BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFF036D07

Length=561
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

gb|AHJ60264.1|  phenylalanine ammonia-lyase 1                           304   1e-95   Ipomoea purpurea
sp|Q42858.1|PAL2_IPOBA  RecName: Full=Phenylalanine ammonia-lyase       253   2e-76   Ipomoea batatas [batate]
ref|XP_009781653.1|  PREDICTED: phenylalanine ammonia-lyase             250   5e-75   Nicotiana sylvestris
gb|AAG49585.1|AF325496_1  phenylalanine ammonia-lyase                   250   6e-75   Ipomoea nil [qian niu]
sp|P45733.1|PAL3_TOBAC  RecName: Full=Phenylalanine ammonia-lyase       250   6e-75   Nicotiana tabacum [American tobacco]
ref|XP_009625397.1|  PREDICTED: phenylalanine ammonia-lyase             247   5e-74   Nicotiana tomentosiformis
sp|P35513.2|PAL2_TOBAC  RecName: Full=Phenylalanine ammonia-lyase       247   6e-74   Nicotiana tabacum [American tobacco]
gb|ABG75910.1|  phenylalanine ammonia-lyase 1                           244   8e-73   Nicotiana attenuata
dbj|BAA95629.1|  phenylalanine ammonia lyase                            243   2e-72   Catharanthus roseus [chatas]
sp|P14166.1|PAL1_IPOBA  RecName: Full=Phenylalanine ammonia-lyase       239   6e-71   Ipomoea batatas [batate]
gb|AIY26016.1|  PAL                                                     239   6e-71   Jasminum sambac [Arabian jasmine]
gb|AFZ94859.1|  phenylalanine ammonia-lyase                             239   8e-71   Plectranthus scutellarioides
gb|EYU38541.1|  hypothetical protein MIMGU_mgv1a001582mg                238   3e-70   Erythranthe guttata [common monkey flower]
gb|AAO13347.1|  phenylalanine ammonia-lyase2                            237   5e-70   Lactuca sativa [cultivated lettuce]
gb|ACF94719.1|  phenylalanine ammonia lyase                             223   1e-69   Robinia pseudoacacia [black locust]
gb|AEM63670.1|  phenylalanine ammonia lyase 1                           235   2e-69   Platycodon grandiflorus [balloon-flower]
ref|XP_011077338.1|  PREDICTED: phenylalanine ammonia-lyase             234   3e-69   Sesamum indicum [beniseed]
gb|ACR56688.1|  phenylalanine ammonia-lyase                             234   5e-69   Scutellaria viscidula [zhan mao huang qin]
emb|CBJ23826.1|  phenylalanine ammonia-lyase                            233   7e-69   Melissa officinalis [sweet balm]
gb|ADN32767.1|  phenylalanine ammonia-lyase 1                           233   7e-69   Scutellaria baicalensis [Baikal skullcap]
ref|XP_004249558.1|  PREDICTED: phenylalanine ammonia-lyase             233   1e-68   Solanum lycopersicum
gb|ABL14039.1|  phenylalanine ammonia lyase                             221   2e-68   Astragalus mongholicus
gb|AAK84225.1|AF401636_1  phenylalanine ammonia-lyase                   232   3e-68   Rehmannia glutinosa [Chinese foxglove]
gb|AHZ31605.1|  phenylalanine ammonia-lyase                             231   4e-68   Olea europaea
gb|AGW27206.1|  phenylalanine ammonia-lyase 3                           232   5e-68   Salvia miltiorrhiza [Chinese salvia]
gb|ABD73282.1|  phenylalanine ammonia-lyase                             231   6e-68   Salvia miltiorrhiza [Chinese salvia]
ref|XP_010262867.1|  PREDICTED: phenylalanine ammonia-lyase             231   6e-68   Nelumbo nucifera [Indian lotus]
gb|ABE03772.1|  phenylalanine ammonia-lyase                             230   1e-67   Arnebia euchroma
gb|ABR14606.1|  phenylalanine ammonia-lyase                             230   1e-67   Salvia miltiorrhiza [Chinese salvia]
ref|XP_009766905.1|  PREDICTED: phenylalanine ammonia-lyase             230   1e-67   Nicotiana sylvestris
sp|O49835.1|PAL1_LITER  RecName: Full=Phenylalanine ammonia-lyase...    230   2e-67   Lithospermum erythrorhizon
ref|XP_010253912.1|  PREDICTED: phenylalanine ammonia-lyase             230   2e-67   Nelumbo nucifera [Indian lotus]
ref|XP_004497516.1|  PREDICTED: phenylalanine ammonia-lyase-like        229   2e-67   Cicer arietinum [garbanzo]
gb|ADN32768.1|  phenylalanine ammonia-lyase 2                           229   3e-67   Scutellaria baicalensis [Baikal skullcap]
ref|XP_009629066.1|  PREDICTED: phenylalanine ammonia-lyase             229   3e-67   Nicotiana tomentosiformis
gb|AEH02821.1|  phenylalanine ammonia lyase                             229   4e-67   Chrysanthemum x morifolium [florist's chrysanthemum]
gb|ABG75911.1|  phenylalanine ammonia-lyase 2                           229   4e-67   Nicotiana attenuata
ref|XP_011094662.1|  PREDICTED: phenylalanine ammonia-lyase             229   4e-67   Sesamum indicum [beniseed]
gb|AFF60415.1|  phenylalanine ammonia lyase                             227   6e-67   Pyrus pyrifolia [sha li]
gb|AJO53274.1|  phenylalanine ammonia-lyase                             228   6e-67   Pogostemon cablin
ref|XP_007162754.1|  hypothetical protein PHAVU_001G1777001g            221   6e-67   Phaseolus vulgaris [French bean]
ref|XP_008387584.1|  PREDICTED: phenylalanine ammonia-lyase 1           228   1e-66   
ref|XP_009342990.1|  PREDICTED: phenylalanine ammonia-lyase 1           228   1e-66   
gb|AGL50914.1|  phenylalanine ammonia lyase                             228   1e-66   Pyrus communis
gb|AFG30054.1|  phenylalanine ammonialyase                              228   1e-66   Malus hybrid cultivar
sp|O23924.1|PALY_DIGLA  RecName: Full=Phenylalanine ammonia-lyase       227   2e-66   Digitalis lanata [Grecian foxglove]
gb|AEO92028.1|  phenylalanine ammonia-lyase 2                           227   2e-66   Coffea canephora [robusta coffee]
sp|O49836.1|PAL2_LITER  RecName: Full=Phenylalanine ammonia-lyase...    227   2e-66   Lithospermum erythrorhizon
gb|AEM63671.1|  phenylalanine ammonia lyase 2                           227   2e-66   Platycodon grandiflorus [balloon-flower]
gb|AFP24940.1|  phenylalanine ammonia lyase                             227   2e-66   Prunus salicina [Japanese plum]
gb|AFK43896.1|  unknown                                                 219   2e-66   Medicago truncatula
emb|CAL91170.1|  phenylalanine ammonia-lyase 3                          216   3e-66   Cynara cardunculus var. scolymus [artichoke]
gb|ADF59061.1|  phenylalanine ammonia-lyase 1 precursor                 227   3e-66   Pyrus x bretschneideri [bai li]
ref|XP_007208432.1|  hypothetical protein PRUPE_ppa002099mg             226   3e-66   Prunus persica
gb|ABQ63094.1|  phenylalanine ammonia-lyase                             226   3e-66   Astragalus membranaceus
sp|O64963.1|PAL1_PRUAV  RecName: Full=Phenylalanine ammonia-lyase 1     226   3e-66   Prunus avium [gean]
gb|AEZ01784.1|  phenylalanine ammonia-lyase                             226   3e-66   Pyrus x bretschneideri [bai li]
ref|XP_006354339.1|  PREDICTED: phenylalanine ammonia-lyase-like        226   4e-66   Solanum tuberosum [potatoes]
gb|KJB16792.1|  hypothetical protein B456_002G248000                    226   5e-66   Gossypium raimondii
gb|AER12109.1|  PAL                                                     226   5e-66   Gossypium hirsutum [American cotton]
ref|XP_006364021.1|  PREDICTED: phenylalanine ammonia-lyase-like        226   6e-66   Solanum tuberosum [potatoes]
gb|AEL21617.1|  phenylalanine ammonia lyase 2                           226   6e-66   Coffea arabica [arabica coffee]
gb|AAX84839.1|  phenylalanine ammonia-lyase                             226   7e-66   Astragalus mongholicus
gb|AIL23235.1|  phenylalanine ammonia-lyase                             226   7e-66   Astragalus chrysochlorus
ref|XP_004246649.1|  PREDICTED: phenylalanine ammonia-lyase-like ...    225   1e-65   Solanum lycopersicum
ref|XP_004246650.1|  PREDICTED: phenylalanine ammonia-lyase-like        225   1e-65   
sp|P45728.1|PAL2_PETCR  RecName: Full=Phenylalanine ammonia-lyase 2     225   1e-65   Petroselinum crispum
gb|AAK15640.1|AF326116_1  phenylalanine ammonia-lyase                   225   1e-65   Agastache rugosa
sp|P26600.1|PAL5_SOLLC  RecName: Full=Phenylalanine ammonia-lyase...    225   1e-65   Solanum lycopersicum
ref|XP_004246651.1|  PREDICTED: phenylalanine ammonia-lyase             225   1e-65   
gb|AGL81344.1|  phenylalanine ammonia lyase                             225   1e-65   Pyrus communis
gb|ABB70117.2|  phenylalanine ammonia lyase                             225   1e-65   Pyrus communis
gb|AEZ67457.1|  phenylalanine ammonia-lyase                             225   1e-65   Perilla frutescens [beefsteak-mint]
gb|KDP29132.1|  hypothetical protein JCGZ_16521                         225   1e-65   Jatropha curcas
ref|XP_002519521.1|  Phenylalanine ammonia-lyase, putative              225   1e-65   Ricinus communis
ref|XP_008243955.1|  PREDICTED: phenylalanine ammonia-lyase 1           225   1e-65   Prunus mume [ume]
gb|ABI33979.1|  phenylalanine ammonia lyase                             224   1e-65   Jatropha curcas
gb|AHZ30594.1|  phenylalanine ammonia lyase-2                           224   1e-65   Prunus domestica
ref|XP_008369679.1|  PREDICTED: phenylalanine ammonia-lyase 1-like      224   2e-65   
ref|XP_008355619.1|  PREDICTED: LOW QUALITY PROTEIN: phenylalanin...    224   3e-65   
gb|AGY49231.1|  phenylalanine ammonia lyase                             224   3e-65   Ricinus communis
gb|ABD42947.1|  phenylalanine ammonia lyase                             224   3e-65   Acacia auriculiformis x Acacia mangium
gb|KGN48161.1|  hypothetical protein Csa_6G445740                       221   3e-65   Cucumis sativus [cucumbers]
gb|KHG18863.1|  Phenylalanine ammonia-lyase                             224   3e-65   Gossypium arboreum [tree cotton]
ref|XP_009794410.1|  PREDICTED: phenylalanine ammonia-lyase-like        224   3e-65   Nicotiana sylvestris
gb|KJB36583.1|  hypothetical protein B456_006G166000                    223   4e-65   Gossypium raimondii
sp|O04058.2|PALY_HELAN  RecName: Full=Phenylalanine ammonia-lyase       223   4e-65   Helianthus annuus
gb|AIA66448.1|  PAL1                                                    223   5e-65   Capsicum annuum
gb|ACF17667.1|  putative phenylalanine ammonia-lyase                    223   5e-65   Capsicum annuum
sp|P24481.1|PAL1_PETCR  RecName: Full=Phenylalanine ammonia-lyase 1     223   5e-65   Petroselinum crispum
gb|KHG04887.1|  Phenylalanine ammonia-lyase                             223   5e-65   Gossypium arboreum [tree cotton]
dbj|BAF36971.1|  phenylalanine ammonia-lyase                            223   5e-65   Lotus japonicus
ref|XP_006364022.1|  PREDICTED: phenylalanine ammonia-lyase-like        223   6e-65   Solanum tuberosum [potatoes]
ref|XP_004173742.1|  PREDICTED: phenylalanine ammonia-lyase-like        208   6e-65   
pdb|1W27|A  Chain A, Phenylalanine Ammonia-Lyase (Pal) From Petro...    223   6e-65   Petroselinum crispum
gb|AHA42445.1|  phenylalanine ammonia lyase                             219   6e-65   Cannabis sativa
gb|ACF94716.1|  phenylalanine ammonia lyase                             223   6e-65   Robinia pseudoacacia [black locust]
gb|AGU91428.1|  phenylalanine ammonia-lyase                             223   6e-65   Chrysanthemum boreale
gb|AHY94892.1|  phenylalanine ammonia lyase                             223   7e-65   Prunella vulgaris
gb|AIA24411.1|  phenylalanine ammonia-lyase                             222   9e-65   Sinopodophyllum hexandrum [Himalayan mayapple]
gb|AGT63063.1|  phenylalanine ammonia-lyase                             222   1e-64   Solanum tuberosum [potatoes]
ref|XP_006354337.1|  PREDICTED: phenylalanine ammonia-lyase-like ...    222   1e-64   Solanum tuberosum [potatoes]
ref|XP_006354336.1|  PREDICTED: phenylalanine ammonia-lyase-like ...    222   1e-64   
ref|XP_004143356.1|  PREDICTED: phenylalanine ammonia-lyase-like        222   1e-64   
gb|KGN48164.1|  hypothetical protein Csa_6G445770                       222   1e-64   Cucumis sativus [cucumbers]
gb|KGN48166.1|  hypothetical protein Csa_6G446280                       207   1e-64   Cucumis sativus [cucumbers]
ref|XP_003521397.1|  PREDICTED: phenylalanine ammonia-lyase 1-like      222   2e-64   
gb|AAZ29733.1|  phenylalanine ammonia lyase                             222   2e-64   Trifolium pratense [peavine clover]
sp|P27991.1|PAL1_SOYBN  RecName: Full=Phenylalanine ammonia-lyase 1     222   2e-64   Glycine max [soybeans]
dbj|BAE71252.1|  putative phenylalanine ammonia lyase                   221   2e-64   Trifolium pratense [peavine clover]
ref|XP_006424540.1|  hypothetical protein CICLE_v10027912mg             221   2e-64   Citrus clementina [clementine]
ref|XP_006424538.1|  hypothetical protein CICLE_v10027913mg             221   2e-64   Citrus clementina [clementine]
emb|CAL91169.1|  phenylalanine ammonia-lyase 3                          221   2e-64   Cynara cardunculus var. scolymus [artichoke]
emb|CAA44609.1|  phenylalanine ammonia-lyase                            209   2e-64   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009373523.1|  PREDICTED: LOW QUALITY PROTEIN: phenylalanin...    221   3e-64   Pyrus x bretschneideri [bai li]
ref|XP_004234632.2|  PREDICTED: phenylalanine ammonia-lyase             221   4e-64   
gb|ACT53398.1|  phenylalanine ammonia-lyase 1                           221   4e-64   Ageratina adenophora
ref|XP_004156293.1|  PREDICTED: LOW QUALITY PROTEIN: phenylalanin...    221   5e-64   
ref|XP_004143256.1|  PREDICTED: phenylalanine ammonia-lyase-like        221   5e-64   
gb|AAL55242.1|AF299330_1  phenylalanine ammonia-lyase                   220   5e-64   Lactuca sativa [cultivated lettuce]
gb|AGV54597.1|  phenylalanine ammonia-lyase                             220   6e-64   Phaseolus vulgaris [French bean]
ref|XP_007162756.1|  hypothetical protein PHAVU_001G177800g             220   6e-64   Phaseolus vulgaris [French bean]
ref|XP_003554382.1|  PREDICTED: phenylalanine ammonia-lyase 1-lik...    220   7e-64   
dbj|BAC56977.1|  phenylalanine ammonia-lyase                            220   7e-64   Daucus carota [carrots]
gb|ABL14040.1|  phenylalanine ammonia lyase                             209   7e-64   Astragalus mongholicus
ref|XP_004143258.1|  PREDICTED: phenylalanine ammonia-lyase-like        220   8e-64   Cucumis sativus [cucumbers]
ref|XP_007027354.1|  PHE ammonia lyase 1                                220   8e-64   Theobroma cacao [chocolate]
emb|CDY18463.1|  BnaA04g21240D                                          209   8e-64   Brassica napus [oilseed rape]
gb|KGN52975.1|  hypothetical protein Csa_4G008780                       219   8e-64   Cucumis sativus [cucumbers]
ref|XP_008449237.1|  PREDICTED: phenylalanine ammonia-lyase-like        220   8e-64   Cucumis melo [Oriental melon]
gb|AHA42443.1|  phenylalanine ammonia lyase                             220   9e-64   Cannabis sativa
ref|XP_003590471.1|  Phenylalanine ammonia-lyase                        219   1e-63   Medicago truncatula
ref|XP_009606373.1|  PREDICTED: phenylalanine ammonia-lyase G4-like     219   1e-63   Nicotiana tomentosiformis
ref|XP_004304440.1|  PREDICTED: phenylalanine ammonia-lyase 1           219   2e-63   Fragaria vesca subsp. vesca
dbj|BAA31258.1|  phenylalanine ammonia-lyase                            210   2e-63   Vitis vinifera
gb|ACT53399.1|  phenylalanine ammonia-lyase 2                           219   2e-63   Ageratina adenophora
ref|XP_002531677.1|  Phenylalanine ammonia-lyase, putative              219   2e-63   Ricinus communis
gb|AJO53273.1|  phenylalanine ammonia-lyase                             218   3e-63   Pogostemon cablin
ref|XP_008454139.1|  PREDICTED: phenylalanine ammonia-lyase-like        218   3e-63   Cucumis melo [Oriental melon]
gb|AEC11891.1|  PAL1                                                    218   3e-63   Petunia exserta
gb|AAV98199.1|  phenylalanine ammonialyase 1                            218   3e-63   Petunia x hybrida [garden petunia]
ref|XP_003521396.1|  PREDICTED: phenylalanine ammonia-lyase 1-like      218   3e-63   
gb|KGN52974.1|  hypothetical protein Csa_4G008770                       216   3e-63   Cucumis sativus [cucumbers]
gb|KGN52973.1|  hypothetical protein Csa_4G008760                       213   3e-63   Cucumis sativus [cucumbers]
ref|XP_004143257.1|  PREDICTED: phenylalanine ammonia-lyase-like        218   4e-63   
ref|XP_008449239.1|  PREDICTED: phenylalanine ammonia-lyase-like        218   4e-63   Cucumis melo [Oriental melon]
emb|CBI31445.3|  unnamed protein product                                216   5e-63   Vitis vinifera
dbj|BAO01110.1|  phenylalanine ammonia-lyase                            218   5e-63   Vigna radiata [mung bean]
ref|XP_002281799.1|  PREDICTED: phenylalanine ammonia-lyase             218   5e-63   Vitis vinifera
ref|XP_006436446.1|  hypothetical protein CICLE_v10030821mg             218   5e-63   Citrus clementina [clementine]
dbj|BAG31930.1|  phenylalanine ammonia-lyase                            218   5e-63   Daucus carota [carrots]
gb|AEV53411.1|  phenylalanine ammonia-lyase 3                           218   6e-63   Populus tomentosa [Chinese white poplar]
ref|XP_009759945.1|  PREDICTED: phenylalanine ammonia-lyase G4-like     218   6e-63   Nicotiana sylvestris
sp|Q01861.1|PAL1_PEA  RecName: Full=Phenylalanine ammonia-lyase 1       218   6e-63   Pisum sativum [garden pea]
sp|P35511.1|PAL1_SOLLC  RecName: Full=Phenylalanine ammonia-lyase...    217   6e-63   Solanum lycopersicum
sp|P45729.1|PAL3_PETCR  RecName: Full=Phenylalanine ammonia-lyase 3     218   6e-63   Petroselinum crispum
prf||2001451A  Phe ammonia lyase                                        218   7e-63
gb|AAR31107.1|  phenylalanine ammonia-lyase                             217   7e-63   Quercus suber [cork oak]
gb|AFN85669.1|  phenylalanine ammonia-lyase                             217   8e-63   Hibiscus cannabinus [bimli-jute]
gb|KDO46246.1|  hypothetical protein CISIN_1g004955mg                   217   8e-63   Citrus sinensis [apfelsine]
dbj|BAJ17655.1|  phenylalanine ammonia lyase                            217   9e-63   Gynura bicolor
ref|XP_009596642.1|  PREDICTED: phenylalanine ammonia-lyase G4-like     217   9e-63   Nicotiana tomentosiformis
gb|ACT32033.1|  phenylalanine ammonia-lyase                             217   9e-63   Glycine soja [wild soybean]
sp|Q42667.1|PALY_CITLI  RecName: Full=Phenylalanine ammonia-lyase       217   1e-62   Citrus limon [lemon]
gb|KHG29664.1|  Phenylalanine ammonia-lyase                             217   1e-62   Gossypium arboreum [tree cotton]
gb|AEA72280.1|  phenylalanine ammonia-lyase                             216   1e-62   Angelica gigas
gb|AIB06732.1|  phenylalanine ammonia lyase                             216   1e-62   Mangifera indica
ref|XP_006354338.1|  PREDICTED: phenylalanine ammonia-lyase-like ...    217   1e-62   Solanum tuberosum [potatoes]
gb|AER58180.1|  phenylalanine ammonia lyase                             216   1e-62   Cucumis sativus [cucumbers]
gb|AID51445.1|  phenylalanine ammonia-lyase 2                           216   1e-62   Astragalus membranaceus
ref|XP_007009873.1|  Phenylalanine ammonia-lyase 2                      216   2e-62   
ref|XP_004152158.1|  PREDICTED: phenylalanine ammonia-lyase-like        216   2e-62   
ref|XP_004152155.1|  PREDICTED: phenylalanine ammonia-lyase-like        216   2e-62   
gb|ACM44926.1|  phenylalanine ammonia-lyase                             216   2e-62   Euphorbia pulcherrima
ref|XP_004246652.1|  PREDICTED: phenylalanine ammonia-lyase-like ...    216   2e-62   
ref|XP_008449238.1|  PREDICTED: phenylalanine ammonia-lyase             216   2e-62   Cucumis melo [Oriental melon]
gb|ACS71953.1|  phenylalanine ammonia-lyase                             216   2e-62   Euphorbia pulcherrima
gb|KGN48162.1|  hypothetical protein Csa_6G445750                       216   2e-62   Cucumis sativus [cucumbers]
dbj|BAF36970.1|  phenylalanine ammonia-lyase                            216   2e-62   Lotus japonicus
ref|XP_010325983.1|  PREDICTED: phenylalanine ammonia-lyase-like ...    216   2e-62   
ref|XP_010658395.1|  PREDICTED: phenylalanine ammonia-lyase G1          216   3e-62   Vitis vinifera
gb|AAN52280.1|AF480620_1  phenylalanine ammonia-lyase                   216   3e-62   Populus tremuloides
emb|CDX91331.1|  BnaC04g08190D                                          209   3e-62   
emb|CDX74991.1|  BnaA05g07370D                                          209   3e-62   
ref|XP_004173741.1|  PREDICTED: phenylalanine ammonia-lyase-like        201   3e-62   
gb|AFZ78651.1|  phenylalanine ammonia-lyase                             215   4e-62   Populus tomentosa [Chinese white poplar]
gb|KEH24019.1|  phenylalanine ammonia-lyase-like protein                215   5e-62   Medicago truncatula
gb|ADO64252.1|  PAL                                                     215   5e-62   Epimedium sagittatum
ref|XP_002322884.2|  phenylalanine ammonia-lyase family protein         215   5e-62   Populus trichocarpa [western balsam poplar]
gb|AEX32784.1|  phenylalanine ammonia-lyase                             215   6e-62   Vitis vinifera
gb|AAA34179.2|  phenylalanine ammonia lyase                             214   7e-62   Solanum lycopersicum
gb|KEH24018.1|  phenylalanine ammonia-lyase-like protein                215   7e-62   Medicago truncatula
gb|KDP44384.1|  hypothetical protein JCGZ_20064                         214   8e-62   Jatropha curcas
dbj|BAF36968.1|  phenylalanine ammonia-lyase                            214   8e-62   Lotus japonicus
ref|XP_008454138.1|  PREDICTED: phenylalanine ammonia-lyase-like        214   9e-62   Cucumis melo [Oriental melon]
gb|EYU34451.1|  hypothetical protein MIMGU_mgv1a002104mg                214   9e-62   Erythranthe guttata [common monkey flower]
gb|AJO53272.1|  phenylalanine ammonia-lyase                             214   1e-61   Pogostemon cablin
ref|XP_002268181.1|  PREDICTED: phenylalanine ammonia-lyase             214   1e-61   Vitis vinifera
sp|Q9M568.1|PAL1_RUBID  RecName: Full=Phenylalanine ammonia-lyase...    214   1e-61   Rubus idaeus [European raspberry]
gb|ABM67591.1|  phenylalanin ammonia-lyase                              214   1e-61   Vitis vinifera
sp|O23865.1|PAL1_DAUCA  RecName: Full=Phenylalanine ammonia-lyase 1     214   1e-61   Daucus carota [carrots]
gb|ACT21093.1|  phenylalanine ammonia-lyase                             214   1e-61   Camellia oleifera [abura-tsubaki]
gb|AAF40224.1|AF237955_1  phenylalanine ammonia-lyase 2                 214   1e-61   Rubus idaeus [European raspberry]
ref|XP_008449240.1|  PREDICTED: phenylalanine ammonia-lyase 1-like      214   1e-61   Cucumis melo [Oriental melon]
dbj|BAF36967.1|  phenylalanine ammonia-lyase                            214   1e-61   Lotus japonicus
sp|P45730.1|PALY_POPTR  RecName: Full=Phenylalanine ammonia-lyase       214   2e-61   Populus trichocarpa [western balsam poplar]
ref|XP_006381441.1|  phenylalanine ammonia-lyase family protein         213   2e-61   Populus trichocarpa [western balsam poplar]
ref|XP_008454137.1|  PREDICTED: phenylalanine ammonia-lyase-like        213   2e-61   Cucumis melo [Oriental melon]
gb|ACE95170.1|  phenylalanine ammonia-lyase                             213   2e-61   Populus tomentosa [Chinese white poplar]
gb|AFZ78650.1|  phenylalanine ammonia-lyase                             213   2e-61   Populus tomentosa [Chinese white poplar]
gb|AFU90757.1|  phenylalanine ammonia-lyase                             213   2e-61   Epimedium sagittatum
ref|XP_002268732.1|  PREDICTED: phenylalanine ammonia-lyase             213   2e-61   Vitis vinifera
sp|Q43052.1|PAL2_POPKI  RecName: Full=Phenylalanine ammonia-lyase...    213   3e-61   Populus sieboldii x Populus grandidentata
ref|XP_004143255.1|  PREDICTED: phenylalanine ammonia-lyase 1-like      213   3e-61   Cucumis sativus [cucumbers]
ref|XP_002312013.1|  phenylalanine ammonia-lyase family protein         213   3e-61   Populus trichocarpa [western balsam poplar]
ref|XP_002268256.1|  PREDICTED: phenylalanine ammonia-lyase             213   3e-61   Vitis vinifera
ref|XP_011031723.1|  PREDICTED: phenylalanine ammonia-lyase G4          213   3e-61   Populus euphratica
sp|P45732.1|PALY_STYHU  RecName: Full=Phenylalanine ammonia-lyase       213   3e-61   Stylosanthes humilis [alfafinha do nordeste]
ref|XP_004156289.1|  PREDICTED: phenylalanine ammonia-lyase-like        213   4e-61   
ref|XP_003633986.1|  PREDICTED: phenylalanine ammonia-lyase-like        213   4e-61   Vitis vinifera
ref|XP_004493977.1|  PREDICTED: phenylalanine ammonia-lyase-like        213   5e-61   Cicer arietinum [garbanzo]
gb|AEJ88223.1|  phenylalanine ammonia lyase                             212   6e-61   Prunus persica
emb|CBI26455.3|  unnamed protein product                                212   6e-61   Vitis vinifera
gb|ACM62741.1|  phenylalanine ammonia-lyase                             212   7e-61   Garcinia mangostana [mangosteen]
gb|KHG30005.1|  Phenylalanine ammonia-lyase                             212   8e-61   Gossypium arboreum [tree cotton]
gb|KJB62426.1|  hypothetical protein B456_009G416300                    212   8e-61   Gossypium raimondii
ref|XP_010662075.1|  PREDICTED: phenylalanine ammonia-lyase             212   8e-61   Vitis vinifera
ref|XP_003635657.2|  PREDICTED: phenylalanine ammonia-lyase-like        212   8e-61   Vitis vinifera
ref|XP_003633987.1|  PREDICTED: phenylalanine ammonia-lyase-like        212   8e-61   Vitis vinifera
gb|KJB46525.1|  hypothetical protein B456_007G373600                    212   9e-61   Gossypium raimondii
gb|AAK60275.1|AF383152_1  phenylalanine ammonia-lyase 2                 211   1e-60   Manihot esculenta [manioc]
ref|NP_001236956.1|  phenylalanine ammonia-lyase 2                      211   1e-60   
ref|XP_006488063.1|  PREDICTED: phenylalanine ammonia-lyase 1-like      211   1e-60   Citrus sinensis [apfelsine]
ref|XP_011048535.1|  PREDICTED: phenylalanine ammonia-lyase-like        211   1e-60   Populus euphratica
gb|AAK60274.1|AF383151_1  phenylalanine ammonia-lyase 1                 211   1e-60   Manihot esculenta [manioc]
gb|AAN52279.1|AF480619_1  phenylalanine ammonia-lyase                   211   1e-60   Populus tremuloides
gb|AGH13333.1|  phenylalanine ammonia-lyase                             211   1e-60   Rhus chinensis
sp|P45734.1|PALY_TRISU  RecName: Full=Phenylalanine ammonia-lyase       211   1e-60   Trifolium subterraneum
gb|AAW78932.1|  phenylalanine-ammonia lyase                             211   1e-60   Rhodiola sachalinensis
ref|XP_003542541.1|  PREDICTED: phenylalanine ammonia-lyase class...    211   1e-60   
sp|P45726.1|PALY_CAMSI  RecName: Full=Phenylalanine ammonia-lyase       211   1e-60   Camellia sinensis [black tea]
gb|AJR20994.1|  phenylalanine ammonia-lyase                             211   1e-60   Populus szechuanica
gb|ACC63889.1|  phenylalanine ammonia-lyase                             211   2e-60   Populus trichocarpa [western balsam poplar]
ref|XP_002315308.1|  phenylalanine ammonia-lyase family protein         211   2e-60   Populus trichocarpa [western balsam poplar]
gb|ADD12041.1|  phenylalanine ammonia lyase                             211   2e-60   Cistanche deserticola
gb|AGE10589.1|  phenylalanine amononia-lyase                            211   2e-60   Lonicera japonica [Japanese honeysuckle]
gb|AAK62030.1|  phenylalanine ammonia-lyase 1                           211   2e-60   Manihot esculenta [manioc]
ref|NP_181241.1|  phenylalanine ammonia-lyase 1                         211   2e-60   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009392118.1|  PREDICTED: phenylalanine ammonia-lyase-like        211   2e-60   Musa acuminata subsp. malaccensis [pisang utan]
gb|AAC18870.1|  phenylalanine ammonia lyase                             211   2e-60   Arabidopsis thaliana [mouse-ear cress]
sp|P31425.1|PAL1_SOLTU  RecName: Full=Phenylalanine ammonia-lyase 1     211   2e-60   Solanum tuberosum [potatoes]
gb|AAZ29735.1|  phenylalanine ammonia lyase                             211   2e-60   Trifolium pratense [peavine clover]
ref|XP_007144370.1|  hypothetical protein PHAVU_007G150500g             210   2e-60   Phaseolus vulgaris [French bean]
gb|ACG56648.1|  phenylalanine ammonia lyase                             210   2e-60   Musa acuminata AAA Group [Cavendish banana]
dbj|BAG70992.1|  phenylalanine ammonia-lyase                            210   3e-60   Musa balbisiana [starchy banana]
ref|XP_011041025.1|  PREDICTED: phenylalanine ammonia-lyase G2B         210   3e-60   Populus euphratica
gb|ACG56647.1|  phenylalanine ammonia lyase                             210   3e-60   Musa acuminata [banana]
gb|AFJ80777.1|  phenylalanine ammonia-lyase                             210   3e-60   Camellia japonica [common camellia]
gb|ADT63058.1|  phenylalanine ammonia-lyase                             210   3e-60   Fagopyrum esculentum
gb|ADY02661.1|  phenylalanine ammonia lyase                             209   3e-60   Parrya nudicaulis
gb|AAU08174.1|  phenylalanine ammonia-lyase                             210   4e-60   Camellia sinensis [black tea]
emb|CAN77065.1|  hypothetical protein VITISV_009233                     210   4e-60   Vitis vinifera
gb|ADY02660.1|  phenylalanine ammonia lyase                             209   4e-60   Parrya nudicaulis
ref|XP_004143259.1|  PREDICTED: phenylalanine ammonia-lyase-like        210   4e-60   
gb|AEX32790.1|  phenylalanine ammonia-lyase                             209   5e-60   Vitis vinifera
sp|P31426.1|PAL2_SOLTU  RecName: Full=Phenylalanine ammonia-lyase 2     208   5e-60   Solanum tuberosum [potatoes]
gb|ADY02662.1|  phenylalanine ammonia lyase                             209   5e-60   Parrya nudicaulis
emb|CAL91037.1|  phenylalanine ammonia-lyase 1                          209   5e-60   Cynara cardunculus var. scolymus [artichoke]
gb|ABN79671.2|  phenylalanine ammonia-lyase                             210   5e-60   Rudbeckia hirta
ref|XP_008449236.1|  PREDICTED: phenylalanine ammonia-lyase-like        209   5e-60   Cucumis melo [Oriental melon]
dbj|BAA21643.1|  phenylalanine ammonia-lyase                            209   7e-60   Populus sieboldii x Populus grandidentata
ref|XP_011010447.1|  PREDICTED: phenylalanine ammonia-lyase             209   7e-60   Populus euphratica
ref|XP_008785254.1|  PREDICTED: phenylalanine ammonia-lyase-like        209   7e-60   Phoenix dactylifera
gb|ACA30407.1|  phenylalanine ammonia-lyase                             209   8e-60   Stylosanthes guianensis [stylo]
gb|AAZ29732.1|  phenylalanine ammonia lyase                             209   9e-60   Trifolium pratense [peavine clover]
ref|XP_003633985.1|  PREDICTED: phenylalanine ammonia-lyase-like        209   1e-59   Vitis vinifera
gb|AAZ29734.1|  phenylalanine ammonia lyase                             209   1e-59   Trifolium pratense [peavine clover]
ref|XP_002881488.1|  hypothetical protein ARALYDRAFT_482690             209   1e-59   
gb|AAQ74878.1|  phenylalanine ammonia lyase                             208   1e-59   Populus trichocarpa x Populus deltoides
ref|XP_010505261.1|  PREDICTED: phenylalanine ammonia-lyase 1-like      209   1e-59   
gb|ABC69916.1|  phenylalanine ammonia-lyase                             209   1e-59   
ref|XP_010509401.1|  PREDICTED: phenylalanine ammonia-lyase 1-like      209   1e-59   
ref|XP_010516949.1|  PREDICTED: phenylalanine ammonia-lyase 1           209   1e-59   
ref|XP_009141625.1|  PREDICTED: phenylalanine ammonia-lyase 1           208   1e-59   
gb|ABY89690.1|  phenylalanine ammonialyase 1 protein                    208   1e-59   
gb|ABY89691.1|  phenylalanine ammonialyase 2 protein                    208   1e-59   
ref|XP_006293761.1|  hypothetical protein CARUB_v10022721mg             208   2e-59   
sp|Q04593.1|PAL2_PEA  RecName: Full=Phenylalanine ammonia-lyase 2       208   2e-59   
gb|AEE81750.1|  phenylalanine ammonia lyase                             208   2e-59   
ref|XP_008233304.1|  PREDICTED: phenylalanine ammonia-lyase 1           208   2e-59   
gb|AHB18375.1|  phenylalanine ammonia-lyase 3                           207   2e-59   
ref|XP_002267953.1|  PREDICTED: phenylalanine ammonia-lyase             208   2e-59   
sp|P27990.1|PALY_MEDSA  RecName: Full=Phenylalanine ammonia-lyase       208   2e-59   
ref|XP_009143533.1|  PREDICTED: phenylalanine ammonia-lyase 1           208   2e-59   
ref|XP_010107520.1|  Phenylalanine ammonia-lyase                        208   3e-59   
gb|AID16077.1|  phenylalanine ammonium lyase                            208   3e-59   
ref|XP_006424536.1|  hypothetical protein CICLE_v10029946mg             193   3e-59   
ref|XP_010107518.1|  Phenylalanine ammonia-lyase                        208   3e-59   
gb|ADA81868.1|  phenylalanine ammonia-lyase                             207   3e-59   
gb|AFP86474.1|  phenylalanine ammonia-lyase                             207   3e-59   
dbj|BAF36974.1|  phenylalanine ammonia-lyase                            207   4e-59   
gb|ABC69917.1|  phenylalanine ammonia-lyase                             207   4e-59   
ref|XP_006481493.1|  PREDICTED: phenylalanine ammonia-lyase-like        207   5e-59   
emb|CDO99754.1|  unnamed protein product                                206   5e-59   
gb|AFZ78653.1|  phenylalanine ammonia-lyase                             207   5e-59   
gb|KFK36594.1|  hypothetical protein AALP_AA4G144000                    207   5e-59   
gb|ACR15762.1|  phenylalanine ammonia-lyase                             207   5e-59   
ref|XP_010553331.1|  PREDICTED: phenylalanine ammonia-lyase 1-like      207   6e-59   
ref|XP_006428758.1|  hypothetical protein CICLE_v10011134mg             207   8e-59   
sp|P19142.1|PAL2_PHAVU  RecName: Full=Phenylalanine ammonia-lyase...    206   8e-59   
gb|ABF50788.1|  phenylalanine ammonia-lyase                             206   9e-59   
gb|AFP49806.1|  phenylalanine ammonialyase 1                            206   9e-59   
gb|AEL21616.1|  phenylalanine ammonia lyase 1                           206   9e-59   
prf||2006271A  Phe ammonia lyase                                        206   9e-59
ref|XP_002285277.1|  PREDICTED: phenylalanine ammonia-lyase             206   1e-58   
gb|ADN32766.1|  phenylalanine ammonia-lyase                             206   1e-58   
ref|XP_010529727.1|  PREDICTED: phenylalanine ammonia-lyase 1-like      206   1e-58   
gb|AGE10591.1|  phenylalanine amononia-lyase                            206   1e-58   
ref|XP_010528074.1|  PREDICTED: phenylalanine ammonia-lyase 1           206   1e-58   
gb|ADI40166.1|  phenylalanine ammonia-lyase                             206   1e-58   
gb|ABI93975.1|  putative phenylalanine ammonia-lyase                    203   2e-58   
gb|KHG26972.1|  Phenylalanine ammonia-lyase                             205   2e-58   
gb|KJB73539.1|  hypothetical protein B456_011G238400                    205   2e-58   
gb|AFG26322.1|  phenylalanine ammonia-lyase                             205   2e-58   
emb|CAB42793.1|  phenylalanine-ammonia lyase                            205   3e-58   
gb|KCW65428.1|  hypothetical protein EUGRSUZ_G02848                     204   3e-58   
gb|AAM12956.1|  phenylalanine ammonia-lyase                             204   3e-58   
ref|XP_010067315.1|  PREDICTED: phenylalanine ammonia-lyase             204   3e-58   
ref|XP_004145752.1|  PREDICTED: phenylalanine ammonia-lyase-like        204   4e-58   
ref|XP_006410883.1|  hypothetical protein EUTSA_v10016314mg             204   5e-58   
ref|XP_011041027.1|  PREDICTED: phenylalanine ammonia-lyase G2B-l...    204   5e-58   
gb|AFI71896.1|  phenylalanine ammonia-lyase                             204   7e-58   
dbj|BAF36972.1|  phenylalanine ammonia-lyase                            203   7e-58   
gb|AEO92029.1|  phenylalanine ammonia-lyase 3                           203   1e-57   
ref|XP_004173912.1|  PREDICTED: phenylalanine ammonia-lyase-like        192   1e-57   
gb|AAW51923.2|  phenylalanine ammonia-lyase 2                           203   2e-57   
gb|AAC18871.1|  phenylalanine ammonia lyase                             202   2e-57   
ref|NP_190894.1|  phenylalanine ammonia-lyase 2                         202   2e-57   
emb|CAA33500.1|  unnamed protein product                                188   2e-57   
ref|XP_010067318.1|  PREDICTED: phenylalanine ammonia-lyase             202   3e-57   
ref|XP_002877909.1|  phenylalanine ammonia-lyase 2                      202   3e-57   
gb|AFP49807.1|  phenylalanine ammonialyase 4                            202   3e-57   
gb|KDO50673.1|  hypothetical protein CISIN_1g005031mg                   202   4e-57   
ref|XP_009103852.1|  PREDICTED: phenylalanine ammonia-lyase 2-like      201   4e-57   
ref|XP_006428759.1|  hypothetical protein CICLE_v10011175mg             201   5e-57   
gb|ADP88940.1|  phenylalanine ammonia-lyase                             187   5e-57   
gb|ADQ39192.1|  phenylalanine ammonia lyase 6                           201   8e-57   
gb|ACZ44834.1|  phenylalanine ammonia-lyase                             201   9e-57   
ref|XP_007220629.1|  hypothetical protein PRUPE_ppa002328mg             199   9e-57   
ref|XP_010067317.1|  PREDICTED: phenylalanine ammonia-lyase-like        201   9e-57   
ref|XP_009384657.1|  PREDICTED: phenylalanine ammonia-lyase-like        201   1e-56   
ref|XP_010515816.1|  PREDICTED: phenylalanine ammonia-lyase 2           201   1e-56   
ref|XP_003556238.1|  PREDICTED: phenylalanine ammonia-lyase 2-like      201   1e-56   
ref|XP_010067316.1|  PREDICTED: phenylalanine ammonia-lyase             200   1e-56   
ref|XP_008366650.1|  PREDICTED: phenylalanine ammonia-lyase 1           200   1e-56   
ref|XP_008463969.1|  PREDICTED: phenylalanine ammonia-lyase-like        200   1e-56   
gb|ADF59062.1|  phenylalanine ammonia-lyase 2 precursor                 200   1e-56   
ref|XP_007220630.1|  hypothetical protein PRUPE_ppa002328mg             199   2e-56   
gb|AEW25915.1|  phenylalanine ammonia-lyase                             186   2e-56   
gb|AEW25882.1|  phenylalanine ammonia-lyase                             186   2e-56   
gb|AEW25884.1|  phenylalanine ammonia-lyase                             185   2e-56   
emb|CDY13306.1|  BnaC06g14510D                                          188   2e-56   
gb|AEW25883.1|  phenylalanine ammonia-lyase                             185   2e-56   
gb|AEW25886.1|  phenylalanine ammonia-lyase                             185   2e-56   
ref|XP_010504083.1|  PREDICTED: phenylalanine ammonia-lyase 2-like      199   2e-56   
ref|XP_004307376.1|  PREDICTED: phenylalanine ammonia-lyase 1           199   2e-56   
gb|AEW25889.1|  phenylalanine ammonia-lyase                             185   3e-56   
gb|AEW25888.1|  phenylalanine ammonia-lyase                             185   3e-56   
ref|XP_008449235.1|  PREDICTED: phenylalanine ammonia-lyase-like        199   3e-56   
gb|AEW25885.1|  phenylalanine ammonia-lyase                             185   4e-56   
ref|XP_010067319.1|  PREDICTED: phenylalanine ammonia-lyase-like        199   4e-56   
emb|CDX76219.1|  BnaA04g04830D                                          196   4e-56   
ref|XP_010426963.1|  PREDICTED: phenylalanine ammonia-lyase 2-like      199   4e-56   
emb|CDY66761.1|  BnaCnng52250D                                          196   4e-56   
ref|XP_009401948.1|  PREDICTED: phenylalanine ammonia-lyase-like        199   5e-56   
ref|XP_010935894.1|  PREDICTED: phenylalanine ammonia-lyase             198   5e-56   
ref|XP_006290660.1|  hypothetical protein CARUB_v10016752mg             198   6e-56   
gb|AEW25919.1|  phenylalanine ammonia-lyase                             184   7e-56   
ref|XP_006403711.1|  hypothetical protein EUTSA_v10010153mg             198   7e-56   
gb|AID51446.1|  phenylalanine ammonia-lyase 3                           197   1e-55   
gb|AAN32866.1|AF460203_1  phenylalanine ammonia-lyase 1                 197   1e-55   
dbj|BAF36976.1|  phenylalanine ammonia-lyase                            197   1e-55   
gb|AAX22055.1|  phenylalanine ammonia-lyase                             197   1e-55   
emb|CAB42794.1|  phenylalanine-ammonia lyase                            197   2e-55   
gb|AEW25903.1|  phenylalanine ammonia-lyase                             182   2e-55   
gb|AEW25894.1|  phenylalanine ammonia-lyase                             182   2e-55   
gb|AAX22053.1|  phenylalanine ammonia-lyase                             197   3e-55   
gb|ADL09136.1|  phenylanlanine ammonia-lyase                            196   3e-55   
ref|XP_008805217.1|  PREDICTED: phenylalanine ammonia-lyase             196   3e-55   
gb|ADA72014.1|  phenylalanine ammonia-lyase                             196   3e-55   
gb|AEW25890.1|  phenylalanine ammonia-lyase                             182   3e-55   
gb|AEW25906.1|  phenylalanine ammonia-lyase                             182   3e-55   
ref|XP_003591877.1|  Phenylalanine ammonia-lyase                        196   4e-55   
emb|CAN61378.1|  hypothetical protein VITISV_032212                     196   4e-55   
gb|KFK34576.1|  hypothetical protein AALP_AA5G163700                    196   4e-55   
gb|ACM61988.1|  phenylalanine ammonia-lyase                             196   5e-55   
dbj|BAL49995.1|  phenylalanine ammonia-lyase                            196   5e-55   
ref|XP_010032174.1|  PREDICTED: phenylalanine ammonia-lyase-like        196   5e-55   
ref|XP_010662173.1|  PREDICTED: phenylalanine ammonia-lyase 1-like      183   6e-55   
ref|XP_009116020.1|  PREDICTED: LOW QUALITY PROTEIN: phenylalanin...    196   7e-55   
gb|KFK38414.1|  hypothetical protein AALP_AA3G110100                    195   7e-55   
gb|KFK38413.1|  hypothetical protein AALP_AA3G110100                    195   7e-55   
ref|XP_004143260.1|  PREDICTED: LOW QUALITY PROTEIN: phenylalanin...    194   9e-55   
ref|XP_009413725.1|  PREDICTED: phenylalanine ammonia-lyase-like        195   1e-54   
gb|AFR41032.1|  phenylalanine ammonia-lyase                             181   1e-54   
gb|AFR41029.1|  phenylalanine ammonia-lyase                             181   1e-54   
ref|XP_010543544.1|  PREDICTED: phenylalanine ammonia-lyase 4           194   2e-54   
gb|AFR41033.1|  phenylalanine ammonia-lyase                             180   2e-54   
gb|KGN48167.1|  hypothetical protein Csa_6G446290                       194   2e-54   
emb|CDX67566.1|  BnaA07g16060D                                          191   2e-54   
gb|AFR41030.1|  phenylalanine ammonia-lyase                             180   3e-54   
gb|ACZ51372.1|  phenylalanine ammonia-lyase                             194   3e-54   
ref|NP_187645.1|  phenylalanine ammonia-lyase 4                         193   4e-54   
ref|XP_002882662.1|  hypothetical protein ARALYDRAFT_897210             193   4e-54   
emb|CDY00922.1|  BnaC05g42780D                                          193   5e-54   
gb|ADC34597.1|  phenylalanine ammonia-lyase                             193   6e-54   
ref|XP_009146849.1|  PREDICTED: phenylalanine ammonia-lyase 4           193   6e-54   
gb|ADQ28104.1|  phenylalanine ammonia-lyase                             193   6e-54   
ref|XP_006297083.1|  hypothetical protein CARUB_v10013086mg             192   7e-54   
ref|XP_007143727.1|  hypothetical protein PHAVU_007G096300g             192   7e-54   
emb|CDY08611.1|  BnaA05g28470D                                          192   7e-54   
ref|XP_010684079.1|  PREDICTED: phenylalanine ammonia-lyase             192   7e-54   
ref|XP_006345786.1|  PREDICTED: phenylalanine ammonia-lyase-like        192   7e-54   
emb|CAA44817.1|  phenylalanine ammonia-lyase                            179   8e-54   
ref|XP_004239660.1|  PREDICTED: phenylalanine ammonia-lyase-like        192   9e-54   
ref|XP_008645952.1|  PREDICTED: phenylalanine ammonia-lyase             192   1e-53   
ref|XP_011077265.1|  PREDICTED: LOW QUALITY PROTEIN: phenylalanin...    192   1e-53   
ref|XP_010482945.1|  PREDICTED: phenylalanine ammonia-lyase 4-like      192   1e-53   
gb|AIZ76766.1|  PAL2                                                    187   1e-53   
gb|EMT29667.1|  Phenylalanine ammonia-lyase                             183   1e-53   
gb|ACT68010.1|  phenylalanine ammonia-lyase                             191   2e-53   
ref|XP_004953157.1|  PREDICTED: phenylalanine ammonia-lyase-like        191   2e-53   
ref|XP_006358655.1|  PREDICTED: phenylalanine ammonia-lyase-like        191   2e-53   
gb|AHG06396.1|  phenylalanine ammonia lyase 2                           191   2e-53   
gb|AFR41042.1|  phenylalanine ammonia-lyase                             177   2e-53   
ref|XP_004976241.1|  PREDICTED: phenylalanine ammonia-lyase-like        191   2e-53   
ref|NP_001168086.1|  phenylalanine ammonia-lyase                        191   2e-53   
gb|EYU39613.1|  hypothetical protein MIMGU_mgv1a019971mg                191   3e-53   
dbj|BAM28968.1|  phenylalanine ammonia lyase                            191   3e-53   
emb|CDX78161.1|  BnaA09g33560D                                          188   3e-53   
ref|XP_004953156.1|  PREDICTED: phenylalanine ammonia-lyase-like        191   3e-53   
ref|XP_006589419.1|  PREDICTED: phenylalanine ammonia-lyase 2-lik...    191   3e-53   
ref|XP_004953155.1|  PREDICTED: phenylalanine ammonia-lyase-like        191   3e-53   
gb|AFR41018.1|  phenylalanine ammonia-lyase                             177   3e-53   
ref|XP_002315309.2|  hypothetical protein POPTR_0010s23110g             190   4e-53   
gb|AGZ95691.1|  phenylalanine ammonia-lyase                             190   5e-53   
ref|XP_006407581.1|  hypothetical protein EUTSA_v10020168mg             190   5e-53   
ref|XP_006407580.1|  hypothetical protein EUTSA_v10020168mg             190   5e-53   
emb|CAA44818.1|  phenylalanine ammonia-lyase                            177   6e-53   
emb|CDX73567.1|  BnaC08g24360D                                          187   6e-53   
gb|KHN09507.1|  Phenylalanine ammonia-lyase 1                           190   7e-53   
ref|XP_002529414.1|  Phenylalanine ammonia-lyase, putative              189   9e-53   
gb|EPS61109.1|  phenylalanine ammonia-lyase                             189   9e-53   
ref|XP_010906526.1|  PREDICTED: phenylalanine ammonia-lyase-like        189   1e-52   
ref|NP_001266106.1|  phenylalanine ammonia-lyase 2                      189   1e-52   
ref|XP_006647543.1|  PREDICTED: phenylalanine ammonia-lyase-like        189   1e-52   
gb|AFR41056.1|  phenylalanine ammonia-lyase                             176   2e-52   
gb|AHB18376.1|  phenylalanine ammonia-lyase 4                           188   2e-52   
gb|AFR41020.1|  phenylalanine ammonia-lyase                             175   2e-52   
ref|XP_009399473.1|  PREDICTED: phenylalanine ammonia-lyase             188   2e-52   
ref|XP_010934327.1|  PREDICTED: phenylalanine ammonia-lyase-like        188   2e-52   
sp|Q42609.1|PALY_BROFI  RecName: Full=Phenylalanine ammonia-lyase       187   4e-52   
gb|AGE10590.1|  phenylalanine amononia-lyase                            187   4e-52   
ref|XP_010112228.1|  Phenylalanine ammonia-lyase                        187   6e-52   
gb|AAR19393.1|  phenylalanine ammonia-lyase                             187   9e-52   
gb|AFR41036.1|  phenylalanine ammonia-lyase                             174   9e-52   
gb|AFR41048.1|  phenylalanine ammonia-lyase                             173   1e-51   
gb|AIC66437.1|  phenylalanine ammonia lyase                             186   2e-51   
ref|XP_007143725.1|  hypothetical protein PHAVU_007G096100g             186   2e-51   
gb|AFR41022.1|  phenylalanine ammonia-lyase                             172   2e-51   
gb|ACZ36441.1|  phenylalanine ammonialyase                              186   2e-51   
emb|CAA89007.1|  phenylalanine ammonia-lyase                            184   2e-51   
ref|XP_006846821.1|  hypothetical protein AMTR_s00148p00088930          185   3e-51   
emb|CAA59217.1|  phenylalanine ammonia-lyase                            173   3e-51   
ref|XP_011041026.1|  PREDICTED: phenylalanine ammonia-lyase G2B-l...    185   4e-51   
dbj|BAJ88975.1|  predicted protein                                      184   1e-50   
gb|AFR41049.1|  phenylalanine ammonia-lyase                             171   1e-50   
gb|AFR41023.1|  phenylalanine ammonia-lyase                             170   2e-50   
ref|XP_004953154.1|  PREDICTED: phenylalanine ammonia-lyase-like        183   2e-50   
gb|AFR41047.1|  phenylalanine ammonia-lyase                             170   2e-50   
gb|ADA72013.1|  phenylalanine ammonia-lyase                             182   3e-50   
gb|AFR41050.1|  phenylalanine ammonia-lyase                             170   3e-50   
ref|NP_001047482.1|  Os02g0626400                                       182   3e-50   
ref|XP_002454200.1|  hypothetical protein SORBIDRAFT_04g026530          182   5e-50   
gb|ADD74179.1|  phenylalanine ammonia lyase                             179   7e-50   
gb|AAP34199.1|  phenylalanine ammonia-lyase                             181   1e-49   
ref|XP_007016787.1|  PHE ammonia lyase 1                                181   1e-49   
ref|XP_002452479.1|  hypothetical protein SORBIDRAFT_04g026560          181   1e-49   
gb|AHG06397.1|  phenylalanine ammonia lyase 62                          181   1e-49   
gb|EMT28134.1|  Phenylalanine ammonia-lyase                             181   1e-49   
gb|ADO24189.1|  phenylalanine ammonia-lyase                             181   1e-49   
gb|AEW10551.1|  phenylalanine ammonia lyase                             167   2e-49   
ref|XP_006354305.1|  PREDICTED: phenylalanine ammonia-lyase-like        179   3e-49   
gb|AFR41051.1|  phenylalanine ammonia-lyase                             167   3e-49   
ref|XP_002454199.1|  hypothetical protein SORBIDRAFT_04g026520          177   2e-48   
gb|AFX98072.1|  phenylalanine ammonia lyase                             177   2e-48   
ref|XP_004167356.1|  PREDICTED: LOW QUALITY PROTEIN: phenylalanin...    177   2e-48   
gb|ACZ44833.1|  phenylalanine ammonia-lyase                             177   3e-48   
dbj|BAM28964.1|  phenylalanine ammonia lyase                            176   6e-48   
dbj|BAM28966.1|  phenylalanine ammonia lyase                            176   6e-48   



>gb|AHJ60264.1| phenylalanine ammonia-lyase 1 [Ipomoea purpurea]
Length=707

 Score =   304 bits (778),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 144/146 (99%), Positives = 145/146 (99%), Gaps = 0/146 (0%)
 Frame = +3

Query  123  MEGAIENGHSNDFCIKVDPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQTLTVAQ  302
            MEGAIENGH+NDFCIKVDPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQTLTVAQ
Sbjct  1    MEGAIENGHTNDFCIKVDPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQTLTVAQ  60

Query  303  VAAIAARDNAVKVELSEGARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSHRRTKNGHA  482
            VAAIAARDNAVKVELSE ARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSHRRTKNGHA
Sbjct  61   VAAIAARDNAVKVELSEAARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSHRRTKNGHA  120

Query  483  LQQELIRFLNAGIFGTGTGHTLPHSA  560
            LQQELIRFLNAGIFGTGTGHTLPHSA
Sbjct  121  LQQELIRFLNAGIFGTGTGHTLPHSA  146



>sp|Q42858.1|PAL2_IPOBA RecName: Full=Phenylalanine ammonia-lyase [Ipomoea batatas]
 dbj|BAA11459.1| phenylalanine ammonia-lyase [Ipomoea batatas]
Length=708

 Score =   253 bits (647),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 126/148 (85%), Positives = 130/148 (88%), Gaps = 3/148 (2%)
 Frame = +3

Query  123  MEGAIENGHSNDFCIKVDPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQTLTVAQ  302
            MEGAI NGH+NDFCIKVDPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQTLT  +
Sbjct  1    MEGAIANGHTNDFCIKVDPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQTLTSLR  60

Query  303  VAAIAARDNAVKVELSEGARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSHRRTKNGHA  482
               IAARDNA K   S    A  ++SSDWVMNSMNNGTDSYGVTTGFGATSHRRTKNGHA
Sbjct  61   SPPIAARDNASKWS-SPRLPARRESSSDWVMNSMNNGTDSYGVTTGFGATSHRRTKNGHA  119

Query  483  LQQELIRFLNAGIFGTGTG--HTLPHSA  560
            LQQELIRFLNAGIFGTGTG  HTLPHSA
Sbjct  120  LQQELIRFLNAGIFGTGTGASHTLPHSA  147



>ref|XP_009781653.1| PREDICTED: phenylalanine ammonia-lyase [Nicotiana sylvestris]
Length=712

 Score =   250 bits (638),  Expect = 5e-75, Method: Compositional matrix adjust.
 Identities = 123/150 (82%), Positives = 133/150 (89%), Gaps = 5/150 (3%)
 Frame = +3

Query  123  MEGAIENGHSN-DFCIKVDPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQTLTVA  299
            M G  +NGH   DFC+KVDPLNWEMAADSLKGSHLDEVK+MVAEFR P VK+GG+TLTVA
Sbjct  1    MAGVAQNGHQEMDFCVKVDPLNWEMAADSLKGSHLDEVKKMVAEFRKPVVKLGGETLTVA  60

Query  300  QVAAIAARDNA--VKVELSEGARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSHRRTKN  473
            QVAAIAA+DNA  VKVELSEGARAGVKASSDWVM+SM+ GTDSYGVTTGFGATSHRRTKN
Sbjct  61   QVAAIAAKDNAKTVKVELSEGARAGVKASSDWVMDSMSKGTDSYGVTTGFGATSHRRTKN  120

Query  474  GHALQQELIRFLNAGIFGTGT--GHTLPHS  557
            G ALQ+ELIRFLNAG+FG GT   HTLP S
Sbjct  121  GGALQKELIRFLNAGVFGNGTESCHTLPQS  150



>gb|AAG49585.1|AF325496_1 phenylalanine ammonia-lyase [Ipomoea nil]
Length=711

 Score =   250 bits (638),  Expect = 6e-75, Method: Compositional matrix adjust.
 Identities = 120/142 (85%), Positives = 129/142 (91%), Gaps = 2/142 (1%)
 Frame = +3

Query  141  NGHSNDFCIKVDPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQTLTVAQVAAIAA  320
            NGH N FC+KVDPLNWE+AADSL+GSHLDEVK MVAEFR PAVK+GG+TLTVAQVAAIA+
Sbjct  9    NGHQNGFCVKVDPLNWEVAADSLRGSHLDEVKVMVAEFRKPAVKLGGETLTVAQVAAIAS  68

Query  321  RDNAVKVELSEGARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSHRRTKNGHALQQELI  500
            RDNAV VELSE +RAGVKASSDWVM+SMN GTDSYGVTTGFGATSHRRTK G ALQ+ELI
Sbjct  69   RDNAVTVELSEESRAGVKASSDWVMDSMNKGTDSYGVTTGFGATSHRRTKQGGALQKELI  128

Query  501  RFLNAGIFGTGT--GHTLPHSA  560
            RFLNAGIFG GT   HTLPHSA
Sbjct  129  RFLNAGIFGNGTESCHTLPHSA  150



>sp|P45733.1|PAL3_TOBAC RecName: Full=Phenylalanine ammonia-lyase [Nicotiana tabacum]
 emb|CAA55075.1| phenylalanine ammonia-lyase [Nicotiana tabacum]
Length=712

 Score =   250 bits (638),  Expect = 6e-75, Method: Compositional matrix adjust.
 Identities = 123/150 (82%), Positives = 133/150 (89%), Gaps = 5/150 (3%)
 Frame = +3

Query  123  MEGAIENGHSN-DFCIKVDPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQTLTVA  299
            M G  +NGH   DFC+KVDPLNWEMAADSLKGSHLDEVK+MVAEFR P VK+GG+TLTVA
Sbjct  1    MAGVAQNGHQEMDFCVKVDPLNWEMAADSLKGSHLDEVKKMVAEFRKPVVKLGGETLTVA  60

Query  300  QVAAIAARDNA--VKVELSEGARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSHRRTKN  473
            QVAAIAA+DNA  VKVELSEGARAGVKASSDWVM+SM+ GTDSYGVTTGFGATSHRRTKN
Sbjct  61   QVAAIAAKDNAKTVKVELSEGARAGVKASSDWVMDSMSKGTDSYGVTTGFGATSHRRTKN  120

Query  474  GHALQQELIRFLNAGIFGTGT--GHTLPHS  557
            G ALQ+ELIRFLNAG+FG GT   HTLP S
Sbjct  121  GGALQKELIRFLNAGVFGNGTESCHTLPQS  150



>ref|XP_009625397.1| PREDICTED: phenylalanine ammonia-lyase [Nicotiana tomentosiformis]
Length=712

 Score =   247 bits (631),  Expect = 5e-74, Method: Compositional matrix adjust.
 Identities = 122/150 (81%), Positives = 131/150 (87%), Gaps = 5/150 (3%)
 Frame = +3

Query  123  MEGAIENGHSN-DFCIKVDPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQTLTVA  299
            M G  +NGH   DFC+KVDPLNWEMAADSLKGSHLDEVK+MVAEFR P VK+GG+TLTVA
Sbjct  1    MAGVAQNGHQEMDFCMKVDPLNWEMAADSLKGSHLDEVKKMVAEFRKPVVKLGGETLTVA  60

Query  300  QVAAIAARDNA--VKVELSEGARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSHRRTKN  473
            QVAAIAA+DN   VKVELSEGARAGVKASSDWVM+SM  GTDSYGVTTGFGATSHRRTKN
Sbjct  61   QVAAIAAKDNVKTVKVELSEGARAGVKASSDWVMDSMGKGTDSYGVTTGFGATSHRRTKN  120

Query  474  GHALQQELIRFLNAGIFGTGT--GHTLPHS  557
            G ALQ+ELIRFLNAG+FG GT   HTLP S
Sbjct  121  GGALQKELIRFLNAGVFGNGTESCHTLPQS  150



>sp|P35513.2|PAL2_TOBAC RecName: Full=Phenylalanine ammonia-lyase [Nicotiana tabacum]
 dbj|BAA22947.1| phenylalanine ammonia-lyase [Nicotiana tabacum]
 dbj|BAA22963.1| phenylalanine ammonia-lyase [Nicotiana tabacum]
Length=712

 Score =   247 bits (630),  Expect = 6e-74, Method: Compositional matrix adjust.
 Identities = 122/150 (81%), Positives = 131/150 (87%), Gaps = 5/150 (3%)
 Frame = +3

Query  123  MEGAIENGHSN-DFCIKVDPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQTLTVA  299
            M G  +NGH   DFC+KVDPLNWEMAADSLKGSHLDEVK+MVAEFR P VK+GG+TLTVA
Sbjct  1    MAGVAQNGHQEMDFCMKVDPLNWEMAADSLKGSHLDEVKKMVAEFRKPVVKLGGETLTVA  60

Query  300  QVAAIAARDNA--VKVELSEGARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSHRRTKN  473
            QVAAIAA+DN   VKVELSEGARAGVKASSDWVM+SM  GTDSYGVTTGFGATSHRRTKN
Sbjct  61   QVAAIAAKDNVKTVKVELSEGARAGVKASSDWVMDSMGKGTDSYGVTTGFGATSHRRTKN  120

Query  474  GHALQQELIRFLNAGIFGTGT--GHTLPHS  557
            G ALQ+ELIRFLNAG+FG GT   HTLP S
Sbjct  121  GGALQKELIRFLNAGVFGNGTESCHTLPQS  150



>gb|ABG75910.1| phenylalanine ammonia-lyase 1 [Nicotiana attenuata]
Length=712

 Score =   244 bits (623),  Expect = 8e-73, Method: Compositional matrix adjust.
 Identities = 121/150 (81%), Positives = 131/150 (87%), Gaps = 5/150 (3%)
 Frame = +3

Query  123  MEGAIENGHSN-DFCIKVDPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQTLTVA  299
            M G  +NGH   DFC+KVDPLNWEMAADSLKGSHLDEVK MVAE+R P VK+GG+TLTVA
Sbjct  1    MAGVAQNGHQEMDFCVKVDPLNWEMAADSLKGSHLDEVKIMVAEYRKPVVKLGGETLTVA  60

Query  300  QVAAIAARDNA--VKVELSEGARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSHRRTKN  473
            QVAAIAA+DNA  V VELSEGARAGVKASSDWVM+SM+ GTDSYGVTTGFGATSHRRTKN
Sbjct  61   QVAAIAAKDNAKTVTVELSEGARAGVKASSDWVMDSMSKGTDSYGVTTGFGATSHRRTKN  120

Query  474  GHALQQELIRFLNAGIFGTGT--GHTLPHS  557
            G ALQ+ELIRFLNAG+FG GT   HTLP S
Sbjct  121  GGALQKELIRFLNAGVFGNGTESCHTLPQS  150



>dbj|BAA95629.1| phenylalanine ammonia lyase [Catharanthus roseus]
Length=716

 Score =   243 bits (620),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 124/152 (82%), Positives = 131/152 (86%), Gaps = 9/152 (6%)
 Frame = +3

Query  129  GAIENGHSN-----DFCIKVDPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQTLT  293
            G+ ENGH N     DFC+K DPLNW MAADSLKGSHLDEVKRMVAEFR P VK+GG+TLT
Sbjct  5    GSTENGHINNGEVLDFCLK-DPLNWGMAADSLKGSHLDEVKRMVAEFRKPVVKLGGETLT  63

Query  294  VAQVAAIAARD-NAVKVELSEGARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSHRRTK  470
            ++QVAAIAARD NAVKVELSE ARAGVKASSDWVM SMN GTDSYGVTTGFGATSHRRTK
Sbjct  64   ISQVAAIAARDYNAVKVELSEDARAGVKASSDWVMESMNKGTDSYGVTTGFGATSHRRTK  123

Query  471  NGHALQQELIRFLNAGIFGTGT--GHTLPHSA  560
             G ALQ+ELIRFLNAGIFG GT   HTLPHSA
Sbjct  124  QGGALQKELIRFLNAGIFGNGTESSHTLPHSA  155



>sp|P14166.1|PAL1_IPOBA RecName: Full=Phenylalanine ammonia-lyase [Ipomoea batatas]
 gb|AAA33389.1| phenylalanine ammonia-lyase [Ipomoea batatas]
Length=707

 Score =   239 bits (609),  Expect = 6e-71, Method: Compositional matrix adjust.
 Identities = 118/144 (82%), Positives = 126/144 (88%), Gaps = 5/144 (3%)
 Frame = +3

Query  144  GHSNDFCIK---VDPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQTLTVAQVAAI  314
             + N FCIK   VDPLNWEMAA+SL+GSHLDEVKRMVAEFR PAVK+GG+TLTVAQVA I
Sbjct  2    ANQNGFCIKKQQVDPLNWEMAAESLRGSHLDEVKRMVAEFRKPAVKLGGETLTVAQVARI  61

Query  315  AARDNAVKVELSEGARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSHRRTKNGHALQQE  494
            A+RDNAV VELSE ARAGVKASSDWVM+SMN GTDSYGVTTGFGATSHRRTK G ALQ+E
Sbjct  62   ASRDNAVAVELSEEARAGVKASSDWVMDSMNKGTDSYGVTTGFGATSHRRTKQGGALQKE  121

Query  495  LIRFLNAGIFGTGT--GHTLPHSA  560
            LIRFLNAGIFG  T   HTLPHSA
Sbjct  122  LIRFLNAGIFGNATESCHTLPHSA  145



>gb|AIY26016.1| PAL [Jasminum sambac]
Length=712

 Score =   239 bits (610),  Expect = 6e-71, Method: Compositional matrix adjust.
 Identities = 120/152 (79%), Positives = 129/152 (85%), Gaps = 7/152 (5%)
 Frame = +3

Query  123  MEGAIENGHSN----DFCIKVDPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQTL  290
            ME A++N  SN    DFC+K DPLNW MAA++LKGSHLDEVKRMV EFR P VK+GG+TL
Sbjct  1    MEIALQNSDSNGKSMDFCVK-DPLNWGMAAEALKGSHLDEVKRMVEEFRKPVVKLGGETL  59

Query  291  TVAQVAAIAARDNAVKVELSEGARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSHRRTK  470
            TV+QVAAIAARDNAV VELSE AR GVKASSDWVM SMN GTDSYGVTTGFGATSHRRTK
Sbjct  60   TVSQVAAIAARDNAVTVELSETARGGVKASSDWVMESMNKGTDSYGVTTGFGATSHRRTK  119

Query  471  NGHALQQELIRFLNAGIFGTGT--GHTLPHSA  560
             G ALQ+ELIRFLNAGIFG GT   HTLPHSA
Sbjct  120  QGGALQKELIRFLNAGIFGNGTESSHTLPHSA  151



>gb|AFZ94859.1| phenylalanine ammonia-lyase [Solenostemon scutellarioides]
Length=711

 Score =   239 bits (609),  Expect = 8e-71, Method: Compositional matrix adjust.
 Identities = 120/150 (80%), Positives = 128/150 (85%), Gaps = 4/150 (3%)
 Frame = +3

Query  123  MEGAIENGH-SNDFCIKV-DPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQTLTV  296
            M  A ENGH SN FC+K  DPLNW  AA++L+GSHLDEVK+MV EFR PAVK+GG+TLT+
Sbjct  1    MAAATENGHQSNGFCVKQNDPLNWAAAAEALQGSHLDEVKKMVEEFRKPAVKLGGETLTI  60

Query  297  AQVAAIAARDNAVKVELSEGARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSHRRTKNG  476
            AQVAAIAARDNAV VELSE ARAGVKASSDWVM SMN GTDSYGVTTGFGATSHRRTK G
Sbjct  61   AQVAAIAARDNAVAVELSEAARAGVKASSDWVMESMNKGTDSYGVTTGFGATSHRRTKQG  120

Query  477  HALQQELIRFLNAGIFGTG--TGHTLPHSA  560
             ALQ ELIRFLNAGIFG G  T HTLPHSA
Sbjct  121  GALQTELIRFLNAGIFGKGTETCHTLPHSA  150



>gb|EYU38541.1| hypothetical protein MIMGU_mgv1a001582mg [Erythranthe guttata]
Length=790

 Score =   238 bits (608),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 119/149 (80%), Positives = 129/149 (87%), Gaps = 6/149 (4%)
 Frame = +3

Query  132  AIENGH---SNDFCIKV-DPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQTLTVA  299
            A ENGH    N FC++  DPLNW MAA+SLKGSHLDEVKRMVAEFR P VK+GG+TLT++
Sbjct  82   AAENGHHAAGNGFCVQQNDPLNWGMAAESLKGSHLDEVKRMVAEFRKPVVKLGGETLTIS  141

Query  300  QVAAIAARDNAVKVELSEGARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSHRRTKNGH  479
            QVAAIAARDNAV VEL+E ARAGVKASSDWVM+SMN GTDSYGVTTGFGATSHRRTK G 
Sbjct  142  QVAAIAARDNAVAVELNESARAGVKASSDWVMDSMNKGTDSYGVTTGFGATSHRRTKQGG  201

Query  480  ALQQELIRFLNAGIFGTGT--GHTLPHSA  560
            ALQ+ELIRFLNAGIFG GT   HTLPHSA
Sbjct  202  ALQKELIRFLNAGIFGNGTESNHTLPHSA  230



>gb|AAO13347.1| phenylalanine ammonia-lyase2 [Lactuca sativa]
Length=713

 Score =   237 bits (604),  Expect = 5e-70, Method: Compositional matrix adjust.
 Identities = 117/144 (81%), Positives = 126/144 (88%), Gaps = 3/144 (2%)
 Frame = +3

Query  138  ENGHSNDFCIKVDPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQTLTVAQVAAIA  317
            +NG   +FC+K DPLNW MAA+SLKGSHLDEVKRMVAEFR P V++GG+TLTV+QVAAIA
Sbjct  12   QNGERAEFCVKGDPLNWGMAAESLKGSHLDEVKRMVAEFRKPVVRLGGETLTVSQVAAIA  71

Query  318  ARDNA-VKVELSEGARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSHRRTKNGHALQQE  494
            A DNA VKVELSE ARAGVKASSDWVM SMN GTDSYGVTTGFGATSHRRTK G ALQ+E
Sbjct  72   ASDNAGVKVELSETARAGVKASSDWVMESMNKGTDSYGVTTGFGATSHRRTKEGGALQKE  131

Query  495  LIRFLNAGIFGTGTG--HTLPHSA  560
            LIRFLNAGIFG GT   HTLPHSA
Sbjct  132  LIRFLNAGIFGNGTESTHTLPHSA  155



>gb|ACF94719.1| phenylalanine ammonia lyase [Robinia pseudoacacia]
Length=210

 Score =   223 bits (567),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 109/155 (70%), Positives = 123/155 (79%), Gaps = 7/155 (5%)
 Frame = +3

Query  117  TTMEGAIENGHSNDFCIKV-----DPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGG  281
            T +      G +   C+K      DPLNW +AA+S+KGSHLDEVKRMV E+RNP V+IGG
Sbjct  4    TRVSNGYHQGQNGSLCLKSNNTSSDPLNWGVAAESMKGSHLDEVKRMVEEYRNPVVRIGG  63

Query  282  QTLTVAQVAAIAARDNAVKVELSEGARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSHR  461
            +TLT++QVAAIA RD    +ELSE ARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSHR
Sbjct  64   ETLTISQVAAIATRDQDASLELSESARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSHR  123

Query  462  RTKNGHALQQELIRFLNAGIFGTG--TGHTLPHSA  560
            RTK G ALQ+ELIRFLNAGIFG G  + HTLPHSA
Sbjct  124  RTKQGGALQKELIRFLNAGIFGNGAVSCHTLPHSA  158



>gb|AEM63670.1| phenylalanine ammonia lyase 1 [Platycodon grandiflorus]
Length=710

 Score =   235 bits (600),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 118/147 (80%), Positives = 126/147 (86%), Gaps = 6/147 (4%)
 Frame = +3

Query  135  IENGHSND---FCIKVDPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQTLTVAQV  305
            IENG  N+   FCIK DPLNW + A+SLKGSHL+EVKRMVAEFR P VK+GG+TLTV+QV
Sbjct  6    IENGQVNEAIEFCIK-DPLNWGVTAESLKGSHLNEVKRMVAEFRKPVVKLGGETLTVSQV  64

Query  306  AAIAARDNAVKVELSEGARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSHRRTKNGHAL  485
            A IAARDN VKVELSE ARAGVKASSDWVM SMN GTDSYGVTTGFGATSHRRTK G AL
Sbjct  65   AGIAARDNGVKVELSESARAGVKASSDWVMESMNKGTDSYGVTTGFGATSHRRTKQGGAL  124

Query  486  QQELIRFLNAGIFGTGT--GHTLPHSA  560
            Q+ELIRFLNAGIFG GT   HTLPHSA
Sbjct  125  QKELIRFLNAGIFGNGTESSHTLPHSA  151



>ref|XP_011077338.1| PREDICTED: phenylalanine ammonia-lyase [Sesamum indicum]
Length=712

 Score =   234 bits (598),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 117/151 (77%), Positives = 128/151 (85%), Gaps = 5/151 (3%)
 Frame = +3

Query  123  MEGAIENGH-SNDFCIKV--DPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQTLT  293
            M  A ENGH SN FC++   DPLNW  AA++LKGSHLDEVKRMV EFR P VK+GG+TLT
Sbjct  1    MAAATENGHHSNGFCVQKQKDPLNWGAAAEALKGSHLDEVKRMVEEFRKPVVKLGGETLT  60

Query  294  VAQVAAIAARDNAVKVELSEGARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSHRRTKN  473
            ++QVAAIA+RDNAV VEL+E ARAGVKASSDWVM SMN GTDSYGVTTGFGATSHRRTK 
Sbjct  61   ISQVAAIASRDNAVAVELAESARAGVKASSDWVMESMNKGTDSYGVTTGFGATSHRRTKQ  120

Query  474  GHALQQELIRFLNAGIFGTGT--GHTLPHSA  560
            G ALQ+ELIRFLNAGIFG GT   HTLPHSA
Sbjct  121  GGALQKELIRFLNAGIFGQGTESCHTLPHSA  151



>gb|ACR56688.1| phenylalanine ammonia-lyase [Scutellaria viscidula]
Length=711

 Score =   234 bits (596),  Expect = 5e-69, Method: Compositional matrix adjust.
 Identities = 116/150 (77%), Positives = 129/150 (86%), Gaps = 4/150 (3%)
 Frame = +3

Query  123  MEGAIENGH-SNDFCIKV-DPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQTLTV  296
            M  A+E  H SN FC+++ DPLNW  AA++LKGSHLDEVKRMV EFRNP VKIGG+ LT+
Sbjct  1    MAPAVEVSHRSNGFCVQLSDPLNWGAAAEALKGSHLDEVKRMVEEFRNPVVKIGGENLTI  60

Query  297  AQVAAIAARDNAVKVELSEGARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSHRRTKNG  476
            AQVAAIA+RDNAV VEL+E ARAGVKASSDWVM+SMN GTDSYGVTTGFGATSHRRTK G
Sbjct  61   AQVAAIASRDNAVAVELAESARAGVKASSDWVMDSMNKGTDSYGVTTGFGATSHRRTKQG  120

Query  477  HALQQELIRFLNAGIFGTGT--GHTLPHSA  560
             ALQ+ELIRFLNAGIFG GT   HTLPH+A
Sbjct  121  GALQKELIRFLNAGIFGKGTEGCHTLPHTA  150



>emb|CBJ23826.1| phenylalanine ammonia-lyase [Melissa officinalis]
Length=709

 Score =   233 bits (595),  Expect = 7e-69, Method: Compositional matrix adjust.
 Identities = 116/146 (79%), Positives = 126/146 (86%), Gaps = 5/146 (3%)
 Frame = +3

Query  138  ENGH--SNDFCIKV-DPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQTLTVAQVA  308
            ENGH  SN FC+K  DPLNW  AA+SLKGSHLDEVKRMV EFR P VK+GG+TLT++QVA
Sbjct  3    ENGHHDSNGFCVKQNDPLNWVAAAESLKGSHLDEVKRMVEEFRKPVVKLGGETLTISQVA  62

Query  309  AIAARDNAVKVELSEGARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSHRRTKNGHALQ  488
            AIAA+DNAV VEL+E ARAGVKASSDWVM SMN GTDSYGVTTGFGATSHRRTK G ALQ
Sbjct  63   AIAAKDNAVAVELAESARAGVKASSDWVMESMNKGTDSYGVTTGFGATSHRRTKQGGALQ  122

Query  489  QELIRFLNAGIFGTG--TGHTLPHSA  560
            +ELIRFLNAGIFG G  T HTLPH+A
Sbjct  123  KELIRFLNAGIFGNGTETNHTLPHTA  148



>gb|ADN32767.1| phenylalanine ammonia-lyase 1 [Scutellaria baicalensis]
Length=711

 Score =   233 bits (595),  Expect = 7e-69, Method: Compositional matrix adjust.
 Identities = 116/150 (77%), Positives = 129/150 (86%), Gaps = 4/150 (3%)
 Frame = +3

Query  123  MEGAIENGH-SNDFCIKV-DPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQTLTV  296
            M  A+E  H SN FC+++ DPLNW  AA++LKGSHLDEVKRMV EFRNP VKIGG+ LT+
Sbjct  1    MAPAVEVSHRSNGFCVQLSDPLNWGAAAEALKGSHLDEVKRMVEEFRNPVVKIGGENLTI  60

Query  297  AQVAAIAARDNAVKVELSEGARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSHRRTKNG  476
            AQVAAIA+RDNAV VEL+E ARAGVKASSDWVM+SMN GTDSYGVTTGFGATSHRRTK G
Sbjct  61   AQVAAIASRDNAVAVELAESARAGVKASSDWVMDSMNKGTDSYGVTTGFGATSHRRTKQG  120

Query  477  HALQQELIRFLNAGIFGTGT--GHTLPHSA  560
             ALQ+ELIRFLNAGIFG GT   HTLPH+A
Sbjct  121  GALQKELIRFLNAGIFGKGTEGCHTLPHTA  150



>ref|XP_004249558.1| PREDICTED: phenylalanine ammonia-lyase [Solanum lycopersicum]
Length=711

 Score =   233 bits (593),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 114/150 (76%), Positives = 126/150 (84%), Gaps = 4/150 (3%)
 Frame = +3

Query  123  MEGAIENGHSNDFCIKVDPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQTLTVAQ  302
            M G I      DFCIKVDPLNWEMAA+SL+GSHLDEVK+MVAEFR P VK+GG+TLTVAQ
Sbjct  1    MAGVINGQQDLDFCIKVDPLNWEMAAESLRGSHLDEVKKMVAEFRKPVVKLGGETLTVAQ  60

Query  303  VAAIAARDNA--VKVELSEGARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSHRRTKNG  476
            VA++AA+ N   VKVEL E ARAGVKASSDWVM SM+ GTDSYGVTTGFGATSHRRTKNG
Sbjct  61   VASVAAKVNVENVKVELCEDARAGVKASSDWVMESMSKGTDSYGVTTGFGATSHRRTKNG  120

Query  477  HALQQELIRFLNAGIFGTGT--GHTLPHSA  560
             ALQ+ELIRFLNAG+FG GT   HTLP S+
Sbjct  121  GALQKELIRFLNAGVFGNGTESCHTLPQSS  150



>gb|ABL14039.1| phenylalanine ammonia lyase, partial [Astragalus mongholicus]
Length=274

 Score =   221 bits (564),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 112/157 (71%), Positives = 125/157 (80%), Gaps = 11/157 (7%)
 Frame = +3

Query  123  MEGAIENGHSN------DFCIKV---DPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKI  275
            ME    NGH++      + CI     DPLNW +AA++LKGS LDEVKRMV E+RNP VKI
Sbjct  1    MEAVGANGHASSTANEAELCISKAGGDPLNWAVAAEALKGSLLDEVKRMVEEYRNPVVKI  60

Query  276  GGQTLTVAQVAAIAARDNAVKVELSEGARAGVKASSDWVMNSMNNGTDSYGVTTGFGATS  455
            GG+TLT++QVA IA+ D  VKVELSE ARAGVKASSDWVMNSMNNGTDSYGVTTGFGATS
Sbjct  61   GGETLTISQVAGIASHDGGVKVELSESARAGVKASSDWVMNSMNNGTDSYGVTTGFGATS  120

Query  456  HRRTKNGHALQQELIRFLNAGIFGTGT--GHTLPHSA  560
            HRRTK G ALQ+E IRFLNAGIFG GT   +TLPHSA
Sbjct  121  HRRTKQGGALQKEFIRFLNAGIFGNGTESNYTLPHSA  157



>gb|AAK84225.1|AF401636_1 phenylalanine ammonia-lyase [Rehmannia glutinosa]
Length=708

 Score =   232 bits (591),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 116/148 (78%), Positives = 126/148 (85%), Gaps = 6/148 (4%)
 Frame = +3

Query  135  IENGH--SNDFCIKV--DPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQTLTVAQ  302
            +ENGH  SN  C++   DPLNW  AA+SLKGSHLDEVKRMV EFR PAVK+GG++LT+AQ
Sbjct  1    MENGHHHSNGLCVETTRDPLNWVAAAESLKGSHLDEVKRMVEEFRKPAVKLGGESLTIAQ  60

Query  303  VAAIAARDNAVKVELSEGARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSHRRTKNGHA  482
            VAAIAARDNAV VEL+E ARAGVKASSDWVM SMN GTDSYGVTTGFGATSHRRTK G A
Sbjct  61   VAAIAARDNAVAVELAETARAGVKASSDWVMESMNKGTDSYGVTTGFGATSHRRTKQGGA  120

Query  483  LQQELIRFLNAGIFGTGT--GHTLPHSA  560
            LQ+ELIRFLNAGIFG GT   H LPHSA
Sbjct  121  LQKELIRFLNAGIFGNGTESNHALPHSA  148



>gb|AHZ31605.1| phenylalanine ammonia-lyase [Olea europaea]
 gb|AHZ31606.1| phenylalanine ammonia-lyase [Olea europaea]
Length=713

 Score =   231 bits (590),  Expect = 4e-68, Method: Compositional matrix adjust.
 Identities = 114/148 (77%), Positives = 127/148 (86%), Gaps = 7/148 (5%)
 Frame = +3

Query  135  IENGHSN----DFCIKVDPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQTLTVAQ  302
            +ENGHS+    +FCI+ DPLNW  AA+SLKGSHLDE+KRMV EFR P VK+GG+TLT++Q
Sbjct  6    VENGHSSGKLLNFCIE-DPLNWGTAAESLKGSHLDELKRMVEEFRKPVVKLGGETLTISQ  64

Query  303  VAAIAARDNAVKVELSEGARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSHRRTKNGHA  482
            VAAIA+RDNAVKVEL+E ARAGVKASSDWVM SMN GTDSYGVTTGFGATSHRRTK G A
Sbjct  65   VAAIASRDNAVKVELAEAARAGVKASSDWVMESMNKGTDSYGVTTGFGATSHRRTKQGGA  124

Query  483  LQQELIRFLNAGIFGTGT--GHTLPHSA  560
            LQ+ELIRFLNAGIFG GT     LPHSA
Sbjct  125  LQKELIRFLNAGIFGNGTESSQALPHSA  152



>gb|AGW27206.1| phenylalanine ammonia-lyase 3 [Salvia miltiorrhiza]
Length=760

 Score =   232 bits (591),  Expect = 5e-68, Method: Compositional matrix adjust.
 Identities = 117/154 (76%), Positives = 131/154 (85%), Gaps = 5/154 (3%)
 Frame = +3

Query  111  FNTTMEGAIENGHS-NDFCIK-VDPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQ  284
            F T++  A ENGHS N FC+K  DPLNW  AA++L+GSHLD VKRMV EFR PAVK+GG+
Sbjct  47   FTTSIMAA-ENGHSENGFCVKQSDPLNWAAAAEALQGSHLDAVKRMVEEFRKPAVKLGGE  105

Query  285  TLTVAQVAAIAARDNAVKVELSEGARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSHRR  464
            TLT+AQVAAIA+RDNAV VEL+E ARAGVKASSDWVM+SM  GTDSYGVTTGFGATSHRR
Sbjct  106  TLTIAQVAAIASRDNAVAVELAESARAGVKASSDWVMDSMGKGTDSYGVTTGFGATSHRR  165

Query  465  TKNGHALQQELIRFLNAGIFGTGT--GHTLPHSA  560
            TK G ALQ+ELIRFLNAGIFG GT   HTLPHS+
Sbjct  166  TKQGGALQKELIRFLNAGIFGNGTESNHTLPHSS  199



>gb|ABD73282.1| phenylalanine ammonia-lyase [Salvia miltiorrhiza]
Length=711

 Score =   231 bits (589),  Expect = 6e-68, Method: Compositional matrix adjust.
 Identities = 115/149 (77%), Positives = 127/149 (85%), Gaps = 6/149 (4%)
 Frame = +3

Query  132  AIENGH---SNDFCIKV-DPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQTLTVA  299
            A ENGH   SN FC+K  DPLNW  AA+SLKGSHLDEVKRMV EFR P VK+GG+TLT++
Sbjct  2    AAENGHHEESNGFCVKQNDPLNWVAAAESLKGSHLDEVKRMVEEFRKPVVKLGGETLTIS  61

Query  300  QVAAIAARDNAVKVELSEGARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSHRRTKNGH  479
            QVAAIAA+DNAV VEL+E +RAGVKASSDWVM SM+ GTDSYGVTTGFGATSHRRTK G 
Sbjct  62   QVAAIAAKDNAVAVELAESSRAGVKASSDWVMESMSKGTDSYGVTTGFGATSHRRTKQGG  121

Query  480  ALQQELIRFLNAGIFGTGT--GHTLPHSA  560
            ALQ+ELIRFLNAGIFG GT   HTLPH+A
Sbjct  122  ALQKELIRFLNAGIFGNGTESNHTLPHTA  150



>ref|XP_010262867.1| PREDICTED: phenylalanine ammonia-lyase [Nelumbo nucifera]
Length=715

 Score =   231 bits (589),  Expect = 6e-68, Method: Compositional matrix adjust.
 Identities = 110/142 (77%), Positives = 121/142 (85%), Gaps = 2/142 (1%)
 Frame = +3

Query  141  NGHSNDFCIKVDPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQTLTVAQVAAIAA  320
            NG    FC++ DPLNW+MAA+SLKGSHLDEVKRMV E+R P VK+GG+TLT++QVAAIA 
Sbjct  13   NGSIKSFCVQQDPLNWQMAAESLKGSHLDEVKRMVQEYRKPVVKLGGETLTISQVAAIAT  72

Query  321  RDNAVKVELSEGARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSHRRTKNGHALQQELI  500
             D  VKVEL+E ARAGVKASSDWVM SMN GTDSYGVTTGFGATSHRRTK G ALQ+ELI
Sbjct  73   HDAGVKVELAESARAGVKASSDWVMESMNKGTDSYGVTTGFGATSHRRTKQGGALQKELI  132

Query  501  RFLNAGIFGTGT--GHTLPHSA  560
            RFLNAGIFG GT   HTLPHSA
Sbjct  133  RFLNAGIFGNGTESCHTLPHSA  154



>gb|ABE03772.1| phenylalanine ammonia-lyase [Arnebia euchroma]
Length=709

 Score =   230 bits (586),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 112/150 (75%), Positives = 128/150 (85%), Gaps = 5/150 (3%)
 Frame = +3

Query  123  MEGAIE--NGHSNDFCIKVDPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQTLTV  296
            ME  +E  NG S +FC++ DPLNWEMAA+S+KGSHLDEVKRMVAEFR P V++ G+TLT+
Sbjct  1    METIVEKGNGKSMEFCMQ-DPLNWEMAAESMKGSHLDEVKRMVAEFRKPVVQLAGKTLTI  59

Query  297  AQVAAIAARDNAVKVELSEGARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSHRRTKNG  476
             QVA+IAA D+ VKVEL+E AR GVKASSDWVM+SMN GTDSYGVTTGFGATSHRRTK G
Sbjct  60   GQVASIAAHDDGVKVELAEAAREGVKASSDWVMDSMNKGTDSYGVTTGFGATSHRRTKQG  119

Query  477  HALQQELIRFLNAGIFGTG--TGHTLPHSA  560
             ALQ+ELIRFL+AGIFG G  T HTLPHSA
Sbjct  120  GALQKELIRFLDAGIFGNGTETSHTLPHSA  149



>gb|ABR14606.1| phenylalanine ammonia-lyase [Salvia miltiorrhiza]
Length=711

 Score =   230 bits (586),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 115/149 (77%), Positives = 126/149 (85%), Gaps = 6/149 (4%)
 Frame = +3

Query  132  AIENGH---SNDFCIKV-DPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQTLTVA  299
            A ENGH   SN FC+K  DPLNW  AA+SLKGSHLDEVKRMV EFR P VK+GG+TLT++
Sbjct  2    AAENGHHEESNGFCVKQNDPLNWVAAAESLKGSHLDEVKRMVEEFRKPVVKLGGETLTIS  61

Query  300  QVAAIAARDNAVKVELSEGARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSHRRTKNGH  479
            QVAAIAA+DNAV VEL E +RAGVKASSDWVM SM+ GTDSYGVTTGFGATSHRRTK G 
Sbjct  62   QVAAIAAKDNAVAVELVESSRAGVKASSDWVMESMSKGTDSYGVTTGFGATSHRRTKQGG  121

Query  480  ALQQELIRFLNAGIFGTGT--GHTLPHSA  560
            ALQ+ELIRFLNAGIFG GT   HTLPH+A
Sbjct  122  ALQKELIRFLNAGIFGNGTESNHTLPHTA  150



>ref|XP_009766905.1| PREDICTED: phenylalanine ammonia-lyase [Nicotiana sylvestris]
 gb|ACJ66297.1| phenylalanine ammonia-lyase 4 [Nicotiana tabacum]
 gb|ACJ66298.1| phenylalanine ammonia-lyase 4 [Nicotiana tabacum]
Length=717

 Score =   230 bits (586),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 117/153 (76%), Positives = 127/153 (83%), Gaps = 13/153 (8%)
 Frame = +3

Query  141  NGHSN-----DFCIK---VDPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQTLTV  296
            NGH N     + C K    DPLNWEMAA+SL+GSHLDEVK+MV+EFR P VK+GG+TLTV
Sbjct  4    NGHVNGGENFELCKKSSATDPLNWEMAAESLRGSHLDEVKKMVSEFRKPMVKLGGETLTV  63

Query  297  AQVAAIAARD---NAVKVELSEGARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSHRRT  467
            AQVAAIA RD   N VKVELSE ARAGVKASSDWVM+SMN GTDSYGVTTGFGATSHRRT
Sbjct  64   AQVAAIAVRDKSANGVKVELSEEARAGVKASSDWVMDSMNKGTDSYGVTTGFGATSHRRT  123

Query  468  KNGHALQQELIRFLNAGIFGTG--TGHTLPHSA  560
            KNG ALQ+ELIRFLNAG+FG G  T HTLPHSA
Sbjct  124  KNGGALQKELIRFLNAGVFGNGTETSHTLPHSA  156



>sp|O49835.1|PAL1_LITER RecName: Full=Phenylalanine ammonia-lyase 1; Short=PAL-1 [Lithospermum 
erythrorhizon]
 dbj|BAA24928.1| phenylalanine ammonia-lyase [Lithospermum erythrorhizon]
Length=710

 Score =   230 bits (586),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 112/150 (75%), Positives = 127/150 (85%), Gaps = 5/150 (3%)
 Frame = +3

Query  123  MEGAIENGHSN--DFCIKVDPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQTLTV  296
            ME  +ENG+    +FC+K DPLNWEMA++S+KGSHLDEVK MVAEFR P V++ G+TLT+
Sbjct  1    METIVENGNGKTMEFCMK-DPLNWEMASESMKGSHLDEVKNMVAEFRKPVVQLAGKTLTI  59

Query  297  AQVAAIAARDNAVKVELSEGARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSHRRTKNG  476
             QVAAIAARD+ V VEL+E AR GVKASSDWVM+SMN GTDSYGVTTGFGATSHRRTK G
Sbjct  60   GQVAAIAARDDGVTVELAEAAREGVKASSDWVMDSMNKGTDSYGVTTGFGATSHRRTKQG  119

Query  477  HALQQELIRFLNAGIFGTG--TGHTLPHSA  560
             ALQ+ELIRFLNAGIFG G  T HTLPHSA
Sbjct  120  GALQKELIRFLNAGIFGNGTETSHTLPHSA  149



>ref|XP_010253912.1| PREDICTED: phenylalanine ammonia-lyase [Nelumbo nucifera]
Length=713

 Score =   230 bits (586),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 115/152 (76%), Positives = 124/152 (82%), Gaps = 6/152 (4%)
 Frame = +3

Query  123  MEGAIENGHSN----DFCIKVDPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQTL  290
            ME A EN + N     FCI+ DPLNWE AA+SLKGSHLDEVKRMV EFR P V++GGQTL
Sbjct  1    MEFAQENCNGNGSLKSFCIQQDPLNWEKAAESLKGSHLDEVKRMVQEFRKPVVRLGGQTL  60

Query  291  TVAQVAAIAARDNAVKVELSEGARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSHRRTK  470
            T++QVAAIA  D  VKV LSE ARAGVKASSDWVM SMN GTDSYGVTTGFGATSHRRTK
Sbjct  61   TISQVAAIATHDAGVKVVLSESARAGVKASSDWVMESMNKGTDSYGVTTGFGATSHRRTK  120

Query  471  NGHALQQELIRFLNAGIFGTG--TGHTLPHSA  560
             G ALQ+ELIRFLNAGIFG G  + HTLPHSA
Sbjct  121  QGGALQKELIRFLNAGIFGNGVESCHTLPHSA  152



>ref|XP_004497516.1| PREDICTED: phenylalanine ammonia-lyase-like [Cicer arietinum]
Length=715

 Score =   229 bits (585),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 113/152 (74%), Positives = 128/152 (84%), Gaps = 6/152 (4%)
 Frame = +3

Query  123  MEGAIENGHSND-FCIK---VDPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQTL  290
            MEGA+ NGH+   FC+     DPLNW +AADS+KGSHLDEVKRMV E+RNP V+IGG+TL
Sbjct  3    MEGALSNGHAQPTFCLTKTLPDPLNWGVAADSMKGSHLDEVKRMVEEYRNPIVRIGGETL  62

Query  291  TVAQVAAIAARDNAVKVELSEGARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSHRRTK  470
            T+AQVA IA+ D+ V+VELSE ARAGVKASSDWVM+SMN GTDSYGVTTGFGATSHRRTK
Sbjct  63   TIAQVAGIASHDSGVRVELSESARAGVKASSDWVMDSMNKGTDSYGVTTGFGATSHRRTK  122

Query  471  NGHALQQELIRFLNAGIFGTGT--GHTLPHSA  560
             G ALQ+ELIRFLNAGIFG GT    TLPH+A
Sbjct  123  QGGALQKELIRFLNAGIFGNGTESNCTLPHTA  154



>gb|ADN32768.1| phenylalanine ammonia-lyase 2 [Scutellaria baicalensis]
Length=708

 Score =   229 bits (584),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 113/147 (77%), Positives = 125/147 (85%), Gaps = 5/147 (3%)
 Frame = +3

Query  135  IENGHSND--FCIKV-DPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQTLTVAQV  305
            +ENGH N   FC+K  DPLNW  AA++L+GSHLDEVKRMVAEFR P VK+GG+TLT++QV
Sbjct  1    MENGHKNGNGFCVKQNDPLNWGAAAEALQGSHLDEVKRMVAEFRKPVVKLGGETLTISQV  60

Query  306  AAIAARDNAVKVELSEGARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSHRRTKNGHAL  485
            AAIAARDN V VEL+E AR GVKASSDWVM SMN GTDSYGVTTGFGATSHRRTK G AL
Sbjct  61   AAIAARDNGVVVELAEAARPGVKASSDWVMESMNKGTDSYGVTTGFGATSHRRTKQGGAL  120

Query  486  QQELIRFLNAGIFGTGT--GHTLPHSA  560
            Q+ELIRFLNAGIFG GT   HTLPH+A
Sbjct  121  QKELIRFLNAGIFGKGTESEHTLPHTA  147



>ref|XP_009629066.1| PREDICTED: phenylalanine ammonia-lyase [Nicotiana tomentosiformis]
 sp|P25872.1|PAL1_TOBAC RecName: Full=Phenylalanine ammonia-lyase [Nicotiana tabacum]
 gb|AAA34122.1| phenylalanine ammonia lyase [Nicotiana tabacum]
 dbj|BAA22948.1| phenylalanine ammonia-lyase [Nicotiana tabacum]
Length=715

 Score =   229 bits (584),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 116/151 (77%), Positives = 127/151 (84%), Gaps = 11/151 (7%)
 Frame = +3

Query  141  NGHSN-----DFCIK-VDPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQTLTVAQ  302
            NGH N     + C K  DPLNWEMAA+SL+GSHLDEVK+MV+EFR P VK+GG++LTVAQ
Sbjct  4    NGHVNGGENFELCKKSADPLNWEMAAESLRGSHLDEVKKMVSEFRKPMVKLGGESLTVAQ  63

Query  303  VAAIAARD---NAVKVELSEGARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSHRRTKN  473
            VAAIA RD   N VKVELSE ARAGVKASSDWVM+SMN GTDSYGVTTGFGATSHRRTKN
Sbjct  64   VAAIAVRDKSANGVKVELSEEARAGVKASSDWVMDSMNKGTDSYGVTTGFGATSHRRTKN  123

Query  474  GHALQQELIRFLNAGIFGTG--TGHTLPHSA  560
            G ALQ+ELIRFLNAG+FG G  T HTLPHSA
Sbjct  124  GGALQKELIRFLNAGVFGNGTETSHTLPHSA  154



>gb|AEH02821.1| phenylalanine ammonia lyase [Chrysanthemum x morifolium]
Length=717

 Score =   229 bits (584),  Expect = 4e-67, Method: Compositional matrix adjust.
 Identities = 115/143 (80%), Positives = 124/143 (87%), Gaps = 4/143 (3%)
 Frame = +3

Query  141  NGHSNDFCIKVDPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQTLTVAQVAAIAA  320
            NGH ND CIK DPLNW +AA++L GSHL+EVK+MV EF+NP VKIGG+TLTV+QVA IAA
Sbjct  15   NGHINDLCIK-DPLNWGVAAEALTGSHLNEVKKMVKEFKNPIVKIGGETLTVSQVAGIAA  73

Query  321  RDNA-VKVELSEGARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSHRRTKNGHALQQEL  497
             DNA VKVELSE ARAGVKASSDWVM SM  GTDSYGVTTGFGATSHRRTKNG ALQ+EL
Sbjct  74   SDNASVKVELSESARAGVKASSDWVMESMGKGTDSYGVTTGFGATSHRRTKNGGALQKEL  133

Query  498  IRFLNAGIFGTGT--GHTLPHSA  560
            IRFLNAGIFG GT   HTLPHSA
Sbjct  134  IRFLNAGIFGNGTEASHTLPHSA  156



>gb|ABG75911.1| phenylalanine ammonia-lyase 2 [Nicotiana attenuata]
Length=717

 Score =   229 bits (583),  Expect = 4e-67, Method: Compositional matrix adjust.
 Identities = 116/153 (76%), Positives = 127/153 (83%), Gaps = 13/153 (8%)
 Frame = +3

Query  141  NGHSN-----DFCIK---VDPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQTLTV  296
            NGH N     + C K    DPLNWEMA++SL+GSHLDEVK+MV+EFR P VK+GG+TLTV
Sbjct  4    NGHVNGGEDFELCKKSSATDPLNWEMASESLRGSHLDEVKKMVSEFRKPMVKLGGETLTV  63

Query  297  AQVAAIAARD---NAVKVELSEGARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSHRRT  467
            AQVAAIA RD   N VKVELSE ARAGVKASSDWVM+SMN GTDSYGVTTGFGATSHRRT
Sbjct  64   AQVAAIAVRDKSANGVKVELSEDARAGVKASSDWVMDSMNKGTDSYGVTTGFGATSHRRT  123

Query  468  KNGHALQQELIRFLNAGIFGTG--TGHTLPHSA  560
            KNG ALQ+ELIRFLNAG+FG G  T HTLPHSA
Sbjct  124  KNGGALQKELIRFLNAGVFGNGTETNHTLPHSA  156



>ref|XP_011094662.1| PREDICTED: phenylalanine ammonia-lyase [Sesamum indicum]
Length=711

 Score =   229 bits (583),  Expect = 4e-67, Method: Compositional matrix adjust.
 Identities = 113/150 (75%), Positives = 127/150 (85%), Gaps = 4/150 (3%)
 Frame = +3

Query  123  MEGAIENGH-SNDFCIKV-DPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQTLTV  296
            M  ++EN H SN FC++  DPLNW +AA++LKGSHLDEVK+MVAEFR P VK+GG+TLT+
Sbjct  1    MAPSLENDHHSNGFCVQQKDPLNWGVAAEALKGSHLDEVKKMVAEFRKPVVKLGGETLTI  60

Query  297  AQVAAIAARDNAVKVELSEGARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSHRRTKNG  476
            +QVAAIAARDN V VEL+E AR GVKASSDWVM SMN GTDSYGVTTGFGATSHRRTK G
Sbjct  61   SQVAAIAARDNGVAVELAEAARGGVKASSDWVMESMNKGTDSYGVTTGFGATSHRRTKQG  120

Query  477  HALQQELIRFLNAGIFGTGT--GHTLPHSA  560
             ALQ+ELIRFLNAGIFG  T   HTLPHSA
Sbjct  121  GALQKELIRFLNAGIFGNATESCHTLPHSA  150



>gb|AFF60415.1| phenylalanine ammonia lyase, partial [Pyrus pyrifolia]
Length=639

 Score =   227 bits (579),  Expect = 6e-67, Method: Compositional matrix adjust.
 Identities = 107/136 (79%), Positives = 118/136 (87%), Gaps = 2/136 (1%)
 Frame = +3

Query  159  FCIKVDPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQTLTVAQVAAIAARDNAVK  338
             CIK DPLNW +AADSLKGSHLDEVKRMVAE+R P VK+GG++LT++QVAAIA  D  VK
Sbjct  4    LCIKKDPLNWGLAADSLKGSHLDEVKRMVAEYRKPVVKLGGESLTISQVAAIATHDTGVK  63

Query  339  VELSEGARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSHRRTKNGHALQQELIRFLNAG  518
            VELSE ARAGVKASSDWVM+SM  GTDSYGVTTGFGATSHRRTK G ALQ+ELIRFLNAG
Sbjct  64   VELSESARAGVKASSDWVMDSMGKGTDSYGVTTGFGATSHRRTKQGAALQKELIRFLNAG  123

Query  519  IFGTGT--GHTLPHSA  560
            +FG+ T  GHTLPH A
Sbjct  124  VFGSATESGHTLPHQA  139



>gb|AJO53274.1| phenylalanine ammonia-lyase [Pogostemon cablin]
Length=715

 Score =   228 bits (582),  Expect = 6e-67, Method: Compositional matrix adjust.
 Identities = 115/154 (75%), Positives = 127/154 (82%), Gaps = 8/154 (5%)
 Frame = +3

Query  123  MEGAIENGHSND----FCIKV--DPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQ  284
            M  A ENGH N     FC+K   DPLNW  AA++LKGSHL+EVKRMV EFR P VK+GG+
Sbjct  1    MAAATENGHRNGAVNGFCVKAQGDPLNWGAAAEALKGSHLEEVKRMVEEFRKPVVKLGGE  60

Query  285  TLTVAQVAAIAARDNAVKVELSEGARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSHRR  464
            +LT++QVAAIAARDNAV VEL+E ARAGVKASSDWVM SMN GTDSYGVTTGFGATSHRR
Sbjct  61   SLTISQVAAIAARDNAVAVELAEPARAGVKASSDWVMESMNKGTDSYGVTTGFGATSHRR  120

Query  465  TKNGHALQQELIRFLNAGIFGTGT--GHTLPHSA  560
            TK G ALQ+ELIR LNAGIFG+GT   HTLPHSA
Sbjct  121  TKQGGALQKELIRSLNAGIFGSGTESCHTLPHSA  154



>ref|XP_007162754.1| hypothetical protein PHAVU_001G1777001g, partial [Phaseolus vulgaris]
 gb|ESW34748.1| hypothetical protein PHAVU_001G1777001g, partial [Phaseolus vulgaris]
Length=411

 Score =   221 bits (564),  Expect = 6e-67, Method: Compositional matrix adjust.
 Identities = 108/149 (72%), Positives = 122/149 (82%), Gaps = 7/149 (5%)
 Frame = +3

Query  135  IENGHSN-DFCIK----VDPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQTLTVA  299
            + N H N  FC+      DPLNW  AA++LKGSHLDEVKRMVAE+R P V++GG+TLT+A
Sbjct  6    LTNAHQNCSFCLPSAKTTDPLNWGTAAEALKGSHLDEVKRMVAEYRQPLVRLGGETLTIA  65

Query  300  QVAAIAARDNAVKVELSEGARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSHRRTKNGH  479
            QVAA++  D  V+VELSE AR GVKASSDWVMNSMNNGTDSYGVTTGFGATSHRRTK G 
Sbjct  66   QVAAVSGHDQGVRVELSESAREGVKASSDWVMNSMNNGTDSYGVTTGFGATSHRRTKQGG  125

Query  480  ALQQELIRFLNAGIFGTGT--GHTLPHSA  560
            ALQ+ELIRFLNAGIFG GT   HTLPH+A
Sbjct  126  ALQKELIRFLNAGIFGNGTESSHTLPHTA  154



>ref|XP_008387584.1| PREDICTED: phenylalanine ammonia-lyase 1 [Malus domestica]
Length=720

 Score =   228 bits (580),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 110/146 (75%), Positives = 123/146 (84%), Gaps = 6/146 (4%)
 Frame = +3

Query  129  GAIENGHSNDFCIKVDPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQTLTVAQVA  308
            GA+E+      CIK DPLNW +AADSLKGSHLDEVKRMVAE+R P VK+GG++LT++QVA
Sbjct  18   GAVES----PLCIKKDPLNWGLAADSLKGSHLDEVKRMVAEYRKPVVKLGGESLTISQVA  73

Query  309  AIAARDNAVKVELSEGARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSHRRTKNGHALQ  488
            AIA  D  VKVELSE ARAGVKASSDWVM+SM  GTDSYGVTTGFGATSHRRTK G ALQ
Sbjct  74   AIATHDTGVKVELSESARAGVKASSDWVMDSMGKGTDSYGVTTGFGATSHRRTKQGAALQ  133

Query  489  QELIRFLNAGIFGTGT--GHTLPHSA  560
            +ELIRFLNAG+FG+ T  GHTLPH A
Sbjct  134  KELIRFLNAGVFGSATESGHTLPHQA  159



>ref|XP_009342990.1| PREDICTED: phenylalanine ammonia-lyase 1 [Pyrus x bretschneideri]
Length=720

 Score =   228 bits (580),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 110/149 (74%), Positives = 123/149 (83%), Gaps = 8/149 (5%)
 Frame = +3

Query  138  ENGHSND------FCIKVDPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQTLTVA  299
            +NGH  +       CIK DPLNW +AADSLKGSHLDEVKRMVAE+R P VK+GG++LT++
Sbjct  11   KNGHHQNGAVESPLCIKKDPLNWGLAADSLKGSHLDEVKRMVAEYRKPVVKLGGESLTIS  70

Query  300  QVAAIAARDNAVKVELSEGARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSHRRTKNGH  479
            QVAAIA  D  VKVELSE ARAGVKASSDWVM+SM  GTDSYGVTTGFGATSHRRTK G 
Sbjct  71   QVAAIATHDTGVKVELSESARAGVKASSDWVMDSMGKGTDSYGVTTGFGATSHRRTKQGA  130

Query  480  ALQQELIRFLNAGIFGTGT--GHTLPHSA  560
            ALQ+ELIRFLNAG+FG+ T  GHTLPH A
Sbjct  131  ALQKELIRFLNAGVFGSATESGHTLPHQA  159



>gb|AGL50914.1| phenylalanine ammonia lyase [Pyrus communis]
Length=720

 Score =   228 bits (580),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 110/149 (74%), Positives = 123/149 (83%), Gaps = 8/149 (5%)
 Frame = +3

Query  138  ENGHSND------FCIKVDPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQTLTVA  299
            +NGH  +       CIK DPLNW +AADSLKGSHLDEVKRMVAE+R P VK+GG++LT++
Sbjct  11   KNGHHQNGAVESPLCIKKDPLNWGLAADSLKGSHLDEVKRMVAEYRKPVVKLGGESLTIS  70

Query  300  QVAAIAARDNAVKVELSEGARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSHRRTKNGH  479
            QVAAIA  D  VKVELSE ARAGVKASSDWVM+SM  GTDSYGVTTGFGATSHRRTK G 
Sbjct  71   QVAAIATHDTGVKVELSESARAGVKASSDWVMDSMGKGTDSYGVTTGFGATSHRRTKQGA  130

Query  480  ALQQELIRFLNAGIFGTGT--GHTLPHSA  560
            ALQ+ELIRFLNAG+FG+ T  GHTLPH A
Sbjct  131  ALQKELIRFLNAGVFGSATESGHTLPHQA  159



>gb|AFG30054.1| phenylalanine ammonialyase [Malus hybrid cultivar]
Length=720

 Score =   228 bits (580),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 110/146 (75%), Positives = 123/146 (84%), Gaps = 6/146 (4%)
 Frame = +3

Query  129  GAIENGHSNDFCIKVDPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQTLTVAQVA  308
            GA+E+      CIK DPLNW +AADSLKGSHLDEVKRMVAE+R P VK+GG++LT++QVA
Sbjct  18   GAVES----PLCIKKDPLNWGLAADSLKGSHLDEVKRMVAEYRKPVVKLGGESLTISQVA  73

Query  309  AIAARDNAVKVELSEGARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSHRRTKNGHALQ  488
            AIA  D  VKVELSE ARAGVKASSDWVM+SM  GTDSYGVTTGFGATSHRRTK G ALQ
Sbjct  74   AIATHDTGVKVELSESARAGVKASSDWVMDSMGKGTDSYGVTTGFGATSHRRTKQGAALQ  133

Query  489  QELIRFLNAGIFGTGT--GHTLPHSA  560
            +ELIRFLNAG+FG+ T  GHTLPH A
Sbjct  134  KELIRFLNAGVFGSATESGHTLPHQA  159



>sp|O23924.1|PALY_DIGLA RecName: Full=Phenylalanine ammonia-lyase [Digitalis lanata]
 emb|CAA05251.1| phenylalanine ammonia lyase [Digitalis lanata]
Length=713

 Score =   227 bits (579),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 113/151 (75%), Positives = 125/151 (83%), Gaps = 5/151 (3%)
 Frame = +3

Query  123  MEGAIENGH--SNDFCIKV-DPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQTLT  293
            M   +ENGH  +N FC+K  DPLNW  AA+ LKGSHLDEVKRMV EFR   VK+GG+TLT
Sbjct  1    MAAVVENGHHGNNGFCVKQNDPLNWVAAAEELKGSHLDEVKRMVEEFRKTVVKLGGETLT  60

Query  294  VAQVAAIAARDNAVKVELSEGARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSHRRTKN  473
            ++QVAAIAARDN V V+L+E +RAGVKASSDWVM SMN GTDSYGVTTGFGATSHRRTK 
Sbjct  61   ISQVAAIAARDNEVAVQLAESSRAGVKASSDWVMESMNKGTDSYGVTTGFGATSHRRTKQ  120

Query  474  GHALQQELIRFLNAGIFGTGTG--HTLPHSA  560
            G ALQ+ELIRFLNAGIFG GT   HTLPHSA
Sbjct  121  GGALQKELIRFLNAGIFGNGTESTHTLPHSA  151



>gb|AEO92028.1| phenylalanine ammonia-lyase 2 [Coffea canephora]
 gb|AEO94540.1| phenylalanine ammonia-lyase 2 [Coffea canephora]
Length=711

 Score =   227 bits (579),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 114/150 (76%), Positives = 125/150 (83%), Gaps = 8/150 (5%)
 Frame = +3

Query  135  IENGHS-----NDFCIKVDPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQTLTVA  299
            +ENGH      ++FC+K DPLNW +AA+SL GSHLDEVKRMVAEFR P VK GG++LTVA
Sbjct  1    MENGHDECVKVSEFCLKSDPLNWGVAAESLMGSHLDEVKRMVAEFRKPVVKFGGESLTVA  60

Query  300  QVAAIAAR-DNAVKVELSEGARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSHRRTKNG  476
            QVAAIAA+ D  VKVEL+E ARAGVKASSDWVM SMN GTDSYGVTTGFGATSHRRT  G
Sbjct  61   QVAAIAAKGDQGVKVELAEDARAGVKASSDWVMESMNKGTDSYGVTTGFGATSHRRTNQG  120

Query  477  HALQQELIRFLNAGIFGTG--TGHTLPHSA  560
             ALQ+ELIRFLNAGIFG G  T HTLPHSA
Sbjct  121  GALQKELIRFLNAGIFGNGTETCHTLPHSA  150



>sp|O49836.1|PAL2_LITER RecName: Full=Phenylalanine ammonia-lyase 2; Short=PAL-2 [Lithospermum 
erythrorhizon]
 dbj|BAA24929.1| phenylalanine ammonia-lyase [Lithospermum erythrorhizon]
Length=705

 Score =   227 bits (578),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 111/145 (77%), Positives = 125/145 (86%), Gaps = 4/145 (3%)
 Frame = +3

Query  135  IENGHSN-DFCIKVDPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQTLTVAQVAA  311
            +ENG+   +FC+K DPLNW MAA+S+KGSHLDEVK+MVAEFR P V++ G+TLT+AQVAA
Sbjct  1    MENGNGKMEFCMK-DPLNWGMAAESMKGSHLDEVKKMVAEFRKPVVQLAGKTLTIAQVAA  59

Query  312  IAARDNAVKVELSEGARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSHRRTKNGHALQQ  491
            IAARD+ V VEL+E AR GVKASSDWVM SMN GTDSYGVTTGFGATSHRRTK G ALQ+
Sbjct  60   IAARDDGVTVELAEAAREGVKASSDWVMESMNKGTDSYGVTTGFGATSHRRTKQGGALQK  119

Query  492  ELIRFLNAGIFGTG--TGHTLPHSA  560
            ELIRFLNAGIFG G  T HTLPHSA
Sbjct  120  ELIRFLNAGIFGNGTETSHTLPHSA  144



>gb|AEM63671.1| phenylalanine ammonia lyase 2 [Platycodon grandiflorus]
Length=708

 Score =   227 bits (578),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 112/146 (77%), Positives = 124/146 (85%), Gaps = 5/146 (3%)
 Frame = +3

Query  132  AIENGHSND--FCIKVDPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQTLTVAQV  305
            A  NGHS +  FC++ DPLNW  AA+ LKGSHLDEVK+MV EFR P V++GG+TLT+AQV
Sbjct  2    AYSNGHSKNGGFCVE-DPLNWGKAAEGLKGSHLDEVKKMVEEFRKPVVQLGGKTLTIAQV  60

Query  306  AAIAARDNAVKVELSEGARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSHRRTKNGHAL  485
            AAIA  D+ VKVELSE ARAGVKASSDWVM+SMNNGTDSYGVTTGFGATSHRRTK G AL
Sbjct  61   AAIATHDSGVKVELSESARAGVKASSDWVMDSMNNGTDSYGVTTGFGATSHRRTKEGGAL  120

Query  486  QQELIRFLNAGIFGTGT--GHTLPHS  557
            Q+ELIRFLNAGIFG GT   HTLPHS
Sbjct  121  QKELIRFLNAGIFGNGTESSHTLPHS  146



>gb|AFP24940.1| phenylalanine ammonia lyase [Prunus salicina]
Length=717

 Score =   227 bits (578),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 108/149 (72%), Positives = 126/149 (85%), Gaps = 8/149 (5%)
 Frame = +3

Query  138  ENGHSN------DFCIKVDPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQTLTVA  299
            +NGH N      + CIK DPLNW +AA++LKGSHLDEVKRMVAE+R P VK+GG++LT++
Sbjct  8    QNGHQNGSLESSELCIKKDPLNWGVAAETLKGSHLDEVKRMVAEYRKPVVKLGGESLTIS  67

Query  300  QVAAIAARDNAVKVELSEGARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSHRRTKNGH  479
            QVAAIA  D+ VKVELSE ARAGVKASSDWVM+SM+ GTDSYGVTTGFGATSHRRTK G 
Sbjct  68   QVAAIATHDSGVKVELSESARAGVKASSDWVMDSMSKGTDSYGVTTGFGATSHRRTKQGA  127

Query  480  ALQQELIRFLNAGIFGT--GTGHTLPHSA  560
            ALQ+ELIRFLNAG+FG+   +GHTLPH A
Sbjct  128  ALQKELIRFLNAGVFGSTKESGHTLPHQA  156



>gb|AFK43896.1| unknown [Medicago truncatula]
Length=374

 Score =   219 bits (558),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 113/152 (74%), Positives = 124/152 (82%), Gaps = 7/152 (5%)
 Frame = +3

Query  123  MEGAIENGHSN-DFCIKV---DPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQTL  290
            MEG I NGH    FC+     DPLNW  AA+SL GSHLDEVKRMV E+RNP VKIGG+TL
Sbjct  1    MEG-ITNGHVEATFCLSKNGGDPLNWGAAAESLTGSHLDEVKRMVEEYRNPLVKIGGETL  59

Query  291  TVAQVAAIAARDNAVKVELSEGARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSHRRTK  470
            T+AQVA IA+ D+ V+VELSE ARAGVKASSDWVM+SMN GTDSYGVTTGFGATSHRRTK
Sbjct  60   TIAQVAGIASHDSGVRVELSESARAGVKASSDWVMDSMNKGTDSYGVTTGFGATSHRRTK  119

Query  471  NGHALQQELIRFLNAGIFGTGT--GHTLPHSA  560
             G ALQ+ELIRFLNAGIFG GT    TLPH+A
Sbjct  120  QGGALQKELIRFLNAGIFGNGTESNCTLPHTA  151



>emb|CAL91170.1| phenylalanine ammonia-lyase 3 [Cynara cardunculus var. scolymus]
Length=264

 Score =   216 bits (549),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 109/145 (75%), Positives = 122/145 (84%), Gaps = 5/145 (3%)
 Frame = +3

Query  141  NGHSNDFCIKVDPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQTLTVAQVAAIAA  320
            NG + DFCI  DPLNW +AA+++ GSHLDEVKRMVAEFR P VK+GG+TLTV+QVA IAA
Sbjct  9    NGVATDFCINKDPLNWGVAAEAMTGSHLDEVKRMVAEFRKPVVKLGGETLTVSQVAGIAA  68

Query  321  RDNA--VKVELSEGARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSHRRTKNGHALQQE  494
              ++  VKVELSE ARAGVKASSDWVM SM+ GTDSYGVTTGFGATSHRRTK G ALQ+E
Sbjct  69   AGDSSVVKVELSEAARAGVKASSDWVMESMSKGTDSYGVTTGFGATSHRRTKQGGALQKE  128

Query  495  LI-RFLNAGIFGTG--TGHTLPHSA  560
            LI RFLNAGIFG G  + HTLPHSA
Sbjct  129  LIRRFLNAGIFGNGSESCHTLPHSA  153



>gb|ADF59061.1| phenylalanine ammonia-lyase 1 precursor [Pyrus x bretschneideri]
Length=719

 Score =   227 bits (578),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 109/148 (74%), Positives = 121/148 (82%), Gaps = 7/148 (5%)
 Frame = +3

Query  138  ENGHSN-----DFCIKVDPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQTLTVAQ  302
            +NGH N       CIK DPLNW + ADSLKGSHLDEVKRMVAE+R P VK+GG++LT++Q
Sbjct  11   QNGHQNRVSESPLCIKKDPLNWGLVADSLKGSHLDEVKRMVAEYRKPVVKLGGESLTISQ  70

Query  303  VAAIAARDNAVKVELSEGARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSHRRTKNGHA  482
            VAAIA  D  VKVELSE ARAGVKASSDWVM+SM  GTDSYGVTTGFGATSHRRT  G A
Sbjct  71   VAAIATHDTGVKVELSESARAGVKASSDWVMDSMGKGTDSYGVTTGFGATSHRRTNKGAA  130

Query  483  LQQELIRFLNAGIFGTGT--GHTLPHSA  560
            LQ+ELIRFLNAG+FG+ T  GHTLPH A
Sbjct  131  LQKELIRFLNAGVFGSATESGHTLPHQA  158



>ref|XP_007208432.1| hypothetical protein PRUPE_ppa002099mg [Prunus persica]
 gb|EMJ09631.1| hypothetical protein PRUPE_ppa002099mg [Prunus persica]
Length=717

 Score =   226 bits (577),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 108/149 (72%), Positives = 126/149 (85%), Gaps = 8/149 (5%)
 Frame = +3

Query  138  ENGHSN------DFCIKVDPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQTLTVA  299
            +NGH N      + CIK DPLNW +AA++LKGSHLDEVKRMVAE+R P VK+GG++LT++
Sbjct  8    QNGHQNRSLESSELCIKKDPLNWGVAAETLKGSHLDEVKRMVAEYRKPVVKLGGESLTIS  67

Query  300  QVAAIAARDNAVKVELSEGARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSHRRTKNGH  479
            QVAAIA  D+ VKVELSE ARAGVKASSDWVM+SM+ GTDSYGVTTGFGATSHRRTK G 
Sbjct  68   QVAAIATHDSGVKVELSESARAGVKASSDWVMDSMSKGTDSYGVTTGFGATSHRRTKQGA  127

Query  480  ALQQELIRFLNAGIFGT--GTGHTLPHSA  560
            ALQ+ELIRFLNAG+FG+   +GHTLPH A
Sbjct  128  ALQKELIRFLNAGVFGSTKESGHTLPHQA  156



>gb|ABQ63094.1| phenylalanine ammonia-lyase [Astragalus membranaceus]
Length=718

 Score =   226 bits (577),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 117/157 (75%), Positives = 128/157 (82%), Gaps = 11/157 (7%)
 Frame = +3

Query  123  MEGAIENGH-SN-----DFCIKV---DPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKI  275
            MEG   NGH SN     ++CI     DPLNW +AA++LKGSHLDEVKRMV E+RNP VKI
Sbjct  1    MEGEGANGHVSNHVTEAEYCISKAGGDPLNWGVAAEALKGSHLDEVKRMVEEYRNPVVKI  60

Query  276  GGQTLTVAQVAAIAARDNAVKVELSEGARAGVKASSDWVMNSMNNGTDSYGVTTGFGATS  455
            GG+TLT+AQVA IA+ D  VKVELSE ARAGVKASSDWVMNSMNNGTDSYGVTTGFGATS
Sbjct  61   GGETLTIAQVAGIASHDGGVKVELSESARAGVKASSDWVMNSMNNGTDSYGVTTGFGATS  120

Query  456  HRRTKNGHALQQELIRFLNAGIFGTGT--GHTLPHSA  560
            HRRTK G ALQ+ELIRFLNAGIFG GT    TLPH+A
Sbjct  121  HRRTKQGGALQKELIRFLNAGIFGNGTESNCTLPHTA  157



>sp|O64963.1|PAL1_PRUAV RecName: Full=Phenylalanine ammonia-lyase 1 [Prunus avium]
 gb|AAC78457.1| phenylalanine ammonia-lyase [Prunus avium]
Length=717

 Score =   226 bits (577),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 108/149 (72%), Positives = 126/149 (85%), Gaps = 8/149 (5%)
 Frame = +3

Query  138  ENGHSN------DFCIKVDPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQTLTVA  299
            +NGH N      + CIK DPLNW +AA++LKGSHLDEVKRMVAE+R P VK+GG++LT++
Sbjct  8    QNGHKNGSVELPELCIKKDPLNWGVAAETLKGSHLDEVKRMVAEYRKPVVKLGGESLTIS  67

Query  300  QVAAIAARDNAVKVELSEGARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSHRRTKNGH  479
            QVAAIA  D+ VKVELSE ARAGVKASSDWVM+SM+ GTDSYGVTTGFGATSHRRTK G 
Sbjct  68   QVAAIATHDSGVKVELSESARAGVKASSDWVMDSMSKGTDSYGVTTGFGATSHRRTKQGA  127

Query  480  ALQQELIRFLNAGIFGT--GTGHTLPHSA  560
            ALQ+ELIRFLNAG+FG+   +GHTLPH A
Sbjct  128  ALQKELIRFLNAGVFGSTKESGHTLPHQA  156



>gb|AEZ01784.1| phenylalanine ammonia-lyase [Pyrus x bretschneideri]
Length=719

 Score =   226 bits (577),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 109/148 (74%), Positives = 121/148 (82%), Gaps = 7/148 (5%)
 Frame = +3

Query  138  ENGHSN-----DFCIKVDPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQTLTVAQ  302
            +NGH N       CIK DPLNW + ADSLKGSHLDEVKRMVAE+R P VK+GG++LT++Q
Sbjct  11   QNGHQNGVSESPLCIKKDPLNWGLVADSLKGSHLDEVKRMVAEYRKPVVKLGGESLTISQ  70

Query  303  VAAIAARDNAVKVELSEGARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSHRRTKNGHA  482
            VAAIA  D  VKVELSE ARAGVKASSDWVM+SM  GTDSYGVTTGFGATSHRRT  G A
Sbjct  71   VAAIATHDTGVKVELSESARAGVKASSDWVMDSMGKGTDSYGVTTGFGATSHRRTNKGAA  130

Query  483  LQQELIRFLNAGIFGTGT--GHTLPHSA  560
            LQ+ELIRFLNAG+FG+ T  GHTLPH A
Sbjct  131  LQKELIRFLNAGVFGSATESGHTLPHQA  158



>ref|XP_006354339.1| PREDICTED: phenylalanine ammonia-lyase-like [Solanum tuberosum]
Length=722

 Score =   226 bits (576),  Expect = 4e-66, Method: Compositional matrix adjust.
 Identities = 117/161 (73%), Positives = 128/161 (80%), Gaps = 15/161 (9%)
 Frame = +3

Query  123  MEGAIENGHSN------DFCIKV----DPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVK  272
            M    +NGH N      + C K     DPLNWEMAADSL+GSHLDEVK+MVAEFR P VK
Sbjct  1    MASIAQNGHVNGEVVAMELCKKSINVDDPLNWEMAADSLRGSHLDEVKKMVAEFRKPIVK  60

Query  273  IGGQTLTVAQVAAIAARDN---AVKVELSEGARAGVKASSDWVMNSMNNGTDSYGVTTGF  443
            +GG+TLTVAQVA+IA  DN    VKVELSE ARAGVKASSDWVM+SM+ GTDSYGVTTGF
Sbjct  61   LGGETLTVAQVASIANADNKSNGVKVELSESARAGVKASSDWVMDSMSKGTDSYGVTTGF  120

Query  444  GATSHRRTKNGHALQQELIRFLNAGIFGTGT--GHTLPHSA  560
            GATSHRRTKNG ALQ+ELIRFLNAG+FG GT   HTLPHSA
Sbjct  121  GATSHRRTKNGGALQKELIRFLNAGVFGNGTESSHTLPHSA  161



>gb|KJB16792.1| hypothetical protein B456_002G248000 [Gossypium raimondii]
Length=721

 Score =   226 bits (576),  Expect = 5e-66, Method: Compositional matrix adjust.
 Identities = 112/150 (75%), Positives = 123/150 (82%), Gaps = 10/150 (7%)
 Frame = +3

Query  141  NGHSNDFC--------IKVDPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQTLTV  296
            NGH   FC        + VDPLNW +AA+SLKGSHLDEVKRMVAEFR P VK+GG+TLT+
Sbjct  11   NGHLQSFCSTTNGGVGVLVDPLNWGVAAESLKGSHLDEVKRMVAEFRKPLVKLGGETLTI  70

Query  297  AQVAAIAARDNAVKVELSEGARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSHRRTKNG  476
            +QVAAIA RD  VKVELSE ARAGVKAS+DWV++ MN GTDSYGVTTGFGATSHRRTK G
Sbjct  71   SQVAAIATRDLGVKVELSEDARAGVKASADWVLDGMNKGTDSYGVTTGFGATSHRRTKQG  130

Query  477  HALQQELIRFLNAGIFGTGT--GHTLPHSA  560
             ALQ+ELIRFLNAGIFG GT   HTLPHSA
Sbjct  131  AALQKELIRFLNAGIFGNGTESCHTLPHSA  160



>gb|AER12109.1| PAL [Gossypium hirsutum]
Length=721

 Score =   226 bits (576),  Expect = 5e-66, Method: Compositional matrix adjust.
 Identities = 112/150 (75%), Positives = 123/150 (82%), Gaps = 10/150 (7%)
 Frame = +3

Query  141  NGHSNDFC--------IKVDPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQTLTV  296
            NGH   FC        + VDPLNW +AA+SLKGSHLDEVKRMVAEFR P VK+GG+TLT+
Sbjct  11   NGHLQSFCSTTNGGVGVLVDPLNWGVAAESLKGSHLDEVKRMVAEFRKPLVKLGGETLTI  70

Query  297  AQVAAIAARDNAVKVELSEGARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSHRRTKNG  476
            +QVAAIA RD  VKVELSE ARAGVKAS+DWV++ MN GTDSYGVTTGFGATSHRRTK G
Sbjct  71   SQVAAIATRDLGVKVELSEDARAGVKASADWVLDGMNKGTDSYGVTTGFGATSHRRTKQG  130

Query  477  HALQQELIRFLNAGIFGTGT--GHTLPHSA  560
             ALQ+ELIRFLNAGIFG GT   HTLPHSA
Sbjct  131  AALQKELIRFLNAGIFGNGTESCHTLPHSA  160



>ref|XP_006364021.1| PREDICTED: phenylalanine ammonia-lyase-like [Solanum tuberosum]
Length=723

 Score =   226 bits (575),  Expect = 6e-66, Method: Compositional matrix adjust.
 Identities = 116/156 (74%), Positives = 126/156 (81%), Gaps = 15/156 (10%)
 Frame = +3

Query  138  ENGHSN--------DFCIK--VDPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQT  287
            +NGH N        D C K   DPLNWEMAADSL+GSHLDEVK+MV EFR P VK+GG+T
Sbjct  7    QNGHINGEVEEVAMDLCKKSNYDPLNWEMAADSLRGSHLDEVKKMVDEFRKPIVKLGGET  66

Query  288  LTVAQVAAIAARDN---AVKVELSEGARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSH  458
            LTVAQVA+IA  DN    VKVELSE ARAGVKASSDWVM+SM+ GTDSYGVTTGFGATSH
Sbjct  67   LTVAQVASIANVDNKSNGVKVELSESARAGVKASSDWVMDSMSKGTDSYGVTTGFGATSH  126

Query  459  RRTKNGHALQQELIRFLNAGIFGTG--TGHTLPHSA  560
            RRTKNG ALQ+ELIRFLNAG+FG G  T HTLPHSA
Sbjct  127  RRTKNGGALQKELIRFLNAGVFGNGTETSHTLPHSA  162



>gb|AEL21617.1| phenylalanine ammonia lyase 2 [Coffea arabica]
Length=711

 Score =   226 bits (575),  Expect = 6e-66, Method: Compositional matrix adjust.
 Identities = 113/150 (75%), Positives = 125/150 (83%), Gaps = 8/150 (5%)
 Frame = +3

Query  135  IENGHS-----NDFCIKVDPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQTLTVA  299
            +ENGH      ++FC+K DPLNW +AA+SL GSHLDEVKRMVAEFR P VK+GG++LTVA
Sbjct  1    MENGHDEGVKVSEFCLKSDPLNWGVAAESLMGSHLDEVKRMVAEFRKPVVKLGGESLTVA  60

Query  300  QVAAIAAR-DNAVKVELSEGARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSHRRTKNG  476
            QVAAIAA+ D  VKVEL+E ARAGVKASSDWVM SMN GTDSYGVTTGFGATSHRRT  G
Sbjct  61   QVAAIAAKGDQGVKVELAEDARAGVKASSDWVMESMNKGTDSYGVTTGFGATSHRRTNQG  120

Query  477  HALQQELIRFLNAGIFGTG--TGHTLPHSA  560
             ALQ+ELIRFLNAGIFG G  T H LPHSA
Sbjct  121  GALQKELIRFLNAGIFGNGTETCHMLPHSA  150



>gb|AAX84839.1| phenylalanine ammonia-lyase [Astragalus mongholicus]
Length=718

 Score =   226 bits (575),  Expect = 7e-66, Method: Compositional matrix adjust.
 Identities = 117/157 (75%), Positives = 127/157 (81%), Gaps = 11/157 (7%)
 Frame = +3

Query  123  MEGAIENGH-SN-----DFCIKV---DPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKI  275
            MEG   NGH SN     +FCI     DPLNW  AA++LKGSHLDEVKRMV E+RNP VKI
Sbjct  1    MEGEGANGHVSNHATEAEFCISKTGGDPLNWGAAAEALKGSHLDEVKRMVEEYRNPVVKI  60

Query  276  GGQTLTVAQVAAIAARDNAVKVELSEGARAGVKASSDWVMNSMNNGTDSYGVTTGFGATS  455
            GG+TLT+AQVA IA+ D  VKVELSE ARAGVKASSDWVMNSMNNGTDSYGVTTGFGATS
Sbjct  61   GGETLTIAQVAGIASHDGGVKVELSESARAGVKASSDWVMNSMNNGTDSYGVTTGFGATS  120

Query  456  HRRTKNGHALQQELIRFLNAGIFGTGT--GHTLPHSA  560
            HRRT+ G ALQ+ELIRFLNAGIFG GT    TLPH+A
Sbjct  121  HRRTRQGGALQKELIRFLNAGIFGNGTESNCTLPHTA  157



>gb|AIL23235.1| phenylalanine ammonia-lyase [Astragalus chrysochlorus]
Length=719

 Score =   226 bits (575),  Expect = 7e-66, Method: Compositional matrix adjust.
 Identities = 117/157 (75%), Positives = 128/157 (82%), Gaps = 11/157 (7%)
 Frame = +3

Query  123  MEGAIENGH-SN-----DFCIKV---DPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKI  275
            MEG   NGH SN     +FCI     DPLNW +AA+++KGSHLDEVKRMV ++RNP VKI
Sbjct  1    MEGEGANGHVSNNVTEAEFCITKTGGDPLNWGVAAEAMKGSHLDEVKRMVEQYRNPVVKI  60

Query  276  GGQTLTVAQVAAIAARDNAVKVELSEGARAGVKASSDWVMNSMNNGTDSYGVTTGFGATS  455
            GG+TLTVAQVA IA+ D  VKVELSE ARAGVKASSDWVMNSMNNGTDSYGVTTGFGATS
Sbjct  61   GGETLTVAQVAGIASHDGGVKVELSESARAGVKASSDWVMNSMNNGTDSYGVTTGFGATS  120

Query  456  HRRTKNGHALQQELIRFLNAGIFGTGT--GHTLPHSA  560
            HRRTK G ALQ+ELIRFLNAGIFG GT    TLPH+A
Sbjct  121  HRRTKQGGALQKELIRFLNAGIFGNGTESNCTLPHTA  157



>ref|XP_004246649.1| PREDICTED: phenylalanine ammonia-lyase-like isoform X1 [Solanum 
lycopersicum]
Length=721

 Score =   225 bits (574),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 115/155 (74%), Positives = 126/155 (81%), Gaps = 13/155 (8%)
 Frame = +3

Query  135  IENGHSN----DFCIKV----DPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQTL  290
            ++NGH N    D C K     DPLNWEMAA+SL+GSHLDEVK+MV EFR P VK+GG+TL
Sbjct  6    VQNGHVNGEAMDLCKKSINVNDPLNWEMAAESLRGSHLDEVKKMVDEFRKPIVKLGGETL  65

Query  291  TVAQVAAIAARDN---AVKVELSEGARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSHR  461
            TVAQVA+IA  DN    VKVELSE ARAGVKASSDWVM+SM  GTDSYGVTTGFGATSHR
Sbjct  66   TVAQVASIANVDNKSNGVKVELSESARAGVKASSDWVMDSMGKGTDSYGVTTGFGATSHR  125

Query  462  RTKNGHALQQELIRFLNAGIFGTGT--GHTLPHSA  560
            RTKNG ALQ+ELIRFLNAG+FG GT   HTLPHSA
Sbjct  126  RTKNGGALQKELIRFLNAGVFGNGTESSHTLPHSA  160



>ref|XP_004246650.1| PREDICTED: phenylalanine ammonia-lyase-like [Solanum lycopersicum]
Length=721

 Score =   225 bits (574),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 115/155 (74%), Positives = 126/155 (81%), Gaps = 13/155 (8%)
 Frame = +3

Query  135  IENGHSN----DFCIKV----DPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQTL  290
            ++NGH N    D C K     DPLNWEMAA+SL+GSHLDEVK+MV EFR P VK+GG+TL
Sbjct  6    VQNGHVNGEAMDLCKKSINVNDPLNWEMAAESLRGSHLDEVKKMVDEFRKPIVKLGGETL  65

Query  291  TVAQVAAIAARDN---AVKVELSEGARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSHR  461
            TVAQVA+IA  DN    VKVELSE ARAGVKASSDWVM+SM  GTDSYGVTTGFGATSHR
Sbjct  66   TVAQVASIANVDNKSNGVKVELSESARAGVKASSDWVMDSMGKGTDSYGVTTGFGATSHR  125

Query  462  RTKNGHALQQELIRFLNAGIFGTGT--GHTLPHSA  560
            RTKNG ALQ+ELIRFLNAG+FG GT   HTLPHSA
Sbjct  126  RTKNGGALQKELIRFLNAGVFGNGTESSHTLPHSA  160



>sp|P45728.1|PAL2_PETCR RecName: Full=Phenylalanine ammonia-lyase 2 [Petroselinum crispum]
 emb|CAA57056.1| phenylalanine ammonia-lyase 2 [Petroselinum crispum]
Length=716

 Score =   225 bits (573),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 111/150 (74%), Positives = 128/150 (85%), Gaps = 6/150 (4%)
 Frame = +3

Query  129  GAIENGHSN----DFCIKV-DPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQTLT  293
            GAI NGH N    DFC+K  DPL W +AA+++ GSHLDEVK+MVAE+R P VK+GG+TLT
Sbjct  6    GAITNGHVNGNGMDFCMKTEDPLYWGIAAEAMTGSHLDEVKKMVAEYRKPVVKLGGETLT  65

Query  294  VAQVAAIAARD-NAVKVELSEGARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSHRRTK  470
            ++QVAAI+ARD + V VELSE ARAGVKASSDWVM+SMN GTDSYGVTTGFGATSHRRTK
Sbjct  66   ISQVAAISARDGSGVTVELSEAARAGVKASSDWVMDSMNKGTDSYGVTTGFGATSHRRTK  125

Query  471  NGHALQQELIRFLNAGIFGTGTGHTLPHSA  560
             G ALQ+ELIRFLNAGIFG G+ +TLPHSA
Sbjct  126  QGGALQKELIRFLNAGIFGNGSDNTLPHSA  155



>gb|AAK15640.1|AF326116_1 phenylalanine ammonia-lyase [Agastache rugosa]
Length=716

 Score =   225 bits (573),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 111/146 (76%), Positives = 125/146 (86%), Gaps = 6/146 (4%)
 Frame = +3

Query  141  NGH---SNDFCIKV-DPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQTLTVAQVA  308
            NGH   +N FC+K  DPLNW  AA+SLKGSHL+EVKRMV EFR P VK+GG+TLT++QVA
Sbjct  10   NGHNNGANGFCVKQNDPLNWAAAAESLKGSHLEEVKRMVEEFRKPVVKLGGETLTISQVA  69

Query  309  AIAARDNAVKVELSEGARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSHRRTKNGHALQ  488
            AIAA+DNAV VEL+E ARAGVKASSDWVM+SM+ GTDSYGVTTGFGATSHRRTK G ALQ
Sbjct  70   AIAAKDNAVAVELAESARAGVKASSDWVMDSMSKGTDSYGVTTGFGATSHRRTKQGGALQ  129

Query  489  QELIRFLNAGIFGTGT--GHTLPHSA  560
            +ELIRFLNAGIFG  T   HTLPH+A
Sbjct  130  KELIRFLNAGIFGNATESNHTLPHTA  155



>sp|P26600.1|PAL5_SOLLC RecName: Full=Phenylalanine ammonia-lyase; Short=PAL [Solanum 
lycopersicum]
 gb|AAA34176.1| phenylalanine ammonia-lyase [Solanum lycopersicum]
Length=721

 Score =   225 bits (573),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 115/155 (74%), Positives = 126/155 (81%), Gaps = 13/155 (8%)
 Frame = +3

Query  135  IENGHSN----DFCIKV----DPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQTL  290
            ++NGH N    D C K     DPLNWEMAA+SL+GSHLDEVK+MV EFR P VK+GG+TL
Sbjct  6    VQNGHVNGEAMDLCKKSINVNDPLNWEMAAESLRGSHLDEVKKMVDEFRKPIVKLGGETL  65

Query  291  TVAQVAAIAARDN---AVKVELSEGARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSHR  461
            TVAQVA+IA  DN    VKVELSE ARAGVKASSDWVM+SM  GTDSYGVTTGFGATSHR
Sbjct  66   TVAQVASIANVDNKSNGVKVELSESARAGVKASSDWVMDSMGKGTDSYGVTTGFGATSHR  125

Query  462  RTKNGHALQQELIRFLNAGIFGTGT--GHTLPHSA  560
            RTKNG ALQ+ELIRFLNAG+FG GT   HTLPHSA
Sbjct  126  RTKNGGALQKELIRFLNAGVFGNGTESSHTLPHSA  160



>ref|XP_004246651.1| PREDICTED: phenylalanine ammonia-lyase [Solanum lycopersicum]
Length=721

 Score =   225 bits (573),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 115/155 (74%), Positives = 126/155 (81%), Gaps = 13/155 (8%)
 Frame = +3

Query  135  IENGHSN----DFCIKV----DPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQTL  290
            ++NGH N    D C K     DPLNWEMAA+SL+GSHLDEVK+MV EFR P VK+GG+TL
Sbjct  6    VQNGHVNGEAMDLCKKSINVNDPLNWEMAAESLRGSHLDEVKKMVDEFRKPIVKLGGETL  65

Query  291  TVAQVAAIAARDN---AVKVELSEGARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSHR  461
            TVAQVA+IA  DN    VKVELSE ARAGVKASSDWVM+SM  GTDSYGVTTGFGATSHR
Sbjct  66   TVAQVASIANVDNKSNGVKVELSESARAGVKASSDWVMDSMGKGTDSYGVTTGFGATSHR  125

Query  462  RTKNGHALQQELIRFLNAGIFGTGT--GHTLPHSA  560
            RTKNG ALQ+ELIRFLNAG+FG GT   HTLPHSA
Sbjct  126  RTKNGGALQKELIRFLNAGVFGNGTESSHTLPHSA  160



>gb|AGL81344.1| phenylalanine ammonia lyase [Pyrus communis]
Length=720

 Score =   225 bits (573),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 109/149 (73%), Positives = 122/149 (82%), Gaps = 8/149 (5%)
 Frame = +3

Query  138  ENGHSND------FCIKVDPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQTLTVA  299
            +NGH  +       CIK DPLNW +AADSLKGSHLDEVKRMVAE+R P VK+GG++LT++
Sbjct  11   KNGHHQNGAVESPLCIKKDPLNWGLAADSLKGSHLDEVKRMVAEYRKPVVKLGGESLTIS  70

Query  300  QVAAIAARDNAVKVELSEGARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSHRRTKNGH  479
            QVAAIA  D  VKVELSE ARAGVKASSDWVM+SM  GTDSYGVTTGFGATSHRRT  G 
Sbjct  71   QVAAIATHDTGVKVELSESARAGVKASSDWVMDSMGKGTDSYGVTTGFGATSHRRTNKGA  130

Query  480  ALQQELIRFLNAGIFGTGT--GHTLPHSA  560
            ALQ+ELIRFLNAG+FG+ T  GHTLPH A
Sbjct  131  ALQKELIRFLNAGVFGSATESGHTLPHQA  159



>gb|ABB70117.2| phenylalanine ammonia lyase [Pyrus communis]
Length=720

 Score =   225 bits (573),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 109/149 (73%), Positives = 122/149 (82%), Gaps = 8/149 (5%)
 Frame = +3

Query  138  ENGHSND------FCIKVDPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQTLTVA  299
            +NGH  +       CIK DPLNW +AADSLKGSHLDEVKRMVAE+R P VK+GG++LT++
Sbjct  11   KNGHHQNGAVESPLCIKKDPLNWGLAADSLKGSHLDEVKRMVAEYRKPVVKLGGESLTIS  70

Query  300  QVAAIAARDNAVKVELSEGARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSHRRTKNGH  479
            QVAAIA  D  VKVELSE ARAGVKASSDWVM+SM  GTDSYGVTTGFGATSHRRT  G 
Sbjct  71   QVAAIATHDTGVKVELSESARAGVKASSDWVMDSMGKGTDSYGVTTGFGATSHRRTNKGA  130

Query  480  ALQQELIRFLNAGIFGTGT--GHTLPHSA  560
            ALQ+ELIRFLNAG+FG+ T  GHTLPH A
Sbjct  131  ALQKELIRFLNAGVFGSATESGHTLPHQA  159



>gb|AEZ67457.1| phenylalanine ammonia-lyase [Perilla frutescens]
Length=711

 Score =   225 bits (573),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 109/131 (83%), Positives = 116/131 (89%), Gaps = 2/131 (2%)
 Frame = +3

Query  174  DPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQTLTVAQVAAIAARDNAVKVELSE  353
            DPLNW MAA+SLKG HLDEVKRMV EFR P VK+GG+TLT++QVAAIAARDNAV VEL+E
Sbjct  20   DPLNWVMAAESLKGIHLDEVKRMVEEFRKPVVKLGGETLTISQVAAIAARDNAVAVELAE  79

Query  354  GARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSHRRTKNGHALQQELIRFLNAGIFGTG  533
             ARAGVKASSDWVM SMN GTDSYGVTTGFGATSHRRTK G ALQ+ELIRFLNAGIFG G
Sbjct  80   SARAGVKASSDWVMESMNKGTDSYGVTTGFGATSHRRTKQGGALQKELIRFLNAGIFGNG  139

Query  534  T--GHTLPHSA  560
            T   HTLPHSA
Sbjct  140  TESNHTLPHSA  150



>gb|KDP29132.1| hypothetical protein JCGZ_16521 [Jatropha curcas]
Length=713

 Score =   225 bits (573),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 112/152 (74%), Positives = 125/152 (82%), Gaps = 6/152 (4%)
 Frame = +3

Query  123  MEGAIENGHSND----FCIKVDPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQTL  290
            M   I NGH N      CI  DPL+W +AA+S+KGSHLDEVK+MV+E+R P VK+GG+TL
Sbjct  1    MATIIGNGHQNGSLEGLCITRDPLSWGVAAESMKGSHLDEVKKMVSEYRKPLVKLGGETL  60

Query  291  TVAQVAAIAARDNAVKVELSEGARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSHRRTK  470
            TVAQVAAIA+ D  VKVEL+E ARAGVKASSDWVM+SMN GTDSYGVTTGFGATSHRRTK
Sbjct  61   TVAQVAAIASHDAGVKVELAESARAGVKASSDWVMDSMNKGTDSYGVTTGFGATSHRRTK  120

Query  471  NGHALQQELIRFLNAGIFGTG--TGHTLPHSA  560
             G ALQ+ELIRFLNAGIFG G  T HTLPHSA
Sbjct  121  QGAALQRELIRFLNAGIFGNGTETCHTLPHSA  152



>ref|XP_002519521.1| Phenylalanine ammonia-lyase, putative [Ricinus communis]
 gb|EEF42935.1| Phenylalanine ammonia-lyase, putative [Ricinus communis]
Length=714

 Score =   225 bits (573),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 114/153 (75%), Positives = 126/153 (82%), Gaps = 7/153 (5%)
 Frame = +3

Query  123  MEGAIENGHSND----FC-IKVDPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQT  287
            M    ENG  ND    FC +  DPL+W +AA+S+KGSHLDEVK+MVAE+R P VK+GG+T
Sbjct  1    MAAMAENGSKNDSLESFCNMGRDPLSWGLAAESMKGSHLDEVKKMVAEYRKPFVKLGGET  60

Query  288  LTVAQVAAIAARDNAVKVELSEGARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSHRRT  467
            LTVAQVAAIA+ D  VKVELSE ARAGVKASSDWVM+SMN GTDSYGVTTGFGATSHRRT
Sbjct  61   LTVAQVAAIASHDCGVKVELSESARAGVKASSDWVMDSMNKGTDSYGVTTGFGATSHRRT  120

Query  468  KNGHALQQELIRFLNAGIFGTGT--GHTLPHSA  560
            K G ALQ+ELIRFLNAGIFG GT   HTLPHSA
Sbjct  121  KQGGALQKELIRFLNAGIFGNGTESCHTLPHSA  153



>ref|XP_008243955.1| PREDICTED: phenylalanine ammonia-lyase 1 [Prunus mume]
Length=717

 Score =   225 bits (573),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 107/149 (72%), Positives = 126/149 (85%), Gaps = 8/149 (5%)
 Frame = +3

Query  138  ENGHSN------DFCIKVDPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQTLTVA  299
            +NGH N      + CIK DPLNW +AA++LKGSHLDEVKRMVAE+R P VK+GG++LT++
Sbjct  8    QNGHQNGSLESSELCIKKDPLNWGVAAETLKGSHLDEVKRMVAEYRKPVVKLGGESLTIS  67

Query  300  QVAAIAARDNAVKVELSEGARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSHRRTKNGH  479
            QVAAIA  D+ VKVELSE A+AGVKASSDWVM+SM+ GTDSYGVTTGFGATSHRRTK G 
Sbjct  68   QVAAIATHDSGVKVELSESAQAGVKASSDWVMDSMSKGTDSYGVTTGFGATSHRRTKQGA  127

Query  480  ALQQELIRFLNAGIFGT--GTGHTLPHSA  560
            ALQ+ELIRFLNAG+FG+   +GHTLPH A
Sbjct  128  ALQKELIRFLNAGVFGSTKESGHTLPHQA  156



>gb|ABI33979.1| phenylalanine ammonia lyase [Jatropha curcas]
Length=713

 Score =   224 bits (572),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 112/152 (74%), Positives = 125/152 (82%), Gaps = 6/152 (4%)
 Frame = +3

Query  123  MEGAIENGHSND----FCIKVDPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQTL  290
            M   I NGH N      CI  DPL+W +AA+S+KGSHLDEVK+MV+E+R P VK+GG+TL
Sbjct  1    MATIIGNGHQNGSLEGLCITRDPLSWGVAAESMKGSHLDEVKKMVSEYRKPLVKLGGETL  60

Query  291  TVAQVAAIAARDNAVKVELSEGARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSHRRTK  470
            TVAQVAAIA+ D  VKVEL+E ARAGVKASSDWVM+SMN GTDSYGVTTGFGATSHRRTK
Sbjct  61   TVAQVAAIASHDAGVKVELAESARAGVKASSDWVMDSMNKGTDSYGVTTGFGATSHRRTK  120

Query  471  NGHALQQELIRFLNAGIFGTG--TGHTLPHSA  560
             G ALQ+ELIRFLNAGIFG G  T HTLPHSA
Sbjct  121  QGAALQRELIRFLNAGIFGNGTETCHTLPHSA  152



>gb|AHZ30594.1| phenylalanine ammonia lyase-2, partial [Prunus domestica]
Length=701

 Score =   224 bits (572),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 105/140 (75%), Positives = 123/140 (88%), Gaps = 2/140 (1%)
 Frame = +3

Query  147  HSNDFCIKVDPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQTLTVAQVAAIAARD  326
             S++ CIK DPLNW +AA++LKGSHLDEVKRMVAE+R P VK+GG++LT++QVAAIA  D
Sbjct  4    ESSELCIKKDPLNWGVAAETLKGSHLDEVKRMVAEYRKPVVKLGGESLTISQVAAIATHD  63

Query  327  NAVKVELSEGARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSHRRTKNGHALQQELIRF  506
            + VKVELSE ARAGVKASSDWVM+SM+ GTDSYGVTTGFGATSHRRTK G ALQ+ELIRF
Sbjct  64   SGVKVELSESARAGVKASSDWVMDSMSKGTDSYGVTTGFGATSHRRTKQGAALQKELIRF  123

Query  507  LNAGIFGT--GTGHTLPHSA  560
            LNAG+FG+   +GHTLPH A
Sbjct  124  LNAGVFGSTKESGHTLPHQA  143



>ref|XP_008369679.1| PREDICTED: phenylalanine ammonia-lyase 1-like [Malus domestica]
Length=720

 Score =   224 bits (571),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 108/149 (72%), Positives = 121/149 (81%), Gaps = 8/149 (5%)
 Frame = +3

Query  138  ENGH------SNDFCIKVDPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQTLTVA  299
            +NGH       +  CIK DPLNW + ADSLKGSHLDEVKRMVAE+R P VK+GG++LT++
Sbjct  11   QNGHHQNGVSESQLCIKKDPLNWGLVADSLKGSHLDEVKRMVAEYRKPVVKLGGESLTIS  70

Query  300  QVAAIAARDNAVKVELSEGARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSHRRTKNGH  479
            QVAAIA  D  VKVELSE ARAGVKASSDWVM+SM  GTDSYGVTTGFGATSHRRT  G 
Sbjct  71   QVAAIATHDTGVKVELSESARAGVKASSDWVMDSMGKGTDSYGVTTGFGATSHRRTNKGA  130

Query  480  ALQQELIRFLNAGIFGTGT--GHTLPHSA  560
            ALQ+ELIRFLNAG+FG+ T  GHTLPH A
Sbjct  131  ALQKELIRFLNAGVFGSATESGHTLPHQA  159



>ref|XP_008355619.1| PREDICTED: LOW QUALITY PROTEIN: phenylalanine ammonia-lyase 1-like 
[Malus domestica]
Length=720

 Score =   224 bits (571),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 108/149 (72%), Positives = 121/149 (81%), Gaps = 8/149 (5%)
 Frame = +3

Query  138  ENGH------SNDFCIKVDPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQTLTVA  299
            +NGH       +  CIK DPLNW + ADSLKGSHLDEVKRMVAE+R P VK+GG++LT++
Sbjct  11   QNGHHQNGVSESQLCIKKDPLNWGLVADSLKGSHLDEVKRMVAEYRKPVVKLGGESLTIS  70

Query  300  QVAAIAARDNAVKVELSEGARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSHRRTKNGH  479
            QVAAIA  D  VKVELSE ARAGVKASSDWVM+SM  GTDSYGVTTGFGATSHRRT  G 
Sbjct  71   QVAAIATHDTGVKVELSESARAGVKASSDWVMDSMGKGTDSYGVTTGFGATSHRRTNKGA  130

Query  480  ALQQELIRFLNAGIFGTGT--GHTLPHSA  560
            ALQ+ELIRFLNAG+FG+ T  GHTLPH A
Sbjct  131  ALQKELIRFLNAGVFGSATESGHTLPHQA  159



>gb|AGY49231.1| phenylalanine ammonia lyase [Ricinus communis]
Length=714

 Score =   224 bits (570),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 114/153 (75%), Positives = 125/153 (82%), Gaps = 7/153 (5%)
 Frame = +3

Query  123  MEGAIENGHSND----FC-IKVDPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQT  287
            M    ENG  ND    FC    DPL+W +AA+S+KGSHLDEVK+MVAE+R P VK+GG+T
Sbjct  1    MAAMAENGSKNDSLESFCNTGRDPLSWGLAAESMKGSHLDEVKKMVAEYRKPFVKLGGET  60

Query  288  LTVAQVAAIAARDNAVKVELSEGARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSHRRT  467
            LTVAQVAAIA+ D  VKVELSE ARAGVKASSDWVM+SMN GTDSYGVTTGFGATSHRRT
Sbjct  61   LTVAQVAAIASHDCGVKVELSESARAGVKASSDWVMDSMNKGTDSYGVTTGFGATSHRRT  120

Query  468  KNGHALQQELIRFLNAGIFGTGT--GHTLPHSA  560
            K G ALQ+ELIRFLNAGIFG GT   HTLPHSA
Sbjct  121  KQGGALQKELIRFLNAGIFGNGTESCHTLPHSA  153



>gb|ABD42947.1| phenylalanine ammonia lyase [Acacia auriculiformis x Acacia mangium]
Length=714

 Score =   224 bits (570),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 109/144 (76%), Positives = 121/144 (84%), Gaps = 7/144 (5%)
 Frame = +3

Query  150  SNDFCIK-----VDPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQTLTVAQVAAI  314
            ++ FC+       DPLNW +AA+SLKGSHLDEVKRMV EFR P V++GG+TLT++QVAAI
Sbjct  11   ADSFCLSGGVAAADPLNWGVAAESLKGSHLDEVKRMVEEFRKPVVRLGGETLTISQVAAI  70

Query  315  AARDNAVKVELSEGARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSHRRTKNGHALQQE  494
            AA D  VKVELSE ARAGVKASSDWVM+SMN GTDSYGVTTGFGATSHRRTK G ALQ+E
Sbjct  71   AAHDQGVKVELSESARAGVKASSDWVMDSMNKGTDSYGVTTGFGATSHRRTKQGAALQKE  130

Query  495  LIRFLNAGIFGTGT--GHTLPHSA  560
            LIRFLNAGIFG GT   HTLPHSA
Sbjct  131  LIRFLNAGIFGNGTESCHTLPHSA  154



>gb|KGN48161.1| hypothetical protein Csa_6G445740 [Cucumis sativus]
Length=544

 Score =   221 bits (562),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 108/139 (78%), Positives = 117/139 (84%), Gaps = 5/139 (4%)
 Frame = +3

Query  159  FCIKV---DPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQTLTVAQVAAIAARDN  329
            FC      DPLNW +AADSLKGSHLDEVKRMV E+R P VK+GG+TLT++QVAAIA RD 
Sbjct  13   FCTNTTHPDPLNWGLAADSLKGSHLDEVKRMVQEYRRPLVKLGGETLTISQVAAIATRDT  72

Query  330  AVKVELSEGARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSHRRTKNGHALQQELIRFL  509
             V VELSE ARAGVKASSDWVM SMN GTDSYGVTTGFGATSHRRTK G ALQ+ELIRFL
Sbjct  73   DVIVELSESARAGVKASSDWVMESMNKGTDSYGVTTGFGATSHRRTKQGGALQKELIRFL  132

Query  510  NAGIFGTG--TGHTLPHSA  560
            NAGIFG+G  + HTLPHSA
Sbjct  133  NAGIFGSGAESDHTLPHSA  151



>gb|KHG18863.1| Phenylalanine ammonia-lyase [Gossypium arboreum]
Length=720

 Score =   224 bits (570),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 113/159 (71%), Positives = 126/159 (79%), Gaps = 13/159 (8%)
 Frame = +3

Query  123  MEGAIENGHSN----DFCIK-------VDPLNWEMAADSLKGSHLDEVKRMVAEFRNPAV  269
            ME   +NGH       FC         +DPLNW +AA+SLKGSHLDEVKRMVAE+RNP V
Sbjct  1    METITQNGHHKGSLESFCTASKGAGGAIDPLNWGVAAESLKGSHLDEVKRMVAEYRNPLV  60

Query  270  KIGGQTLTVAQVAAIAARDNAVKVELSEGARAGVKASSDWVMNSMNNGTDSYGVTTGFGA  449
            K+GG+TLT++QVAAIA RD  VKVELSE ARAGVKAS+DWV++ MN GTDSYGVTTGFGA
Sbjct  61   KLGGETLTISQVAAIATRDLGVKVELSEDARAGVKASADWVLDGMNKGTDSYGVTTGFGA  120

Query  450  TSHRRTKNGHALQQELIRFLNAGIFGTGT--GHTLPHSA  560
            TSHRRTK G ALQ+ELIRFLNAGIFG GT   HTLPHSA
Sbjct  121  TSHRRTKQGAALQKELIRFLNAGIFGHGTESCHTLPHSA  159



>ref|XP_009794410.1| PREDICTED: phenylalanine ammonia-lyase-like [Nicotiana sylvestris]
Length=717

 Score =   224 bits (570),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 115/148 (78%), Positives = 123/148 (83%), Gaps = 8/148 (5%)
 Frame = +3

Query  141  NGHSN-DFCIK----VDPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQTLTVAQV  305
            NGHS+ +FCIK     DPLNW MAA +L GSHLDEVK+MV EFR PAV++GG+TLTVAQV
Sbjct  9    NGHSSQEFCIKGHQQEDPLNWNMAAAALSGSHLDEVKKMVEEFRKPAVRLGGETLTVAQV  68

Query  306  AAIAARD-NAVKVELSEGARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSHRRTKNGHA  482
            AAIA R    VKVELSEGARAGVKASSDWVM  MN GTDSYGVTTGFGATSHRRTK G A
Sbjct  69   AAIAGRSGTEVKVELSEGARAGVKASSDWVMEGMNKGTDSYGVTTGFGATSHRRTKQGAA  128

Query  483  LQQELIRFLNAGIFGTGT--GHTLPHSA  560
            LQ+ELIRFLNAGIFG GT   HTLPHSA
Sbjct  129  LQKELIRFLNAGIFGNGTESCHTLPHSA  156



>gb|KJB36583.1| hypothetical protein B456_006G166000 [Gossypium raimondii]
Length=720

 Score =   223 bits (569),  Expect = 4e-65, Method: Compositional matrix adjust.
 Identities = 113/159 (71%), Positives = 126/159 (79%), Gaps = 13/159 (8%)
 Frame = +3

Query  123  MEGAIENGHSN----DFCIK-------VDPLNWEMAADSLKGSHLDEVKRMVAEFRNPAV  269
            ME   +NGH       FC         VDPLNW +AA+SLKGSHLDEVKRMVAE+RNP V
Sbjct  1    METITQNGHHKGSLESFCTASKGAGGAVDPLNWGVAAESLKGSHLDEVKRMVAEYRNPLV  60

Query  270  KIGGQTLTVAQVAAIAARDNAVKVELSEGARAGVKASSDWVMNSMNNGTDSYGVTTGFGA  449
            K+GG+TLT++QVAAIA RD  VKVELSE ARAGVKAS+DWV++ MN GTDSYGVTTGFGA
Sbjct  61   KLGGETLTISQVAAIATRDLGVKVELSEDARAGVKASADWVLDGMNKGTDSYGVTTGFGA  120

Query  450  TSHRRTKNGHALQQELIRFLNAGIFGTGT--GHTLPHSA  560
            TSHRRTK G ALQ+ELIRFLNAG+FG GT   HTLPHSA
Sbjct  121  TSHRRTKQGAALQKELIRFLNAGVFGHGTESCHTLPHSA  159



>sp|O04058.2|PALY_HELAN RecName: Full=Phenylalanine ammonia-lyase [Helianthus annuus]
 emb|CAA73065.1| phenylalanine ammonia lyase [Helianthus annuus]
Length=667

 Score =   223 bits (567),  Expect = 4e-65, Method: Compositional matrix adjust.
 Identities = 112/144 (78%), Positives = 122/144 (85%), Gaps = 5/144 (3%)
 Frame = +3

Query  141  NGHSNDFCIKVDPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQTLTVAQVAAIAA  320
            NG +N FCIK DPLNW +AA++L GSHLDEVK+MV EFR P VK+GG+TLTV+QVA I+A
Sbjct  8    NGSANGFCIK-DPLNWGVAAEALTGSHLDEVKKMVGEFRKPVVKLGGETLTVSQVAGISA  66

Query  321  --RDNAVKVELSEGARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSHRRTKNGHALQQE  494
                N VKVELSE ARAGVKASSDWVM SMN GTDSYGVTTGFGATSHRRTKNG ALQ+E
Sbjct  67   AGDGNMVKVELSEAARAGVKASSDWVMESMNKGTDSYGVTTGFGATSHRRTKNGGALQKE  126

Query  495  LIRFLNAGIFGTGT--GHTLPHSA  560
            LIRFLNAGIFG GT   HTLPHSA
Sbjct  127  LIRFLNAGIFGNGTESSHTLPHSA  150



>gb|AIA66448.1| PAL1 [Capsicum annuum]
Length=717

 Score =   223 bits (569),  Expect = 5e-65, Method: Compositional matrix adjust.
 Identities = 113/142 (80%), Positives = 121/142 (85%), Gaps = 7/142 (5%)
 Frame = +3

Query  156  DFCIKV--DPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQTLTVAQVAAIAARDN  329
            D C K   DPLNWEMAA+SLKGSHLDEVK+MV EFR P VK+GG+TLTVAQVA+IA  DN
Sbjct  15   DLCNKSIHDPLNWEMAAESLKGSHLDEVKKMVDEFRKPIVKLGGETLTVAQVASIANADN  74

Query  330  ---AVKVELSEGARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSHRRTKNGHALQQELI  500
                VKVELSE ARAGVKASSDWVM+SM  GTDSYGVTTGFGATSHRRTKNG ALQ+ELI
Sbjct  75   KTCGVKVELSESARAGVKASSDWVMDSMCKGTDSYGVTTGFGATSHRRTKNGGALQKELI  134

Query  501  RFLNAGIFGTGTG--HTLPHSA  560
            RFLNAG+FG GTG  HTLPHSA
Sbjct  135  RFLNAGVFGNGTGSCHTLPHSA  156



>gb|ACF17667.1| putative phenylalanine ammonia-lyase [Capsicum annuum]
Length=717

 Score =   223 bits (569),  Expect = 5e-65, Method: Compositional matrix adjust.
 Identities = 113/142 (80%), Positives = 121/142 (85%), Gaps = 7/142 (5%)
 Frame = +3

Query  156  DFCIKV--DPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQTLTVAQVAAIAARDN  329
            D C K   DPLNWEMAA+SLKGSHLDEVK+MV EFR P VK+GG+TLTVAQVA+IA  DN
Sbjct  15   DLCNKSIHDPLNWEMAAESLKGSHLDEVKKMVDEFRKPIVKLGGETLTVAQVASIANADN  74

Query  330  ---AVKVELSEGARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSHRRTKNGHALQQELI  500
                VKVELSE ARAGVKASSDWVM+SM  GTDSYGVTTGFGATSHRRTKNG ALQ+ELI
Sbjct  75   KTCGVKVELSESARAGVKASSDWVMDSMCKGTDSYGVTTGFGATSHRRTKNGGALQKELI  134

Query  501  RFLNAGIFGTGTG--HTLPHSA  560
            RFLNAG+FG GTG  HTLPHSA
Sbjct  135  RFLNAGVFGNGTGSCHTLPHSA  156



>sp|P24481.1|PAL1_PETCR RecName: Full=Phenylalanine ammonia-lyase 1 [Petroselinum crispum]
 emb|CAA68938.1| PAL1 protein [Petroselinum crispum]
Length=716

 Score =   223 bits (568),  Expect = 5e-65, Method: Compositional matrix adjust.
 Identities = 110/150 (73%), Positives = 127/150 (85%), Gaps = 6/150 (4%)
 Frame = +3

Query  129  GAIENGHSN----DFCIKV-DPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQTLT  293
            GA  NGH N    DFC+K  DPL W +AA+++ GSHLDEVK+MVAE+R P VK+GG+TLT
Sbjct  6    GATTNGHVNGNGMDFCMKTEDPLYWGIAAEAMTGSHLDEVKKMVAEYRKPVVKLGGETLT  65

Query  294  VAQVAAIAARD-NAVKVELSEGARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSHRRTK  470
            ++QVAAI+ARD + V VELSE ARAGVKASSDWVM+SMN GTDSYGVTTGFGATSHRRTK
Sbjct  66   ISQVAAISARDGSGVTVELSEAARAGVKASSDWVMDSMNKGTDSYGVTTGFGATSHRRTK  125

Query  471  NGHALQQELIRFLNAGIFGTGTGHTLPHSA  560
             G ALQ+ELIRFLNAGIFG G+ +TLPHSA
Sbjct  126  QGGALQKELIRFLNAGIFGNGSDNTLPHSA  155



>gb|KHG04887.1| Phenylalanine ammonia-lyase [Gossypium arboreum]
Length=728

 Score =   223 bits (569),  Expect = 5e-65, Method: Compositional matrix adjust.
 Identities = 111/150 (74%), Positives = 122/150 (81%), Gaps = 10/150 (7%)
 Frame = +3

Query  141  NGHSNDFC--------IKVDPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQTLTV  296
            NGH   FC        + VDPLNW +AA+SLKGSHLDEVKRMVAEFR P VK+GG+TLT+
Sbjct  18   NGHLQSFCSATNGGVGVVVDPLNWGVAAESLKGSHLDEVKRMVAEFRKPLVKLGGETLTI  77

Query  297  AQVAAIAARDNAVKVELSEGARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSHRRTKNG  476
            +QVAAIA RD  VKVELSE A AGVKAS+DWV++ MN GTDSYGVTTGFGATSHRRTK G
Sbjct  78   SQVAAIATRDLGVKVELSEDAMAGVKASADWVLDGMNKGTDSYGVTTGFGATSHRRTKQG  137

Query  477  HALQQELIRFLNAGIFGTGT--GHTLPHSA  560
             ALQ+ELIRFLNAGIFG GT   HTLPHSA
Sbjct  138  AALQKELIRFLNAGIFGNGTESCHTLPHSA  167



>dbj|BAF36971.1| phenylalanine ammonia-lyase [Lotus japonicus]
Length=717

 Score =   223 bits (568),  Expect = 5e-65, Method: Compositional matrix adjust.
 Identities = 111/147 (76%), Positives = 122/147 (83%), Gaps = 6/147 (4%)
 Frame = +3

Query  138  ENGHSNDFCIKV----DPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQTLTVAQV  305
            E+ +S+ FC       DPL+W +AADS+KGSHLDEVKRMVAE+R P VK+GG+TLT+AQV
Sbjct  10   ESLNSSIFCTAAKAGSDPLSWGVAADSMKGSHLDEVKRMVAEYRKPVVKLGGETLTIAQV  69

Query  306  AAIAARDNAVKVELSEGARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSHRRTKNGHAL  485
            AAIAA D  V VEL E ARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSHRRTKNG+AL
Sbjct  70   AAIAANDQGVSVELCESARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSHRRTKNGNAL  129

Query  486  QQELIRFLNAGIFGTG--TGHTLPHSA  560
            Q ELIRFLNAGIFG G  T HTLP  A
Sbjct  130  QLELIRFLNAGIFGNGTETSHTLPQPA  156



>ref|XP_006364022.1| PREDICTED: phenylalanine ammonia-lyase-like [Solanum tuberosum]
Length=723

 Score =   223 bits (569),  Expect = 6e-65, Method: Compositional matrix adjust.
 Identities = 112/142 (79%), Positives = 121/142 (85%), Gaps = 7/142 (5%)
 Frame = +3

Query  156  DFCIK--VDPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQTLTVAQVAAIAARDN  329
            D C K   DPLNWEMAADSL+GSHLDEVK+MV EFR P VK+GG+TLTVAQVA+IA  DN
Sbjct  21   DLCKKSNYDPLNWEMAADSLRGSHLDEVKKMVDEFRKPIVKLGGETLTVAQVASIANVDN  80

Query  330  ---AVKVELSEGARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSHRRTKNGHALQQELI  500
                VKVELSE ARAGVKASSDWVM+SM+ GTDSYGVTTGFGATSHRRTKNG ALQ+ELI
Sbjct  81   KSNGVKVELSESARAGVKASSDWVMDSMSKGTDSYGVTTGFGATSHRRTKNGGALQKELI  140

Query  501  RFLNAGIFGTGT--GHTLPHSA  560
            RFLNAG+FG GT   HTLPHSA
Sbjct  141  RFLNAGVFGNGTESSHTLPHSA  162



>ref|XP_004173742.1| PREDICTED: phenylalanine ammonia-lyase-like, partial [Cucumis 
sativus]
Length=144

 Score =   208 bits (529),  Expect = 6e-65, Method: Compositional matrix adjust.
 Identities = 102/143 (71%), Positives = 116/143 (81%), Gaps = 3/143 (2%)
 Frame = +3

Query  132  AIENGHSNDFCIK-VDPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQTLTVAQVA  308
            A +NG     C+K  DPLNW +AA+S+KGSHLDEVKRMV E+R P VK+GG+TLT++QVA
Sbjct  2    ACQNGSLESLCMKGQDPLNWGLAAESMKGSHLDEVKRMVEEYRRPLVKLGGETLTISQVA  61

Query  309  AIAARDNAVKVELSEGARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSHRRTKNGHALQ  488
            AIA RDN V VEL+E ARAGVKASSDWVM SM  GTDSYGVTTGFGATSHRRT  G ALQ
Sbjct  62   AIATRDNDVLVELAESARAGVKASSDWVMESMGKGTDSYGVTTGFGATSHRRTNQGGALQ  121

Query  489  QELIRFLNAGIFGTG--TGHTLP  551
            +ELIRFLN+ IFG G  + HTLP
Sbjct  122  KELIRFLNSDIFGNGSESNHTLP  144



>pdb|1W27|A Chain A, Phenylalanine Ammonia-Lyase (Pal) From Petroselinum 
Crispum
 pdb|1W27|B Chain B, Phenylalanine Ammonia-Lyase (Pal) From Petroselinum 
Crispum
Length=714

 Score =   223 bits (568),  Expect = 6e-65, Method: Compositional matrix adjust.
 Identities = 110/150 (73%), Positives = 127/150 (85%), Gaps = 6/150 (4%)
 Frame = +3

Query  129  GAIENGHSN----DFCIKV-DPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQTLT  293
            GA  NGH N    DFC+K  DPL W +AA+++ GSHLDEVK+MVAE+R P VK+GG+TLT
Sbjct  6    GATTNGHVNGNGMDFCMKTEDPLYWGIAAEAMTGSHLDEVKKMVAEYRKPVVKLGGETLT  65

Query  294  VAQVAAIAARD-NAVKVELSEGARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSHRRTK  470
            ++QVAAI+ARD + V VELSE ARAGVKASSDWVM+SMN GTDSYGVTTGFGATSHRRTK
Sbjct  66   ISQVAAISARDGSGVTVELSEAARAGVKASSDWVMDSMNKGTDSYGVTTGFGATSHRRTK  125

Query  471  NGHALQQELIRFLNAGIFGTGTGHTLPHSA  560
             G ALQ+ELIRFLNAGIFG G+ +TLPHSA
Sbjct  126  QGGALQKELIRFLNAGIFGNGSDNTLPHSA  155



>gb|AHA42445.1| phenylalanine ammonia lyase, partial [Cannabis sativa]
Length=528

 Score =   219 bits (559),  Expect = 6e-65, Method: Compositional matrix adjust.
 Identities = 107/136 (79%), Positives = 118/136 (87%), Gaps = 3/136 (2%)
 Frame = +3

Query  159  FCIKVDPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQTLTVAQVAAIAARDNAVK  338
            FC+K DPLNW +AA+S+ GSHLDEVKRMVAE+R P V +GG+TLT++QVAAIAA D  VK
Sbjct  12   FCVKGDPLNWGLAAESMSGSHLDEVKRMVAEYRKPVVGLGGETLTISQVAAIAAAD-GVK  70

Query  339  VELSEGARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSHRRTKNGHALQQELIRFLNAG  518
            VELSE  RAGVKASSDWVM SMN GTDSYGVTTGFGATSHRRTKNG ALQ+ELIRFLNAG
Sbjct  71   VELSESPRAGVKASSDWVMESMNKGTDSYGVTTGFGATSHRRTKNGGALQKELIRFLNAG  130

Query  519  IFGTGT--GHTLPHSA  560
            IFG GT   HTLPHS+
Sbjct  131  IFGHGTESCHTLPHSS  146



>gb|ACF94716.1| phenylalanine ammonia lyase [Robinia pseudoacacia]
Length=719

 Score =   223 bits (568),  Expect = 6e-65, Method: Compositional matrix adjust.
 Identities = 108/141 (77%), Positives = 120/141 (85%), Gaps = 7/141 (5%)
 Frame = +3

Query  159  FCIKV-----DPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQTLTVAQVAAIAAR  323
             C+K      DPLNW +AA+S+KGSHLDEVKRMV E+RNP V+IGG+TLT++QVAAIA R
Sbjct  18   LCLKSNNTSSDPLNWGVAAESMKGSHLDEVKRMVEEYRNPVVRIGGETLTISQVAAIATR  77

Query  324  DNAVKVELSEGARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSHRRTKNGHALQQELIR  503
            D  V +ELSE ARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSHRRTK G ALQ+ELIR
Sbjct  78   DQDVSLELSESARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSHRRTKQGGALQKELIR  137

Query  504  FLNAGIFGTG--TGHTLPHSA  560
            FLNAGIFG G  + HTLPHSA
Sbjct  138  FLNAGIFGNGAVSCHTLPHSA  158



>gb|AGU91428.1| phenylalanine ammonia-lyase [Chrysanthemum boreale]
Length=709

 Score =   223 bits (568),  Expect = 6e-65, Method: Compositional matrix adjust.
 Identities = 113/149 (76%), Positives = 127/149 (85%), Gaps = 8/149 (5%)
 Frame = +3

Query  135  IENGHSN----DFCIKVDPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQTLTVAQ  302
            ++NGH+N    + CIK DPLNW +AA++L GSHLDEVK+MVAEFR P VK+GG+TLTV+Q
Sbjct  1    MDNGHANGVAKELCIK-DPLNWGVAAEALTGSHLDEVKKMVAEFRKPVVKLGGETLTVSQ  59

Query  303  VAAIAARDNA-VKVELSEGARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSHRRTKNGH  479
            VA IAA +NA VKVEL+E ARAGVKASSDWVM SM  GTDSYGVTTGFGATSHRRTKNG 
Sbjct  60   VAGIAASENAGVKVELAESARAGVKASSDWVMESMGKGTDSYGVTTGFGATSHRRTKNGG  119

Query  480  ALQQELIRFLNAGIFGTGT--GHTLPHSA  560
            ALQ+ELIRFLNAGIFG GT   HTLPHSA
Sbjct  120  ALQKELIRFLNAGIFGNGTESNHTLPHSA  148



>gb|AHY94892.1| phenylalanine ammonia lyase [Prunella vulgaris]
Length=710

 Score =   223 bits (567),  Expect = 7e-65, Method: Compositional matrix adjust.
 Identities = 111/148 (75%), Positives = 125/148 (84%), Gaps = 5/148 (3%)
 Frame = +3

Query  132  AIENGH--SNDFCIK-VDPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQTLTVAQ  302
            A ENGH  SN FC+K  DPLNW  AA+S+ GSHL EVKRMV EFR P V++GG+TLT++Q
Sbjct  2    AAENGHHASNGFCVKQSDPLNWGAAAESMSGSHLQEVKRMVEEFRKPVVRLGGETLTISQ  61

Query  303  VAAIAARDNAVKVELSEGARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSHRRTKNGHA  482
            VAAIAA+DNAV VEL+E ARAGVKASSDWVM+SM+ GT SYGVTTGFGATSHRRTK G A
Sbjct  62   VAAIAAKDNAVAVELAESARAGVKASSDWVMDSMSKGTVSYGVTTGFGATSHRRTKQGGA  121

Query  483  LQQELIRFLNAGIFGTGT--GHTLPHSA  560
            LQ+ELIRFLNAGIFG GT   HTLPH+A
Sbjct  122  LQKELIRFLNAGIFGNGTESSHTLPHTA  149



>gb|AIA24411.1| phenylalanine ammonia-lyase [Sinopodophyllum hexandrum]
Length=709

 Score =   222 bits (566),  Expect = 9e-65, Method: Compositional matrix adjust.
 Identities = 105/136 (77%), Positives = 118/136 (87%), Gaps = 2/136 (1%)
 Frame = +3

Query  159  FCIKVDPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQTLTVAQVAAIAARDNAVK  338
            FCIK DPLNW MAAD+LKGSHLDEVK+MV E+R   V++GG+TLT++QVAA+A+ D  VK
Sbjct  15   FCIKEDPLNWGMAADALKGSHLDEVKKMVKEYRQGVVRLGGETLTISQVAAVASHDQGVK  74

Query  339  VELSEGARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSHRRTKNGHALQQELIRFLNAG  518
            VEL+E ARAGVKASSDWVM SMN GTDSYGVTTGFGATSHRRTK G ALQ+ELIRFLNAG
Sbjct  75   VELNESARAGVKASSDWVMESMNKGTDSYGVTTGFGATSHRRTKQGGALQKELIRFLNAG  134

Query  519  IFGTGTG--HTLPHSA  560
            +FG GT   HTLPHSA
Sbjct  135  VFGNGTESTHTLPHSA  150



>gb|AGT63063.1| phenylalanine ammonia-lyase [Solanum tuberosum]
Length=722

 Score =   222 bits (566),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 115/161 (71%), Positives = 127/161 (79%), Gaps = 15/161 (9%)
 Frame = +3

Query  123  MEGAIENGHSN------DFCIKV----DPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVK  272
            M    +NGH N      + C K     DPLNWEMAA+SL+GSHLDEVK+MV EFR P VK
Sbjct  1    MASIAQNGHVNGEVVAMELCKKSINVDDPLNWEMAAESLRGSHLDEVKKMVDEFRKPIVK  60

Query  273  IGGQTLTVAQVAAIAARDN---AVKVELSEGARAGVKASSDWVMNSMNNGTDSYGVTTGF  443
            +GG+TLTVAQVA+IA  DN    VKVELSE ARAGVKASSDWVM+SM+ GTDSYGVTTGF
Sbjct  61   LGGETLTVAQVASIANADNKSNGVKVELSESARAGVKASSDWVMDSMSKGTDSYGVTTGF  120

Query  444  GATSHRRTKNGHALQQELIRFLNAGIFGTGT--GHTLPHSA  560
            GATSHRRTKNG ALQ+ELIRFLNAG+FG GT   HTLPHSA
Sbjct  121  GATSHRRTKNGGALQKELIRFLNAGVFGNGTESSHTLPHSA  161



>ref|XP_006354337.1| PREDICTED: phenylalanine ammonia-lyase-like isoform X2 [Solanum 
tuberosum]
Length=719

 Score =   222 bits (566),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 114/156 (73%), Positives = 126/156 (81%), Gaps = 15/156 (10%)
 Frame = +3

Query  138  ENGHSN------DFCIKV----DPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQT  287
            +NGH N      + C K     DPLNWEMAADSL+GSHLDEVK+MV EFR P VK+GG+T
Sbjct  3    QNGHINGEVVAMELCKKSINVHDPLNWEMAADSLRGSHLDEVKKMVDEFRKPIVKLGGET  62

Query  288  LTVAQVAAIAARDN---AVKVELSEGARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSH  458
            LTVAQVA+IA  DN    VKVELSE +RAGVKASSDWVM+SM+ GTDSYGVTTGFGATSH
Sbjct  63   LTVAQVASIANADNKSNGVKVELSESSRAGVKASSDWVMDSMSKGTDSYGVTTGFGATSH  122

Query  459  RRTKNGHALQQELIRFLNAGIFGTGT--GHTLPHSA  560
            RRTKNG ALQ+ELIRFLNAG+FG GT   HTLPHSA
Sbjct  123  RRTKNGGALQKELIRFLNAGVFGNGTESSHTLPHSA  158



>ref|XP_006354336.1| PREDICTED: phenylalanine ammonia-lyase-like isoform X1 [Solanum 
tuberosum]
Length=719

 Score =   222 bits (566),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 114/156 (73%), Positives = 126/156 (81%), Gaps = 15/156 (10%)
 Frame = +3

Query  138  ENGHSN------DFCIKV----DPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQT  287
            +NGH N      + C K     DPLNWEMAADSL+GSHLDEVK+MV EFR P VK+GG+T
Sbjct  3    QNGHINGEVVAMELCKKSINVHDPLNWEMAADSLRGSHLDEVKKMVDEFRKPIVKLGGET  62

Query  288  LTVAQVAAIAARDN---AVKVELSEGARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSH  458
            LTVAQVA+IA  DN    VKVELSE +RAGVKASSDWVM+SM+ GTDSYGVTTGFGATSH
Sbjct  63   LTVAQVASIANADNKSNGVKVELSESSRAGVKASSDWVMDSMSKGTDSYGVTTGFGATSH  122

Query  459  RRTKNGHALQQELIRFLNAGIFGTGT--GHTLPHSA  560
            RRTKNG ALQ+ELIRFLNAG+FG GT   HTLPHSA
Sbjct  123  RRTKNGGALQKELIRFLNAGVFGNGTELSHTLPHSA  158



>ref|XP_004143356.1| PREDICTED: phenylalanine ammonia-lyase-like [Cucumis sativus]
 ref|XP_004156338.1| PREDICTED: phenylalanine ammonia-lyase-like [Cucumis sativus]
Length=717

 Score =   222 bits (566),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 108/145 (74%), Positives = 121/145 (83%), Gaps = 4/145 (3%)
 Frame = +3

Query  138  ENGHSNDFCIK--VDPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQTLTVAQVAA  311
            +NG    FC    VDPLNW +AA++LKGSHLDEVKRMV E+R P VK+GG+TLT++QVAA
Sbjct  12   QNGSMESFCTSHVVDPLNWGVAAEALKGSHLDEVKRMVDEYRRPVVKLGGETLTISQVAA  71

Query  312  IAARDNAVKVELSEGARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSHRRTKNGHALQQ  491
            IA RDN V V+L+E ARAGVKASSDWVM SMN GTDSYGVTTGFGATSHRRTK G ALQ+
Sbjct  72   IATRDNDVVVKLAESARAGVKASSDWVMESMNKGTDSYGVTTGFGATSHRRTKQGGALQK  131

Query  492  ELIRFLNAGIFGTG--TGHTLPHSA  560
            ELIRFLNAGIFG G  + HTLPHSA
Sbjct  132  ELIRFLNAGIFGNGAESNHTLPHSA  156



>gb|KGN48164.1| hypothetical protein Csa_6G445770 [Cucumis sativus]
Length=717

 Score =   222 bits (566),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 108/145 (74%), Positives = 121/145 (83%), Gaps = 4/145 (3%)
 Frame = +3

Query  138  ENGHSNDFCIK--VDPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQTLTVAQVAA  311
            +NG    FC    VDPLNW +AA++LKGSHLDEVKRMV E+R P VK+GG+TLT++QVAA
Sbjct  12   QNGSMESFCTSHVVDPLNWGVAAEALKGSHLDEVKRMVDEYRRPVVKLGGETLTISQVAA  71

Query  312  IAARDNAVKVELSEGARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSHRRTKNGHALQQ  491
            IA RDN V V+L+E ARAGVKASSDWVM SMN GTDSYGVTTGFGATSHRRTK G ALQ+
Sbjct  72   IATRDNDVVVKLAESARAGVKASSDWVMESMNKGTDSYGVTTGFGATSHRRTKQGGALQK  131

Query  492  ELIRFLNAGIFGTG--TGHTLPHSA  560
            ELIRFLNAGIFG G  + HTLPHSA
Sbjct  132  ELIRFLNAGIFGNGAESNHTLPHSA  156



>gb|KGN48166.1| hypothetical protein Csa_6G446280 [Cucumis sativus]
Length=166

 Score =   207 bits (528),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 103/131 (79%), Positives = 112/131 (85%), Gaps = 2/131 (2%)
 Frame = +3

Query  174  DPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQTLTVAQVAAIAARDNAVKVELSE  353
            DPLNW +AA+SLKGSHLDEVKRMV E+R P VK+GG+TLT++QVAAIA RD  V VELSE
Sbjct  14   DPLNWGVAAESLKGSHLDEVKRMVEEYRRPLVKLGGETLTISQVAAIATRDFDVTVELSE  73

Query  354  GARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSHRRTKNGHALQQELIRFLNAGIFGTG  533
             ARAGVKASSDWVM SM  GTDSYGVTTGFGATSHRRTKNG ALQ+ELIRFLNAGIFG G
Sbjct  74   SARAGVKASSDWVMESMKKGTDSYGVTTGFGATSHRRTKNGGALQKELIRFLNAGIFGNG  133

Query  534  --TGHTLPHSA  560
              + HTL  SA
Sbjct  134  AESCHTLSRSA  144



>ref|XP_003521397.1| PREDICTED: phenylalanine ammonia-lyase 1-like [Glycine max]
Length=713

 Score =   222 bits (565),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 108/148 (73%), Positives = 122/148 (82%), Gaps = 8/148 (5%)
 Frame = +3

Query  141  NGHSN-DFCIKV-----DPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQTLTVAQ  302
            NGH N  FC+       DPLNW  AA+++KGSHLDEVKRMVAE+R P V++GG+TLT+AQ
Sbjct  5    NGHQNGSFCLSTAKGSSDPLNWGAAAEAMKGSHLDEVKRMVAEYRKPVVRLGGETLTIAQ  64

Query  303  VAAIAARDNAVKVELSEGARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSHRRTKNGHA  482
            VAA+A  D+ V VELSE AR GVKASS+WVMNSMNNGTDSYGVTTGFGATSHRRTK G A
Sbjct  65   VAAVAGHDHGVAVELSESAREGVKASSEWVMNSMNNGTDSYGVTTGFGATSHRRTKQGGA  124

Query  483  LQQELIRFLNAGIFGTGT--GHTLPHSA  560
            LQ+ELIRFLNAGIFG GT   HTLPH+A
Sbjct  125  LQKELIRFLNAGIFGNGTESSHTLPHTA  152



>gb|AAZ29733.1| phenylalanine ammonia lyase [Trifolium pratense]
Length=712

 Score =   222 bits (565),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 114/152 (75%), Positives = 125/152 (82%), Gaps = 7/152 (5%)
 Frame = +3

Query  123  MEGAIENGHSN-DFCIKV---DPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQTL  290
            MEG I NGH+   FC+     DPLNW  AA+SL GSHLDEVKRMV E+RNP VKIGG TL
Sbjct  1    MEG-ITNGHAEATFCVTKSVGDPLNWGAAAESLTGSHLDEVKRMVEEYRNPLVKIGGATL  59

Query  291  TVAQVAAIAARDNAVKVELSEGARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSHRRTK  470
            T+AQVA IA+ D+ V+VELSE ARAGVKASSDWVM+SMNNGTDSYGVTTGFGATSHRRTK
Sbjct  60   TIAQVAGIASHDSGVRVELSESARAGVKASSDWVMDSMNNGTDSYGVTTGFGATSHRRTK  119

Query  471  NGHALQQELIRFLNAGIFGTGT--GHTLPHSA  560
             G ALQ+ELIRFLNAGIFG GT    TLPH+A
Sbjct  120  QGGALQKELIRFLNAGIFGNGTESNCTLPHTA  151



>sp|P27991.1|PAL1_SOYBN RecName: Full=Phenylalanine ammonia-lyase 1 [Glycine max]
 emb|CAA37129.1| phenylalanine ammonia-lyase [Glycine max]
Length=713

 Score =   222 bits (565),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 108/148 (73%), Positives = 122/148 (82%), Gaps = 8/148 (5%)
 Frame = +3

Query  141  NGHSN-DFCIKV-----DPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQTLTVAQ  302
            NGH N  FC+       DPLNW  AA+++KGSHLDEVKRMVAE+R P V++GG+TLT+AQ
Sbjct  5    NGHQNGSFCLSTAKGNNDPLNWGAAAEAMKGSHLDEVKRMVAEYRKPVVRLGGETLTIAQ  64

Query  303  VAAIAARDNAVKVELSEGARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSHRRTKNGHA  482
            VAA+A  D+ V VELSE AR GVKASS+WVMNSMNNGTDSYGVTTGFGATSHRRTK G A
Sbjct  65   VAAVAGHDHGVAVELSESAREGVKASSEWVMNSMNNGTDSYGVTTGFGATSHRRTKQGGA  124

Query  483  LQQELIRFLNAGIFGTGT--GHTLPHSA  560
            LQ+ELIRFLNAGIFG GT   HTLPH+A
Sbjct  125  LQKELIRFLNAGIFGNGTESSHTLPHTA  152



>dbj|BAE71252.1| putative phenylalanine ammonia lyase [Trifolium pratense]
Length=712

 Score =   221 bits (564),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 114/152 (75%), Positives = 125/152 (82%), Gaps = 7/152 (5%)
 Frame = +3

Query  123  MEGAIENGHSN-DFCIKV---DPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQTL  290
            MEG I NGH+   FC+     DPLNW  AA+SL GSHLDEVKRMV E+RNP VKIGG TL
Sbjct  1    MEG-ITNGHAEATFCVTKSVGDPLNWGAAAESLTGSHLDEVKRMVEEYRNPLVKIGGATL  59

Query  291  TVAQVAAIAARDNAVKVELSEGARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSHRRTK  470
            T+AQVA IA+ D+ V+VELSE ARAGVKASSDWVM+SMNNGTDSYGVTTGFGATSHRRTK
Sbjct  60   TIAQVAGIASHDSGVRVELSESARAGVKASSDWVMDSMNNGTDSYGVTTGFGATSHRRTK  119

Query  471  NGHALQQELIRFLNAGIFGTGT--GHTLPHSA  560
             G ALQ+ELIRFLNAGIFG GT    TLPH+A
Sbjct  120  QGGALQKELIRFLNAGIFGNGTESNCTLPHTA  151



>ref|XP_006424540.1| hypothetical protein CICLE_v10027912mg [Citrus clementina]
 gb|ESR37780.1| hypothetical protein CICLE_v10027912mg [Citrus clementina]
Length=714

 Score =   221 bits (564),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 105/142 (74%), Positives = 120/142 (85%), Gaps = 2/142 (1%)
 Frame = +3

Query  141  NGHSNDFCIKVDPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQTLTVAQVAAIAA  320
            N  S   C  +DPLNW  A++SLKGSHLDEVKRMV+E+R P V++GG+TLT+AQVAA+A+
Sbjct  12   NIPSGKLCTNIDPLNWVSASESLKGSHLDEVKRMVSEYRKPVVRLGGETLTIAQVAAVAS  71

Query  321  RDNAVKVELSEGARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSHRRTKNGHALQQELI  500
            RD+ V VEL+E ARAGVKASSDWVM SMNNGTDSYGVTTGFGATSHRRTK G ALQ+ELI
Sbjct  72   RDDGVTVELNEEARAGVKASSDWVMESMNNGTDSYGVTTGFGATSHRRTKQGAALQKELI  131

Query  501  RFLNAGIFGTGT--GHTLPHSA  560
            RFLNAGIFG GT   H LPH+A
Sbjct  132  RFLNAGIFGKGTESCHMLPHTA  153



>ref|XP_006424538.1| hypothetical protein CICLE_v10027913mg [Citrus clementina]
 gb|ESR37778.1| hypothetical protein CICLE_v10027913mg [Citrus clementina]
Length=714

 Score =   221 bits (564),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 105/142 (74%), Positives = 120/142 (85%), Gaps = 2/142 (1%)
 Frame = +3

Query  141  NGHSNDFCIKVDPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQTLTVAQVAAIAA  320
            N  S   C  +DPLNW  A++SLKGSHLDEVKRMV+E+R P V++GG+TLT+AQVAA+A+
Sbjct  12   NIPSGKLCTNIDPLNWVSASESLKGSHLDEVKRMVSEYRKPVVRLGGETLTIAQVAAVAS  71

Query  321  RDNAVKVELSEGARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSHRRTKNGHALQQELI  500
            RD+ V VEL+E ARAGVKASSDWVM SMNNGTDSYGVTTGFGATSHRRTK G ALQ+ELI
Sbjct  72   RDDGVTVELNEEARAGVKASSDWVMESMNNGTDSYGVTTGFGATSHRRTKQGAALQKELI  131

Query  501  RFLNAGIFGTGT--GHTLPHSA  560
            RFLNAGIFG GT   H LPH+A
Sbjct  132  RFLNAGIFGKGTESCHMLPHTA  153



>emb|CAL91169.1| phenylalanine ammonia-lyase 3 [Cynara cardunculus var. scolymus]
Length=713

 Score =   221 bits (564),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 110/144 (76%), Positives = 122/144 (85%), Gaps = 4/144 (3%)
 Frame = +3

Query  141  NGHSNDFCIKVDPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQTLTVAQVAAIAA  320
            NG + DFCI  DPLNW +AA+++ GSHLDEVKRMVAEFR P VK+GG+TLTV+QVA IAA
Sbjct  9    NGVATDFCINKDPLNWGVAAEAMTGSHLDEVKRMVAEFRKPVVKLGGETLTVSQVAGIAA  68

Query  321  RDNA--VKVELSEGARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSHRRTKNGHALQQE  494
              ++  VKVELSE ARAGVKASSDWVM SM+ GTDSYGVTTGFGATSHRRTK G ALQ+E
Sbjct  69   AGDSSVVKVELSEAARAGVKASSDWVMESMSKGTDSYGVTTGFGATSHRRTKQGGALQKE  128

Query  495  LIRFLNAGIFGTGT--GHTLPHSA  560
            LIRFLNAGIFG GT   HTLPHSA
Sbjct  129  LIRFLNAGIFGNGTESCHTLPHSA  152



>emb|CAA44609.1| phenylalanine ammonia-lyase [Arabidopsis thaliana]
Length=240

 Score =   209 bits (533),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 103/131 (79%), Positives = 112/131 (85%), Gaps = 2/131 (2%)
 Frame = +3

Query  174  DPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQTLTVAQVAAIAARDNAVKVELSE  353
            DPLNW  AA+ +KGSHLDEVKRMVAEFR P V +GG+TLT+ QVAAI+   N+VKVELSE
Sbjct  34   DPLNWGAAAEQMKGSHLDEVKRMVAEFRKPVVNLGGETLTIGQVAAISTIGNSVKVELSE  93

Query  354  GARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSHRRTKNGHALQQELIRFLNAGIFGTG  533
             ARAGV ASSDWVM SMN GTDSYGVTTGFGATSHRRTKNG ALQ+ELIRFLNAGIFG+ 
Sbjct  94   TARAGVNASSDWVMESMNKGTDSYGVTTGFGATSHRRTKNGVALQKELIRFLNAGIFGST  153

Query  534  --TGHTLPHSA  560
              T HTLPHSA
Sbjct  154  KETSHTLPHSA  164



>ref|XP_009373523.1| PREDICTED: LOW QUALITY PROTEIN: phenylalanine ammonia-lyase 1-like 
[Pyrus x bretschneideri]
Length=719

 Score =   221 bits (563),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 107/148 (72%), Positives = 119/148 (80%), Gaps = 7/148 (5%)
 Frame = +3

Query  138  ENGHSN-----DFCIKVDPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQTLTVAQ  302
            +NGH N       CIK  PLNW + ADSLKGSHLDEVKRMVAE+R P VK+GG++LT++Q
Sbjct  11   QNGHQNGVSESPLCIKKAPLNWGLVADSLKGSHLDEVKRMVAEYRKPVVKLGGESLTISQ  70

Query  303  VAAIAARDNAVKVELSEGARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSHRRTKNGHA  482
            VAAIA  D  VKVELSE ARAGVKASSDWVM+SM  GTDSYGV TGFGATSHRRT  G A
Sbjct  71   VAAIATHDTGVKVELSESARAGVKASSDWVMDSMGKGTDSYGVPTGFGATSHRRTNKGAA  130

Query  483  LQQELIRFLNAGIFGTGT--GHTLPHSA  560
            LQ+ELIRFLNAG+FG+ T  GHTLPH A
Sbjct  131  LQKELIRFLNAGVFGSATESGHTLPHQA  158



>ref|XP_004234632.2| PREDICTED: phenylalanine ammonia-lyase [Solanum lycopersicum]
Length=720

 Score =   221 bits (562),  Expect = 4e-64, Method: Compositional matrix adjust.
 Identities = 113/153 (74%), Positives = 125/153 (82%), Gaps = 12/153 (8%)
 Frame = +3

Query  138  ENGHSN-----DFCIKV--DPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQTLTV  296
            +NGH N     D C K   DPLNWEMAADSL+GSHLDEVK+MV EFR P VK+GG+TL+V
Sbjct  7    QNGHINGEVAMDLCKKSINDPLNWEMAADSLRGSHLDEVKKMVDEFRKPIVKLGGETLSV  66

Query  297  AQVAAIAARD---NAVKVELSEGARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSHRRT  467
            AQVA+IA  D   N VKVELSE ARAGVKASSDWVM+SM+ GTDSYGVT GFGATSHRRT
Sbjct  67   AQVASIANVDDKSNGVKVELSESARAGVKASSDWVMDSMSKGTDSYGVTAGFGATSHRRT  126

Query  468  KNGHALQQELIRFLNAGIFGTG--TGHTLPHSA  560
            KNG ALQ+ELIRFLNAG+FG G  + HTLPHSA
Sbjct  127  KNGGALQKELIRFLNAGVFGNGIESFHTLPHSA  159



>gb|ACT53398.1| phenylalanine ammonia-lyase 1 [Ageratina adenophora]
Length=715

 Score =   221 bits (562),  Expect = 4e-64, Method: Compositional matrix adjust.
 Identities = 115/153 (75%), Positives = 128/153 (84%), Gaps = 9/153 (6%)
 Frame = +3

Query  129  GAIE-NGHSN---DFCIKVDPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQTLTV  296
            G+IE NG  N    FC+K DPLNW + A+SLKGSHLDEVKRMV EFRNP VK+GG+TLTV
Sbjct  2    GSIEFNGDQNIDNYFCVKGDPLNWGVVAESLKGSHLDEVKRMVTEFRNPVVKLGGETLTV  61

Query  297  AQVAAIA--ARDNA-VKVELSEGARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSHRRT  467
            +QVAAIA  A D++ +KVELSE AR GVKASS+WVM SMN GTDSYGVTTGFGATSHRRT
Sbjct  62   SQVAAIAVAATDSSNIKVELSESAREGVKASSEWVMESMNKGTDSYGVTTGFGATSHRRT  121

Query  468  KNGHALQQELIRFLNAGIFGTGT--GHTLPHSA  560
            K G ALQ+ELIRFLNAGIFG+GT   HTLPHSA
Sbjct  122  KEGGALQKELIRFLNAGIFGSGTESSHTLPHSA  154



>ref|XP_004156293.1| PREDICTED: LOW QUALITY PROTEIN: phenylalanine ammonia-lyase-like 
[Cucumis sativus]
Length=712

 Score =   221 bits (562),  Expect = 5e-64, Method: Compositional matrix adjust.
 Identities = 110/146 (75%), Positives = 120/146 (82%), Gaps = 8/146 (5%)
 Frame = +3

Query  147  HSND---FCIKV---DPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQTLTVAQVA  308
             +ND   FC      DPLNW +AADSLKGSHLDEVKRMV E+R P VK+GG+TLT++QVA
Sbjct  6    QTNDDSSFCTNTTHPDPLNWGLAADSLKGSHLDEVKRMVQEYRRPLVKLGGETLTISQVA  65

Query  309  AIAARDNAVKVELSEGARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSHRRTKNGHALQ  488
            AIA RD  V VELSE ARAGVKASSDWVM SMN GTDSYGVTTGFGATSHRRTK G ALQ
Sbjct  66   AIATRDTDVIVELSESARAGVKASSDWVMESMNKGTDSYGVTTGFGATSHRRTKQGGALQ  125

Query  489  QELIRFLNAGIFGTG--TGHTLPHSA  560
            +ELIRFLNAGIFG+G  + HTLPHSA
Sbjct  126  KELIRFLNAGIFGSGAESDHTLPHSA  151



>ref|XP_004143256.1| PREDICTED: phenylalanine ammonia-lyase-like [Cucumis sativus]
Length=712

 Score =   221 bits (562),  Expect = 5e-64, Method: Compositional matrix adjust.
 Identities = 110/146 (75%), Positives = 120/146 (82%), Gaps = 8/146 (5%)
 Frame = +3

Query  147  HSND---FCIKV---DPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQTLTVAQVA  308
             +ND   FC      DPLNW +AADSLKGSHLDEVKRMV E+R P VK+GG+TLT++QVA
Sbjct  6    QTNDDSSFCTNTTHPDPLNWGLAADSLKGSHLDEVKRMVQEYRRPLVKLGGETLTISQVA  65

Query  309  AIAARDNAVKVELSEGARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSHRRTKNGHALQ  488
            AIA RD  V VELSE ARAGVKASSDWVM SMN GTDSYGVTTGFGATSHRRTK G ALQ
Sbjct  66   AIATRDTDVIVELSESARAGVKASSDWVMESMNKGTDSYGVTTGFGATSHRRTKQGGALQ  125

Query  489  QELIRFLNAGIFGTG--TGHTLPHSA  560
            +ELIRFLNAGIFG+G  + HTLPHSA
Sbjct  126  KELIRFLNAGIFGSGAESDHTLPHSA  151



>gb|AAL55242.1|AF299330_1 phenylalanine ammonia-lyase [Lactuca sativa]
Length=711

 Score =   220 bits (561),  Expect = 5e-64, Method: Compositional matrix adjust.
 Identities = 111/144 (77%), Positives = 123/144 (85%), Gaps = 5/144 (3%)
 Frame = +3

Query  141  NGHSNDFCIKVDPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQTLTVAQVAAIAA  320
            NG  N+ CIK DPLNW +AA++L GSHLDEVK+MVAEFR P VK+GG+TLTV+QVA IAA
Sbjct  8    NGVVNELCIK-DPLNWGVAAEALTGSHLDEVKKMVAEFRKPVVKLGGETLTVSQVAGIAA  66

Query  321  RDNA--VKVELSEGARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSHRRTKNGHALQQE  494
             +++  VKVELSE ARAGVKASSDWVM SMN GTDSYGVTTGFGATSHRRTK G ALQ+E
Sbjct  67   ANDSDTVKVELSEAARAGVKASSDWVMESMNKGTDSYGVTTGFGATSHRRTKQGGALQKE  126

Query  495  LIRFLNAGIFGTG--TGHTLPHSA  560
            LIRFLNAGIFG G  T HTLPHSA
Sbjct  127  LIRFLNAGIFGNGTETSHTLPHSA  150



>gb|AGV54597.1| phenylalanine ammonia-lyase [Phaseolus vulgaris]
Length=714

 Score =   220 bits (561),  Expect = 6e-64, Method: Compositional matrix adjust.
 Identities = 105/148 (71%), Positives = 121/148 (82%), Gaps = 6/148 (4%)
 Frame = +3

Query  135  IENGHSNDFCIK----VDPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQTLTVAQ  302
            + N  +  FC+      DPLNW  AA++LKGSHLDEVKRMVAE+R P V++GG+TLT+AQ
Sbjct  6    LTNAQNGSFCLPSAKTTDPLNWGTAAEALKGSHLDEVKRMVAEYRQPLVRLGGETLTIAQ  65

Query  303  VAAIAARDNAVKVELSEGARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSHRRTKNGHA  482
            VAA++  D  V+VELSE AR GVKASS+WVMNSMNNGTDSYGVTTGFGATSHRRTK G A
Sbjct  66   VAAVSGHDQGVRVELSESAREGVKASSEWVMNSMNNGTDSYGVTTGFGATSHRRTKQGGA  125

Query  483  LQQELIRFLNAGIFGTGT--GHTLPHSA  560
            LQ+ELIRFLNAGIFG GT   HTLPH+A
Sbjct  126  LQKELIRFLNAGIFGNGTESSHTLPHTA  153



>ref|XP_007162756.1| hypothetical protein PHAVU_001G177800g [Phaseolus vulgaris]
 gb|ESW34750.1| hypothetical protein PHAVU_001G177800g [Phaseolus vulgaris]
Length=714

 Score =   220 bits (561),  Expect = 6e-64, Method: Compositional matrix adjust.
 Identities = 105/148 (71%), Positives = 121/148 (82%), Gaps = 6/148 (4%)
 Frame = +3

Query  135  IENGHSNDFCIK----VDPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQTLTVAQ  302
            + N  +  FC+      DPLNW  AA++LKGSHLDEVKRMVAE+R P V++GG+TLT+AQ
Sbjct  6    LTNAQNGSFCLPSAKTTDPLNWGTAAEALKGSHLDEVKRMVAEYRQPLVRLGGETLTIAQ  65

Query  303  VAAIAARDNAVKVELSEGARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSHRRTKNGHA  482
            VAA++  D  V+VELSE AR GVKASS+WVMNSMNNGTDSYGVTTGFGATSHRRTK G A
Sbjct  66   VAAVSGHDQGVRVELSESAREGVKASSEWVMNSMNNGTDSYGVTTGFGATSHRRTKQGGA  125

Query  483  LQQELIRFLNAGIFGTGT--GHTLPHSA  560
            LQ+ELIRFLNAGIFG GT   HTLPH+A
Sbjct  126  LQKELIRFLNAGIFGNGTESSHTLPHTA  153



>ref|XP_003554382.1| PREDICTED: phenylalanine ammonia-lyase 1-like isoform 1 [Glycine 
max]
Length=712

 Score =   220 bits (560),  Expect = 7e-64, Method: Compositional matrix adjust.
 Identities = 107/147 (73%), Positives = 122/147 (83%), Gaps = 7/147 (5%)
 Frame = +3

Query  141  NGHSN-DFCIKV----DPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQTLTVAQV  305
            NGH N  FC+      DPLNW  AA+++KGSHLDEVKRMV+E+R P V++GG+TLT+AQV
Sbjct  5    NGHQNGSFCLSSTKGSDPLNWGAAAEAMKGSHLDEVKRMVSEYRKPVVRLGGETLTIAQV  64

Query  306  AAIAARDNAVKVELSEGARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSHRRTKNGHAL  485
            AA+A  D+ V VELSE AR GVKASS+WVMNSMNNGTDSYGVTTGFGATSHRRTK G AL
Sbjct  65   AAVAGHDHGVTVELSESAREGVKASSEWVMNSMNNGTDSYGVTTGFGATSHRRTKQGGAL  124

Query  486  QQELIRFLNAGIFGTGT--GHTLPHSA  560
            Q+ELIRFLNAGIFG GT   HTLPH+A
Sbjct  125  QKELIRFLNAGIFGNGTESSHTLPHTA  151



>dbj|BAC56977.1| phenylalanine ammonia-lyase [Daucus carota]
Length=715

 Score =   220 bits (561),  Expect = 7e-64, Method: Compositional matrix adjust.
 Identities = 109/146 (75%), Positives = 127/146 (87%), Gaps = 5/146 (3%)
 Frame = +3

Query  138  ENGHSNDFCIKV-DPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQTLTVAQVAAI  314
            ENG+  D C+K  DPL+W +AA++LKGSHL+EVKRMVAE+R P VK+GG+TLT++QVAAI
Sbjct  9    ENGNGVDLCMKKEDPLSWGVAAEALKGSHLEEVKRMVAEYRKPVVKLGGETLTISQVAAI  68

Query  315  AARDNA-VKVELSEGARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSHRRTKNGHALQQ  491
            +ARD++ VKVELSE ARAGVKASSDWVM SMN GTDSYGVTTGFGATSHRRTK G ALQ+
Sbjct  69   SARDDSGVKVELSEAARAGVKASSDWVMESMNKGTDSYGVTTGFGATSHRRTKQGGALQK  128

Query  492  ELIRFLNAGIFGTGT---GHTLPHSA  560
            ELIRFLNAGIFG+G     +TLPHSA
Sbjct  129  ELIRFLNAGIFGSGAEAGNNTLPHSA  154



>gb|ABL14040.1| phenylalanine ammonia lyase, partial [Astragalus mongholicus]
Length=274

 Score =   209 bits (533),  Expect = 7e-64, Method: Compositional matrix adjust.
 Identities = 109/156 (70%), Positives = 124/156 (79%), Gaps = 9/156 (6%)
 Frame = +3

Query  120  TMEGAIENG--HSND--FCIKV---DPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIG  278
            T EGA  N   H+N+  FCI+    DP NW +AA++LKGSHLDEVKRMV E+R P V+IG
Sbjct  2    TGEGANGNAKNHANEVEFCIRETRGDPFNWGVAAEALKGSHLDEVKRMVEEYRKPVVRIG  61

Query  279  GQTLTVAQVAAIAARDNAVKVELSEGARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSH  458
            G+TLT++QVAAIA  D  VKV+LSE AR GVKASSDWVM SMN GTDSYGVTTGFGATSH
Sbjct  62   GETLTISQVAAIAGHDQGVKVDLSESARDGVKASSDWVMESMNKGTDSYGVTTGFGATSH  121

Query  459  RRTKNGHALQQELIRFLNAGIFGTG--TGHTLPHSA  560
            RRTK G ALQ+ELIRFLNAGIFG G  T  TLP++A
Sbjct  122  RRTKQGGALQKELIRFLNAGIFGNGTETSCTLPNTA  157



>ref|XP_004143258.1| PREDICTED: phenylalanine ammonia-lyase-like [Cucumis sativus]
 ref|XP_004156291.1| PREDICTED: phenylalanine ammonia-lyase-like [Cucumis sativus]
 gb|KGN48163.1| hypothetical protein Csa_6G445760 [Cucumis sativus]
Length=713

 Score =   220 bits (560),  Expect = 8e-64, Method: Compositional matrix adjust.
 Identities = 108/144 (75%), Positives = 120/144 (83%), Gaps = 3/144 (2%)
 Frame = +3

Query  138  ENGHSNDFCI-KVDPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQTLTVAQVAAI  314
            +NG     CI   DPLNW +AA+SLKGSHLDEVKRMV E+R P VK+GG+TLT++QVAAI
Sbjct  9    KNGSVESLCIGSNDPLNWGVAAESLKGSHLDEVKRMVEEYRRPLVKLGGETLTISQVAAI  68

Query  315  AARDNAVKVELSEGARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSHRRTKNGHALQQE  494
            A RD  V VELSE +RAGVKASSDWVM SMN GTDSYGVTTGFGATSHRRTK G ALQ+E
Sbjct  69   ATRDTDVIVELSESSRAGVKASSDWVMESMNKGTDSYGVTTGFGATSHRRTKQGGALQKE  128

Query  495  LIRFLNAGIFGTG--TGHTLPHSA  560
            LIRFLNAGIFG+G  + HTLPHSA
Sbjct  129  LIRFLNAGIFGSGAESDHTLPHSA  152



>ref|XP_007027354.1| PHE ammonia lyase 1 [Theobroma cacao]
 gb|EOY07856.1| PHE ammonia lyase 1 [Theobroma cacao]
Length=722

 Score =   220 bits (560),  Expect = 8e-64, Method: Compositional matrix adjust.
 Identities = 112/161 (70%), Positives = 124/161 (77%), Gaps = 15/161 (9%)
 Frame = +3

Query  123  MEGAIENGHSN----DFCIK---------VDPLNWEMAADSLKGSHLDEVKRMVAEFRNP  263
            ME   +NG  N     FC           VDPLNW   A+SLKGSHLDEVKRMVAE+R P
Sbjct  1    METIAQNGRQNGSLESFCTTASTATKGAVVDPLNWGATAESLKGSHLDEVKRMVAEYRKP  60

Query  264  AVKIGGQTLTVAQVAAIAARDNAVKVELSEGARAGVKASSDWVMNSMNNGTDSYGVTTGF  443
            +VK+GG+TLT++QVAAIA RD  VKVELSE ARAGVKAS+DWV++ MN GTDSYGVTTGF
Sbjct  61   SVKLGGETLTISQVAAIATRDLGVKVELSEDARAGVKASADWVLDGMNKGTDSYGVTTGF  120

Query  444  GATSHRRTKNGHALQQELIRFLNAGIFGTGT--GHTLPHSA  560
            GATSHRRTK G ALQ+ELIRFLNAGIFG GT   HTLPHSA
Sbjct  121  GATSHRRTKQGAALQKELIRFLNAGIFGNGTESCHTLPHSA  161



>emb|CDY18463.1| BnaA04g21240D [Brassica napus]
Length=263

 Score =   209 bits (532),  Expect = 8e-64, Method: Compositional matrix adjust.
 Identities = 103/138 (75%), Positives = 112/138 (81%), Gaps = 2/138 (1%)
 Frame = +3

Query  153  NDFCIKVDPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQTLTVAQVAAIAARDNA  332
            N   +  DPLNW  AA+ +KGSHLDEVKRMV EFR P V +GG+TLT+ QVAAI+   N 
Sbjct  24   NATVVGADPLNWGAAAEQMKGSHLDEVKRMVKEFRRPVVNLGGETLTIGQVAAISTLGNG  83

Query  333  VKVELSEGARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSHRRTKNGHALQQELIRFLN  512
            VKVELSE ARAGVKASSDWVM SM  GTDSYGVTTGFGATSHRRTKNG ALQ+ELIRFLN
Sbjct  84   VKVELSETARAGVKASSDWVMESMGKGTDSYGVTTGFGATSHRRTKNGVALQKELIRFLN  143

Query  513  AGIFGTG--TGHTLPHSA  560
            AGIFG+   T HTLPHSA
Sbjct  144  AGIFGSTKETSHTLPHSA  161



>gb|KGN52975.1| hypothetical protein Csa_4G008780 [Cucumis sativus]
Length=646

 Score =   219 bits (557),  Expect = 8e-64, Method: Compositional matrix adjust.
 Identities = 108/146 (74%), Positives = 119/146 (82%), Gaps = 3/146 (2%)
 Frame = +3

Query  132  AIENGHSNDFCIK-VDPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQTLTVAQVA  308
            A +NG    FC    DPLNW +AADS+KGSHLDEVKRMV E+R P VK+GGQTLT++QVA
Sbjct  7    ANQNGSMESFCSSHQDPLNWGLAADSMKGSHLDEVKRMVEEYRRPLVKLGGQTLTISQVA  66

Query  309  AIAARDNAVKVELSEGARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSHRRTKNGHALQ  488
            AIA RDN V VEL+E ARAGVKASSDWVM SM  GTDSYGVTTGFGATSHRRT  G ALQ
Sbjct  67   AIATRDNDVLVELAESARAGVKASSDWVMESMGKGTDSYGVTTGFGATSHRRTNQGGALQ  126

Query  489  QELIRFLNAGIFGTG--TGHTLPHSA  560
            +ELIRFLN+GIFG G  + HTLPHSA
Sbjct  127  KELIRFLNSGIFGNGSESNHTLPHSA  152



>ref|XP_008449237.1| PREDICTED: phenylalanine ammonia-lyase-like [Cucumis melo]
Length=717

 Score =   220 bits (560),  Expect = 8e-64, Method: Compositional matrix adjust.
 Identities = 108/147 (73%), Positives = 122/147 (83%), Gaps = 4/147 (3%)
 Frame = +3

Query  132  AIENGHSNDFCIK--VDPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQTLTVAQV  305
            A +NG    FC    VDPLNW +AA++LKGSHLDEVKRMV E+R P VK+GG+TLT++QV
Sbjct  10   AHQNGSMESFCTSHVVDPLNWGVAAEALKGSHLDEVKRMVDEYRRPVVKLGGETLTISQV  69

Query  306  AAIAARDNAVKVELSEGARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSHRRTKNGHAL  485
            AAIA RD+ V V+L+E ARAGVKASSDWVM SMN GTDSYGVTTGFGATSHRRTK G AL
Sbjct  70   AAIATRDSDVVVKLAESARAGVKASSDWVMESMNKGTDSYGVTTGFGATSHRRTKQGGAL  129

Query  486  QQELIRFLNAGIFGTG--TGHTLPHSA  560
            Q+ELIRFLNAGIFG G  + HTLPHSA
Sbjct  130  QKELIRFLNAGIFGNGAESNHTLPHSA  156



>gb|AHA42443.1| phenylalanine ammonia lyase [Cannabis sativa]
Length=707

 Score =   220 bits (560),  Expect = 9e-64, Method: Compositional matrix adjust.
 Identities = 107/136 (79%), Positives = 118/136 (87%), Gaps = 3/136 (2%)
 Frame = +3

Query  159  FCIKVDPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQTLTVAQVAAIAARDNAVK  338
            FC+K DPLNW +AA+S+ GSHLDEVKRMVAE+R P V +GG+TLT++QVAAIAA D  VK
Sbjct  12   FCVKGDPLNWGLAAESMSGSHLDEVKRMVAEYRKPVVGLGGETLTISQVAAIAAAD-GVK  70

Query  339  VELSEGARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSHRRTKNGHALQQELIRFLNAG  518
            VELSE  RAGVKASSDWVM SMN GTDSYGVTTGFGATSHRRTKNG ALQ+ELIRFLNAG
Sbjct  71   VELSESPRAGVKASSDWVMESMNKGTDSYGVTTGFGATSHRRTKNGGALQKELIRFLNAG  130

Query  519  IFGTGT--GHTLPHSA  560
            IFG GT   HTLPHS+
Sbjct  131  IFGHGTESCHTLPHSS  146



>ref|XP_003590471.1| Phenylalanine ammonia-lyase [Medicago truncatula]
 gb|AES60722.1| phenylalanine ammonia-lyase-like protein [Medicago truncatula]
Length=712

 Score =   219 bits (559),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 113/152 (74%), Positives = 124/152 (82%), Gaps = 7/152 (5%)
 Frame = +3

Query  123  MEGAIENGHSN-DFCIKV---DPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQTL  290
            MEG I NGH    FC+     DPLNW  AA+SL GSHLDEVKRMV E+RNP VKIGG+TL
Sbjct  1    MEG-ITNGHVEATFCLSKNGGDPLNWGAAAESLTGSHLDEVKRMVEEYRNPLVKIGGETL  59

Query  291  TVAQVAAIAARDNAVKVELSEGARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSHRRTK  470
            T+AQVA IA+ D+ V+VELSE ARAGVKASSDWVM+SMN GTDSYGVTTGFGATSHRRTK
Sbjct  60   TIAQVAGIASHDSGVRVELSESARAGVKASSDWVMDSMNKGTDSYGVTTGFGATSHRRTK  119

Query  471  NGHALQQELIRFLNAGIFGTGT--GHTLPHSA  560
             G ALQ+ELIRFLNAGIFG GT    TLPH+A
Sbjct  120  QGGALQKELIRFLNAGIFGNGTESNCTLPHTA  151



>ref|XP_009606373.1| PREDICTED: phenylalanine ammonia-lyase G4-like [Nicotiana tomentosiformis]
Length=717

 Score =   219 bits (558),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 113/148 (76%), Positives = 121/148 (82%), Gaps = 8/148 (5%)
 Frame = +3

Query  141  NGHSN-DFCIK----VDPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQTLTVAQV  305
            NGHS+ + CIK     DPLNW MAA +L GSHLDEVK+MV EFR PAV++GG+TLTVAQV
Sbjct  9    NGHSDQELCIKGHQQEDPLNWNMAAAALSGSHLDEVKKMVEEFRKPAVRLGGETLTVAQV  68

Query  306  AAIAARD-NAVKVELSEGARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSHRRTKNGHA  482
            AAIA R    V VELSEGARAGVKASSDWVM  MN GTDSYGVTTGFGATSHRRTK G A
Sbjct  69   AAIAGRSGTEVTVELSEGARAGVKASSDWVMEGMNKGTDSYGVTTGFGATSHRRTKQGAA  128

Query  483  LQQELIRFLNAGIFGTGT--GHTLPHSA  560
            LQ+ELIRFLNAGIFG GT   HTLPHSA
Sbjct  129  LQKELIRFLNAGIFGNGTESCHTLPHSA  156



>ref|XP_004304440.1| PREDICTED: phenylalanine ammonia-lyase 1 [Fragaria vesca subsp. 
vesca]
Length=724

 Score =   219 bits (558),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 108/155 (70%), Positives = 122/155 (79%), Gaps = 8/155 (5%)
 Frame = +3

Query  114  NTTMEGAIENGHSNDFCIKV-------DPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVK  272
            N   +  I+NG  +  C+K        DPLNW  AA+S+ GSHLDEVKRMVAE+R P VK
Sbjct  7    NGYHQNGIQNGSLDILCVKTESLKAVSDPLNWGAAAESMTGSHLDEVKRMVAEYRKPVVK  66

Query  273  IGGQTLTVAQVAAIAARDNAVKVELSEGARAGVKASSDWVMNSMNNGTDSYGVTTGFGAT  452
            +GG+TLT+AQVAAIA  D+ VKVEL E ARAGVKASSDWVM+SMN GTDSYGVTTGFGAT
Sbjct  67   LGGKTLTIAQVAAIANHDSGVKVELDESARAGVKASSDWVMDSMNKGTDSYGVTTGFGAT  126

Query  453  SHRRTKNGHALQQELIRFLNAGIFGTGT-GHTLPH  554
            SHRRTK G ALQ+ELIRFLNAG+FG GT  HTLPH
Sbjct  127  SHRRTKQGAALQKELIRFLNAGVFGKGTESHTLPH  161



>dbj|BAA31258.1| phenylalanine ammonia-lyase [Vitis vinifera]
Length=319

 Score =   210 bits (534),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 101/137 (74%), Positives = 116/137 (85%), Gaps = 3/137 (2%)
 Frame = +3

Query  153  NDFCIKVDPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQTLTVAQVAAIAARDNA  332
              FC+  DPLNW MAA++LKGSHLDEVKRMVAE+R P V++GG+TLT++QVAAIA R+  
Sbjct  13   ESFCVS-DPLNWGMAAETLKGSHLDEVKRMVAEYRKPVVRLGGETLTISQVAAIAGREGD  71

Query  333  VKVELSEGARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSHRRTKNGHALQQELIRFLN  512
            V VELSE ARAGV ASS+WVM SM+ GTDSYGVTTGFGATSHRRTK G ALQ+ELI+FLN
Sbjct  72   VGVELSETARAGVNASSEWVMESMSKGTDSYGVTTGFGATSHRRTKQGGALQKELIKFLN  131

Query  513  AGIFGTG--TGHTLPHS  557
            AGIFG G  + HTLPHS
Sbjct  132  AGIFGNGRESCHTLPHS  148



>gb|ACT53399.1| phenylalanine ammonia-lyase 2 [Ageratina adenophora]
Length=720

 Score =   219 bits (558),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 115/145 (79%), Positives = 120/145 (83%), Gaps = 6/145 (4%)
 Frame = +3

Query  141  NGHSND-FCIKVDPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQTLTVAQVAAIA  317
            NG  ND FCIK DPLNW  AA  L GSHLDEVK+MVAEFR P VK+GG+TLTVAQVA IA
Sbjct  16   NGVVNDPFCIK-DPLNWGAAAAELTGSHLDEVKKMVAEFRKPVVKLGGETLTVAQVAGIA  74

Query  318  ARD--NAVKVELSEGARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSHRRTKNGHALQQ  491
            A D  +AVKVELSE ARAGV ASSDWVM SMN GTDSYGVTTGFGATSHRRTK G ALQ+
Sbjct  75   AADGGSAVKVELSEAARAGVAASSDWVMESMNKGTDSYGVTTGFGATSHRRTKQGGALQK  134

Query  492  ELIRFLNAGIFGTGT--GHTLPHSA  560
            ELIRFLNAGIFG GT   HTLPHSA
Sbjct  135  ELIRFLNAGIFGNGTESSHTLPHSA  159



>ref|XP_002531677.1| Phenylalanine ammonia-lyase, putative [Ricinus communis]
 gb|EEF30696.1| Phenylalanine ammonia-lyase, putative [Ricinus communis]
Length=719

 Score =   219 bits (557),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 108/140 (77%), Positives = 116/140 (83%), Gaps = 6/140 (4%)
 Frame = +3

Query  159  FCIKV----DPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQTLTVAQVAAIAARD  326
            FC       DPLNW M ADSLKGSHLDEVKRMV E+R P V++GG+TLT+AQV AIA RD
Sbjct  19   FCTATAGHHDPLNWGMLADSLKGSHLDEVKRMVDEYRRPVVRLGGETLTIAQVTAIANRD  78

Query  327  NAVKVELSEGARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSHRRTKNGHALQQELIRF  506
              +KVELSE ARAGVKASSDWVM+SMN GTDSYGVTTGFGATSHRRTK G ALQ+ELIRF
Sbjct  79   AGIKVELSEDARAGVKASSDWVMDSMNKGTDSYGVTTGFGATSHRRTKQGGALQRELIRF  138

Query  507  LNAGIFGTGT--GHTLPHSA  560
            LNAGIFG GT   HTLPHSA
Sbjct  139  LNAGIFGNGTESCHTLPHSA  158



>gb|AJO53273.1| phenylalanine ammonia-lyase [Pogostemon cablin]
Length=711

 Score =   218 bits (556),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 118/150 (79%), Positives = 128/150 (85%), Gaps = 4/150 (3%)
 Frame = +3

Query  123  MEGAIENGH-SNDFCIK-VDPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQTLTV  296
            M  A+ENGH SN  C+K  DPLNW  AADSLKGSHLDEVK+MV EFR   VK+GG+TLT+
Sbjct  1    MAPAVENGHFSNGLCVKQSDPLNWGAAADSLKGSHLDEVKKMVEEFRKSVVKLGGETLTI  60

Query  297  AQVAAIAARDNAVKVELSEGARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSHRRTKNG  476
            AQVAAIAARDNAV VEL+E ARAGVKASSDWVM+SM+ GTDSYGVTTGFGATSHRRTK G
Sbjct  61   AQVAAIAARDNAVAVELAEAARAGVKASSDWVMDSMDKGTDSYGVTTGFGATSHRRTKQG  120

Query  477  HALQQELIRFLNAGIFGTGT--GHTLPHSA  560
             ALQ+ELIRFLNAGIFG GT   HTLPHSA
Sbjct  121  GALQKELIRFLNAGIFGKGTESCHTLPHSA  150



>ref|XP_008454139.1| PREDICTED: phenylalanine ammonia-lyase-like [Cucumis melo]
Length=708

 Score =   218 bits (556),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 106/146 (73%), Positives = 120/146 (82%), Gaps = 3/146 (2%)
 Frame = +3

Query  132  AIENGHSNDFCIK-VDPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQTLTVAQVA  308
            A +NG S   C+   DPLNW +AA+S+KGSHLDEVKRMV E+R P VK+GG+TLT++QVA
Sbjct  2    ACQNGSSESLCMNGQDPLNWGLAAESMKGSHLDEVKRMVEEYRRPLVKLGGETLTISQVA  61

Query  309  AIAARDNAVKVELSEGARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSHRRTKNGHALQ  488
            AIA RDN V VEL+E ARAGVKASSDWVM SM  GTDSYGVTTGFGATSHRRT  G ALQ
Sbjct  62   AIATRDNDVVVELAESARAGVKASSDWVMESMGKGTDSYGVTTGFGATSHRRTNQGGALQ  121

Query  489  QELIRFLNAGIFGTG--TGHTLPHSA  560
            +ELIRFLN+GIFG G  + HTLPHSA
Sbjct  122  KELIRFLNSGIFGNGSESNHTLPHSA  147



>gb|AEC11891.1| PAL1 [Petunia exserta]
 gb|AEC11892.1| PAL1 [Petunia axillaris]
Length=718

 Score =   218 bits (556),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 114/157 (73%), Positives = 126/157 (80%), Gaps = 11/157 (7%)
 Frame = +3

Query  123  MEGAIEN--GH-SNDFCIK-----VDPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIG  278
            ME A EN  GH S D C+K     +DPLNW MAAD+LKGSHLDEVKRMV EFR P V++G
Sbjct  1    MEYANENCNGHASQDICVKGHDQQLDPLNWNMAADALKGSHLDEVKRMVKEFRKPVVRLG  60

Query  279  GQTLTVAQVAAIAARDNA-VKVELSEGARAGVKASSDWVMNSMNNGTDSYGVTTGFGATS  455
            G+TLTVAQVAAIA++    V V+LSE +RAGVKASSDWV+  M NGTDSYGVTTGFGATS
Sbjct  61   GETLTVAQVAAIASQSGTDVTVQLSEASRAGVKASSDWVLQGMINGTDSYGVTTGFGATS  120

Query  456  HRRTKNGHALQQELIRFLNAGIFGTGT--GHTLPHSA  560
            HRRTK G ALQ+ELIRFLNAGIFG GT   HTLPHSA
Sbjct  121  HRRTKEGAALQKELIRFLNAGIFGNGTESSHTLPHSA  157



>gb|AAV98199.1| phenylalanine ammonialyase 1 [Petunia x hybrida]
Length=718

 Score =   218 bits (556),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 114/157 (73%), Positives = 126/157 (80%), Gaps = 11/157 (7%)
 Frame = +3

Query  123  MEGAIEN--GH-SNDFCIK-----VDPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIG  278
            ME A EN  GH S D C+K     +DPLNW MAAD+LKGSHLDEVKRMV EFR P V++G
Sbjct  1    MEYANENCNGHASQDICVKGHDQQLDPLNWNMAADALKGSHLDEVKRMVKEFRKPVVRLG  60

Query  279  GQTLTVAQVAAIAARDNA-VKVELSEGARAGVKASSDWVMNSMNNGTDSYGVTTGFGATS  455
            G+TLTVAQVAAIA++    V V+LSE +RAGVKASSDWV+  M NGTDSYGVTTGFGATS
Sbjct  61   GETLTVAQVAAIASQSGTDVTVQLSEASRAGVKASSDWVLQGMINGTDSYGVTTGFGATS  120

Query  456  HRRTKNGHALQQELIRFLNAGIFGTGT--GHTLPHSA  560
            HRRTK G ALQ+ELIRFLNAGIFG GT   HTLPHSA
Sbjct  121  HRRTKEGAALQKELIRFLNAGIFGNGTESSHTLPHSA  157



>ref|XP_003521396.1| PREDICTED: phenylalanine ammonia-lyase 1-like [Glycine max]
Length=716

 Score =   218 bits (556),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 108/150 (72%), Positives = 121/150 (81%), Gaps = 8/150 (5%)
 Frame = +3

Query  135  IENGHSN-DFCIKV-----DPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQTLTV  296
            I NG  N  FC+       DPLNW  AA+++KGSHLDEVKRMVAE+R P V++GG+TLT+
Sbjct  6    ITNGSQNGSFCLSTTKGSSDPLNWGAAAEAMKGSHLDEVKRMVAEYRKPVVRLGGETLTI  65

Query  297  AQVAAIAARDNAVKVELSEGARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSHRRTKNG  476
            AQVAA+A  D  V VELSE AR GVKASS+WVMNSMNNGTDSYGVTTGFGATSHRRTK G
Sbjct  66   AQVAAVAGHDLGVAVELSESAREGVKASSEWVMNSMNNGTDSYGVTTGFGATSHRRTKQG  125

Query  477  HALQQELIRFLNAGIFGTGT--GHTLPHSA  560
             ALQ+ELIRFLNAGIFG GT   HTLPH+A
Sbjct  126  GALQKELIRFLNAGIFGNGTESSHTLPHTA  155



>gb|KGN52974.1| hypothetical protein Csa_4G008770 [Cucumis sativus]
Length=592

 Score =   216 bits (550),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 107/146 (73%), Positives = 118/146 (81%), Gaps = 3/146 (2%)
 Frame = +3

Query  132  AIENGHSNDFCIK-VDPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQTLTVAQVA  308
            A +NG     C    DPLNW +AADS+KGSHLDEVKRMV E+R P VK+GGQTLT++QVA
Sbjct  7    ANQNGSMESLCSSHQDPLNWGLAADSMKGSHLDEVKRMVEEYRRPLVKLGGQTLTISQVA  66

Query  309  AIAARDNAVKVELSEGARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSHRRTKNGHALQ  488
            AIA RDN V VEL+E ARAGVKASSDWVM SM  GTDSYGVTTGFGATSHRRT  G ALQ
Sbjct  67   AIATRDNDVLVELAESARAGVKASSDWVMESMGKGTDSYGVTTGFGATSHRRTNQGGALQ  126

Query  489  QELIRFLNAGIFGTG--TGHTLPHSA  560
            +ELIRFLN+GIFG G  + HTLPHSA
Sbjct  127  KELIRFLNSGIFGNGSESNHTLPHSA  152



>gb|KGN52973.1| hypothetical protein Csa_4G008760 [Cucumis sativus]
Length=438

 Score =   213 bits (541),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 105/146 (72%), Positives = 118/146 (81%), Gaps = 3/146 (2%)
 Frame = +3

Query  132  AIENGHSNDFC-IKVDPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQTLTVAQVA  308
            A +NG     C    DPLNW +AA+S+KGSHLDEVKRMV E+R P VK+GG+TLT++QVA
Sbjct  7    ANQNGSVETLCNTHQDPLNWGLAAESMKGSHLDEVKRMVEEYRRPLVKLGGETLTISQVA  66

Query  309  AIAARDNAVKVELSEGARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSHRRTKNGHALQ  488
            AIA RDN V VEL+E ARAGVKASSDWVM SM  GTDSYGVTTGFGATSHRRT  G ALQ
Sbjct  67   AIATRDNDVLVELAESARAGVKASSDWVMESMGKGTDSYGVTTGFGATSHRRTNQGGALQ  126

Query  489  QELIRFLNAGIFGTG--TGHTLPHSA  560
            +ELIRFLN+GIFG G  + HTLPHSA
Sbjct  127  KELIRFLNSGIFGNGSESNHTLPHSA  152



>ref|XP_004143257.1| PREDICTED: phenylalanine ammonia-lyase-like [Cucumis sativus]
 ref|XP_004156292.1| PREDICTED: phenylalanine ammonia-lyase-like [Cucumis sativus]
Length=710

 Score =   218 bits (555),  Expect = 4e-63, Method: Compositional matrix adjust.
 Identities = 109/144 (76%), Positives = 120/144 (83%), Gaps = 4/144 (3%)
 Frame = +3

Query  141  NGHSND-FC-IKVDPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQTLTVAQVAAI  314
            NGH  D  C    DPLNW +AA+SLKGSHLDEVKRMV E+R P VK+GG+TLT++QVAAI
Sbjct  6    NGHIEDNLCHTHSDPLNWGVAAESLKGSHLDEVKRMVEEYRRPLVKLGGETLTISQVAAI  65

Query  315  AARDNAVKVELSEGARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSHRRTKNGHALQQE  494
            A RD+ V VELSE AR GVKASSDWVM SMN GTDSYGVTTGFGATSHRRTK G ALQ+E
Sbjct  66   ATRDSDVIVELSESARVGVKASSDWVMESMNKGTDSYGVTTGFGATSHRRTKEGGALQKE  125

Query  495  LIRFLNAGIFGTG--TGHTLPHSA  560
            LIRFLNAGIFG+G  + HTLPHSA
Sbjct  126  LIRFLNAGIFGSGAESDHTLPHSA  149



>ref|XP_008449239.1| PREDICTED: phenylalanine ammonia-lyase-like [Cucumis melo]
Length=711

 Score =   218 bits (555),  Expect = 4e-63, Method: Compositional matrix adjust.
 Identities = 105/131 (80%), Positives = 114/131 (87%), Gaps = 2/131 (2%)
 Frame = +3

Query  174  DPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQTLTVAQVAAIAARDNAVKVELSE  353
            DPLNW +AADSLKGSHLDEVKRMV E+R P VK+GG+TLT++QVAAIA RD  V VELSE
Sbjct  20   DPLNWGLAADSLKGSHLDEVKRMVEEYRRPLVKLGGETLTISQVAAIATRDTDVIVELSE  79

Query  354  GARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSHRRTKNGHALQQELIRFLNAGIFGTG  533
             ARAGVKASSDWVM SMN GTDSYGVTTGFGATSHRRTK G ALQ+ELIRFLNAGIFG+G
Sbjct  80   SARAGVKASSDWVMESMNKGTDSYGVTTGFGATSHRRTKQGGALQKELIRFLNAGIFGSG  139

Query  534  --TGHTLPHSA  560
              + H LPHSA
Sbjct  140  AESNHILPHSA  150



>emb|CBI31445.3| unnamed protein product [Vitis vinifera]
Length=578

 Score =   216 bits (549),  Expect = 5e-63, Method: Compositional matrix adjust.
 Identities = 104/131 (79%), Positives = 114/131 (87%), Gaps = 2/131 (2%)
 Frame = +3

Query  174  DPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQTLTVAQVAAIAARDNAVKVELSE  353
            DPLNW MAA+SLKGSHLDEVKRMV E+R   V++GG+TLT++QVAA+A+RD  V VELSE
Sbjct  32   DPLNWNMAAESLKGSHLDEVKRMVEEYRRQVVQLGGETLTISQVAAVASRDTGVTVELSE  91

Query  354  GARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSHRRTKNGHALQQELIRFLNAGIFGTG  533
             AR GVKASSDWVM+SMNNGTDSYGVTTGFGATSHRRTK G ALQ ELIRFLNAGIFG G
Sbjct  92   EAREGVKASSDWVMDSMNNGTDSYGVTTGFGATSHRRTKQGGALQMELIRFLNAGIFGNG  151

Query  534  T--GHTLPHSA  560
            T   HTLPHSA
Sbjct  152  TESCHTLPHSA  162



>dbj|BAO01110.1| phenylalanine ammonia-lyase [Vigna radiata]
Length=715

 Score =   218 bits (555),  Expect = 5e-63, Method: Compositional matrix adjust.
 Identities = 107/149 (72%), Positives = 122/149 (82%), Gaps = 7/149 (5%)
 Frame = +3

Query  135  IENGHSN-DFCIKV----DPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQTLTVA  299
            + NG+ N  FC       DPLNW  AA++LKGSHLDEVKRMVAE+R P V++GG+TLT+A
Sbjct  6    LTNGNQNGSFCFTSTKTSDPLNWGTAAEALKGSHLDEVKRMVAEYRQPLVRLGGETLTIA  65

Query  300  QVAAIAARDNAVKVELSEGARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSHRRTKNGH  479
            QVA ++A D  V+VELSE AR GVKASS+WVMNSMNNGTDSYGVTTGFGATSHRRTK G 
Sbjct  66   QVAGVSAHDQGVRVELSESAREGVKASSEWVMNSMNNGTDSYGVTTGFGATSHRRTKQGG  125

Query  480  ALQQELIRFLNAGIFGTGT--GHTLPHSA  560
            ALQ+ELIRFLNAGIFG GT   HTLPH+A
Sbjct  126  ALQKELIRFLNAGIFGNGTESCHTLPHTA  154



>ref|XP_002281799.1| PREDICTED: phenylalanine ammonia-lyase [Vitis vinifera]
Length=710

 Score =   218 bits (554),  Expect = 5e-63, Method: Compositional matrix adjust.
 Identities = 105/136 (77%), Positives = 116/136 (85%), Gaps = 3/136 (2%)
 Frame = +3

Query  159  FCIKVDPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQTLTVAQVAAIAARDNAVK  338
            FC+  DPLNW +AA+ LKGSHLDEVKRMVAE+R P V++GG+TLT++QVAAIA R+  V 
Sbjct  15   FCVS-DPLNWGVAAEELKGSHLDEVKRMVAEYRKPVVRLGGETLTISQVAAIAGREEDVT  73

Query  339  VELSEGARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSHRRTKNGHALQQELIRFLNAG  518
            VELSE AR GVKASSDWVM SMN GTDSYGVTTGFGATSHRRTK G ALQ+ELIRFLNAG
Sbjct  74   VELSEAAREGVKASSDWVMESMNKGTDSYGVTTGFGATSHRRTKEGGALQKELIRFLNAG  133

Query  519  IFGTGTG--HTLPHSA  560
            IFG GT   HTLPHSA
Sbjct  134  IFGNGTDSCHTLPHSA  149



>ref|XP_006436446.1| hypothetical protein CICLE_v10030821mg [Citrus clementina]
 ref|XP_006485648.1| PREDICTED: phenylalanine ammonia-lyase-like [Citrus sinensis]
 gb|ESR49686.1| hypothetical protein CICLE_v10030821mg [Citrus clementina]
Length=722

 Score =   218 bits (555),  Expect = 5e-63, Method: Compositional matrix adjust.
 Identities = 108/151 (72%), Positives = 120/151 (79%), Gaps = 11/151 (7%)
 Frame = +3

Query  141  NGHSND---------FCIKVDPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQTLT  293
            NG +ND          C   DPLNW +AADSLKGSHLDEVKRMV E+R P VK+GG++LT
Sbjct  9    NGINNDRNGGTSSLGLCTGTDPLNWTVAADSLKGSHLDEVKRMVDEYRRPVVKLGGESLT  68

Query  294  VAQVAAIAARDNAVKVELSEGARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSHRRTKN  473
            + QV AIAA D+ VKVEL+E ARAGVKASSDWVM+SM  GTDSYGVTTGFGATSHRRTK 
Sbjct  69   IGQVTAIAAHDSGVKVELAEAARAGVKASSDWVMDSMMKGTDSYGVTTGFGATSHRRTKQ  128

Query  474  GHALQQELIRFLNAGIFGTGT--GHTLPHSA  560
            G ALQ+ELIRFLN+GIFG GT   HTLPHSA
Sbjct  129  GGALQKELIRFLNSGIFGNGTESSHTLPHSA  159



>dbj|BAG31930.1| phenylalanine ammonia-lyase [Daucus carota]
Length=715

 Score =   218 bits (554),  Expect = 5e-63, Method: Compositional matrix adjust.
 Identities = 108/146 (74%), Positives = 126/146 (86%), Gaps = 5/146 (3%)
 Frame = +3

Query  138  ENGHSNDFCIKV-DPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQTLTVAQVAAI  314
            ENG+  D C+K  DPL+W +AA++L GSHL+EVKRMVAE+R P VK+GG+TLT++QVAAI
Sbjct  9    ENGNGVDLCMKKEDPLSWGVAAEALTGSHLEEVKRMVAEYRKPVVKLGGETLTISQVAAI  68

Query  315  AARDNA-VKVELSEGARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSHRRTKNGHALQQ  491
            +ARD++ VKVELSE ARAGVKASSDWVM SMN GTDSYGVTTGFGATSHRRTK G ALQ+
Sbjct  69   SARDDSGVKVELSEAARAGVKASSDWVMESMNKGTDSYGVTTGFGATSHRRTKQGGALQK  128

Query  492  ELIRFLNAGIFGTGT---GHTLPHSA  560
            ELIRFLNAGIFG+G     +TLPHSA
Sbjct  129  ELIRFLNAGIFGSGAEAGNNTLPHSA  154



>gb|AEV53411.1| phenylalanine ammonia-lyase 3 [Populus tomentosa]
 gb|AFZ78652.1| phenylalanine ammonia-lyase [Populus tomentosa]
Length=715

 Score =   218 bits (554),  Expect = 6e-63, Method: Compositional matrix adjust.
 Identities = 109/154 (71%), Positives = 126/154 (82%), Gaps = 8/154 (5%)
 Frame = +3

Query  123  MEGAIENGHSN----DFCI-KVDPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQT  287
            ME   +NGH N      CI ++DPL+W +AA+++KGSHLDEVKRMVA++R P VK+GG+T
Sbjct  1    METVTKNGHQNGSLESLCINQLDPLSWGVAAEAMKGSHLDEVKRMVADYRKPVVKLGGET  60

Query  288  LTVAQVAAIAARDNA-VKVELSEGARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSHRR  464
            LT+AQVA+IA  D   VKVELSE AR GVKASSDWVM+SM+ GTDSYGVTTGFGATSHRR
Sbjct  61   LTIAQVASIAGHDTGDVKVELSESARPGVKASSDWVMDSMDKGTDSYGVTTGFGATSHRR  120

Query  465  TKNGHALQQELIRFLNAGIFGTG--TGHTLPHSA  560
            TK G ALQ+ELIRFLNAGIFG G  T HTLPHSA
Sbjct  121  TKQGGALQRELIRFLNAGIFGNGTETCHTLPHSA  154



>ref|XP_009759945.1| PREDICTED: phenylalanine ammonia-lyase G4-like [Nicotiana sylvestris]
Length=718

 Score =   218 bits (554),  Expect = 6e-63, Method: Compositional matrix adjust.
 Identities = 110/149 (74%), Positives = 120/149 (81%), Gaps = 9/149 (6%)
 Frame = +3

Query  141  NGH--SNDFCIK----VDPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQTLTVAQ  302
            NGH  S +FCIK     DPLNW MAAD+LKGSHLDEVK+MV EFR P V++GG+TLT+ Q
Sbjct  9    NGHNASQEFCIKGHEQQDPLNWNMAADALKGSHLDEVKKMVEEFRKPVVRLGGETLTIGQ  68

Query  303  VAAIAARD-NAVKVELSEGARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSHRRTKNGH  479
            VAAIA R    V VEL+E ARAGVKASSDWV+  M NGTDSYGVTTGFGATSHRRTK G 
Sbjct  69   VAAIAGRSGTEVMVELAEAARAGVKASSDWVIEGMKNGTDSYGVTTGFGATSHRRTKQGA  128

Query  480  ALQQELIRFLNAGIFGTGT--GHTLPHSA  560
            ALQ+ELIRFLNAGIFG GT   HTLPHSA
Sbjct  129  ALQKELIRFLNAGIFGNGTESSHTLPHSA  157



>sp|Q01861.1|PAL1_PEA RecName: Full=Phenylalanine ammonia-lyase 1 [Pisum sativum]
 dbj|BAA00885.1| phenylalanine ammonia-lyase [Pisum sativum]
 dbj|BAA00886.1| phenylalanine ammonia-lyase [Pisum sativum]
Length=723

 Score =   218 bits (554),  Expect = 6e-63, Method: Compositional matrix adjust.
 Identities = 105/146 (72%), Positives = 122/146 (84%), Gaps = 3/146 (2%)
 Frame = +3

Query  132  AIENGHSNDFCIK-VDPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQTLTVAQVA  308
             + N  +N+  +   DPLNW +AA+++KGSHLDEVKRMV E+R P V++GG+TLT++QVA
Sbjct  18   CVTNAKNNNMKVNSADPLNWGVAAEAMKGSHLDEVKRMVEEYRKPVVRLGGETLTISQVA  77

Query  309  AIAARDNAVKVELSEGARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSHRRTKNGHALQ  488
            AIAA D+ VKVELSE ARAGVKASSDWVM SMN GTDSYGVTTGFGATSHRRTK G ALQ
Sbjct  78   AIAAHDHGVKVELSESARAGVKASSDWVMESMNKGTDSYGVTTGFGATSHRRTKQGGALQ  137

Query  489  QELIRFLNAGIFGTGT--GHTLPHSA  560
            +ELIRFLNAGIFG GT   HTLPH+A
Sbjct  138  KELIRFLNAGIFGNGTESSHTLPHTA  163



>sp|P35511.1|PAL1_SOLLC RecName: Full=Phenylalanine ammonia-lyase; Short=PAL [Solanum 
lycopersicum]
Length=704

 Score =   217 bits (553),  Expect = 6e-63, Method: Compositional matrix adjust.
 Identities = 109/142 (77%), Positives = 120/142 (85%), Gaps = 7/142 (5%)
 Frame = +3

Query  156  DFCIKV--DPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQTLTVAQVAAIAARD-  326
            D C K   DPLNWEMAADSL+GSHLDEVK+MV EFR P VK+GG+TL+VAQVA+IA  D 
Sbjct  2    DLCKKSINDPLNWEMAADSLRGSHLDEVKKMVDEFRKPIVKLGGETLSVAQVASIANVDD  61

Query  327  --NAVKVELSEGARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSHRRTKNGHALQQELI  500
              N VKVELSE ARAGVKASSDWVM+SM+ GTDSYGVT GFGATSHRRTKNG ALQ+ELI
Sbjct  62   KSNGVKVELSESARAGVKASSDWVMDSMSKGTDSYGVTAGFGATSHRRTKNGGALQKELI  121

Query  501  RFLNAGIFGTG--TGHTLPHSA  560
            RFLNAG+FG G  + HTLPHSA
Sbjct  122  RFLNAGVFGNGIESFHTLPHSA  143



>sp|P45729.1|PAL3_PETCR RecName: Full=Phenylalanine ammonia-lyase 3 [Petroselinum crispum]
 emb|CAA57057.1| phenylalanine ammonia-lyase 3 [Petroselinum crispum]
Length=718

 Score =   218 bits (554),  Expect = 6e-63, Method: Compositional matrix adjust.
 Identities = 110/149 (74%), Positives = 127/149 (85%), Gaps = 9/149 (6%)
 Frame = +3

Query  141  NGHSN----DFCIKV-DPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQTLTVAQV  305
            NGH+N    D C+K  DPLNW +AA++L GSHLDEVKRMVAE+R P VK+ G+TLT++QV
Sbjct  9    NGHANGNGLDLCMKKEDPLNWGVAAEALTGSHLDEVKRMVAEYRKPVVKLEGETLTISQV  68

Query  306  AAIAARDNA-VKVELSEGARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSHRRTKNGHA  482
            AAI+ARD++ VKVELSE ARAGVKASSDWVM+SMN GTDSYGVTTGFGATSHRRTK G A
Sbjct  69   AAISARDDSGVKVELSEEARAGVKASSDWVMDSMNKGTDSYGVTTGFGATSHRRTKQGGA  128

Query  483  LQQELIRFLNAGIFGTGT---GHTLPHSA  560
            LQ+ELIRFLNAGIFG+G     +TLPHSA
Sbjct  129  LQKELIRFLNAGIFGSGAEAGNNTLPHSA  157



>prf||2001451A Phe ammonia lyase
Length=723

 Score =   218 bits (554),  Expect = 7e-63, Method: Compositional matrix adjust.
 Identities = 105/146 (72%), Positives = 122/146 (84%), Gaps = 3/146 (2%)
 Frame = +3

Query  132  AIENGHSNDFCIK-VDPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQTLTVAQVA  308
             + N  +N+  +   DPLNW +AA+++KGSHLDEVKRMV E+R P V++GG+TLT++QVA
Sbjct  18   CVTNAKNNNMKVNSADPLNWGVAAEAMKGSHLDEVKRMVEEYRKPVVRLGGETLTISQVA  77

Query  309  AIAARDNAVKVELSEGARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSHRRTKNGHALQ  488
            AIAA D+ VKVELSE ARAGVKASSDWVM SMN GTDSYGVTTGFGATSHRRTK G ALQ
Sbjct  78   AIAAHDHGVKVELSESARAGVKASSDWVMESMNKGTDSYGVTTGFGATSHRRTKQGGALQ  137

Query  489  QELIRFLNAGIFGTGT--GHTLPHSA  560
            +ELIRFLNAGIFG GT   HTLPH+A
Sbjct  138  KELIRFLNAGIFGNGTESSHTLPHTA  163



>gb|AAR31107.1| phenylalanine ammonia-lyase [Quercus suber]
Length=709

 Score =   217 bits (553),  Expect = 7e-63, Method: Compositional matrix adjust.
 Identities = 108/148 (73%), Positives = 121/148 (82%), Gaps = 2/148 (1%)
 Frame = +3

Query  123  MEGAIENGHSNDFCIKVDPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQTLTVAQ  302
            ME    NG S + C   DPLNW +AA+ LKGSHLDEVKRMV EFR P VK GG++LT+AQ
Sbjct  1    MEYCNGNGSSVNSCKSSDPLNWGLAAEGLKGSHLDEVKRMVDEFRKPLVKPGGKSLTIAQ  60

Query  303  VAAIAARDNAVKVELSEGARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSHRRTKNGHA  482
            VAAIA++D A+KVEL+E ARAGVKASSDWVM SM+ G DSYGVTTGFGATSHRRTK G A
Sbjct  61   VAAIASQDGAIKVELAEEARAGVKASSDWVMGSMDKGKDSYGVTTGFGATSHRRTKQGGA  120

Query  483  LQQELIRFLNAGIFGTGT--GHTLPHSA  560
            LQ+ELIRFLNAGIFG GT   HTLPH+A
Sbjct  121  LQRELIRFLNAGIFGNGTESCHTLPHTA  148



>gb|AFN85669.1| phenylalanine ammonia-lyase [Hibiscus cannabinus]
Length=715

 Score =   217 bits (553),  Expect = 8e-63, Method: Compositional matrix adjust.
 Identities = 105/132 (80%), Positives = 116/132 (88%), Gaps = 2/132 (2%)
 Frame = +3

Query  171  VDPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQTLTVAQVAAIAARDNAVKVELS  350
            VDPLNW +AA+SLKGSHLDEVKRMVAE+R P VK+GG+TLT++QVAAIA RD  VKVELS
Sbjct  23   VDPLNWGVAAESLKGSHLDEVKRMVAEYRRPLVKLGGETLTISQVAAIATRDLGVKVELS  82

Query  351  EGARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSHRRTKNGHALQQELIRFLNAGIFGT  530
            E ARAGVKAS+DWV++ MN GTDSYGVTTGFGATSHRRT  G ALQ+ELIRFLNAGIFG 
Sbjct  83   EDARAGVKASADWVLDGMNKGTDSYGVTTGFGATSHRRTNQGAALQKELIRFLNAGIFGN  142

Query  531  GT--GHTLPHSA  560
            GT   HTLPHSA
Sbjct  143  GTESCHTLPHSA  154



>gb|KDO46246.1| hypothetical protein CISIN_1g004955mg [Citrus sinensis]
Length=722

 Score =   217 bits (553),  Expect = 8e-63, Method: Compositional matrix adjust.
 Identities = 107/151 (71%), Positives = 119/151 (79%), Gaps = 11/151 (7%)
 Frame = +3

Query  141  NGHSND---------FCIKVDPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQTLT  293
            NG  ND          C   DPLNW +AADSLKGSHLDEVKRM+ E+R P VK+GG++LT
Sbjct  9    NGIKNDRNGGTSSLGLCTGTDPLNWTVAADSLKGSHLDEVKRMIDEYRRPVVKLGGESLT  68

Query  294  VAQVAAIAARDNAVKVELSEGARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSHRRTKN  473
            + QV AIAA D+ VKVEL+E ARAGVKASSDWVM+SM  GTDSYGVTTGFGATSHRRTK 
Sbjct  69   IGQVTAIAAHDSGVKVELAEAARAGVKASSDWVMDSMMKGTDSYGVTTGFGATSHRRTKQ  128

Query  474  GHALQQELIRFLNAGIFGTGT--GHTLPHSA  560
            G ALQ+ELIRFLN+GIFG GT   HTLPHSA
Sbjct  129  GGALQKELIRFLNSGIFGNGTESSHTLPHSA  159



>dbj|BAJ17655.1| phenylalanine ammonia lyase [Gynura bicolor]
Length=726

 Score =   217 bits (553),  Expect = 9e-63, Method: Compositional matrix adjust.
 Identities = 110/142 (77%), Positives = 121/142 (85%), Gaps = 5/142 (4%)
 Frame = +3

Query  147  HSNDFCIKVDPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQTLTVAQVAAIAARD  326
            H +D CIK D LNW +AA++L GSHLDEVK+MVAEFRNP VKIGG+TLTV+QVA IAA  
Sbjct  25   HVHDLCIK-DTLNWGVAAEALTGSHLDEVKKMVAEFRNPVVKIGGETLTVSQVAGIAAAS  83

Query  327  NA--VKVELSEGARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSHRRTKNGHALQQELI  500
            ++  VKVELSE ARAGVKASSDWVM SM+ GTDSYGVTTGFGATSHRRTK G ALQ+ELI
Sbjct  84   DSSTVKVELSEAARAGVKASSDWVMESMDKGTDSYGVTTGFGATSHRRTKQGGALQKELI  143

Query  501  RFLNAGIFGTGT--GHTLPHSA  560
            RFLNAGIFG GT   HTLPHSA
Sbjct  144  RFLNAGIFGNGTESSHTLPHSA  165



>ref|XP_009596642.1| PREDICTED: phenylalanine ammonia-lyase G4-like [Nicotiana tomentosiformis]
Length=719

 Score =   217 bits (553),  Expect = 9e-63, Method: Compositional matrix adjust.
 Identities = 110/150 (73%), Positives = 121/150 (81%), Gaps = 10/150 (7%)
 Frame = +3

Query  141  NGHSN---DFCIK----VDPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQTLTVA  299
            NGH+N   + CIK     DPLNW MAAD+LKGSHLDEVK+MV EFR P V++GG+TLT+A
Sbjct  9    NGHNNASQELCIKGNEQQDPLNWNMAADALKGSHLDEVKKMVEEFRKPVVQLGGETLTIA  68

Query  300  QVAAIAARD-NAVKVELSEGARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSHRRTKNG  476
            QVAAIA R    V VEL+E ARAGVKASSDWV+  M NGTDSYGVTTGFGATSHRRTK G
Sbjct  69   QVAAIAGRSGTEVMVELAEAARAGVKASSDWVIEGMKNGTDSYGVTTGFGATSHRRTKQG  128

Query  477  HALQQELIRFLNAGIFGTGT--GHTLPHSA  560
             ALQ+ELIRFLNAGIFG GT   HTLPHSA
Sbjct  129  AALQKELIRFLNAGIFGNGTESCHTLPHSA  158



>gb|ACT32033.1| phenylalanine ammonia-lyase [Glycine soja]
Length=712

 Score =   217 bits (553),  Expect = 9e-63, Method: Compositional matrix adjust.
 Identities = 106/147 (72%), Positives = 121/147 (82%), Gaps = 7/147 (5%)
 Frame = +3

Query  141  NGHSN-DFCIKV----DPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQTLTVAQV  305
            NGH N  FC+      DPLNW  AA+++KGSHLDEVKRMV+E+R P V++GG+TLT+AQV
Sbjct  5    NGHQNGSFCLSSTKGSDPLNWGAAAEAMKGSHLDEVKRMVSEYRKPVVRLGGETLTIAQV  64

Query  306  AAIAARDNAVKVELSEGARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSHRRTKNGHAL  485
            AA+A  D+ V VELSE AR GVKASS+WVMNSMNN TDSYGVTTGFGATSHRRTK G AL
Sbjct  65   AAVAGHDHGVTVELSESAREGVKASSEWVMNSMNNRTDSYGVTTGFGATSHRRTKQGGAL  124

Query  486  QQELIRFLNAGIFGTGT--GHTLPHSA  560
            Q+ELIRFLNAGIFG GT   HTLPH+A
Sbjct  125  QKELIRFLNAGIFGNGTESSHTLPHTA  151



>sp|Q42667.1|PALY_CITLI RecName: Full=Phenylalanine ammonia-lyase [Citrus limon]
 gb|AAB67733.1| phenylalanine ammonia-lyase [Citrus limon]
Length=722

 Score =   217 bits (553),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 107/151 (71%), Positives = 119/151 (79%), Gaps = 11/151 (7%)
 Frame = +3

Query  141  NGHSND---------FCIKVDPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQTLT  293
            NG  ND          C   DPLNW +AADSLKGSHLDEVKRM+ E+R P VK+GG++LT
Sbjct  9    NGIKNDRNGGTSSLGLCTGTDPLNWTVAADSLKGSHLDEVKRMIDEYRRPVVKLGGESLT  68

Query  294  VAQVAAIAARDNAVKVELSEGARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSHRRTKN  473
            + QV AIAA D+ VKVEL+E ARAGVKASSDWVM+SM  GTDSYGVTTGFGATSHRRTK 
Sbjct  69   IGQVTAIAAHDSGVKVELAEAARAGVKASSDWVMDSMMKGTDSYGVTTGFGATSHRRTKQ  128

Query  474  GHALQQELIRFLNAGIFGTGT--GHTLPHSA  560
            G ALQ+ELIRFLN+GIFG GT   HTLPHSA
Sbjct  129  GGALQKELIRFLNSGIFGNGTESSHTLPHSA  159



>gb|KHG29664.1| Phenylalanine ammonia-lyase [Gossypium arboreum]
Length=721

 Score =   217 bits (552),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 104/132 (79%), Positives = 117/132 (89%), Gaps = 2/132 (2%)
 Frame = +3

Query  171  VDPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQTLTVAQVAAIAARDNAVKVELS  350
            VDPLNW +AA+SL+GSHLDEVKRMVAE+R P VK+GG+TLT++QVAAIA RD  VKVELS
Sbjct  29   VDPLNWGVAAESLQGSHLDEVKRMVAEYRRPLVKLGGETLTISQVAAIATRDLGVKVELS  88

Query  351  EGARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSHRRTKNGHALQQELIRFLNAGIFGT  530
            E ARAGVKAS+DWV++ MN GTDSYGVTTGFGATSHRRTK G ALQ+ELIRFLNAGIFG 
Sbjct  89   EDARAGVKASADWVLDGMNKGTDSYGVTTGFGATSHRRTKQGAALQKELIRFLNAGIFGN  148

Query  531  G--TGHTLPHSA  560
            G  + HTLPHSA
Sbjct  149  GIESCHTLPHSA  160



>gb|AEA72280.1| phenylalanine ammonia-lyase, partial [Angelica gigas]
Length=699

 Score =   216 bits (551),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 104/137 (76%), Positives = 121/137 (88%), Gaps = 2/137 (1%)
 Frame = +3

Query  156  DFCI-KVDPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQTLTVAQVAAIAARD-N  329
            D CI K DPL+W +AA+++ GSHLDEVK+MVAE+R P VK+GG+TLT++QVAAI+ARD +
Sbjct  2    DLCINKEDPLSWGIAAEAMTGSHLDEVKKMVAEYRKPVVKLGGETLTISQVAAISARDGS  61

Query  330  AVKVELSEGARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSHRRTKNGHALQQELIRFL  509
             V VELSE ARAGVKASSDWVM+SMN GTDSYGVTTGFGATSHRRTK G ALQ+ELIRFL
Sbjct  62   GVTVELSEAARAGVKASSDWVMDSMNKGTDSYGVTTGFGATSHRRTKQGGALQKELIRFL  121

Query  510  NAGIFGTGTGHTLPHSA  560
            NAGIFG G+ +TLPHSA
Sbjct  122  NAGIFGNGSDNTLPHSA  138



>gb|AIB06732.1| phenylalanine ammonia lyase [Mangifera indica]
Length=707

 Score =   216 bits (551),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 104/131 (79%), Positives = 114/131 (87%), Gaps = 2/131 (2%)
 Frame = +3

Query  174  DPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQTLTVAQVAAIAARDNAVKVELSE  353
            DPLNW  AA+SLKGSHLDEVKRMV EFR P VK+GG+TLT+ QV AIA+ D+ V+VELSE
Sbjct  16   DPLNWNFAAESLKGSHLDEVKRMVEEFRKPVVKLGGETLTIGQVTAIASHDSGVRVELSE  75

Query  354  GARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSHRRTKNGHALQQELIRFLNAGIFGTG  533
             ARAGV+ASSDWVM SM NGTDSYGVTTGFGATSHRRTK G ALQ+ELIRFLNAGIFG+G
Sbjct  76   TARAGVQASSDWVMESMKNGTDSYGVTTGFGATSHRRTKQGGALQKELIRFLNAGIFGSG  135

Query  534  T--GHTLPHSA  560
            T   HTLPHSA
Sbjct  136  TESCHTLPHSA  146



>ref|XP_006354338.1| PREDICTED: phenylalanine ammonia-lyase-like isoform X3 [Solanum 
tuberosum]
Length=723

 Score =   217 bits (552),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 111/156 (71%), Positives = 125/156 (80%), Gaps = 15/156 (10%)
 Frame = +3

Query  138  ENGHSN------DFCIKV----DPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQT  287
            +NGH N      + C K     DPLNWEMAA+SL+GSHLDEVK+MV EFR P VK+ G+T
Sbjct  7    QNGHVNGEVVAMELCKKSINVHDPLNWEMAAESLRGSHLDEVKKMVDEFRKPIVKLEGET  66

Query  288  LTVAQVAAIAARDN---AVKVELSEGARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSH  458
            LTVAQVA+IA  DN    VKVELSE ARAGVKASSDWVM+SM+ GTDSYGVTTGFG TSH
Sbjct  67   LTVAQVASIANADNKSNGVKVELSESARAGVKASSDWVMDSMSKGTDSYGVTTGFGDTSH  126

Query  459  RRTKNGHALQQELIRFLNAGIFGTGT--GHTLPHSA  560
            RRTKNG+ALQ++LIRFLNAG+FG GT   HTLPHSA
Sbjct  127  RRTKNGNALQKDLIRFLNAGVFGNGTELSHTLPHSA  162



>gb|AER58180.1| phenylalanine ammonia lyase [Cucumis sativus]
Length=713

 Score =   216 bits (551),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 107/146 (73%), Positives = 118/146 (81%), Gaps = 3/146 (2%)
 Frame = +3

Query  132  AIENGHSNDFCIK-VDPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQTLTVAQVA  308
            A +NG     C    DPLNW +AADS+KGSHLDEVKRMV E+R P VK+GGQTLT++QVA
Sbjct  7    ANQNGSMESLCSSHQDPLNWGLAADSMKGSHLDEVKRMVEEYRRPLVKLGGQTLTISQVA  66

Query  309  AIAARDNAVKVELSEGARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSHRRTKNGHALQ  488
            AIA RDN V VEL+E ARAGVKASSDWVM SM  GTDSYGVTTGFGATSHRRT  G ALQ
Sbjct  67   AIATRDNDVLVELAESARAGVKASSDWVMESMGKGTDSYGVTTGFGATSHRRTNQGGALQ  126

Query  489  QELIRFLNAGIFGTG--TGHTLPHSA  560
            +ELIRFLN+GIFG G  + HTLPHSA
Sbjct  127  KELIRFLNSGIFGNGSESNHTLPHSA  152



>gb|AID51445.1| phenylalanine ammonia-lyase 2 [Astragalus membranaceus]
Length=718

 Score =   216 bits (551),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 108/149 (72%), Positives = 123/149 (83%), Gaps = 9/149 (6%)
 Frame = +3

Query  141  NGHSNDFCIK------VDPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQTLTVAQ  302
            N +   FC+K       DPLNW +AA+S+KGSHLDEVKRMV E+R P V++GG+TLT++Q
Sbjct  9    NFNGGSFCLKNSTINASDPLNWGVAAESMKGSHLDEVKRMVEEYRTPVVRLGGETLTISQ  68

Query  303  VAAIA-ARDNAVKVELSEGARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSHRRTKNGH  479
            VAAIA A D+ V+VELSE ARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSHRRTK G 
Sbjct  69   VAAIAGAYDDGVRVELSESARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSHRRTKQGG  128

Query  480  ALQQELIRFLNAGIFGTGT--GHTLPHSA  560
            ALQ+ELIRFLNAGIFG GT   HTLP +A
Sbjct  129  ALQKELIRFLNAGIFGNGTESSHTLPQTA  157



>ref|XP_007009873.1| Phenylalanine ammonia-lyase 2 [Theobroma cacao]
 gb|EOY18683.1| Phenylalanine ammonia-lyase 2 [Theobroma cacao]
Length=713

 Score =   216 bits (551),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 106/139 (76%), Positives = 115/139 (83%), Gaps = 3/139 (2%)
 Frame = +3

Query  150  SNDFCIKVDPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQTLTVAQVAAIAARDN  329
            S  FCI  DPLNW  +A+SLKGSHLDEVKRMV EFR P V++GG+TLT+AQVAAIA RD 
Sbjct  15   SPGFCI-TDPLNWGASAESLKGSHLDEVKRMVEEFRKPVVRLGGETLTIAQVAAIANRDA  73

Query  330  AVKVELSEGARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSHRRTKNGHALQQELIRFL  509
             VKVELSE AR  VKASSDWVM  MN GTDSYGVTTGFGATSHRRTK G ALQ+ELIRFL
Sbjct  74   GVKVELSEAARPAVKASSDWVMEGMNRGTDSYGVTTGFGATSHRRTKQGAALQKELIRFL  133

Query  510  NAGIFGTGT--GHTLPHSA  560
            NAG+FG GT   HTLPH+A
Sbjct  134  NAGVFGQGTESCHTLPHTA  152



>ref|XP_004152158.1| PREDICTED: phenylalanine ammonia-lyase-like [Cucumis sativus]
Length=713

 Score =   216 bits (551),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 107/146 (73%), Positives = 118/146 (81%), Gaps = 3/146 (2%)
 Frame = +3

Query  132  AIENGHSNDFC-IKVDPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQTLTVAQVA  308
            A +NG     C    DPLNW +AADS+KGSHLDEVKRMV E+R P VK+GGQTLT++QVA
Sbjct  7    ANQNGSVETLCNTHQDPLNWGLAADSMKGSHLDEVKRMVEEYRRPLVKLGGQTLTISQVA  66

Query  309  AIAARDNAVKVELSEGARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSHRRTKNGHALQ  488
            AIA RDN V VEL+E ARAGVKASSDWVM SM  GTDSYGVTTGFGATSHRRT  G ALQ
Sbjct  67   AIATRDNDVLVELAESARAGVKASSDWVMESMGKGTDSYGVTTGFGATSHRRTNQGGALQ  126

Query  489  QELIRFLNAGIFGTG--TGHTLPHSA  560
            +ELIRFLN+GIFG G  + HTLPHSA
Sbjct  127  KELIRFLNSGIFGNGSESNHTLPHSA  152



>ref|XP_004152155.1| PREDICTED: phenylalanine ammonia-lyase-like [Cucumis sativus]
Length=713

 Score =   216 bits (551),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 107/146 (73%), Positives = 118/146 (81%), Gaps = 3/146 (2%)
 Frame = +3

Query  132  AIENGHSNDFCIK-VDPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQTLTVAQVA  308
            A +NG     C    DPLNW +AADS+KGSHLDEVKRMV E+R P VK+GGQTLT++QVA
Sbjct  7    ANQNGSMESLCSSHQDPLNWGLAADSMKGSHLDEVKRMVEEYRRPLVKLGGQTLTISQVA  66

Query  309  AIAARDNAVKVELSEGARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSHRRTKNGHALQ  488
            AIA RDN V VEL+E ARAGVKASSDWVM SM  GTDSYGVTTGFGATSHRRT  G ALQ
Sbjct  67   AIATRDNDVLVELAESARAGVKASSDWVMESMGKGTDSYGVTTGFGATSHRRTNQGGALQ  126

Query  489  QELIRFLNAGIFGTG--TGHTLPHSA  560
            +ELIRFLN+GIFG G  + HTLPHSA
Sbjct  127  KELIRFLNSGIFGNGSESNHTLPHSA  152



>gb|ACM44926.1| phenylalanine ammonia-lyase [Euphorbia pulcherrima]
Length=721

 Score =   216 bits (551),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 109/155 (70%), Positives = 124/155 (80%), Gaps = 10/155 (6%)
 Frame = +3

Query  126  EGAIENGHSNDFCIKV------DPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQT  287
            +   +NG  N  C         DPL+W +AA+S+KGSHLDEVKRMVAEFR P VK+GG+T
Sbjct  6    QNGFKNGSLNSLCTDSESIRSHDPLSWGLAAESMKGSHLDEVKRMVAEFRKPVVKLGGET  65

Query  288  LTVAQVAAIAARDNA--VKVELSEGARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSHR  461
            LTVAQVAAIAA + +  ++VEL+E ARAGVKASSDWVM+SMNNGTDSYGVTTGFGATSHR
Sbjct  66   LTVAQVAAIAASNGSENIRVELAESARAGVKASSDWVMDSMNNGTDSYGVTTGFGATSHR  125

Query  462  RTKNGHALQQELIRFLNAGIFGTG--TGHTLPHSA  560
            RTK G ALQ+ELIRFLNAGIFG G  T H LPHSA
Sbjct  126  RTKQGGALQKELIRFLNAGIFGNGTETSHILPHSA  160



>ref|XP_004246652.1| PREDICTED: phenylalanine ammonia-lyase-like isoform X2 [Solanum 
lycopersicum]
Length=719

 Score =   216 bits (550),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 110/161 (68%), Positives = 125/161 (78%), Gaps = 15/161 (9%)
 Frame = +3

Query  123  MEGAIENGHSN------DFCIKV----DPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVK  272
            M   + NGH+N      D C K     DPLNWEMAA+SL+GSHLDEVK+MV EFR P VK
Sbjct  1    MASIVPNGHANGKVVAMDLCKKSIIVNDPLNWEMAAESLRGSHLDEVKKMVDEFRKPIVK  60

Query  273  IGGQTLTVAQVAAIAARDN---AVKVELSEGARAGVKASSDWVMNSMNNGTDSYGVTTGF  443
            +GG+TLT+AQVA+IA  DN    VKVELSE +RAGVKASSDWVM+SM+ GTDSYGVTTGF
Sbjct  61   LGGETLTIAQVASIANVDNKSNGVKVELSESSRAGVKASSDWVMDSMSKGTDSYGVTTGF  120

Query  444  GATSHRRTKNGHALQQELIRFLNAGIFGTGT--GHTLPHSA  560
            G TSHRRT NG ALQ++LIRFLNAG+ G GT   HTLPHSA
Sbjct  121  GDTSHRRTTNGSALQKDLIRFLNAGVLGNGTESSHTLPHSA  161



>ref|XP_008449238.1| PREDICTED: phenylalanine ammonia-lyase [Cucumis melo]
Length=708

 Score =   216 bits (550),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 104/131 (79%), Positives = 115/131 (88%), Gaps = 2/131 (2%)
 Frame = +3

Query  174  DPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQTLTVAQVAAIAARDNAVKVELSE  353
            DPLNW +AA++LKGSHLDEVKRMV E+R P VK+GG+TLT++QVAAIA RD  V VELSE
Sbjct  17   DPLNWGVAAEALKGSHLDEVKRMVEEYRRPLVKLGGETLTISQVAAIATRDTDVIVELSE  76

Query  354  GARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSHRRTKNGHALQQELIRFLNAGIFGTG  533
             ARAGVKASSDWVM SMN GTDSYGVTTGFGATSHRRTK G ALQ+ELIRFLNAGIFG+G
Sbjct  77   SARAGVKASSDWVMESMNKGTDSYGVTTGFGATSHRRTKQGGALQKELIRFLNAGIFGSG  136

Query  534  --TGHTLPHSA  560
              + HTLPHSA
Sbjct  137  AESNHTLPHSA  147



>gb|ACS71953.1| phenylalanine ammonia-lyase [Euphorbia pulcherrima]
Length=721

 Score =   216 bits (550),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 109/155 (70%), Positives = 124/155 (80%), Gaps = 10/155 (6%)
 Frame = +3

Query  126  EGAIENGHSNDFCIKV------DPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQT  287
            +   +NG  N  C         DPL+W +AA+S+KGSHLDEVKRMVAEFR P VK+GG+T
Sbjct  6    QNGFKNGSLNSLCTDSESIRSHDPLSWGLAAESMKGSHLDEVKRMVAEFRKPVVKLGGET  65

Query  288  LTVAQVAAIAARDNA--VKVELSEGARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSHR  461
            LTVAQVAAIAA + +  ++VEL+E ARAGVKASSDWVM+SMNNGTDSYGVTTGFGATSHR
Sbjct  66   LTVAQVAAIAASNGSENIRVELAESARAGVKASSDWVMDSMNNGTDSYGVTTGFGATSHR  125

Query  462  RTKNGHALQQELIRFLNAGIFGTG--TGHTLPHSA  560
            RTK G ALQ+ELIRFLNAGIFG G  T H LPHSA
Sbjct  126  RTKQGGALQKELIRFLNAGIFGNGTETSHILPHSA  160



>gb|KGN48162.1| hypothetical protein Csa_6G445750 [Cucumis sativus]
Length=708

 Score =   216 bits (550),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 104/131 (79%), Positives = 115/131 (88%), Gaps = 2/131 (2%)
 Frame = +3

Query  174  DPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQTLTVAQVAAIAARDNAVKVELSE  353
            DPLNW +AA+SLKGSHLDEVKRMV E+R P VK+GG+TLT++QVAAIA RD+ V VELSE
Sbjct  17   DPLNWGVAAESLKGSHLDEVKRMVEEYRRPLVKLGGETLTISQVAAIATRDSDVIVELSE  76

Query  354  GARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSHRRTKNGHALQQELIRFLNAGIFGTG  533
             AR GVKASSDWVM SMN GTDSYGVTTGFGATSHRRTK G ALQ+ELIRFLNAGIFG+G
Sbjct  77   SARVGVKASSDWVMESMNKGTDSYGVTTGFGATSHRRTKQGGALQKELIRFLNAGIFGSG  136

Query  534  --TGHTLPHSA  560
              + HTLPHSA
Sbjct  137  AESDHTLPHSA  147



>dbj|BAF36970.1| phenylalanine ammonia-lyase [Lotus japonicus]
Length=704

 Score =   216 bits (549),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 104/131 (79%), Positives = 115/131 (88%), Gaps = 2/131 (2%)
 Frame = +3

Query  174  DPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQTLTVAQVAAIAARDNAVKVELSE  353
            DPL+W +AA+S+KGSHL+EVKRMVAE+R P VK+GG+TLT+AQVAAIAA +  V VEL E
Sbjct  13   DPLSWGVAAESMKGSHLNEVKRMVAEYRKPVVKLGGETLTIAQVAAIAANEQGVSVELCE  72

Query  354  GARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSHRRTKNGHALQQELIRFLNAGIFGTG  533
             ARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSHRRTKNG+ALQ ELIRFLNAGIFG G
Sbjct  73   SARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSHRRTKNGNALQLELIRFLNAGIFGNG  132

Query  534  T--GHTLPHSA  560
            T   HTLP  A
Sbjct  133  TESTHTLPQPA  143



>ref|XP_010325983.1| PREDICTED: phenylalanine ammonia-lyase-like isoform X3 [Solanum 
lycopersicum]
Length=718

 Score =   216 bits (550),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 109/155 (70%), Positives = 124/155 (80%), Gaps = 13/155 (8%)
 Frame = +3

Query  135  IENGHSN----DFCIKV----DPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQTL  290
            ++NGH N    D C K     DPLNWEMAA+SL+GSHLDEVK+MV EFR P VK+GG+TL
Sbjct  6    VQNGHVNGEAMDLCKKSINVNDPLNWEMAAESLRGSHLDEVKKMVDEFRKPIVKLGGETL  65

Query  291  TVAQVAAIAARDN---AVKVELSEGARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSHR  461
            T+AQVA+IA  DN    VKVELSE +RAGVKASSDWVM+SM+ GTDSYGVTTGFG TSHR
Sbjct  66   TIAQVASIANVDNKSNGVKVELSESSRAGVKASSDWVMDSMSKGTDSYGVTTGFGDTSHR  125

Query  462  RTKNGHALQQELIRFLNAGIFGTGT--GHTLPHSA  560
            RT NG ALQ++LIRFLNAG+ G GT   HTLPHSA
Sbjct  126  RTTNGSALQKDLIRFLNAGVLGNGTESSHTLPHSA  160



>ref|XP_010658395.1| PREDICTED: phenylalanine ammonia-lyase G1 [Vitis vinifera]
Length=723

 Score =   216 bits (550),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 104/131 (79%), Positives = 114/131 (87%), Gaps = 2/131 (2%)
 Frame = +3

Query  174  DPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQTLTVAQVAAIAARDNAVKVELSE  353
            DPLNW MAA+SLKGSHLDEVKRMV E+R   V++GG+TLT++QVAA+A+RD  V VELSE
Sbjct  32   DPLNWNMAAESLKGSHLDEVKRMVEEYRRQVVQLGGETLTISQVAAVASRDTGVTVELSE  91

Query  354  GARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSHRRTKNGHALQQELIRFLNAGIFGTG  533
             AR GVKASSDWVM+SMNNGTDSYGVTTGFGATSHRRTK G ALQ ELIRFLNAGIFG G
Sbjct  92   EAREGVKASSDWVMDSMNNGTDSYGVTTGFGATSHRRTKQGGALQMELIRFLNAGIFGNG  151

Query  534  T--GHTLPHSA  560
            T   HTLPHSA
Sbjct  152  TESCHTLPHSA  162



>gb|AAN52280.1|AF480620_1 phenylalanine ammonia-lyase [Populus tremuloides]
Length=711

 Score =   216 bits (549),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 104/131 (79%), Positives = 113/131 (86%), Gaps = 2/131 (2%)
 Frame = +3

Query  174  DPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQTLTVAQVAAIAARDNAVKVELSE  353
            DPLNW MAA+SLKGSHLDEVKRM+ E+R P VK+GG+TLT+ QV AIA+RD  VKVELSE
Sbjct  20   DPLNWGMAAESLKGSHLDEVKRMIDEYRKPVVKLGGETLTIGQVTAIASRDIGVKVELSE  79

Query  354  GARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSHRRTKNGHALQQELIRFLNAGIFGTG  533
             AR GVKASSDWVM+SMN GTDSYGVTTGFGATSHRRTK G  LQ+ELIRFLNAGIFG G
Sbjct  80   EARVGVKASSDWVMDSMNKGTDSYGVTTGFGATSHRRTKQGGELQKELIRFLNAGIFGNG  139

Query  534  TG--HTLPHSA  560
            T   HTLPHSA
Sbjct  140  TESTHTLPHSA  150



>emb|CDX91331.1| BnaC04g08190D [Brassica napus]
Length=380

 Score =   209 bits (531),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 102/131 (78%), Positives = 110/131 (84%), Gaps = 2/131 (2%)
 Frame = +3

Query  174  DPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQTLTVAQVAAIAARDNAVKVELSE  353
            DPLNW  AA+ +KGSHLDEVKRMV EFR P V +GG+TLT+ QVAAI+   N VKVELSE
Sbjct  28   DPLNWGAAAEQMKGSHLDEVKRMVMEFRKPVVNLGGETLTIGQVAAISTVGNGVKVELSE  87

Query  354  GARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSHRRTKNGHALQQELIRFLNAGIFGT-  530
             ARAGVKASSDWVM SM  GTDSYGVTTGFGATSHRRTKNG ALQ+ELIRFLNAGIFG+ 
Sbjct  88   TARAGVKASSDWVMESMGKGTDSYGVTTGFGATSHRRTKNGVALQKELIRFLNAGIFGST  147

Query  531  -GTGHTLPHSA  560
              T HTLPHSA
Sbjct  148  KETCHTLPHSA  158



>emb|CDX74991.1| BnaA05g07370D [Brassica napus]
Length=380

 Score =   209 bits (531),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 102/131 (78%), Positives = 110/131 (84%), Gaps = 2/131 (2%)
 Frame = +3

Query  174  DPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQTLTVAQVAAIAARDNAVKVELSE  353
            DPLNW  AA+ +KGSHLDEVKRMV EFR P V +GG+TLT+ QVAAI+   N VKVELSE
Sbjct  28   DPLNWGAAAEQMKGSHLDEVKRMVMEFRKPVVNLGGETLTIGQVAAISTVGNGVKVELSE  87

Query  354  GARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSHRRTKNGHALQQELIRFLNAGIFGT-  530
             ARAGVKASSDWVM SM  GTDSYGVTTGFGATSHRRTKNG ALQ+ELIRFLNAGIFG+ 
Sbjct  88   TARAGVKASSDWVMESMGKGTDSYGVTTGFGATSHRRTKNGVALQKELIRFLNAGIFGST  147

Query  531  -GTGHTLPHSA  560
              T HTLPHSA
Sbjct  148  KETCHTLPHSA  158



>ref|XP_004173741.1| PREDICTED: phenylalanine ammonia-lyase-like, partial [Cucumis 
sativus]
Length=141

 Score =   201 bits (510),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 98/135 (73%), Positives = 110/135 (81%), Gaps = 1/135 (1%)
 Frame = +3

Query  132  AIENGHSNDFC-IKVDPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQTLTVAQVA  308
            A +NG     C    DPLNW +AA+S+KGSHLDEVKRMV E+R P VK+GG+TLT++QVA
Sbjct  7    ANQNGSVETLCNTHQDPLNWGLAAESMKGSHLDEVKRMVEEYRRPLVKLGGETLTISQVA  66

Query  309  AIAARDNAVKVELSEGARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSHRRTKNGHALQ  488
            AIA RDN V VEL+E ARAGVKASSDWVM SM  GTDSYGVTTGFGATSHRRT  G ALQ
Sbjct  67   AIATRDNDVLVELAESARAGVKASSDWVMESMGKGTDSYGVTTGFGATSHRRTNQGGALQ  126

Query  489  QELIRFLNAGIFGTG  533
            +ELIRFLN+GIFG G
Sbjct  127  KELIRFLNSGIFGNG  141



>gb|AFZ78651.1| phenylalanine ammonia-lyase [Populus tomentosa]
Length=711

 Score =   215 bits (548),  Expect = 4e-62, Method: Compositional matrix adjust.
 Identities = 103/131 (79%), Positives = 113/131 (86%), Gaps = 2/131 (2%)
 Frame = +3

Query  174  DPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQTLTVAQVAAIAARDNAVKVELSE  353
            DPLNW MAA+SLKGSHLDEVKRM+ E+R P +K+GG+TLT+ QV AIA+RD  VKVELSE
Sbjct  20   DPLNWGMAAESLKGSHLDEVKRMIDEYRKPVIKLGGETLTIGQVTAIASRDVGVKVELSE  79

Query  354  GARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSHRRTKNGHALQQELIRFLNAGIFGTG  533
             AR GVKASSDWVM+SMN GTDSYGVTTGFGATSHRRTK G  LQ+ELIRFLNAGIFG G
Sbjct  80   EARVGVKASSDWVMDSMNKGTDSYGVTTGFGATSHRRTKQGGELQKELIRFLNAGIFGNG  139

Query  534  T--GHTLPHSA  560
            T   HTLPHSA
Sbjct  140  TESTHTLPHSA  150



>gb|KEH24019.1| phenylalanine ammonia-lyase-like protein [Medicago truncatula]
Length=724

 Score =   215 bits (548),  Expect = 5e-62, Method: Compositional matrix adjust.
 Identities = 106/161 (66%), Positives = 127/161 (79%), Gaps = 14/161 (9%)
 Frame = +3

Query  120  TMEGAIENGHSND-FCI-----------KVDPLNWEMAADSLKGSHLDEVKRMVAEFRNP  263
            T+  AI    +N+ FC+           + DPLNW +AA+++KGSH+DEVKRMV E+R P
Sbjct  3    TISAAITKNSANESFCLIHAKNNNMKVNEADPLNWGVAAEAMKGSHIDEVKRMVEEYRKP  62

Query  264  AVKIGGQTLTVAQVAAIAARDNAVKVELSEGARAGVKASSDWVMNSMNNGTDSYGVTTGF  443
             V++GG+TLT++QVAAIAA D+ V+VELSE ARAGV+ASSDWVM SMN GTDSYGVTTGF
Sbjct  63   VVRLGGETLTISQVAAIAAHDHGVQVELSESARAGVEASSDWVMESMNKGTDSYGVTTGF  122

Query  444  GATSHRRTKNGHALQQELIRFLNAGIFGTGT--GHTLPHSA  560
            GATSHRRTK G ALQ+ELIRFLNAGIFG GT   HTLPH+A
Sbjct  123  GATSHRRTKQGGALQKELIRFLNAGIFGNGTESNHTLPHTA  163



>gb|ADO64252.1| PAL [Epimedium sagittatum]
Length=708

 Score =   215 bits (547),  Expect = 5e-62, Method: Compositional matrix adjust.
 Identities = 102/146 (70%), Positives = 121/146 (83%), Gaps = 2/146 (1%)
 Frame = +3

Query  129  GAIENGHSNDFCIKVDPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQTLTVAQVA  308
            G++   +S   C+  DPLNW MAA+S+KGSHLDEVKRMV E+R   V++GG++LT++QVA
Sbjct  2    GSLVQENSIALCLNKDPLNWNMAAESMKGSHLDEVKRMVEEYRKGVVRLGGESLTISQVA  61

Query  309  AIAARDNAVKVELSEGARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSHRRTKNGHALQ  488
            AIA+ D  V VEL+E +RAGVKASSDWVM+SMN GTDSYGVTTGFGATSHRRTK G ALQ
Sbjct  62   AIASHDQGVMVELNESSRAGVKASSDWVMDSMNKGTDSYGVTTGFGATSHRRTKQGGALQ  121

Query  489  QELIRFLNAGIFGTG--TGHTLPHSA  560
            +ELIRFLNAG+FG G  T HTLPHSA
Sbjct  122  KELIRFLNAGVFGNGTETSHTLPHSA  147



>ref|XP_002322884.2| phenylalanine ammonia-lyase family protein [Populus trichocarpa]
 gb|ACC63887.1| phenylalanine ammonia-lyase [Populus trichocarpa]
 gb|EEF04645.2| phenylalanine ammonia-lyase family protein [Populus trichocarpa]
Length=715

 Score =   215 bits (547),  Expect = 5e-62, Method: Compositional matrix adjust.
 Identities = 107/154 (69%), Positives = 126/154 (82%), Gaps = 8/154 (5%)
 Frame = +3

Query  123  MEGAIENGHSN----DFCI-KVDPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQT  287
            ME   +NG+ N      C+ ++DPL+W +AA+++KGSHLDEVKRMVA++R P VK+GG+T
Sbjct  1    METVTKNGYQNGSLESLCVNQLDPLSWGVAAEAMKGSHLDEVKRMVADYRKPVVKLGGET  60

Query  288  LTVAQVAAIAARDNA-VKVELSEGARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSHRR  464
            LT+AQVA+IA  D   VKVELSE AR GVKASSDWVM+SM+ GTDSYGVTTGFGATSHRR
Sbjct  61   LTIAQVASIAGHDTGDVKVELSESARPGVKASSDWVMDSMDKGTDSYGVTTGFGATSHRR  120

Query  465  TKNGHALQQELIRFLNAGIFGTG--TGHTLPHSA  560
            TK G ALQ+ELIRFLNAGIFG G  T HTLPHSA
Sbjct  121  TKQGGALQKELIRFLNAGIFGNGTETCHTLPHSA  154



>gb|AEX32784.1| phenylalanine ammonia-lyase [Vitis vinifera]
Length=710

 Score =   215 bits (547),  Expect = 6e-62, Method: Compositional matrix adjust.
 Identities = 104/136 (76%), Positives = 117/136 (86%), Gaps = 3/136 (2%)
 Frame = +3

Query  159  FCIKVDPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQTLTVAQVAAIAARDNAVK  338
            FC+  DPLNW MAA++LKGSHLDEVKRMVAE+R P V++GG+TLT++QVAAIA R+  V 
Sbjct  15   FCVS-DPLNWGMAAETLKGSHLDEVKRMVAEYRKPVVRLGGETLTISQVAAIAGREGDVS  73

Query  339  VELSEGARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSHRRTKNGHALQQELIRFLNAG  518
            VELSE ARAGV ASS+WVM SM+ GTDSYGVTTGFGATSHRRTK G ALQ+ELIRFLNAG
Sbjct  74   VELSETARAGVNASSEWVMESMSKGTDSYGVTTGFGATSHRRTKQGGALQKELIRFLNAG  133

Query  519  IFGTGT--GHTLPHSA  560
            IFG GT   HTLPHSA
Sbjct  134  IFGNGTESCHTLPHSA  149



>gb|AAA34179.2| phenylalanine ammonia lyase [Solanum lycopersicum]
Length=704

 Score =   214 bits (546),  Expect = 7e-62, Method: Compositional matrix adjust.
 Identities = 108/142 (76%), Positives = 119/142 (84%), Gaps = 7/142 (5%)
 Frame = +3

Query  156  DFCIKV--DPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQTLTVAQVAAIAARD-  326
            D C K   DPLNWEMAADSL+ SHLDEVK+MV EFR P VK+GG+TL+VAQVA+IA  D 
Sbjct  2    DLCKKSINDPLNWEMAADSLRQSHLDEVKKMVDEFRKPIVKLGGETLSVAQVASIANVDD  61

Query  327  --NAVKVELSEGARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSHRRTKNGHALQQELI  500
              N VKVELSE ARAGVKASSDWVM+SM+ GTDSYGVT GFGATSHRRTKNG ALQ+ELI
Sbjct  62   KSNGVKVELSESARAGVKASSDWVMDSMSKGTDSYGVTAGFGATSHRRTKNGGALQKELI  121

Query  501  RFLNAGIFGTG--TGHTLPHSA  560
            RFLNAG+FG G  + HTLPHSA
Sbjct  122  RFLNAGVFGNGIESFHTLPHSA  143



>gb|KEH24018.1| phenylalanine ammonia-lyase-like protein [Medicago truncatula]
Length=724

 Score =   215 bits (547),  Expect = 7e-62, Method: Compositional matrix adjust.
 Identities = 106/161 (66%), Positives = 127/161 (79%), Gaps = 14/161 (9%)
 Frame = +3

Query  120  TMEGAIENGHSND-FCI-----------KVDPLNWEMAADSLKGSHLDEVKRMVAEFRNP  263
            T+  AI    +N+ FC+           + DPLNW +AA+++KGSHLDEVKRMV E+R P
Sbjct  3    TISAAITKNSANESFCLIHAKNNNMKVNEADPLNWGVAAEAMKGSHLDEVKRMVEEYRKP  62

Query  264  AVKIGGQTLTVAQVAAIAARDNAVKVELSEGARAGVKASSDWVMNSMNNGTDSYGVTTGF  443
             V++GG+TLT++QVAAIAA D+ V+VELSE ARAGV+ASSDWVM SMN GTDSYGVTTGF
Sbjct  63   VVRLGGETLTISQVAAIAAHDHGVQVELSESARAGVEASSDWVMESMNKGTDSYGVTTGF  122

Query  444  GATSHRRTKNGHALQQELIRFLNAGIFGTG--TGHTLPHSA  560
            GATSHRRTK G ALQ+ELIRFLNAGIFG G  + HTLPH+A
Sbjct  123  GATSHRRTKQGGALQKELIRFLNAGIFGKGSESSHTLPHTA  163



>gb|KDP44384.1| hypothetical protein JCGZ_20064 [Jatropha curcas]
Length=712

 Score =   214 bits (546),  Expect = 8e-62, Method: Compositional matrix adjust.
 Identities = 104/131 (79%), Positives = 112/131 (85%), Gaps = 2/131 (2%)
 Frame = +3

Query  174  DPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQTLTVAQVAAIAARDNAVKVELSE  353
            DPLNW   A+SLKGSHLDEVKRM+ E+R P VK+GG+TLT+AQV AIA RD  VKVELSE
Sbjct  21   DPLNWGAVAESLKGSHLDEVKRMINEYRKPVVKLGGETLTIAQVTAIANRDAGVKVELSE  80

Query  354  GARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSHRRTKNGHALQQELIRFLNAGIFGTG  533
             ARAGVKASSDWVM+SMN GTDSYGVTTGFGATSHRRTK G ALQ+ELIRFLNAGIFG G
Sbjct  81   AARAGVKASSDWVMDSMNKGTDSYGVTTGFGATSHRRTKQGGALQRELIRFLNAGIFGNG  140

Query  534  --TGHTLPHSA  560
              T H LPHSA
Sbjct  141  TETCHILPHSA  151



>dbj|BAF36968.1| phenylalanine ammonia-lyase [Lotus japonicus]
Length=690

 Score =   214 bits (545),  Expect = 8e-62, Method: Compositional matrix adjust.
 Identities = 104/129 (81%), Positives = 113/129 (88%), Gaps = 2/129 (2%)
 Frame = +3

Query  180  LNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQTLTVAQVAAIAARDNAVKVELSEGA  359
            L+W +AA+S+KGSHLDEVKRMVAE+R P VK+GG+TLT+AQVAAIAA D  V VEL E A
Sbjct  1    LSWGVAAESMKGSHLDEVKRMVAEYRKPVVKLGGETLTIAQVAAIAANDQGVSVELCESA  60

Query  360  RAGVKASSDWVMNSMNNGTDSYGVTTGFGATSHRRTKNGHALQQELIRFLNAGIFGTG--  533
            RAGVKASSDWVMNSMNNGTDSYGVTTGFGATSHRRTKNG+ALQ ELIRFLNAGIFG G  
Sbjct  61   RAGVKASSDWVMNSMNNGTDSYGVTTGFGATSHRRTKNGNALQLELIRFLNAGIFGNGTE  120

Query  534  TGHTLPHSA  560
            T HTLP  A
Sbjct  121  TNHTLPQPA  129



>ref|XP_008454138.1| PREDICTED: phenylalanine ammonia-lyase-like [Cucumis melo]
Length=713

 Score =   214 bits (546),  Expect = 9e-62, Method: Compositional matrix adjust.
 Identities = 106/146 (73%), Positives = 118/146 (81%), Gaps = 3/146 (2%)
 Frame = +3

Query  132  AIENGHSNDFC-IKVDPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQTLTVAQVA  308
            A +NG     C    DPLNW +AADS+KGSHLDEVKRMV E+R P VK+GG+TLT++QVA
Sbjct  7    ANQNGSVESLCNSHQDPLNWGLAADSMKGSHLDEVKRMVEEYRRPLVKLGGETLTISQVA  66

Query  309  AIAARDNAVKVELSEGARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSHRRTKNGHALQ  488
            AIA RDN V VEL+E ARAGVKASSDWVM SM  GTDSYGVTTGFGATSHRRT  G ALQ
Sbjct  67   AIATRDNDVVVELAESARAGVKASSDWVMESMGKGTDSYGVTTGFGATSHRRTNQGGALQ  126

Query  489  QELIRFLNAGIFGTG--TGHTLPHSA  560
            +ELIRFLN+GIFG G  + HTLPHSA
Sbjct  127  KELIRFLNSGIFGNGSESNHTLPHSA  152



>gb|EYU34451.1| hypothetical protein MIMGU_mgv1a002104mg [Erythranthe guttata]
Length=714

 Score =   214 bits (546),  Expect = 9e-62, Method: Compositional matrix adjust.
 Identities = 115/148 (78%), Positives = 125/148 (84%), Gaps = 5/148 (3%)
 Frame = +3

Query  132  AIENGH--SNDFCIKV-DPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQTLTVAQ  302
            A ENGH  SN +C+K  DPLNW +AA+ LKGSHLDEVKRMV EFR P V +GG+TLT+AQ
Sbjct  6    ATENGHHNSNGYCVKQKDPLNWGLAAEGLKGSHLDEVKRMVEEFRKPVVNLGGKTLTIAQ  65

Query  303  VAAIAARDNAVKVELSEGARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSHRRTKNGHA  482
            VAAIAA DNAV VEL+E ARAGVKASSDWVM+SMN GTDSYGVTTGFGATSHRRTK G A
Sbjct  66   VAAIAATDNAVAVELAEAARAGVKASSDWVMDSMNKGTDSYGVTTGFGATSHRRTKQGGA  125

Query  483  LQQELIRFLNAGIFGTGT--GHTLPHSA  560
            LQ+ELIRFLNAGIFG GT   H LPHSA
Sbjct  126  LQKELIRFLNAGIFGNGTESSHMLPHSA  153



>gb|AJO53272.1| phenylalanine ammonia-lyase [Pogostemon cablin]
Length=711

 Score =   214 bits (545),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 105/149 (70%), Positives = 122/149 (82%), Gaps = 8/149 (5%)
 Frame = +3

Query  135  IENGHSND-FCIK-----VDPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQTLTV  296
            +ENG++ D  C++     VDPLNW  AA++L+GSHLDEVKRMV EFR P V++GG+TLT+
Sbjct  1    MENGNNGDGLCVQSRNDVVDPLNWNAAAEALRGSHLDEVKRMVEEFRKPVVRLGGETLTI  60

Query  297  AQVAAIAARDNAVKVELSEGARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSHRRTKNG  476
             QVAA+A R+ AV VEL+E AR GVKASSDWVM SMNNGTDSYGVTTGFGATSHRRTK G
Sbjct  61   GQVAAVATREAAVTVELTETAREGVKASSDWVMESMNNGTDSYGVTTGFGATSHRRTKQG  120

Query  477  HALQQELIRFLNAGIFG--TGTGHTLPHS  557
             ALQ+ELIRFLNAGIFG  T + H LPHS
Sbjct  121  GALQKELIRFLNAGIFGNNTESSHMLPHS  149



>ref|XP_002268181.1| PREDICTED: phenylalanine ammonia-lyase [Vitis vinifera]
 ref|XP_010662070.1| PREDICTED: phenylalanine ammonia-lyase [Vitis vinifera]
Length=710

 Score =   214 bits (545),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 104/136 (76%), Positives = 117/136 (86%), Gaps = 3/136 (2%)
 Frame = +3

Query  159  FCIKVDPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQTLTVAQVAAIAARDNAVK  338
            FC+  DPLNW MAA++LKGSHLDEVKRMVAE+R P V++GG+TLT++QVAAIA R+  V 
Sbjct  15   FCVS-DPLNWGMAAETLKGSHLDEVKRMVAEYRKPLVRLGGETLTISQVAAIAGREGDVS  73

Query  339  VELSEGARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSHRRTKNGHALQQELIRFLNAG  518
            VELSE ARAGV ASS+WVM SM+ GTDSYGVTTGFGATSHRRTK G ALQ+ELIRFLNAG
Sbjct  74   VELSETARAGVNASSEWVMESMSKGTDSYGVTTGFGATSHRRTKQGGALQKELIRFLNAG  133

Query  519  IFGTGT--GHTLPHSA  560
            IFG GT   HTLPHSA
Sbjct  134  IFGNGTESCHTLPHSA  149



>sp|Q9M568.1|PAL1_RUBID RecName: Full=Phenylalanine ammonia-lyase 1; AltName: Full=RiPAL1 
[Rubus idaeus]
 gb|AAF40223.1|AF237954_1 phenylalanine ammonia-lyase 1 [Rubus idaeus]
Length=710

 Score =   214 bits (545),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 102/142 (72%), Positives = 118/142 (83%), Gaps = 2/142 (1%)
 Frame = +3

Query  141  NGHSNDFCIKVDPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQTLTVAQVAAIAA  320
            NG    FC   DPLNW MAA+SLKGSH+DE+KRMV+++R P VK+GG+TLT+ QVAAIA+
Sbjct  8    NGAVESFCEGHDPLNWNMAAESLKGSHVDELKRMVSDYRKPVVKLGGETLTIGQVAAIAS  67

Query  321  RDNAVKVELSEGARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSHRRTKNGHALQQELI  500
             D  V+VELSE  RAGVKASSDWVM+SM  GTDSYGVTTGFGATSHRRTKNG ALQ+ELI
Sbjct  68   HDGGVRVELSEEKRAGVKASSDWVMDSMGKGTDSYGVTTGFGATSHRRTKNGGALQRELI  127

Query  501  RFLNAGIFGTG--TGHTLPHSA  560
            RFLNAGIFG+   + H LPH+A
Sbjct  128  RFLNAGIFGSSLDSTHKLPHTA  149



>gb|ABM67591.1| phenylalanin ammonia-lyase [Vitis vinifera]
Length=710

 Score =   214 bits (545),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 104/136 (76%), Positives = 117/136 (86%), Gaps = 3/136 (2%)
 Frame = +3

Query  159  FCIKVDPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQTLTVAQVAAIAARDNAVK  338
            FC+  DPLNW MAA++LKGSHLDEVKRMVAE+R P V++GG+TLT++QVAAIA R+  V 
Sbjct  15   FCVS-DPLNWGMAAETLKGSHLDEVKRMVAEYRKPVVRLGGETLTISQVAAIAGREGDVG  73

Query  339  VELSEGARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSHRRTKNGHALQQELIRFLNAG  518
            VELSE ARAGV ASS+WVM SM+ GTDSYGVTTGFGATSHRRTK G ALQ+ELIRFLNAG
Sbjct  74   VELSETARAGVNASSEWVMESMSKGTDSYGVTTGFGATSHRRTKQGGALQKELIRFLNAG  133

Query  519  IFGTGT--GHTLPHSA  560
            IFG GT   HTLPHSA
Sbjct  134  IFGNGTESCHTLPHSA  149



>sp|O23865.1|PAL1_DAUCA RecName: Full=Phenylalanine ammonia-lyase 1 [Daucus carota]
 dbj|BAA23367.1| phenylalanine ammonia-lyase [Daucus carota]
Length=708

 Score =   214 bits (544),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 105/138 (76%), Positives = 119/138 (86%), Gaps = 4/138 (3%)
 Frame = +3

Query  153  NDFCIKVDPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQTLTVAQVAAIAARDNA  332
            N  C++ DPLNW MAA++L GSHLDEVKRMVAEFR P V++GG+TLTV+QVAAIAA   +
Sbjct  12   NGLCMQKDPLNWGMAAEALTGSHLDEVKRMVAEFRKPMVQLGGETLTVSQVAAIAA--GS  69

Query  333  VKVELSEGARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSHRRTKNGHALQQELIRFLN  512
            VKVEL+E ARAGVKASSDWVM SMN GTDSYGVTTGFGATSHRRTK G ALQ+ELIRFLN
Sbjct  70   VKVELAESARAGVKASSDWVMESMNKGTDSYGVTTGFGATSHRRTKQGGALQKELIRFLN  129

Query  513  AGIFGTG--TGHTLPHSA  560
            AGIFG+G  + + LPHSA
Sbjct  130  AGIFGSGNDSSNILPHSA  147



>gb|ACT21093.1| phenylalanine ammonia-lyase [Camellia oleifera]
Length=706

 Score =   214 bits (544),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 107/148 (72%), Positives = 123/148 (83%), Gaps = 5/148 (3%)
 Frame = +3

Query  123  MEGAIENGHSNDFCIKVDPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQTLTVAQ  302
            ME   ENG+ N   IK DPL+WE+AADS+KGSHLDEVKRMV EFR PA+++GG+TLT++Q
Sbjct  1    MEFCHENGNGNGHVIK-DPLSWELAADSMKGSHLDEVKRMVREFRQPAIRLGGETLTISQ  59

Query  303  VAAIAARDNAVKVELSEGARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSHRRTKNGHA  482
            VAA+AA    + VELSE ARA V+ASS+WVM SMN GTDSYGVTTGFGATSHRRTK G A
Sbjct  60   VAAVAA--GCLPVELSEAARAAVQASSEWVMESMNKGTDSYGVTTGFGATSHRRTKQGGA  117

Query  483  LQQELIRFLNAGIFGTGT--GHTLPHSA  560
            LQ+ELIRFLNAGIFG GT   HTLPHS+
Sbjct  118  LQKELIRFLNAGIFGNGTESCHTLPHSS  145



>gb|AAF40224.1|AF237955_1 phenylalanine ammonia-lyase 2 [Rubus idaeus]
Length=730

 Score =   214 bits (545),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 107/158 (68%), Positives = 124/158 (78%), Gaps = 13/158 (8%)
 Frame = +3

Query  126  EGAIENGHSND-FCIKV----------DPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVK  272
            +  I+NG  +D  CIK           DPLNW  AA+S+ GSHLDEV+RMVAE+R P VK
Sbjct  12   QNGIQNGSLDDGLCIKTESIKTGYSVSDPLNWGAAAESMTGSHLDEVRRMVAEYRKPVVK  71

Query  273  IGGQTLTVAQVAAIAARDNAVKVELSEGARAGVKASSDWVMNSMNNGTDSYGVTTGFGAT  452
            +GG+TLT++QVAAIA  D+ VKVEL+E ARAGVKASSDWVM+SMN GTDSYGVTTGFGAT
Sbjct  72   LGGETLTISQVAAIANHDSGVKVELAESARAGVKASSDWVMDSMNKGTDSYGVTTGFGAT  131

Query  453  SHRRTKNGHALQQELIRFLNAGIF--GTGTGHTLPHSA  560
            SHRRTK G ALQ+ELIRFLNAG+   GT + HTLPHSA
Sbjct  132  SHRRTKQGAALQKELIRFLNAGVLRNGTESAHTLPHSA  169



>ref|XP_008449240.1| PREDICTED: phenylalanine ammonia-lyase 1-like [Cucumis melo]
Length=714

 Score =   214 bits (544),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 106/151 (70%), Positives = 123/151 (81%), Gaps = 10/151 (7%)
 Frame = +3

Query  138  ENGHSN--DFCIKV------DPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQTLT  293
            E+G+ N  +FCI        DPLNW  AA+SLKGSHL+EVKRMV E+R P VK+GG+TLT
Sbjct  3    ESGYQNGVEFCIGARSNSNNDPLNWGAAAESLKGSHLEEVKRMVEEYRRPVVKLGGETLT  62

Query  294  VAQVAAIAARDNAVKVELSEGARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSHRRTKN  473
            ++QVAAIA+RD+ V VELSE AR GV+ASS WVM+SMN GTDSYGVTTGFGATSHRRTK 
Sbjct  63   ISQVAAIASRDSGVVVELSESARGGVEASSKWVMDSMNQGTDSYGVTTGFGATSHRRTKE  122

Query  474  GHALQQELIRFLNAGIFGTGT--GHTLPHSA  560
            G ALQ+ELIRFLNAG+FG GT   HTLPHS+
Sbjct  123  GGALQRELIRFLNAGVFGRGTESSHTLPHSS  153



>dbj|BAF36967.1| phenylalanine ammonia-lyase [Lotus japonicus]
Length=730

 Score =   214 bits (545),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 111/160 (69%), Positives = 122/160 (76%), Gaps = 19/160 (12%)
 Frame = +3

Query  138  ENGHSNDFCIKV----DPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQTLTVAQV  305
            E+ +S+ FC       DPL+W +AADS+KGSHLDEVKRMVAE+R P VK+GG+TLT+AQV
Sbjct  10   ESLNSSIFCTAAKAGSDPLSWGVAADSMKGSHLDEVKRMVAEYRKPVVKLGGETLTIAQV  69

Query  306  AAIAARDNAVKVELSEGARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSHRRTKNGHAL  485
            AAIAA D  V VEL E ARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSHRRTKNG+AL
Sbjct  70   AAIAANDQGVSVELCESARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSHRRTKNGNAL  129

Query  486  QQELI-------------RFLNAGIFGTG--TGHTLPHSA  560
            Q ELI             RFLNAGIFG G  T HTLP  A
Sbjct  130  QLELIRIKVVDVNMFLFFRFLNAGIFGNGTETSHTLPQPA  169



>sp|P45730.1|PALY_POPTR RecName: Full=Phenylalanine ammonia-lyase [Populus trichocarpa]
 pir||JQ2265 phenylalanine ammonia-lyase (EC 4.3.1.5) - western balsam poplar 
x cottonwood
 gb|AAA33805.1| phenylalanine ammonia lyase [Populus trichocarpa x Populus deltoides]
Length=715

 Score =   214 bits (544),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 107/154 (69%), Positives = 125/154 (81%), Gaps = 8/154 (5%)
 Frame = +3

Query  123  MEGAIENGHSN----DFCI-KVDPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQT  287
            ME   +NG+ N      C+ + DPL+W +AA+++KGSHLDEVKRMVA++R P VK+GG+T
Sbjct  1    METVTKNGYQNGSLESLCVNQRDPLSWGVAAEAMKGSHLDEVKRMVADYRKPVVKLGGET  60

Query  288  LTVAQVAAIAARDNA-VKVELSEGARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSHRR  464
            LT+AQVA+IA  D   VKVELSE AR GVKASSDWVM+SM+ GTDSYGVTTGFGATSHRR
Sbjct  61   LTIAQVASIAGHDTGDVKVELSESARPGVKASSDWVMDSMDKGTDSYGVTTGFGATSHRR  120

Query  465  TKNGHALQQELIRFLNAGIFGTG--TGHTLPHSA  560
            TK G ALQ+ELIRFLNAGIFG G  T HTLPHSA
Sbjct  121  TKQGGALQKELIRFLNAGIFGNGTETCHTLPHSA  154



>ref|XP_006381441.1| phenylalanine ammonia-lyase family protein [Populus trichocarpa]
 gb|ACC63888.1| phenylalanine ammonia-lyase [Populus trichocarpa]
 gb|ERP59238.1| phenylalanine ammonia-lyase family protein [Populus trichocarpa]
Length=714

 Score =   213 bits (543),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 105/153 (69%), Positives = 121/153 (79%), Gaps = 3/153 (2%)
 Frame = +3

Query  111  FNTTMEGAIENGHSNDFCIKVDPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQTL  290
              T  +   +NG S   C + DPL+W +AA+++KGSHLDEVKRMVAE+R P V + GQTL
Sbjct  1    METITKNGYQNGSSESLCTQRDPLSWGVAAEAMKGSHLDEVKRMVAEYRKPVVNLAGQTL  60

Query  291  TVAQVAAIAARDNA-VKVELSEGARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSHRRT  467
            T+AQVA+IA  D + VKVELSE AR  VKASSDWVM+SM+ GTDSYGVTTGFGATSHRRT
Sbjct  61   TIAQVASIAGHDASNVKVELSESARPRVKASSDWVMDSMDKGTDSYGVTTGFGATSHRRT  120

Query  468  KNGHALQQELIRFLNAGIFGTG--TGHTLPHSA  560
            K G ALQ+ELIRFLNAGIFG G  T HTLPHSA
Sbjct  121  KQGGALQKELIRFLNAGIFGNGTETCHTLPHSA  153



>ref|XP_008454137.1| PREDICTED: phenylalanine ammonia-lyase-like [Cucumis melo]
Length=713

 Score =   213 bits (543),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 105/146 (72%), Positives = 119/146 (82%), Gaps = 3/146 (2%)
 Frame = +3

Query  132  AIENGHSNDFCIK-VDPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQTLTVAQVA  308
            A +NG +   C    DPLNW +AADS+KGSHLDEVKRMV E+R P VK+GG+TLT++QVA
Sbjct  7    ANQNGSTESLCSSHQDPLNWGLAADSMKGSHLDEVKRMVEEYRRPLVKLGGETLTISQVA  66

Query  309  AIAARDNAVKVELSEGARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSHRRTKNGHALQ  488
            AIA RDN V VEL+E ARAGVKASSDWVM SM  GTDSYGVTTGFGATSHRRT  G ALQ
Sbjct  67   AIATRDNDVVVELAESARAGVKASSDWVMESMGKGTDSYGVTTGFGATSHRRTNQGGALQ  126

Query  489  QELIRFLNAGIFG--TGTGHTLPHSA  560
            +ELIRFLN+GIFG  + + HTLPHSA
Sbjct  127  KELIRFLNSGIFGNESESNHTLPHSA  152



>gb|ACE95170.1| phenylalanine ammonia-lyase [Populus tomentosa]
Length=714

 Score =   213 bits (543),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 105/153 (69%), Positives = 121/153 (79%), Gaps = 3/153 (2%)
 Frame = +3

Query  111  FNTTMEGAIENGHSNDFCIKVDPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQTL  290
              T  +   +NG S   C + DPL+W +AA+++KGSHLDEVKRMVAE+R P V + GQTL
Sbjct  1    METITKNGYQNGSSESLCTQRDPLSWGVAAEAMKGSHLDEVKRMVAEYRKPVVNLAGQTL  60

Query  291  TVAQVAAIAARDNA-VKVELSEGARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSHRRT  467
            T+AQVA+IA  D + VKVELSE AR  VKASSDWVM+SM+ GTDSYGVTTGFGATSHRRT
Sbjct  61   TIAQVASIAGHDASNVKVELSESARPRVKASSDWVMDSMDKGTDSYGVTTGFGATSHRRT  120

Query  468  KNGHALQQELIRFLNAGIFGTG--TGHTLPHSA  560
            K G ALQ+ELIRFLNAGIFG G  T HTLPHSA
Sbjct  121  KQGGALQKELIRFLNAGIFGNGTETCHTLPHSA  153



>gb|AFZ78650.1| phenylalanine ammonia-lyase [Populus tomentosa]
Length=714

 Score =   213 bits (543),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 105/153 (69%), Positives = 121/153 (79%), Gaps = 3/153 (2%)
 Frame = +3

Query  111  FNTTMEGAIENGHSNDFCIKVDPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQTL  290
              T  +   +NG S   C + DPL+W +AA+++KGSHLDEVKRMVAE+R P V + GQTL
Sbjct  1    METITKNGYQNGSSESLCTQRDPLSWGVAAEAMKGSHLDEVKRMVAEYRKPVVNLAGQTL  60

Query  291  TVAQVAAIAARDNA-VKVELSEGARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSHRRT  467
            T+AQVA+IA  D + VKVELSE AR  VKASSDWVM+SM+ GTDSYGVTTGFGATSHRRT
Sbjct  61   TIAQVASIAGHDASNVKVELSESARPRVKASSDWVMDSMDKGTDSYGVTTGFGATSHRRT  120

Query  468  KNGHALQQELIRFLNAGIFGTG--TGHTLPHSA  560
            K G ALQ+ELIRFLNAGIFG G  T HTLPHSA
Sbjct  121  KQGGALQKELIRFLNAGIFGNGTETCHTLPHSA  153



>gb|AFU90757.1| phenylalanine ammonia-lyase [Epimedium sagittatum]
Length=716

 Score =   213 bits (543),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 101/142 (71%), Positives = 119/142 (84%), Gaps = 2/142 (1%)
 Frame = +3

Query  141  NGHSNDFCIKVDPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQTLTVAQVAAIAA  320
            NG  +  C+K DPLNW +AA+SL+GSHLDEVKRMV EF  P VK+ GQ+LT++QVAA+A 
Sbjct  14   NGSIDGLCMKSDPLNWGLAAESLQGSHLDEVKRMVNEFHKPIVKLEGQSLTISQVAAVAM  73

Query  321  RDNAVKVELSEGARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSHRRTKNGHALQQELI  500
            R + ++VELSE ARAGVKASSDWVM+SM+ GTDSYGVTTGFGATSHRRTK G ALQ+ELI
Sbjct  74   RADGIEVELSESARAGVKASSDWVMDSMSKGTDSYGVTTGFGATSHRRTKQGGALQKELI  133

Query  501  RFLNAGIFGTGT--GHTLPHSA  560
            RFLNAG+FG GT   HTLP +A
Sbjct  134  RFLNAGVFGNGTESTHTLPQTA  155



>ref|XP_002268732.1| PREDICTED: phenylalanine ammonia-lyase [Vitis vinifera]
Length=710

 Score =   213 bits (543),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 103/136 (76%), Positives = 117/136 (86%), Gaps = 3/136 (2%)
 Frame = +3

Query  159  FCIKVDPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQTLTVAQVAAIAARDNAVK  338
            FC+  DPLNW MAA++LKGSHLDEVKRMVAE+R P V++GG+TLT++QVAAIA R+  V 
Sbjct  15   FCVS-DPLNWGMAAETLKGSHLDEVKRMVAEYRKPVVRLGGETLTISQVAAIAGREGDVS  73

Query  339  VELSEGARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSHRRTKNGHALQQELIRFLNAG  518
            VELSE ARAGV ASS+WVM SM+ GTDSYGVTTGFGATSHRRTK G ALQ+ELIRFLNAG
Sbjct  74   VELSETARAGVNASSEWVMESMSKGTDSYGVTTGFGATSHRRTKQGGALQKELIRFLNAG  133

Query  519  IFGTG--TGHTLPHSA  560
            IFG G  + HTLPHSA
Sbjct  134  IFGNGRESCHTLPHSA  149



>sp|Q43052.1|PAL2_POPKI RecName: Full=Phenylalanine ammonia-lyase G2B [Populus sieboldii 
x Populus grandidentata]
 pir||S60042 phenylalanine ammonia-lyase (EC 4.3.1.5) 2b - Japanese aspen 
x large-toothed aspen
 dbj|BAA07860.1| phenylalanine ammonia-lyase [Populus sieboldii x Populus grandidentata]
Length=710

 Score =   213 bits (542),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 103/131 (79%), Positives = 113/131 (86%), Gaps = 2/131 (2%)
 Frame = +3

Query  174  DPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQTLTVAQVAAIAARDNAVKVELSE  353
            DPLNW MAA+SLKGSHLDEVKRM+ E+RNP VK+GG+TLT+ QV AIA+RD  V VELSE
Sbjct  20   DPLNWGMAAESLKGSHLDEVKRMIEEYRNPVVKLGGETLTIGQVTAIASRDVGVMVELSE  79

Query  354  GARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSHRRTKNGHALQQELIRFLNAGIFGTG  533
             ARAGVKASSDWVM+SM+ GTDSYGVTTGFGATSHRRTK G  LQ+ELIRFLNAGIFG G
Sbjct  80   EARAGVKASSDWVMDSMSKGTDSYGVTTGFGATSHRRTKQGGELQKELIRFLNAGIFGNG  139

Query  534  T--GHTLPHSA  560
            T   HTLP SA
Sbjct  140  TESSHTLPRSA  150



>ref|XP_004143255.1| PREDICTED: phenylalanine ammonia-lyase 1-like [Cucumis sativus]
 gb|KGN48160.1| Phenylalanine ammonia-lyase [Cucumis sativus]
Length=714

 Score =   213 bits (542),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 107/151 (71%), Positives = 121/151 (80%), Gaps = 10/151 (7%)
 Frame = +3

Query  138  ENGHSN--DFCI------KVDPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQTLT  293
            E GH N  +FCI        DPLNW  AA+SLKGSHL+EVKRMV E+R P VK+GG+TLT
Sbjct  3    ELGHQNGVEFCIGGRNNINNDPLNWGAAAESLKGSHLEEVKRMVEEYRRPVVKLGGETLT  62

Query  294  VAQVAAIAARDNAVKVELSEGARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSHRRTKN  473
            ++QVAAIA+RD+ V VELSE AR GV+ASS WVM+SMN GTDSYGVTTGFGATSHRRTK 
Sbjct  63   ISQVAAIASRDSGVVVELSESARGGVEASSKWVMDSMNQGTDSYGVTTGFGATSHRRTKE  122

Query  474  GHALQQELIRFLNAGIFGTGT--GHTLPHSA  560
            G ALQ+ELIRFLNAG+FG GT   HTLPH A
Sbjct  123  GGALQRELIRFLNAGVFGNGTESSHTLPHLA  153



>ref|XP_002312013.1| phenylalanine ammonia-lyase family protein [Populus trichocarpa]
 gb|ACC63890.1| phenylalanine ammonia-lyase [Populus trichocarpa]
 gb|EEE89380.1| phenylalanine ammonia-lyase family protein [Populus trichocarpa]
Length=711

 Score =   213 bits (542),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 102/131 (78%), Positives = 112/131 (85%), Gaps = 2/131 (2%)
 Frame = +3

Query  174  DPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQTLTVAQVAAIAARDNAVKVELSE  353
            DPLNW M A+SLKGSHLDEVKRM+ E+R P VK+GG++LT+ QV AIA+RD  VKVELSE
Sbjct  20   DPLNWGMVAESLKGSHLDEVKRMIDEYRKPVVKLGGESLTIGQVTAIASRDVGVKVELSE  79

Query  354  GARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSHRRTKNGHALQQELIRFLNAGIFGTG  533
             AR GVKASSDWVM+SMN GTDSYGVTTGFGATSHRRTK G  LQ+ELIRFLNAGIFG G
Sbjct  80   EARVGVKASSDWVMDSMNKGTDSYGVTTGFGATSHRRTKQGGELQKELIRFLNAGIFGNG  139

Query  534  T--GHTLPHSA  560
            T   HTLPHSA
Sbjct  140  TESTHTLPHSA  150



>ref|XP_002268256.1| PREDICTED: phenylalanine ammonia-lyase [Vitis vinifera]
Length=710

 Score =   213 bits (542),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 103/136 (76%), Positives = 117/136 (86%), Gaps = 3/136 (2%)
 Frame = +3

Query  159  FCIKVDPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQTLTVAQVAAIAARDNAVK  338
            FC+  DPLNW MAA++LKGSHLDEVKRMVAE+R P V++GG+TLT++QVAAIA R+  V 
Sbjct  15   FCVS-DPLNWGMAAETLKGSHLDEVKRMVAEYRKPVVRLGGETLTISQVAAIAGREGDVG  73

Query  339  VELSEGARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSHRRTKNGHALQQELIRFLNAG  518
            VELSE ARAGV ASS+WVM SM+ GTDSYGVTTGFGATSHRRTK G ALQ+ELIRFLNAG
Sbjct  74   VELSETARAGVNASSEWVMESMSKGTDSYGVTTGFGATSHRRTKQGGALQKELIRFLNAG  133

Query  519  IFGTG--TGHTLPHSA  560
            IFG G  + HTLPHSA
Sbjct  134  IFGNGRESCHTLPHSA  149



>ref|XP_011031723.1| PREDICTED: phenylalanine ammonia-lyase G4 [Populus euphratica]
Length=711

 Score =   213 bits (541),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 102/131 (78%), Positives = 112/131 (85%), Gaps = 2/131 (2%)
 Frame = +3

Query  174  DPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQTLTVAQVAAIAARDNAVKVELSE  353
            DPLNW M A+SLKGSHLDEVKRM+ E+R P VK+GG++LT+ QV AIA+RD  VKVELSE
Sbjct  20   DPLNWGMVAESLKGSHLDEVKRMINEYRKPVVKLGGESLTIGQVTAIASRDVGVKVELSE  79

Query  354  GARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSHRRTKNGHALQQELIRFLNAGIFGTG  533
             AR GVKASSDWVM+SMN GTDSYGVTTGFGATSHRRTK G  LQ+ELIRFLNAGIFG G
Sbjct  80   EARVGVKASSDWVMDSMNKGTDSYGVTTGFGATSHRRTKQGGELQKELIRFLNAGIFGNG  139

Query  534  T--GHTLPHSA  560
            T   HTLPHSA
Sbjct  140  TESTHTLPHSA  150



>sp|P45732.1|PALY_STYHU RecName: Full=Phenylalanine ammonia-lyase [Stylosanthes humilis]
 gb|AAA99500.1| phenylalanine ammonia lyase [Stylosanthes humilis]
Length=715

 Score =   213 bits (542),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 102/131 (78%), Positives = 114/131 (87%), Gaps = 2/131 (2%)
 Frame = +3

Query  174  DPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQTLTVAQVAAIAARDNAVKVELSE  353
            DPLNW  AA++LKGSHLDEVKRMV+E+R P V +GGQTLT++QVAAIAA D  V V+LSE
Sbjct  24   DPLNWAAAAEALKGSHLDEVKRMVSEYRKPLVNLGGQTLTISQVAAIAANDQGVSVQLSE  83

Query  354  GARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSHRRTKNGHALQQELIRFLNAGIFGTG  533
             +RAGVKASSDWVM+SMNNGTDSYGVTTGFGATSHRRTK G ALQ+ELIRFLNAGIFG G
Sbjct  84   ASRAGVKASSDWVMDSMNNGTDSYGVTTGFGATSHRRTKQGGALQKELIRFLNAGIFGNG  143

Query  534  --TGHTLPHSA  560
              T  TLPH+A
Sbjct  144  TETNCTLPHTA  154



>ref|XP_004156289.1| PREDICTED: phenylalanine ammonia-lyase-like [Cucumis sativus]
Length=714

 Score =   213 bits (541),  Expect = 4e-61, Method: Compositional matrix adjust.
 Identities = 107/151 (71%), Positives = 121/151 (80%), Gaps = 10/151 (7%)
 Frame = +3

Query  138  ENGHSN--DFCI------KVDPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQTLT  293
            E GH N  +FCI        DPLNW  AA+SLKGSHL+EVKRMV E+R P VK+GG+TLT
Sbjct  3    ELGHQNGVEFCIGGRNNINNDPLNWGAAAESLKGSHLEEVKRMVEEYRRPVVKLGGETLT  62

Query  294  VAQVAAIAARDNAVKVELSEGARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSHRRTKN  473
            ++QVAAIA+RD+ V VELSE AR GV+ASS WVM+SMN GTDSYGVTTGFGATSHRRTK 
Sbjct  63   ISQVAAIASRDSGVVVELSESARGGVEASSKWVMDSMNQGTDSYGVTTGFGATSHRRTKE  122

Query  474  GHALQQELIRFLNAGIFGTGT--GHTLPHSA  560
            G ALQ+ELIRFLNAG+FG GT   HTLPH A
Sbjct  123  GGALQRELIRFLNAGVFGNGTESSHTLPHLA  153



>ref|XP_003633986.1| PREDICTED: phenylalanine ammonia-lyase-like [Vitis vinifera]
Length=710

 Score =   213 bits (541),  Expect = 4e-61, Method: Compositional matrix adjust.
 Identities = 103/136 (76%), Positives = 117/136 (86%), Gaps = 3/136 (2%)
 Frame = +3

Query  159  FCIKVDPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQTLTVAQVAAIAARDNAVK  338
            FC+  DPLNW MAA++LKGSHLDEVKRMVAE+R P V++GG+TLT++QVAAIA R+  V 
Sbjct  15   FCVS-DPLNWGMAAETLKGSHLDEVKRMVAEYRKPVVRLGGETLTISQVAAIAGREGDVG  73

Query  339  VELSEGARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSHRRTKNGHALQQELIRFLNAG  518
            VELSE ARAGV ASS+WVM SM+ GTDSYGVTTGFGATSHRRTK G ALQ+ELIRFLNAG
Sbjct  74   VELSETARAGVNASSEWVMESMSKGTDSYGVTTGFGATSHRRTKQGGALQKELIRFLNAG  133

Query  519  IFGTG--TGHTLPHSA  560
            IFG G  + HTLPHSA
Sbjct  134  IFGNGRESCHTLPHSA  149



>ref|XP_004493977.1| PREDICTED: phenylalanine ammonia-lyase-like [Cicer arietinum]
Length=723

 Score =   213 bits (541),  Expect = 5e-61, Method: Compositional matrix adjust.
 Identities = 100/131 (76%), Positives = 114/131 (87%), Gaps = 2/131 (2%)
 Frame = +3

Query  174  DPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQTLTVAQVAAIAARDNAVKVELSE  353
            DPLNW +AA+++KGSHLDEVKRMV E+R P V++GG+TLT++QVAAIA  D+ V VELSE
Sbjct  32   DPLNWGVAAEAMKGSHLDEVKRMVEEYRKPVVRLGGETLTISQVAAIATHDHGVTVELSE  91

Query  354  GARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSHRRTKNGHALQQELIRFLNAGIFGTG  533
             +R GVKASSDWVM SMNNGTDSYGVTTGFGATSHRRTK G ALQ+ELIRFLNAGIFG G
Sbjct  92   SSRPGVKASSDWVMESMNNGTDSYGVTTGFGATSHRRTKQGGALQKELIRFLNAGIFGNG  151

Query  534  T--GHTLPHSA  560
            T   HTLPH+A
Sbjct  152  TESNHTLPHTA  162



>gb|AEJ88223.1| phenylalanine ammonia lyase [Prunus persica]
Length=719

 Score =   212 bits (540),  Expect = 6e-61, Method: Compositional matrix adjust.
 Identities = 103/131 (79%), Positives = 115/131 (88%), Gaps = 2/131 (2%)
 Frame = +3

Query  174  DPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQTLTVAQVAAIAARDNAVKVELSE  353
            DPLNW MAA+SLKGSHLDEVKRMV E+R P V++GG+TLT+AQVAAIA  D+ V VELSE
Sbjct  28   DPLNWGMAAESLKGSHLDEVKRMVNEYRKPVVRLGGETLTIAQVAAIANHDSGVHVELSE  87

Query  354  GARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSHRRTKNGHALQQELIRFLNAGIFGTG  533
             ARAGVKASSDWVM+SM+ GTDSYGVTTGFGATSHRRTK G ALQ+ELIRFLNAGIFG+ 
Sbjct  88   DARAGVKASSDWVMDSMSKGTDSYGVTTGFGATSHRRTKQGGALQRELIRFLNAGIFGSS  147

Query  534  TG--HTLPHSA  560
            T   HTLPH+A
Sbjct  148  TESTHTLPHTA  158



>emb|CBI26455.3| unnamed protein product [Vitis vinifera]
Length=679

 Score =   212 bits (539),  Expect = 6e-61, Method: Compositional matrix adjust.
 Identities = 102/135 (76%), Positives = 116/135 (86%), Gaps = 3/135 (2%)
 Frame = +3

Query  159  FCIKVDPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQTLTVAQVAAIAARDNAVK  338
            FC+  DPLNW MAA++LKGSHLDEVKRMVAE+R P V++GG+TLT++QVAAIA R+  V 
Sbjct  39   FCVS-DPLNWGMAAETLKGSHLDEVKRMVAEYRKPVVRLGGETLTISQVAAIAGREGDVS  97

Query  339  VELSEGARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSHRRTKNGHALQQELIRFLNAG  518
            VELSE ARAGV ASS+WVM SM+ GTDSYGVTTGFGATSHRRTK G ALQ+ELIRFLNAG
Sbjct  98   VELSETARAGVNASSEWVMESMSKGTDSYGVTTGFGATSHRRTKQGGALQKELIRFLNAG  157

Query  519  IFGTG--TGHTLPHS  557
            IFG G  + HTLPHS
Sbjct  158  IFGNGRESCHTLPHS  172



>gb|ACM62741.1| phenylalanine ammonia-lyase [Garcinia mangostana]
Length=718

 Score =   212 bits (540),  Expect = 7e-61, Method: Compositional matrix adjust.
 Identities = 112/157 (71%), Positives = 124/157 (79%), Gaps = 11/157 (7%)
 Frame = +3

Query  123  MEGAI-ENGHS-NDFC------IKVDPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIG  278
            ME  I +NGH  N  C      +  DPLNW   A+SLKGSHL+EVKRMV E+R P VK+G
Sbjct  1    METTITQNGHHMNGLCMNGSAHVNSDPLNWGYLAESLKGSHLEEVKRMVEEYRKPLVKLG  60

Query  279  GQTLTVAQVAAIAARDNA-VKVELSEGARAGVKASSDWVMNSMNNGTDSYGVTTGFGATS  455
            G+TLT+AQVAA+A    A VKVEL+E ARAGVKASSDWVM+SMNNGTDSYGVTTGFGATS
Sbjct  61   GETLTIAQVAAVAGGFEAGVKVELAESARAGVKASSDWVMDSMNNGTDSYGVTTGFGATS  120

Query  456  HRRTKNGHALQQELIRFLNAGIFGTG--TGHTLPHSA  560
            HRRTK G ALQ+ELIRFLNAGIFG G  T HTLPHSA
Sbjct  121  HRRTKQGAALQKELIRFLNAGIFGNGTETSHTLPHSA  157



>gb|KHG30005.1| Phenylalanine ammonia-lyase [Gossypium arboreum]
Length=718

 Score =   212 bits (539),  Expect = 8e-61, Method: Compositional matrix adjust.
 Identities = 105/157 (67%), Positives = 121/157 (77%), Gaps = 11/157 (7%)
 Frame = +3

Query  123  MEGAIENGHSNDFC---------IKVDPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKI  275
            M    +NG  + FC            DPLNW + A+SLKGSHLDEVKRMV E+R P VK+
Sbjct  1    MAAITQNGSFDSFCTTTANGSTAFAADPLNWGIVAESLKGSHLDEVKRMVMEYRKPLVKL  60

Query  276  GGQTLTVAQVAAIAARDNAVKVELSEGARAGVKASSDWVMNSMNNGTDSYGVTTGFGATS  455
            GG+TLT++QVAAIAA D+ VKVELS+ ARA VKAS+DWV++ MN GTDSYGVTTGFGATS
Sbjct  61   GGETLTISQVAAIAAHDSGVKVELSDDARAAVKASADWVLDGMNKGTDSYGVTTGFGATS  120

Query  456  HRRTKNGHALQQELIRFLNAGIFGTGT--GHTLPHSA  560
            HRRTK G ALQ+ELIRFLNAGIFG GT   +TLPHSA
Sbjct  121  HRRTKQGAALQKELIRFLNAGIFGNGTESCNTLPHSA  157



>gb|KJB62426.1| hypothetical protein B456_009G416300 [Gossypium raimondii]
Length=721

 Score =   212 bits (539),  Expect = 8e-61, Method: Compositional matrix adjust.
 Identities = 103/132 (78%), Positives = 115/132 (87%), Gaps = 2/132 (2%)
 Frame = +3

Query  171  VDPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQTLTVAQVAAIAARDNAVKVELS  350
            VDPLNW +AA SL+GSHLDEVKRMVAE+R   VK+GG+TLT++QVAAIA RD  VKVELS
Sbjct  29   VDPLNWGVAAKSLQGSHLDEVKRMVAEYRRSLVKLGGETLTISQVAAIATRDLGVKVELS  88

Query  351  EGARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSHRRTKNGHALQQELIRFLNAGIFGT  530
            E ARAGVKAS+DWV++ MN GTDSYGVTTGFGATSHRRTK G ALQ+ELIRFLNAGIFG 
Sbjct  89   EDARAGVKASADWVLDGMNKGTDSYGVTTGFGATSHRRTKQGAALQKELIRFLNAGIFGN  148

Query  531  G--TGHTLPHSA  560
            G  + HTLPHSA
Sbjct  149  GIESCHTLPHSA  160



>ref|XP_010662075.1| PREDICTED: phenylalanine ammonia-lyase [Vitis vinifera]
Length=710

 Score =   212 bits (539),  Expect = 8e-61, Method: Compositional matrix adjust.
 Identities = 103/136 (76%), Positives = 115/136 (85%), Gaps = 3/136 (2%)
 Frame = +3

Query  159  FCIKVDPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQTLTVAQVAAIAARDNAVK  338
            FC+  DPLNW MAA++LKGSHLDEVKRMVAE+R P V++GG+TLT++QVAAIA R+  V 
Sbjct  15   FCVS-DPLNWGMAAETLKGSHLDEVKRMVAEYRKPVVQLGGETLTISQVAAIAGREGDVS  73

Query  339  VELSEGARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSHRRTKNGHALQQELIRFLNAG  518
            VELSE ARAGVKASSDWVM SM  G DSYGVTTGFGATSHRRTK G ALQ+ELIR LNAG
Sbjct  74   VELSETARAGVKASSDWVMESMKKGIDSYGVTTGFGATSHRRTKQGGALQKELIRVLNAG  133

Query  519  IFGTG--TGHTLPHSA  560
            IFG G  + HTLPHSA
Sbjct  134  IFGNGRESCHTLPHSA  149



>ref|XP_003635657.2| PREDICTED: phenylalanine ammonia-lyase-like [Vitis vinifera]
Length=710

 Score =   212 bits (539),  Expect = 8e-61, Method: Compositional matrix adjust.
 Identities = 102/135 (76%), Positives = 116/135 (86%), Gaps = 3/135 (2%)
 Frame = +3

Query  159  FCIKVDPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQTLTVAQVAAIAARDNAVK  338
            FC+  DPLNW MAA++LKGSHLDEVKRMVAE+R P V++GG+TLT++QVAAIA R+  V 
Sbjct  15   FCVS-DPLNWGMAAETLKGSHLDEVKRMVAEYRKPVVRLGGETLTISQVAAIAGREGDVN  73

Query  339  VELSEGARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSHRRTKNGHALQQELIRFLNAG  518
            VELSE ARAGV ASS+WVM SM+ GTDSYGVTTGFGATSHRRTK G ALQ+ELIRFLNAG
Sbjct  74   VELSETARAGVNASSEWVMESMSKGTDSYGVTTGFGATSHRRTKQGGALQKELIRFLNAG  133

Query  519  IFGTG--TGHTLPHS  557
            IFG G  + HTLPHS
Sbjct  134  IFGNGRESCHTLPHS  148



>ref|XP_003633987.1| PREDICTED: phenylalanine ammonia-lyase-like [Vitis vinifera]
Length=710

 Score =   212 bits (539),  Expect = 8e-61, Method: Compositional matrix adjust.
 Identities = 102/135 (76%), Positives = 116/135 (86%), Gaps = 3/135 (2%)
 Frame = +3

Query  159  FCIKVDPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQTLTVAQVAAIAARDNAVK  338
            FC+  DPLNW MAA++LKGSHLDEVKRMVAE+R P V++GG+TLT++QVAAIA R+  V 
Sbjct  15   FCVS-DPLNWGMAAETLKGSHLDEVKRMVAEYRKPVVRLGGETLTISQVAAIAGREGDVS  73

Query  339  VELSEGARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSHRRTKNGHALQQELIRFLNAG  518
            VELSE ARAGV ASS+WVM SM+ GTDSYGVTTGFGATSHRRTK G ALQ+ELIRFLNAG
Sbjct  74   VELSETARAGVNASSEWVMESMSKGTDSYGVTTGFGATSHRRTKQGGALQKELIRFLNAG  133

Query  519  IFGTG--TGHTLPHS  557
            IFG G  + HTLPHS
Sbjct  134  IFGNGRESCHTLPHS  148



>gb|KJB46525.1| hypothetical protein B456_007G373600 [Gossypium raimondii]
Length=718

 Score =   212 bits (539),  Expect = 9e-61, Method: Compositional matrix adjust.
 Identities = 105/157 (67%), Positives = 121/157 (77%), Gaps = 11/157 (7%)
 Frame = +3

Query  123  MEGAIENGHSNDFC---------IKVDPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKI  275
            M    +NG  + FC            DPLNW + A+SLKGSHLDEVKRMV E+R P VK+
Sbjct  1    MAAITQNGSLDSFCTTTANGSTAFAADPLNWGVVAESLKGSHLDEVKRMVMEYRKPLVKL  60

Query  276  GGQTLTVAQVAAIAARDNAVKVELSEGARAGVKASSDWVMNSMNNGTDSYGVTTGFGATS  455
            GG+TLT++QVAAIAA D+ VKVELS+ ARA VKAS+DWV++ MN GTDSYGVTTGFGATS
Sbjct  61   GGETLTISQVAAIAAHDSGVKVELSDDARAAVKASADWVLDGMNKGTDSYGVTTGFGATS  120

Query  456  HRRTKNGHALQQELIRFLNAGIFGTGT--GHTLPHSA  560
            HRRTK G ALQ+ELIRFLNAGIFG GT   +TLPHSA
Sbjct  121  HRRTKQGAALQKELIRFLNAGIFGNGTESCNTLPHSA  157



>gb|AAK60275.1|AF383152_1 phenylalanine ammonia-lyase 2 [Manihot esculenta]
Length=712

 Score =   211 bits (538),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 106/147 (72%), Positives = 122/147 (83%), Gaps = 7/147 (5%)
 Frame = +3

Query  138  ENGHSN----DFCIKVDPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQTLTVAQV  305
            +NGH N      C   DPLNW +AA+S+ GSHLDEVK+MVAEFR P VK+GG+TLTVAQV
Sbjct  6    QNGHQNGSLDSLCTARDPLNWGLAAESMSGSHLDEVKKMVAEFRKPLVKLGGETLTVAQV  65

Query  306  AAIAARDNAVKVELSEGARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSHRRTKNGHAL  485
            AAIA R++ ++VEL+E ARAGVKASSDWVM+SM+ GTDSYGVTTGFGATSHRRTK G AL
Sbjct  66   AAIA-RESGLQVELAESARAGVKASSDWVMDSMSKGTDSYGVTTGFGATSHRRTKQGGAL  124

Query  486  QQELIRFLNAGIFG--TGTGHTLPHSA  560
            Q+ELIRFLNAGIFG  T + HTL HSA
Sbjct  125  QRELIRFLNAGIFGNKTESCHTLSHSA  151



>ref|NP_001236956.1| phenylalanine ammonia-lyase 2 [Glycine max]
 gb|ACS88364.1| phenylalanine ammonia-lyase 2 [Glycine max]
 gb|ACU30058.1| phenylalanine ammonia-lyase 2 [Glycine max]
Length=717

 Score =   211 bits (538),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 103/151 (68%), Positives = 119/151 (79%), Gaps = 11/151 (7%)
 Frame = +3

Query  141  NGHSNDFCIKV---------DPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQTLT  293
            N  + +FC+ V         DPLNW  AA+++ GSHLDEVKRM+ E+R P VK+GG+TLT
Sbjct  6    NAANTNFCVNVSNNGYISANDPLNWGAAAEAMAGSHLDEVKRMLEEYRRPVVKLGGETLT  65

Query  294  VAQVAAIAARDNAVKVELSEGARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSHRRTKN  473
            ++QVAAIAA D  VKVEL+E +RAGVKASSDWVM SMN GTDSYGVTTGFGATSHRRTK 
Sbjct  66   ISQVAAIAAHDQGVKVELAESSRAGVKASSDWVMESMNKGTDSYGVTTGFGATSHRRTKQ  125

Query  474  GHALQQELIRFLNAGIFGTGT--GHTLPHSA  560
            G ALQ+ELIRFLNAGIFG GT    TLPH+A
Sbjct  126  GAALQKELIRFLNAGIFGNGTESNCTLPHTA  156



>ref|XP_006488063.1| PREDICTED: phenylalanine ammonia-lyase 1-like [Citrus sinensis]
Length=714

 Score =   211 bits (538),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 101/142 (71%), Positives = 116/142 (82%), Gaps = 2/142 (1%)
 Frame = +3

Query  141  NGHSNDFCIKVDPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQTLTVAQVAAIAA  320
            N  S   C  +DPLNW  A++SLKGSHLDEVKRMV+E+R   V++GG+TLT+AQVAA+A+
Sbjct  12   NIPSGKLCTNIDPLNWVSASESLKGSHLDEVKRMVSEYRKQVVRLGGETLTIAQVAAVAS  71

Query  321  RDNAVKVELSEGARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSHRRTKNGHALQQELI  500
            RD  V VEL+E ARAGVKASSDWVM SMN GTDSYG+TTGFGATSHRRTK G ALQ+ELI
Sbjct  72   RDGGVTVELNEEARAGVKASSDWVMESMNKGTDSYGITTGFGATSHRRTKQGAALQKELI  131

Query  501  RFLNAGIFGTGT--GHTLPHSA  560
            RFLNAGIFG GT     LPH+A
Sbjct  132  RFLNAGIFGKGTESCQMLPHTA  153



>ref|XP_011048535.1| PREDICTED: phenylalanine ammonia-lyase-like [Populus euphratica]
Length=714

 Score =   211 bits (538),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 104/153 (68%), Positives = 120/153 (78%), Gaps = 3/153 (2%)
 Frame = +3

Query  111  FNTTMEGAIENGHSNDFCIKVDPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQTL  290
              T  +   +NG S   C + DPL+W +AA+++KGSHLDEVKRMVAE+R P V + GQ L
Sbjct  1    METITKNGYQNGSSESLCTQRDPLSWGVAAEAMKGSHLDEVKRMVAEYRKPVVNLAGQNL  60

Query  291  TVAQVAAIAARDNA-VKVELSEGARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSHRRT  467
            T+AQVA+IA  D + VKVELSE AR  VKASSDWVM+SM+ GTDSYGVTTGFGATSHRRT
Sbjct  61   TIAQVASIAGHDASDVKVELSESARPRVKASSDWVMDSMDKGTDSYGVTTGFGATSHRRT  120

Query  468  KNGHALQQELIRFLNAGIFGTG--TGHTLPHSA  560
            K G ALQ+ELIRFLNAGIFG G  T HTLPHSA
Sbjct  121  KQGGALQKELIRFLNAGIFGNGTETCHTLPHSA  153



>gb|AAK60274.1|AF383151_1 phenylalanine ammonia-lyase 1 [Manihot esculenta]
Length=687

 Score =   211 bits (537),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 102/131 (78%), Positives = 114/131 (87%), Gaps = 2/131 (2%)
 Frame = +3

Query  174  DPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQTLTVAQVAAIAARDNAVKVELSE  353
            DPLNW MAA+SLKGSHLDEVKRMV E+R P V++GG+TLT+AQV AIA  D+ VKVELSE
Sbjct  19   DPLNWGMAAESLKGSHLDEVKRMVDEYRKPVVRLGGETLTIAQVTAIANHDSGVKVELSE  78

Query  354  GARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSHRRTKNGHALQQELIRFLNAGIFGTG  533
             ARAGVKASSDWV++SMN GTDSYGVTTGFGATSHRRTK G ALQ+ELIRFLNAGIFG G
Sbjct  79   EARAGVKASSDWVLDSMNKGTDSYGVTTGFGATSHRRTKQGGALQRELIRFLNAGIFGNG  138

Query  534  --TGHTLPHSA  560
              + HTL H+A
Sbjct  139  QESCHTLSHTA  149



>gb|AAN52279.1|AF480619_1 phenylalanine ammonia-lyase [Populus tremuloides]
Length=714

 Score =   211 bits (538),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 104/153 (68%), Positives = 120/153 (78%), Gaps = 3/153 (2%)
 Frame = +3

Query  111  FNTTMEGAIENGHSNDFCIKVDPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQTL  290
              T  +   +NG S   C + DPL+W +AA+++KGSHLDEVKRMVAE+R P V + GQ L
Sbjct  1    METITKNGYQNGSSESLCTQRDPLSWGVAAEAMKGSHLDEVKRMVAEYRKPVVNLAGQNL  60

Query  291  TVAQVAAIAARDNA-VKVELSEGARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSHRRT  467
            T+AQVA+IA  D + VKVELSE AR  VKASSDWVM+SM+ GTDSYGVTTGFGATSHRRT
Sbjct  61   TIAQVASIAGHDASNVKVELSESARPRVKASSDWVMDSMDKGTDSYGVTTGFGATSHRRT  120

Query  468  KNGHALQQELIRFLNAGIFGTG--TGHTLPHSA  560
            K G ALQ+ELIRFLNAGIFG G  T HTLPHSA
Sbjct  121  KQGGALQKELIRFLNAGIFGNGTETCHTLPHSA  153



>gb|AGH13333.1| phenylalanine ammonia-lyase [Rhus chinensis]
Length=707

 Score =   211 bits (537),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 102/131 (78%), Positives = 111/131 (85%), Gaps = 2/131 (2%)
 Frame = +3

Query  174  DPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQTLTVAQVAAIAARDNAVKVELSE  353
            DPLNW  AA+SLKGSHLDEVKRMV E R P VK+GG+TLT+ QV AIA  D+ ++VELSE
Sbjct  16   DPLNWNFAAESLKGSHLDEVKRMVEESRKPVVKLGGETLTIGQVTAIANHDSGLRVELSE  75

Query  354  GARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSHRRTKNGHALQQELIRFLNAGIFGTG  533
             AR GV+ASSDWVM SMNNGTDSYGVTTGFGATSHRRTK G ALQ+ELIRFLNAGIFG G
Sbjct  76   AARPGVQASSDWVMESMNNGTDSYGVTTGFGATSHRRTKQGGALQKELIRFLNAGIFGNG  135

Query  534  T--GHTLPHSA  560
            T   HTLPHSA
Sbjct  136  TESCHTLPHSA  146



>sp|P45734.1|PALY_TRISU RecName: Full=Phenylalanine ammonia-lyase [Trifolium subterraneum]
 gb|AAA17993.1| phenylalanine ammonia-lyase [Trifolium subterraneum]
Length=725

 Score =   211 bits (538),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 106/143 (74%), Positives = 120/143 (84%), Gaps = 6/143 (4%)
 Frame = +3

Query  147  HSNDFCIKV---DPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQTLTVAQVAAIA  317
            H+N   +KV   DPLNW +AA+++KGSHLDEVKRMV E+R P V++GG+TLT++QVAAIA
Sbjct  23   HANANNMKVNAADPLNWGVAAEAMKGSHLDEVKRMVEEYRKPVVRLGGETLTISQVAAIA  82

Query  318  ARDNAVKVELSEGARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSHRRTKNGHALQQEL  497
            A D A  VELSE ARAGVKASSDWVM SMN GTDSYGVTTGFGATSHRRTK G ALQ+EL
Sbjct  83   AHDGAT-VELSESARAGVKASSDWVMESMNKGTDSYGVTTGFGATSHRRTKQGGALQKEL  141

Query  498  IRFLNAGIFGTGT--GHTLPHSA  560
            IRFLNAGIFG GT   HTLPH+A
Sbjct  142  IRFLNAGIFGNGTESNHTLPHTA  164



>gb|AAW78932.1| phenylalanine-ammonia lyase [Rhodiola sachalinensis]
Length=710

 Score =   211 bits (537),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 104/143 (73%), Positives = 119/143 (83%), Gaps = 2/143 (1%)
 Frame = +3

Query  138  ENGHSNDFCIKVDPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQTLTVAQVAAIA  317
            +NGHS    +  DPL+W +AA+++KGSHLDEVKRMV E+R PAVK+GG+TLT+AQVAAIA
Sbjct  7    QNGHSVANVVVKDPLSWGLAAEAMKGSHLDEVKRMVEEYRKPAVKLGGETLTIAQVAAIA  66

Query  318  ARDNAVKVELSEGARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSHRRTKNGHALQQEL  497
             R + V+VELSE AR GVKASSDWVM SM  GTDSYGVTTGFGATSHRRTK G ALQ+EL
Sbjct  67   GRGSDVRVELSESAREGVKASSDWVMESMGKGTDSYGVTTGFGATSHRRTKQGGALQKEL  126

Query  498  IRFLNAGIFGTG--TGHTLPHSA  560
            IRFLNAGIFG+G  T HTL  SA
Sbjct  127  IRFLNAGIFGSGKDTCHTLSQSA  149



>ref|XP_003542541.1| PREDICTED: phenylalanine ammonia-lyase class 2-like [Glycine 
max]
Length=716

 Score =   211 bits (537),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 108/158 (68%), Positives = 124/158 (78%), Gaps = 15/158 (9%)
 Frame = +3

Query  120  TMEGAIENGHSNDFCIKV---------DPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVK  272
            T EG   NG++N FC+ V         DPLNW  AA+++ GSHLDEVKRMV E+R P VK
Sbjct  2    TQEG---NGNTN-FCMSVNNNGYISANDPLNWGAAAEAMAGSHLDEVKRMVEEYRRPVVK  57

Query  273  IGGQTLTVAQVAAIAARDNAVKVELSEGARAGVKASSDWVMNSMNNGTDSYGVTTGFGAT  452
            +GG+TLT++QVAAIAA D  VKVEL+E +RAGVKASSDWVM SM+ GTDSYGVTTGFGAT
Sbjct  58   LGGETLTISQVAAIAAHDQGVKVELAESSRAGVKASSDWVMESMDKGTDSYGVTTGFGAT  117

Query  453  SHRRTKNGHALQQELIRFLNAGIFGTGT--GHTLPHSA  560
            SHRRTK G ALQ+ELIRFLNAGIFG GT    TLPH+A
Sbjct  118  SHRRTKQGGALQKELIRFLNAGIFGNGTESNCTLPHTA  155



>sp|P45726.1|PALY_CAMSI RecName: Full=Phenylalanine ammonia-lyase [Camellia sinensis]
 dbj|BAA05643.1| phenylalanine ammonia-lyase [Camellia sinensis]
Length=714

 Score =   211 bits (537),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 105/150 (70%), Positives = 121/150 (81%), Gaps = 3/150 (2%)
 Frame = +3

Query  117  TTMEGAIENGHSNDFCIKVDPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQTLTV  296
            T +   + +G S  FC+K DPLNW +AA+++KGSHL+EVK MV EFR P V++GG+TLT+
Sbjct  5    TAIGNGVGSGGSPGFCLK-DPLNWGVAAEAMKGSHLEEVKGMVEEFRKPVVRLGGETLTI  63

Query  297  AQVAAIAARDNAVKVELSEGARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSHRRTKNG  476
            +QVAAIA R + V VELSE AR GVKASSDWVM SMN GTDSYGVTTGFGATSHRRTK G
Sbjct  64   SQVAAIAVRGSEVAVELSESAREGVKASSDWVMESMNKGTDSYGVTTGFGATSHRRTKEG  123

Query  477  HALQQELIRFLNAGIFGTGT--GHTLPHSA  560
             ALQ+ELIRFLNAGIFG GT   HTLP SA
Sbjct  124  GALQKELIRFLNAGIFGNGTESCHTLPQSA  153



>gb|AJR20994.1| phenylalanine ammonia-lyase [Populus szechuanica]
Length=711

 Score =   211 bits (537),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 102/131 (78%), Positives = 112/131 (85%), Gaps = 2/131 (2%)
 Frame = +3

Query  174  DPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQTLTVAQVAAIAARDNAVKVELSE  353
            DPLNW MAA+SLKGSHLDEVKRM+ E+R P VK+GG+TLT+ QV AIA+RD  V VELSE
Sbjct  20   DPLNWGMAAESLKGSHLDEVKRMIEEYRKPVVKLGGETLTIGQVTAIASRDVGVMVELSE  79

Query  354  GARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSHRRTKNGHALQQELIRFLNAGIFGTG  533
             ARAGVKASSDWVM+SM+ GTDSYGVTTGFGATSHRRTK G  LQ+ELIRFLNAGIFG G
Sbjct  80   EARAGVKASSDWVMDSMSKGTDSYGVTTGFGATSHRRTKQGGELQKELIRFLNAGIFGNG  139

Query  534  T--GHTLPHSA  560
            T   HTLP SA
Sbjct  140  TESSHTLPRSA  150



>gb|ACC63889.1| phenylalanine ammonia-lyase [Populus trichocarpa]
Length=711

 Score =   211 bits (537),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 102/131 (78%), Positives = 112/131 (85%), Gaps = 2/131 (2%)
 Frame = +3

Query  174  DPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQTLTVAQVAAIAARDNAVKVELSE  353
            DPLNW MAA+SLKGSHLDEVKRM+ E+R P VK+GG+TLT+ QV AIA+RD  V VELSE
Sbjct  20   DPLNWGMAAESLKGSHLDEVKRMIEEYRKPVVKLGGETLTIGQVTAIASRDVGVMVELSE  79

Query  354  GARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSHRRTKNGHALQQELIRFLNAGIFGTG  533
             ARAGVKASSDWVM+SM+ GTDSYGVTTGFGATSHRRTK G  LQ+ELIRFLNAGIFG G
Sbjct  80   EARAGVKASSDWVMDSMSKGTDSYGVTTGFGATSHRRTKQGGELQKELIRFLNAGIFGNG  139

Query  534  T--GHTLPHSA  560
            T   HTLP SA
Sbjct  140  TESSHTLPRSA  150



>ref|XP_002315308.1| phenylalanine ammonia-lyase family protein [Populus trichocarpa]
 gb|ACC63891.1| phenylalanine ammonia-lyase [Populus trichocarpa]
 gb|EEF01479.1| phenylalanine ammonia-lyase family protein [Populus trichocarpa]
Length=711

 Score =   211 bits (537),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 102/131 (78%), Positives = 112/131 (85%), Gaps = 2/131 (2%)
 Frame = +3

Query  174  DPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQTLTVAQVAAIAARDNAVKVELSE  353
            DPLNW MAA+SLKGSHLDEVKRM+ E+R P VK+GG+TLT+ QV AIA+RD  V VELSE
Sbjct  20   DPLNWGMAAESLKGSHLDEVKRMIEEYRKPVVKLGGETLTIGQVTAIASRDVGVMVELSE  79

Query  354  GARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSHRRTKNGHALQQELIRFLNAGIFGTG  533
             ARAGVKASSDWVM+SM+ GTDSYGVTTGFGATSHRRTK G  LQ+ELIRFLNAGIFG G
Sbjct  80   EARAGVKASSDWVMDSMSKGTDSYGVTTGFGATSHRRTKQGGELQKELIRFLNAGIFGNG  139

Query  534  T--GHTLPHSA  560
            T   HTLP SA
Sbjct  140  TESSHTLPRSA  150



>gb|ADD12041.1| phenylalanine ammonia lyase [Cistanche deserticola]
 gb|ADD16918.1| phenylalanine ammonia lyase [Cistanche deserticola]
Length=709

 Score =   211 bits (537),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 114/147 (78%), Positives = 124/147 (84%), Gaps = 5/147 (3%)
 Frame = +3

Query  135  IENGH-SNDFCIK--VDPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQTLTVAQV  305
            +ENGH SN FC+    DPLNW  AA+SLKGSHLDEVKRMV EFR P VK+GG++LT+AQV
Sbjct  1    MENGHHSNVFCVNENKDPLNWAAAAESLKGSHLDEVKRMVEEFRKPVVKLGGESLTIAQV  60

Query  306  AAIAARDNAVKVELSEGARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSHRRTKNGHAL  485
            AAIAARDNAV VEL+E AR GVKASSDWVM SMN GTDSYGVTTGFGATSHRRTK G AL
Sbjct  61   AAIAARDNAVAVELAEAARDGVKASSDWVMESMNKGTDSYGVTTGFGATSHRRTKQGGAL  120

Query  486  QQELIRFLNAGIFG--TGTGHTLPHSA  560
            Q+ELIRFLNAGIFG  T + HTLP SA
Sbjct  121  QKELIRFLNAGIFGNVTESSHTLPRSA  147



>gb|AGE10589.1| phenylalanine amononia-lyase [Lonicera japonica]
Length=714

 Score =   211 bits (537),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 109/154 (71%), Positives = 121/154 (79%), Gaps = 13/154 (8%)
 Frame = +3

Query  135  IENGHSN-----DFCIKVDPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQTLTVA  299
            +ENGH N       C+K DPLNW +AA+ +KGSHLDEVKRMVAEFRNP VK+GG+ LT++
Sbjct  1    MENGHRNGGXVSXLCVK-DPLNWGVAAEGMKGSHLDEVKRMVAEFRNPVVKLGGEGLTIS  59

Query  300  QVAAIAA-----RDNAVKVELSEGARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSHRR  464
            QVAAIA+         VKVEL EGAR  VKASSDWVM SMN GTDSYGVTTGFGATSHRR
Sbjct  60   QVAAIASAGGGETSAGVKVELWEGARERVKASSDWVMESMNKGTDSYGVTTGFGATSHRR  119

Query  465  TKNGHALQQELIRFLNAGIFGTGT--GHTLPHSA  560
            TK G ALQ+ELIRFLN+GIFG GT   HTLPHSA
Sbjct  120  TKQGGALQKELIRFLNSGIFGNGTESSHTLPHSA  153



>gb|AAK62030.1| phenylalanine ammonia-lyase 1 [Manihot esculenta]
Length=710

 Score =   211 bits (536),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 102/131 (78%), Positives = 114/131 (87%), Gaps = 2/131 (2%)
 Frame = +3

Query  174  DPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQTLTVAQVAAIAARDNAVKVELSE  353
            DPLNW MAA+SLKGSHLDEVKRMV E+R P V++GG+TLT+AQV AIA  D+ VKVELSE
Sbjct  19   DPLNWGMAAESLKGSHLDEVKRMVDEYRKPVVRLGGETLTIAQVTAIANHDSGVKVELSE  78

Query  354  GARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSHRRTKNGHALQQELIRFLNAGIFGTG  533
             ARAGVKASSDWV++SMN GTDSYGVTTGFGATSHRRTK G ALQ+ELIRFLNAGIFG G
Sbjct  79   EARAGVKASSDWVLDSMNKGTDSYGVTTGFGATSHRRTKQGGALQRELIRFLNAGIFGNG  138

Query  534  --TGHTLPHSA  560
              + HTL H+A
Sbjct  139  QESCHTLSHTA  149



>ref|NP_181241.1| phenylalanine ammonia-lyase 1 [Arabidopsis thaliana]
 sp|P35510.3|PAL1_ARATH RecName: Full=Phenylalanine ammonia-lyase 1 [Arabidopsis thaliana]
 gb|AAK76593.1| putative phenylalanine ammonia lyase PAL1 [Arabidopsis thaliana]
 gb|AAL85094.1| putative phenylalanine ammonia lyase PAL1 [Arabidopsis thaliana]
 gb|AAM15324.1| phenylalanine ammonia lyase (PAL1) [Arabidopsis thaliana]
 gb|AAO29949.1| Unknown protein [Arabidopsis thaliana]
 gb|AAP59438.1| phenylalanine ammonia lyase [Arabidopsis thaliana]
 gb|AEC09341.1| phenylalanine ammonia-lyase 1 [Arabidopsis thaliana]
 gb|AGA15805.1| PAL1 [Expression vector pUDE172]
Length=725

 Score =   211 bits (536),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 103/131 (79%), Positives = 112/131 (85%), Gaps = 2/131 (2%)
 Frame = +3

Query  174  DPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQTLTVAQVAAIAARDNAVKVELSE  353
            DPLNW  AA+ +KGSHLDEVKRMVAEFR P V +GG+TLT+ QVAAI+   N+VKVELSE
Sbjct  34   DPLNWGAAAEQMKGSHLDEVKRMVAEFRKPVVNLGGETLTIGQVAAISTIGNSVKVELSE  93

Query  354  GARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSHRRTKNGHALQQELIRFLNAGIFGT-  530
             ARAGV ASSDWVM SMN GTDSYGVTTGFGATSHRRTKNG ALQ+ELIRFLNAGIFG+ 
Sbjct  94   TARAGVNASSDWVMESMNKGTDSYGVTTGFGATSHRRTKNGVALQKELIRFLNAGIFGST  153

Query  531  -GTGHTLPHSA  560
              T HTLPHSA
Sbjct  154  KETSHTLPHSA  164



>ref|XP_009392118.1| PREDICTED: phenylalanine ammonia-lyase-like [Musa acuminata subsp. 
malaccensis]
Length=712

 Score =   211 bits (536),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 103/144 (72%), Positives = 120/144 (83%), Gaps = 4/144 (3%)
 Frame = +3

Query  135  IENGHSNDFCIKVDPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQTLTVAQVAAI  314
            +ENG +  FC+K DPLNW  AA+SL GSHLDEVKRMV EFR P V++ G TLT++QVAA+
Sbjct  10   VENGEA--FCLKADPLNWIKAAESLTGSHLDEVKRMVEEFRKPQVRLEGATLTISQVAAV  67

Query  315  AARDNAVKVELSEGARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSHRRTKNGHALQQE  494
            AA  + V+VELSE AR GV+ASS+WVM SMN GTDSYGVTTGFGATSHRRTK G ALQ+E
Sbjct  68   AAARSPVRVELSEEARDGVRASSEWVMESMNKGTDSYGVTTGFGATSHRRTKQGGALQKE  127

Query  495  LIRFLNAGIFGTG--TGHTLPHSA  560
            LIRFLNAGIFG+G  +G+TLP SA
Sbjct  128  LIRFLNAGIFGSGPESGNTLPSSA  151



>gb|AAC18870.1| phenylalanine ammonia lyase [Arabidopsis thaliana]
Length=725

 Score =   211 bits (536),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 103/131 (79%), Positives = 112/131 (85%), Gaps = 2/131 (2%)
 Frame = +3

Query  174  DPLNWEMAADSLKGSHLDEVKRMVAEFRNPAVKIGGQTLTVAQVAAIAARDNAVKVELSE  353
            DPLNW  AA+ +KGSHLDEVKRMVAEFR P V +GG+TLT+ QVAAI+   N+VKVELSE
Sbjct  34   DPLNWGAAAEQMKGSHLDEVKRMVAEFRKPVVNLGGETLTIGQVAAISTIGNSVKVELSE  93

Query  354  GARAGVKASSDWVMNSMNNGTDSYGVTTGFGATSHRRTKNGHALQQELIRFLNAGIFGT-  530
             ARAGV ASSDWVM SMN GTDSYGVTTGFGATSHRRTKNG ALQ+ELIRFLNAGIFG+ 
Sbjct  94   TARAGVNASSDWVMESMNKGTDSYGVTTGFGATSHRRTKNGVALQKELIRFLNAGIFGST  153

Query  531  -GTGHTLPHSA  560
              T HTLPHSA
Sbjct  154  KETSHTLPHSA  164



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 644970849880