFAREMLAGVNPVSISRLQ  196
            + K +PL ++KE+ R+DGE++ KFP P VI  +K+AW TDEEF REMLAGVNP  I  LQ
Sbjct  329  LSKISPLPVLKEIFRTDGEQVLKFPPPHVIKVSKSAWMTDEEFGREMLAGVNPCLIECLQ  388

Query  197  MFPQRSTLDPKVYGDHTCTITREDIADKLDGLTVEQAIESKRLFILDHHDAITLYARRIN  376
            +FP +S LDP VYGD T TIT+E +   L GL+VEQA+   RLFILDHHDA   Y R+IN
Sbjct  389  VFPPKSKLDPTVYGDQTSTITKEHLEINLGGLSVEQALSGNRLFILDHHDAFIAYLRKIN  448

Query  377  DNTDRKIYATRTLLFLLKDGTLRPIAIELSKPHPDGD  487
            D    K YATRT+LFL  DGTL+P+AIELS PHP GD
Sbjct  449  DLPTAKSYATRTILFLKDDGTLKPLAIELSLPHPRGD  485



>ref|XP_008777614.1| PREDICTED: linoleate 9S-lipoxygenase 6-like [Phoenix dactylifera]
Length=885

 Score =   200 bits (509),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 97/163 (60%), Positives = 121/163 (74%), Gaps = 1/163 (1%)
 Frame = +2

Query  2    PILEHIQKNTPLEMIKELLRSDG-EKMFKFPTPQVIADNKTAWRTDEEFAREMLAGVNPV  178
            P+L+ I++  P EM+KE+LR++G +++ KFP P V    K AW++DEEFAREMLAGVNP+
Sbjct  343  PLLDEIRERIPFEMVKEMLRTEGNQRLLKFPLPHVTQVEKFAWQSDEEFAREMLAGVNPL  402

Query  179  SISRLQMFPQRSTLDPKVYGDHTCTITREDIADKLDGLTVEQAIESKRLFILDHHDAITL  358
             ISRL +FP  S LDP  YG+ T +IT   I   LDGLTV+QA+ES +LFILD HDA+  
Sbjct  403  MISRLHVFPPTSKLDPNKYGNQTSSITAAHIEKNLDGLTVDQALESNKLFILDLHDALIP  462

Query  359  YARRINDNTDRKIYATRTLLFLLKDGTLRPIAIELSKPHPDGD  487
            Y  RIN NT  K YATRTLLFL  D TL+P+AIELS PHPDG+
Sbjct  463  YINRINSNTSNKTYATRTLLFLKGDQTLKPVAIELSLPHPDGE  505



>gb|KHN01371.1| Linoleate 9S-lipoxygenase 1 [Glycine soja]
Length=846

 Score =   200 bits (508),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 96/157 (61%), Positives = 116/157 (74%), Gaps = 0/157 (0%)
 Frame = +2

Query  17   IQKNTPLEMIKELLRSDGEKMFKFPTPQVIADNKTAWRTDEEFAREMLAGVNPVSISRLQ  196
            + K +PL ++KE+ R+DGE++ KFP P VI  +K+AW TDEEF REMLAGVNP  I  LQ
Sbjct  310  LSKISPLPVLKEIFRTDGEQVLKFPPPHVIKVSKSAWMTDEEFGREMLAGVNPCLIECLQ  369

Query  197  MFPQRSTLDPKVYGDHTCTITREDIADKLDGLTVEQAIESKRLFILDHHDAITLYARRIN  376
            +FP +S LDP VYGD T TIT+E +   L GL+VEQA+   RLFILDHHDA   Y R+IN
Sbjct  370  VFPPKSKLDPTVYGDQTSTITKEHLEINLGGLSVEQALSGNRLFILDHHDAFIAYLRKIN  429

Query  377  DNTDRKIYATRTLLFLLKDGTLRPIAIELSKPHPDGD  487
            D    K YATRT+LFL  DGTL+P+AIELS PHP GD
Sbjct  430  DLPTAKSYATRTILFLKDDGTLKPLAIELSLPHPRGD  466



>ref|XP_003591120.1| Lipoxygenase [Medicago truncatula]
 gb|AES61371.1| linoleate 9S-lipoxygenase-like protein [Medicago truncatula]
Length=858

 Score =   200 bits (508),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 100/161 (62%), Positives = 125/161 (78%), Gaps = 1/161 (1%)
 Frame = +2

Query  5    ILEHIQKNTPLEMIKELLRSDGEKMFKFPTPQVIADNKTAWRTDEEFAREMLAGVNPVSI  184
            +L+ +++N   E++KE+LR+DGEK+ KFP PQVIA +K+AWRTDEEFAREMLAGVNPV I
Sbjct  319  LLKDVRENIHGEILKEILRTDGEKLLKFPLPQVIAVDKSAWRTDEEFAREMLAGVNPVMI  378

Query  185  SRLQMFPQRSTLDPKVYGDHTCTITREDIADKLDGLTVEQAIESKRLFILDHHDAITLYA  364
              LQ FP +S LD KVYGD +  IT+E I   LDGLTV++AI +K+LFILDHHD +  Y 
Sbjct  379  CSLQEFPPKSKLDHKVYGDQSSKITKEHIEINLDGLTVDEAIRAKKLFILDHHDTLMPYL  438

Query  365  RRINDNTDRKIYATRTLLFLLKDGTLRPIAIELSKPHPDGD  487
            RRIN  T  K YA+RT+LFL K+GTL+ +AIELS PH  GD
Sbjct  439  RRIN-YTSTKTYASRTILFLQKNGTLKLLAIELSLPHSVGD  478



>ref|XP_007225308.1| hypothetical protein PRUPE_ppa001207mg [Prunus persica]
 gb|ACH90245.1| lipoxygenase LOX-2 [Prunus persica]
 gb|EMJ26507.1| hypothetical protein PRUPE_ppa001207mg [Prunus persica]
Length=881

 Score =   200 bits (508),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 99/162 (61%), Positives = 121/162 (75%), Gaps = 1/162 (1%)
 Frame = +2

Query  2    PILEHIQKNTPLEMIKELLRSDGEKMFKFPTPQVIADNKTAWRTDEEFAREMLAGVNPVS  181
            P L+ I+   P E+ KEL+RSDGE+  KFP P VI  +++AWRTDEEFAREMLAGV+PV+
Sbjct  333  PTLKKIRDCIPWELFKELVRSDGERFLKFPLPDVINKDRSAWRTDEEFAREMLAGVSPVN  392

Query  182  ISRLQMFPQRSTLDPKVYGDHTCTITREDIADKLDGLTVEQAIESKRLFILDHHDAITLY  361
            I+ LQ FP  S L P VYG+   +I  E I   +D LTVEQA++  RLFILDHHDA+  Y
Sbjct  393  IACLQEFPPTSKLKPDVYGNQNSSIREEHIEKNMDDLTVEQAMQWNRLFILDHHDALMPY  452

Query  362  ARRINDNTDRKIYATRTLLFLLKDGTLRPIAIELSKPHPDGD  487
             RRIN +T+ K YATRTLLFL +DGTL+P+AIELS PHP GD
Sbjct  453  LRRIN-STNTKTYATRTLLFLKEDGTLKPLAIELSLPHPQGD  493



>gb|AIQ86601.1| lipoxygenase, partial [Prunus armeniaca]
Length=186

 Score =   187 bits (474),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 90/134 (67%), Positives = 105/134 (78%), Gaps = 1/134 (1%)
 Frame = +2

Query  86   FPTPQVIADNKTAWRTDEEFAREMLAGVNPVSISRLQMFPQRSTLDPKVYGDHTCTITRE  265
            FP PQVI DNK+AWRTDEEFAREMLAGVNPV+I RLQ FP  S LD K YGD T  IT+E
Sbjct  1    FPVPQVIQDNKSAWRTDEEFAREMLAGVNPVAIRRLQEFPPASKLDQKAYGDQTSQITKE  60

Query  266  DIADKLDGLTVEQAIESKRLFILDHHDAITLYARRINDNTDRKIYATRTLLFLLKDGTLR  445
             I   L GL++++AI++ +LFILDHHDA+  Y RRIN  T  K Y++RTLLFL  DGTL+
Sbjct  61   HIEHNLKGLSIDEAIKNNKLFILDHHDALMPYLRRIN-TTSTKTYSSRTLLFLENDGTLK  119

Query  446  PIAIELSKPHPDGD  487
            P+AIELS PHPDGD
Sbjct  120  PLAIELSLPHPDGD  133



>ref|XP_004169780.1| PREDICTED: LOW QUALITY PROTEIN: probable linoleate 9S-lipoxygenase 
5-like [Cucumis sativus]
Length=860

 Score =   200 bits (508),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 97/161 (60%), Positives = 115/161 (71%), Gaps = 1/161 (1%)
 Frame = +2

Query  5    ILEHIQKNTPLEMIKELLRSDGEKMFKFPTPQVIADNKTAWRTDEEFAREMLAGVNPVSI  184
            +LE  ++N P  ++KE+ R+DGE   KFP PQVI DNK+ WRTDEEFAREMLAGVNP+ I
Sbjct  321  LLEKFRQNIPAPLLKEIFRTDGENFLKFPLPQVIQDNKSGWRTDEEFAREMLAGVNPIII  380

Query  185  SRLQMFPQRSTLDPKVYGDHTCTITREDIADKLDGLTVEQAIESKRLFILDHHDAITLYA  364
             RLQ FP  S LDP VYGD    I+ E I + LDGLTV++AIE  +L+ILDHHDA+  Y 
Sbjct  381  RRLQEFPPSSKLDPNVYGDQNSKISEEHIINSLDGLTVQEAIEQNKLYILDHHDALMPYL  440

Query  365  RRINDNTDRKIYATRTLLFLLKDGTLRPIAIELSKPHPDGD  487
             RIN +T  K YATRTL FL  DGTLRP+ IELS P    D
Sbjct  441  NRIN-STSTKTYATRTLXFLNGDGTLRPLVIELSLPQSQKD  480



>ref|XP_007143238.1| hypothetical protein PHAVU_007G055800g [Phaseolus vulgaris]
 gb|ESW15232.1| hypothetical protein PHAVU_007G055800g [Phaseolus vulgaris]
Length=856

 Score =   199 bits (506),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 96/162 (59%), Positives = 121/162 (75%), Gaps = 1/162 (1%)
 Frame = +2

Query  2    PILEHIQKNTPLEMIKELLRSDGEKMFKFPTPQVIADNKTAWRTDEEFAREMLAGVNPVS  181
            P  + +++  P E+++EL+R+DGE+  KFP P VI ++K+AWRTDEEFAREMLAGVNPV 
Sbjct  311  PAAKKLRELVPFEVMRELIRNDGERFLKFPMPDVIKESKSAWRTDEEFAREMLAGVNPVI  370

Query  182  ISRLQMFPQRSTLDPKVYGDHTCTITREDIADKLDGLTVEQAIESKRLFILDHHDAITLY  361
            I RLQ FP  S LDPKVYGD   +I    I + LDG T+ +AI+  RLFILDHHDA+  Y
Sbjct  371  IQRLQEFPPVSKLDPKVYGDQASSIRAIHIENSLDGFTINEAIQEMRLFILDHHDALMPY  430

Query  362  ARRINDNTDRKIYATRTLLFLLKDGTLRPIAIELSKPHPDGD  487
              RIN +T+ K YA+RTLLFL  DGTL+P+AIELS PHP G+
Sbjct  431  ISRIN-STNTKTYASRTLLFLQDDGTLKPLAIELSLPHPQGN  471



>gb|EYU41500.1| hypothetical protein MIMGU_mgv1a001165mg [Erythranthe guttata]
Length=874

 Score =   199 bits (506),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 96/160 (60%), Positives = 122/160 (76%), Gaps = 1/160 (1%)
 Frame = +2

Query  8    LEHIQKNTPLEMIKELLRSDGEKMFKFPTPQVIADNKTAWRTDEEFAREMLAGVNPVSIS  187
            L+ I+ + P E++KEL+RSDGE+  KFPTP VI ++KTAWRTDEEF REMLAGVNPV I 
Sbjct  331  LDKIRAHVPWELLKELIRSDGERFLKFPTPDVIKEDKTAWRTDEEFGREMLAGVNPVIIR  390

Query  188  RLQMFPQRSTLDPKVYGDHTCTITREDIADKLDGLTVEQAIESKRLFILDHHDAITLYAR  367
            RLQ FP  S LDP+ YGD   TI RE +   ++GL+V++A+E  +LFILDHHDA+  Y R
Sbjct  391  RLQEFPPISKLDPQQYGDQDSTIRREHLEKNMNGLSVDEAMEKNKLFILDHHDALMTYLR  450

Query  368  RINDNTDRKIYATRTLLFLLKDGTLRPIAIELSKPHPDGD  487
            RIN  T  K YA+RT+L L ++GTL+P+AIELS PH +GD
Sbjct  451  RIN-TTTTKTYASRTILLLQENGTLKPLAIELSLPHEEGD  489



>ref|XP_003592410.1| Lipoxygenase [Medicago truncatula]
 gb|AES62661.1| linoleate 9S-lipoxygenase-like protein [Medicago truncatula]
Length=856

 Score =   199 bits (506),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 97/162 (60%), Positives = 120/162 (74%), Gaps = 1/162 (1%)
 Frame = +2

Query  2    PILEHIQKNTPLEMIKELLRSDGEKMFKFPTPQVIADNKTAWRTDEEFAREMLAGVNPVS  181
            P+   I+   P E+ +EL+R+DGEK  +FP P VI  +KTAWRTDEEF REMLAGVNPV 
Sbjct  311  PLHSKIRDLIPYEIFRELVRNDGEKFLRFPVPDVIKASKTAWRTDEEFGREMLAGVNPVI  370

Query  182  ISRLQMFPQRSTLDPKVYGDHTCTITREDIADKLDGLTVEQAIESKRLFILDHHDAITLY  361
            I RLQ FP  S LDP VYGD   +I  + I + LDGLT+++A+ES +L+ILDHHDA+  Y
Sbjct  371  IRRLQEFPPASKLDPSVYGDQNSSIQAKHIENSLDGLTIDEALESDKLYILDHHDALMPY  430

Query  362  ARRINDNTDRKIYATRTLLFLLKDGTLRPIAIELSKPHPDGD  487
              RIN +T+ K YATRTLLFL  DGTL+P+AIELS PHP G+
Sbjct  431  LSRIN-STNTKTYATRTLLFLQDDGTLKPLAIELSLPHPQGE  471



>gb|KCW61799.1| hypothetical protein EUGRSUZ_H04497 [Eucalyptus grandis]
Length=598

 Score =   197 bits (500),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 101/162 (62%), Positives = 126/162 (78%), Gaps = 0/162 (0%)
 Frame = +2

Query  2    PILEHIQKNTPLEMIKELLRSDGEKMFKFPTPQVIADNKTAWRTDEEFAREMLAGVNPVS  181
            P+LE ++++ PLEM+K L R+DGE + ++P PQVI ++KTAWRTD EF REMLAGVNPV 
Sbjct  68   PLLESLKEHIPLEMLKILFRTDGEGLLEYPMPQVIKEDKTAWRTDVEFGREMLAGVNPVV  127

Query  182  ISRLQMFPQRSTLDPKVYGDHTCTITREDIADKLDGLTVEQAIESKRLFILDHHDAITLY  361
            +  LQ FP  S L PK+YG+ + +I  E I ++L+GLTVEQAI+ K+LFILDHHDAI  Y
Sbjct  128  VRSLQEFPPASKLHPKIYGNQSSSIREELIQEQLNGLTVEQAIKMKKLFILDHHDAIMPY  187

Query  362  ARRINDNTDRKIYATRTLLFLLKDGTLRPIAIELSKPHPDGD  487
             RRIN  T  K YATRTLLFL  DGTL+P+AIELS PHP+GD
Sbjct  188  LRRINTTTTTKTYATRTLLFLKDDGTLKPLAIELSLPHPEGD  229



>gb|EPS73037.1| lipoxygenase, partial [Genlisea aurea]
Length=442

 Score =   194 bits (492),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 93/161 (58%), Positives = 120/161 (75%), Gaps = 1/161 (1%)
 Frame = +2

Query  5    ILEHIQKNTPLEMIKELLRSDGEKMFKFPTPQVIADNKTAWRTDEEFAREMLAGVNPVSI  184
            +L+ I++  P E I+ELLRSDGE   KFP P VI ++KTAWR+DEEF REMLAG+NPV I
Sbjct  241  LLDRIREKIPSETIRELLRSDGEGALKFPVPLVIQEDKTAWRSDEEFGREMLAGINPVLI  300

Query  185  SRLQMFPQRSTLDPKVYGDHTCTITREDIADKLDGLTVEQAIESKRLFILDHHDAITLYA  364
             RL+ FP  S LDP++YGD +  I+ + I   LDG+T+ +AIES +LFILDHHD++  + 
Sbjct  301  CRLREFPHTSKLDPEIYGDQSSRISEDHIRGSLDGMTIAEAIESNKLFILDHHDSLMPHL  360

Query  365  RRINDNTDRKIYATRTLLFLLKDGTLRPIAIELSKPHPDGD  487
            RRIN  T  K YATRT+L+L+KDG L+P+AIELS P   GD
Sbjct  361  RRIN-TTATKTYATRTILYLMKDGILKPVAIELSLPAAQGD  400



>gb|KHN02707.1| Linoleate 9S-lipoxygenase 5, chloroplastic [Glycine soja]
Length=850

 Score =   199 bits (505),  Expect = 4e-56, Method: Compositional matrix adjust.
 Identities = 96/162 (59%), Positives = 123/162 (76%), Gaps = 1/162 (1%)
 Frame = +2

Query  2    PILEHIQKNTPLEMIKELLRSDGEKMFKFPTPQVIADNKTAWRTDEEFAREMLAGVNPVS  181
            P+   +++  P E+++EL+R+DGE+  KFP P VI  +KTAWRTDEEFAREMLAGVNPV 
Sbjct  305  PLASKLRELVPYELLRELIRNDGERFLKFPVPDVIKVSKTAWRTDEEFAREMLAGVNPVI  364

Query  182  ISRLQMFPQRSTLDPKVYGDHTCTITREDIADKLDGLTVEQAIESKRLFILDHHDAITLY  361
            I RLQ FP  S LD +VYGD T +I    I + LDGLT+++AI++ RLFILDHHDA+  Y
Sbjct  365  IRRLQEFPPASKLDSRVYGDQTSSIRATHIENSLDGLTIDEAIQNMRLFILDHHDALMPY  424

Query  362  ARRINDNTDRKIYATRTLLFLLKDGTLRPIAIELSKPHPDGD  487
              RIN +T+ K YA+RT+LFL  DGTL+P+AIELS PHP G+
Sbjct  425  ISRIN-STNTKTYASRTILFLQDDGTLKPLAIELSLPHPQGE  465



>gb|ADG03095.1| lipoxygenase 3 [Glycine max]
Length=857

 Score =   199 bits (505),  Expect = 4e-56, Method: Compositional matrix adjust.
 Identities = 99/157 (63%), Positives = 120/157 (76%), Gaps = 1/157 (1%)
 Frame = +2

Query  17   IQKNTPLEMIKELLRSDGEKMFKFPTPQVIADNKTAWRTDEEFAREMLAGVNPVSISRLQ  196
            I K +PL ++KE+ R+DGE+  KFP P+VI  +K+AW TDEEFAREMLAGVNP  I  L+
Sbjct  322  ISKISPLPVLKEIFRTDGEQALKFPPPKVIQVSKSAWMTDEEFAREMLAGVNPNLIRCLK  381

Query  197  MFPQRSTLDPKVYGDHTCTITREDIADKLDGLTVEQAIESKRLFILDHHDAITLYARRIN  376
             FP RS LD +VYGDHT  IT+E +   L+GLTV++AI++KRLF+LDHHD I  Y RRIN
Sbjct  382  EFPPRSKLDSQVYGDHTSQITKEHLEPNLEGLTVDEAIQNKRLFLLDHHDPIMPYLRRIN  441

Query  377  DNTDRKIYATRTLLFLLKDGTLRPIAIELSKPHPDGD  487
              T  K YATRT+LFL  DGTLRP+AIELS PHP GD
Sbjct  442  -ATSTKAYATRTILFLKNDGTLRPLAIELSLPHPQGD  477



>ref|XP_008454500.1| PREDICTED: probable linoleate 9S-lipoxygenase 5 [Cucumis melo]
Length=858

 Score =   198 bits (504),  Expect = 4e-56, Method: Compositional matrix adjust.
 Identities = 96/161 (60%), Positives = 117/161 (73%), Gaps = 1/161 (1%)
 Frame = +2

Query  5    ILEHIQKNTPLEMIKELLRSDGEKMFKFPTPQVIADNKTAWRTDEEFAREMLAGVNPVSI  184
            +LE  +++ P  ++KE+ R+DGEK  KFP PQVI DNK+ WRTDEEFAREMLAGVNP+ I
Sbjct  319  LLEKFRQSIPAPLLKEIFRTDGEKFLKFPLPQVIQDNKSGWRTDEEFAREMLAGVNPIII  378

Query  185  SRLQMFPQRSTLDPKVYGDHTCTITREDIADKLDGLTVEQAIESKRLFILDHHDAITLYA  364
             RLQ FP  S LDP VYGD    I+ E I + LDGLTV++A++  +L+ILDHHDA+  Y 
Sbjct  379  RRLQEFPPSSKLDPNVYGDQNSKISEEHIINSLDGLTVQEALKQNKLYILDHHDALMPYL  438

Query  365  RRINDNTDRKIYATRTLLFLLKDGTLRPIAIELSKPHPDGD  487
             RIN +T  K YATRTLLFL  DGTLRP+ IELS P    D
Sbjct  439  NRIN-STSTKTYATRTLLFLNGDGTLRPLVIELSLPQSQKD  478



>gb|AGH13205.1| lipoxygenase [Salvia miltiorrhiza]
Length=856

 Score =   198 bits (504),  Expect = 4e-56, Method: Compositional matrix adjust.
 Identities = 97/161 (60%), Positives = 122/161 (76%), Gaps = 1/161 (1%)
 Frame = +2

Query  5    ILEHIQKNTPLEMIKELLRSDGEKMFKFPTPQVIADNKTAWRTDEEFAREMLAGVNPVSI  184
            +LE I+++ PLE I+ELLRSDGEK + FP P VI ++K AWR+DEEF REMLAG+NPV I
Sbjct  317  MLEKIRQHIPLETIRELLRSDGEKTYNFPLPHVIKEDKDAWRSDEEFGREMLAGINPVII  376

Query  185  SRLQMFPQRSTLDPKVYGDHTCTITREDIADKLDGLTVEQAIESKRLFILDHHDAITLYA  364
              LQ FP  S L+P++YG  +  I+ E I   L+GLTV +AI + +L+ILDHHD++  Y 
Sbjct  377  QCLQEFPPTSKLNPELYGRQSSKISEEHIIHNLEGLTVAEAIRNNKLYILDHHDSLMPYL  436

Query  365  RRINDNTDRKIYATRTLLFLLKDGTLRPIAIELSKPHPDGD  487
            RRIN  T  K YATRT+LFL +DGTLRPIAIELS PHP+GD
Sbjct  437  RRIN-TTAAKTYATRTILFLKEDGTLRPIAIELSLPHPEGD  476



>gb|AGS94394.3| lipoxygenase [Vigna radiata]
Length=867

 Score =   198 bits (504),  Expect = 4e-56, Method: Compositional matrix adjust.
 Identities = 95/157 (61%), Positives = 122/157 (78%), Gaps = 1/157 (1%)
 Frame = +2

Query  17   IQKNTPLEMIKELLRSDGEKMFKFPTPQVIADNKTAWRTDEEFAREMLAGVNPVSISRLQ  196
            + K +P+ +  EL R+DGE++ KFP P+VI  +++AW TDEEFAREM+AGVNP  I+RLQ
Sbjct  331  LSKISPIPLFSELFRTDGEQVLKFPPPKVIQVDQSAWMTDEEFAREMIAGVNPHIITRLQ  390

Query  197  MFPQRSTLDPKVYGDHTCTITREDIADKLDGLTVEQAIESKRLFILDHHDAITLYARRIN  376
             FP +S LD ++YGD+T TITRE +   L GLTVEQAI++ RLFILDHHD +  Y RRIN
Sbjct  391  EFPPKSKLDSQLYGDNTSTITREHLEPNLGGLTVEQAIQNNRLFILDHHDTLIPYLRRIN  450

Query  377  DNTDRKIYATRTLLFLLKDGTLRPIAIELSKPHPDGD  487
              T+ K YATRT++FL  +GTL+P+AIELSKPHP GD
Sbjct  451  -ATETKAYATRTIIFLQDNGTLKPLAIELSKPHPQGD  486



>ref|XP_007135516.1| hypothetical protein PHAVU_010G135900g [Phaseolus vulgaris]
 gb|ESW07510.1| hypothetical protein PHAVU_010G135900g [Phaseolus vulgaris]
Length=867

 Score =   198 bits (504),  Expect = 5e-56, Method: Compositional matrix adjust.
 Identities = 96/157 (61%), Positives = 120/157 (76%), Gaps = 1/157 (1%)
 Frame = +2

Query  17   IQKNTPLEMIKELLRSDGEKMFKFPTPQVIADNKTAWRTDEEFAREMLAGVNPVSISRLQ  196
            + K +P+ +  EL R+DGE++ KFP P+VI  N++AW TDEEFAREM+AGVNP  I RLQ
Sbjct  331  LSKLSPIPLFTELFRTDGEQVLKFPPPKVIQVNQSAWMTDEEFAREMIAGVNPHIIKRLQ  390

Query  197  MFPQRSTLDPKVYGDHTCTITREDIADKLDGLTVEQAIESKRLFILDHHDAITLYARRIN  376
             FP +S LD ++YGD+T TITRE +   L GLTVEQAI++ RLFILDHHD +  Y RRIN
Sbjct  391  EFPPKSKLDSQLYGDNTSTITREHLEPNLGGLTVEQAIQNNRLFILDHHDTLIPYLRRIN  450

Query  377  DNTDRKIYATRTLLFLLKDGTLRPIAIELSKPHPDGD  487
              T  K YATRT++FL  +GTL+P+AIELSKPHP GD
Sbjct  451  -ATQTKAYATRTIIFLQDNGTLKPLAIELSKPHPAGD  486



>ref|XP_007150490.1| hypothetical protein PHAVU_005G157000g [Phaseolus vulgaris]
 gb|ESW22484.1| hypothetical protein PHAVU_005G157000g [Phaseolus vulgaris]
Length=860

 Score =   198 bits (504),  Expect = 5e-56, Method: Compositional matrix adjust.
 Identities = 96/157 (61%), Positives = 122/157 (78%), Gaps = 1/157 (1%)
 Frame = +2

Query  17   IQKNTPLEMIKELLRSDGEKMFKFPTPQVIADNKTAWRTDEEFAREMLAGVNPVSISRLQ  196
            + K +PL ++KE+ R+DGE+  KFP P+V+ D+K+AW TDEEFAREM+ GVNP  I  LQ
Sbjct  325  LSKISPLPVLKEIFRTDGEQTLKFPPPKVVQDSKSAWMTDEEFAREMICGVNPNLIRLLQ  384

Query  197  MFPQRSTLDPKVYGDHTCTITREDIADKLDGLTVEQAIESKRLFILDHHDAITLYARRIN  376
             FP +S LD +VYGDHT  IT+E++   L+GLTV++AI+SKRLF+LDHHD+I  Y RRIN
Sbjct  385  DFPPQSKLDSQVYGDHTSQITKENLEPNLEGLTVDEAIQSKRLFLLDHHDSIMPYLRRIN  444

Query  377  DNTDRKIYATRTLLFLLKDGTLRPIAIELSKPHPDGD  487
              T  K YATRT+LFL KD TL+P+AIELS PHP GD
Sbjct  445  -ATSSKAYATRTILFLKKDRTLKPLAIELSLPHPGGD  480



>ref|XP_007034721.1| PLAT/LH2 domain-containing lipoxygenase family protein isoform 
1 [Theobroma cacao]
 gb|EOY05647.1| PLAT/LH2 domain-containing lipoxygenase family protein isoform 
1 [Theobroma cacao]
Length=677

 Score =   197 bits (501),  Expect = 5e-56, Method: Compositional matrix adjust.
 Identities = 96/160 (60%), Positives = 120/160 (75%), Gaps = 1/160 (1%)
 Frame = +2

Query  8    LEHIQKNTPLEMIKELLRSDGEKMFKFPTPQVIADNKTAWRTDEEFAREMLAGVNPVSIS  187
            L+ I++  P EMIKEL+R+DGE++ KFP P VI ++++AWRTDEEFARE LAGVNPV I 
Sbjct  134  LKKIRECIPWEMIKELIRNDGERLMKFPMPAVIKEDRSAWRTDEEFARETLAGVNPVMIR  193

Query  188  RLQMFPQRSTLDPKVYGDHTCTITREDIADKLDGLTVEQAIESKRLFILDHHDAITLYAR  367
            RL+ FP  S LDPK YG+   T+T E I   ++GLTVE+A+E  +LFIL+HHDA+  Y R
Sbjct  194  RLREFPPASKLDPKTYGNQKSTVTEEHIERNMNGLTVEKALEKNKLFILNHHDALMPYLR  253

Query  368  RINDNTDRKIYATRTLLFLLKDGTLRPIAIELSKPHPDGD  487
            RIN +T  K YATRTL FL  D TL+P+AIELS PHP  D
Sbjct  254  RIN-STSTKTYATRTLFFLQDDDTLKPLAIELSLPHPQSD  292



>gb|AAF15296.2|AF204210_1 lipoxygenase [Phaseolus vulgaris]
Length=856

 Score =   198 bits (504),  Expect = 5e-56, Method: Compositional matrix adjust.
 Identities = 96/157 (61%), Positives = 118/157 (75%), Gaps = 1/157 (1%)
 Frame = +2

Query  17   IQKNTPLEMIKELLRSDGEKMFKFPTPQVIADNKTAWRTDEEFAREMLAGVNPVSISRLQ  196
            + K  P+ ++KE+ RSDGE+  K+P P+V+  +K+AW TDEEFARE +AGVNP  I  L+
Sbjct  320  LSKYAPIPIVKEIFRSDGEQFLKYPPPKVMQVDKSAWMTDEEFARETIAGVNPNVIKILK  379

Query  197  MFPQRSTLDPKVYGDHTCTITREDIADKLDGLTVEQAIESKRLFILDHHDAITLYARRIN  376
             FP RSTLD + YGDHT  IT+E +  KL GLTVEQAIE+K+LFILDHHD +  Y RRIN
Sbjct  380  EFPPRSTLDTQAYGDHTSIITKEHLEPKLGGLTVEQAIENKKLFILDHHDYLIPYLRRIN  439

Query  377  DNTDRKIYATRTLLFLLKDGTLRPIAIELSKPHPDGD  487
             +T  K YATRT+ FL  DGTL P+AIELSKPHP GD
Sbjct  440  SST-TKTYATRTIFFLKDDGTLAPLAIELSKPHPQGD  475



>gb|KHN32710.1| Seed linoleate 9S-lipoxygenase-3 [Glycine soja]
Length=857

 Score =   197 bits (502),  Expect = 8e-56, Method: Compositional matrix adjust.
 Identities = 99/157 (63%), Positives = 120/157 (76%), Gaps = 1/157 (1%)
 Frame = +2

Query  17   IQKNTPLEMIKELLRSDGEKMFKFPTPQVIADNKTAWRTDEEFAREMLAGVNPVSISRLQ  196
            I K +PL ++KE+ R+DGE+  KFP P+VI  +K+AW TDEEFAREMLAGVNP  I  L+
Sbjct  322  ISKISPLPVLKEIFRTDGEQALKFPPPKVIQVSKSAWMTDEEFAREMLAGVNPNLIRCLK  381

Query  197  MFPQRSTLDPKVYGDHTCTITREDIADKLDGLTVEQAIESKRLFILDHHDAITLYARRIN  376
             FP RS LD +VYGDHT  IT+E +   L+GLTV++AI++KRLF+LDHHD I  Y RRIN
Sbjct  382  DFPPRSKLDSQVYGDHTSQITKEHLEPNLEGLTVDEAIQNKRLFLLDHHDPIMPYLRRIN  441

Query  377  DNTDRKIYATRTLLFLLKDGTLRPIAIELSKPHPDGD  487
              T  K YATRT+LFL  DGTLRP+AIELS PHP GD
Sbjct  442  -ATSTKAYATRTILFLKNDGTLRPLAIELSLPHPQGD  477



>gb|ABX60408.1| lipoxygenase L-3 [Glycine max]
 gb|ADG03096.1| lipoxygenase 3 [Glycine max]
Length=857

 Score =   197 bits (502),  Expect = 8e-56, Method: Compositional matrix adjust.
 Identities = 99/157 (63%), Positives = 120/157 (76%), Gaps = 1/157 (1%)
 Frame = +2

Query  17   IQKNTPLEMIKELLRSDGEKMFKFPTPQVIADNKTAWRTDEEFAREMLAGVNPVSISRLQ  196
            I K +PL ++KE+ R+DGE+  KFP P+VI  +K+AW TDEEFAREMLAGVNP  I  L+
Sbjct  322  ISKISPLPVLKEIFRTDGEQALKFPPPKVIQVSKSAWMTDEEFAREMLAGVNPNLIRCLK  381

Query  197  MFPQRSTLDPKVYGDHTCTITREDIADKLDGLTVEQAIESKRLFILDHHDAITLYARRIN  376
             FP RS LD +VYGDHT  IT+E +   L+GLTV++AI++KRLF+LDHHD I  Y RRIN
Sbjct  382  DFPPRSKLDSQVYGDHTSQITKEHLEPNLEGLTVDEAIQNKRLFLLDHHDPIMPYLRRIN  441

Query  377  DNTDRKIYATRTLLFLLKDGTLRPIAIELSKPHPDGD  487
              T  K YATRT+LFL  DGTLRP+AIELS PHP GD
Sbjct  442  -ATSTKAYATRTILFLKNDGTLRPLAIELSLPHPQGD  477



>pdb|1ROV|A Chain A, Lipoxygenase-3 Treated With Cumene Hydroperoxide
Length=857

 Score =   197 bits (502),  Expect = 8e-56, Method: Compositional matrix adjust.
 Identities = 99/157 (63%), Positives = 120/157 (76%), Gaps = 1/157 (1%)
 Frame = +2

Query  17   IQKNTPLEMIKELLRSDGEKMFKFPTPQVIADNKTAWRTDEEFAREMLAGVNPVSISRLQ  196
            I K +PL ++KE+ R+DGE+  KFP P+VI  +K+AW TDEEFAREMLAGVNP  I  L+
Sbjct  322  ISKISPLPVLKEIFRTDGEQALKFPPPKVIQVSKSAWMTDEEFAREMLAGVNPNLIRCLK  381

Query  197  MFPQRSTLDPKVYGDHTCTITREDIADKLDGLTVEQAIESKRLFILDHHDAITLYARRIN  376
             FP RS LD +VYGDHT  IT+E +   L+GLTV++AI++KRLF+LDHHD I  Y RRIN
Sbjct  382  DFPPRSKLDSQVYGDHTSQITKEHLEPNLEGLTVDEAIQNKRLFLLDHHDPIMPYLRRIN  441

Query  377  DNTDRKIYATRTLLFLLKDGTLRPIAIELSKPHPDGD  487
              T  K YATRT+LFL  DGTLRP+AIELS PHP GD
Sbjct  442  -ATSTKAYATRTILFLKNDGTLRPLAIELSLPHPQGD  477



>ref|NP_001235383.1| seed linoleate 9S-lipoxygenase-3 [Glycine max]
 pdb|1IK3|A Chain A, Lipoxygenase-3 (Soybean) Complex With 13(S)-Hydroperoxy- 
9(Z),11(E)-Octadecadienoic Acid
 pdb|1HU9|A Chain A, Lipoxygenase-3 (Soybean) Complex With 4-Hydroperoxy-2- 
Methoxy-Phenol
 pdb|1JNQ|A Chain A, Lipoxygenase-3 (Soybean) Complex With Epigallocathechin 
(Egc)
 pdb|1N8Q|A Chain A, Lipoxygenase In Complex With Protocatechuic Acid
 pdb|1NO3|A Chain A, Refined Structure Of Soybean Lipoxygenase-3 With 4-nitrocatechol 
At 2.15 Angstrom Resolution
 pdb|1RRH|A Chain A, Soybean Lipoxygenase (Lox-3) At Ambient Temperatures 
At 2.0 A Resolution
 pdb|1RRL|A Chain A, Soybean Lipoxygenase (Lox-3) At 93k At 2.0 A Resolution
 pdb|1RRL|B Chain B, Soybean Lipoxygenase (Lox-3) At 93k At 2.0 A Resolution
 pdb|1LNH|A Chain A, Lipoxygenase-3(Soybean) Non-Heme Fe(Ii) Metalloprotein
 gb|AAB41272.1| lipoxygenase-3 [Glycine max]
Length=857

 Score =   197 bits (502),  Expect = 8e-56, Method: Compositional matrix adjust.
 Identities = 99/157 (63%), Positives = 120/157 (76%), Gaps = 1/157 (1%)
 Frame = +2

Query  17   IQKNTPLEMIKELLRSDGEKMFKFPTPQVIADNKTAWRTDEEFAREMLAGVNPVSISRLQ  196
            I K +PL ++KE+ R+DGE+  KFP P+VI  +K+AW TDEEFAREMLAGVNP  I  L+
Sbjct  322  ISKISPLPVLKEIFRTDGEQALKFPPPKVIQVSKSAWMTDEEFAREMLAGVNPNLIRCLK  381

Query  197  MFPQRSTLDPKVYGDHTCTITREDIADKLDGLTVEQAIESKRLFILDHHDAITLYARRIN  376
             FP RS LD +VYGDHT  IT+E +   L+GLTV++AI++KRLF+LDHHD I  Y RRIN
Sbjct  382  DFPPRSKLDSQVYGDHTSQITKEHLEPNLEGLTVDEAIQNKRLFLLDHHDPIMPYLRRIN  441

Query  377  DNTDRKIYATRTLLFLLKDGTLRPIAIELSKPHPDGD  487
              T  K YATRT+LFL  DGTLRP+AIELS PHP GD
Sbjct  442  -ATSTKAYATRTILFLKNDGTLRPLAIELSLPHPQGD  477



>ref|XP_007135506.1| hypothetical protein PHAVU_010G134900g [Phaseolus vulgaris]
 gb|AAB18970.2| lipoxygenase [Phaseolus vulgaris]
 gb|ESW07500.1| hypothetical protein PHAVU_010G134900g [Phaseolus vulgaris]
Length=865

 Score =   197 bits (502),  Expect = 9e-56, Method: Compositional matrix adjust.
 Identities = 96/157 (61%), Positives = 115/157 (73%), Gaps = 0/157 (0%)
 Frame = +2

Query  17   IQKNTPLEMIKELLRSDGEKMFKFPTPQVIADNKTAWRTDEEFAREMLAGVNPVSISRLQ  196
            I   +PL +IKE+ R+DGE++ KFP P VI  +K+AW TDEEF REMLAGVNP  I RLQ
Sbjct  329  ISNISPLPVIKEIFRTDGEQVLKFPPPHVIQVSKSAWMTDEEFGREMLAGVNPCLIQRLQ  388

Query  197  MFPQRSTLDPKVYGDHTCTITREDIADKLDGLTVEQAIESKRLFILDHHDAITLYARRIN  376
             FP +S LD  VYGD T TIT+E++   L GLTVE+A+   +LFILDHHDA   Y R+IN
Sbjct  389  EFPPKSKLDASVYGDQTSTITKENLEINLGGLTVEEALNGNKLFILDHHDAFLPYLRKIN  448

Query  377  DNTDRKIYATRTLLFLLKDGTLRPIAIELSKPHPDGD  487
            D    K YATRT+LFL  DGTL+P+AIELS PHP GD
Sbjct  449  DLPTAKSYATRTILFLKDDGTLKPLAIELSLPHPRGD  485



>ref|XP_004231274.1| PREDICTED: probable linoleate 9S-lipoxygenase 5 [Solanum lycopersicum]
Length=841

 Score =   197 bits (501),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 92/150 (61%), Positives = 116/150 (77%), Gaps = 1/150 (1%)
 Frame = +2

Query  38   EMIKELLRSDGEKMFKFPTPQVIADNKTAWRTDEEFAREMLAGVNPVSISRLQMFPQRST  217
            EM+K+ ++S G +  K+P PQVI ++K+AWRTDEEFAREMLAG+NPV I  L+ FP  S 
Sbjct  313  EMLKKFIQSSGHEFLKYPMPQVIKEDKSAWRTDEEFAREMLAGINPVCICGLKEFPPISK  372

Query  218  LDPKVYGDHTCTITREDIADKLDGLTVEQAIESKRLFILDHHDAITLYARRINDNTDRKI  397
            LDPKVYG+ T  I+RE I ++LDGLT+E+ I+  +LFILDHHD +  Y R+IN  T  KI
Sbjct  373  LDPKVYGNQTSKISREHIQNQLDGLTIEEVIKGNQLFILDHHDTLMPYMRQIN-MTSTKI  431

Query  398  YATRTLLFLLKDGTLRPIAIELSKPHPDGD  487
            YA+RTL FL KDGTL+P+ IELS PHPDGD
Sbjct  432  YASRTLFFLQKDGTLKPLGIELSLPHPDGD  461



>ref|XP_009625817.1| PREDICTED: probable linoleate 9S-lipoxygenase 5 [Nicotiana tomentosiformis]
Length=844

 Score =   197 bits (501),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 95/157 (61%), Positives = 121/157 (77%), Gaps = 2/157 (1%)
 Frame = +2

Query  17   IQKNTPLEMIKELLRSDGEKMFKFPTPQVIADNKTAWRTDEEFAREMLAGVNPVSISRLQ  196
            +Q++T   M+KE ++S G++  K+P PQVI ++K+AWRTDEEFAREMLAG+NPV I  L+
Sbjct  310  LQRST-THMLKEFIQSAGQQFLKYPMPQVIKEDKSAWRTDEEFAREMLAGINPVCICALK  368

Query  197  MFPQRSTLDPKVYGDHTCTITREDIADKLDGLTVEQAIESKRLFILDHHDAITLYARRIN  376
             FP  S LD KVYGD T  +TRE I ++LDG T+E+AI + +LFILDHHD I  Y R+IN
Sbjct  369  EFPPTSKLDLKVYGDQTSKLTREQIQNQLDGFTIEEAINANQLFILDHHDTIMPYLRQIN  428

Query  377  DNTDRKIYATRTLLFLLKDGTLRPIAIELSKPHPDGD  487
              T  +IYA+RTLLFL  DGTL+P+AIELS PHPDGD
Sbjct  429  -MTSTQIYASRTLLFLQNDGTLKPLAIELSLPHPDGD  464



>ref|XP_009387657.1| PREDICTED: linoleate 9S-lipoxygenase A-like [Musa acuminata subsp. 
malaccensis]
Length=861

 Score =   197 bits (501),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 100/163 (61%), Positives = 119/163 (73%), Gaps = 2/163 (1%)
 Frame = +2

Query  2    PILEHIQKNTPLEMIKELLRSDG-EKMFKFPTPQVIADNKTAWRTDEEFAREMLAGVNPV  178
            P+LE +++  P EMI+ELLR +G + + K P PQVI  +KTAWRTDEEF REMLAG+NPV
Sbjct  322  PLLEELRQRVPFEMIRELLRVEGGQGLLKLPKPQVIQVDKTAWRTDEEFTREMLAGLNPV  381

Query  179  SISRLQMFPQRSTLDPKVYGDHTCTITREDIADKLDGLTVEQAIESKRLFILDHHDAITL  358
             I RL+ FP  S LDP  YGDHT TIT   I   LDGLTV QA+E  +LFILDHHDA   
Sbjct  382  VIRRLEEFPPTSKLDPCKYGDHTSTITAAHIEHHLDGLTVHQALEQNKLFILDHHDAYIP  441

Query  359  YARRINDNTDRKIYATRTLLFLLKDGTLRPIAIELSKPHPDGD  487
            Y  RIN     K+YA+RTLLFL +D TL+P+AIELS PHPDG+
Sbjct  442  YLNRIN-ALAVKVYASRTLLFLRQDSTLKPLAIELSLPHPDGE  483



>ref|XP_003597559.1| Seed lipoxygenase-3 [Medicago truncatula]
 gb|AES67810.1| seed linoleate 9S-lipoxygenase [Medicago truncatula]
Length=861

 Score =   197 bits (500),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 95/157 (61%), Positives = 122/157 (78%), Gaps = 1/157 (1%)
 Frame = +2

Query  17   IQKNTPLEMIKELLRSDGEKMFKFPTPQVIADNKTAWRTDEEFAREMLAGVNPVSISRLQ  196
            + K +PL ++KE+ R+DGE+  K+P P+V+  +++AW TDEEFAREMLAGVNP  I  LQ
Sbjct  326  LSKISPLPVLKEIFRTDGEQFLKYPPPKVLQVSRSAWMTDEEFAREMLAGVNPNVICCLQ  385

Query  197  MFPQRSTLDPKVYGDHTCTITREDIADKLDGLTVEQAIESKRLFILDHHDAITLYARRIN  376
             FP RS LD +VYGDHT  IT+E +   L+GLTVE+AI++K+LF+LDHHD+I  Y RRIN
Sbjct  386  EFPPRSKLDSQVYGDHTSKITKEHLEPNLEGLTVEEAIQNKKLFLLDHHDSIMPYLRRIN  445

Query  377  DNTDRKIYATRTLLFLLKDGTLRPIAIELSKPHPDGD  487
             +T  K YATRT+LFL  D TL+P+AIELS PHPDGD
Sbjct  446  -STPTKAYATRTILFLSSDKTLKPLAIELSLPHPDGD  481



>emb|CAP59449.1| lipoxygenase [Momordica charantia]
Length=880

 Score =   197 bits (500),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 96/161 (60%), Positives = 119/161 (74%), Gaps = 1/161 (1%)
 Frame = +2

Query  5    ILEHIQKNTPLEMIKELLRSDGEKMFKFPTPQVIADNKTAWRTDEEFAREMLAGVNPVSI  184
            I +++ ++    + K  LRSDGE+  K+PTPQVI DNK  WRTDEEFAREM+AGVNP+ I
Sbjct  341  IFKNLTEDLAPPLFKAFLRSDGERFLKYPTPQVIKDNKLGWRTDEEFAREMIAGVNPLII  400

Query  185  SRLQMFPQRSTLDPKVYGDHTCTITREDIADKLDGLTVEQAIESKRLFILDHHDAITLYA  364
             RL++FP  S LDP VYG+   T+T E I   LDGLTV++AI+  +L+ILDHHDA+  Y 
Sbjct  401  RRLEVFPPLSKLDPHVYGNQNSTMTEEQIKHGLDGLTVDEAIKENKLYILDHHDALMPYL  460

Query  365  RRINDNTDRKIYATRTLLFLLKDGTLRPIAIELSKPHPDGD  487
            RRIN +T  K YATRTLLFL  D TL+P+AIELS PHP GD
Sbjct  461  RRIN-STSTKTYATRTLLFLKDDSTLKPLAIELSLPHPQGD  500



>gb|KHN03989.1| Putative linoleate 9S-lipoxygenase 5 [Glycine soja]
Length=855

 Score =   197 bits (500),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 99/161 (61%), Positives = 121/161 (75%), Gaps = 4/161 (2%)
 Frame = +2

Query  5    ILEHIQKNTPLEMIKELLRSDGEKMFKFPTPQVIADNKTAWRTDEEFAREMLAGVNPVSI  184
            IL++I+   P EM+KE+LR+DGE+  KFP PQVI ++K+AWRTDEEFAREMLAGVNPV I
Sbjct  319  ILKNIRDKIPAEMLKEILRTDGERFLKFPVPQVIKEDKSAWRTDEEFAREMLAGVNPVII  378

Query  185  SRLQMFPQRSTLDPKVYGDHTCTITREDIADKLDGLTVEQAIESKRLFILDHHDAITLYA  364
              L+ FP  S LD KVYGD T TI ++ I   +DGLT   AI  K+LFILDHHDA+  Y 
Sbjct  379  RCLKEFPPESKLDSKVYGDQTSTIRKKHIESNMDGLT---AIRQKKLFILDHHDALIPYL  435

Query  365  RRINDNTDRKIYATRTLLFLLKDGTLRPIAIELSKPHPDGD  487
            RRIN +T  K YA+RT+LFL  DGTL+P+ IELS PHP+ D
Sbjct  436  RRIN-STSTKTYASRTILFLQNDGTLKPLVIELSLPHPEED  475



>emb|CAA31664.1| unnamed protein product [Glycine max]
Length=857

 Score =   196 bits (498),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 98/157 (62%), Positives = 119/157 (76%), Gaps = 1/157 (1%)
 Frame = +2

Query  17   IQKNTPLEMIKELLRSDGEKMFKFPTPQVIADNKTAWRTDEEFAREMLAGVNPVSISRLQ  196
            I K +PL ++KE+ R+DGE+  KFP P+VI  +K+AW TDEEFAREMLAGVNP  I  L+
Sbjct  322  ISKISPLPVLKEIFRTDGEQALKFPPPKVIQVSKSAWMTDEEFAREMLAGVNPNLIRCLK  381

Query  197  MFPQRSTLDPKVYGDHTCTITREDIADKLDGLTVEQAIESKRLFILDHHDAITLYARRIN  376
             FP RS LD +VYGDHT  IT+E +   L+GLTV++AI++KRLF+L HHD I  Y RRIN
Sbjct  382  EFPPRSKLDSQVYGDHTSQITKEHLEPNLEGLTVDEAIQNKRLFLLGHHDPIMPYLRRIN  441

Query  377  DNTDRKIYATRTLLFLLKDGTLRPIAIELSKPHPDGD  487
              T  K YATRT+LFL  DGTLRP+AIELS PHP GD
Sbjct  442  -ATSTKAYATRTILFLKNDGTLRPLAIELSLPHPQGD  477



>prf||1502333A lipoxygenase 3
Length=858

 Score =   196 bits (498),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 98/157 (62%), Positives = 119/157 (76%), Gaps = 1/157 (1%)
 Frame = +2

Query  17   IQKNTPLEMIKELLRSDGEKMFKFPTPQVIADNKTAWRTDEEFAREMLAGVNPVSISRLQ  196
            I K +PL ++KE+ R+DGE+  KFP P+VI  +K+AW TDEEFAREMLAGVNP  I  L+
Sbjct  323  ISKISPLPVLKEIFRTDGEQALKFPPPKVIQVSKSAWMTDEEFAREMLAGVNPNLIRCLK  382

Query  197  MFPQRSTLDPKVYGDHTCTITREDIADKLDGLTVEQAIESKRLFILDHHDAITLYARRIN  376
             FP RS LD +VYGDHT  IT+E +   L+GLTV++AI++KRLF+L HHD I  Y RRIN
Sbjct  383  EFPPRSKLDSQVYGDHTSQITKEHLEPNLEGLTVDEAIQNKRLFLLGHHDPIMPYLRRIN  442

Query  377  DNTDRKIYATRTLLFLLKDGTLRPIAIELSKPHPDGD  487
              T  K YATRT+LFL  DGTLRP+AIELS PHP GD
Sbjct  443  -ATSTKAYATRTILFLKNDGTLRPLAIELSLPHPQGD  478



>ref|XP_010277588.1| PREDICTED: probable linoleate 9S-lipoxygenase 5 isoform X2 [Nelumbo 
nucifera]
Length=703

 Score =   195 bits (496),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 100/161 (62%), Positives = 130/161 (81%), Gaps = 1/161 (1%)
 Frame = +2

Query  5    ILEHIQKNTPLEMIKELLRSDGEKMFKFPTPQVIADNKTAWRTDEEFAREMLAGVNPVSI  184
            +L+ +++  PLEM+KEL+R+DGE++ KFP PQVI ++K AWRTDEEFAREMLAGVNPVSI
Sbjct  159  VLDSVKEAIPLEMLKELVRTDGEQLLKFPMPQVIQEDKFAWRTDEEFAREMLAGVNPVSI  218

Query  185  SRLQMFPQRSTLDPKVYGDHTCTITREDIADKLDGLTVEQAIESKRLFILDHHDAITLYA  364
             RLQ FP  S LDPK+YG+   +IT+E I   L+GLTV++A+E+ +LF+LD+HDA+  Y 
Sbjct  219  RRLQEFPPASNLDPKLYGNQNSSITKEHIESNLNGLTVDEALENGKLFVLDYHDALMPYL  278

Query  365  RRINDNTDRKIYATRTLLFLLKDGTLRPIAIELSKPHPDGD  487
             RIN +T  K YATRTLLFL  DGTL+P+AIELS PHP+G+
Sbjct  279  TRIN-STTTKTYATRTLLFLKDDGTLQPLAIELSLPHPEGE  318



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 557548962370