BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFF036E18

Length=501
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009613990.1|  PREDICTED: leucine-rich repeat receptor-like...    162   9e-43   Nicotiana tomentosiformis
gb|AIT56194.1|  leucine-rich repeat receptor-like serine/threonin...    162   1e-42   Dimocarpus longan [longan]
ref|XP_011073654.1|  PREDICTED: leucine-rich repeat receptor-like...    161   3e-42   Sesamum indicum [beniseed]
ref|XP_011099433.1|  PREDICTED: leucine-rich repeat receptor-like...    157   8e-41   Sesamum indicum [beniseed]
ref|XP_010271550.1|  PREDICTED: leucine-rich repeat receptor-like...    155   4e-40   Nelumbo nucifera [Indian lotus]
ref|XP_009786199.1|  PREDICTED: leucine-rich repeat receptor-like...    154   1e-39   Nicotiana sylvestris
emb|CDP02660.1|  unnamed protein product                                154   1e-39   Coffea canephora [robusta coffee]
ref|XP_004234641.1|  PREDICTED: leucine-rich repeat receptor-like...    153   2e-39   Solanum lycopersicum
ref|XP_010268646.1|  PREDICTED: leucine-rich repeat receptor-like...    152   3e-39   Nelumbo nucifera [Indian lotus]
dbj|BAK52390.1|  leucine rich repeat receptor protein kinase CLAV...    151   9e-39   Solanum peruvianum [Peruvian tomato]
ref|NP_001274713.1|  leucine-rich repeat receptor-like serine/thr...    151   1e-38   Solanum lycopersicum
gb|EYU41357.1|  hypothetical protein MIMGU_mgv1a000718mg                151   1e-38   Erythranthe guttata [common monkey flower]
dbj|BAK52389.1|  leucine rich repeat receptor protein kinase CLAV...    150   1e-38   Solanum pennellii
ref|XP_010105101.1|  Leucine-rich repeat receptor-like serine/thr...    150   2e-38   Morus notabilis
ref|XP_006357743.1|  PREDICTED: leucine-rich repeat receptor-like...    150   2e-38   Solanum tuberosum [potatoes]
ref|XP_006364007.1|  PREDICTED: leucine-rich repeat receptor-like...    150   3e-38   Solanum tuberosum [potatoes]
emb|CBI35733.3|  unnamed protein product                                148   8e-38   Vitis vinifera
ref|XP_003635561.1|  PREDICTED: leucine-rich repeat receptor-like...    148   1e-37   Vitis vinifera
ref|XP_009771232.1|  PREDICTED: leucine-rich repeat receptor-like...    144   2e-36   Nicotiana sylvestris
gb|KDO78771.1|  hypothetical protein CISIN_1g001816mg                   142   2e-35   Citrus sinensis [apfelsine]
ref|XP_006426178.1|  hypothetical protein CICLE_v10024796mg             142   2e-35   Citrus clementina [clementine]
ref|XP_006466390.1|  PREDICTED: leucine-rich repeat receptor-like...    142   2e-35   Citrus sinensis [apfelsine]
ref|NP_001235080.1|  receptor-like protein kinase 3 precursor           140   5e-35   
ref|XP_009605676.1|  PREDICTED: leucine-rich repeat receptor-like...    140   6e-35   Nicotiana tomentosiformis
ref|XP_009375880.1|  PREDICTED: leucine-rich repeat receptor-like...    140   1e-34   Pyrus x bretschneideri [bai li]
ref|XP_002875982.1|  hypothetical protein ARALYDRAFT_906265             139   1e-34   Arabidopsis lyrata subsp. lyrata
ref|XP_008393812.1|  PREDICTED: leucine-rich repeat receptor-like...    138   3e-34   
ref|XP_006404116.1|  hypothetical protein EUTSA_v10010092mg             138   4e-34   
ref|XP_009354585.1|  PREDICTED: leucine-rich repeat receptor-like...    137   7e-34   Pyrus x bretschneideri [bai li]
ref|XP_008344369.1|  PREDICTED: LOW QUALITY PROTEIN: leucine-rich...    137   7e-34   
ref|XP_006290548.1|  hypothetical protein CARUB_v10016631mg             136   2e-33   Capsella rubella
ref|XP_004511796.1|  PREDICTED: leucine-rich repeat receptor-like...    135   3e-33   
ref|NP_190536.1|  CLAVATA1-related receptor kinase-like protein         135   4e-33   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002310320.2|  hypothetical protein POPTR_0007s14500g             134   7e-33   Populus trichocarpa [western balsam poplar]
ref|XP_007208421.1|  hypothetical protein PRUPE_ppa000739mg             134   8e-33   Prunus persica
ref|NP_001237715.1|  receptor-like protein kinase 2 precursor           134   1e-32   Glycine max [soybeans]
ref|XP_004288299.1|  PREDICTED: leucine-rich repeat receptor-like...    134   1e-32   Fragaria vesca subsp. vesca
ref|XP_008354741.1|  PREDICTED: leucine-rich repeat receptor-like...    134   1e-32   
gb|EPS74129.1|  hypothetical protein M569_00625                         134   1e-32   Genlisea aurea
gb|KDP32143.1|  hypothetical protein JCGZ_12604                         133   3e-32   Jatropha curcas
gb|KFK34238.1|  hypothetical protein AALP_AA5G119100                    132   3e-32   Arabis alpina [alpine rockcress]
ref|XP_007047661.1|  Leucine-rich receptor-like protein kinase fa...    132   3e-32   
gb|KJB48795.1|  hypothetical protein B456_008G087500                    132   4e-32   Gossypium raimondii
ref|XP_011021820.1|  PREDICTED: leucine-rich repeat receptor-like...    132   4e-32   Populus euphratica
gb|KHG03710.1|  Leucine-rich repeat receptor-like serine/threonin...    130   2e-31   Gossypium arboreum [tree cotton]
ref|XP_010426489.1|  PREDICTED: leucine-rich repeat receptor-like...    129   4e-31   Camelina sativa [gold-of-pleasure]
ref|XP_006393995.1|  hypothetical protein EUTSA_v10003584mg             129   4e-31   
ref|XP_010028033.1|  PREDICTED: leucine-rich repeat receptor-like...    129   5e-31   Eucalyptus grandis [rose gum]
gb|KJB18115.1|  hypothetical protein B456_003G034500                    129   6e-31   Gossypium raimondii
ref|XP_010515326.1|  PREDICTED: leucine-rich repeat receptor-like...    129   6e-31   Camelina sativa [gold-of-pleasure]
ref|XP_010484412.1|  PREDICTED: leucine-rich repeat receptor-like...    129   7e-31   Camelina sativa [gold-of-pleasure]
ref|XP_010444585.1|  PREDICTED: leucine-rich repeat receptor-like...    129   7e-31   Camelina sativa [gold-of-pleasure]
ref|XP_010463501.1|  PREDICTED: leucine-rich repeat receptor-like...    129   8e-31   Camelina sativa [gold-of-pleasure]
gb|KJB18113.1|  hypothetical protein B456_003G034400                    129   9e-31   Gossypium raimondii
ref|XP_002864974.1|  hypothetical protein ARALYDRAFT_496807             128   1e-30   
ref|XP_010683073.1|  PREDICTED: leucine-rich repeat receptor-like...    128   1e-30   Beta vulgaris subsp. vulgaris [field beet]
ref|NP_001235065.1|  receptor-like protein kinase 1 precursor           127   2e-30   Glycine max [soybeans]
gb|KHG04200.1|  Leucine-rich repeat receptor-like serine/threonin...    127   2e-30   Gossypium arboreum [tree cotton]
ref|NP_001237688.1|  receptor-like protein kinase precursor             127   3e-30   Glycine max [soybeans]
ref|XP_004509039.1|  PREDICTED: leucine-rich repeat receptor-like...    127   3e-30   Cicer arietinum [garbanzo]
ref|XP_004143422.1|  PREDICTED: leucine-rich repeat receptor-like...    125   7e-30   Cucumis sativus [cucumbers]
ref|XP_010503631.1|  PREDICTED: leucine-rich repeat receptor-like...    125   8e-30   Camelina sativa [gold-of-pleasure]
ref|NP_201371.1|  leucine-rich repeat receptor-like serine/threon...    125   1e-29   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009150662.1|  PREDICTED: leucine-rich repeat receptor-like...    125   1e-29   Brassica rapa
ref|XP_007155783.1|  hypothetical protein PHAVU_003G231400g             125   1e-29   Phaseolus vulgaris [French bean]
ref|XP_006279943.1|  hypothetical protein CARUB_v10025808mg             125   2e-29   Capsella rubella
ref|XP_010547579.1|  PREDICTED: leucine-rich repeat receptor-like...    124   3e-29   Tarenaya hassleriana [spider flower]
ref|XP_002531999.1|  Receptor protein kinase CLAVATA1 precursor, ...    123   8e-29   Ricinus communis
gb|KFK28239.1|  hypothetical protein AALP_AA8G490400                    122   9e-29   Arabis alpina [alpine rockcress]
ref|XP_009397330.1|  PREDICTED: leucine-rich repeat receptor-like...    122   2e-28   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009394785.1|  PREDICTED: leucine-rich repeat receptor-like...    117   6e-27   
ref|XP_008787359.1|  PREDICTED: LOW QUALITY PROTEIN: leucine-rich...    116   2e-26   
ref|XP_009408581.1|  PREDICTED: leucine-rich repeat receptor-like...    116   2e-26   Musa acuminata subsp. malaccensis [pisang utan]
gb|AES94465.2|  LRR receptor-like kinase family protein                 115   4e-26   Medicago truncatula
ref|XP_003611507.1|  Receptor-like protein kinase                       115   4e-26   
ref|XP_010941985.1|  PREDICTED: leucine-rich repeat receptor-like...    115   5e-26   Elaeis guineensis
ref|XP_010939309.1|  PREDICTED: leucine-rich repeat receptor-like...    114   1e-25   Elaeis guineensis
ref|XP_006852730.1|  hypothetical protein AMTR_s00033p00083200          113   2e-25   
ref|XP_010518800.1|  PREDICTED: leucine-rich repeat receptor-like...    112   3e-25   Tarenaya hassleriana [spider flower]
ref|XP_009394620.1|  PREDICTED: leucine-rich repeat receptor-like...    112   3e-25   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010675918.1|  PREDICTED: leucine-rich repeat receptor-like...    112   4e-25   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_009136515.1|  PREDICTED: leucine-rich repeat receptor-like...    110   2e-24   Brassica rapa
ref|XP_008441113.1|  PREDICTED: leucine-rich repeat receptor-like...    109   4e-24   Cucumis melo [Oriental melon]
ref|XP_007156674.1|  hypothetical protein PHAVU_002G007600g             108   1e-23   Phaseolus vulgaris [French bean]
ref|XP_009395647.1|  PREDICTED: leucine-rich repeat receptor-like...    107   2e-23   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010685023.1|  PREDICTED: receptor-like protein 12                105   5e-23   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_010936307.1|  PREDICTED: leucine-rich repeat receptor-like...    105   1e-22   
ref|XP_008790445.1|  PREDICTED: leucine-rich repeat receptor-like...    104   2e-22   Phoenix dactylifera
ref|XP_003608587.1|  Receptor-like protein kinase                       104   2e-22   Medicago truncatula
emb|CDY08759.1|  BnaA06g24650D                                          102   9e-22   Brassica napus [oilseed rape]
gb|ADB85326.1|  putative receptor protein kinase                      96.7    6e-21   Phyllostachys edulis [kikko-chiku]
ref|XP_009396449.1|  PREDICTED: leucine-rich repeat receptor-like...  98.2    4e-20   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_008440463.1|  PREDICTED: leucine-rich repeat receptor-like...  95.5    3e-19   Cucumis melo [Oriental melon]
ref|XP_008237309.1|  PREDICTED: leucine-rich repeat receptor-like...  94.0    1e-18   
ref|XP_008787754.1|  PREDICTED: leucine-rich repeat receptor-like...  93.6    1e-18   Phoenix dactylifera
dbj|BAJ84911.1|  predicted protein                                    93.2    2e-18   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_010676066.1|  PREDICTED: LRR receptor-like serine/threonin...  92.8    2e-18   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_004160944.1|  PREDICTED: LOW QUALITY PROTEIN: leucine-rich...  92.4    3e-18   
ref|XP_004143533.1|  PREDICTED: leucine-rich repeat receptor-like...  92.4    3e-18   Cucumis sativus [cucumbers]
ref|XP_008370076.1|  PREDICTED: probable LRR receptor-like serine...  92.4    3e-18   
ref|XP_009407942.1|  PREDICTED: protein NSP-INTERACTING KINASE 1-...  90.9    6e-18   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_006650665.1|  PREDICTED: leucine-rich repeat receptor-like...  90.9    1e-17   Oryza brachyantha
ref|XP_002466378.1|  hypothetical protein SORBIDRAFT_01g006690        90.9    1e-17   Sorghum bicolor [broomcorn]
ref|XP_008665503.1|  PREDICTED: leucine-rich repeat receptor-like...  90.9    1e-17   Zea mays [maize]
ref|XP_010260843.1|  PREDICTED: leucine-rich repeat receptor-like...  90.1    2e-17   Nelumbo nucifera [Indian lotus]
ref|XP_009411355.1|  PREDICTED: leucine-rich repeat receptor-like...  90.1    2e-17   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_008357152.1|  PREDICTED: receptor protein kinase CLAVATA1-...  89.7    2e-17   
ref|XP_010943209.1|  PREDICTED: LOW QUALITY PROTEIN: leucine-rich...  89.7    2e-17   
ref|XP_008364929.1|  PREDICTED: receptor protein kinase CLAVATA1-...  89.7    2e-17   
ref|XP_011083584.1|  PREDICTED: receptor protein kinase CLAVATA1      89.7    3e-17   Sesamum indicum [beniseed]
ref|XP_007017845.1|  Leucine-rich receptor-like protein kinase fa...  89.4    4e-17   
gb|EMT21473.1|  Putative LRR receptor-like serine/threonine-prote...  89.0    5e-17   
ref|XP_010686227.1|  PREDICTED: probable LRR receptor-like serine...  88.2    5e-17   Beta vulgaris subsp. vulgaris [field beet]
tpg|DAA59489.1|  TPA: putative leucine-rich repeat receptor-like ...  89.0    6e-17   
ref|XP_010484821.1|  PREDICTED: putative receptor-like protein ki...  88.2    6e-17   Camelina sativa [gold-of-pleasure]
emb|CDP18494.1|  unnamed protein product                              88.6    8e-17   Coffea canephora [robusta coffee]
ref|XP_004955796.1|  PREDICTED: probable LRR receptor-like serine...  88.2    8e-17   Setaria italica
ref|XP_010266811.1|  PREDICTED: receptor protein kinase CLAVATA1      88.2    8e-17   
emb|CDY26403.1|  BnaA02g23670D                                        87.8    9e-17   Brassica napus [oilseed rape]
ref|XP_008812886.1|  PREDICTED: probable LRR receptor-like serine...  88.2    1e-16   Phoenix dactylifera
ref|XP_008811184.1|  PREDICTED: protein NSP-INTERACTING KINASE 1-...  87.4    1e-16   Phoenix dactylifera
ref|XP_010905760.1|  PREDICTED: protein NSP-INTERACTING KINASE 1-...  87.4    1e-16   Elaeis guineensis
ref|XP_004955422.1|  PREDICTED: leucine-rich repeat receptor-like...  87.8    1e-16   
emb|CDP04113.1|  unnamed protein product                              87.8    1e-16   Coffea canephora [robusta coffee]
ref|XP_004295533.1|  PREDICTED: leucine-rich repeat receptor-like...  87.4    1e-16   Fragaria vesca subsp. vesca
ref|XP_011045060.1|  PREDICTED: receptor protein kinase CLAVATA1-...  87.4    2e-16   Populus euphratica
ref|XP_010054700.1|  PREDICTED: putative receptor-like protein ki...  87.4    2e-16   Eucalyptus grandis [rose gum]
emb|CDY36706.1|  BnaC02g31270D                                        87.4    2e-16   Brassica napus [oilseed rape]
ref|XP_011036960.1|  PREDICTED: probable LRR receptor-like serine...  87.0    2e-16   Populus euphratica
ref|XP_001752668.1|  CLL1B clavata1-like receptor S/T protein kin...  87.0    2e-16   
ref|XP_010277679.1|  PREDICTED: LRR receptor-like serine/threonin...  87.0    2e-16   Nelumbo nucifera [Indian lotus]
ref|XP_009418700.1|  PREDICTED: leucine-rich repeat receptor-like...  87.0    2e-16   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_011004294.1|  PREDICTED: leucine-rich repeat receptor-like...  87.0    2e-16   Populus euphratica
ref|XP_007025340.1|  Leucine-rich repeat protein kinase family pr...  86.3    2e-16   
ref|XP_007025341.1|  Leucine-rich repeat protein kinase family pr...  86.3    2e-16   
ref|XP_002307734.1|  receptor protein kinase                          86.7    2e-16   Populus trichocarpa [western balsam poplar]
gb|AAT64017.1|  putative leucine-rich repeat transmembrane protein    86.3    3e-16   Gossypium hirsutum [American cotton]
gb|AHJ14779.1|  CLAVATA1                                              86.7    3e-16   Rhododendron ovatum
ref|XP_004981595.1|  PREDICTED: leucine-rich repeat receptor-like...  86.7    3e-16   Setaria italica
ref|XP_009123620.1|  PREDICTED: putative receptor-like protein ki...  86.7    3e-16   Brassica rapa
ref|XP_010257839.1|  PREDICTED: protein NSP-INTERACTING KINASE 1-...  85.9    3e-16   Nelumbo nucifera [Indian lotus]
ref|XP_011004295.1|  PREDICTED: leucine-rich repeat receptor-like...  86.3    3e-16   Populus euphratica
ref|XP_007214567.1|  hypothetical protein PRUPE_ppa000837mg           86.3    4e-16   Prunus persica
ref|XP_008225951.1|  PREDICTED: leucine-rich repeat receptor-like...  86.3    4e-16   Prunus mume [ume]
ref|XP_007021767.1|  Leucine-rich repeat protein kinase family pr...  86.3    4e-16   
ref|XP_010065839.1|  PREDICTED: putative receptor-like protein ki...  86.3    4e-16   Eucalyptus grandis [rose gum]
ref|XP_002985227.1|  hypothetical protein SELMODRAFT_121783           86.3    4e-16   
ref|NP_001058840.2|  Os07g0134200                                     85.9    5e-16   
ref|XP_010520745.1|  PREDICTED: putative receptor-like protein ki...  85.9    5e-16   Tarenaya hassleriana [spider flower]
gb|AAF73373.1|AF193835_1  LRK1 protein                                85.9    5e-16   Oryza sativa [red rice]
ref|XP_002461427.1|  hypothetical protein SORBIDRAFT_02g002450        85.9    5e-16   Sorghum bicolor [broomcorn]
ref|XP_009396215.1|  PREDICTED: protein NSP-INTERACTING KINASE 1-...  85.5    5e-16   Musa acuminata subsp. malaccensis [pisang utan]
gb|EAZ02682.1|  hypothetical protein OsI_24796                        85.9    5e-16   Oryza sativa Indica Group [Indian rice]
dbj|BAC82955.1|  putative OsLRK1(receptor-type protein kinase)        85.9    6e-16   Oryza sativa Japonica Group [Japonica rice]
emb|CDX73202.1|  BnaC06g36500D                                        85.9    6e-16   
gb|ACD56664.1|  putative leucine-rich repeat transmembrane protein    85.1    6e-16   Gossypium arboreum [tree cotton]
gb|KFK42020.1|  hypothetical protein AALP_AA2G201900                  85.5    7e-16   Arabis alpina [alpine rockcress]
ref|XP_007151443.1|  hypothetical protein PHAVU_004G046800g           84.7    8e-16   Phaseolus vulgaris [French bean]
ref|XP_007214129.1|  hypothetical protein PRUPE_ppa018020mg           85.5    8e-16   
ref|XP_008808401.1|  PREDICTED: leucine-rich repeat receptor-like...  85.1    9e-16   Phoenix dactylifera
gb|EEC68381.1|  hypothetical protein OsI_36527                        84.7    9e-16   Oryza sativa Indica Group [Indian rice]
gb|KCW63525.1|  hypothetical protein EUGRSUZ_G01159                   84.3    9e-16   Eucalyptus grandis [rose gum]
ref|XP_002305057.2|  hypothetical protein POPTR_0004s05880g           85.1    9e-16   
ref|XP_006663536.1|  PREDICTED: probable LRR receptor-like serine...  85.1    1e-15   Oryza brachyantha
ref|XP_010690942.1|  PREDICTED: probable LRR receptor-like serine...  85.1    1e-15   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_006382632.1|  hypothetical protein POPTR_0005s03970g           85.1    1e-15   Populus trichocarpa [western balsam poplar]
ref|XP_010100900.1|  Protein NSP-INTERACTING KINASE 1                 84.7    1e-15   
gb|KCW60108.1|  hypothetical protein EUGRSUZ_H02842                   84.7    1e-15   Eucalyptus grandis [rose gum]
ref|XP_010026766.1|  PREDICTED: putative receptor-like protein ki...  85.1    1e-15   
emb|CAH56437.1|  somatic embryogenesis receptor-like kinase 1         84.3    1e-15   Poa pratensis
ref|XP_009400102.1|  PREDICTED: protein NSP-INTERACTING KINASE 1-...  84.3    1e-15   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009391272.1|  PREDICTED: protein NSP-INTERACTING KINASE 1-...  84.3    1e-15   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009400110.1|  PREDICTED: protein NSP-INTERACTING KINASE 1-...  84.3    1e-15   Musa acuminata subsp. malaccensis [pisang utan]
emb|CDX87661.1|  BnaA07g32120D                                        84.7    1e-15   
ref|XP_007154851.1|  hypothetical protein PHAVU_003G152900g           84.3    1e-15   Phaseolus vulgaris [French bean]
ref|XP_002269902.1|  PREDICTED: protein NSP-INTERACTING KINASE 1      84.3    1e-15   Vitis vinifera
ref|XP_010041038.1|  PREDICTED: putative receptor-like protein ki...  84.7    1e-15   
ref|XP_010929457.1|  PREDICTED: protein NSP-INTERACTING KINASE 1-...  84.3    1e-15   Elaeis guineensis
ref|XP_008387933.1|  PREDICTED: receptor protein kinase CLAVATA1      84.7    1e-15   Malus domestica [apple tree]
ref|XP_009391273.1|  PREDICTED: protein NSP-INTERACTING KINASE 1-...  84.3    1e-15   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_008797566.1|  PREDICTED: protein NSP-INTERACTING KINASE 1-...  84.0    1e-15   Phoenix dactylifera
ref|XP_010050671.1|  PREDICTED: putative receptor-like protein ki...  84.7    1e-15   Eucalyptus grandis [rose gum]
ref|XP_009376453.1|  PREDICTED: probable LRR receptor-like serine...  84.7    1e-15   Pyrus x bretschneideri [bai li]
gb|KJB29653.1|  hypothetical protein B456_005G112100                  84.3    2e-15   Gossypium raimondii
gb|EYU38789.1|  hypothetical protein MIMGU_mgv1a000850mg              84.3    2e-15   Erythranthe guttata [common monkey flower]
ref|XP_007213538.1|  hypothetical protein PRUPE_ppa019671mg           81.3    2e-15   
emb|CAN71863.1|  hypothetical protein VITISV_023530                   84.3    2e-15   Vitis vinifera
ref|XP_010269666.1|  PREDICTED: probable LRR receptor-like serine...  84.3    2e-15   
ref|XP_008353615.1|  PREDICTED: LRR receptor-like serine/threonin...  80.5    2e-15   
gb|KCW80214.1|  hypothetical protein EUGRSUZ_C01568                   84.3    2e-15   Eucalyptus grandis [rose gum]
ref|XP_009106236.1|  PREDICTED: receptor protein kinase CLAVATA1      84.3    2e-15   Brassica rapa
ref|XP_008791706.1|  PREDICTED: putative receptor-like protein ki...  84.3    2e-15   
ref|XP_002322110.2|  hypothetical protein POPTR_0015s04680g           84.3    2e-15   Populus trichocarpa [western balsam poplar]
ref|XP_010064788.1|  PREDICTED: putative receptor-like protein ki...  84.3    2e-15   Eucalyptus grandis [rose gum]
ref|XP_002263291.2|  PREDICTED: leucine-rich repeat receptor-like...  84.3    2e-15   Vitis vinifera
gb|KJB40660.1|  hypothetical protein B456_007G073100                  84.3    2e-15   Gossypium raimondii
ref|NP_001176614.1|  Os11g0568800                                     84.3    2e-15   
ref|XP_010248541.1|  PREDICTED: protein NSP-INTERACTING KINASE 3-...  84.0    2e-15   Nelumbo nucifera [Indian lotus]
emb|CBI29704.3|  unnamed protein product                              84.3    2e-15   Vitis vinifera
gb|AAX93041.1|  hypothetical protein LOC_Os11g07260                   84.3    2e-15   Oryza sativa Japonica Group [Japonica rice]
gb|KJB69702.1|  hypothetical protein B456_011G038400                  83.6    2e-15   Gossypium raimondii
ref|XP_010068376.1|  PREDICTED: putative receptor-like protein ki...  84.3    2e-15   
gb|KJB73883.1|  hypothetical protein B456_011G2584002                 80.9    2e-15   Gossypium raimondii
ref|NP_001065874.2|  Os11g0173800                                     84.3    2e-15   
ref|XP_010925613.1|  PREDICTED: probable LRR receptor-like serine...  83.2    2e-15   
gb|KCW69037.1|  hypothetical protein EUGRSUZ_F02592                   84.3    2e-15   Eucalyptus grandis [rose gum]
gb|AAT64032.1|  putative leucine-rich repeat transmembrane protein    83.6    2e-15   Gossypium hirsutum [American cotton]
gb|KEH33614.1|  LRR receptor-like kinase family protein               84.3    2e-15   Medicago truncatula
emb|CDY63395.1|  BnaCnng41990D                                        83.2    2e-15   Brassica napus [oilseed rape]
ref|XP_006856744.1|  hypothetical protein AMTR_s00055p00012250        84.3    2e-15   
gb|KJB69703.1|  hypothetical protein B456_011G038400                  83.6    2e-15   Gossypium raimondii
gb|EAZ18778.1|  hypothetical protein OsJ_34305                        84.0    2e-15   Oryza sativa Japonica Group [Japonica rice]
ref|XP_011035599.1|  PREDICTED: probable LRR receptor-like serine...  84.0    2e-15   Populus euphratica
ref|XP_010925612.1|  PREDICTED: probable LRR receptor-like serine...  83.6    2e-15   Elaeis guineensis
ref|XP_002317696.2|  hypothetical protein POPTR_0012s04160g           84.0    2e-15   
ref|XP_010999778.1|  PREDICTED: probable LRR receptor-like serine...  84.0    2e-15   Populus euphratica
ref|XP_009334873.1|  PREDICTED: receptor protein kinase CLAVATA1      84.0    2e-15   Pyrus x bretschneideri [bai li]
ref|XP_009405747.1|  PREDICTED: leucine-rich repeat receptor-like...  84.0    3e-15   
gb|EEC68382.1|  hypothetical protein OsI_36528                        84.0    3e-15   Oryza sativa Indica Group [Indian rice]
ref|XP_008659447.1|  PREDICTED: protein NSP-INTERACTING KINASE 1-...  80.1    3e-15   Zea mays [maize]
ref|XP_008225333.1|  PREDICTED: probable LRR receptor-like serine...  84.0    3e-15   
gb|EYU30632.1|  hypothetical protein MIMGU_mgv1a022995mg              81.3    3e-15   Erythranthe guttata [common monkey flower]
ref|XP_010068348.1|  PREDICTED: putative receptor-like protein ki...  83.6    3e-15   
ref|XP_006279948.1|  hypothetical protein CARUB_v10025818mg           83.6    3e-15   
gb|AAP49010.1|  CLV1-like receptor kinase                             83.6    3e-15   Brassica napus [oilseed rape]
gb|KCW63534.1|  hypothetical protein EUGRSUZ_G01170                   83.6    3e-15   Eucalyptus grandis [rose gum]
gb|ADD64789.1|  CLAVATA1                                              83.6    3e-15   Brassica napus [oilseed rape]
ref|XP_009377798.1|  PREDICTED: probable LRR receptor-like serine...  83.6    3e-15   
ref|XP_004138566.1|  PREDICTED: probable LRR receptor-like serine...  83.6    3e-15   
ref|XP_010942232.1|  PREDICTED: protein NSP-INTERACTING KINASE 1-...  82.8    3e-15   Elaeis guineensis
ref|XP_011021148.1|  PREDICTED: protein NSP-INTERACTING KINASE 1-...  82.8    3e-15   Populus euphratica
ref|XP_011021146.1|  PREDICTED: protein NSP-INTERACTING KINASE 1-...  82.8    3e-15   Populus euphratica
ref|XP_010927978.1|  PREDICTED: protein NSP-INTERACTING KINASE 1-...  82.8    4e-15   Elaeis guineensis
ref|XP_009108464.1|  PREDICTED: leucine-rich repeat receptor-like...  83.6    4e-15   Brassica rapa
ref|XP_007009037.1|  LRR receptor-like serine/threonine-protein k...  83.2    4e-15   
emb|CBI21262.3|  unnamed protein product                              82.4    4e-15   Vitis vinifera
ref|XP_011019593.1|  PREDICTED: probably inactive leucine-rich re...  83.2    4e-15   Populus euphratica
ref|NP_001238576.1|  receptor protein kinase-like protein precursor   83.2    4e-15   Glycine max [soybeans]
ref|XP_010100747.1|  putative LRR receptor-like serine/threonine-...  82.8    4e-15   
ref|XP_010471715.1|  PREDICTED: receptor protein kinase CLAVATA1 ...  83.2    4e-15   
ref|XP_010935096.1|  PREDICTED: leucine-rich repeat receptor-like...  83.2    4e-15   Elaeis guineensis
ref|XP_002264952.1|  PREDICTED: leucine-rich repeat receptor-like...  83.2    4e-15   Vitis vinifera
ref|XP_008444584.1|  PREDICTED: probable LRR receptor-like serine...  83.2    5e-15   
ref|XP_009131797.1|  PREDICTED: LRR receptor-like serine/threonin...  83.2    5e-15   Brassica rapa
gb|KFK34061.1|  hypothetical protein AALP_AA5G097000                  83.2    5e-15   Arabis alpina [alpine rockcress]
ref|XP_010256508.1|  PREDICTED: probable LRR receptor-like serine...  83.2    5e-15   Nelumbo nucifera [Indian lotus]
ref|XP_006853709.1|  hypothetical protein AMTR_s00056p00150470        82.8    5e-15   Amborella trichopoda
ref|XP_010064793.1|  PREDICTED: putative receptor-like protein ki...  82.4    5e-15   
emb|CAN63733.1|  hypothetical protein VITISV_025883                   82.4    5e-15   Vitis vinifera
gb|KEH19631.1|  LRR receptor-like kinase                              82.8    5e-15   Medicago truncatula
gb|ACD56650.1|  putative leucine-rich repeat transmembrane protein    82.4    6e-15   Gossypioides kirkii
ref|XP_004972877.1|  PREDICTED: probable LRR receptor-like serine...  81.6    6e-15   
ref|XP_009417562.1|  PREDICTED: protein NSP-INTERACTING KINASE 1-...  82.4    6e-15   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_004291349.1|  PREDICTED: receptor protein kinase CLAVATA1      82.8    6e-15   Fragaria vesca subsp. vesca
gb|EYU26654.1|  hypothetical protein MIMGU_mgv1a001213mg              82.8    6e-15   Erythranthe guttata [common monkey flower]
ref|XP_011039407.1|  PREDICTED: probable LRR receptor-like serine...  82.0    6e-15   Populus euphratica
ref|XP_010654174.1|  PREDICTED: putative receptor-like protein ki...  82.8    6e-15   Vitis vinifera
ref|XP_004143021.1|  PREDICTED: probable LRR receptor-like serine...  82.8    6e-15   Cucumis sativus [cucumbers]
ref|XP_011099069.1|  PREDICTED: putative receptor-like protein ki...  82.8    6e-15   
gb|KGN62467.1|  hypothetical protein Csa_2G354930                     82.8    7e-15   Cucumis sativus [cucumbers]
ref|NP_001042048.1|  Os01g0152800                                     82.8    7e-15   
gb|EAY72573.1|  hypothetical protein OsI_00439                        82.8    7e-15   Oryza sativa Indica Group [Indian rice]
gb|KHG14943.1|  LRR receptor-like serine/threonine-protein kinase...  82.4    7e-15   Gossypium arboreum [tree cotton]
ref|XP_009352740.1|  PREDICTED: probable LRR receptor-like serine...  82.0    7e-15   
ref|XP_008792970.1|  PREDICTED: probable LRR receptor-like serine...  81.6    7e-15   
ref|XP_010907375.1|  PREDICTED: probable LRR receptor-like serine...  82.8    7e-15   Elaeis guineensis
emb|CAN83822.1|  hypothetical protein VITISV_030954                   82.8    7e-15   Vitis vinifera
emb|CDX92460.1|  BnaA10g14990D                                        82.4    7e-15   
ref|XP_009377741.1|  PREDICTED: probable LRR receptor-like serine...  82.4    7e-15   
ref|XP_009417563.1|  PREDICTED: protein NSP-INTERACTING KINASE 1-...  81.6    8e-15   
gb|KCW80199.1|  hypothetical protein EUGRSUZ_C01543                   82.4    8e-15   Eucalyptus grandis [rose gum]
gb|KCW69044.1|  hypothetical protein EUGRSUZ_F02602                   82.0    8e-15   Eucalyptus grandis [rose gum]
ref|XP_011039404.1|  PREDICTED: probable LRR receptor-like serine...  82.0    8e-15   Populus euphratica
gb|EEC68386.1|  hypothetical protein OsI_36534                        82.0    9e-15   Oryza sativa Indica Group [Indian rice]
gb|KCW74133.1|  hypothetical protein EUGRSUZ_E02764                   81.6    9e-15   Eucalyptus grandis [rose gum]
ref|XP_008792202.1|  PREDICTED: probable LRR receptor-like serine...  81.6    9e-15   Phoenix dactylifera
ref|XP_006338306.1|  PREDICTED: protein NSP-INTERACTING KINASE 1-...  81.6    9e-15   Solanum tuberosum [potatoes]
emb|CDP10862.1|  unnamed protein product                              82.0    9e-15   Coffea canephora [robusta coffee]
ref|XP_011462029.1|  PREDICTED: probable LRR receptor-like serine...  82.4    9e-15   Fragaria vesca subsp. vesca
ref|XP_006300675.1|  hypothetical protein CARUB_v10019714mg           82.0    1e-14   
ref|XP_010054697.1|  PREDICTED: putative receptor-like protein ki...  82.0    1e-14   
ref|XP_007040964.1|  Leucine-rich receptor-like protein kinase fa...  82.0    1e-14   
ref|XP_004232118.1|  PREDICTED: protein NSP-INTERACTING KINASE 1      81.6    1e-14   
ref|XP_010257264.1|  PREDICTED: probably inactive leucine-rich re...  82.0    1e-14   
gb|KDP44807.1|  hypothetical protein JCGZ_01307                       82.0    1e-14   
gb|KJB59753.1|  hypothetical protein B456_009G269700                  81.6    1e-14   
ref|XP_002317403.1|  leucine-rich repeat transmembrane protein ki...  81.6    1e-14   
ref|XP_008371495.1|  PREDICTED: probable LRR receptor-like serine...  81.6    1e-14   
ref|XP_008371496.1|  PREDICTED: probable LRR receptor-like serine...  81.6    1e-14   
ref|XP_009800500.1|  PREDICTED: putative receptor-like protein ki...  82.0    1e-14   
ref|XP_010533421.1|  PREDICTED: putative receptor-like protein ki...  82.0    1e-14   
ref|XP_002308597.2|  hypothetical protein POPTR_0006s25380g           82.0    1e-14   
gb|KCW77199.1|  hypothetical protein EUGRSUZ_D01548                   82.0    1e-14   
gb|KDP44810.1|  hypothetical protein JCGZ_01310                       82.0    1e-14   
ref|XP_009618942.1|  PREDICTED: putative receptor-like protein ki...  82.0    1e-14   
ref|XP_009393965.1|  PREDICTED: leucine-rich repeat receptor-like...  81.6    1e-14   
ref|XP_009618941.1|  PREDICTED: putative receptor-like protein ki...  82.0    1e-14   
ref|XP_001754727.1|  CLL1A clavata1-like receptor S/T protein kin...  82.0    1e-14   
emb|CCF03508.1|  receptor kinase                                      82.0    1e-14   
ref|XP_007009033.1|  Serine-threonine protein kinase, plant-type,...  81.6    1e-14   
gb|KCW63523.1|  hypothetical protein EUGRSUZ_G011582                  79.3    1e-14   
ref|XP_004979517.1|  PREDICTED: putative receptor-like protein ki...  81.6    1e-14   
ref|XP_003560981.1|  PREDICTED: putative leucine-rich repeat rece...  81.6    1e-14   
gb|KCW62999.1|  hypothetical protein EUGRSUZ_G00600                   81.6    1e-14   
ref|XP_009345734.1|  PREDICTED: putative receptor-like protein ki...  81.6    1e-14   
ref|XP_009351465.1|  PREDICTED: probable LRR receptor-like serine...  81.3    1e-14   
ref|XP_007207830.1|  hypothetical protein PRUPE_ppa023423mg           81.6    1e-14   
ref|XP_008783060.1|  PREDICTED: protein NSP-INTERACTING KINASE 1-...  81.3    1e-14   
ref|XP_002453589.1|  hypothetical protein SORBIDRAFT_04g008570        81.3    2e-14   
emb|CAN71566.1|  hypothetical protein VITISV_016304                   79.3    2e-14   
ref|XP_002526889.1|  serine-threonine protein kinase, plant-type,...  81.6    2e-14   
gb|EEC66712.1|  hypothetical protein OsI_33040                        81.6    2e-14   
emb|CDP16554.1|  unnamed protein product                              80.9    2e-14   
emb|CCF03505.1|  receptor kinase                                      81.6    2e-14   
gb|KCW86689.1|  hypothetical protein EUGRSUZ_B03306                   80.9    2e-14   
ref|XP_009123618.1|  PREDICTED: putative receptor-like protein ki...  81.3    2e-14   
ref|XP_008794419.1|  PREDICTED: putative leucine-rich repeat rece...  81.6    2e-14   
ref|XP_006423117.1|  hypothetical protein CICLE_v10027688mg           81.6    2e-14   
ref|XP_004160745.1|  PREDICTED: LOW QUALITY PROTEIN: probable LRR...  81.3    2e-14   
ref|XP_007021924.1|  Serine-threonine protein kinase                  79.7    2e-14   
gb|KCW69036.1|  hypothetical protein EUGRSUZ_F02590                   81.3    2e-14   
gb|KJB73884.1|  hypothetical protein B456_011G258500                  81.3    2e-14   
ref|XP_006358680.1|  PREDICTED: probable LRR receptor-like serine...  81.3    2e-14   
ref|XP_009415746.1|  PREDICTED: leucine-rich repeat receptor-like...  81.3    2e-14   
ref|XP_008346276.1|  PREDICTED: receptor-like protein kinase          81.3    2e-14   
ref|XP_004964649.1|  PREDICTED: putative leucine-rich repeat rece...  81.3    2e-14   
ref|XP_011074693.1|  PREDICTED: receptor protein kinase CLAVATA1-...  81.3    2e-14   
ref|XP_008370155.1|  PREDICTED: probable LRR receptor-like serine...  81.3    2e-14   
ref|XP_007026751.1|  LRR receptor-like serine/threonine-protein k...  81.3    2e-14   
ref|XP_010675938.1|  PREDICTED: LRR receptor-like serine/threonin...  81.3    2e-14   
ref|XP_008351784.1|  PREDICTED: putative receptor-like protein ki...  81.3    2e-14   
ref|XP_008444352.1|  PREDICTED: protein NSP-INTERACTING KINASE 3 ...  80.9    2e-14   
ref|XP_006350351.1|  PREDICTED: probable LRR receptor-like serine...  81.3    2e-14   
gb|EYU17827.1|  hypothetical protein MIMGU_mgv1a023554mg              81.3    2e-14   
ref|XP_002278965.1|  PREDICTED: protein NSP-INTERACTING KINASE 1      80.9    2e-14   
gb|KCW58273.1|  hypothetical protein EUGRSUZ_H00964                   81.3    2e-14   
ref|XP_003571896.1|  PREDICTED: probable LRR receptor-like serine...  80.9    2e-14   
ref|XP_010269665.1|  PREDICTED: probable LRR receptor-like serine...  81.3    2e-14   
ref|NP_001068120.1|  Os11g0570000                                     80.5    2e-14   
emb|CBI16897.3|  unnamed protein product                              80.9    2e-14   
ref|XP_006590881.1|  PREDICTED: receptor protein kinase CLAVATA1-...  80.9    2e-14   
ref|XP_009781121.1|  PREDICTED: probable LRR receptor-like serine...  80.5    2e-14   
ref|XP_008808621.1|  PREDICTED: leucine-rich repeat receptor-like...  81.3    2e-14   
ref|XP_010026074.1|  PREDICTED: receptor protein kinase CLAVATA1      81.3    2e-14   
emb|CDP20234.1|  unnamed protein product                              81.3    2e-14   
gb|EYU40960.1|  hypothetical protein MIMGU_mgv1a018813mg              80.9    2e-14   
gb|KCW54708.1|  hypothetical protein EUGRSUZ_I00657                   79.0    2e-14   
ref|XP_009781120.1|  PREDICTED: probable LRR receptor-like serine...  80.5    2e-14   
gb|EYU17822.1|  hypothetical protein MIMGU_mgv1a018971mg              80.5    2e-14   
ref|XP_010441796.1|  PREDICTED: putative receptor-like protein ki...  80.9    2e-14   
gb|KCW63536.1|  hypothetical protein EUGRSUZ_G01172                   80.9    2e-14   
ref|XP_007012155.1|  Probably inactive leucine-rich repeat recept...  80.9    2e-14   
ref|XP_009588501.1|  PREDICTED: probable LRR receptor-like serine...  80.9    2e-14   
ref|XP_007213585.1|  hypothetical protein PRUPE_ppa003046mg           80.5    3e-14   
ref|NP_001238004.1|  receptor protein kinase-like protein precursor   80.9    3e-14   
ref|XP_007153543.1|  hypothetical protein PHAVU_003G044400g           80.5    3e-14   
gb|KCW63531.1|  hypothetical protein EUGRSUZ_G01166                   80.5    3e-14   
ref|XP_009409775.1|  PREDICTED: putative leucine-rich repeat rece...  80.9    3e-14   
ref|XP_010911433.1|  PREDICTED: putative receptor-like protein ki...  79.3    3e-14   
dbj|BAC41332.1|  LRR receptor-like kinase                             80.9    3e-14   
ref|XP_011462028.1|  PREDICTED: LRR receptor-like serine/threonin...  78.2    3e-14   
gb|EYU21721.1|  hypothetical protein MIMGU_mgv1a019783mg              80.9    3e-14   
ref|XP_004142972.1|  PREDICTED: protein NSP-INTERACTING KINASE 3-...  80.5    3e-14   
emb|CAH56436.1|  somatic embryogenesis receptor-like kinase 2         80.5    3e-14   
ref|XP_010068338.1|  PREDICTED: putative receptor-like protein ki...  80.9    3e-14   
ref|XP_007020361.1|  Serine-threonine protein kinase, putative        80.5    3e-14   
ref|XP_010655576.1|  PREDICTED: probable LRR receptor-like serine...  80.9    3e-14   
ref|XP_010535394.1|  PREDICTED: putative receptor-like protein ki...  80.9    3e-14   
emb|CDX84254.1|  BnaC04g10160D                                        80.5    3e-14   
ref|XP_002297907.2|  leucine-rich repeat transmembrane protein ki...  80.9    3e-14   
ref|XP_004951350.1|  PREDICTED: probable LRR receptor-like serine...  80.1    3e-14   
gb|EYU40965.1|  hypothetical protein MIMGU_mgv1a024855mg              80.5    3e-14   
ref|XP_008385914.1|  PREDICTED: probable LRR receptor-like serine...  80.9    3e-14   
ref|XP_002510557.1|  Receptor protein kinase CLAVATA1 precursor, ...  80.5    3e-14   
ref|XP_010068335.1|  PREDICTED: putative receptor-like protein ki...  80.5    3e-14   
ref|XP_009409686.1|  PREDICTED: putative receptor-like protein ki...  80.9    3e-14   
ref|XP_002448543.1|  hypothetical protein SORBIDRAFT_06g028760        80.9    3e-14   
gb|KCW80480.1|  hypothetical protein EUGRSUZ_C018221                  77.4    3e-14   
gb|AAD02501.1|  receptor kinase                                       80.5    3e-14   
ref|XP_008439728.1|  PREDICTED: probable LRR receptor-like serine...  80.1    3e-14   
gb|AAB58929.1|  CLV1 receptor kinase                                  80.5    3e-14   
gb|KJB73886.1|  hypothetical protein B456_011G258700                  80.5    3e-14   
pir||E96787  protein T4O12.5 [imported] - Arabidopsis thaliana        80.5    3e-14
gb|KDP44794.1|  hypothetical protein JCGZ_01294                       80.9    3e-14   
ref|XP_010092495.1|  putative LRR receptor-like serine/threonine-...  77.8    3e-14   
ref|XP_008225339.1|  PREDICTED: probable LRR receptor-like serine...  80.1    3e-14   
ref|NP_177710.1|  receptor protein kinase CLAVATA1                    80.5    3e-14   
gb|EAY80122.1|  hypothetical protein OsI_35294                        80.5    3e-14   
ref|XP_010910648.1|  PREDICTED: putative receptor-like protein ki...  78.6    4e-14   
ref|XP_008223897.1|  PREDICTED: probable LRR receptor-like serine...  80.5    4e-14   
ref|XP_004954644.1|  PREDICTED: putative receptor-like protein ki...  80.5    4e-14   
ref|XP_010262819.1|  PREDICTED: putative receptor-like protein ki...  80.5    4e-14   
gb|KCW44699.1|  hypothetical protein EUGRSUZ_L01766                   80.5    4e-14   
gb|EYU40961.1|  hypothetical protein MIMGU_mgv1a001130mg              80.5    4e-14   
ref|XP_010416487.1|  PREDICTED: receptor protein kinase CLAVATA1-...  80.5    4e-14   
ref|XP_007021880.1|  Serine-threonine protein kinase                  77.4    4e-14   
gb|KHG24572.1|  Receptor protein kinase CLAVATA1                      80.5    4e-14   
ref|XP_004507264.1|  PREDICTED: protein NSP-INTERACTING KINASE 1-...  79.7    4e-14   
ref|XP_004309032.2|  PREDICTED: probable LRR receptor-like serine...  80.5    4e-14   
ref|XP_004499483.1|  PREDICTED: leucine-rich repeat receptor-like...  80.5    4e-14   
gb|KHN47744.1|  LRR receptor-like serine/threonine-protein kinase...  80.5    4e-14   
gb|EEE51731.1|  hypothetical protein OsJ_33139                        80.5    4e-14   
ref|XP_002526451.1|  Receptor protein kinase CLAVATA1 precursor, ...  80.1    4e-14   
ref|XP_010068349.1|  PREDICTED: putative receptor-like protein ki...  80.1    4e-14   
ref|XP_002865197.1|  flagellin-sensitive 2                            80.5    4e-14   
ref|XP_009614227.1|  PREDICTED: probable LRR receptor-like serine...  80.1    4e-14   
emb|CCF03507.1|  receptor kinase                                      80.5    4e-14   
ref|XP_010428620.1|  PREDICTED: receptor protein kinase CLAVATA1-...  80.1    4e-14   
gb|AAX93038.1|  hypothetical protein LOC_Os11g07230                   80.5    4e-14   
emb|CCF03504.1|  receptor kinase                                      80.5    4e-14   
ref|XP_008358557.1|  PREDICTED: LRR receptor-like serine/threonin...  80.5    4e-14   
gb|EEC69968.1|  hypothetical protein OsI_00436                        80.1    4e-14   
ref|XP_011099082.1|  PREDICTED: protein NSP-INTERACTING KINASE 1-...  79.7    5e-14   
ref|XP_010068343.1|  PREDICTED: putative receptor-like protein ki...  80.1    5e-14   
emb|CCF03506.1|  receptor kinase                                      80.1    5e-14   
ref|XP_006373507.1|  hypothetical protein POPTR_0017s14360g           79.7    5e-14   
ref|XP_006390268.1|  hypothetical protein EUTSA_v10018069mg           80.1    5e-14   
ref|XP_010050768.1|  PREDICTED: putative receptor-like protein ki...  80.1    5e-14   
ref|XP_009409684.1|  PREDICTED: putative receptor-like protein ki...  80.1    5e-14   
ref|XP_008364895.1|  PREDICTED: probable LRR receptor-like serine...  79.7    5e-14   
gb|EEC79804.1|  hypothetical protein OsI_21242                        80.1    5e-14   
ref|XP_009619542.1|  PREDICTED: probable LRR receptor-like serine...  79.7    5e-14   
gb|KEH41733.1|  LRR receptor-like kinase family protein               76.6    5e-14   
gb|KCW63516.1|  hypothetical protein EUGRSUZ_G011492                  79.0    5e-14   
ref|XP_009782387.1|  PREDICTED: probable LRR receptor-like serine...  80.1    5e-14   
ref|XP_008243752.1|  PREDICTED: protein NSP-INTERACTING KINASE 2      79.7    5e-14   
ref|XP_009107554.1|  PREDICTED: probable LRR receptor-like serine...  79.7    5e-14   
ref|XP_009619541.1|  PREDICTED: probable LRR receptor-like serine...  79.3    5e-14   
ref|XP_006490053.1|  PREDICTED: probably inactive leucine-rich re...  79.7    5e-14   
ref|XP_002300697.2|  receptor protein kinase                          80.1    5e-14   
ref|XP_004972876.1|  PREDICTED: probable LRR receptor-like serine...  80.1    5e-14   
ref|XP_007099725.1|  Serine-threonine protein kinase                  76.6    5e-14   
ref|NP_001174552.1|  Os05g0595950                                     80.1    6e-14   
ref|XP_006421471.1|  hypothetical protein CICLE_v10004276mg           79.7    6e-14   
emb|CBI30706.3|  unnamed protein product                              79.3    6e-14   
ref|XP_006437547.1|  hypothetical protein CICLE_v10033496mg           79.7    6e-14   
ref|XP_008221401.1|  PREDICTED: receptor protein kinase CLAVATA1      79.7    6e-14   
gb|KCW80486.1|  hypothetical protein EUGRSUZ_C01828                   79.7    6e-14   
ref|XP_008807033.1|  PREDICTED: protein NSP-INTERACTING KINASE 1-...  79.3    6e-14   
ref|XP_002889046.1|  hypothetical protein ARALYDRAFT_476729           79.7    6e-14   
ref|XP_008807034.1|  PREDICTED: protein NSP-INTERACTING KINASE 1-...  79.3    6e-14   
ref|XP_002304615.1|  leucine-rich repeat transmembrane protein ki...  79.7    6e-14   
ref|XP_007225356.1|  hypothetical protein PRUPE_ppa000916mg           79.7    6e-14   
ref|XP_010526993.1|  PREDICTED: BRASSINOSTEROID INSENSITIVE 1-ass...  79.3    6e-14   
ref|XP_008345324.1|  PREDICTED: putative receptor-like protein ki...  80.1    6e-14   
emb|CDP19652.1|  unnamed protein product                              79.7    6e-14   
ref|XP_010091686.1|  Protein NSP-INTERACTING KINASE 2                 79.3    6e-14   
emb|CDX91804.1|  BnaC03g31060D                                        79.7    6e-14   
gb|KCW80196.1|  hypothetical protein EUGRSUZ_C01538                   79.7    6e-14   
gb|EEC67765.1|  hypothetical protein OsI_35299                        79.3    7e-14   
ref|XP_008349363.1|  PREDICTED: putative receptor-like protein ki...  79.7    7e-14   
ref|NP_001152329.1|  BRASSINOSTEROID INSENSITIVE 1-associated rec...  79.3    7e-14   
gb|EYU40963.1|  hypothetical protein MIMGU_mgv1a000739mg              79.7    7e-14   
ref|XP_003633015.1|  PREDICTED: probable LRR receptor-like serine...  79.3    7e-14   
ref|XP_009368577.1|  PREDICTED: leucine-rich repeat receptor-like...  79.7    7e-14   
ref|XP_008224399.1|  PREDICTED: probable LRR receptor-like serine...  79.7    7e-14   
ref|XP_004964421.1|  PREDICTED: LRR receptor-like serine/threonin...  79.7    7e-14   
ref|XP_006484594.1|  PREDICTED: probable LRR receptor-like serine...  79.7    7e-14   
gb|KJB73903.1|  hypothetical protein B456_011G260200                  79.7    7e-14   
ref|XP_008223875.1|  PREDICTED: probable LRR receptor-like serine...  79.7    7e-14   
dbj|BAH20868.1|  putative LRR-kinase protein                          79.7    7e-14   
ref|XP_003545159.1|  PREDICTED: leucine-rich repeat receptor-like...  79.3    7e-14   
emb|CCF03509.1|  receptor kinase                                      79.7    7e-14   
ref|XP_010939071.1|  PREDICTED: probable LRR receptor-like serine...  79.7    7e-14   
ref|XP_009373071.1|  PREDICTED: probable LRR receptor-like serine...  79.7    8e-14   
gb|KDP37051.1|  hypothetical protein JCGZ_06107                       79.3    8e-14   
gb|KDP44787.1|  hypothetical protein JCGZ_01287                       76.3    8e-14   
ref|XP_008345430.1|  PREDICTED: probable LRR receptor-like serine...  79.3    8e-14   
gb|KJB60823.1|  hypothetical protein B456_009G327400                  79.0    8e-14   
ref|XP_011021261.1|  PREDICTED: probable LRR receptor-like serine...  79.3    8e-14   
ref|XP_011470626.1|  PREDICTED: LRR receptor-like serine/threonin...  77.8    8e-14   
gb|EEC68365.1|  hypothetical protein OsI_36500                        78.6    8e-14   
gb|KJB73885.1|  hypothetical protein B456_011G258600                  79.3    8e-14   
ref|XP_004295585.1|  PREDICTED: probable LRR receptor-like serine...  79.0    8e-14   
ref|XP_003529146.2|  PREDICTED: probable LRR receptor-like serine...  79.3    8e-14   
ref|XP_006583642.1|  PREDICTED: probable LRR receptor-like serine...  79.3    8e-14   
ref|XP_010044599.1|  PREDICTED: protein NSP-INTERACTING KINASE 3-...  79.0    8e-14   
gb|KCW63508.1|  hypothetical protein EUGRSUZ_G01139                   79.3    8e-14   
ref|XP_007028891.1|  Receptor protein kinase CLAVATA1, putative       79.3    8e-14   
ref|XP_002459536.1|  hypothetical protein SORBIDRAFT_02g006250        79.3    8e-14   
ref|XP_006383439.1|  hypothetical protein POPTR_0005s15520g           79.3    9e-14   
ref|XP_006292332.1|  hypothetical protein CARUB_v10018543mg           79.3    9e-14   
ref|XP_006437528.1|  hypothetical protein CICLE_v10033594mg           79.3    9e-14   
ref|NP_001238448.1|  NSP-interacting kinase precursor                 78.6    9e-14   
ref|XP_007219655.1|  hypothetical protein PRUPE_ppa025151mg           79.3    9e-14   
gb|KDO84901.1|  hypothetical protein CISIN_1g002010mg                 79.3    9e-14   
ref|XP_006435205.1|  hypothetical protein CICLE_v10000156mg           79.3    1e-13   
ref|XP_007158089.1|  hypothetical protein PHAVU_002G123200g           79.3    1e-13   
ref|XP_008339051.1|  PREDICTED: putative receptor-like protein ki...  79.0    1e-13   
emb|CBI25249.3|  unnamed protein product                              79.3    1e-13   
ref|XP_009337767.1|  PREDICTED: probable LRR receptor-like serine...  79.3    1e-13   
ref|XP_010241414.1|  PREDICTED: probable LRR receptor-like serine...  79.3    1e-13   
ref|XP_006473681.1|  PREDICTED: receptor protein kinase CLAVATA1-...  79.0    1e-13   
emb|CBI19895.3|  unnamed protein product                              79.0    1e-13   
ref|XP_009145790.1|  PREDICTED: probable LRR receptor-like serine...  79.0    1e-13   
dbj|BAJ95144.1|  predicted protein                                    79.0    1e-13   
ref|XP_006382044.1|  hypothetical protein POPTR_0006s25380g           79.0    1e-13   
ref|XP_008347286.1|  PREDICTED: LRR receptor-like serine/threonin...  79.0    1e-13   
ref|XP_006645505.1|  PREDICTED: putative receptor-like protein ki...  79.0    1e-13   
ref|XP_002449090.1|  hypothetical protein SORBIDRAFT_05g004660        79.0    1e-13   



>ref|XP_009613990.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM1 [Nicotiana tomentosiformis]
Length=1019

 Score =   162 bits (411),  Expect = 9e-43, Method: Compositional matrix adjust.
 Identities = 87/136 (64%), Positives = 105/136 (77%), Gaps = 0/136 (0%)
 Frame = +1

Query  94   AGAGKPLGVTEQAALLSIKAAFTADSQSSLTSWNISTSHCTWRRVTCdsllhvvsldlsg  273
            + A KP  + E  ALLS+K A T D QS+L SWNISTSHCTW+ VTCD   HV SL++S 
Sbjct  19   SAAAKPHFLPEYRALLSLKTAITDDPQSALISWNISTSHCTWKGVTCDKYRHVTSLNISN  78

Query  274  lNLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLA  453
            LNL+G L P++GQL +LVNLS+A NQ SGP+P E+S IS LR+LNLSNNIF  +FP QL 
Sbjct  79   LNLTGTLPPEIGQLRYLVNLSVAVNQFSGPIPVELSLISNLRYLNLSNNIFNLSFPQQLT  138

Query  454  QLANLQVLDLYNNNLT  501
            QL NL+VLD+YNNNLT
Sbjct  139  QLINLEVLDIYNNNLT  154


 Score = 53.9 bits (128),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 29/73 (40%), Positives = 45/73 (62%), Gaps = 0/73 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            LSG +  ++G+L  L  L +  N LSG + PEI  + +L+ L+LSNN+     P  L++L
Sbjct  250  LSGNIPSEIGKLKKLDTLFLQVNSLSGSLIPEIGYLKSLKSLDLSNNLLSGEIPLTLSEL  309

Query  460  ANLQVLDLYNNNL  498
             NL +L+L+ N L
Sbjct  310  KNLTLLNLFRNKL  322


 Score = 52.0 bits (123),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 26/75 (35%), Positives = 43/75 (57%), Gaps = 1/75 (1%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLS-NNIFGSTFPHQLAQ  456
             +G + P+ G+ PFL  L+++ N+L+G +PPEI  I+TL+ L +   N F    P ++  
Sbjct  177  FTGRIPPEFGKFPFLKYLAVSGNELAGDIPPEIGNITTLKELYVGYYNTFSGGIPPEIGN  236

Query  457  LANLQVLDLYNNNLT  501
            L+ L   D  N  L+
Sbjct  237  LSELVRFDAANCGLS  251


 Score = 52.0 bits (123),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 29/74 (39%), Positives = 42/74 (57%), Gaps = 0/74 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            LSG L P++G L  L +L ++ N LSG +P  +S +  L  LNL  N    + P  + +L
Sbjct  274  LSGSLIPEIGYLKSLKSLDLSNNLLSGEIPLTLSELKNLTLLNLFRNKLYGSIPEFIQEL  333

Query  460  ANLQVLDLYNNNLT  501
              L+VL L+ NN T
Sbjct  334  PKLEVLQLWENNFT  347


 Score = 48.5 bits (114),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 24/74 (32%), Positives = 39/74 (53%), Gaps = 0/74 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
             SG +  ++G+L  L  +  + N  SGP+PPEIS    L F++LS N      P ++  +
Sbjct  490  FSGRIPAEIGKLQQLSKMDFSGNGFSGPIPPEISNCKALTFIDLSRNKLSGEIPTEITGM  549

Query  460  ANLQVLDLYNNNLT  501
              L  L++  N+L 
Sbjct  550  RILNYLNVSRNHLV  563



>gb|AIT56194.1| leucine-rich repeat receptor-like serine/threonine-protein kinase 
BAM1 [Dimocarpus longan]
Length=1015

 Score =   162 bits (411),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 88/128 (69%), Positives = 105/128 (82%), Gaps = 0/128 (0%)
 Frame = +1

Query  118  VTEQAALLSIKAAFTADSQSSLTSWNISTSHCTWRRVTCdsllhvvsldlsglNLSGVLS  297
            V+E  ALLSIK+A +ADSQ++L+SWN +TSHCTW  VTCDS  HV SLDL  LNLSG LS
Sbjct  21   VSEYRALLSIKSALSADSQAALSSWNATTSHCTWTGVTCDSRHHVTSLDLRDLNLSGTLS  80

Query  298  PDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLANLQVL  477
             DV  L FL NL++AANQ SGP+PPEIS +S LRFLNLSNN+F  +FP QLA+LANL+V+
Sbjct  81   SDVAHLQFLRNLTVAANQFSGPIPPEISQLSALRFLNLSNNVFNGSFPSQLARLANLEVM  140

Query  478  DLYNNNLT  501
            DLYNNN+T
Sbjct  141  DLYNNNMT  148


 Score = 50.1 bits (118),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 26/73 (36%), Positives = 44/73 (60%), Gaps = 0/73 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            LSG +  ++G+L  L  L +  N LSG +  E+  + +L+ ++LSNN+F    P   A+L
Sbjct  244  LSGEIPGEIGKLQKLDTLFLQVNGLSGTLARELGNLKSLKSMDLSNNMFTGEIPASFAEL  303

Query  460  ANLQVLDLYNNNL  498
             N+ +L+L+ N L
Sbjct  304  KNMTLLNLFRNKL  316


 Score = 49.7 bits (117),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 25/74 (34%), Positives = 43/74 (58%), Gaps = 0/74 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
             SG ++P++ +   L  + ++ N+LSG VP EI+ +  L +LNLS N    + P  +A +
Sbjct  508  FSGQIAPEISKCKLLTFVDLSRNELSGVVPNEITGMKILNYLNLSRNHLVGSIPAAIASM  567

Query  460  ANLQVLDLYNNNLT  501
             +L  +D   NNL+
Sbjct  568  QSLTSVDFSYNNLS  581



>ref|XP_011073654.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM1 [Sesamum indicum]
Length=1015

 Score =   161 bits (407),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 89/142 (63%), Positives = 103/142 (73%), Gaps = 4/142 (3%)
 Frame = +1

Query  79   RHSAGAGAGKPLGVTEQAALLSIKAAFTADSQSSLTSWNISTSHCTWRRVTCdsllhvvs  258
            R+S GA  G+   + E  ALLSIKAA T D QS+L SWN STSHCTW  VTCD     V+
Sbjct  16   RYSTGARPGR---MPEYRALLSIKAAITEDPQSTLASWNASTSHCTWEGVTCDVSGRHVT  72

Query  259  ldlsg-lNLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGST  435
                  L+L+G LSPDVG L FLVNLS+AAN LSGPVPP+IS I  LR+LNLSNN+F  +
Sbjct  73   ALDISNLSLTGTLSPDVGHLRFLVNLSVAANSLSGPVPPQISDIPNLRYLNLSNNVFNLS  132

Query  436  FPHQLAQLANLQVLDLYNNNLT  501
            FP QL +L NLQVLDLYNNN+T
Sbjct  133  FPPQLYRLKNLQVLDLYNNNMT  154


 Score = 54.3 bits (129),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 27/74 (36%), Positives = 43/74 (58%), Gaps = 0/74 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            L+G L+P++G L  L ++ ++ N LSG +PP  + +  +  LNL  N    + P  + +L
Sbjct  274  LTGGLTPELGNLKSLKSMDLSNNMLSGELPPSFAELKNMTLLNLFRNKLTGSIPDFIGEL  333

Query  460  ANLQVLDLYNNNLT  501
              LQVL L+ NN T
Sbjct  334  PELQVLQLWENNFT  347


 Score = 53.5 bits (127),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 27/75 (36%), Positives = 44/75 (59%), Gaps = 0/75 (0%)
 Frame = +1

Query  277  NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  456
            NLSG ++P++ +   L  + ++ NQLSG VP EI+ +  L +LNLS N    + P  +A 
Sbjct  513  NLSGPIAPEISRCKLLTFVDLSRNQLSGSVPTEITGMRILNYLNLSRNHLVGSIPSSIAS  572

Query  457  LANLQVLDLYNNNLT  501
            + +L  +D   NN +
Sbjct  573  MQSLTSVDFSYNNFS  587


 Score = 50.8 bits (120),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 26/74 (35%), Positives = 44/74 (59%), Gaps = 0/74 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            LSG +  ++G L  L  L +  N L+G + PE+  + +L+ ++LSNN+     P   A+L
Sbjct  250  LSGEIPAEIGNLQNLDTLFLQVNGLTGGLTPELGNLKSLKSMDLSNNMLSGELPPSFAEL  309

Query  460  ANLQVLDLYNNNLT  501
             N+ +L+L+ N LT
Sbjct  310  KNMTLLNLFRNKLT  323



>ref|XP_011099433.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM1 [Sesamum indicum]
Length=1008

 Score =   157 bits (397),  Expect = 8e-41, Method: Compositional matrix adjust.
 Identities = 88/137 (64%), Positives = 110/137 (80%), Gaps = 1/137 (1%)
 Frame = +1

Query  94   AGAGKPLGVTEQAALLSIKAAFTADSQSSLTSWNISTSHCTWRRVTCd-sllhvvsldls  270
            + A +P  ++E  ALLSIKAA T D QS+L SWN++T+HCTW+ +TCD S  HV SLD+S
Sbjct  16   SAAARPPRMSEYRALLSIKAAITDDPQSALASWNLTTNHCTWKGITCDPSRRHVTSLDIS  75

Query  271  glNLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQL  450
             L+L+G LSPDVGQL FLVNLS+AAN +SGPVPP+IS I  LR+LNLSNN+F  +FP +L
Sbjct  76   NLSLTGTLSPDVGQLRFLVNLSVAANFISGPVPPQISDIPNLRYLNLSNNVFNLSFPPEL  135

Query  451  AQLANLQVLDLYNNNLT  501
             +L NLQVLDLYNNN+T
Sbjct  136  YRLRNLQVLDLYNNNMT  152


 Score = 57.0 bits (136),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 28/74 (38%), Positives = 46/74 (62%), Gaps = 0/74 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            L+G + P++G L  L  L +  N LSG + PE+  + +L+ ++LSNN+F    P   A+L
Sbjct  248  LTGEIPPEIGNLQNLDTLFLQVNGLSGSLTPELGNLKSLKSMDLSNNMFSGEIPPSFAEL  307

Query  460  ANLQVLDLYNNNLT  501
             N+ +L+L+ N LT
Sbjct  308  KNMTLLNLFRNKLT  321


 Score = 53.9 bits (128),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 26/74 (35%), Positives = 45/74 (61%), Gaps = 0/74 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            L+G+++P++ Q   L  + ++ NQLSG +P EI+ +  L +LNLS N    + P  +A +
Sbjct  512  LTGLIAPEISQCKLLTFVDLSRNQLSGDIPTEITGMRILNYLNLSRNHLVGSIPSSIASM  571

Query  460  ANLQVLDLYNNNLT  501
             +L  +D   NNL+
Sbjct  572  QSLTSVDFSYNNLS  585


 Score = 53.9 bits (128),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 26/74 (35%), Positives = 42/74 (57%), Gaps = 0/74 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            LSG L+P++G L  L ++ ++ N  SG +PP  + +  +  LNL  N    + P  + +L
Sbjct  272  LSGSLTPELGNLKSLKSMDLSNNMFSGEIPPSFAELKNMTLLNLFRNKLTGSIPDFIGEL  331

Query  460  ANLQVLDLYNNNLT  501
              L+VL L+ NN T
Sbjct  332  PELEVLQLWENNFT  345


 Score = 50.8 bits (120),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 26/75 (35%), Positives = 42/75 (56%), Gaps = 1/75 (1%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLS-NNIFGSTFPHQLAQ  456
             SG + P+ G  P+L  L+++ N+L+G +PPEI  ++ L+ L +   N F    P ++  
Sbjct  175  FSGEIPPEFGSFPYLEYLAVSGNELTGAIPPEIGNLTQLKELYIGYYNAFTGGMPKEIGN  234

Query  457  LANLQVLDLYNNNLT  501
            L+ L  LD  N  LT
Sbjct  235  LSQLVRLDAANCGLT  249



>ref|XP_010271550.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM1 [Nelumbo nucifera]
Length=1032

 Score =   155 bits (392),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 86/134 (64%), Positives = 105/134 (78%), Gaps = 0/134 (0%)
 Frame = +1

Query  100  AGKPLGVTEQAALLSIKAAFTADSQSSLTSWNISTSHCTWRRVTCdsllhvvsldlsglN  279
            AGKP+ ++E  ALLS+K A + D Q  L +WN STSHCTW  V+CDSL  VVSLDLS +N
Sbjct  23   AGKPVRISENRALLSLKTAISDDPQGFLQNWNFSTSHCTWTGVSCDSLNRVVSLDLSNMN  82

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            +SG+LSPDVGQL  LVNL++AAN + GP+PP IS IS LR LNLSNN+F  TFP QL++L
Sbjct  83   ISGILSPDVGQLRNLVNLTVAANLIYGPIPPGISYISGLRLLNLSNNVFNGTFPSQLSRL  142

Query  460  ANLQVLDLYNNNLT  501
              L+VLDLYNNN+T
Sbjct  143  KYLEVLDLYNNNMT  156


 Score = 54.3 bits (129),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 27/73 (37%), Positives = 45/73 (62%), Gaps = 0/73 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            LSG +  ++G+L  L  L +  N LSG + PE+  + +L+ ++LSNN+    FP   ++L
Sbjct  252  LSGEIPHELGKLQKLDTLFLQVNGLSGELTPELGQLKSLKSMDLSNNMLSGEFPETFSEL  311

Query  460  ANLQVLDLYNNNL  498
             NL +L+L+ N L
Sbjct  312  KNLTLLNLFRNKL  324


 Score = 53.5 bits (127),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 25/74 (34%), Positives = 44/74 (59%), Gaps = 0/74 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
             SG ++P++ Q   L  + ++ N+LSG +PPEI+ +  L +LNLS N    + P  ++ +
Sbjct  516  FSGSIAPEISQCKLLTFVDLSRNELSGEIPPEITGMRILNYLNLSRNHLVGSIPASISTM  575

Query  460  ANLQVLDLYNNNLT  501
             +L  +D   NNL+
Sbjct  576  QSLTSVDFSYNNLS  589


 Score = 53.1 bits (126),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 29/74 (39%), Positives = 40/74 (54%), Gaps = 0/74 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            LSG L+P++GQL  L ++ ++ N LSG  P   S +  L  LNL  N      P  +  L
Sbjct  276  LSGELTPELGQLKSLKSMDLSNNMLSGEFPETFSELKNLTLLNLFRNKLHGAIPDFIGDL  335

Query  460  ANLQVLDLYNNNLT  501
              L+VL L+ NN T
Sbjct  336  PELEVLQLWENNFT  349



>ref|XP_009786199.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM1 [Nicotiana sylvestris]
Length=1015

 Score =   154 bits (389),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 85/138 (62%), Positives = 104/138 (75%), Gaps = 2/138 (1%)
 Frame = +1

Query  94   AGAGKPLGVTEQAALLSIKAAFTADSQSSLTSWNIST--SHCTWRRVTCdsllhvvsldl  267
            + A KP  + E  ALLS+K A + D QS+L SWN ST  SHCTW+ VTCD   HV SL++
Sbjct  15   SAAAKPHFLPEYRALLSLKTAISDDPQSALISWNSSTTTSHCTWKGVTCDKYRHVTSLNI  74

Query  268  sglNLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQ  447
            S LNL+G L P++GQL +LVNLS+A NQ SGP+P E+S IS LR+LNLSNNIF  +FP Q
Sbjct  75   SNLNLTGTLPPEIGQLRYLVNLSVAVNQFSGPIPVELSVISNLRYLNLSNNIFNLSFPQQ  134

Query  448  LAQLANLQVLDLYNNNLT  501
            L QL NL+VLD+YNNNLT
Sbjct  135  LTQLINLEVLDIYNNNLT  152


 Score = 54.3 bits (129),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 29/73 (40%), Positives = 45/73 (62%), Gaps = 0/73 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            LSG +  ++G+L  L  L +  N LSG + PEI  + +L+ L+LSNN+     P  L++L
Sbjct  248  LSGEIPAEIGKLKKLDTLFLQVNSLSGSLIPEIGYLKSLKSLDLSNNLLSGEIPLTLSEL  307

Query  460  ANLQVLDLYNNNL  498
             NL +L+L+ N L
Sbjct  308  KNLTLLNLFRNKL  320


 Score = 52.0 bits (123),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 26/75 (35%), Positives = 43/75 (57%), Gaps = 1/75 (1%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLS-NNIFGSTFPHQLAQ  456
             +G + P+ G+ PFL  L+++ N+L+G +PPEI  I+TL+ L +   N F    P ++  
Sbjct  175  FTGRIPPEFGKFPFLKYLAVSGNELAGDIPPEIGNITTLKELYVGYYNTFSGGIPPEIGN  234

Query  457  LANLQVLDLYNNNLT  501
            L+ L   D  N  L+
Sbjct  235  LSELVRFDAANCGLS  249


 Score = 52.0 bits (123),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 29/74 (39%), Positives = 42/74 (57%), Gaps = 0/74 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            LSG L P++G L  L +L ++ N LSG +P  +S +  L  LNL  N    + P  + +L
Sbjct  272  LSGSLIPEIGYLKSLKSLDLSNNLLSGEIPLTLSELKNLTLLNLFRNKLYGSIPEFIEEL  331

Query  460  ANLQVLDLYNNNLT  501
              L+VL L+ NN T
Sbjct  332  PKLEVLQLWENNFT  345



>emb|CDP02660.1| unnamed protein product [Coffea canephora]
Length=1017

 Score =   154 bits (388),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 82/129 (64%), Positives = 96/129 (74%), Gaps = 1/129 (1%)
 Frame = +1

Query  118  VTEQAALLSIKAAFTADSQSSLTSWNISTSHCTWRRVTCdsllhvvsldlsgl-NLSGVL  294
            + E  ALLSIK+A TAD QSSL SWN ST+HC+W  VTCDS    V+       NL+G L
Sbjct  24   MPEYKALLSIKSAITADPQSSLASWNDSTTHCSWSGVTCDSYGRHVTALDISGLNLTGSL  83

Query  295  SPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLANLQV  474
            SPDV  L  L+NLS+AANQ  GPVPPEIS+ISTLR+LNLSNNIF  TFP QL +L NL+V
Sbjct  84   SPDVSHLRLLLNLSVAANQFCGPVPPEISSISTLRYLNLSNNIFNLTFPRQLIRLKNLEV  143

Query  475  LDLYNNNLT  501
            LD YNNN++
Sbjct  144  LDFYNNNMS  152


 Score = 57.4 bits (137),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 30/73 (41%), Positives = 45/73 (62%), Gaps = 0/73 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            LSG + P++G L  L  L +  N LSGP+  E+  + +L+ ++LSNN+F    P   AQL
Sbjct  248  LSGEVPPELGMLQNLDTLFLQVNALSGPLTSELGYLKSLKSMDLSNNMFTGEIPSSFAQL  307

Query  460  ANLQVLDLYNNNL  498
             NL +L+L+ N L
Sbjct  308  KNLTLLNLFRNQL  320


 Score = 50.1 bits (118),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 24/74 (32%), Positives = 43/74 (58%), Gaps = 0/74 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
             SG ++P++ +   L  + ++ NQL+G +P EI+ +  L +LNLS N    + P  +A +
Sbjct  512  FSGPIAPEISECKLLTFVDLSRNQLAGEIPTEITGMRILNYLNLSRNHLVGSIPSPIASM  571

Query  460  ANLQVLDLYNNNLT  501
             +L  +D   NNL+
Sbjct  572  QSLTSVDFSYNNLS  585



>ref|XP_004234641.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM1 [Solanum lycopersicum]
Length=1022

 Score =   153 bits (387),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 85/132 (64%), Positives = 99/132 (75%), Gaps = 0/132 (0%)
 Frame = +1

Query  106  KPLGVTEQAALLSIKAAFTADSQSSLTSWNISTSHCTWRRVTCdsllhvvsldlsglNLS  285
            KP  V E  ALLS+K A T D QS+L SWNISTSHCTWR VTCD   HV SLD+SG NL+
Sbjct  24   KPPYVPEYRALLSLKTAITDDPQSALLSWNISTSHCTWRGVTCDRYRHVTSLDISGFNLT  83

Query  286  GVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLAN  465
            G L+P+VG L FL+NLS+A NQ SGP+P E+S I  LR+LNLSNNIF  +FP QL  L  
Sbjct  84   GTLTPEVGHLRFLLNLSVAVNQFSGPIPVELSFIPNLRYLNLSNNIFNLSFPPQLTHLRY  143

Query  466  LQVLDLYNNNLT  501
            L VLD+YNNN+T
Sbjct  144  LNVLDIYNNNMT  155


 Score = 55.5 bits (132),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 29/73 (40%), Positives = 44/73 (60%), Gaps = 0/73 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            LSG + P++G+L  L  L +  N LSG V PE+  + +L+ L+LSNN+     P    +L
Sbjct  251  LSGEIPPEIGKLQKLDTLFLQVNGLSGSVTPELGNLKSLKSLDLSNNMLSGEIPLTFTEL  310

Query  460  ANLQVLDLYNNNL  498
             NL +L+L+ N L
Sbjct  311  KNLTLLNLFRNKL  323


 Score = 53.1 bits (126),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 29/75 (39%), Positives = 42/75 (56%), Gaps = 1/75 (1%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLS-NNIFGSTFPHQLAQ  456
             SG + P+ G+ PFL  L+++ N L G +PPEI  I+TLR L +   N F    P ++  
Sbjct  178  FSGSIPPEYGRFPFLEYLAVSGNALVGRIPPEIGNITTLRELYIGYYNTFSGGLPAEIGY  237

Query  457  LANLQVLDLYNNNLT  501
            L+ L  LD  N  L+
Sbjct  238  LSELIRLDAANCGLS  252


 Score = 48.9 bits (115),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 26/74 (35%), Positives = 41/74 (55%), Gaps = 0/74 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            LSG ++P++G L  L +L ++ N LSG +P   + +  L  LNL  N    + P  +  +
Sbjct  275  LSGSVTPELGNLKSLKSLDLSNNMLSGEIPLTFTELKNLTLLNLFRNKLYGSMPEFIEDM  334

Query  460  ANLQVLDLYNNNLT  501
              L+VL L+ NN T
Sbjct  335  PKLEVLQLWENNFT  348



>ref|XP_010268646.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM1 [Nelumbo nucifera]
Length=1034

 Score =   152 bits (385),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 85/134 (63%), Positives = 104/134 (78%), Gaps = 0/134 (0%)
 Frame = +1

Query  100  AGKPLGVTEQAALLSIKAAFTADSQSSLTSWNISTSHCTWRRVTCdsllhvvsldlsglN  279
            AG+PL + E  ALLSIK A + D Q+SL +WN+STSHCTW  V+CDS   VVSLDLS +N
Sbjct  20   AGRPLRIPEYRALLSIKTAISDDPQASLPNWNLSTSHCTWTGVSCDSFNRVVSLDLSNMN  79

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            LSG+LSPDVGQL  L+NL+ AAN  SGP+P EIS IS LR LNLSNN+F  +FP + ++L
Sbjct  80   LSGILSPDVGQLRNLINLTAAANFFSGPIPSEISHISGLRLLNLSNNVFNGSFPSEFSRL  139

Query  460  ANLQVLDLYNNNLT  501
              L+VLDLYNNN+T
Sbjct  140  KLLEVLDLYNNNMT  153


 Score = 52.0 bits (123),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 28/74 (38%), Positives = 41/74 (55%), Gaps = 0/74 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            LSG L+P++GQL  L ++ ++ N L+G +P   S +  L  LNL  N      P  +  L
Sbjct  273  LSGGLTPELGQLKSLKSMDLSNNMLAGEIPATFSELKNLTLLNLFRNKLHGAIPDFIGDL  332

Query  460  ANLQVLDLYNNNLT  501
              L+VL L+ NN T
Sbjct  333  PALEVLQLWENNFT  346


 Score = 51.2 bits (121),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 26/73 (36%), Positives = 43/73 (59%), Gaps = 0/73 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            LSG + P+  +L  L  L +  N LSG + PE+  + +L+ ++LSNN+     P   ++L
Sbjct  249  LSGEIPPEFSKLQKLDTLFLQVNGLSGGLTPELGQLKSLKSMDLSNNMLAGEIPATFSEL  308

Query  460  ANLQVLDLYNNNL  498
             NL +L+L+ N L
Sbjct  309  KNLTLLNLFRNKL  321


 Score = 50.1 bits (118),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 24/74 (32%), Positives = 43/74 (58%), Gaps = 0/74 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
             SG ++ ++ Q   L  + ++ N+LSG +PPE++ +  L +LNLS N    + P  +A +
Sbjct  513  FSGPIASEISQCKLLTFVDLSRNELSGVIPPEMTGMRILNYLNLSRNHLTGSIPASIATM  572

Query  460  ANLQVLDLYNNNLT  501
             +L  +D   NNL+
Sbjct  573  QSLTSVDFSYNNLS  586



>dbj|BAK52390.1| leucine rich repeat receptor protein kinase CLAVATA1 [Solanum 
peruvianum]
Length=1015

 Score =   151 bits (382),  Expect = 9e-39, Method: Compositional matrix adjust.
 Identities = 87/140 (62%), Positives = 100/140 (71%), Gaps = 0/140 (0%)
 Frame = +1

Query  82   HSAGAGAGKPLGVTEQAALLSIKAAFTADSQSSLTSWNISTSHCTWRRVTCdsllhvvsl  261
            H     AGK   + E  ALL++K A T D Q +L SWNISTSHCTW  VTCD+  HV SL
Sbjct  11   HFTDFSAGKQPRLPEYQALLALKTAITDDPQLTLASWNISTSHCTWNGVTCDTHRHVTSL  70

Query  262  dlsglNLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFP  441
            D+SG NL+G L P+VG L FL NLS+A NQ +GPVP EIS I  L +LNLSNNIFG  FP
Sbjct  71   DISGFNLTGTLPPEVGNLRFLQNLSVAVNQFTGPVPVEISFIPNLSYLNLSNNIFGMEFP  130

Query  442  HQLAQLANLQVLDLYNNNLT  501
             QL +L NLQVLDLYNNN+T
Sbjct  131  SQLTRLRNLQVLDLYNNNMT  150


 Score = 54.3 bits (129),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 28/73 (38%), Positives = 45/73 (62%), Gaps = 0/73 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            LSG +  ++G+L  L  L +  N LSG + PEI  + +L+ L+LSNN+F    P   A+L
Sbjct  246  LSGKIPREIGKLQNLDTLFLQVNSLSGSLTPEIGYLKSLKSLDLSNNMFSGEIPPTFAEL  305

Query  460  ANLQVLDLYNNNL  498
             N+ +++L+ N L
Sbjct  306  KNITLVNLFRNKL  318


 Score = 53.1 bits (126),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 26/75 (35%), Positives = 44/75 (59%), Gaps = 0/75 (0%)
 Frame = +1

Query  277  NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  456
            NLSG ++P++ Q   L  + ++ NQLSG +P EI+ +  L +LNLS N    + P  ++ 
Sbjct  509  NLSGPIAPEISQCKLLTYVDLSRNQLSGEIPTEITGMRILNYLNLSRNHLVGSIPAPISS  568

Query  457  LANLQVLDLYNNNLT  501
            + +L  +D   NN +
Sbjct  569  MQSLTSVDFSYNNFS  583


 Score = 52.0 bits (123),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 26/74 (35%), Positives = 41/74 (55%), Gaps = 0/74 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            LSG L+P++G L  L +L ++ N  SG +PP  + +  +  +NL  N    + P  +  L
Sbjct  270  LSGSLTPEIGYLKSLKSLDLSNNMFSGEIPPTFAELKNITLVNLFRNKLYGSIPEFIEDL  329

Query  460  ANLQVLDLYNNNLT  501
              L+VL L+ NN T
Sbjct  330  PELEVLQLWENNFT  343



>ref|NP_001274713.1| leucine-rich repeat receptor-like serine/threonine-protein kinase 
BAM1-like precursor [Solanum lycopersicum]
 dbj|BAK52388.1| leucine rich repeat receptor protein kinase CLAVATA1 [Solanum 
lycopersicum]
 dbj|BAK52391.1| leucine rich repeat receptor protein kinase CLAVATA1 [Solanum 
lycopersicum]
Length=1016

 Score =   151 bits (381),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 87/140 (62%), Positives = 100/140 (71%), Gaps = 0/140 (0%)
 Frame = +1

Query  82   HSAGAGAGKPLGVTEQAALLSIKAAFTADSQSSLTSWNISTSHCTWRRVTCdsllhvvsl  261
            H     AGK   + E  ALL++K A T D Q +L SWNISTSHCTW  VTCD+  HV SL
Sbjct  12   HFTDFSAGKQPRLPEYQALLALKTAITDDPQLTLASWNISTSHCTWNGVTCDTHRHVTSL  71

Query  262  dlsglNLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFP  441
            D+SG NL+G L P+VG L FL NLS+A NQ +GPVP EIS I  L +LNLSNNIFG  FP
Sbjct  72   DISGFNLTGTLPPEVGNLRFLQNLSVAVNQFTGPVPVEISFIPNLSYLNLSNNIFGMEFP  131

Query  442  HQLAQLANLQVLDLYNNNLT  501
             QL +L NLQVLDLYNNN+T
Sbjct  132  SQLTRLRNLQVLDLYNNNMT  151


 Score = 58.2 bits (139),  Expect = 8e-07, Method: Compositional matrix adjust.
 Identities = 29/73 (40%), Positives = 46/73 (63%), Gaps = 0/73 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            LSG + P++G+L  L  L +  N LSG + PEI  + +L+ L+LSNN+F    P   A+L
Sbjct  247  LSGKIPPEIGKLQNLDTLFLQVNSLSGSLTPEIGYLKSLKSLDLSNNMFSGEIPPTFAEL  306

Query  460  ANLQVLDLYNNNL  498
             N+ +++L+ N L
Sbjct  307  KNITLVNLFRNKL  319


 Score = 53.1 bits (126),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 26/75 (35%), Positives = 44/75 (59%), Gaps = 0/75 (0%)
 Frame = +1

Query  277  NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  456
            NLSG ++P++ Q   L  + ++ NQLSG +P EI+ +  L +LNLS N    + P  ++ 
Sbjct  510  NLSGPIAPEISQCKLLTYVDLSRNQLSGEIPTEITGMRILNYLNLSRNHLVGSIPAPISS  569

Query  457  LANLQVLDLYNNNLT  501
            + +L  +D   NN +
Sbjct  570  MQSLTSVDFSYNNFS  584


 Score = 52.0 bits (123),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 26/74 (35%), Positives = 41/74 (55%), Gaps = 0/74 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            LSG L+P++G L  L +L ++ N  SG +PP  + +  +  +NL  N    + P  +  L
Sbjct  271  LSGSLTPEIGYLKSLKSLDLSNNMFSGEIPPTFAELKNITLVNLFRNKLYGSIPEFIEDL  330

Query  460  ANLQVLDLYNNNLT  501
              L+VL L+ NN T
Sbjct  331  PELEVLQLWENNFT  344



>gb|EYU41357.1| hypothetical protein MIMGU_mgv1a000718mg [Erythranthe guttata]
Length=1006

 Score =   151 bits (381),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 82/139 (59%), Positives = 99/139 (71%), Gaps = 1/139 (1%)
 Frame = +1

Query  88   AGAGAGKPLGVTEQAALLSIKAAFTADSQSSLTSWNISTSHCTWRRVTCdsllhvvsldl  267
             G+ A  P  + E  ALLSIKAA T D QS+L SWN +T HCTWR VTCD+    V+   
Sbjct  16   GGSAAATPPHMPEYRALLSIKAAITDDPQSALASWNATTHHCTWRGVTCDASGRRVASLD  75

Query  268  sg-lNLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPH  444
               L+L+GVLSPDVG+L FLVN S AAN LSGP+PP+IS I  LR LNLSNN+F  +FP 
Sbjct  76   ISNLSLAGVLSPDVGRLRFLVNFSAAANFLSGPIPPQISDIPNLRHLNLSNNVFNLSFPA  135

Query  445  QLAQLANLQVLDLYNNNLT  501
            +L  L NL+VLD+YNNN+T
Sbjct  136  ELYHLKNLEVLDVYNNNMT  154


 Score = 55.5 bits (132),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 29/74 (39%), Positives = 42/74 (57%), Gaps = 0/74 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            +SG L P++G L  L ++ ++ N LSG +PP  S +  +  LNL  N F  + P  +  L
Sbjct  274  ISGGLPPELGNLKSLKSMDLSNNILSGEIPPSFSQLQNITLLNLFRNKFTGSIPDFIGDL  333

Query  460  ANLQVLDLYNNNLT  501
              LQVL L+ NN T
Sbjct  334  PELQVLQLWENNFT  347


 Score = 54.3 bits (129),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 27/74 (36%), Positives = 44/74 (59%), Gaps = 0/74 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            LSG +  ++G L  L  L +  N +SG +PPE+  + +L+ ++LSNNI     P   +QL
Sbjct  250  LSGQIPAEIGNLQNLDTLFLQVNGISGGLPPELGNLKSLKSMDLSNNILSGEIPPSFSQL  309

Query  460  ANLQVLDLYNNNLT  501
             N+ +L+L+ N  T
Sbjct  310  QNITLLNLFRNKFT  323


 Score = 51.2 bits (121),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 24/75 (32%), Positives = 44/75 (59%), Gaps = 0/75 (0%)
 Frame = +1

Query  277  NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  456
            + SG +SP++ +   L  + ++ N+LSGP+P EI+++  L +LNLS N      P  ++ 
Sbjct  514  DFSGQISPEISRCKLLTFVDLSHNRLSGPIPTEITSMKILNYLNLSRNNLMGNIPSSISG  573

Query  457  LANLQVLDLYNNNLT  501
            + +L  +D   NN +
Sbjct  574  MQSLTSVDFSYNNFS  588



>dbj|BAK52389.1| leucine rich repeat receptor protein kinase CLAVATA1 [Solanum 
pennellii]
Length=1016

 Score =   150 bits (380),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 86/134 (64%), Positives = 99/134 (74%), Gaps = 0/134 (0%)
 Frame = +1

Query  100  AGKPLGVTEQAALLSIKAAFTADSQSSLTSWNISTSHCTWRRVTCdsllhvvsldlsglN  279
            AGK   + E  ALL++K A T D Q +L SWNISTSHCTW  VTCD+  HV SLD+SG N
Sbjct  18   AGKQPRLPEYQALLALKTAITDDPQLTLASWNISTSHCTWNGVTCDTHRHVTSLDISGFN  77

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            L+G L P+VG L FL NLS+A NQ +GPVP EIS I  L +LNLSNNIFG  FP QL +L
Sbjct  78   LTGTLPPEVGNLRFLQNLSVAVNQFTGPVPVEISFIPNLSYLNLSNNIFGMEFPSQLTRL  137

Query  460  ANLQVLDLYNNNLT  501
             NLQVLDLYNNN+T
Sbjct  138  RNLQVLDLYNNNMT  151


 Score = 57.8 bits (138),  Expect = 9e-07, Method: Compositional matrix adjust.
 Identities = 29/73 (40%), Positives = 46/73 (63%), Gaps = 0/73 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            LSG + P++G+L  L  L +  N LSG + PEI  + +L+ L+LSNN+F    P   A+L
Sbjct  247  LSGEIPPEIGKLQNLDTLFLQVNSLSGSLTPEIGYLKSLKSLDLSNNMFSGEIPPTFAEL  306

Query  460  ANLQVLDLYNNNL  498
             N+ +++L+ N L
Sbjct  307  KNITLVNLFRNKL  319


 Score = 53.1 bits (126),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 26/75 (35%), Positives = 44/75 (59%), Gaps = 0/75 (0%)
 Frame = +1

Query  277  NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  456
            NLSG ++P++ Q   L  + ++ NQLSG +P EI+ +  L +LNLS N    + P  ++ 
Sbjct  510  NLSGPIAPEISQCKLLTYVDLSRNQLSGEIPTEITGMRILNYLNLSRNHLVGSIPAPISS  569

Query  457  LANLQVLDLYNNNLT  501
            + +L  +D   NN +
Sbjct  570  MQSLTSVDFSYNNFS  584


 Score = 52.0 bits (123),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 26/74 (35%), Positives = 41/74 (55%), Gaps = 0/74 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            LSG L+P++G L  L +L ++ N  SG +PP  + +  +  +NL  N    + P  +  L
Sbjct  271  LSGSLTPEIGYLKSLKSLDLSNNMFSGEIPPTFAELKNITLVNLFRNKLYGSIPEFIEDL  330

Query  460  ANLQVLDLYNNNLT  501
              L+VL L+ NN T
Sbjct  331  PELEVLQLWENNFT  344



>ref|XP_010105101.1| Leucine-rich repeat receptor-like serine/threonine-protein kinase 
BAM1 [Morus notabilis]
 gb|EXC03886.1| Leucine-rich repeat receptor-like serine/threonine-protein kinase 
BAM1 [Morus notabilis]
Length=1021

 Score =   150 bits (380),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 87/128 (68%), Positives = 99/128 (77%), Gaps = 0/128 (0%)
 Frame = +1

Query  118  VTEQAALLSIKAAFTADSQSSLTSWNISTSHCTWRRVTCdsllhvvsldlsglNLSGVLS  297
            V E  ALLS KAA T D QSSL +WN ST HCTW  +TCDS  HV SLDLSGLNLSG LS
Sbjct  26   VPEYKALLSFKAALTDDPQSSLATWNASTLHCTWFGITCDSRRHVTSLDLSGLNLSGSLS  85

Query  298  PDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLANLQVL  477
            P++  L FL N+S+A NQ SGP+P EISAIS LR LNLSNN+F  TFP +L+QL NLQ+L
Sbjct  86   PELAYLRFLSNVSLADNQFSGPIPAEISAISGLRLLNLSNNVFNGTFPPELSQLKNLQIL  145

Query  478  DLYNNNLT  501
            DLYNNN+T
Sbjct  146  DLYNNNMT  153


 Score = 57.4 bits (137),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 28/73 (38%), Positives = 47/73 (64%), Gaps = 0/73 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            LSG + P++G+L  L  L +  N LSG + PE+ ++++L+ ++LSNN+     P   A+L
Sbjct  249  LSGEIPPEIGKLQKLDTLFLQVNALSGSLTPELGSLNSLKSMDLSNNMLSGEIPPSFAEL  308

Query  460  ANLQVLDLYNNNL  498
             NL +L+L+ N L
Sbjct  309  KNLTLLNLFRNKL  321


 Score = 55.1 bits (131),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 28/74 (38%), Positives = 42/74 (57%), Gaps = 0/74 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            LSG L+P++G L  L ++ ++ N LSG +PP  + +  L  LNL  N      P  + +L
Sbjct  273  LSGSLTPELGSLNSLKSMDLSNNMLSGEIPPSFAELKNLTLLNLFRNKLHGAIPEFIGEL  332

Query  460  ANLQVLDLYNNNLT  501
              L+VL L+ NN T
Sbjct  333  PELEVLQLWENNFT  346


 Score = 51.6 bits (122),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 25/75 (33%), Positives = 43/75 (57%), Gaps = 0/75 (0%)
 Frame = +1

Query  277  NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  456
              SG+++P++ Q   L  + ++ N+LSG +P EI+ +  L +LNLS N      P  +A 
Sbjct  513  KFSGLITPEISQCKVLTFVDLSRNELSGEIPNEITGMRILNYLNLSRNHLVGNIPSSIAS  572

Query  457  LANLQVLDLYNNNLT  501
            + +L  +D   NNL+
Sbjct  573  MQSLTSVDFSYNNLS  587



>ref|XP_006357743.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM1-like [Solanum tuberosum]
Length=1017

 Score =   150 bits (380),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 86/140 (61%), Positives = 100/140 (71%), Gaps = 0/140 (0%)
 Frame = +1

Query  82   HSAGAGAGKPLGVTEQAALLSIKAAFTADSQSSLTSWNISTSHCTWRRVTCdsllhvvsl  261
            H     AGK   + E  ALL++K A T D Q +L SWNISTSHCTW  VTCD+  HV SL
Sbjct  12   HFTDFSAGKQPRLPEYQALLALKTAITDDPQLTLASWNISTSHCTWNGVTCDTHRHVTSL  71

Query  262  dlsglNLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFP  441
            D+SG NL+G L P+VG L FL NLS+A NQ +GP+P EIS I  L +LNLSNNIFG  FP
Sbjct  72   DISGFNLTGTLPPEVGNLRFLQNLSVAVNQFTGPIPVEISFIPNLGYLNLSNNIFGMEFP  131

Query  442  HQLAQLANLQVLDLYNNNLT  501
             QL +L NLQVLDLYNNN+T
Sbjct  132  PQLTRLRNLQVLDLYNNNMT  151


 Score = 58.2 bits (139),  Expect = 8e-07, Method: Compositional matrix adjust.
 Identities = 29/73 (40%), Positives = 46/73 (63%), Gaps = 0/73 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            LSG + P++G+L  L  L +  N LSG + PEI  + +L+ L+LSNN+F    P   A+L
Sbjct  247  LSGEIPPEIGKLQNLDTLFLQVNSLSGSLTPEIGYLKSLKSLDLSNNMFSGEIPPTFAEL  306

Query  460  ANLQVLDLYNNNL  498
             N+ +++L+ N L
Sbjct  307  KNITLVNLFRNKL  319


 Score = 52.8 bits (125),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 25/75 (33%), Positives = 43/75 (57%), Gaps = 0/75 (0%)
 Frame = +1

Query  277  NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  456
            N SG ++P++ Q   L  + ++ NQLSG +P EI+ +  L +LNLS N    + P  ++ 
Sbjct  510  NFSGPMAPEISQCKLLTYVDLSRNQLSGEIPSEITGMRILNYLNLSRNHLVGSIPSPISS  569

Query  457  LANLQVLDLYNNNLT  501
            + +L  +D   NN +
Sbjct  570  MQSLTSVDFSYNNFS  584


 Score = 52.0 bits (123),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 26/74 (35%), Positives = 41/74 (55%), Gaps = 0/74 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            LSG L+P++G L  L +L ++ N  SG +PP  + +  +  +NL  N    + P  +  L
Sbjct  271  LSGSLTPEIGYLKSLKSLDLSNNMFSGEIPPTFAELKNITLVNLFRNKLYGSIPEFIEDL  330

Query  460  ANLQVLDLYNNNLT  501
              L+VL L+ NN T
Sbjct  331  PELEVLQLWENNFT  344



>ref|XP_006364007.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM1-like [Solanum tuberosum]
Length=1022

 Score =   150 bits (378),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 83/132 (63%), Positives = 99/132 (75%), Gaps = 0/132 (0%)
 Frame = +1

Query  106  KPLGVTEQAALLSIKAAFTADSQSSLTSWNISTSHCTWRRVTCdsllhvvsldlsglNLS  285
            KP  V E  ALLS+K + T D QS+L SWNISTSHCTWR VTCD   HV SLD+SG NL+
Sbjct  24   KPPYVPEYRALLSLKTSITDDPQSALLSWNISTSHCTWRGVTCDRYRHVTSLDISGFNLT  83

Query  286  GVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLAN  465
            G L+P+VG L FL+NLS+A NQ SGP+P E+S I  L +LNLSNNIF  +FP QL  L  
Sbjct  84   GTLTPEVGHLRFLLNLSVAVNQFSGPIPIELSFIPNLSYLNLSNNIFNLSFPPQLTHLRY  143

Query  466  LQVLDLYNNNLT  501
            L+VLD+YNNN+T
Sbjct  144  LKVLDIYNNNMT  155


 Score = 56.2 bits (134),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 29/73 (40%), Positives = 44/73 (60%), Gaps = 0/73 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            LSG + P++G+L  L  L +  N LSG V PE+  + +L+ L+LSNN+     P    +L
Sbjct  251  LSGEIPPEIGKLQKLDTLFLQVNGLSGSVTPELGNLKSLKSLDLSNNMLSGEIPFTFTEL  310

Query  460  ANLQVLDLYNNNL  498
             NL +L+L+ N L
Sbjct  311  KNLTLLNLFRNKL  323


 Score = 52.8 bits (125),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 29/75 (39%), Positives = 42/75 (56%), Gaps = 1/75 (1%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLS-NNIFGSTFPHQLAQ  456
             SG + P+ G+ PFL  L+++ N L G +PPEI  I+TLR L +   N F    P ++  
Sbjct  178  FSGSIPPEYGRFPFLEYLAVSGNALVGMIPPEIGNITTLRELYIGYYNTFSGGLPAEIGN  237

Query  457  LANLQVLDLYNNNLT  501
            L+ L  LD  N  L+
Sbjct  238  LSELIRLDAANCGLS  252


 Score = 49.3 bits (116),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 27/74 (36%), Positives = 41/74 (55%), Gaps = 0/74 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            LSG ++P++G L  L +L ++ N LSG +P   + +  L  LNL  N    + P  +  L
Sbjct  275  LSGSVTPELGNLKSLKSLDLSNNMLSGEIPFTFTELKNLTLLNLFRNKLYGSIPEFIEDL  334

Query  460  ANLQVLDLYNNNLT  501
              L+VL L+ NN T
Sbjct  335  PKLEVLQLWENNFT  348



>emb|CBI35733.3| unnamed protein product [Vitis vinifera]
Length=948

 Score =   148 bits (374),  Expect = 8e-38, Method: Compositional matrix adjust.
 Identities = 83/134 (62%), Positives = 102/134 (76%), Gaps = 0/134 (0%)
 Frame = +1

Query  100  AGKPLGVTEQAALLSIKAAFTADSQSSLTSWNISTSHCTWRRVTCdsllhvvsldlsglN  279
            A  P  + E  ALLS++ A + D +S L +WNISTSHCTW  VTCD+  HVV+L+LSGLN
Sbjct  39   AATPPRIPEYRALLSLRTAISYDPESPLAAWNISTSHCTWTGVTCDARRHVVALNLSGLN  98

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            LSG LS D+  L FLVNL++AANQ  GP+PPE+S +S LR LNLSNN+F  TFP QLA+L
Sbjct  99   LSGSLSSDIAHLRFLVNLTLAANQFVGPIPPELSLVSGLRQLNLSNNVFNETFPSQLARL  158

Query  460  ANLQVLDLYNNNLT  501
              L+VLDLYNNN+T
Sbjct  159  KRLEVLDLYNNNMT  172


 Score = 60.8 bits (146),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 29/73 (40%), Positives = 46/73 (63%), Gaps = 0/73 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            LSG + P++G+L  L  L +  N LSGP+ PE+  + +L+ ++LSNN+     P   A+L
Sbjct  268  LSGEIPPEIGKLQNLDTLFLQVNTLSGPLTPELGNLKSLKSMDLSNNVLAGEIPEAFAEL  327

Query  460  ANLQVLDLYNNNL  498
             NL +L+L+ N L
Sbjct  328  KNLTLLNLFRNKL  340


 Score = 49.3 bits (116),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 24/71 (34%), Positives = 42/71 (59%), Gaps = 1/71 (1%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLS-NNIFGSTFPHQLAQ  456
             +G++ P  GQ  FL  L+++ N+L GP+PPEI  +++L+ L +   N +    P ++  
Sbjct  195  FTGIIPPAYGQWEFLEYLAVSGNELHGPIPPEIGNLTSLQQLYVGYYNTYDGGIPPEIGN  254

Query  457  LANLQVLDLYN  489
            L +L  LD+ N
Sbjct  255  LTSLVRLDMAN  265


 Score = 49.3 bits (116),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 25/75 (33%), Positives = 42/75 (56%), Gaps = 0/75 (0%)
 Frame = +1

Query  277  NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  456
              SG ++P++ Q   L  + ++ N+L G +P EI+ +  L +LNLS N    + P  LA 
Sbjct  531  KFSGEITPEISQCKVLTFVDLSRNELFGDIPTEITGMRILNYLNLSRNHLIGSIPASLAS  590

Query  457  LANLQVLDLYNNNLT  501
            + +L  +D   NNL+
Sbjct  591  MQSLTSVDFSYNNLS  605


 Score = 48.9 bits (115),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 26/74 (35%), Positives = 40/74 (54%), Gaps = 0/74 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            LSG L+P++G L  L ++ ++ N L+G +P   + +  L  LNL  N      P  +  L
Sbjct  292  LSGPLTPELGNLKSLKSMDLSNNVLAGEIPEAFAELKNLTLLNLFRNKLHGAIPEFIGDL  351

Query  460  ANLQVLDLYNNNLT  501
              L+VL L+ NN T
Sbjct  352  PELEVLQLWENNFT  365



>ref|XP_003635561.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM1 [Vitis vinifera]
Length=1017

 Score =   148 bits (373),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 83/134 (62%), Positives = 102/134 (76%), Gaps = 0/134 (0%)
 Frame = +1

Query  100  AGKPLGVTEQAALLSIKAAFTADSQSSLTSWNISTSHCTWRRVTCdsllhvvsldlsglN  279
            A  P  + E  ALLS++ A + D +S L +WNISTSHCTW  VTCD+  HVV+L+LSGLN
Sbjct  20   AATPPRIPEYRALLSLRTAISYDPESPLAAWNISTSHCTWTGVTCDARRHVVALNLSGLN  79

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            LSG LS D+  L FLVNL++AANQ  GP+PPE+S +S LR LNLSNN+F  TFP QLA+L
Sbjct  80   LSGSLSSDIAHLRFLVNLTLAANQFVGPIPPELSLVSGLRQLNLSNNVFNETFPSQLARL  139

Query  460  ANLQVLDLYNNNLT  501
              L+VLDLYNNN+T
Sbjct  140  KRLEVLDLYNNNMT  153


 Score = 60.8 bits (146),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 29/73 (40%), Positives = 46/73 (63%), Gaps = 0/73 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            LSG + P++G+L  L  L +  N LSGP+ PE+  + +L+ ++LSNN+     P   A+L
Sbjct  249  LSGEIPPEIGKLQNLDTLFLQVNTLSGPLTPELGNLKSLKSMDLSNNVLAGEIPEAFAEL  308

Query  460  ANLQVLDLYNNNL  498
             NL +L+L+ N L
Sbjct  309  KNLTLLNLFRNKL  321


 Score = 49.7 bits (117),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 24/71 (34%), Positives = 42/71 (59%), Gaps = 1/71 (1%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLS-NNIFGSTFPHQLAQ  456
             +G++ P  GQ  FL  L+++ N+L GP+PPEI  +++L+ L +   N +    P ++  
Sbjct  176  FTGIIPPAYGQWEFLEYLAVSGNELHGPIPPEIGNLTSLQQLYVGYYNTYDGGIPPEIGN  235

Query  457  LANLQVLDLYN  489
            L +L  LD+ N
Sbjct  236  LTSLVRLDMAN  246


 Score = 49.3 bits (116),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 25/75 (33%), Positives = 42/75 (56%), Gaps = 0/75 (0%)
 Frame = +1

Query  277  NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  456
              SG ++P++ Q   L  + ++ N+L G +P EI+ +  L +LNLS N    + P  LA 
Sbjct  512  KFSGEITPEISQCKVLTFVDLSRNELFGDIPTEITGMRILNYLNLSRNHLIGSIPASLAS  571

Query  457  LANLQVLDLYNNNLT  501
            + +L  +D   NNL+
Sbjct  572  MQSLTSVDFSYNNLS  586


 Score = 49.3 bits (116),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 26/74 (35%), Positives = 40/74 (54%), Gaps = 0/74 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            LSG L+P++G L  L ++ ++ N L+G +P   + +  L  LNL  N      P  +  L
Sbjct  273  LSGPLTPELGNLKSLKSMDLSNNVLAGEIPEAFAELKNLTLLNLFRNKLHGAIPEFIGDL  332

Query  460  ANLQVLDLYNNNLT  501
              L+VL L+ NN T
Sbjct  333  PELEVLQLWENNFT  346



>ref|XP_009771232.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM1 [Nicotiana sylvestris]
Length=1019

 Score =   144 bits (364),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 82/134 (61%), Positives = 97/134 (72%), Gaps = 0/134 (0%)
 Frame = +1

Query  100  AGKPLGVTEQAALLSIKAAFTADSQSSLTSWNISTSHCTWRRVTCdsllhvvsldlsglN  279
            AGK   + E  ALL++K A T D Q +L SWNISTSHCTW+ VTCD   HV SLD+SG N
Sbjct  20   AGKQPRIPEYQALLALKTAITDDPQLALASWNISTSHCTWKGVTCDRYRHVTSLDISGFN  79

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            ++G L P+VG L FL NLS+  NQ SGP+P EIS I  L +LNLSNNIF   FP QL +L
Sbjct  80   VTGTLPPEVGNLRFLQNLSVDLNQFSGPIPVEISFIPNLHYLNLSNNIFSLGFPPQLTRL  139

Query  460  ANLQVLDLYNNNLT  501
             NL+VLDLYNNN+T
Sbjct  140  RNLKVLDLYNNNMT  153


 Score = 56.2 bits (134),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 30/74 (41%), Positives = 42/74 (57%), Gaps = 0/74 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            LSG L+P++G L  L +L ++ N LSG VPP  + +  L  LNL  N    + P  +  L
Sbjct  273  LSGSLTPEIGTLKSLKSLDLSNNMLSGEVPPTFADLKNLTLLNLFRNKLHGSIPEFIGDL  332

Query  460  ANLQVLDLYNNNLT  501
              L+VL L+ NN T
Sbjct  333  PELEVLQLWENNFT  346


 Score = 52.4 bits (124),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 29/73 (40%), Positives = 43/73 (59%), Gaps = 0/73 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            LSG +  ++G+L  L  L +  N LSG + PEI  + +L+ L+LSNN+     P   A L
Sbjct  249  LSGEIPAELGKLQNLDTLFLQVNSLSGSLTPEIGTLKSLKSLDLSNNMLSGEVPPTFADL  308

Query  460  ANLQVLDLYNNNL  498
             NL +L+L+ N L
Sbjct  309  KNLTLLNLFRNKL  321


 Score = 49.3 bits (116),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 23/75 (31%), Positives = 43/75 (57%), Gaps = 0/75 (0%)
 Frame = +1

Query  277  NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  456
            + SG ++P++ +   L  + ++ NQLSG +P EI+ +  L +LNLS N    + P  ++ 
Sbjct  512  DFSGPIAPEISKCKLLTYVDLSRNQLSGEIPTEITGMRILNYLNLSRNHLVGSIPAPISS  571

Query  457  LANLQVLDLYNNNLT  501
            + +L  +D   NN +
Sbjct  572  MQSLTSVDFSYNNFS  586



>gb|KDO78771.1| hypothetical protein CISIN_1g001816mg [Citrus sinensis]
Length=1010

 Score =   142 bits (357),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 93/128 (73%), Positives = 106/128 (83%), Gaps = 0/128 (0%)
 Frame = +1

Query  118  VTEQAALLSIKAAFTADSQSSLTSWNISTSHCTWRRVTCdsllhvvsldlsglNLSGVLS  297
            V E  ALLSIK++ T D QSSL +WN +TSHCTW  VTCDS  HV SLDLSGLNLSG LS
Sbjct  20   VPEYKALLSIKSSITDDPQSSLAAWNATTSHCTWPGVTCDSRRHVTSLDLSGLNLSGALS  79

Query  298  PDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLANLQVL  477
            PDV  L FL NLS+AANQLSGP+PPEISA+S+LR LNLSNN+F  +FP QL+QLA+LQVL
Sbjct  80   PDVAHLRFLQNLSVAANQLSGPIPPEISALSSLRLLNLSNNVFNGSFPPQLSQLASLQVL  139

Query  478  DLYNNNLT  501
            DLYNNN+T
Sbjct  140  DLYNNNMT  147


 Score = 57.8 bits (138),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 30/73 (41%), Positives = 45/73 (62%), Gaps = 0/73 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            LSG +  D+G+L  L  L +  N LSGP+  E+  + +L+ ++LSNNIF    P   A+L
Sbjct  243  LSGEIPTDIGRLQNLDTLFLQVNALSGPLTTELGYLKSLKSMDLSNNIFTGEIPASFAEL  302

Query  460  ANLQVLDLYNNNL  498
             NL +L+L+ N L
Sbjct  303  KNLTLLNLFRNKL  315


 Score = 48.9 bits (115),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 23/75 (31%), Positives = 43/75 (57%), Gaps = 0/75 (0%)
 Frame = +1

Query  277  NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  456
              SG ++P++ Q   L  + ++ N+LSG +P +++ +  L +LNLS N    + P  +A 
Sbjct  506  KFSGRIAPEISQCKLLTFVDLSRNELSGEIPNQLTGMRILNYLNLSRNHLVGSIPASIAS  565

Query  457  LANLQVLDLYNNNLT  501
            + +L  +D   NNL+
Sbjct  566  MQSLTSVDFSYNNLS  580



>ref|XP_006426178.1| hypothetical protein CICLE_v10024796mg [Citrus clementina]
 gb|ESR39418.1| hypothetical protein CICLE_v10024796mg [Citrus clementina]
Length=1012

 Score =   142 bits (357),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 93/128 (73%), Positives = 106/128 (83%), Gaps = 0/128 (0%)
 Frame = +1

Query  118  VTEQAALLSIKAAFTADSQSSLTSWNISTSHCTWRRVTCdsllhvvsldlsglNLSGVLS  297
            V E  ALLSIK++ T D QSSL +WN +TSHCTW  VTCDS  HV SLDLSGLNLSG LS
Sbjct  22   VPEYKALLSIKSSITDDPQSSLAAWNATTSHCTWPGVTCDSRRHVTSLDLSGLNLSGALS  81

Query  298  PDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLANLQVL  477
            PDV  L FL NLS+AANQLSGP+PPEISA+S+LR LNLSNN+F  +FP QL+QLA+LQVL
Sbjct  82   PDVAHLRFLQNLSVAANQLSGPIPPEISALSSLRLLNLSNNVFNGSFPPQLSQLASLQVL  141

Query  478  DLYNNNLT  501
            DLYNNN+T
Sbjct  142  DLYNNNMT  149


 Score = 57.8 bits (138),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 30/73 (41%), Positives = 45/73 (62%), Gaps = 0/73 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            LSG +  D+G+L  L  L +  N LSGP+  E+  + +L+ ++LSNNIF    P   A+L
Sbjct  245  LSGEIPTDIGRLQNLDTLFLQVNALSGPLTTELGYLKSLKSMDLSNNIFTGEIPASFAEL  304

Query  460  ANLQVLDLYNNNL  498
             NL +L+L+ N L
Sbjct  305  KNLTLLNLFRNKL  317


 Score = 48.9 bits (115),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 23/75 (31%), Positives = 43/75 (57%), Gaps = 0/75 (0%)
 Frame = +1

Query  277  NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  456
              SG ++P++ Q   L  + ++ N+LSG +P +++ +  L +LNLS N    + P  +A 
Sbjct  508  KFSGRIAPEISQCKLLTFVDLSRNELSGEIPNQLTGMRILNYLNLSRNHLVGSIPASIAS  567

Query  457  LANLQVLDLYNNNLT  501
            + +L  +D   NNL+
Sbjct  568  MQSLTSVDFSYNNLS  582



>ref|XP_006466390.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM1-like [Citrus sinensis]
Length=1010

 Score =   142 bits (357),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 93/128 (73%), Positives = 106/128 (83%), Gaps = 0/128 (0%)
 Frame = +1

Query  118  VTEQAALLSIKAAFTADSQSSLTSWNISTSHCTWRRVTCdsllhvvsldlsglNLSGVLS  297
            V E  ALLSIK++ T D QSSL +WN +TSHCTW  VTCDS  HV SLDLSGLNLSG LS
Sbjct  20   VPEYKALLSIKSSITDDPQSSLAAWNATTSHCTWPGVTCDSRRHVTSLDLSGLNLSGALS  79

Query  298  PDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLANLQVL  477
            PDV  L FL NLS+AANQLSGP+PPEISA+S+LR LNLSNN+F  +FP QL+QLA+LQVL
Sbjct  80   PDVAHLRFLQNLSVAANQLSGPIPPEISALSSLRLLNLSNNVFNGSFPPQLSQLASLQVL  139

Query  478  DLYNNNLT  501
            DLYNNN+T
Sbjct  140  DLYNNNMT  147


 Score = 57.4 bits (137),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 30/73 (41%), Positives = 45/73 (62%), Gaps = 0/73 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            LSG +  D+G+L  L  L +  N LSGP+  E+  + +L+ ++LSNNIF    P   A+L
Sbjct  243  LSGEIPTDIGRLQNLDTLFLQVNALSGPLTTELGYLKSLKSMDLSNNIFTGEIPASFAEL  302

Query  460  ANLQVLDLYNNNL  498
             NL +L+L+ N L
Sbjct  303  KNLTLLNLFRNKL  315


 Score = 48.5 bits (114),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 23/75 (31%), Positives = 43/75 (57%), Gaps = 0/75 (0%)
 Frame = +1

Query  277  NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  456
              SG ++P++ Q   L  + ++ N+LSG +P +++ +  L +LNLS N    + P  +A 
Sbjct  506  KFSGRIAPEISQCKLLTFVDLSRNELSGEIPNQLTGMRILNYLNLSRNHLVGSIPASIAS  565

Query  457  LANLQVLDLYNNNLT  501
            + +L  +D   NNL+
Sbjct  566  MQSLTSVDFSYNNLS  580



>ref|NP_001235080.1| receptor-like protein kinase 3 precursor [Glycine max]
 gb|AAF91324.1|AF244890_1 receptor-like protein kinase 3 [Glycine max]
Length=1012

 Score =   140 bits (354),  Expect = 5e-35, Method: Compositional matrix adjust.
 Identities = 78/128 (61%), Positives = 101/128 (79%), Gaps = 0/128 (0%)
 Frame = +1

Query  118  VTEQAALLSIKAAFTADSQSSLTSWNISTSHCTWRRVTCdsllhvvsldlsglNLSGVLS  297
            ++E  ALLS+++A T  +   LTSWN ST +C+W  VTCD+  HV SLDL+GL+LSG LS
Sbjct  25   ISEYRALLSLRSAITDATPPLLTSWNSSTPYCSWLGVTCDNRRHVTSLDLTGLDLSGPLS  84

Query  298  PDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLANLQVL  477
             DV  LPFL NLS+A+N+ SGP+PP +SA+S LRFLNLSNN+F  TFP +L++L NL+VL
Sbjct  85   ADVAHLPFLSNLSLASNKFSGPIPPSLSALSGLRFLNLSNNVFNETFPSELSRLQNLEVL  144

Query  478  DLYNNNLT  501
            DLYNNN+T
Sbjct  145  DLYNNNMT  152


 Score = 49.7 bits (117),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 25/74 (34%), Positives = 40/74 (54%), Gaps = 0/74 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
             +G + P +G+L  L  +  + N+ SGP+ PEIS    L FL+LS N      P+++  +
Sbjct  488  FTGRIPPQIGRLQQLSKIDFSGNKFSGPIVPEISQCKLLTFLDLSRNELSGDIPNEITGM  547

Query  460  ANLQVLDLYNNNLT  501
              L  L+L  N+L 
Sbjct  548  RILNYLNLSRNHLV  561


 Score = 49.3 bits (116),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 25/74 (34%), Positives = 40/74 (54%), Gaps = 0/74 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            LSG L+P++G L  L ++ ++ N LSG +P     +  +  LNL  N      P  + +L
Sbjct  272  LSGSLTPELGNLKSLKSMDLSNNMLSGEIPARFGELKNITLLNLFRNKLHGAIPEFIGEL  331

Query  460  ANLQVLDLYNNNLT  501
              L+V+ L+ NN T
Sbjct  332  PALEVVQLWENNFT  345


 Score = 48.9 bits (115),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 25/75 (33%), Positives = 41/75 (55%), Gaps = 0/75 (0%)
 Frame = +1

Query  277  NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  456
              SG + P++ Q   L  L ++ N+LSG +P EI+ +  L +LNLS N      P  ++ 
Sbjct  511  KFSGPIVPEISQCKLLTFLDLSRNELSGDIPNEITGMRILNYLNLSRNHLVGGIPSSISS  570

Query  457  LANLQVLDLYNNNLT  501
            + +L  +D   NNL+
Sbjct  571  MQSLTSVDFSYNNLS  585


 Score = 48.5 bits (114),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 25/73 (34%), Positives = 43/73 (59%), Gaps = 0/73 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            LSG +   +G+L  L  L +  N LSG + PE+  + +L+ ++LSNN+     P +  +L
Sbjct  248  LSGEIPAALGKLQKLDTLFLQVNALSGSLTPELGNLKSLKSMDLSNNMLSGEIPARFGEL  307

Query  460  ANLQVLDLYNNNL  498
             N+ +L+L+ N L
Sbjct  308  KNITLLNLFRNKL  320



>ref|XP_009605676.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM1 [Nicotiana tomentosiformis]
Length=1017

 Score =   140 bits (353),  Expect = 6e-35, Method: Compositional matrix adjust.
 Identities = 80/134 (60%), Positives = 95/134 (71%), Gaps = 0/134 (0%)
 Frame = +1

Query  100  AGKPLGVTEQAALLSIKAAFTADSQSSLTSWNISTSHCTWRRVTCdsllhvvsldlsglN  279
            AGK   + E  ALL++K A   D Q +L SWN STSHCTW+ VTCD   HV SLD+SG N
Sbjct  19   AGKHPRIPEYQALLALKTAIIDDPQLALASWNNSTSHCTWKGVTCDRYRHVTSLDISGFN  78

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            ++G L P+VG   FL NLS+A NQ SGP+P EIS I  L +LNLSNNIF   FP QL +L
Sbjct  79   VTGTLPPEVGNFRFLQNLSVALNQFSGPIPVEISFIPNLHYLNLSNNIFSLGFPPQLTRL  138

Query  460  ANLQVLDLYNNNLT  501
             NL+VLDLYNNN+T
Sbjct  139  RNLKVLDLYNNNMT  152


 Score = 56.2 bits (134),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 30/74 (41%), Positives = 42/74 (57%), Gaps = 0/74 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            LSG L+P++G L  L +L ++ N LSG VPP  + +  L  LNL  N    + P  +  L
Sbjct  272  LSGSLTPEIGTLKSLKSLDLSNNMLSGEVPPTFADLKNLTLLNLFRNKLHGSIPEFIGDL  331

Query  460  ANLQVLDLYNNNLT  501
              L+VL L+ NN T
Sbjct  332  PELEVLQLWENNFT  345


 Score = 50.1 bits (118),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 28/73 (38%), Positives = 42/73 (58%), Gaps = 0/73 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            LSG +  ++ +L  L  L +  N LSG + PEI  + +L+ L+LSNN+     P   A L
Sbjct  248  LSGEIPAEIEKLQNLDTLFLQVNSLSGSLTPEIGTLKSLKSLDLSNNMLSGEVPPTFADL  307

Query  460  ANLQVLDLYNNNL  498
             NL +L+L+ N L
Sbjct  308  KNLTLLNLFRNKL  320


 Score = 49.3 bits (116),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 23/75 (31%), Positives = 43/75 (57%), Gaps = 0/75 (0%)
 Frame = +1

Query  277  NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  456
            + SG ++P++ +   L  + ++ NQLSG +P EI+ +  L +LNLS N    + P  ++ 
Sbjct  511  DFSGPIAPEISKCKLLTYVDLSRNQLSGEIPTEITGMRILNYLNLSRNHLVGSIPTPISS  570

Query  457  LANLQVLDLYNNNLT  501
            + +L  +D   NN +
Sbjct  571  MQSLTSVDFSYNNFS  585



>ref|XP_009375880.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM1 [Pyrus x bretschneideri]
Length=1015

 Score =   140 bits (352),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 73/131 (56%), Positives = 94/131 (72%), Gaps = 1/131 (1%)
 Frame = +1

Query  112  LGVTEQAALLSIKAAFTADSQSSLTSWNISTSHCTWRRVTCdsllhvvsldlsgl-NLSG  288
            + ++   ALLS+K++ T+D  S+L++W  +TSHCTW  VTCDS    V+       +L+G
Sbjct  20   IAMSNYRALLSLKSSITSDPNSALSTWTPTTSHCTWSGVTCDSSRRYVTSLDLSGLDLTG  79

Query  289  VLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLANL  468
             LSPDV  L FL NL++A NQ SGP+PPEISA+S LR LNLSNN+F +TFP QL+ L  L
Sbjct  80   TLSPDVAHLRFLANLTLAENQFSGPIPPEISALSGLRLLNLSNNVFNTTFPPQLSNLTRL  139

Query  469  QVLDLYNNNLT  501
             VLDLYNNNLT
Sbjct  140  TVLDLYNNNLT  150


 Score = 58.5 bits (140),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 29/75 (39%), Positives = 45/75 (60%), Gaps = 1/75 (1%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSN-NIFGSTFPHQLAQ  456
             SG + P+ G+ PFL  L+++ N+L GP+PPEI  ++TL+ L +   N +    P ++  
Sbjct  173  FSGQIPPEFGRFPFLEYLAVSGNELGGPIPPEIGNLTTLKELYIGYFNSYEGGIPPEIGN  232

Query  457  LANLQVLDLYNNNLT  501
            L+NL   D  N NLT
Sbjct  233  LSNLVRFDAANCNLT  247


 Score = 53.1 bits (126),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 27/74 (36%), Positives = 46/74 (62%), Gaps = 0/74 (0%)
 Frame = +1

Query  277  NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  456
            NL+G + P+VG+L  +  L +  N LSG +  E+  + +L+ ++LSNN+F    P   ++
Sbjct  245  NLTGEIPPEVGRLQNVDTLFLQVNALSGSLTLELGYLKSLKSMDLSNNVFTGEIPGSFSE  304

Query  457  LANLQVLDLYNNNL  498
            L NL +L+L+ N L
Sbjct  305  LKNLTLLNLFRNRL  318



>ref|XP_002875982.1| hypothetical protein ARALYDRAFT_906265 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH52241.1| hypothetical protein ARALYDRAFT_906265 [Arabidopsis lyrata subsp. 
lyrata]
Length=1001

 Score =   139 bits (351),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 77/130 (59%), Positives = 95/130 (73%), Gaps = 2/130 (2%)
 Frame = +1

Query  118  VTEQAALLSIKAAFTADSQSSLTSWNISTSHCTWRRVTCdsllhvvsldlsg-lNLSGVL  294
            +TE  ALLS+K++FT D  S LTSWN+ST+ C+W  VTCD  L  V+      LNLSG L
Sbjct  25   ITELNALLSLKSSFTIDEHSPLTSWNLSTTFCSWTGVTCDVSLRHVTSLDLSGLNLSGTL  84

Query  295  SPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ-LANLQ  471
            S DV  LP L NLS+AANQ+SGP+PPEIS +  LR LNLSNN+F  ++P +L+  L NL+
Sbjct  85   SSDVSHLPLLQNLSLAANQISGPIPPEISNLYELRHLNLSNNVFNGSYPDELSSGLVNLR  144

Query  472  VLDLYNNNLT  501
            VLDLYNNNLT
Sbjct  145  VLDLYNNNLT  154


 Score = 55.1 bits (131),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 28/73 (38%), Positives = 45/73 (62%), Gaps = 0/73 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            L+G + P++G+L  L  L +  N  SG +  E+  IS+L+ ++LSNN+F    P   +QL
Sbjct  250  LTGEIPPEIGKLQKLDTLFLQVNAFSGTLTSELGFISSLKSMDLSNNMFTGEIPASFSQL  309

Query  460  ANLQVLDLYNNNL  498
             NL +L+L+ N L
Sbjct  310  KNLTLLNLFRNKL  322


 Score = 49.3 bits (116),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 24/74 (32%), Positives = 43/74 (58%), Gaps = 0/74 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
             SG ++P++ +   L  + ++ N+LSG +P EI+ +  L +LNLS N    + P  +A +
Sbjct  515  FSGRIAPEISRCKLLTFVDLSRNELSGDIPKEITGMRILNYLNLSRNHLVGSIPVTIASM  574

Query  460  ANLQVLDLYNNNLT  501
             +L  +D   NNL+
Sbjct  575  QSLTSVDFSYNNLS  588



>ref|XP_008393812.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM1 [Malus domestica]
Length=1014

 Score =   138 bits (348),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 71/129 (55%), Positives = 94/129 (73%), Gaps = 1/129 (1%)
 Frame = +1

Query  118  VTEQAALLSIKAAFTADSQSSLTSWNISTSHCTWRRVTCdsllhvvsldlsgl-NLSGVL  294
            +++  ALLS+K++ T+D  S+L++W  +TSHCTW  VTCDS    V+       +L+G L
Sbjct  21   MSDYRALLSLKSSITSDPNSALSTWTPTTSHCTWSGVTCDSSRRYVTSLDLSGLDLTGTL  80

Query  295  SPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLANLQV  474
            SPD+  L FL NL++A NQ SGP+PP+ISA+S LR LNLSNN+F +TFP QL+ L  L V
Sbjct  81   SPDLAHLRFLSNLTLAENQFSGPIPPDISALSGLRLLNLSNNVFNTTFPRQLSNLTRLTV  140

Query  475  LDLYNNNLT  501
            LDLYNNNLT
Sbjct  141  LDLYNNNLT  149


 Score = 55.1 bits (131),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 28/75 (37%), Positives = 44/75 (59%), Gaps = 1/75 (1%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSN-NIFGSTFPHQLAQ  456
             SG + P+ G+ PFL  L+++ N+L G +PPEI  ++TL+ L +   N +    P ++  
Sbjct  172  FSGQIPPEFGRFPFLEYLAVSGNELGGSIPPEIGNLTTLKELYIGYFNSYEGGIPPEIGN  231

Query  457  LANLQVLDLYNNNLT  501
            L+NL   D  N NLT
Sbjct  232  LSNLVRFDAANCNLT  246


 Score = 53.1 bits (126),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 26/74 (35%), Positives = 47/74 (64%), Gaps = 0/74 (0%)
 Frame = +1

Query  277  NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  456
            NL+G + P++G+L  +  L +  N LSG + PE+  + +L+ ++LSNN++    P   ++
Sbjct  244  NLTGEVPPELGRLQNVDTLFLQVNALSGWLTPELGYLKSLKSMDLSNNMYTGEIPGSFSE  303

Query  457  LANLQVLDLYNNNL  498
            L NL +L+L+ N L
Sbjct  304  LKNLTLLNLFRNRL  317


 Score = 50.1 bits (118),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 27/74 (36%), Positives = 39/74 (53%), Gaps = 0/74 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            LSG L+P++G L  L ++ ++ N  +G +P   S +  L  LNL  N      P  +  L
Sbjct  269  LSGWLTPELGYLKSLKSMDLSNNMYTGEIPGSFSELKNLTLLNLFRNRLHGAIPEFIGDL  328

Query  460  ANLQVLDLYNNNLT  501
              LQVL L+ NN T
Sbjct  329  PELQVLQLWENNFT  342



>ref|XP_006404116.1| hypothetical protein EUTSA_v10010092mg [Eutrema salsugineum]
 gb|ESQ45569.1| hypothetical protein EUTSA_v10010092mg [Eutrema salsugineum]
Length=1009

 Score =   138 bits (347),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 81/139 (58%), Positives = 96/139 (69%), Gaps = 7/139 (5%)
 Frame = +1

Query  100  AGKPLGVTEQAALLSIKAAFTA---DSQSSLTSWNISTSHCTWRRVTCdsllhvvsldls  270
            AG+P  ++E  ALLS+K++ T    D  S LTSW +STS C W  VTCD     V+    
Sbjct  31   AGRP--ISEYHALLSLKSSLTGGENDQHSPLTSWKLSTSFCLWTGVTCDVSRRHVTSLDL  88

Query  271  g-lNLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQ  447
              LNLSG LS DV  LP L NLS+AANQ+SGP+PPEIS +S LR LNLSNNIF  ++P +
Sbjct  89   SGLNLSGTLSSDVAHLPLLQNLSVAANQISGPIPPEISNLSELRHLNLSNNIFNGSYPDE  148

Query  448  L-AQLANLQVLDLYNNNLT  501
            L A L NLQVLDLYNNNLT
Sbjct  149  LSAGLVNLQVLDLYNNNLT  167


 Score = 58.5 bits (140),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 29/73 (40%), Positives = 45/73 (62%), Gaps = 0/73 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            L+G + P++ +L  L  L +  N  SGP+ PE+  IS+L+ ++LSNN+F    P    QL
Sbjct  263  LTGEIPPEIWKLQKLDTLFLQVNAFSGPLTPELGMISSLKSMDLSNNMFTGEIPASFEQL  322

Query  460  ANLQVLDLYNNNL  498
             NL +L+L+ N L
Sbjct  323  KNLTLLNLFRNKL  335



>ref|XP_009354585.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM1 [Pyrus x bretschneideri]
Length=1014

 Score =   137 bits (346),  Expect = 7e-34, Method: Compositional matrix adjust.
 Identities = 71/129 (55%), Positives = 94/129 (73%), Gaps = 1/129 (1%)
 Frame = +1

Query  118  VTEQAALLSIKAAFTADSQSSLTSWNISTSHCTWRRVTCdsllhvvsldlsgl-NLSGVL  294
            +++  ALLS+K++ T+D  S+L++W  +TSHCTW  VTCDS    V+       +L+G L
Sbjct  21   MSDYRALLSLKSSITSDPNSALSTWTPTTSHCTWSGVTCDSSRRYVTSLDLSGLDLTGTL  80

Query  295  SPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLANLQV  474
            SPD+  L FL NL++A NQ SGP+PP+ISA+S LR LNLSNN+F +TFP QL+ L  L V
Sbjct  81   SPDLAHLRFLSNLTLAENQFSGPIPPDISALSGLRLLNLSNNVFNTTFPPQLSNLTRLTV  140

Query  475  LDLYNNNLT  501
            LDLYNNNLT
Sbjct  141  LDLYNNNLT  149


 Score = 55.5 bits (132),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 27/74 (36%), Positives = 47/74 (64%), Gaps = 0/74 (0%)
 Frame = +1

Query  277  NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  456
            NL+G + P++G+L  +  L +  N LSG + PE+  + +L+ ++LSNN+F    P   ++
Sbjct  244  NLTGEVPPELGRLQNVDTLFLQVNALSGSLTPELGYLKSLKSMDLSNNMFTGEIPGSFSE  303

Query  457  LANLQVLDLYNNNL  498
            L NL +L+L+ N L
Sbjct  304  LKNLTLLNLFRNRL  317


 Score = 55.1 bits (131),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 28/75 (37%), Positives = 44/75 (59%), Gaps = 1/75 (1%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSN-NIFGSTFPHQLAQ  456
             SG + P+ G+ PFL  L+++ N+L G +PPEI  ++TL+ L +   N +    P ++  
Sbjct  172  FSGQIPPEFGRFPFLEYLAVSGNELGGSIPPEIGNLTTLKELYIGYFNSYEGGMPPEIGN  231

Query  457  LANLQVLDLYNNNLT  501
            L+NL   D  N NLT
Sbjct  232  LSNLVRFDAANCNLT  246


 Score = 50.8 bits (120),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 27/74 (36%), Positives = 39/74 (53%), Gaps = 0/74 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            LSG L+P++G L  L ++ ++ N  +G +P   S +  L  LNL  N      P  +  L
Sbjct  269  LSGSLTPELGYLKSLKSMDLSNNMFTGEIPGSFSELKNLTLLNLFRNRLHGAIPEFIGDL  328

Query  460  ANLQVLDLYNNNLT  501
              LQVL L+ NN T
Sbjct  329  PELQVLQLWENNFT  342


 Score = 48.9 bits (115),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 26/73 (36%), Positives = 46/73 (63%), Gaps = 2/73 (3%)
 Frame = +1

Query  286  GVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLS-NNIFGSTFPHQLAQLA  462
            G ++P++ Q   L  + ++ N+LSG +P EI+ +  L +LNLS N++FGS  P  ++ + 
Sbjct  511  GSITPEISQCKLLTFVDLSRNELSGEIPNEITGMRILNYLNLSRNHLFGS-IPSSISTMQ  569

Query  463  NLQVLDLYNNNLT  501
            +L  +D   NNL+
Sbjct  570  SLTSVDFSYNNLS  582



>ref|XP_008344369.1| PREDICTED: LOW QUALITY PROTEIN: leucine-rich repeat receptor-like 
serine/threonine-protein kinase BAM1 [Malus domestica]
Length=1015

 Score =   137 bits (345),  Expect = 7e-34, Method: Compositional matrix adjust.
 Identities = 71/131 (54%), Positives = 94/131 (72%), Gaps = 1/131 (1%)
 Frame = +1

Query  112  LGVTEQAALLSIKAAFTADSQSSLTSWNISTSHCTWRRVTCdsllhvvsldlsgl-NLSG  288
            + ++   ALLS+K++ T+D  S+L++W  +TSHCTW  VTCDS    V+       +L+G
Sbjct  20   IAMSNYRALLSLKSSITSDPNSALSTWTPTTSHCTWSGVTCDSSRRYVTSLDLSGLDLTG  79

Query  289  VLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLANL  468
             LSPD+  L FL NL++A NQ SGP+PPEISA+S LR LNLSNN+F +TFP +L+ L  L
Sbjct  80   TLSPDLAHLRFLANLTLADNQFSGPIPPEISALSGLRLLNLSNNVFNTTFPXKLSNLTRL  139

Query  469  QVLDLYNNNLT  501
             VLDLYNNNLT
Sbjct  140  TVLDLYNNNLT  150


 Score = 58.5 bits (140),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 29/75 (39%), Positives = 45/75 (60%), Gaps = 1/75 (1%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSN-NIFGSTFPHQLAQ  456
             SG + P+ G+ PFL  L+++ N+L GP+PPEI  ++TL+ L +   N +    P ++  
Sbjct  173  FSGQIPPEFGRFPFLEYLAVSGNELGGPIPPEIGNLTTLKELYIGYFNSYEGGIPPEIGN  232

Query  457  LANLQVLDLYNNNLT  501
            L+NL   D  N NLT
Sbjct  233  LSNLVRFDAANCNLT  247


 Score = 55.8 bits (133),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 27/74 (36%), Positives = 47/74 (64%), Gaps = 0/74 (0%)
 Frame = +1

Query  277  NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  456
            NL+G + P++G+L  +  L +  N LSG + PE+  + +L+ ++LSNN+F    P   ++
Sbjct  245  NLTGEVPPELGRLQNVDTLFLQVNALSGSLTPELGYLKSLKSMDLSNNVFTGEIPGSFSE  304

Query  457  LANLQVLDLYNNNL  498
            L NL +L+L+ N L
Sbjct  305  LKNLTLLNLFRNRL  318


 Score = 49.3 bits (116),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 27/74 (36%), Positives = 39/74 (53%), Gaps = 0/74 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            LSG L+P++G L  L ++ ++ N  +G +P   S +  L  LNL  N      P  +  L
Sbjct  270  LSGSLTPELGYLKSLKSMDLSNNVFTGEIPGSFSELKNLTLLNLFRNRLHGAIPDFIGDL  329

Query  460  ANLQVLDLYNNNLT  501
              LQVL L+ NN T
Sbjct  330  PELQVLQLWENNFT  343



>ref|XP_006290548.1| hypothetical protein CARUB_v10016631mg [Capsella rubella]
 gb|EOA23446.1| hypothetical protein CARUB_v10016631mg [Capsella rubella]
Length=997

 Score =   136 bits (342),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 73/130 (56%), Positives = 92/130 (71%), Gaps = 2/130 (2%)
 Frame = +1

Query  118  VTEQAALLSIKAAFTADSQSSLTSWNISTSHCTWRRVTCdsllhvvsldlsgl-NLSGVL  294
            +TE  ALLS+K++ T D  S L SWN+ST+ C+W  VTCD     V+       +LSG L
Sbjct  22   ITELQALLSLKSSLTGDEHSPLNSWNLSTTFCSWTGVTCDVSRRHVTSLDLSGLDLSGTL  81

Query  295  SPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ-LANLQ  471
            S DV  LP L NLS+AANQ+SGP+PPEIS +S LR LNLSNN+F  ++P +L+  L NL+
Sbjct  82   SSDVSHLPLLQNLSLAANQISGPIPPEISNLSELRHLNLSNNVFNGSYPDELSSGLVNLR  141

Query  472  VLDLYNNNLT  501
            VLDLYNNNLT
Sbjct  142  VLDLYNNNLT  151


 Score = 52.8 bits (125),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 26/73 (36%), Positives = 44/73 (60%), Gaps = 0/73 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            L+G + P++G+L  L  L +  N  +G +  E+  IS+L+ ++ SNN+F    P   A+L
Sbjct  247  LTGAIPPEIGKLQNLDTLFLQVNAFAGTLTQELGWISSLKSMDFSNNMFTGEIPASFAEL  306

Query  460  ANLQVLDLYNNNL  498
             NL +L+L+ N L
Sbjct  307  KNLTLLNLFRNKL  319


 Score = 48.9 bits (115),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 24/74 (32%), Positives = 43/74 (58%), Gaps = 0/74 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
             SG ++P++ +   L  + ++ N+LSG +P EI+ +  L +LNLS N    + P  +A +
Sbjct  511  FSGRIAPEISRCKLLTFVDLSRNELSGDIPNEITGMKILNYLNLSRNHLVGSIPVTIASM  570

Query  460  ANLQVLDLYNNNLT  501
             +L  +D   NNL+
Sbjct  571  QSLTSVDFSYNNLS  584



>ref|XP_004511796.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM1-like [Cicer arietinum]
Length=1009

 Score =   135 bits (340),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 73/128 (57%), Positives = 97/128 (76%), Gaps = 0/128 (0%)
 Frame = +1

Query  118  VTEQAALLSIKAAFTADSQSSLTSWNISTSHCTWRRVTCdsllhvvsldlsglNLSGVLS  297
            ++E  ALLS++ A T  +   L+SWN ST+HC W  VTCD+  HV +L+L+GLNLSG L+
Sbjct  23   ISEYRALLSLREAITDTNPPILSSWNPSTTHCIWLGVTCDTRRHVTALNLTGLNLSGTLA  82

Query  298  PDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLANLQVL  477
             D+  LPFL NLS+A N+ SG +PP +SA+S LR LNLSNN+F  TFP +L+QL +L+VL
Sbjct  83   ADIAHLPFLSNLSLADNKFSGEIPPSLSAVSGLRLLNLSNNVFNGTFPSELSQLKSLEVL  142

Query  478  DLYNNNLT  501
            DLYNNN+T
Sbjct  143  DLYNNNMT  150



>ref|NP_190536.1| CLAVATA1-related receptor kinase-like protein [Arabidopsis thaliana]
 sp|Q9M2Z1.1|BAME2_ARATH RecName: Full=Leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM2; AltName: Full=Protein BARELY ANY MERISTEM 
2; Flags: Precursor [Arabidopsis thaliana]
 emb|CAB66905.1| receptor protein kinase-like protein [Arabidopsis thaliana]
 gb|AAO64138.1| putative leucine-rich repeat transmembrane protein kinase [Arabidopsis 
thaliana]
 gb|AAP04098.1| putative leucine-rich repeat transmembrane protein kinase [Arabidopsis 
thaliana]
 dbj|BAF00510.1| receptor protein kinase like protein [Arabidopsis thaliana]
 gb|ACN59331.1| leucine-rich repeat receptor-like protein kinase [Arabidopsis 
thaliana]
 gb|AEE78574.1| CLAVATA1-related receptor kinase-like protein [Arabidopsis thaliana]
Length=1002

 Score =   135 bits (340),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 77/131 (59%), Positives = 95/131 (73%), Gaps = 3/131 (2%)
 Frame = +1

Query  118  VTEQAALLSIKAAFTADSQSSL-TSWNISTSHCTWRRVTCdsllhvvsldlsg-lNLSGV  291
            +TE  ALLS+K++FT D  S L TSWN+ST+ C+W  VTCD  L  V+      LNLSG 
Sbjct  25   ITELHALLSLKSSFTIDEHSPLLTSWNLSTTFCSWTGVTCDVSLRHVTSLDLSGLNLSGT  84

Query  292  LSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ-LANL  468
            LS DV  LP L NLS+AANQ+SGP+PP+IS +  LR LNLSNN+F  +FP +L+  L NL
Sbjct  85   LSSDVAHLPLLQNLSLAANQISGPIPPQISNLYELRHLNLSNNVFNGSFPDELSSGLVNL  144

Query  469  QVLDLYNNNLT  501
            +VLDLYNNNLT
Sbjct  145  RVLDLYNNNLT  155


 Score = 55.1 bits (131),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 27/73 (37%), Positives = 45/73 (62%), Gaps = 0/73 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            L+G + P++G+L  L  L +  N  +G +  E+  IS+L+ ++LSNN+F    P   +QL
Sbjct  251  LTGEIPPEIGKLQKLDTLFLQVNAFTGTITQELGLISSLKSMDLSNNMFTGEIPTSFSQL  310

Query  460  ANLQVLDLYNNNL  498
             NL +L+L+ N L
Sbjct  311  KNLTLLNLFRNKL  323



>ref|XP_002310320.2| hypothetical protein POPTR_0007s14500g [Populus trichocarpa]
 gb|EEE90770.2| hypothetical protein POPTR_0007s14500g [Populus trichocarpa]
Length=1020

 Score =   134 bits (338),  Expect = 7e-33, Method: Compositional matrix adjust.
 Identities = 73/129 (57%), Positives = 91/129 (71%), Gaps = 1/129 (1%)
 Frame = +1

Query  118  VTEQAALLSIKAAFTADSQSSLTSWNISTSHCTWRRVTCdsllhvvsldlsgl-NLSGVL  294
            V+E  ALLSIK++ T D QS L++WN +T  C+W  +TCD     V+       NLSG L
Sbjct  28   VSEYEALLSIKSSITDDPQSFLSAWNSTTPLCSWTGITCDHTGRRVTSLDLSGLNLSGTL  87

Query  295  SPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLANLQV  474
            S DV  L +L NLS+A NQ SGP+P  +SA+++LR LNLSNNIF STFP QL+ L NLQV
Sbjct  88   SSDVAHLRYLQNLSLAVNQFSGPIPASLSAVTSLRSLNLSNNIFNSTFPPQLSSLKNLQV  147

Query  475  LDLYNNNLT  501
            LDLYNNN+T
Sbjct  148  LDLYNNNMT  156


 Score = 58.9 bits (141),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 29/73 (40%), Positives = 47/73 (64%), Gaps = 0/73 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            LSG + P++G+L  L  L +  N LSG + PE+ ++ +L+ ++LSNN+F    P   A+L
Sbjct  252  LSGQIPPEIGRLQKLDTLFLQVNGLSGSLTPELGSLKSLKSMDLSNNMFTGEIPTSFAEL  311

Query  460  ANLQVLDLYNNNL  498
             NL +L+L+ N L
Sbjct  312  KNLTLLNLFRNKL  324


 Score = 52.0 bits (123),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 27/74 (36%), Positives = 41/74 (55%), Gaps = 0/74 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            LSG L+P++G L  L ++ ++ N  +G +P   + +  L  LNL  N      P  +A+L
Sbjct  276  LSGSLTPELGSLKSLKSMDLSNNMFTGEIPTSFAELKNLTLLNLFRNKLYGAIPEFIAEL  335

Query  460  ANLQVLDLYNNNLT  501
              LQVL L+ NN T
Sbjct  336  PELQVLQLWENNFT  349


 Score = 50.8 bits (120),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 25/75 (33%), Positives = 43/75 (57%), Gaps = 0/75 (0%)
 Frame = +1

Query  277  NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  456
              SG ++P++ Q   L  + ++ N+LSG +P EI+ +  L +LNLS N    + P  +A 
Sbjct  515  KFSGPIAPEISQCKLLTFVDLSRNELSGEIPTEITGMRILNYLNLSRNHLVGSIPAPIAT  574

Query  457  LANLQVLDLYNNNLT  501
            + +L  +D   NNL+
Sbjct  575  MQSLTSVDFSYNNLS  589


 Score = 50.1 bits (118),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 25/75 (33%), Positives = 40/75 (53%), Gaps = 0/75 (0%)
 Frame = +1

Query  277  NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  456
              SG + P++G+L  L  +  + N+ SGP+ PEIS    L F++LS N      P ++  
Sbjct  491  KFSGSIPPEIGRLQQLTKMDFSHNKFSGPIAPEISQCKLLTFVDLSRNELSGEIPTEITG  550

Query  457  LANLQVLDLYNNNLT  501
            +  L  L+L  N+L 
Sbjct  551  MRILNYLNLSRNHLV  565



>ref|XP_007208421.1| hypothetical protein PRUPE_ppa000739mg [Prunus persica]
 gb|EMJ09620.1| hypothetical protein PRUPE_ppa000739mg [Prunus persica]
Length=1017

 Score =   134 bits (338),  Expect = 8e-33, Method: Compositional matrix adjust.
 Identities = 77/128 (60%), Positives = 94/128 (73%), Gaps = 0/128 (0%)
 Frame = +1

Query  118  VTEQAALLSIKAAFTADSQSSLTSWNISTSHCTWRRVTCdsllhvvsldlsglNLSGVLS  297
            +++  ALLS K++ ++D  S L+SW  +TSHCTW  VTCDS  HV SLDLS  +L G LS
Sbjct  22   MSDYRALLSFKSSISSDPNSVLSSWTPTTSHCTWTGVTCDSRRHVTSLDLSSSDLVGTLS  81

Query  298  PDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLANLQVL  477
             D+  L FL NL++A NQ SGP+P EISA+S LR LNLSNNIF +TFP QL+ L  L VL
Sbjct  82   SDIAHLRFLSNLTLADNQFSGPIPSEISALSGLRLLNLSNNIFNTTFPPQLSNLTRLAVL  141

Query  478  DLYNNNLT  501
            DLYNNNLT
Sbjct  142  DLYNNNLT  149


 Score = 53.5 bits (127),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 28/75 (37%), Positives = 44/75 (59%), Gaps = 1/75 (1%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLS-NNIFGSTFPHQLAQ  456
             SG + P+ G+ P L  L+I+ N+L G +PPEI  +++L+ L +   NI+    P ++  
Sbjct  172  FSGRIPPEFGRFPLLEYLAISGNELGGSIPPEIGNLTSLKELYIGYYNIYEGGIPPEIGN  231

Query  457  LANLQVLDLYNNNLT  501
            L+ L  LD  N NLT
Sbjct  232  LSQLVRLDAANCNLT  246


 Score = 49.7 bits (117),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 25/74 (34%), Positives = 46/74 (62%), Gaps = 0/74 (0%)
 Frame = +1

Query  277  NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  456
            NL+G +  ++G+L  +  L +  N LSG +  E+ ++ +L+ ++LSNN+F    P   ++
Sbjct  244  NLTGEVPRELGRLQNVDTLFLQVNALSGSLTAELGSLKSLKSMDLSNNMFSGEIPGSFSE  303

Query  457  LANLQVLDLYNNNL  498
            L NL +L+L+ N L
Sbjct  304  LKNLTLLNLFRNKL  317


 Score = 48.9 bits (115),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 27/74 (36%), Positives = 38/74 (51%), Gaps = 0/74 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            LSG L+ ++G L  L ++ ++ N  SG +P   S +  L  LNL  N      P  +  L
Sbjct  269  LSGSLTAELGSLKSLKSMDLSNNMFSGEIPGSFSELKNLTLLNLFRNKLHGAIPEFIGDL  328

Query  460  ANLQVLDLYNNNLT  501
              LQVL L+ NN T
Sbjct  329  PELQVLQLWENNFT  342



>ref|NP_001237715.1| receptor-like protein kinase 2 precursor [Glycine max]
 gb|AAF91323.1|AF244889_1 receptor-like protein kinase 2 [Glycine max]
Length=1012

 Score =   134 bits (337),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 72/128 (56%), Positives = 98/128 (77%), Gaps = 0/128 (0%)
 Frame = +1

Query  118  VTEQAALLSIKAAFTADSQSSLTSWNISTSHCTWRRVTCdsllhvvsldlsglNLSGVLS  297
            ++E  ALLS+++  T  +   L+SWN S  +C+W  VTCD+  HV +L+L+GL+LSG LS
Sbjct  25   ISEYRALLSLRSVITDATPPVLSSWNASIPYCSWLGVTCDNRRHVTALNLTGLDLSGTLS  84

Query  298  PDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLANLQVL  477
             DV  LPFL NLS+AAN+ SGP+PP +SA+S LR+LNLSNN+F  TFP +L +L +L+VL
Sbjct  85   ADVAHLPFLSNLSLAANKFSGPIPPSLSALSGLRYLNLSNNVFNETFPSELWRLQSLEVL  144

Query  478  DLYNNNLT  501
            DLYNNN+T
Sbjct  145  DLYNNNMT  152


 Score = 51.2 bits (121),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 25/75 (33%), Positives = 43/75 (57%), Gaps = 0/75 (0%)
 Frame = +1

Query  277  NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  456
              SG ++P++ Q   L  L ++ N+LSG +P EI+ +  L +LNLS N    + P  ++ 
Sbjct  511  KFSGPIAPEISQCKLLTFLDLSRNELSGDIPNEITGMRILNYLNLSKNHLVGSIPSSISS  570

Query  457  LANLQVLDLYNNNLT  501
            + +L  +D   NNL+
Sbjct  571  MQSLTSVDFSYNNLS  585


 Score = 50.4 bits (119),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 26/74 (35%), Positives = 41/74 (55%), Gaps = 0/74 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            LSG L+P++G L  L ++ ++ N LSG +P     +  +  LNL  N      P  + +L
Sbjct  272  LSGSLTPELGNLKSLKSMDLSNNMLSGEIPASFGELKNITLLNLFRNKLHGAIPEFIGEL  331

Query  460  ANLQVLDLYNNNLT  501
              L+V+ L+ NNLT
Sbjct  332  PALEVVQLWENNLT  345



>ref|XP_004288299.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM1 [Fragaria vesca subsp. vesca]
Length=1023

 Score =   134 bits (336),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 80/123 (65%), Positives = 95/123 (77%), Gaps = 1/123 (1%)
 Frame = +1

Query  133  ALLSIKAAFTADSQSSLTSWNISTSHCTWRRVTCdsllhvvsldlsglNLSGVLSPDVGQ  312
            ALLS+K++   D  S L+SW  +TSHCTW  VTCDS  HV SLDLSGLNLSG LSPD+  
Sbjct  38   ALLSLKSSLD-DPDSRLSSWTPNTSHCTWAGVTCDSHNHVTSLDLSGLNLSGYLSPDIAF  96

Query  313  LPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLANLQVLDLYNN  492
            L +L NL++A N LSGP+PPEISA+  LR LNLSNN+F  TFP +L+ L NL+VLDLYNN
Sbjct  97   LVYLSNLTLAENNLSGPIPPEISALPALRLLNLSNNVFNRTFPPELSNLTNLRVLDLYNN  156

Query  493  NLT  501
            NLT
Sbjct  157  NLT  159


 Score = 55.1 bits (131),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 28/74 (38%), Positives = 47/74 (64%), Gaps = 0/74 (0%)
 Frame = +1

Query  277  NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  456
            NLSG + P++G+L  +  L +  N LSG +  E+ ++ +L+ ++LSNN+F    P   A+
Sbjct  254  NLSGEIPPELGRLQNVDTLFLQVNALSGSLTSELGSLKSLKSMDLSNNLFSGEIPTSFAE  313

Query  457  LANLQVLDLYNNNL  498
            L NL +L+L+ N L
Sbjct  314  LKNLTLLNLFRNQL  327



>ref|XP_008354741.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM1 [Malus domestica]
Length=1015

 Score =   134 bits (336),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 70/131 (53%), Positives = 93/131 (71%), Gaps = 1/131 (1%)
 Frame = +1

Query  112  LGVTEQAALLSIKAAFTADSQSSLTSWNISTSHCTWRRVTCdsllhvvsldlsgl-NLSG  288
            + ++   ALLS+K++ T+   S+L++W  +TSHCTW  VTCDS    V+       +L+G
Sbjct  20   IAMSNYRALLSLKSSITSXPNSALSTWTPTTSHCTWSGVTCDSSRRYVTSLDLSGLDLTG  79

Query  289  VLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLANL  468
             LSPD+  L FL NL++A NQ SGP+PPEISA+S LR LNLSNN+F +TFP +L+ L  L
Sbjct  80   TLSPDLAHLRFLANLTLADNQFSGPIPPEISALSGLRLLNLSNNVFNTTFPPKLSNLTRL  139

Query  469  QVLDLYNNNLT  501
             VLDLYNNNLT
Sbjct  140  TVLDLYNNNLT  150


 Score = 58.5 bits (140),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 29/75 (39%), Positives = 45/75 (60%), Gaps = 1/75 (1%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSN-NIFGSTFPHQLAQ  456
             SG + P+ G+ PFL  L+++ N+L GP+PPEI  ++TL+ L +   N +    P ++  
Sbjct  173  FSGQIPPEFGRFPFLEYLAVSGNELGGPIPPEIGNLTTLKELYIGYFNSYEGGIPPEIGN  232

Query  457  LANLQVLDLYNNNLT  501
            L+NL   D  N NLT
Sbjct  233  LSNLVRFDAANCNLT  247


 Score = 55.8 bits (133),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 27/74 (36%), Positives = 47/74 (64%), Gaps = 0/74 (0%)
 Frame = +1

Query  277  NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  456
            NL+G + P++G+L  +  L +  N LSG + PE+  + +L+ ++LSNN+F    P   ++
Sbjct  245  NLTGEVPPELGRLQNVDTLFLQVNALSGSLTPELGYLKSLKSMDLSNNVFTGEIPGSFSE  304

Query  457  LANLQVLDLYNNNL  498
            L NL +L+L+ N L
Sbjct  305  LKNLTLLNLFRNRL  318


 Score = 49.3 bits (116),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 27/74 (36%), Positives = 39/74 (53%), Gaps = 0/74 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            LSG L+P++G L  L ++ ++ N  +G +P   S +  L  LNL  N      P  +  L
Sbjct  270  LSGSLTPELGYLKSLKSMDLSNNVFTGEIPGSFSELKNLTLLNLFRNRLHGAIPDFIGDL  329

Query  460  ANLQVLDLYNNNLT  501
              LQVL L+ NN T
Sbjct  330  PELQVLQLWENNFT  343



>gb|EPS74129.1| hypothetical protein M569_00625, partial [Genlisea aurea]
Length=970

 Score =   134 bits (336),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 84/141 (60%), Positives = 104/141 (74%), Gaps = 1/141 (1%)
 Frame = +1

Query  82   HSAGAGAGKPLGVTEQAALLSIKAAFTADSQSSLTSWNISTSHCTWRRVTCdsllhvvsl  261
            H     A +P  ++E  AL+SIKAA + +++ +L SWN   SHC+WR VTCDSL   V+ 
Sbjct  15   HLQRCAAVRPPRMSEYHALVSIKAAISEEARPALASWNSGASHCSWRGVTCDSLGRHVTG  74

Query  262  -dlsglNLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTF  438
             D+S L+LSG LSPDVGQL FLVNLS AAN LSGPVP EI+ I  LR+LNLSNN+F  +F
Sbjct  75   LDISNLSLSGSLSPDVGQLLFLVNLSAAANLLSGPVPAEIADIPNLRYLNLSNNVFNLSF  134

Query  439  PHQLAQLANLQVLDLYNNNLT  501
            P +L +L NLQVLDLYNNN+T
Sbjct  135  PTELYRLKNLQVLDLYNNNMT  155


 Score = 52.0 bits (123),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 27/74 (36%), Positives = 42/74 (57%), Gaps = 0/74 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
             SG L+P++G L  L ++ ++ N LSG +P   + +  L  LNL  N    + P+ + +L
Sbjct  275  FSGGLTPELGNLKNLKSMDLSNNALSGEIPSSFAELKNLTLLNLFRNKLNGSIPNFIGEL  334

Query  460  ANLQVLDLYNNNLT  501
              LQVL L+ NN T
Sbjct  335  PQLQVLQLWENNFT  348


 Score = 50.4 bits (119),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 27/74 (36%), Positives = 41/74 (55%), Gaps = 0/74 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
             SG + P++ Q   L  + ++ NQL+G VP EISA+  L +LNLS N      P  ++ +
Sbjct  515  FSGQIPPELSQCKQLAFVDLSRNQLNGRVPSEISAMKILNYLNLSRNQLDGNIPSSISSM  574

Query  460  ANLQVLDLYNNNLT  501
             +L  +D   NN T
Sbjct  575  QSLTSVDFSYNNFT  588


 Score = 48.9 bits (115),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 23/68 (34%), Positives = 39/68 (57%), Gaps = 1/68 (1%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLS-NNIFGSTFPHQLAQ  456
             +G + P+ G  P L  L+++ N+LSG +PPE+  ++ L+ L +   N F    P ++  
Sbjct  178  FTGTMPPEFGSFPHLEYLAVSGNELSGTIPPELGNLTQLKELYVGYYNTFSGGLPKEIGN  237

Query  457  LANLQVLD  480
            L+NL  LD
Sbjct  238  LSNLLRLD  245



>gb|KDP32143.1| hypothetical protein JCGZ_12604 [Jatropha curcas]
Length=1013

 Score =   133 bits (334),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 84/129 (65%), Positives = 100/129 (78%), Gaps = 2/129 (2%)
 Frame = +1

Query  118  VTEQAALLSIKAAFTADSQSSLTSWNISTSHCTWRRVTCd-sllhvvsldlsglNLSGVL  294
            ++E  ALLS+KAA   D QS+L SWN S S C+W  VTCD S  HV SLDLS LNLSG+L
Sbjct  23   MSEYQALLSVKAAID-DPQSALVSWNSSNSLCSWSGVTCDPSGRHVTSLDLSSLNLSGIL  81

Query  295  SPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLANLQV  474
            S D+  L +L NL++AANQLSGP+PP++SAI  LR LNLSNN+F  TFP QL+QL NLQV
Sbjct  82   SSDIAHLRYLQNLTLAANQLSGPIPPQLSAIPGLRSLNLSNNVFNGTFPSQLSQLKNLQV  141

Query  475  LDLYNNNLT  501
            LDLYNNN+T
Sbjct  142  LDLYNNNMT  150


 Score = 52.4 bits (124),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 26/74 (35%), Positives = 43/74 (58%), Gaps = 0/74 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
             SG ++P++ Q   L  + ++ N+LSG +P EI+ +  L +LNLS N    + P  +A +
Sbjct  510  FSGPITPEISQCKLLTFVDLSRNELSGAIPTEITGMRILNYLNLSRNHLIGSIPSSIATM  569

Query  460  ANLQVLDLYNNNLT  501
             +L  +D   NNLT
Sbjct  570  QSLTSVDFSYNNLT  583


 Score = 50.1 bits (118),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 25/73 (34%), Positives = 40/73 (55%), Gaps = 0/73 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
             SG + P +G+L  L  +  ++N+ SGP+ PEIS    L F++LS N      P ++  +
Sbjct  486  FSGAIPPQIGRLQQLSKMDFSSNKFSGPITPEISQCKLLTFVDLSRNELSGAIPTEITGM  545

Query  460  ANLQVLDLYNNNL  498
              L  L+L  N+L
Sbjct  546  RILNYLNLSRNHL  558



>gb|KFK34238.1| hypothetical protein AALP_AA5G119100 [Arabis alpina]
Length=998

 Score =   132 bits (333),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 89/137 (65%), Positives = 104/137 (76%), Gaps = 5/137 (4%)
 Frame = +1

Query  100  AGKPLGVTEQAALLSIKAAFTADSQSS-LTSWNISTSHCTWRRVTC-dsllhvvsldlsg  273
            A +P   TE  ALLS+K + T+  QSS LTSWN+S S C W  VTC  SL HV SLDLS 
Sbjct  17   AARP--TTELHALLSLKTSLTSGEQSSSLTSWNLSKSFCLWAGVTCDVSLRHVTSLDLSS  74

Query  274  lNLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQL-  450
            LNLSG LS DV  LP L NLS+AANQ+SGP+PPEI+ +S LR LNLSNN+F  ++P+QL 
Sbjct  75   LNLSGTLSSDVAHLPLLQNLSVAANQISGPIPPEIANLSELRHLNLSNNVFNGSYPNQLS  134

Query  451  AQLANLQVLDLYNNNLT  501
            A+LANLQVLDLYNNNLT
Sbjct  135  ARLANLQVLDLYNNNLT  151


 Score = 58.9 bits (141),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 29/73 (40%), Positives = 45/73 (62%), Gaps = 0/73 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            L+G + P++G+L  L  L +  N  SGP+  E+  IS+L+ ++LSNN+F    P    QL
Sbjct  247  LTGEIPPEIGKLQKLDTLFLQVNAFSGPLTSELGVISSLKSMDLSNNMFTGEIPASFEQL  306

Query  460  ANLQVLDLYNNNL  498
             NL +L+L+ N L
Sbjct  307  KNLTLLNLFRNKL  319


 Score = 48.5 bits (114),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 24/72 (33%), Positives = 42/72 (58%), Gaps = 0/72 (0%)
 Frame = +1

Query  286  GVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLAN  465
            G ++P++ Q   L  + ++ N+LSG +P EI+ +  L +LNLS N    + P  +A + +
Sbjct  514  GRIAPEISQCKLLTFVDLSRNELSGEIPNEITGMRILNYLNLSRNHLLGSIPVTMASMQS  573

Query  466  LQVLDLYNNNLT  501
            L  +D   NNL+
Sbjct  574  LTSVDFSYNNLS  585



>ref|XP_007047661.1| Leucine-rich receptor-like protein kinase family protein [Theobroma 
cacao]
 gb|EOX91818.1| Leucine-rich receptor-like protein kinase family protein [Theobroma 
cacao]
Length=1018

 Score =   132 bits (333),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 70/135 (52%), Positives = 96/135 (71%), Gaps = 3/135 (2%)
 Frame = +1

Query  100  AGKPLGVTEQAALLSIKAAFTADSQSSLTSWNISTSHCTWRRVTCdsllhvvsldlsg-l  276
            A +P  V+E  ALL++K++FT D +S L++WN +T  C++  V CD     V+       
Sbjct  19   AARP--VSEFRALLAVKSSFTDDPESYLSNWNATTRFCSFTGVACDYTGRHVTSIDLSNF  76

Query  277  NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  456
            NLSG LSP    L FL +LS+AANQ+SGP+P E++A+S+LR+ NLSNN+F  +FP QL+Q
Sbjct  77   NLSGTLSPSFSHLRFLQSLSLAANQISGPIPTELAALSSLRYFNLSNNVFNGSFPSQLSQ  136

Query  457  LANLQVLDLYNNNLT  501
            L NLQVLDLYNNN+T
Sbjct  137  LKNLQVLDLYNNNMT  151


 Score = 51.2 bits (121),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 24/75 (32%), Positives = 43/75 (57%), Gaps = 0/75 (0%)
 Frame = +1

Query  277  NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  456
              SG ++P++ +   L  + ++ N+LSG +P EI+ +  L +LNLS N    + P  +A 
Sbjct  511  KFSGTIAPEISKCKLLTFVDLSRNELSGEIPTEITGMRILNYLNLSRNHLIGSIPSSIAT  570

Query  457  LANLQVLDLYNNNLT  501
            + +L  +D   NNL+
Sbjct  571  MQSLTSVDFSYNNLS  585



>gb|KJB48795.1| hypothetical protein B456_008G087500 [Gossypium raimondii]
Length=1013

 Score =   132 bits (332),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 72/129 (56%), Positives = 93/129 (72%), Gaps = 1/129 (1%)
 Frame = +1

Query  118  VTEQAALLSIKAAFTADSQSSLTSWNISTSHCTWRRVTCdsllhvvsld-lsglNLSGVL  294
            V+E  ALL++K++ T D QS L++WN +T  C++  VTCD     V+   LS  NLSG L
Sbjct  24   VSEFQALLAVKSSITDDPQSYLSNWNATTPLCSFTGVTCDYTGRHVTSLNLSYFNLSGTL  83

Query  295  SPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLANLQV  474
            SP    L FL N S+AANQL GP+P E++A+S LR+LNLSNN+F  +FP QL+QL NLQV
Sbjct  84   SPSFSHLQFLQNFSLAANQLYGPIPTELAALSALRYLNLSNNVFNGSFPTQLSQLKNLQV  143

Query  475  LDLYNNNLT  501
            LDLYNNN+T
Sbjct  144  LDLYNNNMT  152


 Score = 57.0 bits (136),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 28/73 (38%), Positives = 44/73 (60%), Gaps = 0/73 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            LSG + P++G+L  L  L +  N LSG + PE+  + +L+ ++LSNN+     P   A L
Sbjct  248  LSGEIPPEIGKLQKLDTLFLQVNALSGSLTPELGTLESLKSMDLSNNMLAGEIPESFADL  307

Query  460  ANLQVLDLYNNNL  498
             NL +L+L+ N L
Sbjct  308  KNLTLLNLFRNKL  320


 Score = 50.4 bits (119),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 26/74 (35%), Positives = 41/74 (55%), Gaps = 0/74 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            LSG L+P++G L  L ++ ++ N L+G +P   + +  L  LNL  N      P  + +L
Sbjct  272  LSGSLTPELGTLESLKSMDLSNNMLAGEIPESFADLKNLTLLNLFRNKLHGQIPEFIGEL  331

Query  460  ANLQVLDLYNNNLT  501
              L+VL L+ NN T
Sbjct  332  PELEVLQLWENNFT  345



>ref|XP_011021820.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM1 [Populus euphratica]
Length=1020

 Score =   132 bits (332),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 71/129 (55%), Positives = 90/129 (70%), Gaps = 1/129 (1%)
 Frame = +1

Query  118  VTEQAALLSIKAAFTADSQSSLTSWNISTSHCTWRRVTCdsllhvvsldlsgl-NLSGVL  294
            V+E  ALLSIK++ T D QS L++WN +   C+W  +TCD     V+       NLSG L
Sbjct  28   VSEYEALLSIKSSITDDPQSFLSAWNSTAPLCSWTGITCDHTGRRVTSLDLSGLNLSGTL  87

Query  295  SPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLANLQV  474
            S D+  L +L NLS+A NQ SGP+P  +SA+++LR LNLSNNIF STFP QL+ L NLQV
Sbjct  88   SSDIAHLRYLQNLSLAVNQFSGPIPASLSAVTSLRSLNLSNNIFNSTFPPQLSSLKNLQV  147

Query  475  LDLYNNNLT  501
            LDLYNNN+T
Sbjct  148  LDLYNNNMT  156


 Score = 54.7 bits (130),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 28/73 (38%), Positives = 46/73 (63%), Gaps = 0/73 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            LSG + P++G+L  L  L +  N LSG +  E+ ++ +L+ ++LSNN+F    P   A+L
Sbjct  252  LSGQIPPEIGRLQKLDTLFLQVNGLSGSLTLELGSLKSLKSMDLSNNMFTGEIPTSFAEL  311

Query  460  ANLQVLDLYNNNL  498
             NL +L+L+ N L
Sbjct  312  KNLTLLNLFRNKL  324


 Score = 51.2 bits (121),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 25/75 (33%), Positives = 43/75 (57%), Gaps = 0/75 (0%)
 Frame = +1

Query  277  NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  456
              SG ++P++ Q   L  + ++ N+LSG +P EI+ +  L +LNLS N    + P  +A 
Sbjct  515  KFSGPIAPEISQCKLLTFVDLSRNELSGEIPTEITGMRILNYLNLSRNHLVGSIPSPIAT  574

Query  457  LANLQVLDLYNNNLT  501
            + +L  +D   NNL+
Sbjct  575  MQSLTSVDFSYNNLS  589


 Score = 50.1 bits (118),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 25/75 (33%), Positives = 40/75 (53%), Gaps = 0/75 (0%)
 Frame = +1

Query  277  NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  456
              SG + P++G+L  L  +  + N+ SGP+ PEIS    L F++LS N      P ++  
Sbjct  491  KFSGSIPPEIGRLQQLTKMDFSHNKFSGPIAPEISQCKLLTFVDLSRNELSGEIPTEITG  550

Query  457  LANLQVLDLYNNNLT  501
            +  L  L+L  N+L 
Sbjct  551  MRILNYLNLSRNHLV  565



>gb|KHG03710.1| Leucine-rich repeat receptor-like serine/threonine-protein kinase 
BAM1 [Gossypium arboreum]
 gb|KHG03906.1| Leucine-rich repeat receptor-like serine/threonine-protein kinase 
BAM1 [Gossypium arboreum]
Length=1013

 Score =   130 bits (327),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 69/129 (53%), Positives = 89/129 (69%), Gaps = 1/129 (1%)
 Frame = +1

Query  118  VTEQAALLSIKAAFTADSQSSLTSWNISTSHCTWRRVTCdsllhvvsldlsgl-NLSGVL  294
            V E  ALL++K++ T D QS L++WN +   C++  VTCD     V+       NLSG L
Sbjct  24   VLEFQALLAVKSSITGDPQSYLSNWNATIPLCSFTGVTCDYTGRHVTSLDLSYFNLSGTL  83

Query  295  SPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLANLQV  474
            SP    L FL N S+AANQL GP+P E++A+S LR+LNLSNN+F  +FP QL+QL NLQV
Sbjct  84   SPSFSHLRFLQNFSLAANQLYGPIPTELAALSALRYLNLSNNVFNGSFPTQLSQLKNLQV  143

Query  475  LDLYNNNLT  501
            LDLYNNN+T
Sbjct  144  LDLYNNNMT  152


 Score = 57.0 bits (136),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 28/73 (38%), Positives = 44/73 (60%), Gaps = 0/73 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            LSG + P++G+L  L  L +  N LSG + PE+  + +L+ ++LSNN+     P   A L
Sbjct  248  LSGEIPPEIGKLQKLDTLFLQVNALSGSLTPELGTLKSLKSMDLSNNMLAGEIPESFADL  307

Query  460  ANLQVLDLYNNNL  498
             NL +L+L+ N L
Sbjct  308  KNLTLLNLFRNKL  320


 Score = 49.7 bits (117),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 26/74 (35%), Positives = 41/74 (55%), Gaps = 0/74 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            LSG L+P++G L  L ++ ++ N L+G +P   + +  L  LNL  N      P  + +L
Sbjct  272  LSGSLTPELGTLKSLKSMDLSNNMLAGEIPESFADLKNLTLLNLFRNKLHGQIPGFIGEL  331

Query  460  ANLQVLDLYNNNLT  501
              L+VL L+ NN T
Sbjct  332  PELEVLQLWENNFT  345



>ref|XP_010426489.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM2 [Camelina sativa]
Length=1000

 Score =   129 bits (325),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 75/132 (57%), Positives = 93/132 (70%), Gaps = 4/132 (3%)
 Frame = +1

Query  118  VTEQAALLSIKAAFTADSQSSL-TSWNIS-TSHCTWRRVTCdsllhvvsldlsg-lNLSG  288
            +TE  ALLS+K++ T D  S L TSWN+S T+ C+W  V CD     V+      LNLSG
Sbjct  23   ITELNALLSLKSSLTGDDHSPLLTSWNLSSTTFCSWTGVKCDVSRRHVTSLDLSGLNLSG  82

Query  289  VLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ-LAN  465
             LS DV  LP L NLS+AANQ+SGP+PPEIS +S LR LNLSNN+F  ++P +L+  L N
Sbjct  83   TLSSDVSHLPLLQNLSLAANQISGPIPPEISKLSELRLLNLSNNVFNGSYPDELSSGLVN  142

Query  466  LQVLDLYNNNLT  501
            L+VLDLYNNNLT
Sbjct  143  LRVLDLYNNNLT  154


 Score = 57.0 bits (136),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 27/73 (37%), Positives = 46/73 (63%), Gaps = 0/73 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            L+G + P++G+L  L  L +  N  +GP+  E+  IS+L+ ++LSNN+F    P   ++L
Sbjct  250  LTGAIPPEIGKLQNLDTLFLQVNAFAGPLTSELGLISSLKSMDLSNNMFTGEIPTSFSEL  309

Query  460  ANLQVLDLYNNNL  498
             NL +L+L+ N L
Sbjct  310  KNLTLLNLFRNKL  322


 Score = 48.9 bits (115),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 24/74 (32%), Positives = 43/74 (58%), Gaps = 0/74 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
             SG ++P++ +   L  + ++ N+LSG +P EI+ +  L +LNLS N    + P  +A +
Sbjct  514  FSGRIAPEISRCKLLTFVDLSRNELSGDIPNEITGMRILNYLNLSRNHLVGSIPVSIASM  573

Query  460  ANLQVLDLYNNNLT  501
             +L  +D   NNL+
Sbjct  574  QSLTSVDFSYNNLS  587



>ref|XP_006393995.1| hypothetical protein EUTSA_v10003584mg [Eutrema salsugineum]
 gb|ESQ31281.1| hypothetical protein EUTSA_v10003584mg [Eutrema salsugineum]
Length=1007

 Score =   129 bits (325),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 74/139 (53%), Positives = 94/139 (68%), Gaps = 7/139 (5%)
 Frame = +1

Query  100  AGKPLGVTEQAALLSIKAAFTA---DSQSSLTSWNISTSHCTWRRVTCdsllhvvsldls  270
            AG+P  ++E  AL+S+K++ T    D  S L SW  STS CTW  VTCD     V+    
Sbjct  19   AGRP--ISELHALISLKSSLTGAGEDPNSPLASWKSSTSFCTWTGVTCDISRRHVTSLDL  76

Query  271  gl-NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQ  447
               NLSG LSPDV +LP L NLS+A NQ+SGP+PPEIS +  LR LNLSNN+F  +FP +
Sbjct  77   SGLNLSGTLSPDVSRLPLLQNLSVADNQISGPIPPEISNLYGLRHLNLSNNVFNGSFPDE  136

Query  448  LAQ-LANLQVLDLYNNNLT  501
            ++  L NL+VLD+YNNNLT
Sbjct  137  ISSGLVNLRVLDVYNNNLT  155


 Score = 56.6 bits (135),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 28/73 (38%), Positives = 46/73 (63%), Gaps = 0/73 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            L+G + P++G+L  L  L +  N  SGP+  E+  +S+L+ ++LSNN+F    P   A+L
Sbjct  251  LTGEIPPEIGKLQKLDTLFLQVNVFSGPLTWELGTLSSLKSMDLSNNMFTGEIPASFAEL  310

Query  460  ANLQVLDLYNNNL  498
             NL +L+L+ N L
Sbjct  311  KNLTLLNLFRNKL  323


 Score = 50.4 bits (119),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 25/74 (34%), Positives = 42/74 (57%), Gaps = 0/74 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
             SG ++P++     L  + ++ N+LSG +P EI+ +  L +LNLS N    T P  ++ +
Sbjct  515  FSGRIAPEISHCKLLTFVDLSRNELSGDIPNEITGMRILNYLNLSRNHLVGTIPGSISSM  574

Query  460  ANLQVLDLYNNNLT  501
             +L  LD   NNL+
Sbjct  575  QSLTSLDFSYNNLS  588



>ref|XP_010028033.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM1 [Eucalyptus grandis]
 gb|KCW54695.1| hypothetical protein EUGRSUZ_I00635 [Eucalyptus grandis]
Length=1023

 Score =   129 bits (325),  Expect = 5e-31, Method: Compositional matrix adjust.
 Identities = 85/149 (57%), Positives = 107/149 (72%), Gaps = 9/149 (6%)
 Frame = +1

Query  79   RHSAGAGAGKPLGVTEQAALLSIKAAFTADSQSSLTSWNISTS-------HCTWRRVTCd  237
            R  A A A  P  +TE  ALLSI+AA T D QS+L+SW  + +       HC+W+ VTCD
Sbjct  17   RRGAAASAA-PTRLTEPLALLSIRAAVTGDPQSALSSWTSAAAAAANGSSHCSWQGVTCD  75

Query  238  -sllhvvsldlsglNLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLS  414
                HV +LDLS L L+G LSPDV  L FL++LS+AANQLSGP+PP+ISA++ LR+LNLS
Sbjct  76   PRRRHVTALDLSSLELAGALSPDVAHLRFLISLSVAANQLSGPIPPQISALAALRYLNLS  135

Query  415  NNIFGSTFPHQLAQLANLQVLDLYNNNLT  501
            NN+F  TFP +L  L NL+VLDLYNNN+T
Sbjct  136  NNVFNGTFPPRLGLLRNLRVLDLYNNNMT  164


 Score = 55.8 bits (133),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 28/73 (38%), Positives = 44/73 (60%), Gaps = 0/73 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            LSG + P++ +L  L  L +  N  +G +P EI  +++L+ L+LSNN+F    P   +QL
Sbjct  260  LSGEIPPEIAKLQNLDTLFLQVNGFAGSLPAEIGYLNSLKSLDLSNNMFAGEIPESFSQL  319

Query  460  ANLQVLDLYNNNL  498
             NL +L L+ N L
Sbjct  320  KNLTLLHLFRNKL  332


 Score = 53.9 bits (128),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 26/75 (35%), Positives = 45/75 (60%), Gaps = 0/75 (0%)
 Frame = +1

Query  277  NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  456
            N SG + P++G+L  L  +  ++N+ SGP+P +IS    L F++LS N      P+++  
Sbjct  500  NFSGQIPPEIGRLQQLAKIDFSSNRYSGPIPAQISQCKLLTFVDLSGNELSGEIPNEITG  559

Query  457  LANLQVLDLYNNNLT  501
            +  L  L+L +NNL+
Sbjct  560  MRILNYLNLSSNNLS  574


 Score = 51.6 bits (122),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 29/69 (42%), Positives = 40/69 (58%), Gaps = 0/69 (0%)
 Frame = +1

Query  286  GVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLAN  465
            G L P++G L  LV L  A+  LSG +PPEI+ +  L  L L  N F  + P ++  L +
Sbjct  238  GSLPPEIGNLSQLVRLDAASCGLSGEIPPEIAKLQNLDTLFLQVNGFAGSLPAEIGYLNS  297

Query  466  LQVLDLYNN  492
            L+ LDL NN
Sbjct  298  LKSLDLSNN  306



>gb|KJB18115.1| hypothetical protein B456_003G034500 [Gossypium raimondii]
Length=1014

 Score =   129 bits (324),  Expect = 6e-31, Method: Compositional matrix adjust.
 Identities = 67/129 (52%), Positives = 91/129 (71%), Gaps = 1/129 (1%)
 Frame = +1

Query  118  VTEQAALLSIKAAFTADSQSSLTSWNISTSHCTWRRVTCdsllhvvsldlsg-lNLSGVL  294
            VTE  AL+++K++ T D QS L++WN ST  C++  VTCD     V+      + L+G L
Sbjct  27   VTELRALIAVKSSITDDPQSYLSNWNASTPLCSFAGVTCDLTGRHVTSIDLTNVTLAGTL  86

Query  295  SPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLANLQV  474
            SP +  L FL NLS+A N LSGP+P E++ +S LR+LNLSNN+F  +FP QL+QL NLQ+
Sbjct  87   SPSLAHLRFLQNLSVAGNDLSGPIPTELAVLSNLRYLNLSNNVFNGSFPTQLSQLKNLQI  146

Query  475  LDLYNNNLT  501
            LDLYNNN+T
Sbjct  147  LDLYNNNMT  155


 Score = 60.5 bits (145),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 30/73 (41%), Positives = 47/73 (64%), Gaps = 0/73 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            LSG + P++G+L  L  L +  N LSG + PE+  +++L+ ++LSNN+F    P   AQL
Sbjct  251  LSGEIPPEIGKLQKLDTLFLQVNALSGSLTPELGTLNSLKSMDLSNNMFTGEIPASFAQL  310

Query  460  ANLQVLDLYNNNL  498
             NL +L+L+ N L
Sbjct  311  KNLTLLNLFRNKL  323


 Score = 50.1 bits (118),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 24/75 (32%), Positives = 45/75 (60%), Gaps = 0/75 (0%)
 Frame = +1

Query  277  NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  456
             LSG++ P++ +   L  + ++ N+LSG +P EI+++  L +LNLS N    + P  ++ 
Sbjct  515  KLSGLIPPEICKCKLLTFVDLSGNELSGRIPTEITSMRILNYLNLSRNHLLGSIPSSIST  574

Query  457  LANLQVLDLYNNNLT  501
            + +L  +D   NNL+
Sbjct  575  MQSLTSVDFSYNNLS  589



>ref|XP_010515326.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM2 [Camelina sativa]
Length=1000

 Score =   129 bits (323),  Expect = 6e-31, Method: Compositional matrix adjust.
 Identities = 75/132 (57%), Positives = 94/132 (71%), Gaps = 4/132 (3%)
 Frame = +1

Query  118  VTEQAALLSIKAAFTADSQSSL-TSWNISTS-HCTWRRVTCdsllhvvsldlsg-lNLSG  288
            +TE  ALLS+K++ T D  S L +SWN+ST+  C+W  VTCD     V+      LNLSG
Sbjct  23   ITEFNALLSLKSSLTGDDHSPLLSSWNLSTTTFCSWTGVTCDVSRRHVTSLDLSGLNLSG  82

Query  289  VLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ-LAN  465
             LS DV  LP L NLS+AANQ+SGP+PPEIS +S LR LNLSNN+F  ++P +L+  L N
Sbjct  83   TLSSDVSHLPLLQNLSLAANQISGPIPPEISNLSELRLLNLSNNVFNGSYPDELSSGLVN  142

Query  466  LQVLDLYNNNLT  501
            L+VLDLYNNNLT
Sbjct  143  LRVLDLYNNNLT  154


 Score = 58.2 bits (139),  Expect = 8e-07, Method: Compositional matrix adjust.
 Identities = 28/73 (38%), Positives = 46/73 (63%), Gaps = 0/73 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            L+G + P++G+L  L  L +  N  SGP+  E+  IS+L+ ++LSNN+F    P   ++L
Sbjct  250  LTGAIPPEIGKLQNLDTLFLQVNAFSGPLTSELGLISSLKSMDLSNNMFTGEIPTSFSEL  309

Query  460  ANLQVLDLYNNNL  498
             NL +L+L+ N L
Sbjct  310  KNLTLLNLFRNKL  322


 Score = 48.5 bits (114),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 24/74 (32%), Positives = 43/74 (58%), Gaps = 0/74 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
             SG ++P++ +   L  + ++ N+LSG +P EI+ +  L +LNLS N    + P  +A +
Sbjct  514  FSGRIAPEISRCKLLTFVDLSRNELSGDIPNEITGMRILNYLNLSRNHLVGSIPVSIASM  573

Query  460  ANLQVLDLYNNNLT  501
             +L  +D   NNL+
Sbjct  574  QSLTSVDFSYNNLS  587



>ref|XP_010484412.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM1 [Camelina sativa]
Length=1005

 Score =   129 bits (323),  Expect = 7e-31, Method: Compositional matrix adjust.
 Identities = 73/134 (54%), Positives = 91/134 (68%), Gaps = 6/134 (4%)
 Frame = +1

Query  118  VTEQAALLSIKAAFTA----DSQSSLTSWNISTSHCTWRRVTCdsllhvvsldlsgl-NL  282
            ++E  ALLS+K++ T     D  S L+SW +STS CTW  VTCD     V+       NL
Sbjct  23   ISEFRALLSLKSSLTGAGTDDQNSPLSSWKVSTSFCTWVGVTCDVSRRHVTSLDLSGLNL  82

Query  283  SGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ-L  459
            SG LSPDV  L  L NLS+A NQ+SGP+PPEIS +S LR LNLSNN+F  +FP +L+  L
Sbjct  83   SGTLSPDVSHLRLLQNLSLAENQISGPIPPEISILSGLRHLNLSNNVFNGSFPDELSSGL  142

Query  460  ANLQVLDLYNNNLT  501
             NL+VLD+YNNNLT
Sbjct  143  VNLRVLDVYNNNLT  156


 Score = 56.6 bits (135),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 28/73 (38%), Positives = 46/73 (63%), Gaps = 0/73 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            L+G + P++G+L  L  L +  N  SGP+  E+  +S+L+ ++LSNN+F    P   A+L
Sbjct  252  LTGEIPPEIGKLQKLDTLFLQVNVFSGPLTWELGTLSSLKSMDLSNNMFTGEIPASFAEL  311

Query  460  ANLQVLDLYNNNL  498
             NL +L+L+ N L
Sbjct  312  KNLTLLNLFRNKL  324


 Score = 49.3 bits (116),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 24/74 (32%), Positives = 43/74 (58%), Gaps = 0/74 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
             SG ++P++ +   L  + ++ N+LSG +P EI+ +  L +LNLS N    + P  ++ +
Sbjct  516  FSGRIAPEISRCKLLTFVDLSRNELSGEIPNEITGMRILNYLNLSRNHLLGSIPGSISSM  575

Query  460  ANLQVLDLYNNNLT  501
             +L  LD   NNL+
Sbjct  576  QSLTSLDFSYNNLS  589



>ref|XP_010444585.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM1 [Camelina sativa]
Length=1006

 Score =   129 bits (323),  Expect = 7e-31, Method: Compositional matrix adjust.
 Identities = 73/134 (54%), Positives = 91/134 (68%), Gaps = 6/134 (4%)
 Frame = +1

Query  118  VTEQAALLSIKAAFTA----DSQSSLTSWNISTSHCTWRRVTCdsllhvvsldlsgl-NL  282
            ++E  ALLS+K++ T     D  S L+SW +STS CTW  VTCD     V+       NL
Sbjct  23   ISEFRALLSLKSSLTGAGSDDQNSPLSSWKVSTSFCTWVGVTCDVSRRHVTSLDLSGLNL  82

Query  283  SGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ-L  459
            SG LSPDV  L  L NLS+A NQ+SGP+PPEIS +S LR LNLSNN+F  +FP +L+  L
Sbjct  83   SGTLSPDVSHLRLLQNLSLAENQISGPIPPEISILSGLRHLNLSNNVFNGSFPDELSSGL  142

Query  460  ANLQVLDLYNNNLT  501
             NL+VLD+YNNNLT
Sbjct  143  VNLRVLDVYNNNLT  156


 Score = 56.6 bits (135),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 28/73 (38%), Positives = 46/73 (63%), Gaps = 0/73 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            L+G + P++G+L  L  L +  N  SGP+  E+  +S+L+ ++LSNN+F    P   A+L
Sbjct  252  LTGEIPPEIGKLQKLDTLFLQVNVFSGPLTWELGTLSSLKSMDLSNNMFTGEIPASFAEL  311

Query  460  ANLQVLDLYNNNL  498
             NL +L+L+ N L
Sbjct  312  KNLTLLNLFRNKL  324


 Score = 49.3 bits (116),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 24/74 (32%), Positives = 43/74 (58%), Gaps = 0/74 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
             SG ++P++ +   L  + ++ N+LSG +P EI+ +  L +LNLS N    + P  ++ +
Sbjct  516  FSGRIAPEISRCKLLTFVDLSRNELSGEIPNEITGMRILNYLNLSRNHLLGSIPGSISSM  575

Query  460  ANLQVLDLYNNNLT  501
             +L  LD   NNL+
Sbjct  576  QSLTSLDFSYNNLS  589



>ref|XP_010463501.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM1 [Camelina sativa]
Length=1006

 Score =   129 bits (323),  Expect = 8e-31, Method: Compositional matrix adjust.
 Identities = 73/134 (54%), Positives = 91/134 (68%), Gaps = 6/134 (4%)
 Frame = +1

Query  118  VTEQAALLSIKAAFTA----DSQSSLTSWNISTSHCTWRRVTCdsllhvvsldlsgl-NL  282
            ++E  ALLS+K++ T     D  S L+SW +STS CTW  VTCD     V+       NL
Sbjct  23   ISEFRALLSLKSSLTGAGTDDKNSPLSSWKVSTSFCTWVGVTCDVSRRHVTSLDLSGLNL  82

Query  283  SGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ-L  459
            SG LSPDV  L  L NLS+A NQ+SGP+PPEIS +S LR LNLSNN+F  +FP +L+  L
Sbjct  83   SGTLSPDVSHLRLLQNLSLAENQISGPIPPEISNLSGLRHLNLSNNVFNGSFPDELSSGL  142

Query  460  ANLQVLDLYNNNLT  501
             NL+VLD+YNNNLT
Sbjct  143  VNLRVLDVYNNNLT  156


 Score = 57.0 bits (136),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 28/73 (38%), Positives = 47/73 (64%), Gaps = 0/73 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            L+G + P++G+L  L  L +  N  SGP+  E+ ++S+L+ ++LSNN+F    P   A+L
Sbjct  252  LTGEIPPEIGKLQKLDTLFLQVNVFSGPLTWELGSLSSLKSMDLSNNMFTGEIPTSFAEL  311

Query  460  ANLQVLDLYNNNL  498
             NL +L+L+ N L
Sbjct  312  KNLTLLNLFRNKL  324


 Score = 49.3 bits (116),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 24/74 (32%), Positives = 43/74 (58%), Gaps = 0/74 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
             SG ++P++ +   L  + ++ N+LSG +P EI+ +  L +LNLS N    + P  ++ +
Sbjct  516  FSGRIAPEISRCKLLTFVDLSRNELSGEIPNEITGMRILNYLNLSRNHLLGSIPGSISSM  575

Query  460  ANLQVLDLYNNNLT  501
             +L  LD   NNL+
Sbjct  576  QSLTSLDFSYNNLS  589



>gb|KJB18113.1| hypothetical protein B456_003G034400 [Gossypium raimondii]
 gb|KJB18114.1| hypothetical protein B456_003G034400 [Gossypium raimondii]
Length=1026

 Score =   129 bits (323),  Expect = 9e-31, Method: Compositional matrix adjust.
 Identities = 67/129 (52%), Positives = 91/129 (71%), Gaps = 1/129 (1%)
 Frame = +1

Query  118  VTEQAALLSIKAAFTADSQSSLTSWNISTSHCTWRRVTCdsllhvvsldlsg-lNLSGVL  294
            VTE +AL+++K++ T D QS L++WN +T  C++  V CD     V+        LSG L
Sbjct  27   VTELSALIAVKSSITDDPQSYLSNWNANTPLCSFAGVACDLTGRHVTSIDLTNFTLSGTL  86

Query  295  SPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLANLQV  474
            SP +  L FL NLS+AAN LSGP+P E++ +S LR+LNLSNN+F  +FP QL+QL NLQ+
Sbjct  87   SPSLAHLRFLQNLSVAANDLSGPIPTELAVLSNLRYLNLSNNVFNGSFPTQLSQLKNLQI  146

Query  475  LDLYNNNLT  501
            LDLYNNN+T
Sbjct  147  LDLYNNNMT  155


 Score = 60.5 bits (145),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 31/73 (42%), Positives = 47/73 (64%), Gaps = 0/73 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            LSG + P+VG+L  L  L +  N LSG + PE+  +++L+ ++LSNN+F    P   AQL
Sbjct  251  LSGEIPPEVGKLQRLHTLFLQVNALSGSLTPELGTLNSLKSMDLSNNMFTGEIPASFAQL  310

Query  460  ANLQVLDLYNNNL  498
             NL +L+L+ N L
Sbjct  311  KNLTLLNLFRNKL  323



>ref|XP_002864974.1| hypothetical protein ARALYDRAFT_496807 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH41233.1| hypothetical protein ARALYDRAFT_496807 [Arabidopsis lyrata subsp. 
lyrata]
Length=1003

 Score =   128 bits (322),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 72/133 (54%), Positives = 92/133 (69%), Gaps = 5/133 (4%)
 Frame = +1

Query  118  VTEQAALLSIKAAFTA---DSQSSLTSWNISTSHCTWRRVTCdsllhvvsldlsgl-NLS  285
            ++E  ALLS+K++ T    D  S L+SW +STS CTW  VTCD     V+       NLS
Sbjct  23   ISEFRALLSLKSSLTGAGDDINSPLSSWKVSTSFCTWTGVTCDVSRRHVTSLDLSGLNLS  82

Query  286  GVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ-LA  462
            G LSPDV  L  L NLS+A NQ+SGP+PPEIS++S LR LNLSNN+F  +FP +++  L 
Sbjct  83   GTLSPDVSHLRLLQNLSLADNQISGPIPPEISSLSGLRHLNLSNNVFNGSFPDEISSGLV  142

Query  463  NLQVLDLYNNNLT  501
            NL+VLD+YNNNLT
Sbjct  143  NLRVLDVYNNNLT  155


 Score = 53.1 bits (126),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 27/73 (37%), Positives = 45/73 (62%), Gaps = 0/73 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            L+G + P++G+L  L  L +  N  SG +  E+  +S+L+ ++LSNN+F    P   A+L
Sbjct  251  LTGEIPPEIGKLQKLDTLFLQVNVFSGSLTWELGTLSSLKSMDLSNNMFTGEIPASFAEL  310

Query  460  ANLQVLDLYNNNL  498
             NL +L+L+ N L
Sbjct  311  KNLTLLNLFRNKL  323


 Score = 49.7 bits (117),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 24/74 (32%), Positives = 43/74 (58%), Gaps = 0/74 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
             SG ++P++ +   L  + ++ N+LSG +P EI+ +  L +LNLS N    + P  ++ +
Sbjct  515  FSGRIAPEISRCKLLTFVDLSRNELSGEIPNEITGMKILNYLNLSRNNLVGSIPGSISSM  574

Query  460  ANLQVLDLYNNNLT  501
             +L  LD   NNL+
Sbjct  575  QSLTSLDFSYNNLS  588



>ref|XP_010683073.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM1 [Beta vulgaris subsp. vulgaris]
Length=1009

 Score =   128 bits (321),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 72/132 (55%), Positives = 86/132 (65%), Gaps = 6/132 (5%)
 Frame = +1

Query  124  EQAALLSIKAAFTADSQSSLTSWNISTSHCTWRRVTCdsllhvvsldlsgl------NLS  285
            EQ ALL IK+A T D QSSL+SWN ST HCTW  + C S   +              NL+
Sbjct  24   EQKALLGIKSAITDDPQSSLSSWNTSTHHCTWDFIKCSSSSSLNHHQSVVSLNISGLNLT  83

Query  286  GVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLAN  465
            G+LSPD+G L  L NLS+A N  SGP+P  +S +S L  LNLSNNIF STFP  L+ L N
Sbjct  84   GILSPDIGFLTNLQNLSVAGNSFSGPIPSSLSLLSNLYHLNLSNNIFNSTFPSSLSPLQN  143

Query  466  LQVLDLYNNNLT  501
            LQ+LD+YNNNLT
Sbjct  144  LQILDVYNNNLT  155


 Score = 48.9 bits (115),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 24/73 (33%), Positives = 41/73 (56%), Gaps = 0/73 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
             SG + P++G+L  L  +  ++N+ SG +P EIS    L F++LS N F    P ++  +
Sbjct  492  FSGSIPPEIGRLQQLSKIDFSSNKFSGEIPSEISKCKLLTFVDLSRNQFSGEIPKEITGM  551

Query  460  ANLQVLDLYNNNL  498
              L  L++  N+L
Sbjct  552  RILNYLNISRNHL  564



>ref|NP_001235065.1| receptor-like protein kinase 1 precursor [Glycine max]
 gb|AAF91322.1|AF244888_1 receptor-like protein kinase 1 [Glycine max]
Length=1008

 Score =   127 bits (320),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 76/129 (59%), Positives = 97/129 (75%), Gaps = 1/129 (1%)
 Frame = +1

Query  118  VTEQAALLSIKAA-FTADSQSSLTSWNISTSHCTWRRVTCdsllhvvsldlsglNLSGVL  294
            ++E  ALLS KA+  T D   +L+SWN ST  C+W  +TCDS  HV SL+L+ L+LSG L
Sbjct  19   ISEYRALLSFKASSLTDDPTHALSSWNSSTPFCSWFGLTCDSRRHVTSLNLTSLSLSGTL  78

Query  295  SPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLANLQV  474
            S D+  LPFL +LS+A N+ SGP+P   SA+S LRFLNLSNN+F +TFP QL +LANL+V
Sbjct  79   SDDLSHLPFLSHLSLADNKFSGPIPASFSALSALRFLNLSNNVFNATFPSQLNRLANLEV  138

Query  475  LDLYNNNLT  501
            LDLYNNN+T
Sbjct  139  LDLYNNNMT  147


 Score = 52.0 bits (123),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 27/73 (37%), Positives = 45/73 (62%), Gaps = 0/73 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            LSG +  ++G+L  L  L +  N LSG + PE+ ++ +L+ ++LSNN+     P   A+L
Sbjct  243  LSGEIPAELGKLQNLDTLFLQVNALSGSLTPELGSLKSLKSMDLSNNMLSGEVPASFAEL  302

Query  460  ANLQVLDLYNNNL  498
             NL +L+L+ N L
Sbjct  303  KNLTLLNLFRNKL  315


 Score = 51.2 bits (121),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 28/74 (38%), Positives = 41/74 (55%), Gaps = 0/74 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            LSG L+P++G L  L ++ ++ N LSG VP   + +  L  LNL  N      P  + +L
Sbjct  267  LSGSLTPELGSLKSLKSMDLSNNMLSGEVPASFAELKNLTLLNLFRNKLHGAIPEFVGEL  326

Query  460  ANLQVLDLYNNNLT  501
              L+VL L+ NN T
Sbjct  327  PALEVLQLWENNFT  340


 Score = 48.5 bits (114),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 22/74 (30%), Positives = 43/74 (58%), Gaps = 0/74 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
             SG ++P++ +   L  + ++ N+LSG +P +I+++  L +LNLS N    + P  +A +
Sbjct  507  FSGPIAPEISKCKLLTFIDLSGNELSGEIPNKITSMRILNYLNLSRNHLDGSIPGNIASM  566

Query  460  ANLQVLDLYNNNLT  501
             +L  +D   NN +
Sbjct  567  QSLTSVDFSYNNFS  580



>gb|KHG04200.1| Leucine-rich repeat receptor-like serine/threonine-protein kinase 
BAM1 [Gossypium arboreum]
Length=1014

 Score =   127 bits (319),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 67/129 (52%), Positives = 90/129 (70%), Gaps = 1/129 (1%)
 Frame = +1

Query  118  VTEQAALLSIKAAFTADSQSSLTSWNISTSHCTWRRVTCdsllhvvsldlsg-lNLSGVL  294
            VTE  AL+++K++ T D QS L++WN +T  C++  VTCD     V+        LSG L
Sbjct  27   VTELRALIAVKSSITDDPQSYLSNWNATTPLCSFAGVTCDLTGRHVTSIDLTNFTLSGTL  86

Query  295  SPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLANLQV  474
            SP +  L FL NLS+A N L+GP+P E++ +S LR+LNLSNN+F  +FP QL+QL NLQV
Sbjct  87   SPSLAHLRFLQNLSVADNNLTGPIPTELAVLSNLRYLNLSNNVFNGSFPTQLSQLKNLQV  146

Query  475  LDLYNNNLT  501
            LDLYNNN+T
Sbjct  147  LDLYNNNMT  155


 Score = 60.1 bits (144),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 30/73 (41%), Positives = 47/73 (64%), Gaps = 0/73 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            LSG + P++G+L  L  L +  N LSG + PE+  +++L+ ++LSNN+F    P   AQL
Sbjct  251  LSGEIPPEIGKLQKLDTLFLQVNALSGSLTPELGTLNSLKSMDLSNNMFTGEIPASFAQL  310

Query  460  ANLQVLDLYNNNL  498
             NL +L+L+ N L
Sbjct  311  KNLTLLNLFRNKL  323


 Score = 48.9 bits (115),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 24/74 (32%), Positives = 44/74 (59%), Gaps = 0/74 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
             SG++ P++ +   L  + ++ N+LSG +P EI+++  L FLNLS N    + P  ++ +
Sbjct  516  FSGLIPPEICKCELLTFVDLSRNELSGRIPTEITSMRILNFLNLSRNHLLGSIPSSISTM  575

Query  460  ANLQVLDLYNNNLT  501
             +L  +D   NNL+
Sbjct  576  QSLTSVDFSYNNLS  589



>ref|NP_001237688.1| receptor-like protein kinase precursor [Glycine max]
 gb|ACM89563.1| receptor-like protein kinase [Glycine max]
Length=1010

 Score =   127 bits (319),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 74/129 (57%), Positives = 93/129 (72%), Gaps = 1/129 (1%)
 Frame = +1

Query  118  VTEQAALLSIKAA-FTADSQSSLTSWNISTSHCTWRRVTCdsllhvvsldlsglNLSGVL  294
            ++E  ALLS KA+  T D   +L+SWN ST  C+W  VTCDS  HV  L+L+ L+LS  L
Sbjct  19   ISEYRALLSFKASSITNDPTHALSSWNSSTPFCSWFGVTCDSRRHVTGLNLTSLSLSATL  78

Query  295  SPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLANLQV  474
               +  LPFL +LS+A NQ SGP+P   SA+S LRFLNLSNN+F  TFP QLA+L+NL+V
Sbjct  79   YDHLSHLPFLSHLSLADNQFSGPIPVSFSALSALRFLNLSNNVFNQTFPSQLARLSNLEV  138

Query  475  LDLYNNNLT  501
            LDLYNNN+T
Sbjct  139  LDLYNNNMT  147


 Score = 50.8 bits (120),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 26/73 (36%), Positives = 40/73 (55%), Gaps = 0/73 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
             SG + P +G+L  L  +  + N+ SGP+ PEIS    L F++LS N      P+Q+  +
Sbjct  483  FSGRIPPQIGRLQQLSKIDFSHNKFSGPIAPEISRCKLLTFIDLSGNELSGEIPNQITSM  542

Query  460  ANLQVLDLYNNNL  498
              L  L+L  N+L
Sbjct  543  RILNYLNLSRNHL  555



>ref|XP_004509039.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM1-like [Cicer arietinum]
Length=1005

 Score =   127 bits (319),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 71/130 (55%), Positives = 92/130 (71%), Gaps = 2/130 (2%)
 Frame = +1

Query  118  VTEQAALLSIKAA-FTADSQSSLTSWNISTSHCTWRRVTCds-llhvvsldlsglNLSGV  291
            ++E   LLS K++  T D   SL SWN ST+HC+W  +TC     HV S+DLS L L+  
Sbjct  22   ISEHKTLLSFKSSSITDDPTHSLISWNSSTTHCSWHGITCTGPHRHVTSIDLSSLTLTAT  81

Query  292  LSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLANLQ  471
            LS  +  LPFL NLS+A N+ SGP+PP  S++ +LRFLNLSNN+F  TFP QL++L+NL 
Sbjct  82   LSDHLSNLPFLSNLSLADNKFSGPIPPSFSSLYSLRFLNLSNNVFNGTFPSQLSRLSNLH  141

Query  472  VLDLYNNNLT  501
            VLDLYNNN+T
Sbjct  142  VLDLYNNNMT  151


 Score = 54.7 bits (130),  Expect = 9e-06, Method: Compositional matrix adjust.
 Identities = 28/73 (38%), Positives = 45/73 (62%), Gaps = 0/73 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            L+G + P++G+L  L  L +  N LSG + PE+  + +L+ ++LSNN F    P   A+L
Sbjct  247  LTGEIPPELGKLQNLDTLFLQVNALSGSLTPELGNLKSLKSMDLSNNAFDGEVPASFAEL  306

Query  460  ANLQVLDLYNNNL  498
             NL +L+L+ N L
Sbjct  307  KNLTLLNLFRNKL  319


 Score = 52.0 bits (123),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 26/75 (35%), Positives = 42/75 (56%), Gaps = 0/75 (0%)
 Frame = +1

Query  277  NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  456
              SG ++P++     L  + ++ N+LSG +P EI+ +  L +LNLS N    T P  +A 
Sbjct  510  KFSGPIAPEISHCKLLTFVDLSRNELSGEIPNEITGMRILNYLNLSRNHLVGTIPGSIAS  569

Query  457  LANLQVLDLYNNNLT  501
            + +L  +D   NNLT
Sbjct  570  MQSLTSVDFSYNNLT  584



>ref|XP_004143422.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM1-like [Cucumis sativus]
 ref|XP_004163335.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM1-like [Cucumis sativus]
 gb|KGN48657.1| hypothetical protein Csa_6G497080 [Cucumis sativus]
Length=1019

 Score =   125 bits (315),  Expect = 7e-30, Method: Compositional matrix adjust.
 Identities = 82/128 (64%), Positives = 99/128 (77%), Gaps = 0/128 (0%)
 Frame = +1

Query  118  VTEQAALLSIKAAFTADSQSSLTSWNISTSHCTWRRVTCdsllhvvsldlsglNLSGVLS  297
            V+E  ALLS+K + T D +SSL SWN STSHCTW  VTCD   HV +LDL+ L LSG LS
Sbjct  26   VSEYRALLSLKTSITGDPKSSLASWNASTSHCTWFGVTCDLRRHVTALDLTALGLSGSLS  85

Query  298  PDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLANLQVL  477
            PDV  L FL NLS+AAN+ SGP+PPE+S+IS+LR LNLSNN+F  +FP + +QL NL VL
Sbjct  86   PDVAFLRFLTNLSLAANEFSGPIPPELSSISSLRLLNLSNNVFDGSFPSRFSQLQNLHVL  145

Query  478  DLYNNNLT  501
            DLYNNN+T
Sbjct  146  DLYNNNMT  153


 Score = 60.5 bits (145),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 32/73 (44%), Positives = 47/73 (64%), Gaps = 0/73 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            LSG + P++G+L  L  L +  N LSGP+ PEI  +++L+ L+LSNN+     P   AQL
Sbjct  249  LSGRIPPELGKLQNLDTLFLQVNALSGPLTPEIGQLNSLKSLDLSNNMLVGEIPVSFAQL  308

Query  460  ANLQVLDLYNNNL  498
             NL +L+L+ N L
Sbjct  309  KNLTLLNLFRNKL  321


 Score = 52.8 bits (125),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 27/74 (36%), Positives = 44/74 (59%), Gaps = 0/74 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            LSG ++P++ Q   L  + ++ NQLSG +P EI+++  L +LNLS N      P  +A +
Sbjct  513  LSGPIAPEISQCKLLTFVDLSRNQLSGEIPNEITSMRILNYLNLSKNHLVGGIPATIASM  572

Query  460  ANLQVLDLYNNNLT  501
             +L  +D   NNL+
Sbjct  573  QSLTSVDFSYNNLS  586


 Score = 52.0 bits (123),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 26/75 (35%), Positives = 42/75 (56%), Gaps = 0/75 (0%)
 Frame = +1

Query  277  NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  456
              SG + P++G+L  L  +  ++N LSGP+ PEIS    L F++LS N      P+++  
Sbjct  488  KFSGQIPPEIGRLQQLSKIDFSSNMLSGPIAPEISQCKLLTFVDLSRNQLSGEIPNEITS  547

Query  457  LANLQVLDLYNNNLT  501
            +  L  L+L  N+L 
Sbjct  548  MRILNYLNLSKNHLV  562


 Score = 51.2 bits (121),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 28/74 (38%), Positives = 40/74 (54%), Gaps = 0/74 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            LSG L+P++GQL  L +L ++ N L G +P   + +  L  LNL  N      P  +  L
Sbjct  273  LSGPLTPEIGQLNSLKSLDLSNNMLVGEIPVSFAQLKNLTLLNLFRNKLHGAIPSFIGDL  332

Query  460  ANLQVLDLYNNNLT  501
              L+VL L+ NN T
Sbjct  333  PKLEVLQLWENNFT  346



>ref|XP_010503631.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM2 [Camelina sativa]
Length=999

 Score =   125 bits (315),  Expect = 8e-30, Method: Compositional matrix adjust.
 Identities = 73/132 (55%), Positives = 92/132 (70%), Gaps = 4/132 (3%)
 Frame = +1

Query  118  VTEQAALLSIKAAFTADSQSSL-TSWNISTS-HCTWRRVTCdsllhvvsldlsg-lNLSG  288
            +TE  ALLS+K++ T D  S L +SWN+ST+  C+W  VTCD     V+      LNLSG
Sbjct  22   ITELNALLSLKSSLTGDDHSPLLSSWNLSTTTFCSWTGVTCDVSRRHVTSLDLSGLNLSG  81

Query  289  VLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ-LAN  465
             LS DV  LP L NLS+AANQ+SGP+PPE S +  LR LNLSNN+F  ++P +L+  L N
Sbjct  82   TLSSDVSHLPLLQNLSLAANQISGPIPPEFSNLYELRLLNLSNNVFNGSYPDELSSGLVN  141

Query  466  LQVLDLYNNNLT  501
            L+VLDLYNNNLT
Sbjct  142  LRVLDLYNNNLT  153


 Score = 57.8 bits (138),  Expect = 8e-07, Method: Compositional matrix adjust.
 Identities = 28/73 (38%), Positives = 46/73 (63%), Gaps = 0/73 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            L+G + P++G+L  L  L +  N  SGP+  E+  IS+L+ ++LSNN+F    P   ++L
Sbjct  249  LTGAIPPEIGKLQNLDTLFLQVNAFSGPLTSELGLISSLKSMDLSNNMFTGEIPTSFSEL  308

Query  460  ANLQVLDLYNNNL  498
             NL +L+L+ N L
Sbjct  309  KNLTLLNLFRNKL  321


 Score = 48.5 bits (114),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 24/74 (32%), Positives = 43/74 (58%), Gaps = 0/74 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
             SG ++P++ +   L  + ++ N+LSG +P EI+ +  L +LNLS N    + P  +A +
Sbjct  513  FSGRIAPEISRCKLLTFVDLSRNELSGDIPNEITGMRILNYLNLSRNHLVGSIPVSIASM  572

Query  460  ANLQVLDLYNNNLT  501
             +L  +D   NNL+
Sbjct  573  QSLTSVDFSYNNLS  586



>ref|NP_201371.1| leucine-rich repeat receptor-like serine/threonine-protein kinase 
BAM1 [Arabidopsis thaliana]
 ref|NP_001190624.1| leucine-rich repeat receptor-like serine/threonine-protein kinase 
BAM1 [Arabidopsis thaliana]
 sp|O49545.1|BAME1_ARATH RecName: Full=Leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM1; AltName: Full=Protein BARELY ANY MERISTEM 
1; Flags: Precursor [Arabidopsis thaliana]
 emb|CAA16688.1| receptor protein kinase - like protein [Arabidopsis thaliana]
 dbj|BAB10677.1| receptor protein kinase-like protein [Arabidopsis thaliana]
 gb|AAM20665.1| receptor protein kinase-like protein [Arabidopsis thaliana]
 gb|AAP68249.1| At5g65700 [Arabidopsis thaliana]
 dbj|BAE98627.1| receptor protein kinase like protein [Arabidopsis thaliana]
 gb|ACN59407.1| leucine-rich repeat receptor-like protein kinase [Arabidopsis 
thaliana]
 gb|AED98091.1| CLAVATA1-related receptor kinase-like protein [Arabidopsis thaliana]
 gb|AED98092.1| CLAVATA1-related receptor kinase-like protein [Arabidopsis thaliana]
Length=1003

 Score =   125 bits (315),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 71/133 (53%), Positives = 90/133 (68%), Gaps = 5/133 (4%)
 Frame = +1

Query  118  VTEQAALLSIKAAFTA---DSQSSLTSWNISTSHCTWRRVTCdsllhvvsldlsgl-NLS  285
            ++E  ALLS+K + T    D  S L+SW +STS CTW  VTCD     V+       NLS
Sbjct  23   ISEFRALLSLKTSLTGAGDDKNSPLSSWKVSTSFCTWIGVTCDVSRRHVTSLDLSGLNLS  82

Query  286  GVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ-LA  462
            G LSPDV  L  L NLS+A N +SGP+PPEIS++S LR LNLSNN+F  +FP +++  L 
Sbjct  83   GTLSPDVSHLRLLQNLSLAENLISGPIPPEISSLSGLRHLNLSNNVFNGSFPDEISSGLV  142

Query  463  NLQVLDLYNNNLT  501
            NL+VLD+YNNNLT
Sbjct  143  NLRVLDVYNNNLT  155


 Score = 56.6 bits (135),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 28/73 (38%), Positives = 46/73 (63%), Gaps = 0/73 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            L+G + P++G+L  L  L +  N  SGP+  E+  +S+L+ ++LSNN+F    P   A+L
Sbjct  251  LTGEIPPEIGKLQKLDTLFLQVNVFSGPLTWELGTLSSLKSMDLSNNMFTGEIPASFAEL  310

Query  460  ANLQVLDLYNNNL  498
             NL +L+L+ N L
Sbjct  311  KNLTLLNLFRNKL  323


 Score = 50.8 bits (120),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 25/74 (34%), Positives = 44/74 (59%), Gaps = 0/74 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
             SG ++P++ +   L  + ++ N+LSG +P EI+A+  L +LNLS N    + P  ++ +
Sbjct  515  FSGRIAPEISRCKLLTFVDLSRNELSGEIPNEITAMKILNYLNLSRNHLVGSIPGSISSM  574

Query  460  ANLQVLDLYNNNLT  501
             +L  LD   NNL+
Sbjct  575  QSLTSLDFSYNNLS  588



>ref|XP_009150662.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM1 [Brassica rapa]
Length=997

 Score =   125 bits (314),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 81/131 (62%), Positives = 99/131 (76%), Gaps = 3/131 (2%)
 Frame = +1

Query  118  VTEQAALLSIKAAFTADSQSS-LTSWNISTSHCTWRRVTC-dsllhvvsldlsglNLSGV  291
            ++E  ALLS+K++ T D+ +S L SW  +TS CTW  VTC  S  HV SLDLS LNLSG 
Sbjct  23   ISEFRALLSLKSSLTGDAPNSPLASWKPTTSFCTWTGVTCDVSRRHVTSLDLSSLNLSGT  82

Query  292  LSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQL-AQLANL  468
            LSPDV  LP L NLS+A NQ+SGP+PPEIS +S LR LNLSNNIF  +FP ++ A LANL
Sbjct  83   LSPDVSHLPLLQNLSLADNQISGPIPPEISNLSGLRHLNLSNNIFNGSFPGEISAGLANL  142

Query  469  QVLDLYNNNLT  501
            +VLD+YNNN+T
Sbjct  143  RVLDVYNNNMT  153


 Score = 54.3 bits (129),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 27/73 (37%), Positives = 45/73 (62%), Gaps = 0/73 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            L+G + P++G+L  L  L +  N  SGP+  E+  +S+L+ ++LSNN+F    P   + L
Sbjct  249  LNGEIPPEIGRLQKLDTLFLQVNVFSGPLTWELGKLSSLKSMDLSNNMFTGEIPASFSDL  308

Query  460  ANLQVLDLYNNNL  498
             NL +L+L+ N L
Sbjct  309  KNLTLLNLFRNKL  321


 Score = 50.4 bits (119),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 24/74 (32%), Positives = 43/74 (58%), Gaps = 0/74 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
             SG ++P++ +   L  + ++ N+LSG +P EI+ +  L +LNLS N    + P  ++ +
Sbjct  513  FSGGIAPEISRCKLLTFVDLSRNELSGEIPKEITGMKILNYLNLSRNHLIGSIPGSISSM  572

Query  460  ANLQVLDLYNNNLT  501
             +L  LD   NNL+
Sbjct  573  QSLTSLDFSYNNLS  586



>ref|XP_007155783.1| hypothetical protein PHAVU_003G231400g [Phaseolus vulgaris]
 gb|ESW27777.1| hypothetical protein PHAVU_003G231400g [Phaseolus vulgaris]
Length=1018

 Score =   125 bits (313),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 72/129 (56%), Positives = 95/129 (74%), Gaps = 1/129 (1%)
 Frame = +1

Query  118  VTEQAALLSIKAA-FTADSQSSLTSWNISTSHCTWRRVTCdsllhvvsldlsglNLSGVL  294
            ++E  ALLS KA+  T D  ++L+SWN ST++C+W  +TCDS LHV +L+L+  +LSG L
Sbjct  26   ISEYRALLSFKASSITDDPTNALSSWNSSTTYCSWLGITCDSRLHVTTLNLTSSSLSGTL  85

Query  295  SPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLANLQV  474
               +  LPFL  LS+A NQ SGP+P   S++S LR LNLSNN F +TFP  L++LANLQV
Sbjct  86   YDHLSHLPFLSYLSLADNQFSGPIPASFSSLSALRHLNLSNNAFNATFPSNLSRLANLQV  145

Query  475  LDLYNNNLT  501
            LDLYNNN+T
Sbjct  146  LDLYNNNMT  154


 Score = 51.2 bits (121),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 27/73 (37%), Positives = 43/73 (59%), Gaps = 0/73 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            LSG +  D+G+L  +  L +  N LSG + PE+  + +L+ ++LSNNI     P    +L
Sbjct  250  LSGEIPADLGRLQNMDTLFLQVNALSGSLTPELGNLKSLKSMDLSNNILSGEVPASFTEL  309

Query  460  ANLQVLDLYNNNL  498
             NL +L+L+ N L
Sbjct  310  KNLTLLNLFRNKL  322


 Score = 50.4 bits (119),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 28/74 (38%), Positives = 41/74 (55%), Gaps = 0/74 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            LSG L+P++G L  L ++ ++ N LSG VP   + +  L  LNL  N      P  + +L
Sbjct  274  LSGSLTPELGNLKSLKSMDLSNNILSGEVPASFTELKNLTLLNLFRNKLHGAIPEFVGEL  333

Query  460  ANLQVLDLYNNNLT  501
              L+VL L+ NN T
Sbjct  334  PALEVLQLWENNFT  347


 Score = 49.3 bits (116),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 24/74 (32%), Positives = 44/74 (59%), Gaps = 0/74 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
             SG ++P++ +   L  + ++ N+LSG +P +I+A+  L +LNLS N    + P  +A +
Sbjct  514  FSGPIAPEISRCKLLTFIDLSRNELSGEIPNQITAMRILNYLNLSRNHLVGSIPGSIASM  573

Query  460  ANLQVLDLYNNNLT  501
             +L  +D   NNL+
Sbjct  574  QSLTSVDFSYNNLS  587



>ref|XP_006279943.1| hypothetical protein CARUB_v10025808mg [Capsella rubella]
 gb|EOA12841.1| hypothetical protein CARUB_v10025808mg [Capsella rubella]
Length=1004

 Score =   125 bits (313),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 72/134 (54%), Positives = 90/134 (67%), Gaps = 6/134 (4%)
 Frame = +1

Query  118  VTEQAALLSIKAAFTA----DSQSSLTSWNISTSHCTWRRVTCdsllhvvsldlsgl-NL  282
            ++E  ALLS+K++ T     D  S L+SW +STS CTW  VTCD     V+       NL
Sbjct  23   ISEFRALLSLKSSLTGAGSDDKNSPLSSWKVSTSFCTWVGVTCDVSRRHVTSLDLSGLNL  82

Query  283  SGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ-L  459
            SG LSPDV  L  L NLS+A NQ+SGP+P EIS +S LR LNLSNN+F  +FP +L+  L
Sbjct  83   SGTLSPDVSHLRLLQNLSLAENQISGPIPTEISNLSGLRHLNLSNNVFNGSFPDELSYGL  142

Query  460  ANLQVLDLYNNNLT  501
             NL+VLD+YNNNLT
Sbjct  143  VNLRVLDVYNNNLT  156


 Score = 56.6 bits (135),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 28/73 (38%), Positives = 46/73 (63%), Gaps = 0/73 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            L+G + P++G+L  L  L +  N  SGP+  E+  +S+L+ ++LSNN+F    P   A+L
Sbjct  252  LTGEIPPEIGKLQKLDTLFLQVNVFSGPLTWELGTLSSLKSMDLSNNMFTGEIPASFAEL  311

Query  460  ANLQVLDLYNNNL  498
             NL +L+L+ N L
Sbjct  312  KNLTLLNLFRNKL  324


 Score = 49.7 bits (117),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 24/74 (32%), Positives = 43/74 (58%), Gaps = 0/74 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
             SG ++P++ +   L  + ++ N+LSG +P EI+ +  L +LNLS N    + P  ++ +
Sbjct  516  FSGRIAPEISRCKLLTFVDLSRNELSGEIPNEITGMKILNYLNLSRNHLVGSIPGSISSM  575

Query  460  ANLQVLDLYNNNLT  501
             +L  LD   NNL+
Sbjct  576  QSLTSLDFSYNNLS  589



>ref|XP_010547579.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM1 [Tarenaya hassleriana]
Length=1015

 Score =   124 bits (310),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 71/139 (51%), Positives = 94/139 (68%), Gaps = 8/139 (6%)
 Frame = +1

Query  103  GKPLGVTEQAALLSIKAAFTA----DSQSSLTSWNISTSHCTWRRVTCdsllhvvsldls  270
            G+P  ++E  ALLSIK++ +      + S L +WN ST+ C W  VTCD+    V     
Sbjct  22   GRP--ISEFRALLSIKSSLSGAGDGPNSSPLATWNDSTTFCAWTGVTCDASGRHVISLDL  79

Query  271  gl-NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQ  447
               NLSG LSPD+  L  L NLS+A+NQ+SGP+PPE+S++S LR+LNLSNN+F  +FP +
Sbjct  80   SGLNLSGTLSPDIAHLFLLQNLSVASNQISGPIPPEVSSLSGLRYLNLSNNVFNGSFPDE  139

Query  448  L-AQLANLQVLDLYNNNLT  501
            L A   NL+VLDLYNNNLT
Sbjct  140  LSAGAVNLRVLDLYNNNLT  158


 Score = 60.8 bits (146),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 31/73 (42%), Positives = 47/73 (64%), Gaps = 0/73 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            L+G + P+VG+L  L  L +  N LSGP+  E+  +S+L+ ++LSNN+F    P   AQL
Sbjct  254  LTGKIPPEVGKLQKLDTLFLQVNALSGPLTTELGTLSSLKSMDLSNNMFTGEIPASFAQL  313

Query  460  ANLQVLDLYNNNL  498
             NL +L+L+ N L
Sbjct  314  KNLTLLNLFRNKL  326


 Score = 50.8 bits (120),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 26/74 (35%), Positives = 43/74 (58%), Gaps = 0/74 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            LSG ++P++ Q   L  + ++ N+LSG +P EI+ +  L +LNLS N      P  +A +
Sbjct  518  LSGRIAPEISQCKLLTFVDLSRNELSGEIPNEITGMRILNYLNLSRNHLVGPIPASVASM  577

Query  460  ANLQVLDLYNNNLT  501
             +L  +D   NNL+
Sbjct  578  QSLTSVDFSYNNLS  591


 Score = 49.3 bits (116),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 27/75 (36%), Positives = 41/75 (55%), Gaps = 0/75 (0%)
 Frame = +1

Query  277  NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  456
              +G + P VG+L  L  + I+ NQLSG + PEIS    L F++LS N      P+++  
Sbjct  493  KFTGPIPPQVGKLQQLSKMDISHNQLSGRIAPEISQCKLLTFVDLSRNELSGEIPNEITG  552

Query  457  LANLQVLDLYNNNLT  501
            +  L  L+L  N+L 
Sbjct  553  MRILNYLNLSRNHLV  567



>ref|XP_002531999.1| Receptor protein kinase CLAVATA1 precursor, putative [Ricinus 
communis]
 gb|EEF30398.1| Receptor protein kinase CLAVATA1 precursor, putative [Ricinus 
communis]
Length=1021

 Score =   123 bits (308),  Expect = 8e-29, Method: Compositional matrix adjust.
 Identities = 78/131 (60%), Positives = 98/131 (75%), Gaps = 4/131 (3%)
 Frame = +1

Query  118  VTEQAALLSIKAAFTADSQSSLTSWNISTSH--CTWRRVTCdsl-lhvvsldlsglNLSG  288
            ++E  ALLS+K+A   D Q +L SWN +  +  CTW  VTCD    H+ SLDLS LNLSG
Sbjct  25   ISEYQALLSLKSAID-DPQGALASWNSTNKNNLCTWSFVTCDYNNRHITSLDLSSLNLSG  83

Query  289  VLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLANL  468
             LSPD+  L +L NL++AANQ+SGP+P ++SAIS LR LNLSNN+F  +FP QL+QL NL
Sbjct  84   TLSPDIAHLRYLQNLTLAANQISGPIPIQLSAISGLRCLNLSNNVFNGSFPTQLSQLKNL  143

Query  469  QVLDLYNNNLT  501
            QVLDLYNNN+T
Sbjct  144  QVLDLYNNNMT  154


 Score = 52.4 bits (124),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 26/74 (35%), Positives = 43/74 (58%), Gaps = 0/74 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
             SG ++P++ Q   L  + ++ N+LSG +P EI+ +  L +LNLS N    + P  +A +
Sbjct  515  FSGPIAPEISQCKLLTFVDLSRNELSGAIPTEITGMRILNYLNLSRNHLVGSIPASIATM  574

Query  460  ANLQVLDLYNNNLT  501
             +L  +D   NNLT
Sbjct  575  QSLTSVDFSYNNLT  588


 Score = 50.4 bits (119),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 27/73 (37%), Positives = 44/73 (60%), Gaps = 0/73 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            LSG +  ++G+L  L  L +  N LSG +  E+  + +L+ ++LSNN+     P   AQL
Sbjct  250  LSGEIPKEIGKLQKLDTLFLQVNGLSGSLIEELGNLKSLKSMDLSNNMLSGEIPTSFAQL  309

Query  460  ANLQVLDLYNNNL  498
            +NL +L+L+ N L
Sbjct  310  SNLTLLNLFRNKL  322


 Score = 49.3 bits (116),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 25/74 (34%), Positives = 40/74 (54%), Gaps = 0/74 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
             SG + P++G+L  L  +  + N+ SGP+ PEIS    L F++LS N      P ++  +
Sbjct  491  FSGPIPPEIGKLQQLSKVDFSHNKFSGPIAPEISQCKLLTFVDLSRNELSGAIPTEITGM  550

Query  460  ANLQVLDLYNNNLT  501
              L  L+L  N+L 
Sbjct  551  RILNYLNLSRNHLV  564



>gb|KFK28239.1| hypothetical protein AALP_AA8G490400 [Arabis alpina]
Length=1002

 Score =   122 bits (307),  Expect = 9e-29, Method: Compositional matrix adjust.
 Identities = 69/139 (50%), Positives = 93/139 (67%), Gaps = 8/139 (6%)
 Frame = +1

Query  103  GKPLGVTEQAALLSIKAAFTA----DSQSSLTSWNISTSHCTWRRVTCdsllhvvsldls  270
            GKP  ++E  ALLS+K++ T     D  S L+SW ++TS CTW  VTCD     V+    
Sbjct  20   GKP--ISEPRALLSLKSSLTVTGDDDKNSPLSSWKLTTSFCTWTGVTCDVSRRHVTSLDL  77

Query  271  gl-NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQ  447
               NL G LSP++  L  L NLS+A NQ+SG +PP+IS +S LR+LNLSNN+F  TFP +
Sbjct  78   SGLNLPGTLSPEISHLRLLQNLSLAENQISGQIPPQISNLSGLRYLNLSNNVFNGTFPDE  137

Query  448  LAQ-LANLQVLDLYNNNLT  501
            ++  L NL++LD+YNNNLT
Sbjct  138  ISSGLVNLRILDVYNNNLT  156


 Score = 53.9 bits (128),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 27/73 (37%), Positives = 46/73 (63%), Gaps = 0/73 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            L+G +  ++G+L  L  L +  N  SGP+  E+ ++S+L+ ++LSNN+F    P   A+L
Sbjct  252  LTGEIPSEIGKLKKLDTLFLQVNVFSGPLTWELGSLSSLKSMDLSNNMFTGEIPTSFAEL  311

Query  460  ANLQVLDLYNNNL  498
             NL +L+L+ N L
Sbjct  312  KNLTLLNLFRNKL  324


 Score = 48.9 bits (115),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 24/74 (32%), Positives = 41/74 (55%), Gaps = 0/74 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
             SG ++P++     L  + ++ N+LSG +P EI+ +  L +LNLS N      P  ++ +
Sbjct  516  FSGRIAPEISHCKLLTFVDLSRNELSGDIPNEITGMRILNYLNLSRNHLVGAIPSSISSM  575

Query  460  ANLQVLDLYNNNLT  501
             +L  LD   NNL+
Sbjct  576  QSLTSLDFSYNNLS  589



>ref|XP_009397330.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM1 [Musa acuminata subsp. malaccensis]
Length=1023

 Score =   122 bits (305),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 77/139 (55%), Positives = 96/139 (69%), Gaps = 4/139 (3%)
 Frame = +1

Query  85   SAGAGAGKPLGVTEQAALLSIKAAFTADSQSSLTSWNISTSHCTWRRVTCdsllhvvsld  264
            +A  GAG      E  ALLS+KA  + D  ++L  W+ +T HC+W  VTCD    VVSLD
Sbjct  20   AADDGAGY---AEEHRALLSLKAQLS-DPGAALGPWDATTDHCSWPGVTCDDAGAVVSLD  75

Query  265  lsglNLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPH  444
            LSG NLSG+L P VG+L  L+ LS AAN  SGP+P E++ +  LR LNLSNNIF  +FP 
Sbjct  76   LSGRNLSGLLPPAVGRLRSLLRLSAAANSFSGPIPSELALLPALRHLNLSNNIFNGSFPA  135

Query  445  QLAQLANLQVLDLYNNNLT  501
             LA+LA+L+VLDLYNNNLT
Sbjct  136  PLARLADLRVLDLYNNNLT  154


 Score = 55.5 bits (132),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 29/73 (40%), Positives = 44/73 (60%), Gaps = 0/73 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            LSG + P++G L  L  L +  N L G +PPE+S + +L+ ++LSNN      P   A L
Sbjct  250  LSGRIPPEMGNLRNLDTLFLQVNGLGGEIPPELSRLRSLKSMDLSNNALTGEIPPSFAAL  309

Query  460  ANLQVLDLYNNNL  498
            +NL +L+L+ N L
Sbjct  310  SNLTLLNLFRNKL  322


 Score = 50.4 bits (119),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 26/73 (36%), Positives = 42/73 (58%), Gaps = 0/73 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
             +G + P+VG+L  L  L +++N+ SGP+ PE+S    L F++LS N      P  +A +
Sbjct  492  FTGKIPPEVGRLQQLSKLDLSSNRFSGPITPEVSKCKLLTFVDLSRNELSGDVPADVAAM  551

Query  460  ANLQVLDLYNNNL  498
              L  L+L  N+L
Sbjct  552  RILNYLNLSRNHL  564


 Score = 50.1 bits (118),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 28/75 (37%), Positives = 41/75 (55%), Gaps = 1/75 (1%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLS-NNIFGSTFPHQLAQ  456
             SG + P+ G   FL  L+I+ N+L GP+PPEI  +S LR L +   N +    P ++  
Sbjct  177  FSGSIPPEYGSWQFLEYLAISGNELGGPIPPEIGNLSALRELYIGYYNSYDGGLPPEIGN  236

Query  457  LANLQVLDLYNNNLT  501
            L+ L  LD  N  L+
Sbjct  237  LSTLLRLDAANCGLS  251


 Score = 49.3 bits (116),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 29/72 (40%), Positives = 41/72 (57%), Gaps = 0/72 (0%)
 Frame = +1

Query  286  GVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLAN  465
            G L P++G L  L+ L  A   LSG +PPE+  +  L  L L  N  G   P +L++L +
Sbjct  228  GGLPPEIGNLSTLLRLDAANCGLSGRIPPEMGNLRNLDTLFLQVNGLGGEIPPELSRLRS  287

Query  466  LQVLDLYNNNLT  501
            L+ +DL NN LT
Sbjct  288  LKSMDLSNNALT  299


 Score = 48.9 bits (115),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 25/74 (34%), Positives = 41/74 (55%), Gaps = 0/74 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            L G + P++ +L  L ++ ++ N L+G +PP  +A+S L  LNL  N      P  +  L
Sbjct  274  LGGEIPPELSRLRSLKSMDLSNNALTGEIPPSFAALSNLTLLNLFRNKLFGAIPEFVGDL  333

Query  460  ANLQVLDLYNNNLT  501
              L+VL ++ NN T
Sbjct  334  PELEVLQVWENNFT  347



>ref|XP_009394785.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM1 [Musa acuminata subsp. malaccensis]
Length=1006

 Score =   117 bits (294),  Expect = 6e-27, Method: Compositional matrix adjust.
 Identities = 75/130 (58%), Positives = 95/130 (73%), Gaps = 3/130 (2%)
 Frame = +1

Query  121  TEQAALLSIKAAFTADSQSSLTSWNISTS--HCTWRRVTCd-sllhvvsldlsglNLSGV  291
            ++  ALLS+KA F+  + + L++WN S    HC+W  V+CD     VVSLDL+GLNLSG 
Sbjct  30   SDVEALLSLKADFSDATSAVLSAWNSSADDDHCSWPGVSCDPLQGFVVSLDLTGLNLSGT  89

Query  292  LSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLANLQ  471
            LSP VG+L  L+NLS A+N LSGP+P E+S +S LR LNLSNN+F  +FP  LA+L NL 
Sbjct  90   LSPAVGRLRHLLNLSAASNSLSGPIPAELSRLSDLRHLNLSNNLFNGSFPSALARLKNLL  149

Query  472  VLDLYNNNLT  501
            VLDLYNNNLT
Sbjct  150  VLDLYNNNLT  159


 Score = 54.7 bits (130),  Expect = 9e-06, Method: Compositional matrix adjust.
 Identities = 26/74 (35%), Positives = 43/74 (58%), Gaps = 0/74 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
             SG++SP++ Q   L  + ++ N+LSG +P EI+ +  L +LNLS N      P  +A +
Sbjct  521  FSGLISPEISQCKLLTFVDLSRNELSGEIPSEITGMRILNYLNLSRNQLEGNIPSSIATM  580

Query  460  ANLQVLDLYNNNLT  501
             +L  +D   NNL+
Sbjct  581  QSLTAIDFSYNNLS  594


 Score = 52.8 bits (125),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 27/73 (37%), Positives = 42/73 (58%), Gaps = 0/73 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            LSG + P++G L  L  + +  N L+G +PPE+  +  L+ ++LSNN      P   A L
Sbjct  255  LSGEIPPELGNLQNLDTIFLQVNGLTGDLPPEMGRLRNLKSMDLSNNALAGEIPATFADL  314

Query  460  ANLQVLDLYNNNL  498
             NL +L+L+ N L
Sbjct  315  QNLTLLNLFRNKL  327


 Score = 48.9 bits (115),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 26/74 (35%), Positives = 42/74 (57%), Gaps = 0/74 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            L+G L P++G+L  L ++ ++ N L+G +P   + +  L  LNL  N    + P  +A L
Sbjct  279  LTGDLPPEMGRLRNLKSMDLSNNALAGEIPATFADLQNLTLLNLFRNKLHGSIPEFIADL  338

Query  460  ANLQVLDLYNNNLT  501
              L+VL L+ NN T
Sbjct  339  PTLEVLQLWENNFT  352



>ref|XP_008787359.1| PREDICTED: LOW QUALITY PROTEIN: leucine-rich repeat receptor-like 
serine/threonine-protein kinase BAM1, partial [Phoenix 
dactylifera]
Length=1004

 Score =   116 bits (290),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 74/140 (53%), Positives = 93/140 (66%), Gaps = 5/140 (4%)
 Frame = +1

Query  85   SAGAGAGKPLGVTEQAALLSIKAAFTADSQSSLTSWNISTSHC-TWRRVTCdsllhvvsl  261
            +A +G G+   V E  ALL +KAA   D   +L  W+ +  HC  W  V CD+   VVSL
Sbjct  19   AAASGRGR---VVEHRALLDLKAAL-GDPSGALAGWDATADHCQAWSGVACDAAGRVVSL  74

Query  262  dlsglNLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFP  441
            ++S LNLSG L   V +L  L++LS AAN+LSGP+PPE+S +S LRFLNLSNN F  T P
Sbjct  75   NISXLNLSGPLPRAVSRLRSLLHLSAAANELSGPIPPELSLLSGLRFLNLSNNAFNRTLP  134

Query  442  HQLAQLANLQVLDLYNNNLT  501
              L++L NL VLDLYNNNLT
Sbjct  135  SALSRLKNLHVLDLYNNNLT  154


 Score = 57.4 bits (137),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 28/73 (38%), Positives = 44/73 (60%), Gaps = 0/73 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            LSG + P++G L  L  L +  N LSG + PE+  + +L+ ++LSNN+     P   A+L
Sbjct  250  LSGEIPPEIGNLQNLDTLFLQVNGLSGEITPELGKLRSLKSMDLSNNVLTGEIPRTFAEL  309

Query  460  ANLQVLDLYNNNL  498
             NL +L+L+ N L
Sbjct  310  KNLTLLNLFRNKL  322


 Score = 53.1 bits (126),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 26/73 (36%), Positives = 41/73 (56%), Gaps = 0/73 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
             SG + P++G+L  L  +  + N+ SGP+ PEIS    L F++LS N F    P ++  +
Sbjct  492  FSGRIPPEIGRLQQLSKMDFSGNRFSGPITPEISKCKLLTFVDLSRNNFSGEIPAEITGM  551

Query  460  ANLQVLDLYNNNL  498
              L  L+L  N+L
Sbjct  552  RILNYLNLSRNHL  564


 Score = 48.5 bits (114),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 25/74 (34%), Positives = 41/74 (55%), Gaps = 0/74 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            LSG ++P++G+L  L ++ ++ N L+G +P   + +  L  LNL  N      P  +  L
Sbjct  274  LSGEITPELGKLRSLKSMDLSNNVLTGEIPRTFAELKNLTLLNLFRNKLHGAIPDLIGDL  333

Query  460  ANLQVLDLYNNNLT  501
              L+VL L+ NN T
Sbjct  334  PRLEVLQLWENNFT  347



>ref|XP_009408581.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM1 [Musa acuminata subsp. malaccensis]
Length=1016

 Score =   116 bits (290),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 66/126 (52%), Positives = 83/126 (66%), Gaps = 2/126 (2%)
 Frame = +1

Query  124  EQAALLSIKAAFTADSQSSLTSWNISTSHCTWRRVTCdsllhvvsldlsglNLSGVLSPD  303
            E  ALLSIK+  + D  ++LT+W+ +T HC W  VTCD    V        NLSG LSP 
Sbjct  30   EHHALLSIKSQLS-DPGAALTAWDPATDHCAWPGVTCDRAAVVELDLSGR-NLSGPLSPA  87

Query  304  VGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLANLQVLDL  483
             G L  L+ LS A N LSGP+PP ++ ++ LR LNLSNN+F  +FP  LA LA+L+VLDL
Sbjct  88   FGSLRSLLRLSAAENSLSGPIPPALALLTVLRHLNLSNNLFDGSFPPALAGLADLRVLDL  147

Query  484  YNNNLT  501
            YNNNLT
Sbjct  148  YNNNLT  153


 Score = 52.0 bits (123),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 27/73 (37%), Positives = 42/73 (58%), Gaps = 0/73 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            LSG + P++G L  L +L +  N L G +P E+  + +L+ ++LSNN      P   A L
Sbjct  249  LSGRIPPEIGNLRILDSLFLQVNGLVGEIPLELGRLRSLKSMDLSNNALTGEIPPSFADL  308

Query  460  ANLQVLDLYNNNL  498
             NL +L+L+ N L
Sbjct  309  GNLTLLNLFRNKL  321


 Score = 51.6 bits (122),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 26/74 (35%), Positives = 42/74 (57%), Gaps = 0/74 (0%)
 Frame = +1

Query  277  NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  456
            + +G + P+VG+L  L  L  + N+ +GP+ PEIS    L F++LS N      P ++A 
Sbjct  490  SFTGGIPPEVGRLQQLSKLDFSGNRFAGPITPEISKCKLLTFVDLSRNELSGDIPEEIAA  549

Query  457  LANLQVLDLYNNNL  498
            +  L  L+L  N+L
Sbjct  550  MRILNYLNLSRNHL  563



>gb|AES94465.2| LRR receptor-like kinase family protein [Medicago truncatula]
Length=1014

 Score =   115 bits (287),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 69/128 (54%), Positives = 97/128 (76%), Gaps = 0/128 (0%)
 Frame = +1

Query  118  VTEQAALLSIKAAFTADSQSSLTSWNISTSHCTWRRVTCdsllhvvsldlsglNLSGVLS  297
            ++E  ALLS + + T  +  SL+SWN +T+HCTW  VTC++  HV +++L+GL+LSG LS
Sbjct  25   ISEYRALLSFRQSITDSTPPSLSSWNTNTTHCTWFGVTCNTRRHVTAVNLTGLDLSGTLS  84

Query  298  PDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLANLQVL  477
             ++  LPFL NLS+A N+ SG +PP +SA++ LR LNLSNN+F  TFP +L+ L NL+VL
Sbjct  85   DELSHLPFLTNLSLADNKFSGQIPPSLSAVTNLRLLNLSNNVFNGTFPSELSLLKNLEVL  144

Query  478  DLYNNNLT  501
            DLYNNN+T
Sbjct  145  DLYNNNMT  152



>ref|XP_003611507.1| Receptor-like protein kinase [Medicago truncatula]
Length=1109

 Score =   115 bits (288),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 69/128 (54%), Positives = 97/128 (76%), Gaps = 0/128 (0%)
 Frame = +1

Query  118  VTEQAALLSIKAAFTADSQSSLTSWNISTSHCTWRRVTCdsllhvvsldlsglNLSGVLS  297
            ++E  ALLS + + T  +  SL+SWN +T+HCTW  VTC++  HV +++L+GL+LSG LS
Sbjct  25   ISEYRALLSFRQSITDSTPPSLSSWNTNTTHCTWFGVTCNTRRHVTAVNLTGLDLSGTLS  84

Query  298  PDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLANLQVL  477
             ++  LPFL NLS+A N+ SG +PP +SA++ LR LNLSNN+F  TFP +L+ L NL+VL
Sbjct  85   DELSHLPFLTNLSLADNKFSGQIPPSLSAVTNLRLLNLSNNVFNGTFPSELSLLKNLEVL  144

Query  478  DLYNNNLT  501
            DLYNNN+T
Sbjct  145  DLYNNNMT  152



>ref|XP_010941985.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM1 [Elaeis guineensis]
Length=1024

 Score =   115 bits (287),  Expect = 5e-26, Method: Compositional matrix adjust.
 Identities = 79/142 (56%), Positives = 94/142 (66%), Gaps = 4/142 (3%)
 Frame = +1

Query  79   RHSAGAGAGKPLGVTEQAALLSIKAAFTADSQSSLTSWNISTSHC-TWRRVTCdsllhvv  255
            R SA A  G  +G  E  ALL +KAA   D   +L  W+ +  HC  W  V CD+   VV
Sbjct  16   RPSAAASGGGRVG--EHRALLDLKAAL-GDPSGALAGWDAAADHCQAWVGVACDAAGRVV  72

Query  256  sldlsglNLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGST  435
            SL++S LNLSG L P V +L  L+ LS AANQLSGP+PPE+S +S LRFLNLSNN F  T
Sbjct  73   SLNISNLNLSGPLPPAVSRLRSLLRLSTAANQLSGPIPPELSLLSGLRFLNLSNNAFNET  132

Query  436  FPHQLAQLANLQVLDLYNNNLT  501
            FP  L++L NL VLDLYNNNLT
Sbjct  133  FPSALSRLKNLHVLDLYNNNLT  154


 Score = 54.7 bits (130),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 28/73 (38%), Positives = 43/73 (59%), Gaps = 0/73 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            LSG + P++G L  L  L +  N LSG + PE+  + +L+ ++LSNN      P   A+L
Sbjct  250  LSGKIPPEIGNLQNLDTLFLQVNGLSGGITPELGMLRSLKSMDLSNNALTGEIPRTFAEL  309

Query  460  ANLQVLDLYNNNL  498
             NL +L+L+ N L
Sbjct  310  KNLTLLNLFRNRL  322



>ref|XP_010939309.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM1 [Elaeis guineensis]
Length=1020

 Score =   114 bits (284),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 72/142 (51%), Positives = 89/142 (63%), Gaps = 7/142 (5%)
 Frame = +1

Query  94   AGAGKPLG---VTEQAALLSIKAAFTADSQSSLTSWNISTS--HCTWRRVTCdsllhvvs  258
            AGA  P G     +QA LLS+K+A + D  ++L  WN + +  HC W  V CD+ L  V 
Sbjct  25   AGAPPPDGEASADDQATLLSLKSALS-DPGAALAGWNATAAPDHCAWHGVACDATLRRVV  83

Query  259  ldlsgl-NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGST  435
                   NLSG L   VG L  L+NLS A N LSGP+PPE+S +S LR LNLSNN+F  +
Sbjct  84   SLDLSGLNLSGSLPTAVGHLRHLLNLSAATNFLSGPIPPELSFLSDLRHLNLSNNLFNGS  143

Query  436  FPHQLAQLANLQVLDLYNNNLT  501
            FP  L +L NL+VLDLYNNNLT
Sbjct  144  FPSALRRLKNLEVLDLYNNNLT  165


 Score = 54.7 bits (130),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 29/73 (40%), Positives = 44/73 (60%), Gaps = 0/73 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            LSG + P++G+L  L  L +  N L+G +PPE+  + +L+ L+LSNN      P   A L
Sbjct  261  LSGSIPPELGRLENLDTLFLQVNGLAGELPPELGRLRSLKSLDLSNNALTGEIPPSFADL  320

Query  460  ANLQVLDLYNNNL  498
             NL +L+L+ N L
Sbjct  321  WNLTLLNLFRNKL  333


 Score = 52.8 bits (125),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 28/74 (38%), Positives = 43/74 (58%), Gaps = 0/74 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            L+G L P++G+L  L +L ++ N L+G +PP  + +  L  LNL  N    T P  +  L
Sbjct  285  LAGELPPELGRLRSLKSLDLSNNALTGEIPPSFADLWNLTLLNLFRNKLDGTVPDFIGDL  344

Query  460  ANLQVLDLYNNNLT  501
              L+VL L++NN T
Sbjct  345  PELEVLQLWDNNFT  358


 Score = 49.7 bits (117),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 24/74 (32%), Positives = 42/74 (57%), Gaps = 0/74 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
             SG ++P++ +   L  + ++ N LSG +P EI+ I  L +LN+S N    + P  +A +
Sbjct  527  FSGEIAPEISKCKLLTFVDLSRNNLSGEIPAEIAGIRILNYLNVSRNHLEGSIPPSIATM  586

Query  460  ANLQVLDLYNNNLT  501
             +L  +D   NNL+
Sbjct  587  QSLTAVDFSYNNLS  600



>ref|XP_006852730.1| hypothetical protein AMTR_s00033p00083200 [Amborella trichopoda]
 gb|ERN14197.1| hypothetical protein AMTR_s00033p00083200 [Amborella trichopoda]
Length=1017

 Score =   113 bits (282),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 70/127 (55%), Positives = 90/127 (71%), Gaps = 2/127 (2%)
 Frame = +1

Query  124  EQAALLSIKAAFTADSQSSLTSWNISTSHCTWRRVTCdsll-hvvsldlsglNLSGVLSP  300
            E   LLS+KAA   D  +SL SWN ST +C+W  V CD+   HVVSLDLS  NL+G L+P
Sbjct  28   EYRYLLSLKAAII-DPDNSLQSWNSSTDYCSWSGVACDASSNHVVSLDLSARNLNGTLAP  86

Query  301  DVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLANLQVLD  480
            ++G+L  LVN+++A NQ +G +P EIS I+ L+ LNLSNN F + FP   + L NL+VLD
Sbjct  87   EIGRLRSLVNITVAENQFAGGIPLEISQINGLKLLNLSNNYFSANFPANFSGLKNLEVLD  146

Query  481  LYNNNLT  501
            LYNNNLT
Sbjct  147  LYNNNLT  153


 Score = 55.5 bits (132),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 27/73 (37%), Positives = 46/73 (63%), Gaps = 0/73 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            LSG + P+  +L  L  L +  N LSGP+ PE+ ++ +L+ ++LSNN+     P + ++L
Sbjct  249  LSGSIPPEFRKLQKLDTLFLQVNGLSGPITPELGSLKSLKSMDLSNNMLDGQIPVEFSEL  308

Query  460  ANLQVLDLYNNNL  498
             NL +L+L+ N L
Sbjct  309  KNLTLLNLFRNRL  321


 Score = 52.0 bits (123),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 28/74 (38%), Positives = 41/74 (55%), Gaps = 0/74 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            LSG ++P++G L  L ++ ++ N L G +P E S +  L  LNL  N    + P  +  L
Sbjct  273  LSGPITPELGSLKSLKSMDLSNNMLDGQIPVEFSELKNLTLLNLFRNRLHGSIPGFIGDL  332

Query  460  ANLQVLDLYNNNLT  501
              LQVL L+ NN T
Sbjct  333  PELQVLQLWENNFT  346



>ref|XP_010518800.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM1 [Tarenaya hassleriana]
Length=1011

 Score =   112 bits (281),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 62/115 (54%), Positives = 77/115 (67%), Gaps = 2/115 (2%)
 Frame = +1

Query  163  ADSQSSLTSWNISTSHCTWRRVTCdsllhvvsldlsgl-NLSGVLSPDVGQLPFLVNLSI  339
            A   S+L +W  STS C W  VTCD+    V        NLSG LS D+  L  L N S+
Sbjct  40   AGDDSALATWTDSTSFCGWAGVTCDASRRHVISLDLSGLNLSGTLSSDIAHLRLLQNFSV  99

Query  340  AANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQL-AQLANLQVLDLYNNNLT  501
            +ANQ+SGP+PPEIS++  LR+LNLSNN+F  +FP +L A L NL+VLDLYNNNLT
Sbjct  100  SANQISGPIPPEISSLFGLRYLNLSNNVFNGSFPDELSAGLVNLRVLDLYNNNLT  154


 Score = 60.1 bits (144),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 30/73 (41%), Positives = 45/73 (62%), Gaps = 0/73 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            L+G + P++G+L  L  L +  N LSGP+ PE+  +  L  ++LSNN+F    P   AQL
Sbjct  250  LTGQIPPEIGKLQKLDTLFLQVNGLSGPLTPELGTLPILESMDLSNNMFVGEIPASFAQL  309

Query  460  ANLQVLDLYNNNL  498
             NL +L+L+ N L
Sbjct  310  KNLTLLNLFRNKL  322


 Score = 52.0 bits (123),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 26/74 (35%), Positives = 39/74 (53%), Gaps = 0/74 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            LSG L+P++G LP L ++ ++ N   G +P   + +  L  LNL  N      P  +  L
Sbjct  274  LSGPLTPELGTLPILESMDLSNNMFVGEIPASFAQLKNLTLLNLFRNKLHGAIPEFIGDL  333

Query  460  ANLQVLDLYNNNLT  501
              L+VL L+ NN T
Sbjct  334  PELEVLQLWENNFT  347



>ref|XP_009394620.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM1 [Musa acuminata subsp. malaccensis]
Length=1003

 Score =   112 bits (281),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 74/130 (57%), Positives = 93/130 (72%), Gaps = 4/130 (3%)
 Frame = +1

Query  121  TEQAALLSIKAAFTADSQSSLTSWNIS--TSHCTWRRVTCd-sllhvvsldlsglNLSGV  291
            TE  ALL +KAA  +D  ++L++WN S    HC+W  V CD     VVSLDLSGLNLSG 
Sbjct  29   TEVEALLELKAA-VSDPSAALSAWNSSDGVDHCSWPGVACDPLRGSVVSLDLSGLNLSGT  87

Query  292  LSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLANLQ  471
            LSP VG+L  L+NLS+A+N LSGP+P ++S ++ LR LNLS+N+   +FP  LA L NL 
Sbjct  88   LSPAVGRLRHLLNLSVASNSLSGPIPADLSRLADLRHLNLSDNLLNGSFPSALAHLKNLL  147

Query  472  VLDLYNNNLT  501
            VLDLYNNNLT
Sbjct  148  VLDLYNNNLT  157


 Score = 53.5 bits (127),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 24/74 (32%), Positives = 44/74 (59%), Gaps = 0/74 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
             SG ++P++ +   L  + ++ N++SG +PP+I+ +  L +LNLS N    + P  LA +
Sbjct  519  FSGPIAPEISRCKLLAFVDLSRNEISGEIPPDIAGMRILNYLNLSRNHLEGSIPQSLATI  578

Query  460  ANLQVLDLYNNNLT  501
             +L  +D   NNL+
Sbjct  579  QSLTAVDFSYNNLS  592


 Score = 51.2 bits (121),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 27/73 (37%), Positives = 40/73 (55%), Gaps = 0/73 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
             SG + P+ G+L  L  L ++ N+ SGP+ PEIS    L F++LS N      P  +A +
Sbjct  495  FSGRIPPETGRLQELCKLDLSGNRFSGPIAPEISRCKLLAFVDLSRNEISGEIPPDIAGM  554

Query  460  ANLQVLDLYNNNL  498
              L  L+L  N+L
Sbjct  555  RILNYLNLSRNHL  567



>ref|XP_010675918.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM1 [Beta vulgaris subsp. vulgaris]
Length=940

 Score =   112 bits (280),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 62/129 (48%), Positives = 85/129 (66%), Gaps = 2/129 (2%)
 Frame = +1

Query  118  VTEQAALLSIKAAFTADSQSSLTSWNISTSHCTWRRVTCdsllhvvsldlsg-lNLSGVL  294
            ++E+ ALLSIK+A T D Q+ L+SWN +T HC+W  +TC SL   V       L L+G+L
Sbjct  51   LSEEKALLSIKSAITDDPQNYLSSWNTTTHHCSWPFITCSSLSSSVISLDISGLELTGIL  110

Query  295  SPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLANLQV  474
            SPD+G L  L NL+IA N  S P+PP +S ++ LR+LNLS N F +TFP   + L  L +
Sbjct  111  SPDIGSLTHLQNLNIAENSFSDPIPPSLSLLTQLRYLNLSYNDF-TTFPSTFSSLKKLTI  169

Query  475  LDLYNNNLT  501
            LD+ +NN T
Sbjct  170  LDILSNNFT  178



>ref|XP_009136515.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM2 [Brassica rapa]
Length=993

 Score =   110 bits (275),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 64/112 (57%), Positives = 78/112 (70%), Gaps = 2/112 (2%)
 Frame = +1

Query  172  QSSLTSWNISTSHCTWRRVTCdsllhvvsldlsg-lNLSGVLSPDVGQLPFLVNLSIAAN  348
             S L SW++STS C W  VTCD+ L  V       LNLSG L   V  LP L NLS+AAN
Sbjct  45   HSPLASWDLSTSFCLWTGVTCDASLRHVISLDLSGLNLSGTLPSSVAHLPLLRNLSLAAN  104

Query  349  QLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQL-AQLANLQVLDLYNNNLT  501
            Q+SG +PPE++++S LR LNLSNN+F  +FP +L A L NL+VLDLYNNNLT
Sbjct  105  QISGHIPPEMASLSELRRLNLSNNVFNGSFPDELSAGLVNLRVLDLYNNNLT  156


 Score = 61.2 bits (147),  Expect = 8e-08, Method: Compositional matrix adjust.
 Identities = 30/73 (41%), Positives = 46/73 (63%), Gaps = 0/73 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            L G + P++G+L  L  L +  N  SG +PPE+  IS+L+ ++LSNN+F    P +  QL
Sbjct  252  LRGEIPPEIGRLRRLDTLFLQVNAFSGTLPPELGTISSLKSMDLSNNMFTGEIPPRFEQL  311

Query  460  ANLQVLDLYNNNL  498
             NL +L+L+ N L
Sbjct  312  RNLTLLNLFRNKL  324



>ref|XP_008441113.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM1, partial [Cucumis melo]
Length=977

 Score =   109 bits (272),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 73/110 (66%), Positives = 87/110 (79%), Gaps = 0/110 (0%)
 Frame = +1

Query  172  QSSLTSWNISTSHCTWRRVTCdsllhvvsldlsglNLSGVLSPDVGQLPFLVNLSIAANQ  351
            +SSL SWN STSHCTW  VTCD   HV +LDL+ L LSG LSPDV  L FL NLS+AAN+
Sbjct  2    KSSLASWNASTSHCTWFGVTCDLRRHVTALDLTALGLSGSLSPDVAFLRFLTNLSLAANE  61

Query  352  LSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLANLQVLDLYNNNLT  501
             SGP+PPE+S+IS+LR LNLSNN+F  +FP + +QL NL VLDLYNNN+T
Sbjct  62   FSGPIPPELSSISSLRLLNLSNNVFDGSFPSRFSQLQNLHVLDLYNNNMT  111


 Score = 60.5 bits (145),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 32/73 (44%), Positives = 47/73 (64%), Gaps = 0/73 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            LSG + P++G+L  L  L +  N LSGP+ PEI  +++L+ L+LSNN+     P   AQL
Sbjct  207  LSGRIPPELGKLQNLDTLFLQVNALSGPLTPEIGQLNSLKSLDLSNNMLVGEIPVSFAQL  266

Query  460  ANLQVLDLYNNNL  498
             NL +L+L+ N L
Sbjct  267  KNLTLLNLFRNKL  279


 Score = 52.4 bits (124),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 27/74 (36%), Positives = 44/74 (59%), Gaps = 0/74 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            LSG ++P++ Q   L  + ++ NQLSG +P EI+++  L +LNLS N      P  +A +
Sbjct  471  LSGPIAPEISQCKLLTFVDLSRNQLSGEIPNEITSMRILNYLNLSKNHLVGGIPATIASM  530

Query  460  ANLQVLDLYNNNLT  501
             +L  +D   NNL+
Sbjct  531  QSLTSVDFSYNNLS  544


 Score = 52.0 bits (123),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 26/75 (35%), Positives = 42/75 (56%), Gaps = 0/75 (0%)
 Frame = +1

Query  277  NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  456
              SG + P++G+L  L  +  ++N LSGP+ PEIS    L F++LS N      P+++  
Sbjct  446  KFSGQIPPEIGRLQQLSKIDFSSNMLSGPIAPEISQCKLLTFVDLSRNQLSGEIPNEITS  505

Query  457  LANLQVLDLYNNNLT  501
            +  L  L+L  N+L 
Sbjct  506  MRILNYLNLSKNHLV  520


 Score = 50.8 bits (120),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 28/74 (38%), Positives = 40/74 (54%), Gaps = 0/74 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            LSG L+P++GQL  L +L ++ N L G +P   + +  L  LNL  N      P  +  L
Sbjct  231  LSGPLTPEIGQLNSLKSLDLSNNMLVGEIPVSFAQLKNLTLLNLFRNKLHGAIPSFIGDL  290

Query  460  ANLQVLDLYNNNLT  501
              L+VL L+ NN T
Sbjct  291  PKLEVLQLWENNFT  304



>ref|XP_007156674.1| hypothetical protein PHAVU_002G007600g [Phaseolus vulgaris]
 gb|ESW28668.1| hypothetical protein PHAVU_002G007600g [Phaseolus vulgaris]
Length=1005

 Score =   108 bits (269),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 74/130 (57%), Positives = 101/130 (78%), Gaps = 0/130 (0%)
 Frame = +1

Query  112  LGVTEQAALLSIKAAFTADSQSSLTSWNISTSHCTWRRVTCdsllhvvsldlsglNLSGV  291
            L  +E  ALLS+++A T  +   L+SWN STS+C+W  VTCDS  HV++L+L+GL+LSG 
Sbjct  18   LPFSEYTALLSLRSAITDATPPVLSSWNASTSYCSWLGVTCDSHRHVIALNLTGLDLSGT  77

Query  292  LSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLANLQ  471
            LS D+  LPFL NLS+A N+ SGP+PP +S++S+LR LNLSNN F  TFP +L++L +L+
Sbjct  78   LSADIAHLPFLSNLSLATNKFSGPIPPALSSLSSLRLLNLSNNGFNQTFPPELSRLQSLE  137

Query  472  VLDLYNNNLT  501
            VLDLYNNN+T
Sbjct  138  VLDLYNNNMT  147


 Score = 52.4 bits (124),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 26/73 (36%), Positives = 45/73 (62%), Gaps = 0/73 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            LSG ++  +G+L  L  L +  N LSGP+ PE+  + +L+ ++LSNN+     P   ++L
Sbjct  243  LSGEITAALGKLQKLDTLFLQVNALSGPLTPELGNLKSLKSMDLSNNMLSGEIPATFSEL  302

Query  460  ANLQVLDLYNNNL  498
             N+ +L+L+ N L
Sbjct  303  KNITLLNLFRNKL  315


 Score = 51.2 bits (121),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 26/74 (35%), Positives = 42/74 (57%), Gaps = 0/74 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            LSG L+P++G L  L ++ ++ N LSG +P   S +  +  LNL  N      P  + +L
Sbjct  267  LSGPLTPELGNLKSLKSMDLSNNMLSGEIPATFSELKNITLLNLFRNKLHGAIPEFIGEL  326

Query  460  ANLQVLDLYNNNLT  501
             +L+V+ L+ NN T
Sbjct  327  PSLEVVQLWENNFT  340



>ref|XP_009395647.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM1 [Musa acuminata subsp. malaccensis]
Length=1004

 Score =   107 bits (267),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 65/112 (58%), Positives = 81/112 (72%), Gaps = 1/112 (1%)
 Frame = +1

Query  166  DSQSSLTSWNISTSHCTWRRVTCd-sllhvvsldlsglNLSGVLSPDVGQLPFLVNLSIA  342
            D   +L +WN +  HC+W  V CD   + V+SLDL+GLNLSG LSP VG+L  LVNLS A
Sbjct  46   DPSGALYAWNSADGHCSWPGVACDPIRVFVLSLDLTGLNLSGTLSPAVGRLHHLVNLSTA  105

Query  343  ANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLANLQVLDLYNNNL  498
            +N LSGP+P E+S +S LR LNLSNN+F  +FP   ++L NL VLDLYNNNL
Sbjct  106  SNSLSGPLPAELSHLSNLRHLNLSNNLFNGSFPSAFSRLKNLLVLDLYNNNL  157


 Score = 54.3 bits (129),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 28/73 (38%), Positives = 44/73 (60%), Gaps = 0/73 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            L+G + P++G+L  L  L +  N LSG +PPE+  + +L+ ++LSNN      P   A L
Sbjct  254  LTGDIPPELGKLQNLDTLFLQVNGLSGRLPPELGGLRSLKSMDLSNNALTGEIPGSFADL  313

Query  460  ANLQVLDLYNNNL  498
             NL +L+L+ N L
Sbjct  314  QNLTLLNLFRNKL  326


 Score = 50.8 bits (120),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 26/67 (39%), Positives = 37/67 (55%), Gaps = 0/67 (0%)
 Frame = +1

Query  277  NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  456
            NL+G L P+V +LP L++L +  N  SG +PPE      L +L +S N  G   P +L  
Sbjct  156  NLAGTLPPEVSELPNLLHLHLGGNFFSGVIPPEFGHWEFLEYLAVSGNELGGPIPPELGN  215

Query  457  LANLQVL  477
            L  L+ L
Sbjct  216  LTRLRQL  222



>ref|XP_010685023.1| PREDICTED: receptor-like protein 12 [Beta vulgaris subsp. vulgaris]
Length=762

 Score =   105 bits (263),  Expect = 5e-23, Method: Compositional matrix adjust.
 Identities = 69/142 (49%), Positives = 92/142 (65%), Gaps = 12/142 (8%)
 Frame = +1

Query  106  KPLGVTEQAALLSIKAAFTADSQSSLTSWNISTSHCTWRRVTC---------dsllhvvs  258
            KPL   EQ  LLSIK++ T D Q++L+SWN +T+HCTW  VTC          +   V+S
Sbjct  21   KPLQ-DEQKVLLSIKSSITDDPQNTLSSWNTTTNHCTWPFVTCSHHHHSPTNTTTSTVIS  79

Query  259  ldlsglNLSGVLS-PDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGST  435
            LD+S LNL+G+LS  ++  L  L  LS+A N  SG +PP +S +S LR+LNLS+NIF  T
Sbjct  80   LDISSLNLTGILSLSNISLLTNLQKLSVADNYFSGQIPPSLSLLSNLRYLNLSDNIFNGT  139

Query  436  FPHQLAQLANLQVLDLYNNNLT  501
            FP  L+    L +LD+YNN LT
Sbjct  140  FP-SLSSFKRLTILDVYNNYLT  160



>ref|XP_010936307.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM1 [Elaeis guineensis]
Length=1007

 Score =   105 bits (261),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 72/130 (55%), Positives = 92/130 (71%), Gaps = 5/130 (4%)
 Frame = +1

Query  124  EQAALLSIKAAFTADSQSSLTSWNISTS--HCTWRRVTCdsl--lhvvsldlsglNLSGV  291
            E+ ALLS+K+A + D  ++L  WN S +  HC+W  V CD      V++LDLSGLNLSG 
Sbjct  33   ERVALLSLKSALS-DPGAALAGWNASANPDHCSWPGVACDDAPLRRVIALDLSGLNLSGS  91

Query  292  LSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLANLQ  471
            L P V  L  L+NLS AAN LSGP+P ++S +S LR+LNLSNN+F  +FP  L +L NL+
Sbjct  92   LPPAVAHLRHLLNLSTAANLLSGPIPLDLSLLSDLRYLNLSNNVFNGSFPSALRRLKNLE  151

Query  472  VLDLYNNNLT  501
            VLDLYNNNLT
Sbjct  152  VLDLYNNNLT  161


 Score = 56.2 bits (134),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 29/73 (40%), Positives = 43/73 (59%), Gaps = 0/73 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            LSG + P++G L  L  L +  N LSG +PPE+  + +L+ ++LSNN      P   A L
Sbjct  257  LSGQIPPELGHLEHLDTLFLQVNGLSGELPPELGRLRSLKSMDLSNNALTGEIPPTFADL  316

Query  460  ANLQVLDLYNNNL  498
             NL +L+L+ N L
Sbjct  317  RNLTLLNLFRNKL  329


 Score = 53.5 bits (127),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 28/74 (38%), Positives = 43/74 (58%), Gaps = 0/74 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            LSG L P++G+L  L ++ ++ N L+G +PP  + +  L  LNL  N    T P  +  L
Sbjct  281  LSGELPPELGRLRSLKSMDLSNNALTGEIPPTFADLRNLTLLNLFRNKLYGTIPDFIGDL  340

Query  460  ANLQVLDLYNNNLT  501
              L+VL L++NN T
Sbjct  341  PELEVLQLWDNNFT  354


 Score = 50.1 bits (118),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 27/74 (36%), Positives = 41/74 (55%), Gaps = 0/74 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            LSG L P +G    +  L +  NQ SG +PPEI  +  L  ++ S+N F S  P ++++ 
Sbjct  475  LSGPLPPSIGNFSGVQKLLLNQNQFSGRIPPEIGRLQQLSKVDFSSNRFSSGIPPEISKC  534

Query  460  ANLQVLDLYNNNLT  501
              L  +DL  NNL+
Sbjct  535  KLLTFVDLSRNNLS  548



>ref|XP_008790445.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM1 [Phoenix dactylifera]
Length=1019

 Score =   104 bits (259),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 68/124 (55%), Positives = 86/124 (69%), Gaps = 5/124 (4%)
 Frame = +1

Query  142  SIKAAFTADSQSSLTSWNIST--SHCTWRRVTCdsl--lhvvsldlsglNLSGVLSPDVG  309
            S+K+A + D  ++L  WN S    HC+W  V CD+     V+SLDL+GLNLSG L P V 
Sbjct  42   SLKSALS-DPGAALAGWNASAYPDHCSWPGVACDNAPLRRVISLDLTGLNLSGSLPPAVA  100

Query  310  QLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLANLQVLDLYN  489
             L  L+NLS AAN LSGP+PPE+S +  LR LNLSNN+F  +FP  L +L +L+VLDLYN
Sbjct  101  HLRHLLNLSAAANLLSGPIPPELSLLFDLRHLNLSNNVFNGSFPSALRRLKHLEVLDLYN  160

Query  490  NNLT  501
            NNLT
Sbjct  161  NNLT  164


 Score = 57.4 bits (137),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 30/73 (41%), Positives = 45/73 (62%), Gaps = 0/73 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            LSG + P++G+L  L  L +  N LSG +PPE+  + +L+ ++LSNN F    P   A L
Sbjct  260  LSGEIPPELGRLENLDTLFLQVNGLSGELPPELGRLRSLKSMDLSNNAFTGEIPPTFADL  319

Query  460  ANLQVLDLYNNNL  498
             NL +L+L+ N L
Sbjct  320  RNLTLLNLFRNKL  332


 Score = 52.4 bits (124),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 27/74 (36%), Positives = 42/74 (57%), Gaps = 0/74 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            LSG L P++G+L  L ++ ++ N  +G +PP  + +  L  LNL  N    T P  +  L
Sbjct  284  LSGELPPELGRLRSLKSMDLSNNAFTGEIPPTFADLRNLTLLNLFRNKLYGTIPDFIGDL  343

Query  460  ANLQVLDLYNNNLT  501
              L+VL L++NN T
Sbjct  344  PELEVLQLWDNNFT  357



>ref|XP_003608587.1| Receptor-like protein kinase [Medicago truncatula]
 gb|AES90784.1| LRR receptor-like kinase family protein [Medicago truncatula]
Length=1005

 Score =   104 bits (259),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 69/128 (54%), Positives = 94/128 (73%), Gaps = 2/128 (2%)
 Frame = +1

Query  118  VTEQAALLSIKAAFTADSQSSLTSWNISTSHCTWRRVTCdsllhvvsldlsglNLSGVLS  297
            ++E  +LLS K++ T D Q+ LTSWN  T +C+W  + C    HV+SL+L+ L+L+G LS
Sbjct  25   ISEYHSLLSFKSSITNDPQNILTSWNPKTPYCSWYGIKCSQHRHVISLNLTSLSLTGTLS  84

Query  298  PDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLANLQVL  477
              +  LPFL NLS+A N+ SGP+P  +S++S+LRFLNLSNNIF  T P +L+ L NLQVL
Sbjct  85   --LSNLPFLTNLSLADNKFSGPIPSSLSSLSSLRFLNLSNNIFNGTLPQELSNLFNLQVL  142

Query  478  DLYNNNLT  501
            DLYNNN+T
Sbjct  143  DLYNNNMT  150


 Score = 52.4 bits (124),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 26/74 (35%), Positives = 42/74 (57%), Gaps = 0/74 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
             SG ++P++     L  + ++ N+LSG +P EI+ +  L +LNLS N    T P  +A +
Sbjct  510  FSGPIAPEISHCKLLTFVDLSRNELSGEIPKEITKMKILNYLNLSRNHLVGTIPGSIASM  569

Query  460  ANLQVLDLYNNNLT  501
             +L  +D   NNLT
Sbjct  570  QSLTSVDFSYNNLT  583


 Score = 50.1 bits (118),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 27/73 (37%), Positives = 44/73 (60%), Gaps = 0/73 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            L+G + P++G+L  L  L +  N LSG +  E+  + +L+ ++LSNN F    P   A+L
Sbjct  246  LTGEVPPELGKLQKLDTLFLQVNALSGSLTSELGNLKSLKSMDLSNNAFTGEVPVSFAEL  305

Query  460  ANLQVLDLYNNNL  498
             NL +L+L+ N L
Sbjct  306  KNLTLLNLFRNKL  318



>emb|CDY08759.1| BnaA06g24650D [Brassica napus]
Length=971

 Score =   102 bits (255),  Expect = 9e-22, Method: Compositional matrix adjust.
 Identities = 60/130 (46%), Positives = 81/130 (62%), Gaps = 27/130 (21%)
 Frame = +1

Query  118  VTEQAALLSIKAAFTADSQSS-LTSWNISTSHCTWRRVTCdsllhvvsldlsglNLSGVL  294
            ++E  ALLS+K++ T D+ +S L SW  +TS CTW  VTC                    
Sbjct  23   ISEFRALLSLKSSLTGDAPNSPLASWKPTTSFCTWTGVTC--------------------  62

Query  295  SPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ-LANLQ  471
              DV +     NLS+A NQ+SGP+PPEIS +S LR LNLSNN+F  +FP +++  LANL+
Sbjct  63   --DVSRRH---NLSLADNQISGPIPPEISNLSGLRHLNLSNNVFNGSFPDKISSGLANLR  117

Query  472  VLDLYNNNLT  501
            VLD+YNNN+T
Sbjct  118  VLDVYNNNMT  127


 Score = 54.3 bits (129),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 27/73 (37%), Positives = 45/73 (62%), Gaps = 0/73 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            L+G + P++G+L  L  L +  N  SGP+  E+  +S+L+ ++LSNN+F    P   + L
Sbjct  223  LNGEIPPEIGRLQKLDTLFLQVNVFSGPLTWELGKLSSLKSMDLSNNMFTGEIPASFSDL  282

Query  460  ANLQVLDLYNNNL  498
             NL +L+L+ N L
Sbjct  283  KNLTLLNLFRNKL  295


 Score = 50.4 bits (119),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 24/74 (32%), Positives = 43/74 (58%), Gaps = 0/74 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
             SG ++P++ +   L  + ++ N+LSG +P EI+ +  L +LNLS N    + P  ++ +
Sbjct  487  FSGGIAPEISRCKLLTFVDLSRNELSGEIPKEITGMKILNYLNLSRNHLIGSIPGSISSM  546

Query  460  ANLQVLDLYNNNLT  501
             +L  LD   NNL+
Sbjct  547  QSLTSLDFSYNNLS  560



>gb|ADB85326.1| putative receptor protein kinase [Phyllostachys edulis]
Length=265

 Score = 96.7 bits (239),  Expect = 6e-21, Method: Compositional matrix adjust.
 Identities = 59/114 (52%), Positives = 76/114 (67%), Gaps = 1/114 (1%)
 Frame = +1

Query  163  ADSQSSLTSW-NISTSHCTWRRVTCdsllhvvsldlsglNLSGVLSPDVGQLPFLVNLSI  339
            +D   +L SW N + SHC W  VTC +   VV LD++GLNLSG L P + +L  L  LS+
Sbjct  36   SDPTGALASWANGTASHCAWAGVTCSTRGTVVGLDVAGLNLSGALPPALSRLRGLFRLSV  95

Query  340  AANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLANLQVLDLYNNNLT  501
            AAN  SGP+P  ++ +  L  LNLSNN F  +FP  LA+L +L+VLDLYNNNLT
Sbjct  96   AANAFSGPIPASLARLQFLVHLNLSNNAFDGSFPAPLARLRSLRVLDLYNNNLT  149



>ref|XP_009396449.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM1 [Musa acuminata subsp. malaccensis]
Length=1006

 Score = 98.2 bits (243),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 64/117 (55%), Positives = 81/117 (69%), Gaps = 3/117 (3%)
 Frame = +1

Query  160  TADSQSSLTSWNISTS--HCTWRRVTCd-sllhvvsldlsglNLSGVLSPDVGQLPFLVN  330
             +D   +L++WN S S  HC+W  V CD     VVSLDL+G NLSG LS  V +L  L+N
Sbjct  43   VSDPSDALSAWNNSASGGHCSWPGVACDPLRGFVVSLDLTGFNLSGTLSLAVVRLRHLLN  102

Query  331  LSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLANLQVLDLYNNNLT  501
            LS A+N LSGP+P E+S +S LR LNLSNN+F  +FP  + +L NL VLD+YNNNLT
Sbjct  103  LSAASNSLSGPIPAELSRLSNLRHLNLSNNLFNGSFPSAIVRLKNLLVLDIYNNNLT  159


 Score = 53.1 bits (126),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 25/74 (34%), Positives = 44/74 (59%), Gaps = 0/74 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
             SG ++P++ +   L  + ++ N+LSG +PPEI+ +  L +LNLS N    + P  +A +
Sbjct  521  FSGPIAPEISRCKLLTFVDLSRNELSGELPPEIAGMRILNYLNLSRNQLEGSIPASIATM  580

Query  460  ANLQVLDLYNNNLT  501
             +L  +D   NNL+
Sbjct  581  QSLTAVDFSYNNLS  594


 Score = 52.8 bits (125),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 29/75 (39%), Positives = 42/75 (56%), Gaps = 0/75 (0%)
 Frame = +1

Query  277  NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  456
            N  G + P++G LP LV L +A   L+G +PPE+  +  L  L L  N      P +L +
Sbjct  230  NFEGGIPPEIGGLPELVRLDMANCGLTGEIPPELGNLQNLDTLFLQVNGLSGRLPVELGR  289

Query  457  LANLQVLDLYNNNLT  501
            L +L+ +DL NN LT
Sbjct  290  LRSLKSMDLSNNALT  304


 Score = 50.8 bits (120),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 27/73 (37%), Positives = 40/73 (55%), Gaps = 0/73 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
             SG + P++G+L  L  L  + N+ SGP+ PEIS    L F++LS N      P ++A +
Sbjct  497  FSGRIPPEMGRLQQLSKLDFSGNRFSGPIAPEISRCKLLTFVDLSRNELSGELPPEIAGM  556

Query  460  ANLQVLDLYNNNL  498
              L  L+L  N L
Sbjct  557  RILNYLNLSRNQL  569


 Score = 49.3 bits (116),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 27/73 (37%), Positives = 42/73 (58%), Gaps = 0/73 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            L+G + P++G L  L  L +  N LSG +P E+  + +L+ ++LSNN      P   A L
Sbjct  255  LTGEIPPELGNLQNLDTLFLQVNGLSGRLPVELGRLRSLKSMDLSNNALTGEIPSSFADL  314

Query  460  ANLQVLDLYNNNL  498
             NL +L+L+ N L
Sbjct  315  QNLTLLNLFRNKL  327



>ref|XP_008440463.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM1 [Cucumis melo]
Length=973

 Score = 95.5 bits (236),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 66/128 (52%), Positives = 93/128 (73%), Gaps = 2/128 (2%)
 Frame = +1

Query  124  EQAALLSIKAAFTADSQSSLTSWNIST--SHCTWRRVTCdsllhvvsldlsglNLSGVLS  297
            E  ALLS+K++ + D  SSL+SWN +   +HC+W  VTCDS  HVV+LDLS L+L+  LS
Sbjct  39   ESQALLSLKSSISDDPHSSLSSWNPAAVATHCSWLGVTCDSHRHVVALDLSSLDLTATLS  98

Query  298  PDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLANLQVL  477
            P +  L FL N+S   N+ SG +PPEI+++S+L+ LNLS+N+   + P + ++L NLQVL
Sbjct  99   PHIASLRFLTNVSFGLNKFSGGIPPEIASLSSLQLLNLSSNVLNGSIPSEFSRLKNLQVL  158

Query  478  DLYNNNLT  501
            D+YNNNLT
Sbjct  159  DVYNNNLT  166



>ref|XP_008237309.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM1 [Prunus mume]
Length=968

 Score = 94.0 bits (232),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 48/75 (64%), Positives = 56/75 (75%), Gaps = 0/75 (0%)
 Frame = +1

Query  277  NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  456
            +L G LS D+  L FL N ++A NQ SGP+P EISA+S LR LNLSNNIF +TFP QL+ 
Sbjct  26   DLVGTLSSDIAHLRFLSNGTLADNQFSGPIPSEISALSGLRLLNLSNNIFNTTFPPQLSN  85

Query  457  LANLQVLDLYNNNLT  501
            L  L VLDLYNNNLT
Sbjct  86   LTRLAVLDLYNNNLT  100


 Score = 52.4 bits (124),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 26/75 (35%), Positives = 44/75 (59%), Gaps = 1/75 (1%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLS-NNIFGSTFPHQLAQ  456
             SG + P+ G+ P L  L+++ N+L G +PPEI  +++L+ L +   N++    P ++  
Sbjct  123  FSGRIPPEFGRFPLLEYLAVSGNELGGSIPPEIGNLTSLKELYIGYYNVYEGGIPPEIGN  182

Query  457  LANLQVLDLYNNNLT  501
            L+ L  LD  N NLT
Sbjct  183  LSQLVRLDAANCNLT  197


 Score = 49.3 bits (116),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 25/74 (34%), Positives = 46/74 (62%), Gaps = 0/74 (0%)
 Frame = +1

Query  277  NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  456
            NL+G +  ++G+L  +  L +  N LSG +  E+ ++ +L+ ++LSNN+F    P   ++
Sbjct  195  NLTGEVPRELGRLQNVDTLFLQVNALSGSLTAELGSLKSLKSMDLSNNMFSGEIPGSFSE  254

Query  457  LANLQVLDLYNNNL  498
            L NL +L+L+ N L
Sbjct  255  LKNLTLLNLFRNKL  268


 Score = 48.5 bits (114),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 27/74 (36%), Positives = 38/74 (51%), Gaps = 0/74 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            LSG L+ ++G L  L ++ ++ N  SG +P   S +  L  LNL  N      P  +  L
Sbjct  220  LSGSLTAELGSLKSLKSMDLSNNMFSGEIPGSFSELKNLTLLNLFRNKLHGAIPEFIGDL  279

Query  460  ANLQVLDLYNNNLT  501
              LQVL L+ NN T
Sbjct  280  PELQVLQLWENNFT  293



>ref|XP_008787754.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM1 [Phoenix dactylifera]
Length=990

 Score = 93.6 bits (231),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 59/142 (42%), Positives = 77/142 (54%), Gaps = 27/142 (19%)
 Frame = +1

Query  79   RHSAGAGAGKPLGVTEQAALLSIKAAFTADSQSSLTSWNISTSHC-TWRRVTCdsllhvv  255
            R SA A AG+   V E  ALL +KAA +     S   W+ +  HC +W  V CD+     
Sbjct  15   RPSAAADAGEVTAV-EHRALLDVKAA-SGSPSGSFAGWDATADHCRSWAGVACDAAGR--  70

Query  256  sldlsglNLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGST  435
                                  +V+L I+   LSGP+PPE+S +S LR+LNLSNN+F  T
Sbjct  71   ----------------------VVSLDISNLNLSGPIPPELSLLSGLRYLNLSNNVFNGT  108

Query  436  FPHQLAQLANLQVLDLYNNNLT  501
            FP  L+ L NL+VLD+YNNNLT
Sbjct  109  FPSALSSLKNLRVLDIYNNNLT  130


 Score = 51.6 bits (122),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 27/74 (36%), Positives = 38/74 (51%), Gaps = 0/74 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            LSG L   +G  P L  L +  NQ SG +PPEI  +  L  ++ S N F    P + ++ 
Sbjct  441  LSGALPSSIGNFPGLQKLLLGQNQFSGCIPPEIGKLQQLSKMDFSGNRFSCPIPAETSKC  500

Query  460  ANLQVLDLYNNNLT  501
              L  +DL  NNL+
Sbjct  501  KLLTFIDLSRNNLS  514


 Score = 50.8 bits (120),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 27/73 (37%), Positives = 41/73 (56%), Gaps = 0/73 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            LSG + P++G L  L  L +  N L G + PE+  + +L+ ++LSNN      P   A L
Sbjct  226  LSGEIPPEMGNLQNLDTLFLQVNGLFGEITPELGKLRSLKSMDLSNNALAGEIPPTFADL  285

Query  460  ANLQVLDLYNNNL  498
             NL +L+L+ N L
Sbjct  286  KNLTLLNLFRNKL  298


 Score = 48.9 bits (115),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 25/74 (34%), Positives = 41/74 (55%), Gaps = 0/74 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            L G ++P++G+L  L ++ ++ N L+G +PP  + +  L  LNL  N      P  +  L
Sbjct  250  LFGEITPELGKLRSLKSMDLSNNALAGEIPPTFADLKNLTLLNLFRNKLYGAIPDFVGDL  309

Query  460  ANLQVLDLYNNNLT  501
              L+VL L+ NN T
Sbjct  310  PQLEVLQLWENNFT  323



>dbj|BAJ84911.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ96166.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=1020

 Score = 93.2 bits (230),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 55/114 (48%), Positives = 70/114 (61%), Gaps = 2/114 (2%)
 Frame = +1

Query  166  DSQSSLTSW-NISTSHCTWRRVTCdsllhvvsldl-sglNLSGVLSPDVGQLPFLVNLSI  339
            D   SL SW N ST  C W  V+CD     V     SG NLSG +     +LP+L  L++
Sbjct  37   DPTGSLASWSNASTGPCAWSGVSCDGRSGAVVGVDLSGRNLSGAVPRAFSRLPYLARLNL  96

Query  340  AANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLANLQVLDLYNNNLT  501
            AAN LSGP+PP +S +  L +LNLS+N+   +FP  LA+L  L+VLDLYNNN T
Sbjct  97   AANSLSGPIPPSLSRLGLLTYLNLSSNLLNGSFPPPLARLRALRVLDLYNNNFT  150


 Score = 50.4 bits (119),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 25/75 (33%), Positives = 41/75 (55%), Gaps = 0/75 (0%)
 Frame = +1

Query  277  NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  456
            +  G +  ++G+   L  L ++ N+LSG +PP IS +  L +LNLS N      P  +A 
Sbjct  510  SFDGGVPSEIGKCRLLTYLDVSQNKLSGDIPPAISGMRILNYLNLSRNQLDGEIPVTIAA  569

Query  457  LANLQVLDLYNNNLT  501
            + +L  +D   NNL+
Sbjct  570  MQSLTAVDFSYNNLS  584



>ref|XP_010676066.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
RCH1 [Beta vulgaris subsp. vulgaris]
Length=853

 Score = 92.8 bits (229),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 56/129 (43%), Positives = 81/129 (63%), Gaps = 1/129 (1%)
 Frame = +1

Query  118  VTEQAALLSIKAAFTADSQSSLTSWNISTSHCTWRRVTCdsllhvvsld-lsglNLSGVL  294
            ++E+ ALLSIK+A T D  +SL+SW  +T HC+W  +TC S    V     + L L G+L
Sbjct  24   LSERQALLSIKSAITYDPFNSLSSWKNTTHHCSWPYITCSSSSSSVISLNFTELLLEGIL  83

Query  295  SPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLANLQV  474
            SPD+G L  L NLSI +N  SGP+P  +S ++ LR+L++S+N F    P  L+ L  L+ 
Sbjct  84   SPDIGFLTNLQNLSIRSNLFSGPLPHSLSLLTQLRYLHVSSNSFTGPIPSSLSLLTQLRH  143

Query  475  LDLYNNNLT  501
            LD+  N+ T
Sbjct  144  LDVSFNSFT  152



>ref|XP_004160944.1| PREDICTED: LOW QUALITY PROTEIN: leucine-rich repeat receptor-like 
serine/threonine-protein kinase BAM1-like [Cucumis sativus]
Length=984

 Score = 92.4 bits (228),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 64/128 (50%), Positives = 93/128 (73%), Gaps = 2/128 (2%)
 Frame = +1

Query  124  EQAALLSIKAAFTADSQSSLTSWNIST--SHCTWRRVTCdsllhvvsldlsglNLSGVLS  297
            E  ALLS+K++ + D  SSL+SWN +   +HC+W  VTCDS  HVV+LDLS L+L+  +S
Sbjct  41   ESQALLSLKSSISDDPHSSLSSWNPAAVHAHCSWLGVTCDSRRHVVALDLSSLDLTATIS  100

Query  298  PDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLANLQVL  477
            P +  L FL N+S   N++ G +PPEI+++S+L+ LNLS+N+   + P + ++L NLQVL
Sbjct  101  PHISSLRFLTNVSFGLNKIFGGIPPEIASLSSLQLLNLSSNVLNGSIPSEFSRLKNLQVL  160

Query  478  DLYNNNLT  501
            D+YNNNLT
Sbjct  161  DVYNNNLT  168



>ref|XP_004143533.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM1-like [Cucumis sativus]
 gb|KGN48656.1| Receptor-like protein kinase 3 [Cucumis sativus]
Length=984

 Score = 92.4 bits (228),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 64/128 (50%), Positives = 93/128 (73%), Gaps = 2/128 (2%)
 Frame = +1

Query  124  EQAALLSIKAAFTADSQSSLTSWNIST--SHCTWRRVTCdsllhvvsldlsglNLSGVLS  297
            E  ALLS+K++ + D  SSL+SWN +   +HC+W  VTCDS  HVV+LDLS L+L+  +S
Sbjct  41   ESQALLSLKSSISDDPHSSLSSWNPAAVHAHCSWLGVTCDSRRHVVALDLSSLDLTATIS  100

Query  298  PDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLANLQVL  477
            P +  L FL N+S   N++ G +PPEI+++S+L+ LNLS+N+   + P + ++L NLQVL
Sbjct  101  PHISSLRFLTNVSFGLNKIFGGIPPEIASLSSLQLLNLSSNVLNGSIPSEFSRLKNLQVL  160

Query  478  DLYNNNLT  501
            D+YNNNLT
Sbjct  161  DVYNNNLT  168



>ref|XP_008370076.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At3g47570 [Malus domestica]
Length=1053

 Score = 92.4 bits (228),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 48/128 (38%), Positives = 71/128 (55%), Gaps = 1/128 (1%)
 Frame = +1

Query  121  TEQAALLSIKAAFTADSQSSLTSWNISTSHCTWRRVTCdsllhvvsldls-glNLSGVLS  297
            +++ ALL  K   T D Q  ++SWN ST  C WR VTC++    V        NL G L+
Sbjct  43   SDRLALLDFKKRITEDPQHIMSSWNDSTHFCGWRGVTCNNSNKRVLTLKLNSQNLVGSLT  102

Query  298  PDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLANLQVL  477
            P +G L +L  +++ +N   G +P EI  + +L +LNLS N FG   P  ++    L+VL
Sbjct  103  PSIGNLTYLTGINLTSNGFHGEIPQEIGRLRSLEYLNLSYNSFGGKIPTNMSSCTQLKVL  162

Query  478  DLYNNNLT  501
             +Y+N LT
Sbjct  163  SIYSNKLT  170



>ref|XP_009407942.1| PREDICTED: protein NSP-INTERACTING KINASE 1-like [Musa acuminata 
subsp. malaccensis]
Length=623

 Score = 90.9 bits (224),  Expect = 6e-18, Method: Compositional matrix adjust.
 Identities = 60/141 (43%), Positives = 77/141 (55%), Gaps = 3/141 (2%)
 Frame = +1

Query  85   SAGAGAGKPLGVT-EQAALLSIKAAFTADSQSSLTSWN-ISTSHCTWRRVTCdsllhvvs  258
            +AG     P GV  E  AL+ IKA+   D  S L +W+  S   C+W  VTC     VV 
Sbjct  20   AAGTALLSPKGVNFEVQALMGIKASLM-DPHSVLENWDQDSVDPCSWTMVTCSPENLVVG  78

Query  259  ldlsglNLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTF  438
            L     NLSG LSP +G L  L  L +  N +SGP+PPEI  +S L+ ++LSNN F    
Sbjct  79   LATPSQNLSGTLSPSIGNLTNLKILFLQNNNMSGPIPPEIGKLSKLQTIDLSNNYFSGEI  138

Query  439  PHQLAQLANLQVLDLYNNNLT  501
            P  L  L NLQ + L NN+L+
Sbjct  139  PDSLGNLNNLQYMRLNNNSLS  159



>ref|XP_006650665.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM1-like [Oryza brachyantha]
Length=1021

 Score = 90.9 bits (224),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 59/117 (50%), Positives = 76/117 (65%), Gaps = 4/117 (3%)
 Frame = +1

Query  163  ADSQSSLTSW----NISTSHCTWRRVTCdsllhvvsldlsglNLSGVLSPDVGQLPFLVN  330
            +D   +L SW    N STSHC+W  VTC S   VV LD+SG NLSG L  ++ +L  L+ 
Sbjct  32   SDPTGALASWGNGTNTSTSHCSWAGVTCSSRGTVVGLDVSGFNLSGALPAELSRLRGLLR  91

Query  331  LSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLANLQVLDLYNNNLT  501
            L++ AN  SGP+P  +  +  L +LNLSNN F  +FP  LA+L  L+VLDLYNNNLT
Sbjct  92   LAVGANAFSGPIPGSLGRLQFLTYLNLSNNAFNGSFPAALARLRGLRVLDLYNNNLT  148


 Score = 52.4 bits (124),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 25/74 (34%), Positives = 40/74 (54%), Gaps = 0/74 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
              G + P++G+   L  L ++ N +SG +PP IS +  L +LNLS N      P  +A +
Sbjct  509  FEGGVPPEIGKCRLLTYLDLSRNNISGKIPPAISGMRILNYLNLSRNHLDGEIPPSIATM  568

Query  460  ANLQVLDLYNNNLT  501
             +L  +D   NNL+
Sbjct  569  QSLTAVDFSYNNLS  582



>ref|XP_002466378.1| hypothetical protein SORBIDRAFT_01g006690 [Sorghum bicolor]
 gb|EER93376.1| hypothetical protein SORBIDRAFT_01g006690 [Sorghum bicolor]
Length=1030

 Score = 90.9 bits (224),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 59/113 (52%), Positives = 74/113 (65%), Gaps = 4/113 (4%)
 Frame = +1

Query  175  SSLTSWNISTS-HCTWRRVTCd---sllhvvsldlsglNLSGVLSPDVGQLPFLVNLSIA  342
             +L SW +++S HC W  VTC    S   VV LD+SGLNLSG L P + +L  L  LS+A
Sbjct  45   GALASWGVASSDHCAWAGVTCAPRGSGGVVVGLDVSGLNLSGALPPALSRLRGLQRLSVA  104

Query  343  ANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLANLQVLDLYNNNLT  501
            AN   GP+PP ++ +  L  LNLSNN F  +FP  LA+L  L+VLDLYNNNLT
Sbjct  105  ANGFYGPIPPSLARLQLLVHLNLSNNAFNGSFPPALARLRALRVLDLYNNNLT  157


 Score = 52.8 bits (125),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 26/75 (35%), Positives = 40/75 (53%), Gaps = 0/75 (0%)
 Frame = +1

Query  277  NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  456
               G + P++G+   L  L ++ N LSG +PP IS +  L +LNLS N      P  +A 
Sbjct  518  KFEGGVPPEIGKCRLLTYLDMSQNNLSGKIPPAISGMRILNYLNLSRNHLDGEIPPSIAT  577

Query  457  LANLQVLDLYNNNLT  501
            + +L  +D   NNL+
Sbjct  578  MQSLTAVDFSYNNLS  592



>ref|XP_008665503.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM1 [Zea mays]
 tpg|DAA51666.1| TPA: putative leucine-rich repeat receptor-like protein kinase 
family protein [Zea mays]
Length=1034

 Score = 90.9 bits (224),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 59/118 (50%), Positives = 75/118 (64%), Gaps = 5/118 (4%)
 Frame = +1

Query  163  ADSQSSLTSWNISTS-HCTWRRVTCd----sllhvvsldlsglNLSGVLSPDVGQLPFLV  327
            +D   +L SW+ ++S HC W  VTC         VV LD+SGLNLSG L P + +L  L 
Sbjct  34   SDPTGALASWDAASSDHCAWVGVTCAPRGSGGGVVVGLDVSGLNLSGALPPALSRLRGLQ  93

Query  328  NLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLANLQVLDLYNNNLT  501
             LS+AAN   GP+PP ++ +  L  LNLSNN F  +FP  LA+L  L+VLDLYNNNLT
Sbjct  94   RLSVAANGFYGPIPPSLARLQLLVHLNLSNNAFNGSFPPALARLRALRVLDLYNNNLT  151


 Score = 53.5 bits (127),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 27/75 (36%), Positives = 40/75 (53%), Gaps = 0/75 (0%)
 Frame = +1

Query  277  NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  456
               G + P+VG+   L  L ++ N LSG +PP IS +  L +LNLS N      P  +A 
Sbjct  512  KFEGGVPPEVGKCRLLTYLDMSQNNLSGKIPPAISGMRILNYLNLSRNHLDGEIPPSIAT  571

Query  457  LANLQVLDLYNNNLT  501
            + +L  +D   NNL+
Sbjct  572  MQSLTAVDFSYNNLS  586



>ref|XP_010260843.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM3 [Nelumbo nucifera]
 ref|XP_010260847.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM3 [Nelumbo nucifera]
Length=1006

 Score = 90.1 bits (222),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 53/128 (41%), Positives = 76/128 (59%), Gaps = 4/128 (3%)
 Frame = +1

Query  124  EQAALLSIKAAFTADSQSSLTSWNIS--TSHCTWRRVTCdsllhvvsldlsg-lNLSGVL  294
            + +  LS+K AF   + + L +WN S   S C+W  + CD +   V        N+SGV+
Sbjct  53   QASIFLSLKQAFYVPT-TCLDTWNESNFMSLCSWTGIQCDDMGSSVVSLDISNFNISGVI  111

Query  295  SPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLANLQV  474
            SP +G+L  L+NLSIA N  SG  PPE+  +++LRFLN+SNN F  +     + L  L+V
Sbjct  112  SPAIGELQSLLNLSIAGNSFSGLFPPELHKLTSLRFLNISNNQFNGSLSWNFSSLRELEV  171

Query  475  LDLYNNNL  498
            LD+YNNN 
Sbjct  172  LDVYNNNF  179


 Score = 56.2 bits (134),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 27/75 (36%), Positives = 44/75 (59%), Gaps = 0/75 (0%)
 Frame = +1

Query  277  NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  456
            NL+G + PD+G    L  L ++ NQLSGP+P +IS I  L +LN+S N    + P ++  
Sbjct  540  NLTGRIPPDIGNCLLLTYLDLSQNQLSGPIPVQISQIHILNYLNISWNHLNQSLPKEIGA  599

Query  457  LANLQVLDLYNNNLT  501
            + +L   D  +N+ +
Sbjct  600  IKSLTSADFSHNDFS  614


 Score = 48.9 bits (115),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 26/69 (38%), Positives = 37/69 (54%), Gaps = 0/69 (0%)
 Frame = +1

Query  277  NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  456
            N  G L   V +LP L +L +  N +SG +PP   A+  L +L+L+ N  G   P +L  
Sbjct  178  NFFGSLPLGVTELPKLKHLDLGGNYISGKIPPSYGAMEELNYLSLAGNDLGGLIPGELGN  237

Query  457  LANLQVLDL  483
            L NL+ L L
Sbjct  238  LTNLKQLYL  246



>ref|XP_009411355.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM1 [Musa acuminata subsp. malaccensis]
Length=1009

 Score = 90.1 bits (222),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 67/117 (57%), Positives = 83/117 (71%), Gaps = 3/117 (3%)
 Frame = +1

Query  160  TADSQSSLTSWNIS--TSHCTWRRVTCd-sllhvvsldlsglNLSGVLSPDVGQLPFLVN  330
             +D  +SL++WN S    HC+W  V CD     VVSLDL+G NLSG L P VG+L  L+N
Sbjct  41   VSDPSASLSAWNSSAGVGHCSWPGVGCDPIQGSVVSLDLTGFNLSGSLFPAVGRLRHLLN  100

Query  331  LSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLANLQVLDLYNNNLT  501
            LS A+N LSGP+P EIS +++LR LNLSNN+   +FP  LA+L NL VLDLYNNNLT
Sbjct  101  LSAASNSLSGPIPAEISRLASLRHLNLSNNLLNGSFPSALARLKNLLVLDLYNNNLT  157


 Score = 51.2 bits (121),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 28/75 (37%), Positives = 42/75 (56%), Gaps = 0/75 (0%)
 Frame = +1

Query  277  NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  456
            +  G + P++G LP LV L +A   L+G +PPE+  +  L  L L  N      P +L +
Sbjct  228  SFEGGIPPEIGSLPALVRLDMANCGLNGEIPPELWKLQNLDTLFLQVNGLAGDIPPELGR  287

Query  457  LANLQVLDLYNNNLT  501
            L +L+ +DL NN LT
Sbjct  288  LRSLKSMDLSNNALT  302


 Score = 50.4 bits (119),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 24/74 (32%), Positives = 42/74 (57%), Gaps = 0/74 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
             SG ++P++ +   L  + ++ N+LSG +PPEI+ +  L +LNLS N      P  +A +
Sbjct  519  FSGPITPEISRCKLLTFVDLSRNELSGEIPPEIARMRILNYLNLSRNQLEGGIPPSIATM  578

Query  460  ANLQVLDLYNNNLT  501
             +L  +D   N L+
Sbjct  579  QSLTAVDFSYNKLS  592


 Score = 50.1 bits (118),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 26/73 (36%), Positives = 43/73 (59%), Gaps = 0/73 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            L+G + P++ +L  L  L +  N L+G +PPE+  + +L+ ++LSNN      P   A L
Sbjct  253  LNGEIPPELWKLQNLDTLFLQVNGLAGDIPPELGRLRSLKSMDLSNNALTGEIPATFADL  312

Query  460  ANLQVLDLYNNNL  498
             NL +L+L+ N L
Sbjct  313  ENLTLLNLFRNKL  325


 Score = 48.5 bits (114),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 25/73 (34%), Positives = 40/73 (55%), Gaps = 0/73 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
             S  + P++G+L  L  +  + N+ SGP+ PEIS    L F++LS N      P ++A++
Sbjct  495  FSDRIPPEIGRLQELSKVDFSGNRFSGPITPEISRCKLLTFVDLSRNELSGEIPPEIARM  554

Query  460  ANLQVLDLYNNNL  498
              L  L+L  N L
Sbjct  555  RILNYLNLSRNQL  567



>ref|XP_008357152.1| PREDICTED: receptor protein kinase CLAVATA1-like [Malus domestica]
Length=837

 Score = 89.7 bits (221),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 53/123 (43%), Positives = 79/123 (64%), Gaps = 1/123 (1%)
 Frame = +1

Query  136  LLSIKAAFTADSQSSLTSWNISTSHCTWRRVTCdsllhvvsldlsglNLSGVLSPDVGQL  315
            LL +KAA     +S L  WN S+SHC++  V CD    VVSL++S L L G ++ ++G L
Sbjct  33   LLKLKAAMIGXKRSGLEDWNPSSSHCSFSGVLCDRDSRVVSLNVSNLPLYGTIAAEIGLL  92

Query  316  PFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQL-AQLANLQVLDLYNN  492
              LVNL+IA N  +G +P E++ ++ L+ LN+S N+F  +FP ++   +  L+VLD YNN
Sbjct  93   DKLVNLTIAGNNFTGRLPAEMANLTALKHLNISGNLFHGSFPIEIVVGMTELEVLDAYNN  152

Query  493  NLT  501
            N T
Sbjct  153  NFT  155


 Score = 51.6 bits (122),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 28/74 (38%), Positives = 43/74 (58%), Gaps = 0/74 (0%)
 Frame = +1

Query  277  NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  456
            NL G +   +  L  L  L +  N+LSG +PPE+SA++ L  L+LS N      P   ++
Sbjct  250  NLVGPIPTTLSLLKHLHTLFLQVNRLSGSIPPELSALNRLMSLDLSINELSGEIPESFSE  309

Query  457  LANLQVLDLYNNNL  498
            L N+ +++LY NNL
Sbjct  310  LKNITLINLYRNNL  323



>ref|XP_010943209.1| PREDICTED: LOW QUALITY PROTEIN: leucine-rich repeat receptor-like 
serine/threonine-protein kinase BAM1 [Elaeis guineensis]
Length=995

 Score = 89.7 bits (221),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 57/142 (40%), Positives = 76/142 (54%), Gaps = 27/142 (19%)
 Frame = +1

Query  79   RHSAGAGAGKPLGVTEQAALLSIKAAFTADSQSSLTSWNISTSHC-TWRRVTCdsllhvv  255
            R SA A  G+     E  AL+ +KAA   +   SL  W+ +  HC +W  V CD+     
Sbjct  15   RPSATAATGEGT-AAEHRALVELKAAI-GNPTGSLAGWDAAADHCRSWAGVACDAAGR--  70

Query  256  sldlsglNLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGST  435
                                  +V+L I+   LSGP+PPE+S +S LR+LNLSNN+F  T
Sbjct  71   ----------------------VVSLDISNLNLSGPIPPELSLLSGLRYLNLSNNVFNGT  108

Query  436  FPHQLAQLANLQVLDLYNNNLT  501
            FP  L++L NL+ LDLYNNNLT
Sbjct  109  FPSDLSRLKNLRALDLYNNNLT  130


 Score = 51.2 bits (121),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 26/74 (35%), Positives = 42/74 (57%), Gaps = 0/74 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            LSG ++P++G+L  L ++ ++ N L+G +PP  + +  L  LNL  N      P  +  L
Sbjct  250  LSGEITPELGKLWGLKSMDLSNNALTGEIPPTFADLKNLTLLNLFRNKLHGAIPDFVGDL  309

Query  460  ANLQVLDLYNNNLT  501
              L+VL L+ NN T
Sbjct  310  PELEVLQLWENNFT  323


 Score = 50.8 bits (120),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 24/73 (33%), Positives = 41/73 (56%), Gaps = 0/73 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
             SG + P++G+L  L  +  + N+ S P+PPEIS    + F++LS N      P ++ ++
Sbjct  465  FSGCIPPEIGRLQQLSKMDFSGNRFSCPIPPEISKCRLVTFIDLSRNNLSGEIPVEITEM  524

Query  460  ANLQVLDLYNNNL  498
              L  L+L  N+L
Sbjct  525  RILNYLNLSRNHL  537


 Score = 50.8 bits (120),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 28/73 (38%), Positives = 41/73 (56%), Gaps = 0/73 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            LSG + P++G L  L  L +  N LSG + PE+  +  L+ ++LSNN      P   A L
Sbjct  226  LSGEIPPEMGDLQNLDTLFLQVNGLSGEITPELGKLWGLKSMDLSNNALTGEIPPTFADL  285

Query  460  ANLQVLDLYNNNL  498
             NL +L+L+ N L
Sbjct  286  KNLTLLNLFRNKL  298


 Score = 49.7 bits (117),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 26/74 (35%), Positives = 39/74 (53%), Gaps = 0/74 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            LSG L   +G  P L  L +  NQ SG +PPEI  +  L  ++ S N F    P ++++ 
Sbjct  441  LSGALPSSIGNFPGLQKLLLNQNQFSGCIPPEIGRLQQLSKMDFSGNRFSCPIPPEISKC  500

Query  460  ANLQVLDLYNNNLT  501
              +  +DL  NNL+
Sbjct  501  RLVTFIDLSRNNLS  514



>ref|XP_008364929.1| PREDICTED: receptor protein kinase CLAVATA1-like [Malus domestica]
Length=973

 Score = 89.7 bits (221),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 53/123 (43%), Positives = 79/123 (64%), Gaps = 1/123 (1%)
 Frame = +1

Query  136  LLSIKAAFTADSQSSLTSWNISTSHCTWRRVTCdsllhvvsldlsglNLSGVLSPDVGQL  315
            LL +KAA     +S L  WN S+SHC++  V CD    VVSL++S L L G ++ ++G L
Sbjct  33   LLKLKAAMIGXKRSGLEDWNPSSSHCSFSGVLCDRDSRVVSLNVSNLPLYGTIAAEIGLL  92

Query  316  PFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQL-AQLANLQVLDLYNN  492
              LVNL+IA N  +G +P E++ ++ L+ LN+S N+F  +FP ++   +  L+VLD YNN
Sbjct  93   DKLVNLTIAGNNFTGRLPAEMANLTALKHLNISGNLFHGSFPIEIVVGMTELEVLDAYNN  152

Query  493  NLT  501
            N T
Sbjct  153  NFT  155


 Score = 51.2 bits (121),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 28/74 (38%), Positives = 43/74 (58%), Gaps = 0/74 (0%)
 Frame = +1

Query  277  NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  456
            NL G +   +  L  L  L +  N+LSG +PPE+SA++ L  L+LS N      P   ++
Sbjct  250  NLVGPIPTTLSLLKHLHTLFLQVNRLSGSIPPELSALNRLMSLDLSINELSGEIPESFSE  309

Query  457  LANLQVLDLYNNNL  498
            L N+ +++LY NNL
Sbjct  310  LKNITLINLYRNNL  323



>ref|XP_011083584.1| PREDICTED: receptor protein kinase CLAVATA1 [Sesamum indicum]
Length=974

 Score = 89.7 bits (221),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 51/133 (38%), Positives = 85/133 (64%), Gaps = 6/133 (5%)
 Frame = +1

Query  121  TEQAALLSIKAAFTADSQSSLTSWNISTS-----HCTWRRVTCdsllhvvsldlsglNLS  285
            ++   LL +K++    S S L  W    S     HC++  VTCD+   V SL+++ + L 
Sbjct  23   SDLETLLKLKSSLVGPSASGLHDWAAPPSPSSSAHCSFSGVTCDADARVTSLNVANVPLF  82

Query  286  GVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLA-QLA  462
            G L P++G L  LVNL++A N++SGP+P E+S +++L+++NLS+N+F  T P ++  +L 
Sbjct  83   GTLPPEIGLLDKLVNLTLAGNKISGPLPVEMSNLTSLKYVNLSSNVFNGTLPGEIVLKLT  142

Query  463  NLQVLDLYNNNLT  501
             L+V D+YNNN +
Sbjct  143  ELEVFDVYNNNFS  155


 Score = 52.8 bits (125),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 29/75 (39%), Positives = 42/75 (56%), Gaps = 0/75 (0%)
 Frame = +1

Query  277  NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  456
            NL+G L  ++  L  L++L I+ N L G +P   S +  L  +NL  N F   FP  +  
Sbjct  274  NLTGRLPSELSGLMSLMSLDISINNLIGEIPESFSKLKNLTLINLFQNKFQGPFPAFIGD  333

Query  457  LANLQVLDLYNNNLT  501
            L NL+VL ++NNN T
Sbjct  334  LPNLEVLQIWNNNFT  348



>ref|XP_007017845.1| Leucine-rich receptor-like protein kinase family protein [Theobroma 
cacao]
 gb|EOY15070.1| Leucine-rich receptor-like protein kinase family protein [Theobroma 
cacao]
Length=982

 Score = 89.4 bits (220),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 54/133 (41%), Positives = 80/133 (60%), Gaps = 4/133 (3%)
 Frame = +1

Query  115  GVTEQAALLSIKAAFTADSQSSLTSWNISTS---HCTWRRVTCdsllhvvsldlsglNLS  285
            G ++   LL +K++      S L  W  S+S   HC +  V CD   HVVSL+ S   LS
Sbjct  25   GYSDLEVLLKLKSSMIGPKGSGLEDWEFSSSPSAHCHFSGVQCDEEFHVVSLNASFAPLS  84

Query  286  GVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQ-LAQLA  462
            G + P++G L  LVNL+IAA  L+G +P E+  +++L+  N+SNN+F  +FP + L  + 
Sbjct  85   GTIPPEIGLLNKLVNLTIAAANLTGKIPVEMGNLTSLKLFNISNNVFKGSFPGEILTGMT  144

Query  463  NLQVLDLYNNNLT  501
             L++LD YNNN T
Sbjct  145  ELEILDAYNNNFT  157



>gb|EMT21473.1| Putative LRR receptor-like serine/threonine-protein kinase [Aegilops 
tauschii]
Length=1048

 Score = 89.0 bits (219),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 57/145 (39%), Positives = 83/145 (57%), Gaps = 6/145 (4%)
 Frame = +1

Query  82   HSAGAGAGKPLGV---TEQAALLSIKAAFTADSQSSLTSWNISTSHCTWRRVTCds---l  243
            H AG G    LG    T+  +LL  K A T D   +L+SWN ST+ C W+ VTC +    
Sbjct  13   HIAGKGDCVVLGWNDNTDLHSLLEFKQAITKDPTRALSSWNRSTNFCRWKGVTCSADRPK  72

Query  244  lhvvsldlsglNLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNI  423
             HV+ L+L+  +L G +SP +G L +LV ++ + N  SG +PP    +  L+ L+LSNN+
Sbjct  73   RHVMKLELAAQSLVGHISPSLGNLTYLVTINFSTNSFSGNLPPLFHRLQNLQILDLSNNL  132

Query  424  FGSTFPHQLAQLANLQVLDLYNNNL  498
                 P  LA  ++L+ LDLY N+L
Sbjct  133  LHGVIPQGLANCSDLRKLDLYGNSL  157


 Score = 50.4 bits (119),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 26/75 (35%), Positives = 41/75 (55%), Gaps = 0/75 (0%)
 Frame = +1

Query  277  NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  456
            NL GVL P+VG L  L  L +++N+L+G +P  ++    L  + +  N F    P  L  
Sbjct  500  NLEGVLPPEVGSLQQLTELQLSSNKLTGAIPKTLAQCKQLETIKMDQNFFTEDIPISLGD  559

Query  457  LANLQVLDLYNNNLT  501
            L +L  L+L +N L+
Sbjct  560  LQSLTTLNLSHNKLS  574



>ref|XP_010686227.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At5g45780 [Beta vulgaris subsp. vulgaris]
Length=614

 Score = 88.2 bits (217),  Expect = 5e-17, Method: Composition-based stats.
 Identities = 55/133 (41%), Positives = 74/133 (56%), Gaps = 2/133 (2%)
 Frame = +1

Query  109  PLGVT-EQAALLSIKAAFTADSQSSLTSWNI-STSHCTWRRVTCdsllhvvsldlsglNL  282
            P GV  E AAL+S+K     D    L  W+I S   CTW  V C +   V+SLD++ + L
Sbjct  24   PKGVNYEVAALMSLKNKMRDDKYHVLDGWDINSVDPCTWYMVACSAEASVISLDMASMGL  83

Query  283  SGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLA  462
            SG LSP +G L  L ++S+  NQLSGP+P EI  +  L+ L+LS N F    P  +  L 
Sbjct  84   SGTLSPSIGNLTHLRSISMQNNQLSGPIPDEIGKLQELQTLDLSGNQFSGEIPGSIGNLG  143

Query  463  NLQVLDLYNNNLT  501
            +L  L L  N L+
Sbjct  144  HLSYLKLSRNKLS  156



>tpg|DAA59489.1| TPA: putative leucine-rich repeat receptor-like protein kinase 
family protein [Zea mays]
Length=1037

 Score = 89.0 bits (219),  Expect = 6e-17, Method: Compositional matrix adjust.
 Identities = 56/115 (49%), Positives = 72/115 (63%), Gaps = 2/115 (2%)
 Frame = +1

Query  163  ADSQSSLTSWN--ISTSHCTWRRVTCdsllhvvsldlsglNLSGVLSPDVGQLPFLVNLS  336
            +D   +L SW    ST  C W  VTC++   V+ LDLSG NLSG +   + +L  L  L 
Sbjct  45   SDPAGALASWTNATSTGACAWSGVTCNARAAVIGLDLSGRNLSGPVPTALSRLAHLARLD  104

Query  337  IAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLANLQVLDLYNNNLT  501
            +AAN L GP+P  +S + +L  LNLSNN+   TFP  LA+L  L+VLDLYNNNLT
Sbjct  105  LAANALCGPIPAPLSRLQSLTHLNLSNNVLNGTFPPPLARLRALRVLDLYNNNLT  159


 Score = 57.0 bits (136),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 28/74 (38%), Positives = 42/74 (57%), Gaps = 0/74 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            L G + P++G+   L  L ++ N LSG +PP IS +  L +LNLS N  G   P  +A +
Sbjct  520  LDGGVPPEIGKCRLLTYLDLSRNNLSGEIPPAISGMRILNYLNLSRNHLGGEIPATIAAM  579

Query  460  ANLQVLDLYNNNLT  501
             +L  +D   NNL+
Sbjct  580  QSLTAVDFSYNNLS  593



>ref|XP_010484821.1| PREDICTED: putative receptor-like protein kinase At3g47110 [Camelina 
sativa]
Length=584

 Score = 88.2 bits (217),  Expect = 6e-17, Method: Compositional matrix adjust.
 Identities = 48/128 (38%), Positives = 78/128 (61%), Gaps = 1/128 (1%)
 Frame = +1

Query  121  TEQAALLSIKAAFTADSQSSLTSWNISTSHCTWRRVTCdsllhvvsldlsglN-LSGVLS  297
            T++ AL+S ++  + D Q+   SW+ +TS C W  V+C++    V+      + LSG +S
Sbjct  16   TDKEALISFRSQISQDPQTLFLSWDQNTSPCNWTGVSCNTRNRRVASINLSSHGLSGSIS  75

Query  298  PDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLANLQVL  477
            P +G L FL +L +  NQL G +P EI+ +  L+ LNLS+N    + P  L++L NL++L
Sbjct  76   PSIGNLSFLTSLQLQNNQLQGTIPKEITNLFRLKVLNLSSNSLEESLPSNLSKLVNLRIL  135

Query  478  DLYNNNLT  501
            DL +N +T
Sbjct  136  DLTSNTIT  143


 Score = 49.3 bits (116),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 25/48 (52%), Positives = 32/48 (67%), Gaps = 0/48 (0%)
 Frame = +1

Query  358  GPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLANLQVLDLYNNNLT  501
            GP+PP +S IS+L  L+LS N      P++L +L  LQVLDL  NNLT
Sbjct  168  GPIPPSLSNISSLTVLSLSTNSLSGPIPYELGRLEKLQVLDLTINNLT  215



>emb|CDP18494.1| unnamed protein product [Coffea canephora]
Length=1062

 Score = 88.6 bits (218),  Expect = 8e-17, Method: Compositional matrix adjust.
 Identities = 48/127 (38%), Positives = 66/127 (52%), Gaps = 1/127 (1%)
 Frame = +1

Query  121  TEQAALLSIKAAFTADSQSSLTSWNISTSHCTWRRVTCdsllhvvsldlsg-lNLSGVLS  297
            T+Q ALL  K     D    L+SWN S  HC W+ +TCD+    V+       +LSG LS
Sbjct  63   TDQLALLEFKQQILDDPHGVLSSWNHSEHHCQWQGITCDTQHQRVTALTLAGKSLSGTLS  122

Query  298  PDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLANLQVL  477
            P +G L F+ ++ +  N   G +PPEI  +  LRFLNLS N F    P  L+  + +  +
Sbjct  123  PHIGNLSFMKSIQLGGNLFHGEIPPEIGRLFRLRFLNLSRNTFSGEIPVNLSHCSQITTI  182

Query  478  DLYNNNL  498
             L  N L
Sbjct  183  SLSRNRL  189


 Score = 50.1 bits (118),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 27/74 (36%), Positives = 41/74 (55%), Gaps = 0/74 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
             +G L  +VG+L  LV  +I+ N  SG +PP ++    L  L +  N F    P +LA L
Sbjct  536  FNGSLPLEVGKLIHLVVFNISYNMFSGEIPPSLADCLDLEHLRMEANFFHGMIPSKLASL  595

Query  460  ANLQVLDLYNNNLT  501
              +Q +DL +N+LT
Sbjct  596  TGIQEIDLSSNSLT  609



>ref|XP_004955796.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At3g47570-like [Setaria italica]
Length=1053

 Score = 88.2 bits (217),  Expect = 8e-17, Method: Compositional matrix adjust.
 Identities = 51/125 (41%), Positives = 81/125 (65%), Gaps = 3/125 (2%)
 Frame = +1

Query  124  EQAALLSIKAAFTADSQSSLTSWNISTSHCTWRRVTCdsll--hvvsldlsglNLSGVLS  297
            ++AAL++ KA  + DS   L+SWN STS+C+W  +TC       VV+LDLS   L+G +S
Sbjct  38   DEAALVAFKAKISGDS-GKLSSWNESTSYCSWEGITCSKRYPWRVVALDLSSQGLTGTIS  96

Query  298  PDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLANLQVL  477
            P VG L FL++L++++N L G +PP I ++S LR L+LS N+     P  +++  +L+V+
Sbjct  97   PAVGNLTFLLSLNLSSNALQGEIPPSIGSLSRLRILDLSENMLNGVIPSNISRCTSLRVM  156

Query  478  DLYNN  492
             +  N
Sbjct  157  MISRN  161



>ref|XP_010266811.1| PREDICTED: receptor protein kinase CLAVATA1 [Nelumbo nucifera]
 ref|XP_010266812.1| PREDICTED: receptor protein kinase CLAVATA1 [Nelumbo nucifera]
Length=979

 Score = 88.2 bits (217),  Expect = 8e-17, Method: Compositional matrix adjust.
 Identities = 53/131 (40%), Positives = 82/131 (63%), Gaps = 4/131 (3%)
 Frame = +1

Query  121  TEQAALLSIKAAFTADSQSSLTSWNISTS---HCTWRRVTCdsllhvvsldlsglNLSGV  291
            T+  ALL +K A      S L  WN+S+S   HC +  V+CD    VV+L++S + L G 
Sbjct  25   TDLDALLKLKTAMIGRRGSGLDDWNVSSSRNSHCLFSGVSCDENSRVVALNVSYVPLFGT  84

Query  292  LSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLA-QLANL  468
            +SP++G L  LVNL+++ N L+G +P EI+ +++L+ LN+SNN F    P  +A  L  +
Sbjct  85   VSPEIGLLNKLVNLTLSCNNLTGKLPEEIANLTSLKLLNISNNAFVGGVPEGIAGGLLEV  144

Query  469  QVLDLYNNNLT  501
            ++ D+YNNN T
Sbjct  145  EIFDIYNNNFT  155


 Score = 51.6 bits (122),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 26/74 (35%), Positives = 45/74 (61%), Gaps = 0/74 (0%)
 Frame = +1

Query  277  NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  456
            NL+G +   +G+L  L  L +  N+LSG +P E+S + +L+ L+LSNN      P   ++
Sbjct  250  NLTGEIPASLGRLKLLHTLFLQLNKLSGLIPAELSGLVSLKSLDLSNNDLTGEIPESFSE  309

Query  457  LANLQVLDLYNNNL  498
            L  L +++L+ N+L
Sbjct  310  LKQLTLINLFRNHL  323



>emb|CDY26403.1| BnaA02g23670D [Brassica napus]
Length=781

 Score = 87.8 bits (216),  Expect = 9e-17, Method: Compositional matrix adjust.
 Identities = 52/128 (41%), Positives = 78/128 (61%), Gaps = 1/128 (1%)
 Frame = +1

Query  121  TEQAALLSIKAAFTADSQSSLTSWNISTSHCTWRRVTCdsllhvvsldlsglN-LSGVLS  297
            T++ ALLS ++  + + QS   SW+ +TS C W  VTCD+ +  V+      + LSG +S
Sbjct  31   TDREALLSFESQMSQNPQSLSFSWDPNTSPCNWTGVTCDTRIRRVASINLSGHGLSGSIS  90

Query  298  PDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLANLQVL  477
            P +G L FL +L +  NQL GP+P EI+ +  LR LNLS+N    + P  L++L  L+ L
Sbjct  91   PSIGNLSFLTSLQLQNNQLRGPIPKEITNLFRLRVLNLSSNSLDGSLPSNLSKLIELRAL  150

Query  478  DLYNNNLT  501
            DL +N +T
Sbjct  151  DLTSNMIT  158


 Score = 55.8 bits (133),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 30/74 (41%), Positives = 45/74 (61%), Gaps = 0/74 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            ++G++   +G L  L  L++  N L GP+PP +S IS+L  L+L  N      P++L +L
Sbjct  157  ITGIVPNQLGDLKNLTILNLGKNLLHGPIPPSLSNISSLTVLSLGTNSLSGPVPNELGRL  216

Query  460  ANLQVLDLYNNNLT  501
              LQVLDL  NNL+
Sbjct  217  QRLQVLDLTINNLS  230



>ref|XP_008812886.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At3g47570 [Phoenix dactylifera]
Length=1123

 Score = 88.2 bits (217),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 53/129 (41%), Positives = 71/129 (55%), Gaps = 2/129 (2%)
 Frame = +1

Query  121  TEQAALLSIKAAFTADSQSSLTSWNISTSHCTWRRVTCdsllhvvsldlsglNLS--GVL  294
            T++ ALL+ KAA T D   SL SWN S S C W  V+C        + L   +LS  G +
Sbjct  38   TDRFALLAFKAAITHDPTGSLKSWNASASICRWAGVSCSPRDQERVVALVLESLSLGGSI  97

Query  295  SPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLANLQV  474
            SP +G L FL  L +  N+L G VPP++  +  L+ LNLS+N  G   P  L Q  +L  
Sbjct  98   SPSIGNLTFLTRLHLPGNRLGGVVPPDVGHLRHLKDLNLSSNSLGGPIPASLGQCRSLLG  157

Query  475  LDLYNNNLT  501
            LDL +N L+
Sbjct  158  LDLTDNLLS  166


 Score = 52.4 bits (124),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 31/74 (42%), Positives = 40/74 (54%), Gaps = 0/74 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            L G L P VG+L  L  L+I+ N+LSG +P  I     L +L L  N F  + P  L  L
Sbjct  603  LDGPLPPSVGKLRNLQFLNISNNKLSGEIPTAIGDCQVLEYLYLEGNFFQGSIPSSLGNL  662

Query  460  ANLQVLDLYNNNLT  501
              + VLDL  NNL+
Sbjct  663  KGIIVLDLSLNNLS  676



>ref|XP_008811184.1| PREDICTED: protein NSP-INTERACTING KINASE 1-like [Phoenix dactylifera]
Length=635

 Score = 87.4 bits (215),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 59/141 (42%), Positives = 80/141 (57%), Gaps = 3/141 (2%)
 Frame = +1

Query  85   SAGAGAGKPLGVT-EQAALLSIKAAFTADSQSSLTSWNI-STSHCTWRRVTCdsllhvvs  258
            ++ AG   P GV  E  AL+ IKA+   D  S L +W+  S   C+W  VTC     V+S
Sbjct  31   ASAAGLLSPKGVNFEVQALMGIKASLK-DPHSVLENWDRDSVDPCSWAMVTCSPENLVIS  89

Query  259  ldlsglNLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTF  438
            L +   NLSG LS  +G L  L  + +  N +SGP+PPEI  +S L+ L+LSNN F    
Sbjct  90   LGIPSQNLSGTLSSSIGNLTNLETVLLQNNNISGPIPPEIGKLSKLKTLDLSNNYFTGGI  149

Query  439  PHQLAQLANLQVLDLYNNNLT  501
            P  + QL +LQ L L NN+L+
Sbjct  150  PTSIGQLESLQYLRLNNNSLS  170



>ref|XP_010905760.1| PREDICTED: protein NSP-INTERACTING KINASE 1-like [Elaeis guineensis]
Length=635

 Score = 87.4 bits (215),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 58/133 (44%), Positives = 77/133 (58%), Gaps = 3/133 (2%)
 Frame = +1

Query  109  PLGVT-EQAALLSIKAAFTADSQSSLTSWNI-STSHCTWRRVTCdsllhvvsldlsglNL  282
            P GV  E  AL+ IK +   D  S L +W+  S   C+W  VTC S   V+SL +   NL
Sbjct  39   PKGVNFEVQALMYIKDSL-KDPHSVLENWDRDSVDPCSWAMVTCSSENLVISLGIPSQNL  97

Query  283  SGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLA  462
            SG LSP +G L  L  + +  N +SGP+PPEI  +S L+ L+LSNN F    P  + QL 
Sbjct  98   SGTLSPSIGNLTNLETVLLQNNNISGPIPPEIGKLSKLKTLDLSNNYFTGGIPTSIGQLE  157

Query  463  NLQVLDLYNNNLT  501
            +LQ L L NN+L+
Sbjct  158  SLQYLRLNNNSLS  170



>ref|XP_004955422.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM1-like [Setaria italica]
Length=1030

 Score = 87.8 bits (216),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 53/111 (48%), Positives = 71/111 (64%), Gaps = 2/111 (2%)
 Frame = +1

Query  175  SSLTSW--NISTSHCTWRRVTCdsllhvvsldlsglNLSGVLSPDVGQLPFLVNLSIAAN  348
             +L SW  N + S C W  VTC++   V+ +DLSG NLSG +   + +LP L  L +AAN
Sbjct  47   GALASWTANATASPCAWSGVTCNARGAVIGVDLSGRNLSGPVPAALSRLPHLARLDLAAN  106

Query  349  QLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLANLQVLDLYNNNLT  501
              SGP+P  ++ +  L  LNLSNN+   TFP  LA+L  L+V+DLYNNNLT
Sbjct  107  AFSGPIPTPLARLRYLTHLNLSNNVLNGTFPPPLARLRALRVVDLYNNNLT  157


 Score = 53.9 bits (128),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 27/75 (36%), Positives = 42/75 (56%), Gaps = 0/75 (0%)
 Frame = +1

Query  277  NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  456
            +L G + P++G+   L  L ++ N LSG +PP IS +  L +LNLS N      P  +A 
Sbjct  517  SLDGGVPPEIGKCRLLTYLDLSRNNLSGEIPPAISGMRILNYLNLSRNHLDGEIPATIAA  576

Query  457  LANLQVLDLYNNNLT  501
            + +L  +D   NNL+
Sbjct  577  MQSLTAVDFSYNNLS  591



>emb|CDP04113.1| unnamed protein product [Coffea canephora]
Length=987

 Score = 87.8 bits (216),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 58/128 (45%), Positives = 75/128 (59%), Gaps = 3/128 (2%)
 Frame = +1

Query  124  EQAALLSIKAAFTADSQSSLTSWNISTSH--CTWRRVTCdsllhvvsldlsglNLSGVLS  297
            + + L+S+K  F   S  SL SWN+S     C W  +TCD    VVSLD+S LNLSG LS
Sbjct  38   QASVLVSVKQKFQTSS-PSLDSWNMSNYMFLCMWNGITCDENRLVVSLDISNLNLSGSLS  96

Query  298  PDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLANLQVL  477
            P + +L  L+N+S+A N   G   PEI     LR LNLSNN+F      + + L  L+VL
Sbjct  97   PAITELRSLINISVAGNGFFGVFLPEIHKFENLRILNLSNNVFSGNLSWEFSHLQELEVL  156

Query  478  DLYNNNLT  501
            D YNNN +
Sbjct  157  DGYNNNFS  164


 Score = 52.4 bits (124),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 25/75 (33%), Positives = 42/75 (56%), Gaps = 0/75 (0%)
 Frame = +1

Query  277  NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  456
            N SG + P++G+   L  L ++ NQLSGP+P +I+ I  L + N+S N      P ++  
Sbjct  524  NFSGNIPPEIGKCLSLTYLDLSQNQLSGPIPVQIAQIHILNYFNISWNHLSQKLPKEIGS  583

Query  457  LANLQVLDLYNNNLT  501
            + +L   D  +NN +
Sbjct  584  IKSLTSADFSHNNFS  598


 Score = 51.6 bits (122),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 26/73 (36%), Positives = 45/73 (62%), Gaps = 0/73 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            L G +  ++G L  L  L +  NQL+G +PP++  +++L+ L+LSNN+     P +L+ L
Sbjct  260  LVGPIPAELGHLKMLDTLFLQTNQLNGSIPPQLGNLASLKSLDLSNNVLTGEIPAELSPL  319

Query  460  ANLQVLDLYNNNL  498
              L +L+L+ N L
Sbjct  320  QELTLLNLFMNRL  332


 Score = 48.5 bits (114),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 27/74 (36%), Positives = 41/74 (55%), Gaps = 0/74 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            L+G + P +G L  L +L ++ N L+G +P E+S +  L  LNL  N      P  + +L
Sbjct  284  LNGSIPPQLGNLASLKSLDLSNNVLTGEIPAELSPLQELTLLNLFMNRLHGEIPQFVEEL  343

Query  460  ANLQVLDLYNNNLT  501
              L+VL L+ NN T
Sbjct  344  PQLEVLKLWQNNFT  357



>ref|XP_004295533.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM3 [Fragaria vesca subsp. vesca]
Length=982

 Score = 87.4 bits (215),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 56/131 (43%), Positives = 77/131 (59%), Gaps = 5/131 (4%)
 Frame = +1

Query  118  VTEQAALL-SIKAAFTADSQSSLTSWNISTSH--CTWRRVTCdsllhvvsldlsg-lNLS  285
            +  QA++L S+K  F A S  SL+SWN+S     C+W  + CD+L   V        NLS
Sbjct  26   LRRQASILASVKQGFEA-SDPSLSSWNVSNYKFLCSWAGIMCDNLSRSVISLDVSNYNLS  84

Query  286  GVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLAN  465
            G LSPD+ +L  LVNLS++ N  SG  P  I  +  L++LN+SNN FG +   + AQL  
Sbjct  85   GSLSPDITELRTLVNLSVSGNDFSGSFPAGIHKLPRLQYLNISNNGFGGSMDWEFAQLKE  144

Query  466  LQVLDLYNNNL  498
            L +LD YNN+ 
Sbjct  145  LILLDAYNNDF  155


 Score = 55.8 bits (133),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 26/75 (35%), Positives = 42/75 (56%), Gaps = 0/75 (0%)
 Frame = +1

Query  277  NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  456
            N SG + P++G    L  L ++ NQLSGP+PP++  I  L + N+S N    + P +L  
Sbjct  517  NFSGSIPPEIGNCTLLTYLDLSQNQLSGPIPPQVVQIHILNYFNVSWNHLNQSLPKELGS  576

Query  457  LANLQVLDLYNNNLT  501
            L +L   D  +N+ +
Sbjct  577  LKSLTSADFSHNSFS  591


 Score = 52.0 bits (123),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 32/74 (43%), Positives = 45/74 (61%), Gaps = 0/74 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            LSG +   +G L  L +L ++ N L+G +P E SA+  L  LNL  N F    PH++A+L
Sbjct  276  LSGSIPAQLGNLSSLRSLDLSNNALTGDIPVEFSALRELTLLNLFINKFHGEIPHEIAEL  335

Query  460  ANLQVLDLYNNNLT  501
             NL+VL L+ NN T
Sbjct  336  PNLEVLKLWQNNFT  349



>ref|XP_011045060.1| PREDICTED: receptor protein kinase CLAVATA1-like [Populus euphratica]
Length=972

 Score = 87.4 bits (215),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 53/134 (40%), Positives = 82/134 (61%), Gaps = 5/134 (4%)
 Frame = +1

Query  115  GVTEQAALLSIKAAFTADSQSSLTSWNIS----TSHCTWRRVTCdsllhvvsldlsglNL  282
            G ++   LL +K +    + + L  W  S    T+HC +  V CD    VVSL+LS  +L
Sbjct  20   GYSDLEVLLKLKTSMCGHNGTGLQDWVASPASPTAHCYFSGVMCDEDSRVVSLNLSFRHL  79

Query  283  SGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLA-QL  459
             G++ P++G L  LVNL+++ N L+G  P EI+ +++LR LN+SNN+    FP ++   +
Sbjct  80   PGLIPPEIGLLNKLVNLTLSGNNLTGGFPVEIAMLTSLRILNISNNVIAGNFPGKITLGM  139

Query  460  ANLQVLDLYNNNLT  501
            A L+VLD+YNNN T
Sbjct  140  AQLEVLDVYNNNFT  153


 Score = 49.7 bits (117),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 25/74 (34%), Positives = 44/74 (59%), Gaps = 0/74 (0%)
 Frame = +1

Query  277  NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  456
            NL G +   +GQL  L +L +  N L+G +PPE+S + +L+ L+LS N      P   + 
Sbjct  248  NLDGEIPSTLGQLTHLHSLFLQVNNLTGHIPPELSGLISLKSLDLSINNLTGEIPESFSD  307

Query  457  LANLQVLDLYNNNL  498
            L ++++++L+ N L
Sbjct  308  LKDIELVNLFQNKL  321



>ref|XP_010054700.1| PREDICTED: putative receptor-like protein kinase At3g47110 [Eucalyptus 
grandis]
Length=1018

 Score = 87.4 bits (215),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 53/128 (41%), Positives = 70/128 (55%), Gaps = 2/128 (2%)
 Frame = +1

Query  121  TEQAALLSIKAAFTADSQSSLTSWNISTSHCTWRRVTCdsll--hvvsldlsglNLSGVL  294
            T++  L S+K A   D   +L+SWN ST HC W+ V C       V SL L    L G L
Sbjct  31   TDRLVLTSLKNAIHKDPFGALSSWNDSTHHCEWQGVLCSKRHPGRVTSLVLRSQGLEGFL  90

Query  295  SPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLANLQV  474
            SP VG L FL  + +  N   G +PP+I  +  LR L LSNN FG   P  L+  +NL++
Sbjct  91   SPHVGNLSFLRVIFLQNNSFHGEIPPQIGNLLRLRVLILSNNSFGGPIPSNLSHCSNLEI  150

Query  475  LDLYNNNL  498
            L+L +N L
Sbjct  151  LNLIDNQL  158


 Score = 50.1 bits (118),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 28/73 (38%), Positives = 40/73 (55%), Gaps = 0/73 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            L+  +   +G+L  L  L +  N+ +G +P  I  I++L  LNL++NIF    P  L   
Sbjct  402  LTDCIPHSIGELSNLHQLFLGGNRFTGEIPSSIGNITSLYGLNLASNIFQGHIPQSLGNC  461

Query  460  ANLQVLDLYNNNL  498
              L VLDL NNNL
Sbjct  462  RQLIVLDLSNNNL  474



>emb|CDY36706.1| BnaC02g31270D [Brassica napus]
Length=956

 Score = 87.4 bits (215),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 52/128 (41%), Positives = 77/128 (60%), Gaps = 1/128 (1%)
 Frame = +1

Query  121  TEQAALLSIKAAFTADSQSSLTSWNISTSHCTWRRVTCdsllhvvsldlsglN-LSGVLS  297
            T+  ALLS ++  +   QS   SW+ +TS C W  VTCD+ +  V+      + L+G +S
Sbjct  31   TDSEALLSFESQMSQSPQSLSFSWDPNTSPCNWTGVTCDTRIRRVASINLSGHGLTGSIS  90

Query  298  PDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLANLQVL  477
            P +G L FL +L +  NQL GP+P EI+ +  LR LNLS+N    + P  L++L  L+VL
Sbjct  91   PSIGNLSFLTSLQLQNNQLRGPIPKEITNLFRLRVLNLSSNSLDGSLPSNLSKLIELRVL  150

Query  478  DLYNNNLT  501
            DL +N +T
Sbjct  151  DLTSNMIT  158


 Score = 55.5 bits (132),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 30/74 (41%), Positives = 45/74 (61%), Gaps = 0/74 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            ++G++   +G L  L  L++  N L GP+PP +S IS+L  L+L  N      P++L +L
Sbjct  157  ITGIVPNQLGDLKNLTILNLGKNLLHGPIPPSLSNISSLTVLSLGTNSLSGPVPNELGRL  216

Query  460  ANLQVLDLYNNNLT  501
              LQVLDL  NNL+
Sbjct  217  QRLQVLDLTINNLS  230



>ref|XP_011036960.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At3g47570 [Populus euphratica]
Length=1022

 Score = 87.0 bits (214),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 55/128 (43%), Positives = 82/128 (64%), Gaps = 1/128 (1%)
 Frame = +1

Query  121  TEQAALLSIKAAFTADSQSSLTSWNISTSHCTWRRVTCdsl-lhvvsldlsglNLSGVLS  297
            T++ ALLS+K+  T D  ++L SWN ++S C W RV+C+ +   VV LDLSGL L+G +S
Sbjct  37   TDKEALLSLKSQVTTDPSNTLFSWNNNSSPCNWTRVSCNQVNQRVVGLDLSGLRLTGSIS  96

Query  298  PDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLANLQVL  477
            P++G L FL +L +  NQ +G +P +I A+S L  LN+S N      P  + +  NLQ+L
Sbjct  97   PNIGNLSFLRSLHLQGNQFTGLIPDQIGALSRLSVLNISFNSITGRIPLNITKCLNLQIL  156

Query  478  DLYNNNLT  501
            DL  N ++
Sbjct  157  DLMQNEIS  164



>ref|XP_001752668.1| CLL1B clavata1-like receptor S/T protein kinase protein [Physcomitrella 
patens]
 gb|EDQ82539.1| CLL1B clavata1-like receptor S/T protein kinase protein [Physcomitrella 
patens]
Length=992

 Score = 87.0 bits (214),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 52/128 (41%), Positives = 84/128 (66%), Gaps = 3/128 (2%)
 Frame = +1

Query  124  EQAALLSIKAAFTADSQSSLTSW--NISTSHCTWRRVTCdsllhvvsldlsglNLSGVLS  297
            E  ALL++K++F AD Q+ L +W  N + + C W  +TC +   VV L+LS +NL+G L 
Sbjct  12   EGLALLAMKSSF-ADPQNHLENWKLNGTATPCLWTGITCSNASSVVGLNLSNMNLTGTLP  70

Query  298  PDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLANLQVL  477
             D+G+L  LVN+S+  N  +G +P EI  +  L+++N+SNN F   FP  +++L +L+VL
Sbjct  71   ADLGRLKNLVNISLDLNNFTGVLPAEIVTLLMLQYVNISNNRFNGAFPANVSRLQSLKVL  130

Query  478  DLYNNNLT  501
            D +NN+ +
Sbjct  131  DCFNNDFS  138


 Score = 52.0 bits (123),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 29/75 (39%), Positives = 39/75 (52%), Gaps = 0/75 (0%)
 Frame = +1

Query  277  NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  456
            NLS  L   +G LP L +  IA N  SGP+PP+I  + +L  L+LS N      P +++ 
Sbjct  449  NLSSKLPESIGNLPTLQSFLIANNHFSGPIPPQICDMQSLNKLDLSGNELTGLIPQEMSN  508

Query  457  LANLQVLDLYNNNLT  501
               L  LD   N LT
Sbjct  509  CKKLGSLDFSRNGLT  523


 Score = 50.8 bits (120),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 29/74 (39%), Positives = 42/74 (57%), Gaps = 0/74 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            L GV+   +G L  LV+L ++ N LSG +PP +  +  L  L+L +N F    P  +  +
Sbjct  258  LVGVIPVQIGNLVNLVSLDLSYNNLSGIIPPALIYLQKLELLSLMSNNFEGEIPDFIGDM  317

Query  460  ANLQVLDLYNNNLT  501
             NLQVL L+ N LT
Sbjct  318  PNLQVLYLWANKLT  331



>ref|XP_010277679.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
EFR [Nelumbo nucifera]
Length=1040

 Score = 87.0 bits (214),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 52/127 (41%), Positives = 73/127 (57%), Gaps = 2/127 (2%)
 Frame = +1

Query  124  EQAALLSIKAAFTADSQSSLTSWNISTSHCTWRRVTCdsllhvvsld-lsglNLSGVLSP  300
            ++ ALL  K   T D +  L+SWN S   C WR VTC      V +  L G +L+G +SP
Sbjct  47   DKQALLEFKHQ-TTDPKGVLSSWNDSLHFCQWRGVTCGRRHQRVVILNLEGHHLTGTISP  105

Query  301  DVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLANLQVLD  480
             +G L FL  + +  N L G +P E+  +  LR+++LSNN  G   P  L+Q +NL+VL 
Sbjct  106  HIGNLTFLRYIYLQNNSLYGSIPQELGRLFRLRYISLSNNTLGGEIPSNLSQCSNLRVLR  165

Query  481  LYNNNLT  501
            L NNNL+
Sbjct  166  LLNNNLS  172


 Score = 52.8 bits (125),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 28/74 (38%), Positives = 46/74 (62%), Gaps = 0/74 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            LSG L  +VG L  ++ L  +AN++SG +P  I    +L  L ++NN+F  T P  L+ L
Sbjct  514  LSGSLPSEVGNLQSILVLDFSANKMSGEIPSTIGDCLSLEDLYMNNNLFDGTIPTSLSSL  573

Query  460  ANLQVLDLYNNNLT  501
             +++ +DL +NNL+
Sbjct  574  KDIEEIDLSHNNLS  587



>ref|XP_009418700.1| PREDICTED: leucine-rich repeat receptor-like kinase protein FLORAL 
ORGAN NUMBER1 [Musa acuminata subsp. malaccensis]
Length=993

 Score = 87.0 bits (214),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 52/131 (40%), Positives = 82/131 (63%), Gaps = 2/131 (2%)
 Frame = +1

Query  115  GVTEQAALLSIKAAFTADSQSSLTSWN-ISTSHCTWRRVTCdsllhvvsldlsglNLSGV  291
            G  +  AL+ +KAA  A   S+L +W+  S  +C++  V CD    VV+L+ +G+ L+G 
Sbjct  24   GDADLEALIKLKAALVAPGSSALGNWDPASADYCSFTGVACDENSRVVALNFTGVQLNGT  83

Query  292  LSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPH-QLAQLANL  468
            L P++G L  LVNL+++ + + GP+P E++A+ +LR LN+SNN F   FPH        L
Sbjct  84   LPPEIGILSGLVNLTVSCSGVVGPLPMELAALPSLRLLNVSNNNFSGAFPHVGPGGFPTL  143

Query  469  QVLDLYNNNLT  501
            +V+D YNNN +
Sbjct  144  EVIDAYNNNFS  154


 Score = 61.2 bits (147),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 31/74 (42%), Positives = 46/74 (62%), Gaps = 0/74 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            ++G + P +G LP L NL++ +NQ+SG +PPEI  +  L  LNLS N      P  L + 
Sbjct  465  ITGSIPPAIGSLPALQNLALDSNQISGAIPPEIGQLKQLSKLNLSGNSLSGDIPVDLTRC  524

Query  460  ANLQVLDLYNNNLT  501
            ++L ++DL  NNLT
Sbjct  525  SSLVMIDLSRNNLT  538



>ref|XP_011004294.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM3 isoform X1 [Populus euphratica]
Length=988

 Score = 87.0 bits (214),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 53/128 (41%), Positives = 73/128 (57%), Gaps = 4/128 (3%)
 Frame = +1

Query  124  EQAALLSIKAAFTADSQSSLTSWNISTSH--CTWRRVTCdsllhvvsldlsg-lNLSGVL  294
            + + L+S+K +  +    SL SWN+S  H  C+W  + CD +   V        N+SG L
Sbjct  36   QASILVSLKQSLES-YDPSLDSWNVSNYHLLCSWTGIQCDDMNRSVVALDISNSNISGTL  94

Query  295  SPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLANLQV  474
            SP + +L  LVNLSI  N  S   P EI  +  L+FLN+SNN+F      + +QL  LQV
Sbjct  95   SPAITELRSLVNLSIQGNSFSDEFPREIHKLIRLQFLNISNNLFSGELAWEFSQLKELQV  154

Query  475  LDLYNNNL  498
            LD+YNNNL
Sbjct  155  LDVYNNNL  162


 Score = 54.7 bits (130),  Expect = 9e-06, Method: Compositional matrix adjust.
 Identities = 27/75 (36%), Positives = 43/75 (57%), Gaps = 0/75 (0%)
 Frame = +1

Query  277  NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  456
            NLSG + P++G    L  L ++ NQLSGP+P  I+ I  L +LN+S N    + P ++  
Sbjct  523  NLSGNIPPEIGDCRTLTYLDLSQNQLSGPIPVHITQIHILNYLNISWNHLNQSLPKEIGS  582

Query  457  LANLQVLDLYNNNLT  501
            + +L   D  +NN +
Sbjct  583  MKSLTSADFSHNNFS  597


 Score = 53.1 bits (126),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 27/74 (36%), Positives = 45/74 (61%), Gaps = 0/74 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            L+G + P++G L  +++L ++ N L+G +P E S +  L  LNL  N      P+ +A+L
Sbjct  283  LTGPIPPELGNLSSIISLDLSNNALTGDIPLEFSGLRRLTLLNLFLNKLHGEIPYFIAEL  342

Query  460  ANLQVLDLYNNNLT  501
              L+VL L++NN T
Sbjct  343  PELEVLKLWHNNFT  356


 Score = 52.4 bits (124),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 28/73 (38%), Positives = 45/73 (62%), Gaps = 0/73 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            LSG + P++G L  L  L +  N+L+GP+PPE+  +S++  L+LSNN      P + + L
Sbjct  259  LSGPIPPELGGLNKLDTLFLQTNELTGPIPPELGNLSSIISLDLSNNALTGDIPLEFSGL  318

Query  460  ANLQVLDLYNNNL  498
              L +L+L+ N L
Sbjct  319  RRLTLLNLFLNKL  331


 Score = 50.8 bits (120),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 30/75 (40%), Positives = 43/75 (57%), Gaps = 1/75 (1%)
 Frame = +1

Query  280  LSGVLSPDVGQLP-FLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  456
            LSG +   + + P  L  +++A N+LSGP+P  I   S L+ L LS N F    P Q+ Q
Sbjct  451  LSGQVPQQISKTPSKLAQMNLADNRLSGPLPASIGNFSNLQILLLSGNRFTGEIPSQIGQ  510

Query  457  LANLQVLDLYNNNLT  501
            L N+  LD+  NNL+
Sbjct  511  LKNVFTLDMSRNNLS  525


 Score = 50.4 bits (119),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 28/74 (38%), Positives = 42/74 (57%), Gaps = 0/74 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
              G + P+ G+L  LV++ +A   LSGP+PPE+  ++ L  L L  N      P +L  L
Sbjct  235  FDGGIPPEFGKLINLVHIDLANCSLSGPIPPELGGLNKLDTLFLQTNELTGPIPPELGNL  294

Query  460  ANLQVLDLYNNNLT  501
            +++  LDL NN LT
Sbjct  295  SSIISLDLSNNALT  308



>ref|XP_007025340.1| Leucine-rich repeat protein kinase family protein isoform 1 [Theobroma 
cacao]
 gb|EOY27962.1| Leucine-rich repeat protein kinase family protein isoform 1 [Theobroma 
cacao]
Length=616

 Score = 86.3 bits (212),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 58/141 (41%), Positives = 79/141 (56%), Gaps = 3/141 (2%)
 Frame = +1

Query  85   SAGAGAGKPLGVT-EQAALLSIKAAFTADSQSSLTSWNI-STSHCTWRRVTCdsllhvvs  258
            SAG     P GV  E AAL+S+K     D+++ +  W+I S   CTW  V C +   V+S
Sbjct  18   SAGDSLLSPKGVNYEVAALMSVKREMI-DARNVMDGWDINSVDPCTWNMVACSAEGFVIS  76

Query  259  ldlsglNLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTF  438
            L+++   LSG+LSP +G L  L  + +  NQLSGP+P EI   S L+ L+LS N F    
Sbjct  77   LEMASTGLSGLLSPSIGNLSHLRTMLLQNNQLSGPIPDEIGKFSELQTLDLSGNQFVGVI  136

Query  439  PHQLAQLANLQVLDLYNNNLT  501
            P  L  L +L  L L  NNL+
Sbjct  137  PSSLGSLTHLSYLRLSKNNLS  157



>ref|XP_007025341.1| Leucine-rich repeat protein kinase family protein isoform 2 [Theobroma 
cacao]
 gb|EOY27963.1| Leucine-rich repeat protein kinase family protein isoform 2 [Theobroma 
cacao]
Length=614

 Score = 86.3 bits (212),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 58/141 (41%), Positives = 79/141 (56%), Gaps = 3/141 (2%)
 Frame = +1

Query  85   SAGAGAGKPLGVT-EQAALLSIKAAFTADSQSSLTSWNI-STSHCTWRRVTCdsllhvvs  258
            SAG     P GV  E AAL+S+K     D+++ +  W+I S   CTW  V C +   V+S
Sbjct  18   SAGDSLLSPKGVNYEVAALMSVKREMI-DARNVMDGWDINSVDPCTWNMVACSAEGFVIS  76

Query  259  ldlsglNLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTF  438
            L+++   LSG+LSP +G L  L  + +  NQLSGP+P EI   S L+ L+LS N F    
Sbjct  77   LEMASTGLSGLLSPSIGNLSHLRTMLLQNNQLSGPIPDEIGKFSELQTLDLSGNQFVGVI  136

Query  439  PHQLAQLANLQVLDLYNNNLT  501
            P  L  L +L  L L  NNL+
Sbjct  137  PSSLGSLTHLSYLRLSKNNLS  157



>ref|XP_002307734.1| receptor protein kinase [Populus trichocarpa]
 gb|EEE94730.1| receptor protein kinase [Populus trichocarpa]
Length=973

 Score = 86.7 bits (213),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 53/134 (40%), Positives = 82/134 (61%), Gaps = 5/134 (4%)
 Frame = +1

Query  115  GVTEQAALLSIKAAFTADSQSSLTSWNIS----TSHCTWRRVTCdsllhvvsldlsglNL  282
            G ++   LL +K +    + + L  W  S    T+HC +  VTCD    VVSL++S  +L
Sbjct  20   GYSDLEVLLKLKTSMYGHNGTGLQDWVASPASPTAHCYFSGVTCDEDSRVVSLNVSFRHL  79

Query  283  SGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLA-QL  459
             G + P++G L  LVNL+++ N L+G  P EI+ +++LR LN+SNN+    FP ++   +
Sbjct  80   PGSIPPEIGLLNKLVNLTLSGNNLTGGFPVEIAMLTSLRILNISNNVIAGNFPGKITLGM  139

Query  460  ANLQVLDLYNNNLT  501
            A L+VLD+YNNN T
Sbjct  140  ALLEVLDVYNNNFT  153



>gb|AAT64017.1| putative leucine-rich repeat transmembrane protein [Gossypium 
hirsutum]
Length=618

 Score = 86.3 bits (212),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 60/144 (42%), Positives = 79/144 (55%), Gaps = 5/144 (3%)
 Frame = +1

Query  82   HSAGAGAG--KPLGVT-EQAALLSIKAAFTADSQSSLTSWNI-STSHCTWRRVTCdsllh  249
            HSA  G     P GV  E AAL+S+K     D Q  +  W+I S   CTW  V C +   
Sbjct  20   HSASDGDSLLSPKGVNYEVAALMSVKRELRDDKQV-MDGWDINSVDPCTWNMVACSAEGF  78

Query  250  vvsldlsglNLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFG  429
            V+SL+++   LSG+LSP +G L  L  + +  NQLSGP+P EI  +S L+ L+LS N F 
Sbjct  79   VISLEMASTGLSGMLSPSIGNLSHLRTMLLQNNQLSGPIPDEIGKLSELQTLDLSGNHFV  138

Query  430  STFPHQLAQLANLQVLDLYNNNLT  501
               P  L  L +L  L L  NNL+
Sbjct  139  GAIPSTLGSLTHLSYLRLSKNNLS  162



>gb|AHJ14779.1| CLAVATA1 [Rhododendron ovatum]
Length=992

 Score = 86.7 bits (213),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 52/129 (40%), Positives = 71/129 (55%), Gaps = 3/129 (2%)
 Frame = +1

Query  124  EQAALLSIKAAFTADSQSSLTSWNIST--SHCTWRRVTCdsllhvvsldlsg-lNLSGVL  294
            +   LLS+K AF     S LTSWN+S   S CTW  + CD+    +        N+SG L
Sbjct  37   QATILLSLKQAFEPPEDSCLTSWNVSNYNSLCTWTGIKCDAKNTSILSLDISNYNISGYL  96

Query  295  SPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLANLQV  474
             P +  +  LVNLS++ N LSG  P +I  +  L+FLN+SNN F  +   Q ++L  L V
Sbjct  97   LPAISDIHTLVNLSVSGNSLSGTFPVDIHKLVRLQFLNISNNQFNGSLNWQFSKLKKLVV  156

Query  475  LDLYNNNLT  501
            LD YNN  +
Sbjct  157  LDAYNNEFS  165


 Score = 54.3 bits (129),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 34/99 (34%), Positives = 49/99 (49%), Gaps = 25/99 (25%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNI------------  423
            L G + P++G L  L  L +  NQLSG +PPE++ ++TL+  +LSNN+            
Sbjct  261  LKGPIPPELGNLNKLDTLFLQTNQLSGSIPPELANLTTLKSFDLSNNVLTGEIPVELFSG  320

Query  424  -------------FGSTFPHQLAQLANLQVLDLYNNNLT  501
                         F    P  LA+L NL+VL L+ NN T
Sbjct  321  LKELTLLNLFLNKFHGEIPRVLAELPNLEVLKLWQNNFT  359



>ref|XP_004981595.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM1-like [Setaria italica]
Length=1029

 Score = 86.7 bits (213),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 59/116 (51%), Positives = 71/116 (61%), Gaps = 7/116 (6%)
 Frame = +1

Query  175  SSLTSWN-ISTSHCTWRRVTCd------sllhvvsldlsglNLSGVLSPDVGQLPFLVNL  333
             +L SWN  S  HC W  VTC           VV LD+SGLNLSG L   + +L  L  L
Sbjct  40   GALRSWNATSPDHCAWAGVTCAPPGGGRGGGIVVGLDVSGLNLSGALPQALSRLHGLQRL  99

Query  334  SIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLANLQVLDLYNNNLT  501
            S+AAN L GP+PP ++ +  L  LNLSNN F  +FP  LA+L  L+VLDLYNNNLT
Sbjct  100  SVAANALYGPIPPSLARLQQLVHLNLSNNAFNGSFPPALARLRGLRVLDLYNNNLT  155


 Score = 52.0 bits (123),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 26/75 (35%), Positives = 40/75 (53%), Gaps = 0/75 (0%)
 Frame = +1

Query  277  NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  456
               G + P++G+   L  L ++ N LSG +PP IS +  L +LNLS N      P  +A 
Sbjct  516  KFEGGVPPEIGKCRLLTYLDMSQNNLSGKIPPAISGMWILNYLNLSRNHLDGEIPPSIAT  575

Query  457  LANLQVLDLYNNNLT  501
            + +L  +D   NNL+
Sbjct  576  MQSLTAVDFSYNNLS  590



>ref|XP_009123620.1| PREDICTED: putative receptor-like protein kinase At3g47110 [Brassica 
rapa]
Length=1001

 Score = 86.7 bits (213),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 51/128 (40%), Positives = 78/128 (61%), Gaps = 1/128 (1%)
 Frame = +1

Query  121  TEQAALLSIKAAFTADSQSSLTSWNISTSHCTWRRVTCdsllhvvsldlsglN-LSGVLS  297
            T++ ALLS ++  + + QS   SW+ +TS C W  VTCD+ +  V+      + L+G +S
Sbjct  31   TDREALLSFESQMSQNPQSLSFSWDPNTSPCNWTGVTCDTRIRRVTSINLSGHGLTGSIS  90

Query  298  PDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLANLQVL  477
            P +G L FL +L +  NQL GP+P EI+ +  LR LNLS+N    + P  L++L  L+ L
Sbjct  91   PSIGNLSFLTSLQLQNNQLRGPIPKEITNLFRLRVLNLSSNSLDGSLPSNLSKLIELRAL  150

Query  478  DLYNNNLT  501
            DL +N +T
Sbjct  151  DLTSNMIT  158


 Score = 55.5 bits (132),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 30/74 (41%), Positives = 45/74 (61%), Gaps = 0/74 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            ++G++   +G L  L  L++  N L GP+PP +S IS+L  L+L  N      P++L +L
Sbjct  157  ITGIVPNQLGDLKNLTILNLGKNLLHGPIPPSLSNISSLTVLSLGTNSLSGPVPNELGRL  216

Query  460  ANLQVLDLYNNNLT  501
              LQVLDL  NNL+
Sbjct  217  QRLQVLDLTINNLS  230



>ref|XP_010257839.1| PREDICTED: protein NSP-INTERACTING KINASE 1-like [Nelumbo nucifera]
Length=624

 Score = 85.9 bits (211),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 55/133 (41%), Positives = 72/133 (54%), Gaps = 3/133 (2%)
 Frame = +1

Query  109  PLGVT-EQAALLSIKAAFTADSQSSLTSWN-ISTSHCTWRRVTCdsllhvvsldlsglNL  282
            P GV  E  AL+ IKA+   D    L +W+  S   C+W  VTC     V  L     NL
Sbjct  28   PKGVNFEVQALMGIKASLV-DPHGVLDNWDGDSVDPCSWTMVTCSPQSLVTGLGTPSQNL  86

Query  283  SGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLA  462
            SG LSP +G L  L  + +  N +SGP+PPE+  +S LR L+LSNN F    P  L  + 
Sbjct  87   SGTLSPSIGNLTNLQIVLLQNNNISGPLPPELGRLSKLRTLDLSNNFFSGEIPTSLGHMK  146

Query  463  NLQVLDLYNNNLT  501
            +LQ L L NN+L+
Sbjct  147  SLQYLRLNNNSLS  159



>ref|XP_011004295.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM3 isoform X2 [Populus euphratica]
Length=893

 Score = 86.3 bits (212),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 53/128 (41%), Positives = 73/128 (57%), Gaps = 4/128 (3%)
 Frame = +1

Query  124  EQAALLSIKAAFTADSQSSLTSWNISTSH--CTWRRVTCdsllhvvsldlsg-lNLSGVL  294
            + + L+S+K +  +    SL SWN+S  H  C+W  + CD +   V        N+SG L
Sbjct  36   QASILVSLKQSLES-YDPSLDSWNVSNYHLLCSWTGIQCDDMNRSVVALDISNSNISGTL  94

Query  295  SPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLANLQV  474
            SP + +L  LVNLSI  N  S   P EI  +  L+FLN+SNN+F      + +QL  LQV
Sbjct  95   SPAITELRSLVNLSIQGNSFSDEFPREIHKLIRLQFLNISNNLFSGELAWEFSQLKELQV  154

Query  475  LDLYNNNL  498
            LD+YNNNL
Sbjct  155  LDVYNNNL  162


 Score = 54.3 bits (129),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 27/75 (36%), Positives = 43/75 (57%), Gaps = 0/75 (0%)
 Frame = +1

Query  277  NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  456
            NLSG + P++G    L  L ++ NQLSGP+P  I+ I  L +LN+S N    + P ++  
Sbjct  523  NLSGNIPPEIGDCRTLTYLDLSQNQLSGPIPVHITQIHILNYLNISWNHLNQSLPKEIGS  582

Query  457  LANLQVLDLYNNNLT  501
            + +L   D  +NN +
Sbjct  583  MKSLTSADFSHNNFS  597


 Score = 52.8 bits (125),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 27/74 (36%), Positives = 45/74 (61%), Gaps = 0/74 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            L+G + P++G L  +++L ++ N L+G +P E S +  L  LNL  N      P+ +A+L
Sbjct  283  LTGPIPPELGNLSSIISLDLSNNALTGDIPLEFSGLRRLTLLNLFLNKLHGEIPYFIAEL  342

Query  460  ANLQVLDLYNNNLT  501
              L+VL L++NN T
Sbjct  343  PELEVLKLWHNNFT  356


 Score = 52.0 bits (123),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 28/73 (38%), Positives = 45/73 (62%), Gaps = 0/73 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            LSG + P++G L  L  L +  N+L+GP+PPE+  +S++  L+LSNN      P + + L
Sbjct  259  LSGPIPPELGGLNKLDTLFLQTNELTGPIPPELGNLSSIISLDLSNNALTGDIPLEFSGL  318

Query  460  ANLQVLDLYNNNL  498
              L +L+L+ N L
Sbjct  319  RRLTLLNLFLNKL  331


 Score = 50.1 bits (118),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 30/75 (40%), Positives = 43/75 (57%), Gaps = 1/75 (1%)
 Frame = +1

Query  280  LSGVLSPDVGQLP-FLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  456
            LSG +   + + P  L  +++A N+LSGP+P  I   S L+ L LS N F    P Q+ Q
Sbjct  451  LSGQVPQQISKTPSKLAQMNLADNRLSGPLPASIGNFSNLQILLLSGNRFTGEIPSQIGQ  510

Query  457  LANLQVLDLYNNNLT  501
            L N+  LD+  NNL+
Sbjct  511  LKNVFTLDMSRNNLS  525


 Score = 50.1 bits (118),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 28/74 (38%), Positives = 42/74 (57%), Gaps = 0/74 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
              G + P+ G+L  LV++ +A   LSGP+PPE+  ++ L  L L  N      P +L  L
Sbjct  235  FDGGIPPEFGKLINLVHIDLANCSLSGPIPPELGGLNKLDTLFLQTNELTGPIPPELGNL  294

Query  460  ANLQVLDLYNNNLT  501
            +++  LDL NN LT
Sbjct  295  SSIISLDLSNNALT  308



>ref|XP_007214567.1| hypothetical protein PRUPE_ppa000837mg [Prunus persica]
 gb|EMJ15766.1| hypothetical protein PRUPE_ppa000837mg [Prunus persica]
Length=986

 Score = 86.3 bits (212),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 56/133 (42%), Positives = 78/133 (59%), Gaps = 5/133 (4%)
 Frame = +1

Query  112  LGVTEQAALL-SIKAAFTADSQSSLTSWNISTSH--CTWRRVTCdsllhvvsldlsg-lN  279
            L +  QA++L S+K +F A S  SL SWN+S     C+W  + CD++   V        N
Sbjct  29   LSLRRQASILVSVKQSFEA-SNPSLNSWNVSNYMFICSWAGIHCDNMNISVVSLDISNYN  87

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            LSG LSP + +L  LVNLS++ N  SG  PPEI  ++ L++LN+SNN F      + AQL
Sbjct  88   LSGSLSPAITELRTLVNLSVSGNGFSGIFPPEIHKLARLQYLNISNNGFSGNLSWEFAQL  147

Query  460  ANLQVLDLYNNNL  498
              L +LD YNN+ 
Sbjct  148  KELILLDAYNNDF  160


 Score = 49.7 bits (117),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 31/74 (42%), Positives = 44/74 (59%), Gaps = 0/74 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            LSG +   +G L  L +L ++ N L+G +P E SA+  L  LNL  N F    PH +A+L
Sbjct  281  LSGSIPAQLGNLSSLRSLDLSNNALTGDIPAEFSALRKLTLLNLFINKFHGEIPHAIAEL  340

Query  460  ANLQVLDLYNNNLT  501
              L+VL L++NN T
Sbjct  341  PKLEVLKLWHNNFT  354



>ref|XP_008225951.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM3 [Prunus mume]
Length=986

 Score = 86.3 bits (212),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 56/133 (42%), Positives = 78/133 (59%), Gaps = 5/133 (4%)
 Frame = +1

Query  112  LGVTEQAALL-SIKAAFTADSQSSLTSWNISTSH--CTWRRVTCdsllhvvsldlsg-lN  279
            L +  QA++L S+K +F A S  SL SWN+S     C+W  + CD++   V        N
Sbjct  29   LSLRRQASILVSVKQSFEA-SNPSLNSWNVSNYMFLCSWAGIHCDNMNISVVSLDISNYN  87

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            LSG LSP + +L  LVNLS++ N  SG  PPEI  ++ L++LN+SNN F      + AQL
Sbjct  88   LSGSLSPAITELRTLVNLSVSGNGFSGIFPPEIHKLARLQYLNISNNGFSGNLSWEFAQL  147

Query  460  ANLQVLDLYNNNL  498
              L +LD YNN+ 
Sbjct  148  KELILLDAYNNDF  160


 Score = 48.9 bits (115),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 25/75 (33%), Positives = 41/75 (55%), Gaps = 0/75 (0%)
 Frame = +1

Query  277  NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  456
            N SG + P+VG    L  L ++ NQL+GP+P +I  I  L + N+S N    + P +L  
Sbjct  521  NFSGRIPPEVGNCLSLTYLDLSQNQLTGPIPFQIVQIHILNYFNVSWNHLNQSLPRELGS  580

Query  457  LANLQVLDLYNNNLT  501
            + +L   D  +N+ +
Sbjct  581  MKSLTSADFSHNSFS  595


 Score = 48.5 bits (114),  Expect = 9e-04, Method: Compositional matrix adjust.
 Identities = 31/74 (42%), Positives = 44/74 (59%), Gaps = 0/74 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            LSG +   +G L  L +L ++ N L+G +P E SA+  L  LNL  N F    PH +A+L
Sbjct  281  LSGSIPAQLGNLSSLRSLDLSNNALTGDMPAEFSALRELTLLNLFINKFHGEIPHAIAEL  340

Query  460  ANLQVLDLYNNNLT  501
              L+VL L++NN T
Sbjct  341  PKLEVLKLWHNNFT  354



>ref|XP_007021767.1| Leucine-rich repeat protein kinase family protein, putative [Theobroma 
cacao]
 gb|EOY13292.1| Leucine-rich repeat protein kinase family protein, putative [Theobroma 
cacao]
Length=1142

 Score = 86.3 bits (212),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 55/127 (43%), Positives = 74/127 (58%), Gaps = 3/127 (2%)
 Frame = +1

Query  121  TEQAALLSIKAAFTADSQSSLTSWNISTSHCTWRRVTCdsllhvvsldlsg-lNLSGVLS  297
            T+Q ALL++KA   +D  +  T+W+ +TS C W  VTC S  H V+       NL G + 
Sbjct  34   TDQLALLALKAHVNSDLLA--TNWSTATSICNWVGVTCGSRHHRVTALDLFGTNLVGTIP  91

Query  298  PDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLANLQVL  477
            PD+G L FL +L I  N L G +P E++ +  L+ L LSNN F    P  L  L+ L+VL
Sbjct  92   PDIGNLSFLASLDIGNNSLHGSLPIELANLHRLKSLILSNNNFNGEIPSSLCSLSKLEVL  151

Query  478  DLYNNNL  498
             LYNNNL
Sbjct  152  SLYNNNL  158


 Score = 51.2 bits (121),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 27/74 (36%), Positives = 38/74 (51%), Gaps = 0/74 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            L G L  D+G+   + N+  + NQLSG +P  I  +  L +L+LS N    + P     L
Sbjct  645  LRGALPIDIGKWKVVYNIDFSKNQLSGEIPRSIGDLKDLTYLSLSGNRLQGSIPESFGGL  704

Query  460  ANLQVLDLYNNNLT  501
              LQ LDL  NN +
Sbjct  705  KGLQFLDLSRNNFS  718



>ref|XP_010065839.1| PREDICTED: putative receptor-like protein kinase At3g47110 [Eucalyptus 
grandis]
Length=1017

 Score = 86.3 bits (212),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 55/129 (43%), Positives = 67/129 (52%), Gaps = 2/129 (2%)
 Frame = +1

Query  121  TEQAALLSIKAAFTADSQSSLTSWNISTSHCTWRRVTCdsll--hvvsldlsglNLSGVL  294
            T+Q AL S K A   D    L+SWN ST HC W+ V C       V SL L    L G L
Sbjct  31   TDQLALASFKNAIHEDPFGVLSSWNDSTHHCEWQGVLCSKRYPWRVTSLVLRSQGLKGFL  90

Query  295  SPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLANLQV  474
            SP VG L FL  + +  N   G +PP+I  +  LR L LSNN FG   P  L++  NL  
Sbjct  91   SPQVGNLSFLRVIILQNNSFHGEIPPQIGNLLQLRVLVLSNNSFGGPIPSNLSRCLNLNT  150

Query  475  LDLYNNNLT  501
            L+L +N L 
Sbjct  151  LNLIDNQLV  159



>ref|XP_002985227.1| hypothetical protein SELMODRAFT_121783 [Selaginella moellendorffii]
 gb|EFJ13721.1| hypothetical protein SELMODRAFT_121783 [Selaginella moellendorffii]
Length=1023

 Score = 86.3 bits (212),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 51/131 (39%), Positives = 75/131 (57%), Gaps = 3/131 (2%)
 Frame = +1

Query  115  GVTEQAALLSIKAAFTADSQSSLTSW-NISTSHCTWRRVTCdsllhvvsldlsg-lNLSG  288
            G  +++ALL++KAA   DS  SL  W     + C W  +TCD  L  V        NLSG
Sbjct  22   GFQDKSALLALKAAMI-DSSGSLDDWTETDDTPCLWTGITCDDRLSRVVALDLSNKNLSG  80

Query  289  VLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLANL  468
            + S  +G+L  L+NL++  N  +G +P E++ +  L FLN+S+N F   FP + + L  L
Sbjct  81   IFSSSIGRLTELINLTLDVNNFTGNLPSELATLHDLHFLNVSHNTFTGDFPGRFSNLQLL  140

Query  469  QVLDLYNNNLT  501
            +VLD YNNN +
Sbjct  141  EVLDAYNNNFS  151


 Score = 55.5 bits (132),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 29/74 (39%), Positives = 46/74 (62%), Gaps = 0/74 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            L GV+  ++G L  L +L +  N LSGP+PP++  +  L+ L+LSNN      P +L +L
Sbjct  247  LEGVIPAELGNLSNLDSLFLQINHLSGPIPPQLGDLVNLKSLDLSNNNLTGAIPIELRKL  306

Query  460  ANLQVLDLYNNNLT  501
             NL++L L+ N L+
Sbjct  307  QNLELLSLFLNGLS  320


 Score = 51.6 bits (122),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 31/75 (41%), Positives = 42/75 (56%), Gaps = 0/75 (0%)
 Frame = +1

Query  277  NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  456
            + +G + P++G+L  L  L IA+  L G +P E+  +S L  L L  N      P QL  
Sbjct  222  HFTGGIPPELGRLLNLQKLDIASCGLEGVIPAELGNLSNLDSLFLQINHLSGPIPPQLGD  281

Query  457  LANLQVLDLYNNNLT  501
            L NL+ LDL NNNLT
Sbjct  282  LVNLKSLDLSNNNLT  296



>ref|NP_001058840.2| Os07g0134200 [Oryza sativa Japonica Group]
 dbj|BAF20754.2| Os07g0134200 [Oryza sativa Japonica Group]
Length=883

 Score = 85.9 bits (211),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 63/130 (48%), Positives = 81/130 (62%), Gaps = 5/130 (4%)
 Frame = +1

Query  124  EQAALLSIKAAFTADSQSSLTSW--NISTSHCTWRRVTCdsllhvvsldlsglNLSGVL-  294
            E  ALL++KAA   D   +L SW  N ++S C W  V C++   VV LD+SG NL+G L 
Sbjct  27   EADALLAVKAALD-DPTGALASWTTNTTSSPCAWSGVACNARGAVVGLDVSGRNLTGGLP  85

Query  295  SPDVGQLPFLVNLSIAANQLSGPVPPEISAIST-LRFLNLSNNIFGSTFPHQLAQLANLQ  471
               +  L  L  L +AAN LSGP+P  +S ++  L  LNLSNN    TFP QL++L  L+
Sbjct  86   GAALSGLQHLARLDLAANALSGPIPAALSRLAPFLTHLNLSNNGLNGTFPPQLSRLRALR  145

Query  472  VLDLYNNNLT  501
            VLDLYNNNLT
Sbjct  146  VLDLYNNNLT  155


 Score = 52.8 bits (125),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 26/74 (35%), Positives = 40/74 (54%), Gaps = 0/74 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
              G + P++G+   L  L ++ N LSG +PP IS +  L +LNLS N      P  +A +
Sbjct  516  FDGGVPPEIGKCRLLTYLDLSRNNLSGEIPPAISGMRILNYLNLSRNQLDGEIPATIAAM  575

Query  460  ANLQVLDLYNNNLT  501
             +L  +D   NNL+
Sbjct  576  QSLTAVDFSYNNLS  589



>ref|XP_010520745.1| PREDICTED: putative receptor-like protein kinase At3g47110 [Tarenaya 
hassleriana]
Length=999

 Score = 85.9 bits (211),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 47/129 (36%), Positives = 76/129 (59%), Gaps = 1/129 (1%)
 Frame = +1

Query  118  VTEQAALLSIKAAFTADSQSSLTSWNISTSHCTWRRVTCdsllhvvsldlsg-lNLSGVL  294
            VT++ AL+S ++  + DS +  +SW+ +TS C W  V+C +    V       L  +G +
Sbjct  32   VTDREALISFRSKLSVDSPNPFSSWDKNTSPCDWTGVSCGTRNLRVISLNLSGLGFTGFI  91

Query  295  SPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLANLQV  474
            SP +G L FL +L +  N+L GP+P EI+ +  LR LNLS+N    + P   ++L  L+V
Sbjct  92   SPSIGNLSFLTSLQLQRNRLYGPIPEEIANLFRLRNLNLSSNSLEGSLPSNTSKLVELKV  151

Query  475  LDLYNNNLT  501
            LDL +N ++
Sbjct  152  LDLTSNKIS  160


 Score = 53.5 bits (127),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 31/74 (42%), Positives = 43/74 (58%), Gaps = 0/74 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            +SG +  ++G L  L  LS+  N L GP+PP ++ +S L  LNL  N      P  L++L
Sbjct  159  ISGPIPVNIGYLTKLQVLSLGKNLLHGPLPPSMANLSLLTVLNLDTNSLNGPIPESLSRL  218

Query  460  ANLQVLDLYNNNLT  501
              L+VLDL  NNLT
Sbjct  219  RRLKVLDLSINNLT  232



>gb|AAF73373.1|AF193835_1 LRK1 protein [Oryza sativa]
Length=970

 Score = 85.9 bits (211),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 63/130 (48%), Positives = 81/130 (62%), Gaps = 5/130 (4%)
 Frame = +1

Query  124  EQAALLSIKAAFTADSQSSLTSW--NISTSHCTWRRVTCdsllhvvsldlsglNLSGVL-  294
            E  ALL++KAA   D   +L SW  N ++S C W  V C++   VV LD+SG NL+G L 
Sbjct  27   EADALLAVKAALD-DPTGALASWTTNTTSSPCAWSGVACNARGAVVGLDVSGRNLTGGLP  85

Query  295  SPDVGQLPFLVNLSIAANQLSGPVPPEISAIST-LRFLNLSNNIFGSTFPHQLAQLANLQ  471
               +  L  L  L +AAN LSGP+P  +S ++  L  LNLSNN    TFP QL++L  L+
Sbjct  86   GAALSGLQHLARLDLAANALSGPIPAALSRLAPFLTHLNLSNNGLNGTFPPQLSRLRALR  145

Query  472  VLDLYNNNLT  501
            VLDLYNNNLT
Sbjct  146  VLDLYNNNLT  155


 Score = 53.1 bits (126),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 26/73 (36%), Positives = 41/73 (56%), Gaps = 0/73 (0%)
 Frame = +1

Query  283  SGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLA  462
            +G + P++G+   L  L ++ N LSG +PP IS +  L +LNLS N      P  +A + 
Sbjct  521  TGGVPPEIGKCRLLTYLDLSRNNLSGEIPPAISGMRILNYLNLSRNQLDGEIPATIAAMQ  580

Query  463  NLQVLDLYNNNLT  501
            +L  +D   NNL+
Sbjct  581  SLTAVDFSYNNLS  593



>ref|XP_002461427.1| hypothetical protein SORBIDRAFT_02g002450 [Sorghum bicolor]
 gb|EER97948.1| hypothetical protein SORBIDRAFT_02g002450 [Sorghum bicolor]
Length=1031

 Score = 85.9 bits (211),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 57/116 (49%), Positives = 73/116 (63%), Gaps = 3/116 (3%)
 Frame = +1

Query  163  ADSQSSLTSWN--ISTSHCTWRRVTCdsllhvvsldlsglNLSG-VLSPDVGQLPFLVNL  333
            +D   +L SW    ST  C W  VTC++   V+ LDLSG NLSG V +  + +L  L  L
Sbjct  42   SDPAGALASWTNATSTGPCAWSGVTCNARGAVIGLDLSGRNLSGAVPAAALSRLAHLARL  101

Query  334  SIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLANLQVLDLYNNNLT  501
             +AAN LSGP+P  +S + +L  LNLSNN+   TFP   A+L  L+VLDLYNNNLT
Sbjct  102  DLAANALSGPIPAPLSRLQSLTHLNLSNNVLNGTFPPPFARLRALRVLDLYNNNLT  157


 Score = 54.7 bits (130),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 27/74 (36%), Positives = 41/74 (55%), Gaps = 0/74 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            L G + P++G+   L  L ++ N LSG +PP IS +  L +LNLS N      P  +A +
Sbjct  518  LDGGMPPEIGKCRLLTYLDLSRNNLSGEIPPAISGMRILNYLNLSRNHLDGEIPATIAAM  577

Query  460  ANLQVLDLYNNNLT  501
             +L  +D   NNL+
Sbjct  578  QSLTAVDFSYNNLS  591



>ref|XP_009396215.1| PREDICTED: protein NSP-INTERACTING KINASE 1-like [Musa acuminata 
subsp. malaccensis]
 ref|XP_009396224.1| PREDICTED: protein NSP-INTERACTING KINASE 1-like [Musa acuminata 
subsp. malaccensis]
Length=621

 Score = 85.5 bits (210),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 59/133 (44%), Positives = 75/133 (56%), Gaps = 3/133 (2%)
 Frame = +1

Query  109  PLGVT-EQAALLSIKAAFTADSQSSLTSWNI-STSHCTWRRVTCdsllhvvsldlsglNL  282
            P GV  E  AL+ IKA+   D  S L +W+  S   C+W  +TC S   VV L   G +L
Sbjct  28   PKGVNYEVQALMGIKASLV-DPHSVLENWDKDSVDPCSWTMITCSSENLVVGLGTPGQDL  86

Query  283  SGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLA  462
            SG LSP +G L  L  + +  N +SGPVPPEI  +S L  L+LSNN F    P  L+ L 
Sbjct  87   SGTLSPSIGNLTNLEIVLLQNNNISGPVPPEIGKLSKLHTLDLSNNKFSGRIPASLSNLK  146

Query  463  NLQVLDLYNNNLT  501
             LQ L L NN+L+
Sbjct  147  GLQYLRLNNNSLS  159



>gb|EAZ02682.1| hypothetical protein OsI_24796 [Oryza sativa Indica Group]
Length=1023

 Score = 85.9 bits (211),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 63/130 (48%), Positives = 81/130 (62%), Gaps = 5/130 (4%)
 Frame = +1

Query  124  EQAALLSIKAAFTADSQSSLTSW--NISTSHCTWRRVTCdsllhvvsldlsglNLSGVL-  294
            E  ALL++KAA   D   +L SW  N ++S C W  V C++   VV LD+SG NL+G L 
Sbjct  27   EADALLAVKAALD-DPTGALASWTTNTTSSPCAWSGVACNARGAVVGLDVSGRNLTGGLP  85

Query  295  SPDVGQLPFLVNLSIAANQLSGPVPPEISAIST-LRFLNLSNNIFGSTFPHQLAQLANLQ  471
               +  L  L  L +AAN LSGP+P  +S ++  L  LNLSNN    TFP QL++L  L+
Sbjct  86   GAALSGLQHLARLDLAANALSGPIPAALSRLAPFLTHLNLSNNGLNGTFPPQLSRLRALR  145

Query  472  VLDLYNNNLT  501
            VLDLYNNNLT
Sbjct  146  VLDLYNNNLT  155


 Score = 52.8 bits (125),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 26/75 (35%), Positives = 41/75 (55%), Gaps = 0/75 (0%)
 Frame = +1

Query  277  NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  456
            +  G + P++G+   L  L ++ N LSG +PP IS +  L +LNLS N      P  +A 
Sbjct  515  SFDGGVPPEIGKCRLLTYLDLSRNNLSGEIPPAISGMRILNYLNLSRNQLDGEIPATIAA  574

Query  457  LANLQVLDLYNNNLT  501
            + +L  +D   NNL+
Sbjct  575  MQSLTAVDFSYNNLS  589



>dbj|BAC82955.1| putative OsLRK1(receptor-type protein kinase) [Oryza sativa Japonica 
Group]
 dbj|BAD30615.1| putative OsLRK1(receptor-type protein kinase) [Oryza sativa Japonica 
Group]
 gb|EAZ38608.1| hypothetical protein OsJ_22997 [Oryza sativa Japonica Group]
 dbj|BAH01666.1| unnamed protein product [Oryza sativa Japonica Group]
Length=1023

 Score = 85.9 bits (211),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 63/130 (48%), Positives = 81/130 (62%), Gaps = 5/130 (4%)
 Frame = +1

Query  124  EQAALLSIKAAFTADSQSSLTSW--NISTSHCTWRRVTCdsllhvvsldlsglNLSGVL-  294
            E  ALL++KAA   D   +L SW  N ++S C W  V C++   VV LD+SG NL+G L 
Sbjct  27   EADALLAVKAALD-DPTGALASWTTNTTSSPCAWSGVACNARGAVVGLDVSGRNLTGGLP  85

Query  295  SPDVGQLPFLVNLSIAANQLSGPVPPEISAIST-LRFLNLSNNIFGSTFPHQLAQLANLQ  471
               +  L  L  L +AAN LSGP+P  +S ++  L  LNLSNN    TFP QL++L  L+
Sbjct  86   GAALSGLQHLARLDLAANALSGPIPAALSRLAPFLTHLNLSNNGLNGTFPPQLSRLRALR  145

Query  472  VLDLYNNNLT  501
            VLDLYNNNLT
Sbjct  146  VLDLYNNNLT  155


 Score = 52.8 bits (125),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 26/75 (35%), Positives = 41/75 (55%), Gaps = 0/75 (0%)
 Frame = +1

Query  277  NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  456
            +  G + P++G+   L  L ++ N LSG +PP IS +  L +LNLS N      P  +A 
Sbjct  515  SFDGGVPPEIGKCRLLTYLDLSRNNLSGEIPPAISGMRILNYLNLSRNQLDGEIPATIAA  574

Query  457  LANLQVLDLYNNNLT  501
            + +L  +D   NNL+
Sbjct  575  MQSLTAVDFSYNNLS  589



>emb|CDX73202.1| BnaC06g36500D [Brassica napus]
Length=987

 Score = 85.9 bits (211),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 54/132 (41%), Positives = 84/132 (64%), Gaps = 5/132 (4%)
 Frame = +1

Query  121  TEQAALLSIKAAFTADSQSSLTSWNISTS---HCTWRRVTCdsllhvvsldlsglNLSGV  291
            T+   LL++K++    +   L  W  STS   HC++  V+CD    V+SL++S   L G 
Sbjct  33   TDMDHLLTLKSSMVGPNGHGLHDWVHSTSPSAHCSFSGVSCDGDARVISLNVSFTPLFGT  92

Query  292  LSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNI-FGSTFPHQ-LAQLAN  465
            +SP++G L  LVNL++AAN  SG +P E+ ++++L+ LN+SNN+    TFP + L  + +
Sbjct  93   ISPEIGMLDRLVNLTLAANNFSGMLPLEMKSLTSLKVLNISNNVNLNGTFPGEILTPMVD  152

Query  466  LQVLDLYNNNLT  501
            L+VLD YNNN T
Sbjct  153  LEVLDAYNNNFT  164



>gb|ACD56664.1| putative leucine-rich repeat transmembrane protein [Gossypium 
arboreum]
 gb|KHG23954.1| hypothetical protein F383_02006 [Gossypium arboreum]
Length=618

 Score = 85.1 bits (209),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 56/133 (42%), Positives = 75/133 (56%), Gaps = 3/133 (2%)
 Frame = +1

Query  109  PLGVT-EQAALLSIKAAFTADSQSSLTSWNI-STSHCTWRRVTCdsllhvvsldlsglNL  282
            P GV  E AAL+S+K     D Q  +  W+I S   CTW  V C +   V+SL+++   L
Sbjct  31   PKGVNYEVAALMSVKRELRDDKQV-MDGWDINSVDPCTWNMVACSAEGFVISLEMASTGL  89

Query  283  SGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLA  462
            SG+LSP +G L  L  + +  NQLSGP+P EI  +S L+ L+LS N F    P  L  L 
Sbjct  90   SGMLSPSIGNLSHLRTMLLQNNQLSGPIPDEIGKLSELQTLDLSGNHFVGAIPSTLGSLT  149

Query  463  NLQVLDLYNNNLT  501
            +L  L L  NNL+
Sbjct  150  HLSYLRLSKNNLS  162



>gb|KFK42020.1| hypothetical protein AALP_AA2G201900 [Arabis alpina]
Length=974

 Score = 85.5 bits (210),  Expect = 7e-16, Method: Compositional matrix adjust.
 Identities = 55/132 (42%), Positives = 84/132 (64%), Gaps = 5/132 (4%)
 Frame = +1

Query  121  TEQAALLSIKAAFTADSQSSLTSWNISTS---HCTWRRVTCdsllhvvsldlsglNLSGV  291
            T+   LL++K++ T  + + L  W  STS   HC++  VTC+S   V+SL++S   L G 
Sbjct  30   TDMETLLNLKSSMTGPNGAGLHDWLHSTSPTSHCSFSGVTCNSQSRVISLNISFTPLFGT  89

Query  292  LSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNI-FGSTFPHQL-AQLAN  465
            +SP++G L  LVNL++AAN  SG +P  +  +++L+ LN+SNN     TFP ++   + N
Sbjct  90   ISPEIGNLNHLVNLTLAANNFSGNLPTSLKNLTSLKILNISNNGNLNGTFPGEIFIYMTN  149

Query  466  LQVLDLYNNNLT  501
            L+VLD YNNN T
Sbjct  150  LEVLDAYNNNFT  161



>ref|XP_007151443.1| hypothetical protein PHAVU_004G046800g [Phaseolus vulgaris]
 gb|ESW23437.1| hypothetical protein PHAVU_004G046800g [Phaseolus vulgaris]
Length=626

 Score = 84.7 bits (208),  Expect = 8e-16, Method: Compositional matrix adjust.
 Identities = 53/132 (40%), Positives = 74/132 (56%), Gaps = 3/132 (2%)
 Frame = +1

Query  109  PLGVT-EQAALLSIKAAFTADSQSSLTSWN-ISTSHCTWRRVTCdsllhvvsldlsglNL  282
            P GV  E  AL+ IKA F  D    L +W+  +   C+W  VTC     V+SL +   NL
Sbjct  29   PKGVNFEVQALMGIKA-FLVDPHGILDNWDGDAVDPCSWNMVTCSPENLVISLGIPSQNL  87

Query  283  SGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLA  462
            SG+LSP +G L +L  + +  N ++GP+P EI  +S L+ L+LS+N F    P  L  L 
Sbjct  88   SGILSPSIGNLTYLQTVVLQNNNITGPIPSEIGKLSKLQTLDLSDNFFNGEIPPSLGHLR  147

Query  463  NLQVLDLYNNNL  498
            +LQ L L NN+ 
Sbjct  148  SLQYLRLNNNSF  159



>ref|XP_007214129.1| hypothetical protein PRUPE_ppa018020mg, partial [Prunus persica]
 gb|EMJ15328.1| hypothetical protein PRUPE_ppa018020mg, partial [Prunus persica]
Length=1216

 Score = 85.5 bits (210),  Expect = 8e-16, Method: Compositional matrix adjust.
 Identities = 52/136 (38%), Positives = 74/136 (54%), Gaps = 1/136 (1%)
 Frame = +1

Query  97   GAGKPLGVTEQAALLSIKAAFTADSQSSLTSWNISTSHCTWRRVTCdsllhvvsld-lsg  273
            GA K    T+Q+ALL++++  T+D Q+ L +W+ STS C W  VTC +    V    LS 
Sbjct  251  GAAKTNITTDQSALLAMRSHITSDPQNILVNWSTSTSVCNWVGVTCGARHLRVVSLNLSY  310

Query  274  lNLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLA  453
            +  +G + P VG L FLV LS   N   G +P E+S +  L+F++L  N F  + P    
Sbjct  311  MGFTGTIPPHVGNLSFLVALSFNNNSFYGTLPHELSYLRRLKFISLGFNNFMGSIPSWFG  370

Query  454  QLANLQVLDLYNNNLT  501
                LQ LDLY N  +
Sbjct  371  SFPKLQRLDLYGNQFS  386


 Score = 50.4 bits (119),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 29/74 (39%), Positives = 41/74 (55%), Gaps = 0/74 (0%)
 Frame = +1

Query  277  NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  456
            +LSG++   +G L  LVNLS+A N L GP+P     + +L  L+LS N      P  L  
Sbjct  745  HLSGIMPSTIGGLQDLVNLSLANNNLEGPIPSAFDGLLSLEQLDLSRNNLSGVIPKSLEA  804

Query  457  LANLQVLDLYNNNL  498
            L+ L+ +DL  N L
Sbjct  805  LSLLKYMDLSFNRL  818



>ref|XP_008808401.1| PREDICTED: leucine-rich repeat receptor-like kinase protein FLORAL 
ORGAN NUMBER1 [Phoenix dactylifera]
Length=989

 Score = 85.1 bits (209),  Expect = 9e-16, Method: Compositional matrix adjust.
 Identities = 50/124 (40%), Positives = 76/124 (61%), Gaps = 1/124 (1%)
 Frame = +1

Query  133  ALLSIKAAFTADSQSSLTSWNIST-SHCTWRRVTCdsllhvvsldlsglNLSGVLSPDVG  309
            AL+ +K      + + L  W+ S  +HC++  VTCD+   VV+L++S +     L P++ 
Sbjct  31   ALMKLKEGLLGSAGNDLHDWDPSAPTHCSFSGVTCDADARVVALNVSHIRFHRPLPPEIS  90

Query  310  QLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLANLQVLDLYN  489
            +L  LVNL++A + L+G +PPEI+A+  LRFLN+SNN F   FP        L+VLD YN
Sbjct  91   RLDRLVNLTVACDSLAGRLPPEIAALPALRFLNISNNNFTGHFPDVDGGFLALEVLDAYN  150

Query  490  NNLT  501
            NN +
Sbjct  151  NNFS  154


 Score = 49.3 bits (116),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 29/75 (39%), Positives = 42/75 (56%), Gaps = 1/75 (1%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            +SG + P +G    L  LS+ +N++SG +PP+I  +  L  LNLS N      P  LA+ 
Sbjct  465  ISGPIPPAIGNFRGLQTLSLQSNRISGEIPPQIGDLKQLSNLNLSGNNLTGEIPSDLARC  524

Query  460  AN-LQVLDLYNNNLT  501
            A  L+ +DL  N LT
Sbjct  525  AGTLEAVDLSRNRLT  539



>gb|EEC68381.1| hypothetical protein OsI_36527 [Oryza sativa Indica Group]
Length=713

 Score = 84.7 bits (208),  Expect = 9e-16, Method: Compositional matrix adjust.
 Identities = 51/130 (39%), Positives = 74/130 (57%), Gaps = 4/130 (3%)
 Frame = +1

Query  115  GVTEQAALLSIKAAFTADSQSSLTSWNISTSHCTWRRVTCdsl--lhvvsldlsglNLSG  288
            G+ ++ ALLS ++   +D    L SWN S+ +C+W  V C       VV+L +S  NLSG
Sbjct  34   GMADEPALLSFESMLLSDG--FLASWNASSHYCSWPGVVCGGRHPERVVALQMSSFNLSG  91

Query  289  VLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLANL  468
             +SP +G L  L  L +  NQ +G +PPEI  ++ LR LNLS+N    + P  + + A L
Sbjct  92   RISPSLGNLSLLRELELGDNQFTGDIPPEIGQLTRLRMLNLSSNYLQGSIPASIGECAEL  151

Query  469  QVLDLYNNNL  498
              +DL NN L
Sbjct  152  MSIDLGNNQL  161


 Score = 53.9 bits (128),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 29/75 (39%), Positives = 43/75 (57%), Gaps = 0/75 (0%)
 Frame = +1

Query  277  NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  456
            NL G +  ++G L  LV     +N+LSG +P  +     L+ ++L NN    + P  L+Q
Sbjct  442  NLEGSIPQEIGGLKNLVQFYADSNKLSGEIPSTLGECQLLQNISLQNNFLSGSVPSLLSQ  501

Query  457  LANLQVLDLYNNNLT  501
            L  LQ+LDL NNNL+
Sbjct  502  LKGLQILDLSNNNLS  516



>gb|KCW63525.1| hypothetical protein EUGRSUZ_G01159 [Eucalyptus grandis]
Length=566

 Score = 84.3 bits (207),  Expect = 9e-16, Method: Compositional matrix adjust.
 Identities = 53/129 (41%), Positives = 69/129 (53%), Gaps = 2/129 (2%)
 Frame = +1

Query  121  TEQAALLSIKAAFTADSQSSLTSWNISTSHCTWRRVTCdsll--hvvsldlsglNLSGVL  294
            T++ AL   K A   D    L+SWN ST HC W+ V C       V SL L    L G L
Sbjct  36   TDRVALAFFKNAIHEDPLGVLSSWNDSTHHCEWQGVLCRKRHPGRVTSLVLRSQGLKGFL  95

Query  295  SPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLANLQV  474
            SP VG L FL  + +  N   G +PP+I  +  LR L LSNN FG   P  L++ +NL++
Sbjct  96   SPYVGNLSFLRVIILQNNSFHGEIPPQIGNLLRLRVLYLSNNSFGGLIPSNLSRCSNLEI  155

Query  475  LDLYNNNLT  501
            L+L +N L 
Sbjct  156  LNLVDNRLV  164



>ref|XP_002305057.2| hypothetical protein POPTR_0004s05880g [Populus trichocarpa]
 gb|EEE85568.2| hypothetical protein POPTR_0004s05880g [Populus trichocarpa]
Length=1005

 Score = 85.1 bits (209),  Expect = 9e-16, Method: Compositional matrix adjust.
 Identities = 49/135 (36%), Positives = 73/135 (54%), Gaps = 1/135 (1%)
 Frame = +1

Query  100  AGKPLGVTEQAALLSIKAAFTADSQSSLTSWNISTSHCTWRRVTCdsllhvvsldlsg-l  276
            A  P   T++ ALLS K+    D  ++L+SWN ++S C W RV C  +   V       L
Sbjct  28   AAVPGLFTDKEALLSFKSQVVVDPSNTLSSWNDNSSPCNWTRVDCSQVHQRVIGLDLSGL  87

Query  277  NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  456
             L+G +SP +G L FL +L +  NQ +G +P +I A+  L+ LN+S N      P  +  
Sbjct  88   RLTGSISPHIGNLSFLRSLHLQENQFTGVIPDQIGALFRLKVLNMSFNTINGPIPLNITN  147

Query  457  LANLQVLDLYNNNLT  501
              NLQ+LDL  N ++
Sbjct  148  CLNLQILDLMQNEIS  162


 Score = 50.1 bits (118),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 30/74 (41%), Positives = 42/74 (57%), Gaps = 0/74 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            +SG +  ++  L  L  L +  N+L G +PP I+ IS+L  L+L  N  G   P  L +L
Sbjct  161  ISGAIPEELSNLKSLEILKLGGNKLWGMIPPVIANISSLLTLDLVTNNLGGMIPADLGRL  220

Query  460  ANLQVLDLYNNNLT  501
             NL+ LDL  NNLT
Sbjct  221  ENLKHLDLSINNLT  234



>ref|XP_006663536.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At3g47570-like [Oryza brachyantha]
Length=1062

 Score = 85.1 bits (209),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 51/127 (40%), Positives = 71/127 (56%), Gaps = 2/127 (2%)
 Frame = +1

Query  124  EQAALLSIKAAFTADSQSSLTSWNISTSHCTWRRVTCdsl--lhvvsldlsglNLSGVLS  297
            ++ ALLS K+  ++ + S L SWN ST +C+W  V C       V +L +   NLSG +S
Sbjct  38   DELALLSFKSMLSSPATSPLASWNASTPYCSWPGVACSRRHPERVTALRVGSFNLSGQIS  97

Query  298  PDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLANLQVL  477
            P +  L FL  L ++ NQL+G VPPE+  +  L  LNL+ N    T P  +    NL VL
Sbjct  98   PVLANLSFLRELDLSENQLTGEVPPELGRLGRLESLNLAANTLQGTLPMAIGNCTNLVVL  157

Query  478  DLYNNNL  498
            DL +N L
Sbjct  158  DLSSNQL  164


 Score = 53.1 bits (126),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 29/75 (39%), Positives = 40/75 (53%), Gaps = 0/75 (0%)
 Frame = +1

Query  277  NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  456
            NL G +  ++G L  LV     +N+LSG +PP +     L+   L NN    T P  L+Q
Sbjct  535  NLEGSIPQEIGHLINLVEFHAESNKLSGEIPPSLGECQLLQNFYLQNNFINGTIPSVLSQ  594

Query  457  LANLQVLDLYNNNLT  501
            L  L+ LDL NN L+
Sbjct  595  LKGLENLDLSNNKLS  609



>ref|XP_010690942.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At3g47570 [Beta vulgaris subsp. vulgaris]
Length=1030

 Score = 85.1 bits (209),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 51/128 (40%), Positives = 70/128 (55%), Gaps = 1/128 (1%)
 Frame = +1

Query  121  TEQAALLSIKAAFTADSQSSLTSWNISTSHCTWRRVTCdsllhvvsld-lsglNLSGVLS  297
            T+Q ALL +K+  T D    ++SWN +   CTW  VTCD + H V    L   NL+G++S
Sbjct  29   TDQKALLEMKSKITHDPLGVMSSWNDNLPFCTWHGVTCDRVHHRVIALDLQSSNLTGIIS  88

Query  298  PDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLANLQVL  477
            P +G L FL  L I  N L G +PPEI  +  LR + L NN  G   P  ++  ++L  L
Sbjct  89   PYLGNLSFLRELHIENNNLQGTIPPEIGRLHRLRVMWLVNNSIGGKIPRDISGCSSLVSL  148

Query  478  DLYNNNLT  501
             +Y N L 
Sbjct  149  YIYRNKLV  156


 Score = 49.3 bits (116),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 31/75 (41%), Positives = 37/75 (49%), Gaps = 0/75 (0%)
 Frame = +1

Query  277  NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  456
            +LSG+L  +VG L  L  L +  N  SG +P  I     L  L L  N F    P  L  
Sbjct  497  HLSGLLPQEVGLLNNLAGLDLTRNMFSGEIPHTIGQCIALEELYLGRNYFQGAIPDALQM  556

Query  457  LANLQVLDLYNNNLT  501
            L  LQVLDL  NNL+
Sbjct  557  LKGLQVLDLSQNNLS  571



>ref|XP_006382632.1| hypothetical protein POPTR_0005s03970g [Populus trichocarpa]
 gb|ERP60429.1| hypothetical protein POPTR_0005s03970g [Populus trichocarpa]
Length=1060

 Score = 85.1 bits (209),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 49/128 (38%), Positives = 74/128 (58%), Gaps = 1/128 (1%)
 Frame = +1

Query  121  TEQAALLSIKAAFTADSQSSLTSWNISTSHCTWRRVTCdsllhvvsldlsg-lNLSGVLS  297
            T++ ALLS+K+  T D  ++L+SWN S+S C W RV+C+ +   V       L L+G +S
Sbjct  68   TDKEALLSLKSQVTTDPSNTLSSWNNSSSPCNWTRVSCNQVNQRVIGLDLSGLRLTGSIS  127

Query  298  PDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLANLQVL  477
            P++G L  L +L +  NQ +G +P +I A+S L  LN+S N      P       NLQ+L
Sbjct  128  PNIGNLSLLRSLHLQGNQFTGLIPDQIGALSRLSVLNISFNSINGPIPLNTTMCLNLQIL  187

Query  478  DLYNNNLT  501
            DL  N ++
Sbjct  188  DLMQNEIS  195


 Score = 49.7 bits (117),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 28/74 (38%), Positives = 41/74 (55%), Gaps = 0/74 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            +SG +  ++  L  L  L++  N+L G +PP  + IS+L  LNL+ N  G   P    + 
Sbjct  194  ISGAIPEELSSLKNLEILNLGGNKLWGTIPPSFANISSLLTLNLATNNLGGMIPDDFGRF  253

Query  460  ANLQVLDLYNNNLT  501
             NL+ LDL  NNLT
Sbjct  254  KNLKHLDLSINNLT  267



>ref|XP_010100900.1| Protein NSP-INTERACTING KINASE 1 [Morus notabilis]
 gb|EXB85824.1| Protein NSP-INTERACTING KINASE 1 [Morus notabilis]
Length=695

 Score = 84.7 bits (208),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 56/141 (40%), Positives = 72/141 (51%), Gaps = 3/141 (2%)
 Frame = +1

Query  85   SAGAGAGKPLGVT-EQAALLSIKAAFTADSQSSLTSWN-ISTSHCTWRRVTCdsllhvvs  258
            S   G   P GV  E  AL+ IK +   D    L +W+  S   C+W  VTC     V+ 
Sbjct  21   SCANGILSPKGVNFEVQALMGIKHSL-EDPHGVLENWDGDSVDPCSWTMVTCSPESLVIG  79

Query  259  ldlsglNLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTF  438
            L     NLSG LSP +G L  L  + +  N + GPVPPE+  +  L  L+LSNN+F    
Sbjct  80   LGTPSQNLSGTLSPSIGNLTNLQIVLLQNNNIRGPVPPELGKLQKLHTLDLSNNMFTGEI  139

Query  439  PHQLAQLANLQVLDLYNNNLT  501
            P  L  L NLQ LD+  NNL+
Sbjct  140  PSSLGHLRNLQYLDMSYNNLS  160



>gb|KCW60108.1| hypothetical protein EUGRSUZ_H02842, partial [Eucalyptus grandis]
Length=940

 Score = 84.7 bits (208),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 52/129 (40%), Positives = 67/129 (52%), Gaps = 1/129 (1%)
 Frame = +1

Query  118  VTEQAALLSIKAAFTADSQSSLTSWNISTSHCTWRRVTCdsllhvvsldls-glNLSGVL  294
            +T++ ALL+ KA  T D   +L SWN +T HC W  V C  L   V+      L LSG +
Sbjct  1    MTDKLALLAFKATITEDPFGALNSWNHTTDHCQWHGVMCGHLHRRVTGLNLPSLKLSGSI  60

Query  295  SPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLANLQV  474
            SP +G L FL  L +  N     +P E+S + +LRFL LSNN      P  L+  A L  
Sbjct  61   SPHIGNLSFLRTLMLKNNSFHHKIPQEVSHLHSLRFLLLSNNTLDGEIPRNLSSCARLTR  120

Query  475  LDLYNNNLT  501
            L L NN L 
Sbjct  121  LGLANNRLV  129



>ref|XP_010026766.1| PREDICTED: putative receptor-like protein kinase At3g47110 [Eucalyptus 
grandis]
Length=985

 Score = 85.1 bits (209),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 52/129 (40%), Positives = 67/129 (52%), Gaps = 1/129 (1%)
 Frame = +1

Query  118  VTEQAALLSIKAAFTADSQSSLTSWNISTSHCTWRRVTCdsllhvvsldls-glNLSGVL  294
            +T++ ALL+ KA  T D   +L SWN +T HC W  V C  L   V+      L LSG +
Sbjct  1    MTDKLALLAFKATITEDPFGALNSWNHTTDHCQWHGVMCGHLHRRVTGLNLPSLKLSGSI  60

Query  295  SPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLANLQV  474
            SP +G L FL  L +  N     +P E+S + +LRFL LSNN      P  L+  A L  
Sbjct  61   SPHIGNLSFLRTLMLKNNSFHHKIPQEVSHLHSLRFLLLSNNTLDGEIPRNLSSCARLTR  120

Query  475  LDLYNNNLT  501
            L L NN L 
Sbjct  121  LGLANNRLV  129



>emb|CAH56437.1| somatic embryogenesis receptor-like kinase 1 [Poa pratensis]
Length=629

 Score = 84.3 bits (207),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 54/141 (38%), Positives = 80/141 (57%), Gaps = 3/141 (2%)
 Frame = +1

Query  85   SAGAGAGKPLGVT-EQAALLSIKAAFTADSQSSLTSWNI-STSHCTWRRVTCdsllhvvs  258
            SAG     P G+  E AAL+++K+    D +  +  W+I S   CTW  VTC +   VVS
Sbjct  32   SAGDPPLSPKGLNYEVAALMAVKSRMR-DEKGVMAGWDINSVDPCTWSMVTCSADQFVVS  90

Query  259  ldlsglNLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTF  438
            L ++   L+G LSP +G L +L  + +  N++SG +PPE+  ++ L+ L+LS N F    
Sbjct  91   LQMANNGLAGALSPSIGNLSYLQTMLLQNNRISGDIPPEVGKLAKLKALDLSGNQFLGEI  150

Query  439  PHQLAQLANLQVLDLYNNNLT  501
            P+ L QL  L  L L  NNL+
Sbjct  151  PNSLGQLTQLNYLRLDRNNLS  171



>ref|XP_009400102.1| PREDICTED: protein NSP-INTERACTING KINASE 1-like isoform X1 [Musa 
acuminata subsp. malaccensis]
Length=627

 Score = 84.3 bits (207),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 52/132 (39%), Positives = 69/132 (52%), Gaps = 1/132 (1%)
 Frame = +1

Query  109  PLGVTEQAALLSIKAAFTADSQSSLTSWNI-STSHCTWRRVTCdsllhvvsldlsglNLS  285
            P GV  +  +L    A+  D    L +W+  S   C+W  VTC     V+ L     NLS
Sbjct  31   PKGVNFEVQVLMGIKAYLVDPHGVLENWDQDSVDPCSWTMVTCSPENSVIGLATPSQNLS  90

Query  286  GVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLAN  465
            G L+P +G L  L  L +  N LSGPVPPEI  +S L+ ++LSNN F    P  +  L  
Sbjct  91   GTLNPSIGNLTNLQILFLQNNNLSGPVPPEIGKLSKLQTVDLSNNYFSGKIPASVGNLNG  150

Query  466  LQVLDLYNNNLT  501
            LQ + L NN+LT
Sbjct  151  LQYMRLNNNSLT  162



>ref|XP_009391272.1| PREDICTED: protein NSP-INTERACTING KINASE 1-like isoform X1 [Musa 
acuminata subsp. malaccensis]
Length=646

 Score = 84.3 bits (207),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 56/140 (40%), Positives = 79/140 (56%), Gaps = 3/140 (2%)
 Frame = +1

Query  88   AGAGAGKPLGVT-EQAALLSIKAAFTADSQSSLTSWNI-STSHCTWRRVTCdsllhvvsl  261
            + AG   P GV  E  AL+ +KA+   D  S L +W+  S   C+W  VTC     V+ L
Sbjct  42   SAAGVLSPKGVNYEVQALMGVKASL-KDPHSVLENWDQDSVDPCSWTMVTCSPENLVIGL  100

Query  262  dlsglNLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFP  441
                 NLSG LSP +G L  L  + +  N +SGP+P EI+ +S L+ L+LSNN F    P
Sbjct  101  GTPSQNLSGTLSPSIGNLTNLQIILLQNNNISGPIPQEIARLSNLKTLDLSNNNFNGEIP  160

Query  442  HQLAQLANLQVLDLYNNNLT  501
              ++ L++LQ L L NN+L+
Sbjct  161  TSISYLSSLQYLRLNNNSLS  180



>ref|XP_009400110.1| PREDICTED: protein NSP-INTERACTING KINASE 1-like isoform X2 [Musa 
acuminata subsp. malaccensis]
Length=624

 Score = 84.3 bits (207),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 52/132 (39%), Positives = 69/132 (52%), Gaps = 1/132 (1%)
 Frame = +1

Query  109  PLGVTEQAALLSIKAAFTADSQSSLTSWNI-STSHCTWRRVTCdsllhvvsldlsglNLS  285
            P GV  +  +L    A+  D    L +W+  S   C+W  VTC     V+ L     NLS
Sbjct  31   PKGVNFEVQVLMGIKAYLVDPHGVLENWDQDSVDPCSWTMVTCSPENSVIGLATPSQNLS  90

Query  286  GVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLAN  465
            G L+P +G L  L  L +  N LSGPVPPEI  +S L+ ++LSNN F    P  +  L  
Sbjct  91   GTLNPSIGNLTNLQILFLQNNNLSGPVPPEIGKLSKLQTVDLSNNYFSGKIPASVGNLNG  150

Query  466  LQVLDLYNNNLT  501
            LQ + L NN+LT
Sbjct  151  LQYMRLNNNSLT  162



>emb|CDX87661.1| BnaA07g32120D [Brassica napus]
Length=965

 Score = 84.7 bits (208),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 54/135 (40%), Positives = 86/135 (64%), Gaps = 5/135 (4%)
 Frame = +1

Query  112  LGVTEQAALLSIKAAFTADSQSSLTSWNIS---TSHCTWRRVTCdsllhvvsldlsglNL  282
            L  T+   LL++K++    + + L  W  S   T+HC++  V+CD    V+SL++S   L
Sbjct  30   LASTDMDHLLTLKSSMVGPNGNGLHDWVHSPSPTAHCSFSGVSCDGDARVISLNVSFTPL  89

Query  283  SGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNI-FGSTFPHQ-LAQ  456
             G +SP++G L  LVNL++AAN  SG +P E+ ++++L+ LN+SNN+    TFP + L  
Sbjct  90   FGTISPEIGMLNRLVNLTLAANNFSGMLPLEMKSLTSLKVLNISNNVNLNGTFPGEILTP  149

Query  457  LANLQVLDLYNNNLT  501
            + +L+VLD YNNN T
Sbjct  150  MVDLEVLDAYNNNFT  164



>ref|XP_007154851.1| hypothetical protein PHAVU_003G152900g [Phaseolus vulgaris]
 gb|ESW26845.1| hypothetical protein PHAVU_003G152900g [Phaseolus vulgaris]
Length=634

 Score = 84.3 bits (207),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 52/127 (41%), Positives = 73/127 (57%), Gaps = 2/127 (2%)
 Frame = +1

Query  124  EQAALLSIKAAFTADSQSSLTSWN-ISTSHCTWRRVTCdsllhvvsldlsglNLSGVLSP  300
            E  AL++IKAA   D    L +W+  S   C+W  +TC S   V+ L     +LSG  SP
Sbjct  24   EVEALMNIKAALN-DPHGVLNNWDEYSVDACSWTMITCSSDDLVIGLGAPSQSLSGTFSP  82

Query  301  DVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLANLQVLD  480
             +G L  L  + +  N +SG +PPE+ A+  L+ L+LSNN+F    P  L+QL +LQ L 
Sbjct  83   AIGNLTNLRQVLLQNNNISGNIPPELGALPKLQTLDLSNNLFSGVIPASLSQLNSLQYLR  142

Query  481  LYNNNLT  501
            L NNNL+
Sbjct  143  LNNNNLS  149



>ref|XP_002269902.1| PREDICTED: protein NSP-INTERACTING KINASE 1 [Vitis vinifera]
 emb|CBI27432.3| unnamed protein product [Vitis vinifera]
Length=625

 Score = 84.3 bits (207),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 54/133 (41%), Positives = 75/133 (56%), Gaps = 3/133 (2%)
 Frame = +1

Query  109  PLGVT-EQAALLSIKAAFTADSQSSLTSWNI-STSHCTWRRVTCdsllhvvsldlsglNL  282
            P GV  E  AL+SIK +   D +S L +W+  +   C+W  +TC     V+SL     NL
Sbjct  28   PKGVNFEVQALMSIKNSLI-DPRSVLENWDKDAVDPCSWNMITCSDDKLVISLGTPSQNL  86

Query  283  SGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLA  462
            SG LSP +G L  L  + +  N +SGP+P E+  +S L  L+LSNN F    P  L+ L 
Sbjct  87   SGTLSPSIGNLTNLQTVLLQDNSISGPIPSELGKLSKLHLLDLSNNFFNGEIPTSLSHLK  146

Query  463  NLQVLDLYNNNLT  501
            +LQ L L NN+L+
Sbjct  147  SLQYLRLNNNSLS  159



>ref|XP_010041038.1| PREDICTED: putative receptor-like protein kinase At3g47110, partial 
[Eucalyptus grandis]
Length=796

 Score = 84.7 bits (208),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 54/129 (42%), Positives = 70/129 (54%), Gaps = 2/129 (2%)
 Frame = +1

Query  121  TEQAALLSIKAAFTADSQSSLTSWNISTSHCTWRRVTCdsll--hvvsldlsglNLSGVL  294
            T++ AL S K A   D    L+SWN ST HC W+ V C       V SL L    L G L
Sbjct  13   TDRLALASFKNAIHEDPFGVLSSWNDSTHHCEWQGVLCSKRHPGRVTSLVLRSQGLKGFL  72

Query  295  SPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLANLQV  474
            S  VG L FL  + +  N   G +PP+IS +  LR L LSNN FG   P  L++ +NL++
Sbjct  73   SSQVGNLSFLRVIFLQNNSFHGEIPPQISNLLHLRVLFLSNNSFGGPIPSNLSRCSNLKI  132

Query  475  LDLYNNNLT  501
            L+L +N L 
Sbjct  133  LNLIDNQLV  141



>ref|XP_010929457.1| PREDICTED: protein NSP-INTERACTING KINASE 1-like [Elaeis guineensis]
Length=624

 Score = 84.3 bits (207),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 56/133 (42%), Positives = 72/133 (54%), Gaps = 3/133 (2%)
 Frame = +1

Query  109  PLGVT-EQAALLSIKAAFTADSQSSLTSWNI-STSHCTWRRVTCdsllhvvsldlsglNL  282
            P GV  E  AL+ IKA F  D  + L +W+  S   C+W  VTC     V  L     NL
Sbjct  28   PKGVNFEVQALMGIKA-FLKDPHNVLENWDKDSVDPCSWTMVTCSPQNLVTGLGTPSQNL  86

Query  283  SGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLA  462
            SG LSP +G L  L  + +  N +SGP+P EI  +S LR L+LSNN F    P  +  L 
Sbjct  87   SGTLSPSIGNLTNLEIVLLQNNNISGPLPAEIGKLSRLRTLDLSNNYFSGEIPSSVGNLK  146

Query  463  NLQVLDLYNNNLT  501
            +LQ L L NN+L+
Sbjct  147  SLQYLRLNNNSLS  159



>ref|XP_008387933.1| PREDICTED: receptor protein kinase CLAVATA1 [Malus domestica]
Length=973

 Score = 84.7 bits (208),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 52/129 (40%), Positives = 78/129 (60%), Gaps = 1/129 (1%)
 Frame = +1

Query  115  GVTEQAALLSIKAAFTADSQSSLTSWNISTSHCTWRRVTCdsllhvvsldlsglNLSGVL  294
            G  +  ALL +KAA      S L  WN S+SHC +  V CD    VV+L++S + L G +
Sbjct  26   GHRDLDALLKLKAAMVGPKGSGLEDWNSSSSHCFFSGVLCDRDSRVVALNVSNIPLFGTI  85

Query  295  SPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLA-QLANLQ  471
               +G L  LVNL I  + L+G +P E++ +++L+ LN+SNN F  +FP ++   + +L+
Sbjct  86   PAAIGLLDKLVNLEITDDNLTGRLPAEMANLTSLKHLNISNNAFSGSFPGEIVLGMTDLE  145

Query  472  VLDLYNNNL  498
            VLD YNNN 
Sbjct  146  VLDAYNNNF  154



>ref|XP_009391273.1| PREDICTED: protein NSP-INTERACTING KINASE 1-like isoform X2 [Musa 
acuminata subsp. malaccensis]
Length=642

 Score = 84.3 bits (207),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 56/140 (40%), Positives = 79/140 (56%), Gaps = 3/140 (2%)
 Frame = +1

Query  88   AGAGAGKPLGVT-EQAALLSIKAAFTADSQSSLTSWNI-STSHCTWRRVTCdsllhvvsl  261
            + AG   P GV  E  AL+ +KA+   D  S L +W+  S   C+W  VTC     V+ L
Sbjct  42   SAAGVLSPKGVNYEVQALMGVKASL-KDPHSVLENWDQDSVDPCSWTMVTCSPENLVIGL  100

Query  262  dlsglNLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFP  441
                 NLSG LSP +G L  L  + +  N +SGP+P EI+ +S L+ L+LSNN F    P
Sbjct  101  GTPSQNLSGTLSPSIGNLTNLQIILLQNNNISGPIPQEIARLSNLKTLDLSNNNFNGEIP  160

Query  442  HQLAQLANLQVLDLYNNNLT  501
              ++ L++LQ L L NN+L+
Sbjct  161  TSISYLSSLQYLRLNNNSLS  180



>ref|XP_008797566.1| PREDICTED: protein NSP-INTERACTING KINASE 1-like [Phoenix dactylifera]
Length=624

 Score = 84.0 bits (206),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 57/133 (43%), Positives = 73/133 (55%), Gaps = 3/133 (2%)
 Frame = +1

Query  109  PLGVT-EQAALLSIKAAFTADSQSSLTSWNI-STSHCTWRRVTCdsllhvvsldlsglNL  282
            P GV  E  AL+ IKA F  D  + L +W+  S   C+W  VTC S   V +L     NL
Sbjct  28   PKGVNFEVQALMGIKA-FLKDPHNVLENWDKDSVDPCSWTMVTCSSQKLVTTLGTPSQNL  86

Query  283  SGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLA  462
            SG LSP +G L  L  + +  N +SGP+P EI  +S LR L LSNN F    P  L  L 
Sbjct  87   SGTLSPSIGNLTNLETVLLQNNNISGPLPAEIGRLSKLRTLELSNNYFSGEIPSSLGNLR  146

Query  463  NLQVLDLYNNNLT  501
            +L+ L L NN+L+
Sbjct  147  SLRYLMLNNNSLS  159



>ref|XP_010050671.1| PREDICTED: putative receptor-like protein kinase At3g47110 [Eucalyptus 
grandis]
Length=987

 Score = 84.7 bits (208),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 53/129 (41%), Positives = 70/129 (54%), Gaps = 2/129 (2%)
 Frame = +1

Query  121  TEQAALLSIKAAFTADSQSSLTSWNISTSHCTWRRVTCdsl--lhvvsldlsglNLSGVL  294
            T++  L+  + +   D   +L+SWN S  HC W+ V C       VVSL+L    L G+L
Sbjct  6    TDRLTLIYFRHSVDEDPLGALSSWNDSFHHCEWQGVICGGRHPERVVSLNLMSKGLGGLL  65

Query  295  SPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLANLQV  474
            SP VG L FL +L +  N   G +P  I  +  LR L LSNN FG   P  L+Q +NL+ 
Sbjct  66   SPHVGNLSFLRSLVLQNNSFCGEIPQSIGHLFCLRRLVLSNNSFGGQMPTNLSQCSNLEF  125

Query  475  LDLYNNNLT  501
            LDL NN L 
Sbjct  126  LDLINNQLV  134



>ref|XP_009376453.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At3g47570 [Pyrus x bretschneideri]
Length=1042

 Score = 84.7 bits (208),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 46/126 (37%), Positives = 67/126 (53%), Gaps = 1/126 (1%)
 Frame = +1

Query  124  EQAALLSIKAAFTADSQSSLTSWNISTSHCTWRRVTCdsllhvvsld-lsglNLSGVLSP  300
            ++ ALL  K   TAD    ++SWN S   C+W  V+C      V    L    L G + P
Sbjct  44   DRLALLDFKKRITADPLDVMSSWNHSVHFCSWVGVSCHRSTKRVLTLNLESQKLVGSIPP  103

Query  301  DVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLANLQVLD  480
             VG L +L  +++ AN   G +PPE+  + +L++LNLS N F    P  L+Q   L+VLD
Sbjct  104  SVGNLTYLTGINLGANNFHGEIPPEMGRLQSLQYLNLSYNSFRGVIPTNLSQCTQLKVLD  163

Query  481  LYNNNL  498
            L +N +
Sbjct  164  LQDNRI  169



>gb|KJB29653.1| hypothetical protein B456_005G112100 [Gossypium raimondii]
Length=980

 Score = 84.3 bits (207),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 49/133 (37%), Positives = 83/133 (62%), Gaps = 4/133 (3%)
 Frame = +1

Query  115  GVTEQAALLSIKAAFTADSQSSLTSWNISTS---HCTWRRVTCdsllhvvsldlsglNLS  285
            G ++   LL +K++      S L +W  S+S   HC +  V CD    VV+L++S   L 
Sbjct  25   GSSDLEVLLLLKSSMIGPKGSGLENWEFSSSPSAHCRFSGVQCDEDFSVVALNVSFAPLF  84

Query  286  GVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQL-AQLA  462
            G + P++G L  LVNL+I+++ L+G +P E+  +++L+  N+SNN+F  +FP ++ A + 
Sbjct  85   GTIPPEIGLLNKLVNLTISSDSLTGRIPVEMGNLTSLKIFNISNNVFQGSFPGEIFAGMT  144

Query  463  NLQVLDLYNNNLT  501
            +L++LD YNNN T
Sbjct  145  HLEILDAYNNNFT  157



>gb|EYU38789.1| hypothetical protein MIMGU_mgv1a000850mg [Erythranthe guttata]
Length=962

 Score = 84.3 bits (207),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 55/138 (40%), Positives = 85/138 (62%), Gaps = 11/138 (8%)
 Frame = +1

Query  121  TEQAALLSIKAAFTADSQSSLTSW----------NISTSHCTWRRVTCdsllhvvsldls  270
            ++   LL IK++    S S L  W          + S++HC++  VTCD    V SL+++
Sbjct  23   SDLETLLDIKSSLVGPSGSGLHDWVGPSPSPPSASSSSAHCSFSGVTCDEDGRVTSLNVT  82

Query  271  glNLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQ-  447
            G  LSGVL P++G L  LVNL++AA  L+GP+P E+S +++L+ +NLS N+     P + 
Sbjct  83   GAPLSGVLPPEIGLLSKLVNLTLAAGNLTGPLPVEMSELTSLKHVNLSWNLLNGVIPGET  142

Query  448  LAQLANLQVLDLYNNNLT  501
            + +LA L+V D+YNNN T
Sbjct  143  VLRLAELEVFDVYNNNFT  160


 Score = 49.3 bits (116),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 26/75 (35%), Positives = 42/75 (56%), Gaps = 0/75 (0%)
 Frame = +1

Query  277  NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  456
            NL+G++  ++     L++L ++ N LSG +P   S +  L  +NL  N F    P  +  
Sbjct  257  NLTGLIPAELSGSTSLMSLDLSINNLSGEIPASFSELKNLTLINLFQNKFQGPLPGFIGD  316

Query  457  LANLQVLDLYNNNLT  501
            L NL+VL ++NNN T
Sbjct  317  LPNLEVLQIWNNNFT  331



>ref|XP_007213538.1| hypothetical protein PRUPE_ppa019671mg, partial [Prunus persica]
 gb|EMJ14737.1| hypothetical protein PRUPE_ppa019671mg, partial [Prunus persica]
Length=249

 Score = 81.3 bits (199),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 48/137 (35%), Positives = 70/137 (51%), Gaps = 1/137 (1%)
 Frame = +1

Query  94   AGAGKPLGVTEQAALLSIKAAFTADSQSSLTSWNISTSHCTWRRVTCdsllhvvsldlsg  273
             GA K    T+Q+ALL++++  T+D  + L +W+ STS C W  VTC +    V      
Sbjct  22   TGAAKTNITTDQSALLAMRSHITSDPHNILVNWSTSTSVCNWVGVTCGARHLRVVSLNLS  81

Query  274  lN-LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQL  450
                +G + P +G L FLV LS   N   G +P E+S +  L+F++L  N F  + P   
Sbjct  82   YMVFTGTIPPHLGNLSFLVALSFNNNSFYGTLPHELSYLRRLKFISLGFNNFMGSIPSWF  141

Query  451  AQLANLQVLDLYNNNLT  501
                 LQ LDLY N  +
Sbjct  142  GSFPKLQRLDLYGNQFS  158



>emb|CAN71863.1| hypothetical protein VITISV_023530 [Vitis vinifera]
Length=954

 Score = 84.3 bits (207),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 52/125 (42%), Positives = 74/125 (59%), Gaps = 6/125 (5%)
 Frame = +1

Query  133  ALLSIKAAFTADSQSSLTSWNIST--SHCTWRRVTCdsllhvvsldlsglNLSGVLSPDV  306
            AL+++K  F A S   L+SWN+ST  S C WR + C     V        NL G +SPD+
Sbjct  8    ALVALKRGF-AFSDPGLSSWNVSTLSSVCWWRGIQCAHGRVVGLDLTDM-NLCGSVSPDI  65

Query  307  GQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLANLQVLDLY  486
             +L  L N+SI+ N  +GP+  EI  +S+LR+LN+SNN F  +     + + +L+VLD Y
Sbjct  66   SRLDQLSNISISGNNFTGPI--EIQNLSSLRWLNISNNQFSGSLNWSFSTMEDLEVLDAY  123

Query  487  NNNLT  501
            NNN T
Sbjct  124  NNNFT  128


 Score = 50.1 bits (118),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 26/74 (35%), Positives = 39/74 (53%), Gaps = 0/74 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            LSG +  ++G    L  L I+ N LSGP+P E+S I  + +LNLS N      P  +  +
Sbjct  491  LSGEIPLEIGACFHLTYLDISQNNLSGPIPSEVSNIKIMNYLNLSRNHLSEAIPKSIGSM  550

Query  460  ANLQVLDLYNNNLT  501
             +L + D   N L+
Sbjct  551  KSLTIADFSFNELS  564



>ref|XP_010269666.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At3g47570 isoform X2 [Nelumbo nucifera]
Length=976

 Score = 84.3 bits (207),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 49/127 (39%), Positives = 67/127 (53%), Gaps = 1/127 (1%)
 Frame = +1

Query  121  TEQAALLSIKAAFTADSQSSLTSWNISTSHCTWRRVTCdsllhvvsld-lsglNLSGVLS  297
            T++ ALL  K   T D   +L+SWN ST  C WR VTC      V    L   +L G++S
Sbjct  36   TDRLALLEFKEMITEDPLGALSSWNYSTHFCQWRGVTCSRRHQRVIALNLESQSLVGIVS  95

Query  298  PDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLANLQVL  477
            P +G L FL  +++  N   G +P EI  +  LR L LSNN F    P  L  L++L+ +
Sbjct  96   PHIGNLSFLRTITLQNNSFHGKIPQEIGRLFRLRSLTLSNNSFQGNIPPSLGNLSSLKQI  155

Query  478  DLYNNNL  498
             +  NNL
Sbjct  156  SIATNNL  162


 Score = 50.8 bits (120),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 29/74 (39%), Positives = 42/74 (57%), Gaps = 0/74 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            L+G L  +VG L  LVNL I+ N+LSG +P  +     L  L + +N+F    P  L+ L
Sbjct  459  LTGSLPSEVGNLKNLVNLDISKNRLSGSIPDTLGNCLLLENLYMQDNLFEGMIPQSLSAL  518

Query  460  ANLQVLDLYNNNLT  501
              LQ LD+ +N L+
Sbjct  519  RGLQDLDISHNKLS  532



>ref|XP_008353615.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
EFR [Malus domestica]
Length=197

 Score = 80.5 bits (197),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 50/131 (38%), Positives = 75/131 (57%), Gaps = 4/131 (3%)
 Frame = +1

Query  121  TEQAALLSIKAAFTADSQSSLTS-WNISTSH--CTWRRVTCdsllhvvsldl-sglNLSG  288
            T+Q+ALLS+KA  T+D Q+ LT+ W+ +++   C W  V+C +  H V+    S + L+G
Sbjct  14   TDQSALLSLKAHITSDPQNILTANWSSASNSNICNWVGVSCGAGHHRVTXLNLSHMGLAG  73

Query  289  VLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLANL  468
            V+ P +G L FLV L +  N   GP+P E+S +  L+ +N  NN F  T P      A L
Sbjct  74   VIPPHLGNLSFLVELGLENNSFHGPLPQELSRLRRLKEINFGNNSFMGTIPSWFGSFAKL  133

Query  469  QVLDLYNNNLT  501
            Q + LY N  +
Sbjct  134  QTIKLYGNGFS  144



>gb|KCW80214.1| hypothetical protein EUGRSUZ_C01568, partial [Eucalyptus grandis]
Length=969

 Score = 84.3 bits (207),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 53/129 (41%), Positives = 70/129 (54%), Gaps = 2/129 (2%)
 Frame = +1

Query  121  TEQAALLSIKAAFTADSQSSLTSWNISTSHCTWRRVTCdsl--lhvvsldlsglNLSGVL  294
            T++  L+  + +   D   +L+SWN S  HC W+ V C       VVSL+L    L G+L
Sbjct  6    TDRLTLIYFRHSVDEDPLGALSSWNDSFHHCEWQGVICGGRHPERVVSLNLMSKGLGGLL  65

Query  295  SPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLANLQV  474
            SP VG L FL +L +  N   G +P  I  +  LR L LSNN FG   P  L+Q +NL+ 
Sbjct  66   SPHVGNLSFLRSLVLQNNSFCGEIPQSIGHLFCLRRLVLSNNSFGGQMPTNLSQCSNLEF  125

Query  475  LDLYNNNLT  501
            LDL NN L 
Sbjct  126  LDLINNQLV  134



>ref|XP_009106236.1| PREDICTED: receptor protein kinase CLAVATA1 [Brassica rapa]
Length=987

 Score = 84.3 bits (207),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 54/135 (40%), Positives = 85/135 (63%), Gaps = 5/135 (4%)
 Frame = +1

Query  112  LGVTEQAALLSIKAAFTADSQSSLTSWNIS---TSHCTWRRVTCdsllhvvsldlsglNL  282
            L  T+   LL++K++    +   L  W  S   T+HC++  V+CD    V+SL++S   L
Sbjct  30   LASTDMDHLLNLKSSMVGPNGHGLHDWVHSPSPTAHCSFSGVSCDGDARVISLNVSFTPL  89

Query  283  SGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNI-FGSTFPHQ-LAQ  456
             G +SP++G L  LVNL++AAN  SG +P E+ ++++L+ LN+SNN+    TFP + L  
Sbjct  90   FGTISPEIGMLNRLVNLTLAANNFSGTLPLEMKSLTSLKVLNISNNVNLNGTFPGEILTP  149

Query  457  LANLQVLDLYNNNLT  501
            + +L+VLD YNNN T
Sbjct  150  MVDLEVLDAYNNNFT  164



>ref|XP_008791706.1| PREDICTED: putative receptor-like protein kinase At3g47110 [Phoenix 
dactylifera]
Length=994

 Score = 84.3 bits (207),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 51/127 (40%), Positives = 76/127 (60%), Gaps = 0/127 (0%)
 Frame = +1

Query  118  VTEQAALLSIKAAFTADSQSSLTSWNISTSHCTWRRVTCdsllhvvsldlsglNLSGVLS  297
            +T+Q ALLS K   T+D    L+SWN ST+ C W RV C++   V +LDL GL LSG +S
Sbjct  18   ITDQEALLSFKTLITSDPSDVLSSWNDSTTVCQWSRVLCNNKRRVSTLDLKGLGLSGSIS  77

Query  298  PDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLANLQVL  477
            P +G L  L  L +  N  +G +P ++  ++ L+ LN S+N+ G   P  +++ +NL  L
Sbjct  78   PHIGNLSALQFLYLQDNHFTGDLPDQLGNLARLQILNASSNLIGGAIPPNISKCSNLNTL  137

Query  478  DLYNNNL  498
            DL  N +
Sbjct  138  DLALNTI  144



>ref|XP_002322110.2| hypothetical protein POPTR_0015s04680g [Populus trichocarpa]
 gb|EEF06237.2| hypothetical protein POPTR_0015s04680g [Populus trichocarpa]
Length=1052

 Score = 84.3 bits (207),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 52/127 (41%), Positives = 72/127 (57%), Gaps = 1/127 (1%)
 Frame = +1

Query  121  TEQAALLSIKAAFTADSQSSLTSWNISTSHCTWRRVTCdsllhvvsld-lsglNLSGVLS  297
            T+Q ALL+IK   + D  +SL+SWN S   C+W+ VTC      V+   LS L L+G LS
Sbjct  66   TDQQALLAIKDFISEDPFNSLSSWNNSLQFCSWQGVTCGRRHRRVTSLNLSSLKLAGSLS  125

Query  298  PDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLANLQVL  477
            P  G L FL  + ++ N+     PPE+  +  LR+L+L+NN F    P  L   +NL  L
Sbjct  126  PHFGNLTFLRVIDLSRNRFHHIFPPEVGQLFRLRYLSLANNSFQGELPSTLGICSNLIFL  185

Query  478  DLYNNNL  498
            +LY NN 
Sbjct  186  NLYGNNF  192



>ref|XP_010064788.1| PREDICTED: putative receptor-like protein kinase At3g47110 [Eucalyptus 
grandis]
Length=989

 Score = 84.3 bits (207),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 54/129 (42%), Positives = 71/129 (55%), Gaps = 2/129 (2%)
 Frame = +1

Query  121  TEQAALLSIKAAFTADSQSSLTSWNISTSHCTWRRVTCdsl--lhvvsldlsglNLSGVL  294
            T+Q AL+  K +   DS   L+SWN S+ HC W  + C       VVSL+L    L G+L
Sbjct  10   TDQLALIYFKDSVDKDSLGILSSWNDSSHHCEWPGIVCGGRHPERVVSLNLMSKGLGGLL  69

Query  295  SPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLANLQV  474
            SP VG L FL +L +  N   G +P  I  +  LR L LSNN F    P  L+Q +NL+V
Sbjct  70   SPHVGNLSFLRSLVLQNNSFRGKIPQSIGHLFRLRRLVLSNNSFSGQMPTNLSQCSNLEV  129

Query  475  LDLYNNNLT  501
            L+L +N L 
Sbjct  130  LNLIDNQLV  138


 Score = 51.6 bits (122),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 32/74 (43%), Positives = 42/74 (57%), Gaps = 0/74 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            LSG L   VG L  LV L ++ N+L+GP+P  IS    L  LNL+ N F    P  L  L
Sbjct  478  LSGSLPSQVGSLTNLVELDLSYNKLTGPIPSSISKCLLLGRLNLAVNSFYGEIPPALGTL  537

Query  460  ANLQVLDLYNNNLT  501
              LQ LD+ +N+L+
Sbjct  538  RGLQELDVSHNDLS  551


 Score = 48.9 bits (115),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 28/76 (37%), Positives = 43/76 (57%), Gaps = 1/76 (1%)
 Frame = +1

Query  277  NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFL-NLSNNIFGSTFPHQLA  453
            N  G +   +G    L+ L ++ N LSGP+P E+ ++ST+  + NL++N    + P Q+ 
Sbjct  428  NFYGEIPQSLGNCRQLIELELSNNNLSGPIPREVLSLSTISIIFNLAHNQLSGSLPSQVG  487

Query  454  QLANLQVLDLYNNNLT  501
             L NL  LDL  N LT
Sbjct  488  SLTNLVELDLSYNKLT  503



>ref|XP_002263291.2| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM1 [Vitis vinifera]
Length=976

 Score = 84.3 bits (207),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 52/125 (42%), Positives = 74/125 (59%), Gaps = 6/125 (5%)
 Frame = +1

Query  133  ALLSIKAAFTADSQSSLTSWNIST--SHCTWRRVTCdsllhvvsldlsglNLSGVLSPDV  306
            AL+++K  F A S   L+SWN+ST  S C WR + C     V        NL G +SPD+
Sbjct  30   ALVALKRGF-AFSDPGLSSWNVSTLSSVCWWRGIQCAHGRVVGLDLTDM-NLCGSVSPDI  87

Query  307  GQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLANLQVLDLY  486
             +L  L N+SI+ N  +GP+  EI  +S+LR+LN+SNN F  +     + + +L+VLD Y
Sbjct  88   SRLDQLSNISISGNNFTGPI--EIQNLSSLRWLNISNNQFSGSLNWSFSTMEDLEVLDAY  145

Query  487  NNNLT  501
            NNN T
Sbjct  146  NNNFT  150


 Score = 50.1 bits (118),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 26/74 (35%), Positives = 39/74 (53%), Gaps = 0/74 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            LSG +  ++G    L  L I+ N LSGP+P E+S I  + +LNLS N      P  +  +
Sbjct  513  LSGEIPLEIGACFHLTYLDISQNNLSGPIPSEVSNIKIMNYLNLSRNHLSEAIPKSIGSM  572

Query  460  ANLQVLDLYNNNLT  501
             +L + D   N L+
Sbjct  573  KSLTIADFSFNELS  586



>gb|KJB40660.1| hypothetical protein B456_007G073100 [Gossypium raimondii]
Length=1012

 Score = 84.3 bits (207),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 50/124 (40%), Positives = 70/124 (56%), Gaps = 1/124 (1%)
 Frame = +1

Query  124  EQAALLSIKAAFTADSQSSLTSWNISTSHCTWRRVTCdsllhvvsldlsglN-LSGVLSP  300
            + A LLS K +   D  + L++WN S+SHC+W  V C +    V       N LSG +  
Sbjct  22   DSAILLSFKDSIFYDPSNLLSTWNSSSSHCSWYGVKCANSSDKVIALSLPHNGLSGEIPG  81

Query  301  DVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLANLQVLD  480
             +G L FL  L +  N+ SG +P +IS+IS+L  LNLS N F    P +L   +NL+V+D
Sbjct  82   VIGDLKFLQVLQVQGNKFSGQIPVQISSISSLNVLNLSFNSFSGHIPDKLIGNSNLKVID  141

Query  481  LYNN  492
            L NN
Sbjct  142  LSNN  145


 Score = 49.3 bits (116),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 29/75 (39%), Positives = 42/75 (56%), Gaps = 1/75 (1%)
 Frame = +1

Query  280  LSGVLSPD-VGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  456
             SG +S D   +  FL +LS++ N L G +PPEI     LR L L  N+     P ++ Q
Sbjct  147  FSGRISVDNSSRCEFLTHLSLSNNSLVGNIPPEIGNCKNLRTLLLDYNLLEGKIPAEIGQ  206

Query  457  LANLQVLDLYNNNLT  501
            +  L+VLD+  N+LT
Sbjct  207  ITELRVLDVSRNSLT  221


 Score = 49.3 bits (116),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 27/73 (37%), Positives = 42/73 (58%), Gaps = 0/73 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            LSG L   +G+L  L  +S+  N LSG +PPE+  ++ L+ L+LS+N    + P  L   
Sbjct  528  LSGSLPNQLGKLKNLTWISLGENNLSGEIPPELGQLALLKVLDLSHNFLTGSIPASLTNA  587

Query  460  ANLQVLDLYNNNL  498
             NL+ + L +N L
Sbjct  588  GNLETILLDHNRL  600


 Score = 48.9 bits (115),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 27/74 (36%), Positives = 42/74 (57%), Gaps = 0/74 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            + G + P +G L  L  L +  N+LSG +P ++  +  L +++L  N      P +L QL
Sbjct  504  IEGSIDPCIGNLTMLEWLDLRGNRLSGSLPNQLGKLKNLTWISLGENNLSGEIPPELGQL  563

Query  460  ANLQVLDLYNNNLT  501
            A L+VLDL +N LT
Sbjct  564  ALLKVLDLSHNFLT  577



>ref|NP_001176614.1| Os11g0568800 [Oryza sativa Japonica Group]
 gb|ABA94319.1| Leucine Rich Repeat family protein, expressed [Oryza sativa Japonica 
Group]
 dbj|BAH95342.1| Os11g0568800 [Oryza sativa Japonica Group]
Length=1133

 Score = 84.3 bits (207),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 51/129 (40%), Positives = 73/129 (57%), Gaps = 4/129 (3%)
 Frame = +1

Query  118  VTEQAALLSIKAAFTADSQSSLTSWNISTSHCTWRRVTCdsl--lhvvsldlsglNLSGV  291
            + ++ ALLS K+   +D    L SWN S+ +C+W  V C       VV+L +S  NLSG 
Sbjct  35   MADEPALLSFKSMLLSDG--FLASWNASSHYCSWPGVVCGGRHPERVVALQMSSFNLSGR  92

Query  292  LSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLANLQ  471
            +SP +G L  L  L +  NQ +G +PPEI  ++ LR LNLS+N    + P  + + A L 
Sbjct  93   ISPSLGNLSLLRELELGDNQFTGDIPPEIGQLTRLRMLNLSSNYLQGSIPASIGECAELM  152

Query  472  VLDLYNNNL  498
             +DL NN L
Sbjct  153  SIDLGNNQL  161


 Score = 54.7 bits (130),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 29/75 (39%), Positives = 43/75 (57%), Gaps = 0/75 (0%)
 Frame = +1

Query  277  NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  456
            NL G +  ++G L  LV     +N+LSG +P  +     L+ ++L NN    + P  L+Q
Sbjct  529  NLEGSIPQEIGGLKNLVQFYADSNKLSGEIPSTLGECQLLQNISLQNNFLSGSVPSLLSQ  588

Query  457  LANLQVLDLYNNNLT  501
            L  LQ+LDL NNNL+
Sbjct  589  LKGLQILDLSNNNLS  603



>ref|XP_010248541.1| PREDICTED: protein NSP-INTERACTING KINASE 3-like isoform X1 [Nelumbo 
nucifera]
Length=626

 Score = 84.0 bits (206),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 56/133 (42%), Positives = 74/133 (56%), Gaps = 3/133 (2%)
 Frame = +1

Query  109  PLGVT-EQAALLSIKAAFTADSQSSLTSWN-ISTSHCTWRRVTCdsllhvvsldlsglNL  282
            P G+  E  AL++IK     D  + L +W+  S   C WR +TC    +V SL L+  +L
Sbjct  27   PSGINYEVEALVNIKTGLR-DPHNVLDNWDSTSVDPCGWRMITCSPDGYVSSLGLASQSL  85

Query  283  SGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLA  462
            SG LSP +G L  L ++S+  N LSGP+P EI  +  L  L+LSNN F    P  L  L 
Sbjct  86   SGTLSPGIGNLSNLKSVSLQNNALSGPIPAEIGKLEKLEQLDLSNNKFSGVIPSSLGDLK  145

Query  463  NLQVLDLYNNNLT  501
            NL  L L NN+LT
Sbjct  146  NLNYLRLGNNSLT  158



>emb|CBI29704.3| unnamed protein product [Vitis vinifera]
Length=895

 Score = 84.3 bits (207),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 52/125 (42%), Positives = 74/125 (59%), Gaps = 6/125 (5%)
 Frame = +1

Query  133  ALLSIKAAFTADSQSSLTSWNIST--SHCTWRRVTCdsllhvvsldlsglNLSGVLSPDV  306
            AL+++K  F A S   L+SWN+ST  S C WR + C     V        NL G +SPD+
Sbjct  30   ALVALKRGF-AFSDPGLSSWNVSTLSSVCWWRGIQCAHGRVVGLDLTDM-NLCGSVSPDI  87

Query  307  GQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLANLQVLDLY  486
             +L  L N+SI+ N  +GP+  EI  +S+LR+LN+SNN F  +     + + +L+VLD Y
Sbjct  88   SRLDQLSNISISGNNFTGPI--EIQNLSSLRWLNISNNQFSGSLNWSFSTMEDLEVLDAY  145

Query  487  NNNLT  501
            NNN T
Sbjct  146  NNNFT  150



>gb|AAX93041.1| hypothetical protein LOC_Os11g07260 [Oryza sativa Japonica Group]
 gb|AAX95776.1| Leucine Rich Repeat, putative [Oryza sativa Japonica Group]
 gb|ABA91657.1| Leucine Rich Repeat family protein, expressed [Oryza sativa Japonica 
Group]
 gb|EAZ17603.1| hypothetical protein OsJ_33142 [Oryza sativa Japonica Group]
Length=1013

 Score = 84.3 bits (207),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 50/129 (39%), Positives = 72/129 (56%), Gaps = 3/129 (2%)
 Frame = +1

Query  121  TEQAALLSIKAAFTADSQSSLTSWNISTSHCTWRRVTCdsllhvvsldlsglN--LSGVL  294
            T+Q +LL  K A + D Q SL SWN ST++C+W  V+C          L+  N  L G +
Sbjct  30   TDQLSLLEFKKAISLDPQQSLISWNDSTNYCSWEGVSCSLKNPGRVTSLNLTNRALVGHI  89

Query  295  SPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLANLQV  474
            SP +G L FL  L++  N LSG +PP +  +  L++L LS N    + P   A  + L+V
Sbjct  90   SPSLGNLTFLKYLALLKNALSGEIPPSLGHLRRLQYLYLSGNTLQGSIP-SFANCSELKV  148

Query  475  LDLYNNNLT  501
            L ++ NNLT
Sbjct  149  LWVHRNNLT  157



>gb|KJB69702.1| hypothetical protein B456_011G038400 [Gossypium raimondii]
Length=618

 Score = 83.6 bits (205),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 55/133 (41%), Positives = 75/133 (56%), Gaps = 3/133 (2%)
 Frame = +1

Query  109  PLGVT-EQAALLSIKAAFTADSQSSLTSWNI-STSHCTWRRVTCdsllhvvsldlsglNL  282
            P GV  E AAL+S+K     D +  +  W+I S   CTW  V C +   V+SL+++   L
Sbjct  31   PKGVNYEVAALMSVKRELR-DYKQVMDGWDINSVDPCTWNMVACSAEGFVISLEMASTGL  89

Query  283  SGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLA  462
            SG+LSP +G L  L  + +  NQLSGP+P EI  +S L+ L+LS N F    P  L  L 
Sbjct  90   SGLLSPSIGNLSHLRTMLLQNNQLSGPIPDEIGKLSELQTLDLSGNHFVGAIPSTLGSLT  149

Query  463  NLQVLDLYNNNLT  501
            +L  L L  NNL+
Sbjct  150  HLSYLRLSKNNLS  162



>ref|XP_010068376.1| PREDICTED: putative receptor-like protein kinase At3g47110 [Eucalyptus 
grandis]
Length=1011

 Score = 84.3 bits (207),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 51/129 (40%), Positives = 66/129 (51%), Gaps = 2/129 (2%)
 Frame = +1

Query  121  TEQAALLSIKAAFTADSQSSLTSWNISTSHCTWRRVTCdsll--hvvsldlsglNLSGVL  294
            T+  AL S K A   D    L+SWN ST HC W+ V C       V SL L    L G L
Sbjct  31   TDWLALASFKNAIHEDPFGVLSSWNDSTHHCEWQGVLCSKRHPGRVTSLFLRSQGLGGFL  90

Query  295  SPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLANLQV  474
            SP +G L FL  + +  N   G +PP+I  +  LR+L+L+NN FG   P  L+   NL+ 
Sbjct  91   SPHIGNLSFLRVMRLQNNSFYGEIPPQIGNLLRLRYLDLTNNSFGGPIPSNLSHCLNLET  150

Query  475  LDLYNNNLT  501
            L+   N L 
Sbjct  151  LNFLGNQLV  159


 Score = 48.5 bits (114),  Expect = 9e-04, Method: Compositional matrix adjust.
 Identities = 30/75 (40%), Positives = 39/75 (52%), Gaps = 0/75 (0%)
 Frame = +1

Query  277  NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  456
            NLSG L   VG L  L  L ++ N+L+G +P  I     L  L+L +N F    P  L  
Sbjct  498  NLSGSLPLQVGSLINLAELDLSCNRLTGLIPASIGGCLRLERLHLEDNSFHGQIPQALLP  557

Query  457  LANLQVLDLYNNNLT  501
            L  L+ LDL NNN +
Sbjct  558  LRGLEHLDLSNNNFS  572



>gb|KJB73883.1| hypothetical protein B456_011G2584002, partial [Gossypium raimondii]
Length=244

 Score = 80.9 bits (198),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 53/128 (41%), Positives = 65/128 (51%), Gaps = 1/128 (1%)
 Frame = +1

Query  121  TEQAALLSIKAAFTADSQSSLTSWNISTSHCTWRRVTC-dsllhvvsldlsglNLSGVLS  297
            T+Q ALL  KA  T D  + + SWN S   C W  VTC      V  L L  L LSG LS
Sbjct  45   TDQQALLQYKAKITGDQLNIMESWNSSIHFCQWIGVTCGRKHQRVTKLKLRFLKLSGSLS  104

Query  298  PDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLANLQVL  477
            P +G L FL  L +AAN     +P EI  +  L  L+LSNN      P  L+  + L  +
Sbjct  105  PYIGNLSFLRELDLAANSFHNQIPQEIGGLRRLETLDLSNNSISGEIPSNLSACSKLIFV  164

Query  478  DLYNNNLT  501
            D+ NN LT
Sbjct  165  DMTNNQLT  172



>ref|NP_001065874.2| Os11g0173800 [Oryza sativa Japonica Group]
 dbj|BAF27719.2| Os11g0173800 [Oryza sativa Japonica Group]
Length=901

 Score = 84.3 bits (207),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 50/129 (39%), Positives = 72/129 (56%), Gaps = 3/129 (2%)
 Frame = +1

Query  121  TEQAALLSIKAAFTADSQSSLTSWNISTSHCTWRRVTCdsllhvvsldlsglN--LSGVL  294
            T+Q +LL  K A + D Q SL SWN ST++C+W  V+C          L+  N  L G +
Sbjct  30   TDQLSLLEFKKAISLDPQQSLISWNDSTNYCSWEGVSCSLKNPGRVTSLNLTNRALVGHI  89

Query  295  SPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLANLQV  474
            SP +G L FL  L++  N LSG +PP +  +  L++L LS N    + P   A  + L+V
Sbjct  90   SPSLGNLTFLKYLALLKNALSGEIPPSLGHLRRLQYLYLSGNTLQGSIP-SFANCSELKV  148

Query  475  LDLYNNNLT  501
            L ++ NNLT
Sbjct  149  LWVHRNNLT  157



>ref|XP_010925613.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At5g45780 isoform X2 [Elaeis guineensis]
Length=504

 Score = 83.2 bits (204),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 55/133 (41%), Positives = 74/133 (56%), Gaps = 3/133 (2%)
 Frame = +1

Query  109  PLGVT-EQAALLSIKAAFTADSQSSLTSWNI-STSHCTWRRVTCdsllhvvsldlsglNL  282
            P GV  E AAL+S+K+    D   ++  W+I S   CTW  V C     V+SL+++   L
Sbjct  30   PKGVNYEVAALMSVKSKMW-DEAGAMDGWDINSVDPCTWSMVGCSPDGFVISLEMARNGL  88

Query  283  SGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLA  462
            SG LSP +G L  L  + +  N++SGP+PPEI  +S LR L+LS N F    P  L  L 
Sbjct  89   SGTLSPSIGNLSHLQTMLLQNNKISGPIPPEIGKLSQLRTLDLSGNQFIGEIPRSLGFLN  148

Query  463  NLQVLDLYNNNLT  501
             L  L L  NNL+
Sbjct  149  QLGYLRLDKNNLS  161



>gb|KCW69037.1| hypothetical protein EUGRSUZ_F02592, partial [Eucalyptus grandis]
Length=993

 Score = 84.3 bits (207),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 54/129 (42%), Positives = 71/129 (55%), Gaps = 2/129 (2%)
 Frame = +1

Query  121  TEQAALLSIKAAFTADSQSSLTSWNISTSHCTWRRVTCdsl--lhvvsldlsglNLSGVL  294
            T+Q AL+  K +   DS   L+SWN S+ HC W  + C       VVSL+L    L G+L
Sbjct  6    TDQLALIYFKDSVDKDSLGILSSWNDSSHHCEWPGIVCGGRHPERVVSLNLMSKGLGGLL  65

Query  295  SPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLANLQV  474
            SP VG L FL +L +  N   G +P  I  +  LR L LSNN F    P  L+Q +NL+V
Sbjct  66   SPHVGNLSFLRSLVLQNNSFRGKIPQSIGHLFRLRRLVLSNNSFSGQMPTNLSQCSNLEV  125

Query  475  LDLYNNNLT  501
            L+L +N L 
Sbjct  126  LNLIDNQLV  134


 Score = 51.6 bits (122),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 32/74 (43%), Positives = 42/74 (57%), Gaps = 0/74 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            LSG L   VG L  LV L ++ N+L+GP+P  IS    L  LNL+ N F    P  L  L
Sbjct  474  LSGSLPSQVGSLTNLVELDLSYNKLTGPIPSSISKCLLLGRLNLAVNSFYGEIPPALGTL  533

Query  460  ANLQVLDLYNNNLT  501
              LQ LD+ +N+L+
Sbjct  534  RGLQELDVSHNDLS  547


 Score = 48.5 bits (114),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 28/76 (37%), Positives = 43/76 (57%), Gaps = 1/76 (1%)
 Frame = +1

Query  277  NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFL-NLSNNIFGSTFPHQLA  453
            N  G +   +G    L+ L ++ N LSGP+P E+ ++ST+  + NL++N    + P Q+ 
Sbjct  424  NFYGEIPQSLGNCRQLIELELSNNNLSGPIPREVLSLSTISIIFNLAHNQLSGSLPSQVG  483

Query  454  QLANLQVLDLYNNNLT  501
             L NL  LDL  N LT
Sbjct  484  SLTNLVELDLSYNKLT  499



>gb|AAT64032.1| putative leucine-rich repeat transmembrane protein [Gossypium 
hirsutum]
Length=618

 Score = 83.6 bits (205),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 55/133 (41%), Positives = 75/133 (56%), Gaps = 3/133 (2%)
 Frame = +1

Query  109  PLGVT-EQAALLSIKAAFTADSQSSLTSWNI-STSHCTWRRVTCdsllhvvsldlsglNL  282
            P GV  E AAL+S+K     D +  +  W+I S   CTW  V C +   V+SL+++   L
Sbjct  31   PKGVNYEVAALMSVKRELR-DYKQVMDGWDINSVDPCTWNMVACSAEGFVISLEMASTGL  89

Query  283  SGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLA  462
            SG+LSP +G L  L  + +  NQLSGP+P EI  +S L+ L+LS N F    P  L  L 
Sbjct  90   SGLLSPSIGNLSHLRTMLLQNNQLSGPIPDEIGKLSELQTLDLSGNHFVGAIPSTLGSLT  149

Query  463  NLQVLDLYNNNLT  501
            +L  L L  NNL+
Sbjct  150  HLSYLRLSKNNLS  162



>gb|KEH33614.1| LRR receptor-like kinase family protein [Medicago truncatula]
Length=985

 Score = 84.3 bits (207),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 54/133 (41%), Positives = 77/133 (58%), Gaps = 6/133 (5%)
 Frame = +1

Query  112  LGVTEQAALL-SIKAAFTADSQSSLTSWNIS--TSHCTWRRVTCdsllhvvsldl---sg  273
            L +  QA++L S+K  F   S +SL+SWN+S   S CTW  + CD  +  +S+     S 
Sbjct  25   LSLKNQASILVSMKQDFEPSSNTSLSSWNMSNYMSLCTWYGIQCDHTITNMSIVSLDISN  84

Query  274  lNLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLA  453
            LN+SG  SP + +L  LVN+SI  N   G  P EI  +  L+ LN+SNN+F      +  
Sbjct  85   LNISGSFSPQITKLYNLVNVSIQGNSFYGEFPTEIHKLQRLKCLNISNNMFSGNLSWEFN  144

Query  454  QLANLQVLDLYNN  492
            +L  L+VLD+YNN
Sbjct  145  KLKELEVLDIYNN  157


 Score = 52.8 bits (125),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 29/74 (39%), Positives = 43/74 (58%), Gaps = 0/74 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            L+G + P++G L  L  L ++ N L+G +P E S +  L  LNL  N F S  P  +++L
Sbjct  280  LTGFIPPELGNLSRLNALDLSLNNLTGGIPNEFSNLRELSLLNLFINKFHSEIPDFISEL  339

Query  460  ANLQVLDLYNNNLT  501
              L+VL L+ NN T
Sbjct  340  PKLEVLKLWRNNFT  353



>emb|CDY63395.1| BnaCnng41990D, partial [Brassica napus]
Length=525

 Score = 83.2 bits (204),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 45/126 (36%), Positives = 73/126 (58%), Gaps = 1/126 (1%)
 Frame = +1

Query  124  EQAALLSIKAAFTADSQSSLTSWNISTSHCTWRRVTCdsllhvvsldlsgl-NLSGVLSP  300
            ++ ALL IK+  + ++Q  L+SWN S+  C W+ VTC      V+    G   LSG++ P
Sbjct  25   DRKALLDIKSQVSEENQDVLSSWNNSSPLCNWKGVTCGLKHKRVTRLDLGGWQLSGMIPP  84

Query  301  DVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLANLQVLD  480
             +G L FL++L ++ N + G +P E+  +  L++LN+S+N  G   P  L   + L  LD
Sbjct  85   SIGNLSFLISLDLSENSIGGTIPYEVGNLFRLKYLNMSSNFLGGEIPVNLFNCSRLLGLD  144

Query  481  LYNNNL  498
            L +N+L
Sbjct  145  LSDNHL  150



>ref|XP_006856744.1| hypothetical protein AMTR_s00055p00012250 [Amborella trichopoda]
 gb|ERN18211.1| hypothetical protein AMTR_s00055p00012250 [Amborella trichopoda]
Length=1014

 Score = 84.3 bits (207),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 48/130 (37%), Positives = 73/130 (56%), Gaps = 2/130 (2%)
 Frame = +1

Query  118  VTEQAALLSIKAAFTADSQ--SSLTSWNISTSHCTWRRVTCdsllhvvsldlsglNLSGV  291
            V +   LL +K     + Q  S L  W     HC W  VTC+    VV+L++  + L G 
Sbjct  59   VDDSEVLLKLKRGLILEPQKISFLKDWETGKDHCLWSGVTCNDEARVVALNICFIPLHGR  118

Query  292  LSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLANLQ  471
            +  D+G L  LVN++++++ L+G +PP+I  + +LRFLN+SNN      P   + L  L+
Sbjct  119  IFGDIGLLDKLVNVTLSSSNLTGNLPPQIGHLRSLRFLNISNNDLSGDIPTTFSGLQELE  178

Query  472  VLDLYNNNLT  501
            VLD YNNN +
Sbjct  179  VLDAYNNNFS  188


 Score = 58.2 bits (139),  Expect = 8e-07, Method: Compositional matrix adjust.
 Identities = 29/74 (39%), Positives = 45/74 (61%), Gaps = 0/74 (0%)
 Frame = +1

Query  277  NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  456
            NLSG +   +GQL FL  L +  N+ SG +P E+S + +++ L+LSNN      P   ++
Sbjct  283  NLSGQIPATLGQLKFLDTLFLQMNRFSGEIPEELSGLKSVKSLDLSNNQLTGELPEGFSE  342

Query  457  LANLQVLDLYNNNL  498
            L  L +L+L+ NNL
Sbjct  343  LRELTLLNLFRNNL  356



>gb|KJB69703.1| hypothetical protein B456_011G038400 [Gossypium raimondii]
Length=620

 Score = 83.6 bits (205),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 55/133 (41%), Positives = 75/133 (56%), Gaps = 3/133 (2%)
 Frame = +1

Query  109  PLGVT-EQAALLSIKAAFTADSQSSLTSWNI-STSHCTWRRVTCdsllhvvsldlsglNL  282
            P GV  E AAL+S+K     D +  +  W+I S   CTW  V C +   V+SL+++   L
Sbjct  31   PKGVNYEVAALMSVKRELR-DYKQVMDGWDINSVDPCTWNMVACSAEGFVISLEMASTGL  89

Query  283  SGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLA  462
            SG+LSP +G L  L  + +  NQLSGP+P EI  +S L+ L+LS N F    P  L  L 
Sbjct  90   SGLLSPSIGNLSHLRTMLLQNNQLSGPIPDEIGKLSELQTLDLSGNHFVGAIPSTLGSLT  149

Query  463  NLQVLDLYNNNLT  501
            +L  L L  NNL+
Sbjct  150  HLSYLRLSKNNLS  162



>gb|EAZ18778.1| hypothetical protein OsJ_34305 [Oryza sativa Japonica Group]
Length=1047

 Score = 84.0 bits (206),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 51/129 (40%), Positives = 73/129 (57%), Gaps = 4/129 (3%)
 Frame = +1

Query  118  VTEQAALLSIKAAFTADSQSSLTSWNISTSHCTWRRVTCdsl--lhvvsldlsglNLSGV  291
            + ++ ALLS K+   +D    L SWN S+ +C+W  V C       VV+L +S  NLSG 
Sbjct  35   MADEPALLSFKSMLLSDG--FLASWNASSHYCSWPGVVCGGRHPERVVALQMSSFNLSGR  92

Query  292  LSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLANLQ  471
            +SP +G L  L  L +  NQ +G +PPEI  ++ LR LNLS+N    + P  + + A L 
Sbjct  93   ISPSLGNLSLLRELELGDNQFTGDIPPEIGQLTRLRMLNLSSNYLQGSIPASIGECAELM  152

Query  472  VLDLYNNNL  498
             +DL NN L
Sbjct  153  SIDLGNNQL  161


 Score = 53.9 bits (128),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 29/75 (39%), Positives = 43/75 (57%), Gaps = 0/75 (0%)
 Frame = +1

Query  277  NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  456
            NL G +  ++G L  LV     +N+LSG +P  +     L+ ++L NN    + P  L+Q
Sbjct  529  NLEGSIPQEIGGLKNLVQFYADSNKLSGEIPSTLGECQLLQNISLQNNFLSGSVPSLLSQ  588

Query  457  LANLQVLDLYNNNLT  501
            L  LQ+LDL NNNL+
Sbjct  589  LKGLQILDLSNNNLS  603



>ref|XP_011035599.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At3g47570 isoform X1 [Populus euphratica]
Length=1023

 Score = 84.0 bits (206),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 51/127 (40%), Positives = 73/127 (57%), Gaps = 1/127 (1%)
 Frame = +1

Query  121  TEQAALLSIKAAFTADSQSSLTSWNISTSHCTWRRVTCdsllhvvsld-lsglNLSGVLS  297
            T+Q ALL+IK   + D  +SL+SWN S   C+W+ V+C      V+   LS L L+G LS
Sbjct  37   TDQQALLAIKDLISEDPFNSLSSWNNSLQFCSWQGVSCGRRHRRVTSLNLSSLELAGSLS  96

Query  298  PDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLANLQVL  477
            P +G L FL  + ++ N+     PPE+     LR+L+L+NN F    P  L+  +NL  L
Sbjct  97   PHIGNLTFLRVIDLSRNRFHHVFPPEVGQFFRLRYLSLANNSFQGELPSTLSICSNLIFL  156

Query  478  DLYNNNL  498
            +LY NN 
Sbjct  157  NLYGNNF  163



>ref|XP_010925612.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At5g45780 isoform X1 [Elaeis guineensis]
Length=616

 Score = 83.6 bits (205),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 55/133 (41%), Positives = 74/133 (56%), Gaps = 3/133 (2%)
 Frame = +1

Query  109  PLGVT-EQAALLSIKAAFTADSQSSLTSWNI-STSHCTWRRVTCdsllhvvsldlsglNL  282
            P GV  E AAL+S+K+    D   ++  W+I S   CTW  V C     V+SL+++   L
Sbjct  30   PKGVNYEVAALMSVKSKMW-DEAGAMDGWDINSVDPCTWSMVGCSPDGFVISLEMARNGL  88

Query  283  SGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLA  462
            SG LSP +G L  L  + +  N++SGP+PPEI  +S LR L+LS N F    P  L  L 
Sbjct  89   SGTLSPSIGNLSHLQTMLLQNNKISGPIPPEIGKLSQLRTLDLSGNQFIGEIPRSLGFLN  148

Query  463  NLQVLDLYNNNLT  501
             L  L L  NNL+
Sbjct  149  QLGYLRLDKNNLS  161



>ref|XP_002317696.2| hypothetical protein POPTR_0012s04160g [Populus trichocarpa]
 gb|EEE95916.2| hypothetical protein POPTR_0012s04160g [Populus trichocarpa]
Length=1025

 Score = 84.0 bits (206),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 50/128 (39%), Positives = 72/128 (56%), Gaps = 1/128 (1%)
 Frame = +1

Query  121  TEQAALLSIKAAFTADSQSSLTSWNISTSHCTWRRVTCdsllhvvsld-lsglNLSGVLS  297
            T++ ALL++K    +D   +L+SWN S   CTW  V C S    V    LS L L+G LS
Sbjct  41   TDREALLAMKHLVLSDPFRALSSWNASLHFCTWHGVACGSKHQRVIALNLSSLQLAGFLS  100

Query  298  PDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLANLQVL  477
            P +G L FL  + ++ N   G +P E+  +  L++L+LSNN F    P  L+  +NL+ L
Sbjct  101  PHIGNLTFLRRIDLSKNNFHGTIPEEVGQLFRLQYLSLSNNSFQDELPGNLSHCSNLRFL  160

Query  478  DLYNNNLT  501
             +  NNLT
Sbjct  161  GMEGNNLT  168



>ref|XP_010999778.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At3g47570 [Populus euphratica]
Length=1041

 Score = 84.0 bits (206),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 48/135 (36%), Positives = 73/135 (54%), Gaps = 1/135 (1%)
 Frame = +1

Query  100  AGKPLGVTEQAALLSIKAAFTADSQSSLTSWNISTSHCTWRRVTCdsllhvvsldlsg-l  276
            A +P   T++ ALLS K+    D  ++L+SWN ++S C W  V C  +   V       L
Sbjct  42   AAEPGLFTDKEALLSFKSQVIVDPSNTLSSWNDNSSPCNWTHVDCSQVHQRVVGLDLSGL  101

Query  277  NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  456
             L+G +SP +G L FL +L +  NQ +G +P +I A+  L+ LN+S N      P  +  
Sbjct  102  GLTGSISPHIGNLSFLRSLYLQENQFTGVIPDQIGALFRLKVLNMSFNTINGPIPLNITN  161

Query  457  LANLQVLDLYNNNLT  501
              NLQ+LDL  N ++
Sbjct  162  CLNLQILDLMQNEIS  176


 Score = 50.1 bits (118),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 30/74 (41%), Positives = 42/74 (57%), Gaps = 0/74 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            +SG +  ++  L  L  L +  N+L G +PP I+ IS+L  L+L  N  G   P  L +L
Sbjct  175  ISGAIPEELSNLKSLEILKLGGNKLWGMIPPVIANISSLLTLDLVTNNLGGMIPADLGRL  234

Query  460  ANLQVLDLYNNNLT  501
             NL+ LDL  NNLT
Sbjct  235  ENLKHLDLSINNLT  248



>ref|XP_009334873.1| PREDICTED: receptor protein kinase CLAVATA1 [Pyrus x bretschneideri]
Length=973

 Score = 84.0 bits (206),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 53/129 (41%), Positives = 77/129 (60%), Gaps = 1/129 (1%)
 Frame = +1

Query  115  GVTEQAALLSIKAAFTADSQSSLTSWNISTSHCTWRRVTCdsllhvvsldlsglNLSGVL  294
            G  +  ALL +KAA      S L  WN S+SHC +  V CD    VVSL++S + L G +
Sbjct  26   GHRDLDALLKLKAAMVGPKGSGLEDWNSSSSHCFFSGVLCDRDSRVVSLNVSNIPLFGTI  85

Query  295  SPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLA-QLANLQ  471
               +G L  LVNL I  + L+G +P E++ ++ L+ LN+SNN F  +FP ++   + +L+
Sbjct  86   PAAIGLLDKLVNLKITDDNLTGRLPAEMANLTALKHLNISNNAFSGSFPGEIMLGMTDLE  145

Query  472  VLDLYNNNL  498
            VLD YNNN 
Sbjct  146  VLDAYNNNF  154


 Score = 51.2 bits (121),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 28/74 (38%), Positives = 44/74 (59%), Gaps = 0/74 (0%)
 Frame = +1

Query  277  NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  456
            NL G +   +  L  L +L +  N+LSG +PP++SA++ L  L+LS N      P   ++
Sbjct  250  NLVGPIPTTLSLLKHLYSLFLQVNRLSGSIPPQLSALNRLMSLDLSINELTGEIPESFSE  309

Query  457  LANLQVLDLYNNNL  498
            L NL +++LY NNL
Sbjct  310  LKNLTLVNLYKNNL  323



>ref|XP_009405747.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM3 [Musa acuminata subsp. malaccensis]
Length=984

 Score = 84.0 bits (206),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 57/130 (44%), Positives = 75/130 (58%), Gaps = 6/130 (5%)
 Frame = +1

Query  124  EQAALLSIKAAFTADSQSSLTSWNISTSH---CTWRRVTCdsllhvvsldlsg-lNLSGV  291
            + + LLSIK +F   SQS L SWN S++H   C W  V CD   H+V        N SG 
Sbjct  35   QASILLSIKRSFH-HSQSLLPSWN-SSAHAALCAWDGVRCDDSNHLVLALDVANSNFSGS  92

Query  292  LSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLANLQ  471
            LSP + +L  L +LS+A N LSGP P  IS +  LR+LN+SNN F  T     +  A L+
Sbjct  93   LSPAIAELKGLASLSVAGNSLSGPFPHAISELPRLRYLNISNNQFNGTLNWSFSDTAELE  152

Query  472  VLDLYNNNLT  501
            VLD Y+N+ +
Sbjct  153  VLDAYDNDFS  162


 Score = 53.9 bits (128),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 26/75 (35%), Positives = 42/75 (56%), Gaps = 0/75 (0%)
 Frame = +1

Query  277  NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  456
            N SG + P++G    L  L ++ NQL+GP+P  IS +  L +LNLS N      P ++A 
Sbjct  522  NFSGRIPPEIGDCSSLTYLDLSHNQLAGPIPARISQVRILSYLNLSWNRLSQRIPQEMAS  581

Query  457  LANLQVLDLYNNNLT  501
            + +L   D  +N+ +
Sbjct  582  MKSLTSADFSHNDFS  596


 Score = 51.6 bits (122),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 25/73 (34%), Positives = 44/73 (60%), Gaps = 0/73 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            L G + P++G L  L  L +  NQL+G +P ++  +S+LR+L++SNN      P + ++L
Sbjct  258  LEGEIPPELGNLKNLDTLFLQTNQLTGAIPFQLGNLSSLRYLDISNNALTGEIPKEFSKL  317

Query  460  ANLQVLDLYNNNL  498
              L +L ++ N L
Sbjct  318  HQLTLLHVFMNRL  330



>gb|EEC68382.1| hypothetical protein OsI_36528 [Oryza sativa Indica Group]
Length=955

 Score = 84.0 bits (206),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 51/129 (40%), Positives = 73/129 (57%), Gaps = 4/129 (3%)
 Frame = +1

Query  118  VTEQAALLSIKAAFTADSQSSLTSWNISTSHCTWRRVTCdsl--lhvvsldlsglNLSGV  291
            + ++ ALLS K+   +D    L SWN S+ +C+W  V C       VV+L +S  NLSG 
Sbjct  1    MADEPALLSFKSMLLSDG--FLASWNASSHYCSWPGVVCGGRHPERVVALQMSSFNLSGR  58

Query  292  LSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLANLQ  471
            +SP +G L  L  L +  NQ +G +PPEI  ++ LR LNLS+N    + P  + + A L 
Sbjct  59   ISPSLGNLSLLRELELGDNQFTGDIPPEIGQLTRLRMLNLSSNYLQGSIPASIGECAELM  118

Query  472  VLDLYNNNL  498
             +DL NN L
Sbjct  119  SIDLGNNQL  127


 Score = 53.9 bits (128),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 29/75 (39%), Positives = 43/75 (57%), Gaps = 0/75 (0%)
 Frame = +1

Query  277  NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  456
            NL G +  ++G L  LV     +N+LSG +P  +     L+ ++L NN    + P  L+Q
Sbjct  437  NLEGSIPQEIGGLKNLVQFYADSNKLSGEIPSTLGECQLLQNISLQNNFLSGSVPSLLSQ  496

Query  457  LANLQVLDLYNNNLT  501
            L  LQ+LDL NNNL+
Sbjct  497  LKGLQILDLSNNNLS  511



>ref|XP_008659447.1| PREDICTED: protein NSP-INTERACTING KINASE 1-like [Zea mays]
 gb|AFW86332.1| hypothetical protein ZEAMMB73_446534 [Zea mays]
Length=199

 Score = 80.1 bits (196),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 47/137 (34%), Positives = 71/137 (52%), Gaps = 1/137 (1%)
 Frame = +1

Query  94   AGAGKPLGVTEQAALLSIKAAFTADSQSSLTSWNI-STSHCTWRRVTCdsllhvvsldls  270
            +G   P+    +  +L +  +   D   +L +W+  S   CTW  ++C     V +L+  
Sbjct  20   SGLAAPMDFNHEVQVLMVIKSLLKDPYGALRNWDRNSVDPCTWSFISCSPENLVTALEAP  79

Query  271  glNLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQL  450
              NLSG LSP +G L  L  L +  N + GP+P EI  ++ LR L LS+N    T P+ L
Sbjct  80   SKNLSGRLSPSIGNLTKLEKLQLQNNNIIGPIPAEIGKLAKLRTLVLSSNKLHGTVPNSL  139

Query  451  AQLANLQVLDLYNNNLT  501
             +L  LQ +DL  NNL+
Sbjct  140  GRLGRLQYIDLSYNNLS  156



>ref|XP_008225333.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At3g47570 [Prunus mume]
Length=1522

 Score = 84.0 bits (206),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 51/141 (36%), Positives = 77/141 (55%), Gaps = 2/141 (1%)
 Frame = +1

Query  85   SAGAGAGKPLGVTEQAALLSIKAAFTADSQSSLTSWNISTSHCTWRRVTCdsllhvvsld  264
            S G GA K    T+Q+ALL++++  T+D  + L +W+ STS C W  VTC +  H+  + 
Sbjct  19   SIGTGAAKTNITTDQSALLAMRSHITSDPHNILVNWSTSTSVCNWVGVTCGARRHLRVVS  78

Query  265  lsglNL--SGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTF  438
            L+   +  +G + P +G L FLV LS   N   G +P E+S +  L+F++L  N F  + 
Sbjct  79   LNLSYMVFTGTIPPHLGNLSFLVALSFNNNSFYGTLPHELSYLRRLKFISLRFNNFMGSI  138

Query  439  PHQLAQLANLQVLDLYNNNLT  501
            P        LQ LDLY N  +
Sbjct  139  PSWFGSFPKLQRLDLYGNQFS  159



>gb|EYU30632.1| hypothetical protein MIMGU_mgv1a022995mg, partial [Erythranthe 
guttata]
Length=326

 Score = 81.3 bits (199),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 53/130 (41%), Positives = 83/130 (64%), Gaps = 4/130 (3%)
 Frame = +1

Query  121  TEQAALLSIKAAFTADSQSSLT-SWNISTSHCTWRRVTCdsll---hvvsldlsglNLSG  288
            T+Q+ LL +K+   +D    L+ +W  S+S C+W  VTC S      V +LD+SG++LSG
Sbjct  5    TDQSTLLVLKSHIVSDPYQILSENWTDSSSPCSWIGVTCGSRRHRDRVTALDISGMSLSG  64

Query  289  VLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLANL  468
             + P +G L FLV+L++  N  SG +P ++S++  L+FL+L NN F    P+ L+ L+N+
Sbjct  65   TIPPQIGNLSFLVSLNLGDNLFSGVIPQQLSSLRRLKFLSLQNNGFTGFVPNSLSNLSNI  124

Query  469  QVLDLYNNNL  498
            QV+DL  N L
Sbjct  125  QVVDLSTNYL  134



>ref|XP_010068348.1| PREDICTED: putative receptor-like protein kinase At3g47110 [Eucalyptus 
grandis]
Length=1084

 Score = 83.6 bits (205),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 53/129 (41%), Positives = 67/129 (52%), Gaps = 2/129 (2%)
 Frame = +1

Query  121  TEQAALLSIKAAFTADSQSSLTSWNISTSHCTWRRVTCdsl--lhvvsldlsglNLSGVL  294
            T+  AL S K A   D    L+SWN ST HC W+ V C       V SL L    L G L
Sbjct  31   TDLLALASFKNAIHKDPFRVLSSWNDSTHHCEWQGVLCSKRHPRRVTSLYLRSQGLEGFL  90

Query  295  SPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLANLQV  474
            SP VG L FL  + +  N   G +PP I  +  L  L LSNN FG + P  L++  NL++
Sbjct  91   SPHVGNLSFLRVIFLQNNSFHGEIPPHIGNLFRLHVLVLSNNSFGGSIPSNLSRCLNLEI  150

Query  475  LDLYNNNLT  501
            L+L +N L 
Sbjct  151  LNLIDNQLV  159



>ref|XP_006279948.1| hypothetical protein CARUB_v10025818mg, partial [Capsella rubella]
 gb|EOA12846.1| hypothetical protein CARUB_v10025818mg, partial [Capsella rubella]
Length=974

 Score = 83.6 bits (205),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 48/128 (38%), Positives = 78/128 (61%), Gaps = 1/128 (1%)
 Frame = +1

Query  121  TEQAALLSIKAAFTADSQSSLTSWNISTSHCTWRRVTCdsllhvvsld-lsglNLSGVLS  297
            T++ AL+S ++  + + Q+    W+ +TS C W  V+C++    V+   LS   L+G +S
Sbjct  27   TDKEALISFRSQISQNPQTLSFFWDKNTSPCNWTGVSCNTRNRRVASINLSSRGLTGSIS  86

Query  298  PDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLANLQVL  477
            P +G L FL +L +  NQL G +P EI+ +  L+ LNLS+N  G + P  L +L +LQ+L
Sbjct  87   PSIGNLSFLTSLQLQNNQLQGTIPEEITNLFRLKVLNLSSNSIGGSLPSNLNKLVDLQIL  146

Query  478  DLYNNNLT  501
            DL +N +T
Sbjct  147  DLTSNTIT  154


 Score = 59.3 bits (142),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 32/74 (43%), Positives = 45/74 (61%), Gaps = 0/74 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            ++G++   +G L  L  L++  N   GP+PP +S IS+L  LNL  N    T P++L +L
Sbjct  153  ITGLVPNQLGDLKNLNILNLGKNLFYGPIPPSLSNISSLTVLNLGTNSLSGTIPYELGRL  212

Query  460  ANLQVLDLYNNNLT  501
              LQVLDL  NNLT
Sbjct  213  QKLQVLDLTINNLT  226


 Score = 49.3 bits (116),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 28/74 (38%), Positives = 42/74 (57%), Gaps = 0/74 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            LSG +  DV +L  LV+L I+ NQLS  +P  I    +L  LN++ N      P  +A+L
Sbjct  499  LSGPIPQDVSRLESLVSLDISDNQLSSNIPSSIKGCQSLEKLNMARNNLSGPIPESVAEL  558

Query  460  ANLQVLDLYNNNLT  501
              L++LDL +N  +
Sbjct  559  KGLELLDLSSNQFS  572



>gb|AAP49010.1| CLV1-like receptor kinase [Brassica napus]
Length=978

 Score = 83.6 bits (205),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 53/132 (40%), Positives = 83/132 (63%), Gaps = 5/132 (4%)
 Frame = +1

Query  121  TEQAALLSIKAAFTADSQSSLTSWNISTS---HCTWRRVTCdsllhvvsldlsglNLSGV  291
            T+   LL++K++    +   L  W  S S   HC++  V+CD    V+SL++S   L G 
Sbjct  33   TDMDHLLTLKSSMVGPNGHGLHDWVRSPSPSAHCSFSGVSCDGDARVISLNVSFTPLFGT  92

Query  292  LSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNI-FGSTFPHQ-LAQLAN  465
            +SP++G L  LVNL++AAN  SG +P E+ ++++L+ LN+SNN+    TFP + L  + +
Sbjct  93   ISPEIGMLDRLVNLTLAANNFSGMLPLEMKSLTSLKVLNISNNVNLNGTFPGEILTPMVD  152

Query  466  LQVLDLYNNNLT  501
            L+VLD YNNN T
Sbjct  153  LEVLDAYNNNFT  164



>gb|KCW63534.1| hypothetical protein EUGRSUZ_G01170 [Eucalyptus grandis]
Length=969

 Score = 83.6 bits (205),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 53/129 (41%), Positives = 67/129 (52%), Gaps = 2/129 (2%)
 Frame = +1

Query  121  TEQAALLSIKAAFTADSQSSLTSWNISTSHCTWRRVTCdsll--hvvsldlsglNLSGVL  294
            T+  AL S K A   D    L+SWN ST HC W+ V C       V SL L    L G L
Sbjct  31   TDLLALASFKNAIHKDPFRVLSSWNDSTHHCEWQGVLCSKRHPRRVTSLYLRSQGLEGFL  90

Query  295  SPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLANLQV  474
            SP VG L FL  + +  N   G +PP I  +  L  L LSNN FG + P  L++  NL++
Sbjct  91   SPHVGNLSFLRVIFLQNNSFHGEIPPHIGNLFRLHVLVLSNNSFGGSIPSNLSRCLNLEI  150

Query  475  LDLYNNNLT  501
            L+L +N L 
Sbjct  151  LNLIDNQLV  159



>gb|ADD64789.1| CLAVATA1 [Brassica napus]
Length=987

 Score = 83.6 bits (205),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 53/132 (40%), Positives = 83/132 (63%), Gaps = 5/132 (4%)
 Frame = +1

Query  121  TEQAALLSIKAAFTADSQSSLTSWNISTS---HCTWRRVTCdsllhvvsldlsglNLSGV  291
            T+   LL++K++    +   L  W  S S   HC++  V+CD    V+SL++S   L G 
Sbjct  33   TDMDHLLTLKSSMVGPNGHGLHDWVRSPSPSAHCSFSGVSCDGDARVISLNVSFTPLFGT  92

Query  292  LSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNI-FGSTFPHQ-LAQLAN  465
            +SP++G L  LVNL++AAN  SG +P E+ ++++L+ LN+SNN+    TFP + L  + +
Sbjct  93   ISPEIGMLDRLVNLTLAANNFSGMLPLEMKSLTSLKVLNISNNVNLNGTFPGEILTPMVD  152

Query  466  LQVLDLYNNNLT  501
            L+VLD YNNN T
Sbjct  153  LEVLDAYNNNFT  164



>ref|XP_009377798.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At3g47570 [Pyrus x bretschneideri]
Length=1067

 Score = 83.6 bits (205),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 45/126 (36%), Positives = 67/126 (53%), Gaps = 1/126 (1%)
 Frame = +1

Query  124  EQAALLSIKAAFTADSQSSLTSWNISTSHCTWRRVTCdsllhvvsld-lsglNLSGVLSP  300
            ++ ALL  K   TAD    ++SWN S   C+W  V+C      V +  L    L G + P
Sbjct  21   DRLALLDFKKRITADPLDVMSSWNHSIHFCSWVGVSCHRSTKRVLMLNLESQKLVGSIPP  80

Query  301  DVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLANLQVLD  480
             VG L +L  + + AN   G +PPE+  + +L++LNLS N F    P  L+Q   L++LD
Sbjct  81   SVGNLTYLTGIKLGANNFHGEIPPEMGRLQSLQYLNLSYNSFRGVIPTNLSQCTQLKMLD  140

Query  481  LYNNNL  498
            L +N +
Sbjct  141  LQDNRI  146


 Score = 50.1 bits (118),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 28/74 (38%), Positives = 41/74 (55%), Gaps = 0/74 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            L+G L   VG L  L  L++  N LSG +P  + + ++L  L+L  N F  T P  L  L
Sbjct  492  LTGSLPLQVGDLVHLTELNVLRNNLSGEIPSNLGSCASLERLHLQGNKFEGTIPQSLKDL  551

Query  460  ANLQVLDLYNNNLT  501
              L+ LD+ +NNL+
Sbjct  552  KGLERLDISSNNLS  565



>ref|XP_004138566.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At3g47570-like [Cucumis sativus]
 gb|KGN45786.1| hypothetical protein Csa_6G011610 [Cucumis sativus]
Length=1023

 Score = 83.6 bits (205),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 52/139 (37%), Positives = 71/139 (51%), Gaps = 4/139 (3%)
 Frame = +1

Query  85   SAGAGAGKPLGVTEQAALLSIKAAFTADSQSSLTSWNISTSHCTWRRVTCdsllhvvsld  264
            SA  GA +    T++ ALLS K+  T D      SWN S   C W  V C+    V  L+
Sbjct  31   SAAIGANE----TDRLALLSFKSEITVDPLGLFISWNESVHFCNWAGVICNPQRRVTELN  86

Query  265  lsglNLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPH  444
            L     +G LSP +G L FL  L++  N   G +P EI ++S L+ L+  NN F    P 
Sbjct  87   LPSYQFNGKLSPSIGNLSFLTTLNLPNNSFGGEIPQEIGSLSRLQELDFRNNYFVGEIPI  146

Query  445  QLAQLANLQVLDLYNNNLT  501
             ++  + LQ + L NNNLT
Sbjct  147  TISNCSQLQYIGLLNNNLT  165



>ref|XP_010942232.1| PREDICTED: protein NSP-INTERACTING KINASE 1-like [Elaeis guineensis]
Length=624

 Score = 82.8 bits (203),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 61/141 (43%), Positives = 78/141 (55%), Gaps = 3/141 (2%)
 Frame = +1

Query  85   SAGAGAGKPLGVT-EQAALLSIKAAFTADSQSSLTSWNI-STSHCTWRRVTCdsllhvvs  258
            +  A A  P GV  E  AL++IKA+   D  ++L SW+  S   C+W  VTC     V+S
Sbjct  20   ACAAAALTPKGVNFEVQALMNIKASLK-DPHNALKSWDKDSVDPCSWAAVTCSPQDFVIS  78

Query  259  ldlsglNLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTF  438
            L     NLSG LSP +G L  L  L +  N +SGP+P EI  +S LR L LSNN F    
Sbjct  79   LGTPSWNLSGTLSPSIGNLTNLETLLLQNNSISGPLPAEIGKLSKLRTLELSNNRFSGEI  138

Query  439  PHQLAQLANLQVLDLYNNNLT  501
            P  L  L +LQ L L NN+L+
Sbjct  139  PSSLGNLKSLQYLRLNNNSLS  159



>ref|XP_011021148.1| PREDICTED: protein NSP-INTERACTING KINASE 1-like isoform X2 [Populus 
euphratica]
Length=626

 Score = 82.8 bits (203),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 53/133 (40%), Positives = 73/133 (55%), Gaps = 3/133 (2%)
 Frame = +1

Query  109  PLGVT-EQAALLSIKAAFTADSQSSLTSWN-ISTSHCTWRRVTCdsllhvvsldlsglNL  282
            P GV  E  AL+ IKA+   D    L +W+  +   C+W  VTC S   V+ L     NL
Sbjct  31   PKGVNFEVQALMGIKASLD-DPHGVLENWDGDAVDPCSWTMVTCSSESLVIGLGTPSQNL  89

Query  283  SGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLA  462
            SG LSP +G L  L  + + +N ++GP+P EI  +S L  L+LSNN F    P  L  L 
Sbjct  90   SGTLSPTIGNLTNLQTVLLQSNNITGPIPAEIGKLSKLHTLDLSNNFFTGKIPSSLGHLR  149

Query  463  NLQVLDLYNNNLT  501
            NL+ + L NN+L+
Sbjct  150  NLEYMRLNNNSLS  162



>ref|XP_011021146.1| PREDICTED: protein NSP-INTERACTING KINASE 1-like isoform X1 [Populus 
euphratica]
Length=627

 Score = 82.8 bits (203),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 53/133 (40%), Positives = 73/133 (55%), Gaps = 3/133 (2%)
 Frame = +1

Query  109  PLGVT-EQAALLSIKAAFTADSQSSLTSWN-ISTSHCTWRRVTCdsllhvvsldlsglNL  282
            P GV  E  AL+ IKA+   D    L +W+  +   C+W  VTC S   V+ L     NL
Sbjct  31   PKGVNFEVQALMGIKASLD-DPHGVLENWDGDAVDPCSWTMVTCSSESLVIGLGTPSQNL  89

Query  283  SGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLA  462
            SG LSP +G L  L  + + +N ++GP+P EI  +S L  L+LSNN F    P  L  L 
Sbjct  90   SGTLSPTIGNLTNLQTVLLQSNNITGPIPAEIGKLSKLHTLDLSNNFFTGKIPSSLGHLR  149

Query  463  NLQVLDLYNNNLT  501
            NL+ + L NN+L+
Sbjct  150  NLEYMRLNNNSLS  162



>ref|XP_010927978.1| PREDICTED: protein NSP-INTERACTING KINASE 1-like isoform X1 [Elaeis 
guineensis]
Length=635

 Score = 82.8 bits (203),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 56/141 (40%), Positives = 78/141 (55%), Gaps = 3/141 (2%)
 Frame = +1

Query  85   SAGAGAGKPLGVT-EQAALLSIKAAFTADSQSSLTSWN-ISTSHCTWRRVTCdsllhvvs  258
            ++ AG   P GV  E  AL+ IK +   D  S L +W+  S   C+W  VTC     V+S
Sbjct  31   ASAAGLLSPKGVNFEVQALIDIKVSLK-DPHSVLENWDQDSVDPCSWAMVTCSPDNLVIS  89

Query  259  ldlsglNLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTF  438
            L     +LSG LS  +G L  L  + +  N +SGP+PPEI  +S L+ L+LSNN F    
Sbjct  90   LGSPSQSLSGTLSSSIGNLTNLETVLLQNNNISGPIPPEIGRLSKLKTLDLSNNYFTGEI  149

Query  439  PHQLAQLANLQVLDLYNNNLT  501
            P  + Q+ +LQ L L NN+L+
Sbjct  150  PTSIGQMESLQYLRLNNNSLS  170



>ref|XP_009108464.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM3 [Brassica rapa]
Length=995

 Score = 83.6 bits (205),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 55/132 (42%), Positives = 75/132 (57%), Gaps = 5/132 (4%)
 Frame = +1

Query  118  VTEQAALLSIKAAFTADSQSSLTSWNIST--SHCTWRRVTCdsllhvvsldlsg-lNLSG  288
            V +   L SIK +F +    SL SW +    S C+W  V+CD+L   ++      LN+SG
Sbjct  36   VRQAKVLFSIKQSFDS-YDPSLDSWTVPNFNSLCSWTGVSCDNLNQSITRLDISNLNISG  94

Query  289  VLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIF-GSTFPHQLAQLAN  465
             LSP+V +LP LV LS+A+N  SG +P EI  +S L  LN+S N F G   P +  ++  
Sbjct  95   TLSPEVSRLPSLVFLSVASNSFSGKIPKEIHKLSNLEVLNISTNAFEGELAPLEFGEMTQ  154

Query  466  LQVLDLYNNNLT  501
            L  LD YNNN T
Sbjct  155  LTTLDAYNNNFT  166


 Score = 52.0 bits (123),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 27/75 (36%), Positives = 44/75 (59%), Gaps = 0/75 (0%)
 Frame = +1

Query  277  NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  456
            NLSG L P+ G+   L  L ++ N++SG +P +IS I  L +LN+S N    + P +L  
Sbjct  528  NLSGKLPPEFGECQSLTYLDLSHNEISGQIPVQISRIRILNYLNVSWNSLNQSLPVELGS  587

Query  457  LANLQVLDLYNNNLT  501
            + +L  +D  +NN +
Sbjct  588  MKSLTSVDFSHNNFS  602



>ref|XP_007009037.1| LRR receptor-like serine/threonine-protein kinase, putative [Theobroma 
cacao]
 gb|EOY17847.1| LRR receptor-like serine/threonine-protein kinase, putative [Theobroma 
cacao]
Length=907

 Score = 83.2 bits (204),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 54/128 (42%), Positives = 74/128 (58%), Gaps = 1/128 (1%)
 Frame = +1

Query  121  TEQAALLSIKAAFTADSQSSLTSWNISTSHCTWRRVTCdsl-lhvvsldlsglNLSGVLS  297
            T++ ALLSIK         +L SWN S   C W+ VTC      V +L+LSGL L+G LS
Sbjct  42   TDRIALLSIKDQLVGAYPGALDSWNASLHFCEWQGVTCGRRHQRVTALELSGLKLAGSLS  101

Query  298  PDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLANLQVL  477
            P +G L FL  L+++ N+L G +P E+  +  L F  LS+N      P +LA  +NL  +
Sbjct  102  PSIGNLTFLRRLNLSDNRLKGNIPKEVGYLRRLLFFELSSNNLHGKLPVELANCSNLLTI  161

Query  478  DLYNNNLT  501
            DL +NNLT
Sbjct  162  DLSSNNLT  169


 Score = 83.2 bits (204),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 51/128 (40%), Positives = 70/128 (55%), Gaps = 1/128 (1%)
 Frame = +1

Query  121  TEQAALLSIKAAFTADSQSSLTSWNISTSHCTWRRVTCdsllhvvsldls-glNLSGVLS  297
            T++ ALLSIK         +L SWN S   C W+ VTC      V+     GL L+G LS
Sbjct  230  TDRIALLSIKDQLVGAYPGALDSWNASLHFCEWQGVTCGRHHQRVTALELPGLKLAGSLS  289

Query  298  PDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLANLQVL  477
            P +G L FL  L+++ N+L G +P E+  +  L F  LS+N      P +LA  +NL  +
Sbjct  290  PSIGNLTFLRRLNLSDNRLKGNIPKEVGYLRRLLFFELSSNNLHGKLPVELANCSNLLTI  349

Query  478  DLYNNNLT  501
            DL +NNLT
Sbjct  350  DLSSNNLT  357


 Score = 52.4 bits (124),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 27/74 (36%), Positives = 41/74 (55%), Gaps = 0/74 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            L+G+L  D+G L  L+ L +  N+L G +P  +   S LR L+++ N F    P     L
Sbjct  702  LTGLLPSDLGNLKNLIGLYVYENKLFGEIPKTLGECSGLRSLDMAGNFFQGGIPLSFGSL  761

Query  460  ANLQVLDLYNNNLT  501
             +L+ LDL  NNL+
Sbjct  762  KSLEFLDLSRNNLS  775



>emb|CBI21262.3| unnamed protein product [Vitis vinifera]
Length=481

 Score = 82.4 bits (202),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 48/123 (39%), Positives = 70/123 (57%), Gaps = 1/123 (1%)
 Frame = +1

Query  136  LLSIKAAFTADSQSSLTSWNISTSHCTWRRVTCdsllhvvsldlsglNL-SGVLSPDVGQ  312
            LLS K++ + D  S L+ WN+ST+HC W  VTCD     + +     N+ SG +  DV +
Sbjct  29   LLSFKSSISLDPASLLSDWNLSTNHCHWYGVTCDRFSGRLRILSIPHNVFSGEIPADVAK  88

Query  313  LPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLANLQVLDLYNN  492
            L  L  L +  N  SG +P +IS++ +LR LNLS N+     P +L     L+V+DL NN
Sbjct  89   LHKLEILQLQGNNFSGRIPDQISSLLSLRMLNLSYNVVSGQIPDKLIGSGKLRVIDLSNN  148

Query  493  NLT  501
             L+
Sbjct  149  QLS  151



>ref|XP_011019593.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At2g25790 [Populus euphratica]
 ref|XP_011019594.1| PREDICTED: probably inactive leucine-rich repeat receptor-like 
protein kinase At2g25790 [Populus euphratica]
Length=971

 Score = 83.2 bits (204),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 50/126 (40%), Positives = 79/126 (63%), Gaps = 3/126 (2%)
 Frame = +1

Query  124  EQAALLSIKAAFTADSQSSLTSWNISTSHCTWRRVTCdsllhvvsldlsglNLSGVLSPD  303
            E   LLS K++   D    L++WN+S + C W+ +TC +   +  ++LSG N+SG +S  
Sbjct  36   ELELLLSFKSSLN-DPLKYLSNWNLSATFCKWQGITCTTSSRITVIELSGKNISGKISSS  94

Query  304  VGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLANLQVLDL  483
            + QLP++  + +++NQLSG +P ++ + S+LRFLNLSNN F    P+    L  L+ LDL
Sbjct  95   IFQLPYIQTIDLSSNQLSGKLPDDVFSSSSLRFLNLSNNNFTGPIPNGSKFL--LETLDL  152

Query  484  YNNNLT  501
             NN L+
Sbjct  153  SNNMLS  158


 Score = 52.0 bits (123),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 27/75 (36%), Positives = 44/75 (59%), Gaps = 0/75 (0%)
 Frame = +1

Query  277  NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  456
            NL+G +   +G L  L  L +  N+L+GP+P  I  ++ L  L+LS+N      P  + +
Sbjct  252  NLTGQIPSSLGNLSNLQYLFLYQNKLAGPIPKSIFGLTKLISLDLSDNSLSGEIPELIIK  311

Query  457  LANLQVLDLYNNNLT  501
            L NL++L L++NN T
Sbjct  312  LKNLEILHLFSNNFT  326



>ref|NP_001238576.1| receptor protein kinase-like protein precursor [Glycine max]
 gb|AAF59905.1|AF197946_1 receptor protein kinase-like protein [Glycine max]
Length=981

 Score = 83.2 bits (204),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 50/133 (38%), Positives = 85/133 (64%), Gaps = 6/133 (5%)
 Frame = +1

Query  121  TEQAALLSIKAAFTAD--SQSSLTSWNISTS---HCTWRRVTCdsllhvvsldlsglNLS  285
            ++  ALL +K +   D     +L  W  STS   HC +  V+CD  L VV++++S + L 
Sbjct  27   SDMDALLKLKESMKGDRAKDDALHDWKFSTSLSAHCFFSGVSCDQELRVVAINVSFVPLF  86

Query  286  GVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLA-QLA  462
            G + P++G+L  L NL+I+ N L+G +P E++A+++L+ LN+S+N+F   FP ++   + 
Sbjct  87   GHVPPEIGELDKLENLTISQNNLTGELPKELAALTSLKHLNISHNVFSGYFPGKIILPMT  146

Query  463  NLQVLDLYNNNLT  501
             L+VLD+Y+NN T
Sbjct  147  ELEVLDVYDNNFT  159



>ref|XP_010100747.1| putative LRR receptor-like serine/threonine-protein kinase [Morus 
notabilis]
 gb|EXB84050.1| putative LRR receptor-like serine/threonine-protein kinase [Morus 
notabilis]
Length=599

 Score = 82.8 bits (203),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 54/133 (41%), Positives = 74/133 (56%), Gaps = 3/133 (2%)
 Frame = +1

Query  109  PLGVT-EQAALLSIKAAFTADSQSSLTSWNI-STSHCTWRRVTCdsllhvvsldlsglNL  282
            P GV  E AAL+S+K+    D    +  W+I S   CTW  V C     V+SL+++ + L
Sbjct  33   PKGVNYEVAALMSLKSKMK-DELQVMGGWDINSVDPCTWNMVACSLEGFVISLEMTSVGL  91

Query  283  SGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLA  462
            SG LSP +G L  L  + +  NQ++GP+P EI  +S L  L+LS N F    P  L  L 
Sbjct  92   SGTLSPSIGNLTHLRTMLLQNNQITGPIPSEIGKLSELHTLDLSGNQFDGEIPSSLGLLT  151

Query  463  NLQVLDLYNNNLT  501
            +L  LDL  NNL+
Sbjct  152  HLSYLDLSFNNLS  164



>ref|XP_010471715.1| PREDICTED: receptor protein kinase CLAVATA1 isoform X1 [Camelina 
sativa]
 ref|XP_010471716.1| PREDICTED: receptor protein kinase CLAVATA1 isoform X2 [Camelina 
sativa]
Length=991

 Score = 83.2 bits (204),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 51/135 (38%), Positives = 85/135 (63%), Gaps = 5/135 (4%)
 Frame = +1

Query  112  LGVTEQAALLSIKAAFTADSQSSLTSWNISTS---HCTWRRVTCdsllhvvsldlsglNL  282
            L  T+   LL++K++    +   L  W  S S   HC++  V+CD    V+SL++S   L
Sbjct  34   LAYTDMEVLLNLKSSMIGHNGDGLHDWIHSPSPAAHCSFTGVSCDGEARVISLNVSFTPL  93

Query  283  SGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNI-FGSTFPHQLAQ-  456
             G +SP++G L  LVNL++AAN  +G +P E+ ++++L+ LN+SNN+    +FP ++ + 
Sbjct  94   FGKISPEIGMLNRLVNLTLAANNFTGELPLEMKSLTSLKVLNISNNVNLSGSFPGEMVKA  153

Query  457  LANLQVLDLYNNNLT  501
            + +L+VLD YNNN T
Sbjct  154  MVDLEVLDAYNNNFT  168



>ref|XP_010935096.1| PREDICTED: leucine-rich repeat receptor-like kinase protein FLORAL 
ORGAN NUMBER1 [Elaeis guineensis]
Length=987

 Score = 83.2 bits (204),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 51/123 (41%), Positives = 73/123 (59%), Gaps = 1/123 (1%)
 Frame = +1

Query  136  LLSIKAAFTADSQSSLTSWNIS-TSHCTWRRVTCdsllhvvsldlsglNLSGVLSPDVGQ  312
            L+ +K      + + L  W+ S  +HC++  VTCD+   VV+L++S +     L P++G 
Sbjct  30   LMKLKDGLHGPAGNDLHDWDPSGPTHCSFSGVTCDADARVVALNVSYIRFHRPLPPEIGL  89

Query  313  LPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLANLQVLDLYNN  492
            L  LVNL++A N L+G +PPEI A+  LRFLN+SNN F   FP        L VLD YNN
Sbjct  90   LDRLVNLTVACNFLTGQLPPEIGALPALRFLNISNNNFTGRFPDVDGGFPALVVLDAYNN  149

Query  493  NLT  501
            N +
Sbjct  150  NFS  152


 Score = 57.0 bits (136),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 29/75 (39%), Positives = 45/75 (60%), Gaps = 0/75 (0%)
 Frame = +1

Query  277  NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  456
            +L+G + PD+G L  L +L ++ N+L+G +P   + +  L+ LNL  N F    P  +A 
Sbjct  271  HLTGSIPPDLGGLDRLQSLDLSINELTGELPESFAGLKQLKLLNLFRNHFRGRIPPFIAD  330

Query  457  LANLQVLDLYNNNLT  501
            L NL+VL L+ NN T
Sbjct  331  LPNLEVLQLWENNFT  345


 Score = 50.1 bits (118),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 26/74 (35%), Positives = 42/74 (57%), Gaps = 0/74 (0%)
 Frame = +1

Query  277  NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  456
            NLSG +   +GQL  L +L +  N L+G +PP++  +  L+ L+LS N      P   A 
Sbjct  247  NLSGRIPASLGQLKLLDSLFLQWNHLTGSIPPDLGGLDRLQSLDLSINELTGELPESFAG  306

Query  457  LANLQVLDLYNNNL  498
            L  L++L+L+ N+ 
Sbjct  307  LKQLKLLNLFRNHF  320



>ref|XP_002264952.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM3 [Vitis vinifera]
Length=988

 Score = 83.2 bits (204),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 57/128 (45%), Positives = 77/128 (60%), Gaps = 4/128 (3%)
 Frame = +1

Query  124  EQAALLSIKAAFTADSQSSLTSWNIST--SHCTWRRVTCdsllh-vvsldlsglNLSGVL  294
            + + L+++K AF A    SL SW +S   S C+W  V CD     VVSLD+S  N+SG L
Sbjct  36   QASTLVALKQAFEA-PHPSLNSWKVSNYRSLCSWTGVQCDDTSTWVVSLDISNSNISGAL  94

Query  295  SPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLANLQV  474
            SP + +L  L NLS+  N L+G  PPEI  +S L++LN+SNN F  +   +  QL  L V
Sbjct  95   SPAIMELGSLRNLSVCGNNLAGSFPPEIHKLSRLQYLNISNNQFNGSLNWEFHQLKELAV  154

Query  475  LDLYNNNL  498
            LD Y+NN 
Sbjct  155  LDAYDNNF  162


 Score = 56.2 bits (134),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 26/75 (35%), Positives = 44/75 (59%), Gaps = 0/75 (0%)
 Frame = +1

Query  277  NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  456
            N SG++ P++G    L  L ++ NQ+SGP+P +I+ I  L +LNLS N      P ++  
Sbjct  523  NFSGIIPPEIGHCLSLTYLDLSQNQISGPIPVQIAQIHILNYLNLSWNHMNQNLPKEIGF  582

Query  457  LANLQVLDLYNNNLT  501
            + +L  +D  +NN +
Sbjct  583  MKSLTSVDFSHNNFS  597



>ref|XP_008444584.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At3g47570 [Cucumis melo]
Length=994

 Score = 83.2 bits (204),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 52/130 (40%), Positives = 79/130 (61%), Gaps = 3/130 (2%)
 Frame = +1

Query  121  TEQAALLSIKAAFTADSQSS-LTSW-NISTSHCTWRRVTCdsllhvvsldlsg-lNLSGV  291
            T++ AL+SIK+ FT    S+ L+SW N ++S C W RV+C+   + V       L +SG 
Sbjct  11   TDKQALISIKSGFTNLKPSNPLSSWDNPNSSPCNWTRVSCNKKGNRVIGLDLSGLQISGS  70

Query  292  LSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLANLQ  471
            L P +G L FL +L +  N L+GP+P +IS +  L  LN+S N     FP  ++ +A L+
Sbjct  71   LDPHIGNLTFLHSLQLQNNLLTGPIPHQISKLFRLNLLNMSFNSLEGGFPSNISHMAALE  130

Query  472  VLDLYNNNLT  501
            +LDL +NN+T
Sbjct  131  ILDLTSNNIT  140



>ref|XP_009131797.1| PREDICTED: LRR receptor-like serine/threonine-protein kinase 
EFR [Brassica rapa]
Length=1032

 Score = 83.2 bits (204),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 48/127 (38%), Positives = 71/127 (56%), Gaps = 1/127 (1%)
 Frame = +1

Query  121  TEQAALLSIKAAFTADSQSSLTSWNISTSHCTWRRVTCdsllhvvsld-lsglNLSGVLS  297
            T+  ALL  K+  T + +  L SWN S+  CTW  VTC+     V+   L G  L+GV+S
Sbjct  31   TDMKALLEFKSQATVNRREVLASWNNSSPLCTWIGVTCNRRRERVTSLNLGGFKLAGVIS  90

Query  298  PDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLANLQVL  477
            P +G L FL++L++  N   G +P E+  +  L++LN+S N+     PH L+    L  L
Sbjct  91   PSIGNLSFLISLNLGDNSFVGTIPQEVGMLFRLQYLNMSFNLLEGKIPHSLSNCYRLSTL  150

Query  478  DLYNNNL  498
            DL +N L
Sbjct  151  DLSSNRL  157


 Score = 50.4 bits (119),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 29/74 (39%), Positives = 44/74 (59%), Gaps = 1/74 (1%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            L+G L  +VG+L  LV L+ + N+LSG +P  +    +L FL +  N F    P  ++QL
Sbjct  501  LTGSLPEEVGKLQLLVGLAASNNKLSGHLPHTLGGCLSLEFLYMQGNSFDGDIP-DISQL  559

Query  460  ANLQVLDLYNNNLT  501
             +L+ LD  NNNL+
Sbjct  560  VSLRNLDFSNNNLS  573



>gb|KFK34061.1| hypothetical protein AALP_AA5G097000 [Arabis alpina]
Length=1015

 Score = 83.2 bits (204),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 45/127 (35%), Positives = 71/127 (56%), Gaps = 1/127 (1%)
 Frame = +1

Query  121  TEQAALLSIKAAFTADSQSSLTSWNISTSHCTWRRVTCdsllhvvsldls-glNLSGVLS  297
            T++ ALL  K+  + D +  L+SWN S   C W+ VTC      V+      L L GV++
Sbjct  28   TDRQALLEFKSQVSEDGRVVLSSWNHSFPVCNWKGVTCGRKHKRVTGLALGRLQLGGVIT  87

Query  298  PDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLANLQVL  477
            P +G L FL++L+I+ N   G +P E+  +  L+ L++S+N+     P  L   + LQ L
Sbjct  88   PSIGNLSFLISLNISENSFVGHIPHELGNLFRLKHLDMSSNVLEGGIPASLYNCSRLQTL  147

Query  478  DLYNNNL  498
            +LY N+L
Sbjct  148  ELYKNHL  154


 Score = 49.3 bits (116),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 31/74 (42%), Positives = 41/74 (55%), Gaps = 1/74 (1%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
             SG L  DVGQL  LV LS+A N+LSG +P  +     L  L L  N F    P  + +L
Sbjct  498  FSGSLPNDVGQLQSLVILSVAHNKLSGKLPQSLGKCLPLEVLYLRGNSFDGEVP-DIRRL  556

Query  460  ANLQVLDLYNNNLT  501
              L+++DL NN L+
Sbjct  557  VGLRIVDLSNNKLS  570



>ref|XP_010256508.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At3g47570 [Nelumbo nucifera]
Length=1044

 Score = 83.2 bits (204),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 47/128 (37%), Positives = 65/128 (51%), Gaps = 1/128 (1%)
 Frame = +1

Query  121  TEQAALLSIKAAFTADSQSSLTSWNISTSHCTWRRVTCdsllhvvsldlsglN-LSGVLS  297
            T++ ALL  K     D   +L SWN S   C W+ VTC      ++      N L G+L 
Sbjct  38   TDRLALLGFKNNHIYDPLGALNSWNESLHFCKWKGVTCGRKHQRITFLDLSDNRLEGILP  97

Query  298  PDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLANLQVL  477
            P +G L FL  + ++ N   G +P EI  +  L+FLNLS N      P  L +  +L+VL
Sbjct  98   PYIGNLTFLRGIYLSNNGFHGTIPQEIGRLFRLQFLNLSTNFLQGEIPTNLTRCHDLRVL  157

Query  478  DLYNNNLT  501
            D+  NNLT
Sbjct  158  DIRKNNLT  165


 Score = 58.9 bits (141),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 31/74 (42%), Positives = 46/74 (62%), Gaps = 0/74 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            LSG L P+V +L ++  L++  N+LSG +P  + A S+LR+L L  N F    P  L+ L
Sbjct  509  LSGSLPPEVVKLKYIEQLAVFGNKLSGEIPAALGACSSLRYLYLGANFFHGNIPSSLSLL  568

Query  460  ANLQVLDLYNNNLT  501
              ++VLDL  NNL+
Sbjct  569  RAIEVLDLSLNNLS  582



>ref|XP_006853709.1| hypothetical protein AMTR_s00056p00150470 [Amborella trichopoda]
 gb|ERN15176.1| hypothetical protein AMTR_s00056p00150470 [Amborella trichopoda]
Length=918

 Score = 82.8 bits (203),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 62/130 (48%), Positives = 85/130 (65%), Gaps = 3/130 (2%)
 Frame = +1

Query  118  VTEQAALLSIKAAFTADSQSSLTSWNI--STSHCTWRRVTCdsllhvvsldlsglNLSGV  291
            V     L ++K A   D +SSL +W+   S+++C+W  + CD   +V  LD+S + LSG 
Sbjct  21   VDNSGPLWAVKFAIN-DPESSLETWSKGNSSNYCSWIGIQCDDSGYVSVLDISDMGLSGQ  79

Query  292  LSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLANLQ  471
            +SP++G L  L  LS+A N+ SG +P EI+ IS L  LNLSNN+F  TFP  L+ L NL+
Sbjct  80   ISPEIGNLQRLTTLSLAVNEFSGQIPAEIARISGLNLLNLSNNLFNGTFPVSLSGLKNLE  139

Query  472  VLDLYNNNLT  501
            VLDLYNNNLT
Sbjct  140  VLDLYNNNLT  149



>ref|XP_010064793.1| PREDICTED: putative receptor-like protein kinase At3g47110 [Eucalyptus 
grandis]
Length=665

 Score = 82.4 bits (202),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 52/129 (40%), Positives = 70/129 (54%), Gaps = 2/129 (2%)
 Frame = +1

Query  121  TEQAALLSIKAAFTADSQSSLTSWNISTSHCTWRRVTCdsl--lhvvsldlsglNLSGVL  294
            T++ AL+  K +   DS   L+SWN S+ HC W  + C       V SL+L    L G+L
Sbjct  29   TDRLALIYFKDSVDEDSLEVLSSWNDSSHHCEWPGIVCGGRHPKRVTSLNLMSKGLGGLL  88

Query  295  SPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLANLQV  474
            SP VG L FL +L +  N   G +P  I  +  LR L LSNN F    P  L+Q +NL+V
Sbjct  89   SPHVGNLSFLRSLVLQNNSFHGKIPQSIGHLFRLRHLVLSNNSFSGQMPTNLSQCSNLEV  148

Query  475  LDLYNNNLT  501
            L+L +N L 
Sbjct  149  LNLIDNQLV  157



>emb|CAN63733.1| hypothetical protein VITISV_025883 [Vitis vinifera]
Length=609

 Score = 82.4 bits (202),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 50/124 (40%), Positives = 71/124 (57%), Gaps = 2/124 (2%)
 Frame = +1

Query  133  ALLSIKAAFTADSQSSLTSWNI-STSHCTWRRVTCdsllhvvsldlsglNLSGVLSPDVG  309
            AL+SIK +   D +S L +W+  +   C+W  +TC     V+SL     NLSG LSP +G
Sbjct  21   ALMSIKNSLI-DPRSVLENWDKDAVDPCSWNMITCSDDKLVISLGTPSQNLSGTLSPSIG  79

Query  310  QLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLANLQVLDLYN  489
             L  L  + +  N +SGP+P E+  +S L  L+LSNN F    P  L+ L +LQ L L N
Sbjct  80   NLTNLQTVLLQDNSISGPIPSELGKLSKLHLLDLSNNFFNGEIPTSLSHLKSLQYLRLNN  139

Query  490  NNLT  501
            N+L+
Sbjct  140  NSLS  143



>gb|KEH19631.1| LRR receptor-like kinase [Medicago truncatula]
Length=1082

 Score = 82.8 bits (203),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 52/129 (40%), Positives = 78/129 (60%), Gaps = 2/129 (2%)
 Frame = +1

Query  121  TEQAALLSIKAAFTADSQSSLTS-WNISTSHCTWRRVTCdsll-hvvsldlsglNLSGVL  294
            T+Q+ALL+ K   T+D  + L + W+ ++S C+W  VTCD     V SL+L+ + L G +
Sbjct  31   TDQSALLAFKFLITSDPNNPLVNNWSTTSSVCSWVGVTCDDRHGRVHSLNLTNMGLRGTV  90

Query  295  SPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLANLQV  474
            SP++G L FLV L ++ N   GP P EI  +  L+FL +SNN F    P +L  L+ LQ+
Sbjct  91   SPNLGNLSFLVKLDLSYNTFVGPFPKEICRLRRLKFLAISNNEFNGGVPTRLGDLSQLQL  150

Query  475  LDLYNNNLT  501
            L +  NN +
Sbjct  151  LSIATNNFS  159



Lambda      K        H        a         alpha
   0.316    0.129    0.374    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 564814758300