BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFF036C21

Length=592
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009590977.1|  PREDICTED: BES1/BZR1 homolog protein 4-like        160   6e-44   Nicotiana tomentosiformis
gb|AEA86340.1|  BES1/BZR1-like protein                                  155   9e-44   Solanum nigrum
emb|CDO96875.1|  unnamed protein product                                156   7e-43   Coffea canephora [robusta coffee]
ref|XP_011101448.1|  PREDICTED: BES1/BZR1 homolog protein 4-like        157   8e-43   Sesamum indicum [beniseed]
ref|XP_009607196.1|  PREDICTED: BES1/BZR1 homolog protein 4-like ...    156   2e-42   Nicotiana tomentosiformis
gb|EYU28126.1|  hypothetical protein MIMGU_mgv1a007967mg                155   5e-42   Erythranthe guttata [common monkey flower]
ref|XP_009800423.1|  PREDICTED: BES1/BZR1 homolog protein 4-like ...    154   1e-41   Nicotiana sylvestris
ref|XP_006358089.1|  PREDICTED: BES1/BZR1 homolog protein 4-like ...    154   1e-41   Solanum tuberosum [potatoes]
ref|XP_009785426.1|  PREDICTED: BES1/BZR1 homolog protein 4-like        154   1e-41   Nicotiana sylvestris
gb|EYU28125.1|  hypothetical protein MIMGU_mgv1a007967mg                155   2e-41   Erythranthe guttata [common monkey flower]
ref|XP_004234074.1|  PREDICTED: BES1/BZR1 homolog protein 4 isofo...    153   2e-41   Solanum lycopersicum
ref|XP_011033513.1|  PREDICTED: BES1/BZR1 homolog protein 4-like ...    152   5e-41   Populus euphratica
ref|XP_002305719.1|  hypothetical protein POPTR_0004s06100g             152   5e-41   Populus trichocarpa [western balsam poplar]
ref|XP_010242162.1|  PREDICTED: BES1/BZR1 homolog protein 4             152   6e-41   Nelumbo nucifera [Indian lotus]
ref|XP_002522271.1|  BRASSINAZOLE-RESISTANT 2 protein, putative         150   2e-40   Ricinus communis
gb|KDP21147.1|  hypothetical protein JCGZ_21618                         150   3e-40   Jatropha curcas
ref|XP_006358087.1|  PREDICTED: BES1/BZR1 homolog protein 4-like ...    149   6e-40   Solanum tuberosum [potatoes]
ref|XP_007025289.1|  BES1/BZR1                                          147   3e-39   Theobroma cacao [chocolate]
gb|KJB68362.1|  hypothetical protein B456_010G240700                    145   7e-39   Gossypium raimondii
gb|KHG20428.1|  BES1/BZR1 4 -like protein                               146   1e-38   Gossypium arboreum [tree cotton]
gb|KJB68361.1|  hypothetical protein B456_010G240700                    146   1e-38   Gossypium raimondii
ref|XP_004233053.1|  PREDICTED: BES1/BZR1 homolog protein 4 isofo...    146   1e-38   Solanum lycopersicum
ref|XP_004147390.1|  PREDICTED: BES1/BZR1 homolog protein 4-like        145   2e-38   Cucumis sativus [cucumbers]
ref|XP_008443587.1|  PREDICTED: BES1/BZR1 homolog protein 4             145   3e-38   Cucumis melo [Oriental melon]
ref|XP_010052157.1|  PREDICTED: BES1/BZR1 homolog protein 4 isofo...    144   5e-38   Eucalyptus grandis [rose gum]
ref|XP_011039378.1|  PREDICTED: BES1/BZR1 homolog protein 4-like        142   3e-37   Populus euphratica
ref|XP_010316856.1|  PREDICTED: BES1/BZR1 homolog protein 4 isofo...    141   6e-37   Solanum lycopersicum
ref|XP_006449559.1|  hypothetical protein CICLE_v10015910mg             140   1e-36   Citrus clementina [clementine]
gb|EPS61611.1|  hypothetical protein M569_13185                         137   2e-35   Genlisea aurea
ref|XP_010518826.1|  PREDICTED: BES1/BZR1 homolog protein 3 isofo...    135   6e-35   Tarenaya hassleriana [spider flower]
ref|XP_009352718.1|  PREDICTED: BES1/BZR1 homolog protein 4-like        136   7e-35   Pyrus x bretschneideri [bai li]
ref|XP_010518825.1|  PREDICTED: BES1/BZR1 homolog protein 3 isofo...    135   1e-34   Tarenaya hassleriana [spider flower]
ref|XP_008371512.1|  PREDICTED: BES1/BZR1 homolog protein 4-like        135   1e-34   Malus domestica [apple tree]
gb|KJB69669.1|  hypothetical protein B456_011G036300                    132   1e-34   Gossypium raimondii
ref|XP_008383594.1|  PREDICTED: BES1/BZR1 homolog protein 4-like        135   2e-34   
emb|CDP06034.1|  unnamed protein product                                134   2e-34   Coffea canephora [robusta coffee]
ref|XP_008796066.1|  PREDICTED: protein BZR1 homolog 3                  134   3e-34   Phoenix dactylifera
gb|KJB69670.1|  hypothetical protein B456_011G036300                    133   5e-34   Gossypium raimondii
gb|KHG25078.1|  BES1/BZR1 4 -like protein                               133   6e-34   Gossypium arboreum [tree cotton]
gb|KJB69668.1|  hypothetical protein B456_011G036300                    133   7e-34   Gossypium raimondii
gb|KHG15415.1|  BES1/BZR1 4 -like protein                               133   1e-33   Gossypium arboreum [tree cotton]
ref|XP_008451746.1|  PREDICTED: BES1/BZR1 homolog protein 4             133   1e-33   Cucumis melo [Oriental melon]
ref|XP_010915465.1|  PREDICTED: protein BZR1 homolog 3-like             133   2e-33   Elaeis guineensis
ref|XP_006442380.1|  hypothetical protein CICLE_v10021151mg             132   2e-33   Citrus clementina [clementine]
ref|XP_007021866.1|  BES1/BZR1                                          132   2e-33   
ref|XP_004137229.1|  PREDICTED: BES1/BZR1 homolog protein 4-like        132   2e-33   Cucumis sativus [cucumbers]
ref|XP_006477843.1|  PREDICTED: BES1/BZR1 homolog protein 4-like ...    131   4e-33   Citrus sinensis [apfelsine]
ref|XP_010644097.1|  PREDICTED: BES1/BZR1 homolog protein 4             131   4e-33   Vitis vinifera
ref|XP_010916623.1|  PREDICTED: protein BZR1 homolog 3-like             131   5e-33   Elaeis guineensis
gb|KJB13026.1|  hypothetical protein B456_002G052400                    130   9e-33   Gossypium raimondii
ref|XP_006370100.1|  hypothetical protein POPTR_0001s39520g             129   2e-32   Populus trichocarpa [western balsam poplar]
ref|XP_011002762.1|  PREDICTED: BES1/BZR1 homolog protein 4 isofo...    129   2e-32   Populus euphratica
ref|XP_004489001.1|  PREDICTED: BES1/BZR1 homolog protein 4-like ...    129   3e-32   Cicer arietinum [garbanzo]
gb|KJB45771.1|  hypothetical protein B456_007G327000                    129   3e-32   Gossypium raimondii
ref|XP_002317445.1|  brassinosteroid signaling positive regulator...    129   4e-32   Populus trichocarpa [western balsam poplar]
ref|XP_009359371.1|  PREDICTED: BES1/BZR1 homolog protein 4-like        128   5e-32   Pyrus x bretschneideri [bai li]
ref|XP_006833072.1|  hypothetical protein AMTR_s00170p00061300          127   8e-32   Amborella trichopoda
ref|XP_009334016.1|  PREDICTED: BES1/BZR1 homolog protein 4-like        128   9e-32   Pyrus x bretschneideri [bai li]
ref|XP_007149549.1|  hypothetical protein PHAVU_005G079400g             127   1e-31   Phaseolus vulgaris [French bean]
ref|XP_004489004.1|  PREDICTED: BES1/BZR1 homolog protein 4-like ...    127   1e-31   Cicer arietinum [garbanzo]
ref|XP_004489003.1|  PREDICTED: BES1/BZR1 homolog protein 4-like ...    127   2e-31   
ref|XP_007211588.1|  hypothetical protein PRUPE_ppa008637mg             126   3e-31   Prunus persica
ref|XP_007211637.1|  hypothetical protein PRUPE_ppa008675mg             126   3e-31   Prunus persica
gb|KHG21553.1|  BES1/BZR1 4 -like protein                               125   4e-31   Gossypium arboreum [tree cotton]
ref|XP_009768995.1|  PREDICTED: BES1/BZR1 homolog protein 4-like        125   4e-31   Nicotiana sylvestris
ref|XP_009416433.1|  PREDICTED: protein BZR1 homolog 3                  126   5e-31   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_011044050.1|  PREDICTED: BES1/BZR1 homolog protein 4-like        125   5e-31   Populus euphratica
ref|XP_009622768.1|  PREDICTED: BES1/BZR1 homolog protein 4-like        124   1e-30   Nicotiana tomentosiformis
ref|XP_008386283.1|  PREDICTED: BES1/BZR1 homolog protein 4-like        125   1e-30   
ref|XP_002267082.1|  PREDICTED: BES1/BZR1 homolog protein 4             125   1e-30   Vitis vinifera
emb|CBI20158.3|  unnamed protein product                                119   2e-30   Vitis vinifera
ref|XP_003540501.1|  PREDICTED: BES1/BZR1 homolog protein 4-like ...    124   2e-30   Glycine max [soybeans]
ref|XP_006592939.1|  PREDICTED: BES1/BZR1 homolog protein 4-like ...    124   2e-30   Glycine max [soybeans]
ref|XP_003596275.1|  Brassinosteroid signaling positive regulator...    124   2e-30   Medicago truncatula
ref|XP_004244287.1|  PREDICTED: BES1/BZR1 homolog protein 4             124   2e-30   Solanum lycopersicum
ref|XP_006348323.1|  PREDICTED: BES1/BZR1 homolog protein 4-like        124   3e-30   Solanum tuberosum [potatoes]
ref|XP_010665681.1|  PREDICTED: BES1/BZR1 homolog protein 4             124   3e-30   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_003543195.1|  PREDICTED: BES1/BZR1 homolog protein 4-like        123   4e-30   Glycine max [soybeans]
ref|XP_008381083.1|  PREDICTED: BES1/BZR1 homolog protein 4             123   4e-30   
gb|KHN36918.1|  BES1/BZR1 like protein 4                                123   6e-30   Glycine soja [wild soybean]
ref|XP_009381197.1|  PREDICTED: BES1/BZR1 homolog protein 4-like        124   6e-30   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010924706.1|  PREDICTED: protein BZR1 homolog 3-like             123   7e-30   Elaeis guineensis
ref|XP_009397454.1|  PREDICTED: protein BZR1 homolog 2-like             123   7e-30   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_008226380.1|  PREDICTED: BES1/BZR1 homolog protein 4-like        122   7e-30   Prunus mume [ume]
ref|XP_004294130.1|  PREDICTED: BES1/BZR1 homolog protein 4-like        122   8e-30   Fragaria vesca subsp. vesca
gb|ABK21940.1|  unknown                                                 122   2e-29   Picea sitchensis
gb|AES66525.2|  brassinazole-resistant 1 protein                        123   2e-29   Medicago truncatula
ref|XP_003596274.1|  Brassinosteroid signaling positive regulator...    122   2e-29   
ref|XP_003540502.1|  PREDICTED: BES1/BZR1 homolog protein 4             120   6e-29   Glycine max [soybeans]
ref|XP_010925590.1|  PREDICTED: protein BZR1 homolog 3-like             120   7e-29   
ref|XP_004309625.1|  PREDICTED: BES1/BZR1 homolog protein 4             120   7e-29   Fragaria vesca subsp. vesca
gb|ACU18376.1|  unknown                                                 115   7e-29   Glycine max [soybeans]
ref|XP_009415180.1|  PREDICTED: protein BZR1 homolog 3-like             120   8e-29   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_006594721.1|  PREDICTED: BES1/BZR1 homolog protein 4-like ...    119   1e-28   Glycine max [soybeans]
ref|XP_003543196.1|  PREDICTED: BES1/BZR1 homolog protein 4-like ...    119   1e-28   Glycine max [soybeans]
ref|XP_009136969.1|  PREDICTED: BES1/BZR1 homolog protein 3-like        118   1e-28   Brassica rapa
emb|CDY01563.1|  BnaC07g35530D                                          118   1e-28   
emb|CDX98592.1|  BnaA03g43770D                                          118   2e-28   
ref|XP_011082785.1|  PREDICTED: BES1/BZR1 homolog protein 4             118   3e-28   
ref|XP_009388695.1|  PREDICTED: protein BZR1 homolog 3-like             119   3e-28   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_006284265.1|  hypothetical protein CARUB_v10005431mg             117   4e-28   Capsella rubella
ref|NP_193624.1|  BES1/BZR1-like protein 3                              117   4e-28   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009132289.1|  PREDICTED: BES1/BZR1 homolog protein 3             117   4e-28   Brassica rapa
ref|XP_010429699.1|  PREDICTED: BES1/BZR1 homolog protein 4-like        118   4e-28   Camelina sativa [gold-of-pleasure]
ref|XP_010062789.1|  PREDICTED: BES1/BZR1 homolog protein 4-like        117   5e-28   Eucalyptus grandis [rose gum]
ref|XP_010417476.1|  PREDICTED: BES1/BZR1 homolog protein 4             117   5e-28   Camelina sativa [gold-of-pleasure]
ref|XP_010088009.1|  hypothetical protein L484_004599                   118   5e-28   
ref|XP_010537716.1|  PREDICTED: BES1/BZR1 homolog protein 4             117   5e-28   Tarenaya hassleriana [spider flower]
ref|XP_006389963.1|  hypothetical protein EUTSA_v10018888mg             117   6e-28   Eutrema salsugineum [saltwater cress]
ref|NP_565187.1|  BES1/BZR1 homolog 4                                   117   7e-28   Arabidopsis thaliana [mouse-ear cress]
gb|KFK28557.1|  hypothetical protein AALP_AA7G011700                    116   1e-27   Arabis alpina [alpine rockcress]
ref|XP_002887754.1|  hypothetical protein ARALYDRAFT_895772             116   1e-27   Arabidopsis lyrata subsp. lyrata
ref|XP_010434483.1|  PREDICTED: BES1/BZR1 homolog protein 3             115   2e-27   Camelina sativa [gold-of-pleasure]
ref|XP_006302567.1|  hypothetical protein CARUB_v10020674mg             115   2e-27   Capsella rubella
ref|XP_006414043.1|  hypothetical protein EUTSA_v10025918mg             115   3e-27   Eutrema salsugineum [saltwater cress]
ref|XP_002870016.1|  hypothetical protein ARALYDRAFT_492971             114   5e-27   
ref|XP_010472705.1|  PREDICTED: BES1/BZR1 homolog protein 4-like        114   1e-26   Camelina sativa [gold-of-pleasure]
ref|XP_002983955.1|  hypothetical protein SELMODRAFT_451483             115   1e-26   Selaginella moellendorffii
ref|XP_002960716.1|  hypothetical protein SELMODRAFT_437216             115   1e-26   Selaginella moellendorffii
ref|XP_008792311.1|  PREDICTED: protein BZR1 homolog 3-like             112   4e-26   Phoenix dactylifera
ref|XP_008790049.1|  PREDICTED: protein BZR1 homolog 3-like             112   5e-26   Phoenix dactylifera
emb|CDY14593.1|  BnaC02g25200D                                          111   8e-26   Brassica napus [oilseed rape]
emb|CDY26877.1|  BnaA02g19020D                                          111   8e-26   Brassica napus [oilseed rape]
ref|XP_009128310.1|  PREDICTED: BES1/BZR1 homolog protein 4             111   9e-26   Brassica rapa
emb|CDX88466.1|  BnaC06g39100D                                          110   2e-25   
emb|CDX87440.1|  BnaA07g34330D                                          109   5e-25   
ref|XP_002437132.1|  hypothetical protein SORBIDRAFT_10g021750          109   5e-25   Sorghum bicolor [broomcorn]
ref|XP_009106588.1|  PREDICTED: BES1/BZR1 homolog protein 4-like        108   7e-25   Brassica rapa
gb|ABR18463.1|  unknown                                                 109   1e-24   Picea sitchensis
ref|XP_001782551.1|  predicted protein                                  111   1e-24   
ref|XP_004965584.1|  PREDICTED: BES1/BZR1 homolog protein 4-like        108   1e-24   Setaria italica
ref|XP_010675300.1|  PREDICTED: BES1/BZR1 homolog protein 4             107   2e-24   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_010559011.1|  PREDICTED: BES1/BZR1 homolog protein 3-like        103   2e-24   Tarenaya hassleriana [spider flower]
ref|NP_001136786.1|  BES transcription factor                           107   4e-24   Zea mays [maize]
ref|XP_001782618.1|  predicted protein                                  107   4e-24   
gb|EYU29527.1|  hypothetical protein MIMGU_mgv1a010055mg                107   5e-24   Erythranthe guttata [common monkey flower]
ref|XP_003565213.1|  PREDICTED: protein BZR1 homolog 2                  106   7e-24   
gb|KFK42252.1|  hypothetical protein AALP_AA2G231000                    105   1e-23   Arabis alpina [alpine rockcress]
gb|EMT21245.1|  hypothetical protein F775_32777                         103   7e-23   
gb|EEC80795.1|  hypothetical protein OsI_23332                          103   1e-22   Oryza sativa Indica Group [Indian rice]
ref|NP_001057840.1|  Os06g0552300                                       103   1e-22   
ref|XP_002454981.1|  hypothetical protein SORBIDRAFT_03g002480          103   1e-22   Sorghum bicolor [broomcorn]
ref|XP_004968562.1|  PREDICTED: BES1/BZR1 homolog protein 4-like        103   1e-22   Setaria italica
dbj|BAB33003.1|  unknown protein                                        102   2e-22   Oryza sativa Japonica Group [Japonica rice]
ref|NP_001042330.1|  Os01g0203000                                       102   2e-22   
ref|XP_003563774.1|  PREDICTED: protein BZR1 homolog 3                  102   2e-22   Brachypodium distachyon [annual false brome]
ref|NP_001132634.1|  uncharacterized protein LOC100194109               102   2e-22   Zea mays [maize]
gb|ACG41016.1|  brassinazole-resistant 1 protein                        102   2e-22   Zea mays [maize]
ref|XP_010254939.1|  PREDICTED: BES1/BZR1 homolog protein 2             102   2e-22   Nelumbo nucifera [Indian lotus]
ref|XP_006377532.1|  hypothetical protein POPTR_0011s06810g           98.2    2e-22   
emb|CDM82126.1|  unnamed protein product                                101   4e-22   Triticum aestivum [Canadian hard winter wheat]
gb|EEC70129.1|  hypothetical protein OsI_00807                          100   7e-22   Oryza sativa Indica Group [Indian rice]
gb|EEE54074.1|  hypothetical protein OsJ_00786                          100   7e-22   Oryza sativa Japonica Group [Japonica rice]
ref|XP_002965931.1|  hypothetical protein SELMODRAFT_407084             100   8e-22   Selaginella moellendorffii
ref|XP_010093488.1|  hypothetical protein L484_017551                   100   1e-21   
ref|XP_002968357.1|  hypothetical protein SELMODRAFT_409126             100   1e-21   Selaginella moellendorffii
ref|XP_009349751.1|  PREDICTED: BES1/BZR1 homolog protein 2-like      99.8    2e-21   Pyrus x bretschneideri [bai li]
ref|XP_006383240.1|  hypothetical protein POPTR_0005s12790g           99.8    2e-21   
ref|XP_008795632.1|  PREDICTED: protein BZR1 homolog 1-like           99.8    2e-21   Phoenix dactylifera
ref|XP_009379188.1|  PREDICTED: BES1/BZR1 homolog protein 2-like      99.4    2e-21   Pyrus x bretschneideri [bai li]
ref|XP_006383241.1|  hypothetical protein POPTR_0005s12790g           99.4    2e-21   Populus trichocarpa [western balsam poplar]
emb|CDX99414.1|  BnaC01g11380D                                        99.4    2e-21   
ref|XP_010680895.1|  PREDICTED: BES1/BZR1 homolog protein 2-like      99.4    2e-21   Beta vulgaris subsp. vulgaris [field beet]
gb|EYU44662.1|  hypothetical protein MIMGU_mgv1a010729mg              99.4    2e-21   Erythranthe guttata [common monkey flower]
ref|XP_010999949.1|  PREDICTED: BES1/BZR1 homolog protein 2-like      99.4    3e-21   Populus euphratica
ref|XP_009374228.1|  PREDICTED: BES1/BZR1 homolog protein 2           99.0    3e-21   Pyrus x bretschneideri [bai li]
ref|XP_009389663.1|  PREDICTED: protein BZR1 homolog 1-like           99.0    3e-21   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_008241630.1|  PREDICTED: BES1/BZR1 homolog protein 2           99.0    3e-21   Prunus mume [ume]
ref|XP_008338783.1|  PREDICTED: BES1/BZR1 homolog protein 2-like      99.0    3e-21   
ref|XP_002273547.1|  PREDICTED: BES1/BZR1 homolog protein 2           99.0    3e-21   Vitis vinifera
ref|XP_007202252.1|  hypothetical protein PRUPE_ppa008842mg           99.0    3e-21   Prunus persica
ref|XP_010907212.1|  PREDICTED: protein BZR1 homolog 1-like           98.2    6e-21   Elaeis guineensis
gb|KDP38469.1|  hypothetical protein JCGZ_04394                       97.8    7e-21   Jatropha curcas
ref|XP_009411027.1|  PREDICTED: protein BZR1 homolog 1                97.8    7e-21   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_011097209.1|  PREDICTED: BES1/BZR1 homolog protein 2-like      97.8    7e-21   Sesamum indicum [beniseed]
ref|XP_002525100.1|  BRASSINAZOLE-RESISTANT 1 protein, putative       97.8    8e-21   Ricinus communis
ref|XP_011099590.1|  PREDICTED: BES1/BZR1 homolog protein 2           97.8    8e-21   Sesamum indicum [beniseed]
dbj|BAJ97997.1|  predicted protein                                    97.8    9e-21   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_011025717.1|  PREDICTED: LOW QUALITY PROTEIN: BES1/BZR1 ho...  97.4    1e-20   Populus euphratica
ref|XP_004958130.1|  PREDICTED: BES1/BZR1 homolog protein 2-like      97.4    1e-20   Setaria italica
ref|XP_009394366.1|  PREDICTED: protein BZR1 homolog 1-like           96.7    2e-20   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_007156899.1|  hypothetical protein PHAVU_002G0267001g          92.4    2e-20   Phaseolus vulgaris [French bean]
ref|XP_003537545.1|  PREDICTED: BES1/BZR1 homolog protein 2-like      96.7    2e-20   Glycine max [soybeans]
ref|XP_010558116.1|  PREDICTED: BES1/BZR1 homolog protein 1           96.3    2e-20   Tarenaya hassleriana [spider flower]
sp|Q6EUF1.2|BZR4_ORYSJ  RecName: Full=Protein BZR1 homolog 4; Sho...  97.1    2e-20   Oryza sativa Japonica Group [Japonica rice]
ref|XP_007047017.1|  Brassinosteroid signaling positive regulator...  96.7    2e-20   
emb|CAN83287.1|  hypothetical protein VITISV_033232                   96.3    2e-20   Vitis vinifera
ref|XP_010531182.1|  PREDICTED: BES1/BZR1 homolog protein 2-like      96.3    2e-20   Tarenaya hassleriana [spider flower]
ref|XP_002283352.1|  PREDICTED: protein BRASSINAZOLE-RESISTANT 1      96.3    2e-20   Vitis vinifera
ref|XP_010943157.1|  PREDICTED: protein BZR1 homolog 1-like           96.3    2e-20   Elaeis guineensis
emb|CDP02805.1|  unnamed protein product                              96.3    2e-20   Coffea canephora [robusta coffee]
ref|XP_002310201.1|  hypothetical protein POPTR_0007s12370g           96.3    2e-20   Populus trichocarpa [western balsam poplar]
emb|CBI19651.3|  unnamed protein product                              95.9    3e-20   Vitis vinifera
ref|XP_002463083.1|  hypothetical protein SORBIDRAFT_02g037500        96.3    3e-20   Sorghum bicolor [broomcorn]
ref|XP_008653282.1|  PREDICTED: protein BZR1 homolog 1-like           96.3    3e-20   
ref|XP_004300602.1|  PREDICTED: BES1/BZR1 homolog protein 2           95.9    3e-20   Fragaria vesca subsp. vesca
gb|KDP31804.1|  hypothetical protein JCGZ_12265                       95.9    3e-20   Jatropha curcas
emb|CDX90690.1|  BnaA03g40910D                                        95.9    3e-20   
sp|Q7XI96.1|BZR1_ORYSJ  RecName: Full=Protein BZR1 homolog 1; Sho...  95.9    4e-20   Oryza sativa Japonica Group [Japonica rice]
ref|NP_001060100.2|  Os07g0580500                                     95.9    4e-20   
ref|XP_009136556.1|  PREDICTED: BES1/BZR1 homolog protein 1           95.5    4e-20   Brassica rapa
gb|ADE77805.1|  unknown                                               95.5    4e-20   Picea sitchensis
ref|XP_007156901.1|  hypothetical protein PHAVU_002G0268001g          91.7    4e-20   Phaseolus vulgaris [French bean]
ref|NP_190644.1|  BES1/BZR1 1                                         95.1    4e-20   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002510347.1|  BRASSINAZOLE-RESISTANT 1 protein, putative       95.5    4e-20   Ricinus communis
ref|XP_003517250.1|  PREDICTED: BES1/BZR1 homolog protein 2-like      95.5    5e-20   
ref|NP_001151195.1|  BES1/BZR1 protein                                95.5    5e-20   
ref|XP_008806188.1|  PREDICTED: protein BZR1 homolog 1-like           95.5    5e-20   Phoenix dactylifera
gb|KDO79470.1|  hypothetical protein CISIN_1g020929mg                 95.1    6e-20   Citrus sinensis [apfelsine]
ref|XP_008440681.1|  PREDICTED: BES1/BZR1 homolog protein 2           95.1    6e-20   Cucumis melo [Oriental melon]
ref|XP_004143497.1|  PREDICTED: BES1/BZR1 homolog protein 2-like      95.1    6e-20   Cucumis sativus [cucumbers]
ref|XP_006466728.1|  PREDICTED: BES1/BZR1 homolog protein 2-like      95.1    7e-20   Citrus sinensis [apfelsine]
ref|XP_010070026.1|  PREDICTED: BES1/BZR1 homolog protein 2-like      95.1    7e-20   
ref|XP_006404006.1|  hypothetical protein EUTSA_v10010593mg           94.7    7e-20   Eutrema salsugineum [saltwater cress]
ref|XP_002877766.1|  hypothetical protein ARALYDRAFT_485421           94.7    8e-20   
ref|XP_006425734.1|  hypothetical protein CICLE_v10026102mg           95.1    8e-20   Citrus clementina [clementine]
ref|XP_007017466.1|  Brassinosteroid signaling positive regulator...  94.7    1e-19   Theobroma cacao [chocolate]
gb|KJB59824.1|  hypothetical protein B456_009G274000                  94.7    1e-19   Gossypium raimondii
ref|XP_006342599.1|  PREDICTED: protein BRASSINAZOLE-RESISTANT 1-...  94.7    1e-19   Solanum tuberosum [potatoes]
emb|CDP07559.1|  unnamed protein product                              94.7    1e-19   Coffea canephora [robusta coffee]
ref|XP_010471609.1|  PREDICTED: protein BRASSINAZOLE-RESISTANT 1-...  94.0    2e-19   Camelina sativa [gold-of-pleasure]
emb|CDY64371.1|  BnaC07g50000D                                        93.6    2e-19   Brassica napus [oilseed rape]
ref|XP_003571150.2|  PREDICTED: protein BZR1 homolog 3-like           94.0    2e-19   Brachypodium distachyon [annual false brome]
gb|EMT29878.1|  hypothetical protein F775_52316                       93.6    2e-19   
ref|XP_010521471.1|  PREDICTED: BES1/BZR1 homolog protein 1-like      93.2    2e-19   Tarenaya hassleriana [spider flower]
gb|AFK40796.1|  unknown                                               92.8    2e-19   Lotus japonicus
emb|CBI20161.3|  unnamed protein product                              92.8    3e-19   Vitis vinifera
gb|KHN36916.1|  Protein BRASSINAZOLE-RESISTANT 2                      89.4    3e-19   Glycine soja [wild soybean]
gb|KJB58324.1|  hypothetical protein B456_009G204600                  93.2    3e-19   Gossypium raimondii
ref|NP_001234745.1|  mature anther-specific protein LAT61             93.2    3e-19   
ref|XP_007047018.1|  Brassinosteroid signaling positive regulator...  93.2    3e-19   
gb|ADE77262.1|  unknown                                               93.2    3e-19   Picea sitchensis
ref|XP_006367310.1|  PREDICTED: protein BRASSINAZOLE-RESISTANT 1-...  92.8    4e-19   
ref|XP_011083731.1|  PREDICTED: protein BRASSINAZOLE-RESISTANT 1      92.8    4e-19   Sesamum indicum [beniseed]
ref|NP_195396.4|  BES1/BZR1-like protein 2                            92.4    4e-19   Arabidopsis thaliana [mouse-ear cress]
gb|AFK43588.1|  unknown                                               92.8    5e-19   Medicago truncatula
ref|XP_006583443.1|  PREDICTED: protein argonaute 4-like              92.0    5e-19   Glycine max [soybeans]
ref|XP_010426615.1|  PREDICTED: BES1/BZR1 homolog protein 1           92.4    5e-19   Camelina sativa [gold-of-pleasure]
ref|XP_003611934.1|  BES1/BZR1-like protein                           92.8    5e-19   Medicago truncatula
ref|XP_010548357.1|  PREDICTED: BES1/BZR1 homolog protein 2-like      92.4    5e-19   Tarenaya hassleriana [spider flower]
gb|EYU45114.1|  hypothetical protein MIMGU_mgv1a009718mg              92.8    5e-19   Erythranthe guttata [common monkey flower]
ref|XP_004238228.1|  PREDICTED: protein BRASSINAZOLE-RESISTANT 1      92.4    5e-19   Solanum lycopersicum
ref|XP_008220760.1|  PREDICTED: protein BRASSINAZOLE-RESISTANT 1      92.4    5e-19   Prunus mume [ume]
gb|KJB29554.1|  hypothetical protein B456_005G107000                  92.4    6e-19   Gossypium raimondii
ref|XP_010539923.1|  PREDICTED: protein BRASSINAZOLE-RESISTANT 1      92.4    6e-19   Tarenaya hassleriana [spider flower]
gb|KFK30297.1|  hypothetical protein AALP_AA7G243400                  92.4    6e-19   Arabis alpina [alpine rockcress]
ref|XP_009142040.1|  PREDICTED: BES1/BZR1 homolog protein 2           92.0    6e-19   Brassica rapa
ref|XP_011074507.1|  PREDICTED: protein BRASSINAZOLE-RESISTANT 1 ...  92.4    7e-19   Sesamum indicum [beniseed]
gb|EMS63049.1|  hypothetical protein TRIUR3_11319                     94.4    7e-19   Triticum urartu
emb|CDY62653.1|  BnaAnng18240D                                        92.0    7e-19   Brassica napus [oilseed rape]
ref|XP_009594614.1|  PREDICTED: protein BRASSINAZOLE-RESISTANT 1      92.0    7e-19   Nicotiana tomentosiformis
gb|AFG30996.1|  BES1S                                                 89.7    8e-19   Triticum aestivum [Canadian hard winter wheat]
ref|XP_006411962.1|  hypothetical protein EUTSA_v10025775mg           92.0    8e-19   Eutrema salsugineum [saltwater cress]
ref|XP_008444689.1|  PREDICTED: protein BRASSINAZOLE-RESISTANT 1-...  91.7    9e-19   Cucumis melo [Oriental melon]
ref|XP_010428512.1|  PREDICTED: protein BRASSINAZOLE-RESISTANT 1      92.0    9e-19   Camelina sativa [gold-of-pleasure]
ref|XP_010416372.1|  PREDICTED: protein BRASSINAZOLE-RESISTANT 1      92.0    9e-19   Camelina sativa [gold-of-pleasure]
ref|XP_009781919.1|  PREDICTED: protein BRASSINAZOLE-RESISTANT 1-...  91.7    1e-18   Nicotiana sylvestris
emb|CDY59466.1|  BnaCnng34980D                                        91.7    1e-18   Brassica napus [oilseed rape]
ref|XP_009765795.1|  PREDICTED: BES1/BZR1 homolog protein 2-like      91.7    1e-18   Nicotiana sylvestris
ref|XP_004512010.1|  PREDICTED: BES1/BZR1 homolog protein 2-like      91.7    1e-18   
ref|XP_006284125.1|  hypothetical protein CARUB_v10005257mg           91.7    1e-18   Capsella rubella
ref|XP_006302529.1|  hypothetical protein CARUB_v10020629mg           91.7    1e-18   Capsella rubella
sp|Q94A43.1|BEH2_ARATH  RecName: Full=BES1/BZR1 homolog protein 2     91.7    1e-18   Arabidopsis thaliana [mouse-ear cress]
ref|XP_004152709.1|  PREDICTED: protein BRASSINAZOLE-RESISTANT 1-...  91.7    1e-18   
emb|CDX72603.1|  BnaC07g46250D                                        91.7    1e-18   
ref|XP_009610833.1|  PREDICTED: BES1/BZR1 homolog protein 2-like      91.7    1e-18   Nicotiana tomentosiformis
ref|XP_002866992.1|  hypothetical protein ARALYDRAFT_912686           91.7    1e-18   Arabidopsis lyrata subsp. lyrata
ref|XP_007223253.1|  hypothetical protein PRUPE_ppa009388mg           91.3    1e-18   Prunus persica
gb|EPS60905.1|  hypothetical protein M569_13896                       91.3    1e-18   Genlisea aurea
ref|XP_002887573.1|  At1g75080/F9E10_7                                91.3    1e-18   
ref|XP_009414760.1|  PREDICTED: protein BZR1 homolog 1-like           91.3    1e-18   Musa acuminata subsp. malaccensis [pisang utan]
ref|NP_565099.1|  brassinazole-resistant 1 protein                    91.3    1e-18   Arabidopsis thaliana [mouse-ear cress]
gb|AAL57684.1|  At1g75080/F9E10_7                                     91.3    1e-18   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010503740.1|  PREDICTED: BES1/BZR1 homolog protein 1-like      90.9    2e-18   Camelina sativa [gold-of-pleasure]
ref|XP_006473462.1|  PREDICTED: protein BRASSINAZOLE-RESISTANT 1-...  90.9    2e-18   Citrus sinensis [apfelsine]
ref|XP_006434936.1|  hypothetical protein CICLE_v10001978mg           90.9    2e-18   Citrus clementina [clementine]
ref|XP_009104725.1|  PREDICTED: protein BRASSINAZOLE-RESISTANT 1      90.9    2e-18   Brassica rapa
emb|CDX68150.1|  BnaA07g21900D                                        90.9    2e-18   
ref|XP_010437306.1|  PREDICTED: BES1/BZR1 homolog protein 2-like      90.9    2e-18   
ref|XP_007160782.1|  hypothetical protein PHAVU_001G016100g           90.9    2e-18   
ref|XP_010432137.1|  PREDICTED: BES1/BZR1 homolog protein 2           90.9    2e-18   
ref|XP_006291638.1|  hypothetical protein CARUB_v10017793mg           90.5    2e-18   
emb|CDX69246.1|  BnaC01g02070D                                        90.9    2e-18   
ref|XP_006390354.1|  hypothetical protein EUTSA_v10018835mg           90.9    2e-18   
ref|XP_010446744.1|  PREDICTED: BES1/BZR1 homolog protein 2-like      90.9    2e-18   
ref|XP_004233505.1|  PREDICTED: BES1/BZR1 homolog protein 2-like      90.9    2e-18   
ref|XP_006601311.1|  PREDICTED: protein BRASSINAZOLE-RESISTANT 1-...  90.9    2e-18   
ref|XP_003544426.1|  PREDICTED: protein BRASSINAZOLE-RESISTANT 1-...  90.5    2e-18   
gb|KFK41947.1|  hypothetical protein AALP_AA2G192600                  90.9    2e-18   
gb|KHN20997.1|  Protein BRASSINAZOLE-RESISTANT 1                      90.5    2e-18   
ref|XP_010060920.1|  PREDICTED: protein BRASSINAZOLE-RESISTANT 1-...  90.5    2e-18   
ref|XP_010106032.1|  hypothetical protein L484_021209                 90.5    2e-18   
emb|CAB16821.1|  putative protein                                     88.6    3e-18   
ref|XP_009106166.1|  PREDICTED: protein BRASSINAZOLE-RESISTANT 1      90.5    3e-18   
ref|XP_009365607.1|  PREDICTED: protein BRASSINAZOLE-RESISTANT 1      90.1    4e-18   
ref|XP_010412706.1|  PREDICTED: BES1/BZR1 homolog protein 1-like      89.4    4e-18   
gb|AFK41936.1|  unknown                                               87.0    4e-18   
ref|XP_006596113.1|  PREDICTED: uncharacterized protein LOC100812053  89.7    4e-18   
ref|XP_009767052.1|  PREDICTED: protein BRASSINAZOLE-RESISTANT 1-...  89.7    4e-18   
ref|XP_006658737.1|  PREDICTED: BES1/BZR1 homolog protein 2-like      89.7    4e-18   
ref|XP_010498349.1|  PREDICTED: protein BRASSINAZOLE-RESISTANT 2-...  89.7    5e-18   
ref|XP_002890330.1|  bri1-ems-suppressor 1                            89.7    5e-18   
ref|XP_010459601.1|  PREDICTED: protein BRASSINAZOLE-RESISTANT 2      89.7    5e-18   
gb|AAM64408.1|  unknown                                               89.7    5e-18   
ref|XP_010477145.1|  PREDICTED: protein BRASSINAZOLE-RESISTANT 2-...  89.7    5e-18   
ref|NP_564081.1|  protein brassinazole-resistant 2                    89.7    5e-18   
gb|AAF22161.1|AF134217_1  107 protein                                 89.7    5e-18   
ref|XP_006856104.1|  hypothetical protein AMTR_s00059p00136790        87.0    6e-18   
ref|NP_973863.1|  protein brassinazole-resistant 2                    89.7    6e-18   
gb|KHN22271.1|  Protein BRASSINAZOLE-RESISTANT 1                      89.4    6e-18   
ref|XP_009110278.1|  PREDICTED: protein BRASSINAZOLE-RESISTANT 2-...  89.4    7e-18   
emb|CDX83768.1|  BnaC08g18770D                                        89.4    7e-18   
emb|CDX96665.1|  BnaA08g22080D                                        89.4    7e-18   
gb|EPS60133.1|  hypothetical protein M569_14671                       89.0    8e-18   
ref|XP_006416513.1|  hypothetical protein EUTSA_v10008172mg           89.0    8e-18   
ref|XP_006346930.1|  PREDICTED: BES1/BZR1 homolog protein 2-like      89.0    9e-18   
ref|XP_011031482.1|  PREDICTED: protein BRASSINAZOLE-RESISTANT 1      89.0    9e-18   
ref|XP_003528182.1|  PREDICTED: protein BRASSINAZOLE-RESISTANT 1-...  89.0    9e-18   
ref|XP_003523854.1|  PREDICTED: protein BRASSINAZOLE-RESISTANT 1-...  89.0    9e-18   
gb|AFG30995.1|  BES1                                                  89.0    1e-17   
gb|KHN32496.1|  Protein argonaute 4                                   89.0    1e-17   
ref|XP_008377432.1|  PREDICTED: protein BRASSINAZOLE-RESISTANT 1      88.6    1e-17   
ref|XP_009364430.1|  PREDICTED: protein BRASSINAZOLE-RESISTANT 1-...  88.6    1e-17   
ref|XP_009587721.1|  PREDICTED: protein BRASSINAZOLE-RESISTANT 1-...  88.6    1e-17   
gb|EMT13476.1|  hypothetical protein F775_16100                       88.6    1e-17   
ref|XP_006305153.1|  hypothetical protein CARUB_v10009520mg           89.0    1e-17   
dbj|BAJ85589.1|  predicted protein                                    88.6    1e-17   
gb|ACU23266.1|  unknown                                               87.8    1e-17   
ref|XP_010095295.1|  hypothetical protein L484_014637                 88.6    1e-17   
ref|XP_003562829.1|  PREDICTED: protein BZR1 homolog 1-like           88.6    1e-17   
ref|XP_006375071.1|  brassinazole-resistant 2 family protein          88.2    1e-17   
gb|AGJ98226.1|  BES-like transcription factor BEH2                    88.2    2e-17   
ref|XP_009149416.1|  PREDICTED: protein BRASSINAZOLE-RESISTANT 2      88.2    2e-17   
ref|NP_001168185.1|  hypothetical protein                             88.6    2e-17   
ref|XP_002453576.1|  hypothetical protein SORBIDRAFT_04g008380        88.6    2e-17   
emb|CDY26676.1|  BnaA06g13460D                                        87.8    3e-17   
ref|XP_011074506.1|  PREDICTED: protein BRASSINAZOLE-RESISTANT 1 ...  87.8    3e-17   
ref|XP_011017294.1|  PREDICTED: protein BRASSINAZOLE-RESISTANT 1-...  87.4    3e-17   
gb|ACJ84321.1|  unknown                                               87.4    3e-17   
ref|XP_007136574.1|  hypothetical protein PHAVU_009G056400g           87.4    3e-17   
ref|XP_002301217.1|  brassinazole-resistant 2 family protein          87.4    3e-17   
ref|XP_004291900.1|  PREDICTED: protein BRASSINAZOLE-RESISTANT 1      87.4    3e-17   
emb|CDX81925.1|  BnaC08g36760D                                        87.4    3e-17   
emb|CDY69925.1|  BnaAnng32010D                                        87.0    4e-17   
ref|XP_004501038.1|  PREDICTED: protein BRASSINAZOLE-RESISTANT 1-...  87.0    4e-17   
ref|XP_009117543.1|  PREDICTED: protein BRASSINAZOLE-RESISTANT 2-...  86.7    5e-17   
emb|CDX73140.1|  BnaC06g35880D                                        86.3    6e-17   
tpg|DAA41222.1|  TPA: hypothetical protein ZEAMMB73_149703            86.7    6e-17   
emb|CDY21670.1|  BnaA09g44210D                                        87.0    7e-17   
gb|EYU32803.1|  hypothetical protein MIMGU_mgv1a009986mg              86.3    9e-17   
gb|EAZ22344.1|  hypothetical protein OsJ_05997                        85.5    9e-17   
tpg|DAA52958.1|  TPA: hypothetical protein ZEAMMB73_916860            83.6    9e-17   
ref|XP_010684125.1|  PREDICTED: protein BRASSINAZOLE-RESISTANT 1-...  85.5    1e-16   
ref|NP_001172869.1|  Os02g0233200                                     86.3    1e-16   
gb|EAY85121.1|  hypothetical protein OsI_06471                        86.3    1e-16   
ref|XP_008377452.1|  PREDICTED: protein BRASSINAZOLE-RESISTANT 1-...  84.7    1e-16   
ref|XP_008377342.1|  PREDICTED: protein BRASSINAZOLE-RESISTANT 1-...  85.1    2e-16   
ref|XP_002468545.1|  hypothetical protein SORBIDRAFT_01g047720        86.3    2e-16   
gb|ACU18252.1|  unknown                                               84.3    3e-16   
gb|EPS68364.1|  hypothetical protein M569_06407                       84.0    5e-16   
gb|AGT17385.1|  hypothetical protein SHCRBa_176_L06_F_70              80.9    1e-15   
gb|AAG51929.1|AC013258_23  unknown protein; 17658-16304               81.6    4e-15   
ref|XP_006648481.1|  PREDICTED: LOW QUALITY PROTEIN: BES1/BZR1 ho...  80.9    5e-15   
ref|XP_002453577.1|  hypothetical protein SORBIDRAFT_04g008400        81.6    6e-15   
ref|XP_006429487.1|  hypothetical protein CICLE_v10013546mg           77.8    2e-14   
gb|KDO63263.1|  hypothetical protein CISIN_1g043700mg                 77.8    2e-14   
ref|XP_008679813.1|  PREDICTED: protein BZR1 homolog 4                78.6    3e-14   
ref|XP_002991405.1|  hypothetical protein SELMODRAFT_429765           79.3    3e-14   
gb|AFW65979.1|  hypothetical protein ZEAMMB73_636175                  79.0    8e-14   
ref|XP_009609992.1|  PREDICTED: BES1/BZR1 homolog protein 3-like      73.9    1e-13   
gb|KEH40099.1|  brassinazole-resistant 1 protein                      76.3    2e-13   
ref|XP_009797386.1|  PREDICTED: protein BRASSINAZOLE-RESISTANT 2-...  75.1    2e-13   
ref|XP_009795965.1|  PREDICTED: uncharacterized protein LOC104242587  74.7    2e-13   
ref|XP_006829668.1|  hypothetical protein AMTR_s00122p00129760        74.7    4e-13   
ref|XP_007026585.1|  Brassinosteroid signaling positive regulator...  73.9    4e-13   
ref|XP_008645603.1|  PREDICTED: protein BZR1 homolog 4-like           75.5    8e-13   
ref|XP_010653393.1|  PREDICTED: BES1/BZR1 homolog protein 2-like      72.4    9e-13   
gb|KDP22831.1|  hypothetical protein JCGZ_00418                       72.4    1e-12   
ref|XP_001768561.1|  predicted protein                                75.9    1e-12   
ref|XP_010930840.1|  PREDICTED: protein BZR1 homolog 2-like           72.0    2e-12   
ref|XP_010677019.1|  PREDICTED: protein BRASSINAZOLE-RESISTANT 2-...  71.6    3e-12   
ref|XP_001760271.1|  predicted protein                                74.7    3e-12   
emb|CDP06431.1|  unnamed protein product                              69.7    2e-11   
ref|XP_011095225.1|  PREDICTED: beta-amylase 7-like                   69.3    2e-11   
ref|XP_002323613.1|  hypothetical protein POPTR_0016s13350g           69.3    2e-11   
ref|XP_010327721.1|  PREDICTED: protein BRASSINAZOLE-RESISTANT 2-...  67.8    7e-11   
gb|EYU41957.1|  hypothetical protein MIMGU_mgv1a026686mg              67.0    1e-10   
ref|XP_008786570.1|  PREDICTED: protein BRASSINAZOLE-RESISTANT 1-...  67.0    1e-10   
gb|KJB77048.1|  hypothetical protein B456_012G118900                  67.0    1e-10   
ref|XP_011046810.1|  PREDICTED: protein BRASSINAZOLE-RESISTANT 2-...  66.6    2e-10   
ref|XP_008451866.1|  PREDICTED: beta-amylase 8                        68.6    4e-10   
gb|KGN53462.1|  hypothetical protein Csa_4G056530                     68.6    4e-10   
ref|XP_004150546.1|  PREDICTED: beta-amylase 8-like                   68.2    5e-10   
ref|XP_007210828.1|  hypothetical protein PRUPE_ppa019231mg           67.0    1e-09   
ref|XP_004512346.1|  PREDICTED: beta-amylase 8-like                   66.6    2e-09   
ref|XP_008238070.1|  PREDICTED: beta-amylase 8                        66.6    2e-09   
ref|XP_009365721.1|  PREDICTED: beta-amylase 8                        66.6    2e-09   
ref|XP_002519919.1|  Beta-amylase, putative                           66.2    2e-09   
ref|XP_008373437.1|  PREDICTED: beta-amylase 8                        66.2    3e-09   
gb|KDP28061.1|  hypothetical protein JCGZ_19469                       65.9    3e-09   
ref|XP_009398814.1|  PREDICTED: protein BZR1 homolog 1-like           62.8    3e-09   
ref|XP_003534334.1|  PREDICTED: beta-amylase 8-like                   65.5    4e-09   
emb|CBI29216.3|  unnamed protein product                              65.1    4e-09   
ref|XP_010054915.1|  PREDICTED: beta-amylase 8                        65.5    5e-09   
ref|XP_002270680.1|  PREDICTED: beta-amylase 8                        65.1    5e-09   
ref|XP_007158095.1|  hypothetical protein PHAVU_002G123700g           65.1    5e-09   
ref|XP_003612541.1|  Beta-amylase                                     65.1    6e-09   
ref|XP_001764738.1|  predicted protein                                64.7    8e-09   
ref|XP_008803967.1|  PREDICTED: beta-amylase 8-like isoform X2        63.5    8e-09   
gb|KHN41758.1|  Beta-amylase 8                                        64.3    8e-09   
gb|AES95500.2|  beta-amylase-like protein                             63.9    9e-09   
ref|XP_008803966.1|  PREDICTED: beta-amylase 8-like isoform X1        63.5    9e-09   
ref|XP_010275178.1|  PREDICTED: LOW QUALITY PROTEIN: beta-amylase 8   64.3    9e-09   
ref|XP_003612542.1|  Beta-amylase                                     63.9    1e-08   
ref|XP_003516502.1|  PREDICTED: beta-amylase 8-like isoform X1        63.9    1e-08   
ref|XP_011465289.1|  PREDICTED: beta-amylase 8                        63.2    2e-08   
ref|XP_010941426.1|  PREDICTED: uncharacterized protein LOC105059706  63.2    2e-08   
gb|KJB51477.1|  hypothetical protein B456_008G218300                  63.2    2e-08   
gb|KJB51478.1|  hypothetical protein B456_008G218300                  62.8    3e-08   
ref|NP_199343.1|  beta-amylase 2                                      63.2    3e-08   
ref|NP_001032014.1|  beta-amylase 2                                   62.8    3e-08   
gb|KHG17783.1|  Beta-amylase 8 -like protein                          62.8    3e-08   
gb|KJB51475.1|  hypothetical protein B456_008G218300                  62.8    3e-08   
ref|XP_001771848.1|  predicted protein                                62.8    3e-08   
ref|XP_002973760.1|  hypothetical protein SELMODRAFT_414095           62.0    3e-08   
ref|XP_006846017.1|  hypothetical protein AMTR_s00155p00073540        61.2    3e-08   
ref|XP_002975808.1|  hypothetical protein SELMODRAFT_415870           61.6    4e-08   
ref|XP_010232995.1|  PREDICTED: BES1/BZR1 homolog protein 2-like      59.7    4e-08   
ref|XP_011027980.1|  PREDICTED: beta-amylase 8 isoform X2             62.4    4e-08   
ref|XP_011027979.1|  PREDICTED: beta-amylase 8 isoform X1             62.4    4e-08   
ref|XP_002304400.1|  hypothetical protein POPTR_0003s10570g           62.4    4e-08   
ref|XP_010910608.1|  PREDICTED: beta-amylase 8                        62.0    4e-08   
ref|XP_010324505.1|  PREDICTED: beta-amylase 8 isoform X5             62.0    4e-08   
ref|XP_004244442.1|  PREDICTED: beta-amylase 8 isoform X2             62.0    5e-08   
ref|XP_010324502.1|  PREDICTED: beta-amylase 8 isoform X1             62.0    5e-08   
ref|XP_007040897.1|  Beta-amylase 2                                   62.0    5e-08   
gb|KJB51476.1|  hypothetical protein B456_008G218300                  62.0    5e-08   
ref|XP_006878652.1|  hypothetical protein AMTR_s00011p00265640        62.0    5e-08   
ref|XP_010676684.1|  PREDICTED: beta-amylase 8                        62.0    5e-08   
ref|XP_009384530.1|  PREDICTED: beta-amylase 8                        62.0    5e-08   
ref|XP_006432891.1|  hypothetical protein CICLE_v10000490mg           62.0    6e-08   
ref|XP_006432890.1|  hypothetical protein CICLE_v10000490mg           61.6    6e-08   
gb|KDO43643.1|  hypothetical protein CISIN_1g005715mg                 61.6    6e-08   
gb|KDO43644.1|  hypothetical protein CISIN_1g005715mg                 61.6    6e-08   
gb|AFQ33619.1|  beta-amylase 7                                        61.6    6e-08   
ref|XP_010529274.1|  PREDICTED: LOW QUALITY PROTEIN: beta-amylase 8   61.6    8e-08   
ref|XP_002865252.1|  hypothetical protein ARALYDRAFT_356484           61.6    8e-08   
gb|KDO43646.1|  hypothetical protein CISIN_1g005715mg                 61.2    8e-08   
ref|XP_006398198.1|  hypothetical protein EUTSA_v10001222mg           61.2    9e-08   
ref|XP_006279583.1|  hypothetical protein CARUB_v10025996mg           61.2    9e-08   
gb|KFK31578.1|  hypothetical protein AALP_AA6G130300                  61.2    9e-08   
ref|XP_010481609.1|  PREDICTED: beta-amylase 8-like                   61.2    1e-07   
ref|XP_010441757.1|  PREDICTED: beta-amylase 8-like                   61.2    1e-07   
gb|KFK31577.1|  hypothetical protein AALP_AA6G130300                  61.2    1e-07   
ref|XP_006361593.1|  PREDICTED: beta-amylase 8-like                   60.8    1e-07   
ref|XP_010494622.1|  PREDICTED: beta-amylase 8                        60.8    1e-07   
ref|XP_011082155.1|  PREDICTED: beta-amylase 8 isoform X1             60.8    1e-07   
ref|XP_009589916.1|  PREDICTED: beta-amylase 8                        60.8    1e-07   
gb|EPS74220.1|  hypothetical protein M569_00539                       57.0    1e-07   
dbj|BAD67816.1|  hypothetical protein                                 58.2    1e-07   
ref|XP_002979060.1|  hypothetical protein SELMODRAFT_418727           60.5    1e-07   
gb|KDO43645.1|  hypothetical protein CISIN_1g005715mg                 60.5    1e-07   
ref|XP_006432889.1|  hypothetical protein CICLE_v10000490mg           60.5    1e-07   
ref|XP_011038890.1|  PREDICTED: BES1/BZR1 homolog protein 4-like      58.9    2e-07   
ref|XP_009769112.1|  PREDICTED: beta-amylase 8                        60.5    2e-07   
ref|XP_011082156.1|  PREDICTED: beta-amylase 8 isoform X2             60.1    2e-07   
gb|EEE53973.1|  hypothetical protein OsJ_00591                        58.2    2e-07   
ref|XP_010105162.1|  Beta-amylase 8                                   60.1    2e-07   
ref|XP_010324503.1|  PREDICTED: beta-amylase 8 isoform X3             60.1    2e-07   
ref|XP_010324504.1|  PREDICTED: beta-amylase 8 isoform X4             60.1    2e-07   
ref|XP_002298893.2|  hypothetical protein POPTR_0001s38140g           58.2    3e-07   
emb|CDY69112.1|  BnaA02g36650D                                        59.7    3e-07   
ref|XP_010241187.1|  PREDICTED: protein BZR1 homolog 3-like           58.5    3e-07   
emb|CDX87798.1|  BnaC02g31510D                                        59.3    4e-07   
ref|XP_009128781.1|  PREDICTED: beta-amylase 8                        58.9    5e-07   
ref|XP_008225589.1|  PREDICTED: BES1/BZR1 homolog protein 4-like      56.2    6e-07   
ref|XP_002455083.1|  hypothetical protein SORBIDRAFT_03g004070        56.2    6e-07   
ref|XP_011096676.1|  PREDICTED: BES1/BZR1 homolog protein 4-like      56.6    7e-07   
gb|EYU37446.1|  hypothetical protein MIMGU_mgv1a002385mg              58.5    8e-07   
ref|XP_006468299.1|  PREDICTED: beta-amylase 7-like isoform X1        56.6    1e-06   
emb|CDM81910.1|  unnamed protein product                              55.8    1e-06   
ref|XP_006448917.1|  hypothetical protein CICLE_v10017778mg           56.2    1e-06   
ref|XP_008808792.1|  PREDICTED: beta-amylase 8 isoform X1             57.8    1e-06   
ref|XP_004295606.1|  PREDICTED: protein BZR1 homolog 2-like           55.1    1e-06   
ref|NP_001045777.1|  Os02g0129600                                     57.0    1e-06   
gb|KDP34937.1|  hypothetical protein JCGZ_09225                       56.2    1e-06   
ref|XP_006295619.1|  hypothetical protein CARUB_v10024732mg           53.9    2e-06   
ref|XP_008808793.1|  PREDICTED: beta-amylase 8 isoform X2             57.4    2e-06   
ref|XP_003632998.2|  PREDICTED: protein BZR1 homolog 3-like           55.8    2e-06   
ref|XP_008383467.1|  PREDICTED: BES1/BZR1 homolog protein 2-like      55.1    2e-06   
emb|CBI31001.3|  unnamed protein product                              55.1    2e-06   
gb|EYU19128.1|  hypothetical protein MIMGU_mgv1a013909mg              55.5    2e-06   
ref|XP_009344419.1|  PREDICTED: protein BRASSINAZOLE-RESISTANT 1-...  54.7    3e-06   
emb|CDP17316.1|  unnamed protein product                              55.5    3e-06   
ref|XP_007212847.1|  hypothetical protein PRUPE_ppa020974mg           54.3    3e-06   
ref|XP_002523196.1|  BRASSINAZOLE-RESISTANT 1 protein, putative       55.1    4e-06   
ref|NP_001145137.1|  uncharacterized protein LOC100278364             54.3    4e-06   
tpg|DAA60726.1|  TPA: hypothetical protein ZEAMMB73_150352            54.3    4e-06   
ref|XP_009783611.1|  PREDICTED: protein BZR1 homolog 4-like isofo...  54.3    5e-06   
ref|XP_004971713.1|  PREDICTED: protein BRASSINAZOLE-RESISTANT 2-...  53.9    5e-06   



>ref|XP_009590977.1| PREDICTED: BES1/BZR1 homolog protein 4-like [Nicotiana tomentosiformis]
Length=324

 Score =   160 bits (404),  Expect = 6e-44, Method: Compositional matrix adjust.
 Identities = 137/156 (88%), Positives = 145/156 (93%), Gaps = 0/156 (0%)
 Frame = +2

Query  125  MTSGTRLPTWkerennkrrerrrraiaakiFAGLRMYGNYKLPKHCDNNEVLKALCKEAG  304
            MTSGTRLP+WKERENNKRRERRRRAIAAKIFAGLRMYGN+KLPKHCDNNEVLKALC EAG
Sbjct  1    MTSGTRLPSWKERENNKRRERRRRAIAAKIFAGLRMYGNFKLPKHCDNNEVLKALCNEAG  60

Query  305  WIVEEDGTTYRKGCKPTERMDIMGssvsvspcssyqpsqGpsynpspasssfpspvssRY  484
            WIVEEDGTTY+KGCKP ERMDI+G S SV+PCSSYQPS G SYNPSPASSSFPSPVSS Y
Sbjct  61   WIVEEDGTTYKKGCKPVERMDIIGYSASVNPCSSYQPSPGASYNPSPASSSFPSPVSSHY  120

Query  485  ITNNNNDTDPNSLIPWLKNLssgsspsssKLPHHLY  592
            + N  N++DPNSLIPWLKNLSSGSSPSSSK PHHLY
Sbjct  121  VANTQNNSDPNSLIPWLKNLSSGSSPSSSKFPHHLY  156



>gb|AEA86340.1| BES1/BZR1-like protein [Solanum nigrum]
Length=174

 Score =   155 bits (392),  Expect = 9e-44, Method: Compositional matrix adjust.
 Identities = 138/155 (89%), Positives = 141/155 (91%), Gaps = 1/155 (1%)
 Frame = +2

Query  125  MTSGTRLPTWkerennkrrerrrraiaakiFAGLRMYGNYKLPKHCDNNEVLKALCKEAG  304
            MTSGTRLPTWKERENNKRRERRRRAIAAKIFAGLRMYGNYKLPKHCDNNEVLKALCKEAG
Sbjct  1    MTSGTRLPTWKERENNKRRERRRRAIAAKIFAGLRMYGNYKLPKHCDNNEVLKALCKEAG  60

Query  305  WIVEEDGTTYRKGCKPTERMDIMGssvsvspcssyqpsqGpsynpspasssfpspvssRY  484
            WIVEEDGTTYRKGCKP ERMDI G SVSVSPCSSYQ S G SYNPSP SSS PSPVSS Y
Sbjct  61   WIVEEDGTTYRKGCKPVERMDI-GGSVSVSPCSSYQLSPGASYNPSPVSSSIPSPVSSHY  119

Query  485  ITNNNNDTDPNSLIPWLKNLssgsspsssKLPHHL  589
            + N  N++DPNSLIPWLKNLSSGSS SSSK PHHL
Sbjct  120  VANVQNNSDPNSLIPWLKNLSSGSSSSSSKFPHHL  154



>emb|CDO96875.1| unnamed protein product [Coffea canephora]
Length=295

 Score =   156 bits (395),  Expect = 7e-43, Method: Compositional matrix adjust.
 Identities = 134/156 (86%), Positives = 142/156 (91%), Gaps = 0/156 (0%)
 Frame = +2

Query  125  MTSGTRLPTWkerennkrrerrrraiaakiFAGLRMYGNYKLPKHCDNNEVLKALCKEAG  304
            MTSGTRLPTWKERENNKRRERRRRAIAAKIFAGLRMYGN+KLPKHCDNNEVLKALC EAG
Sbjct  1    MTSGTRLPTWKERENNKRRERRRRAIAAKIFAGLRMYGNFKLPKHCDNNEVLKALCNEAG  60

Query  305  WIVEEDGTTYRKGCKPTERMDIMGssvsvspcssyqpsqGpsynpspasssfpspvssRY  484
            W+VEEDGTTYRKGCKP ERMDI+G S ++SPCSSYQPS G SYNPSP+SSSFPSPVSS Y
Sbjct  61   WVVEEDGTTYRKGCKPAERMDIIGGSATMSPCSSYQPSPGVSYNPSPSSSSFPSPVSSHY  120

Query  485  ITNNNNDTDPNSLIPWLKNLssgsspsssKLPHHLY  592
              N N   D NSLIPWLKNLSSGSSP+SSKLPHH+Y
Sbjct  121  AANANGSADANSLIPWLKNLSSGSSPASSKLPHHIY  156



>ref|XP_011101448.1| PREDICTED: BES1/BZR1 homolog protein 4-like [Sesamum indicum]
Length=325

 Score =   157 bits (397),  Expect = 8e-43, Method: Compositional matrix adjust.
 Identities = 135/156 (87%), Positives = 141/156 (90%), Gaps = 1/156 (1%)
 Frame = +2

Query  125  MTSGTRLPTWkerennkrrerrrraiaakiFAGLRMYGNYKLPKHCDNNEVLKALCKEAG  304
            MTSGTRLPTWKERENNKRRERRRRAIAAKIFAGLRMYGNYKLPKHCDNNEVLKALC EAG
Sbjct  1    MTSGTRLPTWKERENNKRRERRRRAIAAKIFAGLRMYGNYKLPKHCDNNEVLKALCNEAG  60

Query  305  WIVEEDGTTYRKGCKPTERMDIMGssvsvspcssyqpsqGpsynpspasssfpspvssRY  484
            WIVEEDGTTYRKGCKP ERMDI+G S +VSPCSSYQPS G S+NPSPASSSF SPVSS +
Sbjct  61   WIVEEDGTTYRKGCKPVERMDIIG-SAAVSPCSSYQPSPGASFNPSPASSSFASPVSSHF  119

Query  485  ITNNNNDTDPNSLIPWLKNLssgsspsssKLPHHLY  592
              + NN  DPNSLIPWLKNLSSGS P+SSK PHHLY
Sbjct  120  AASVNNTADPNSLIPWLKNLSSGSLPASSKFPHHLY  155



>ref|XP_009607196.1| PREDICTED: BES1/BZR1 homolog protein 4-like isoform X1 [Nicotiana 
tomentosiformis]
 ref|XP_009607197.1| PREDICTED: BES1/BZR1 homolog protein 4-like isoform X2 [Nicotiana 
tomentosiformis]
Length=326

 Score =   156 bits (395),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 137/155 (88%), Positives = 141/155 (91%), Gaps = 0/155 (0%)
 Frame = +2

Query  125  MTSGTRLPTWkerennkrrerrrraiaakiFAGLRMYGNYKLPKHCDNNEVLKALCKEAG  304
            MTSGTRLPTWKERENNKRRERRRRAIAAKIFAGLRMYGNYKLPKHCDNNEVLKALCKEAG
Sbjct  1    MTSGTRLPTWKERENNKRRERRRRAIAAKIFAGLRMYGNYKLPKHCDNNEVLKALCKEAG  60

Query  305  WIVEEDGTTYRKGCKPTERMDIMGssvsvspcssyqpsqGpsynpspasssfpspvssRY  484
            WIVE+DGTTYRKGCKP   MDI+G S SVSPCSSYQ S G SYNPSPASSS PSPVSS Y
Sbjct  61   WIVEDDGTTYRKGCKPVHHMDIIGGSASVSPCSSYQLSPGASYNPSPASSSIPSPVSSHY  120

Query  485  ITNNNNDTDPNSLIPWLKNLssgsspsssKLPHHL  589
            I N  N++DPNSLIPWLKNLSSGSSPSSSK PHHL
Sbjct  121  IANVQNNSDPNSLIPWLKNLSSGSSPSSSKFPHHL  155



>gb|EYU28126.1| hypothetical protein MIMGU_mgv1a007967mg [Erythranthe guttata]
Length=328

 Score =   155 bits (391),  Expect = 5e-42, Method: Compositional matrix adjust.
 Identities = 135/157 (86%), Positives = 142/157 (90%), Gaps = 2/157 (1%)
 Frame = +2

Query  125  MTSGTRLPTWkerennkrrerrrraiaakiFAGLRMYGNYKLPKHCDNNEVLKALCKEAG  304
            MTSGTRLPTWKERENNKRRERRRRAIAAKIF+GLRMYGNYKLPKHCDNNEVLKALC EAG
Sbjct  1    MTSGTRLPTWKERENNKRRERRRRAIAAKIFSGLRMYGNYKLPKHCDNNEVLKALCNEAG  60

Query  305  WIVEEDGTTYRKGCKPTERMDIMGssvsvspcssyqpsqGpsynpspasssfpspvssRY  484
            WIVEEDGTTYRKGCKP ERMDIMG S +VSPC+SYQPS G S+NPSP+SSSF SPVSS Y
Sbjct  61   WIVEEDGTTYRKGCKPVERMDIMG-SSAVSPCTSYQPSPGTSFNPSPSSSSFASPVSSHY  119

Query  485  ITNNNNDTDPNSLIPWLKNLssgss-psssKLPHHLY  592
            + N  N  DPNSLIPWLKNLSSG + PSSSKLPHHLY
Sbjct  120  VGNATNTADPNSLIPWLKNLSSGGTLPSSSKLPHHLY  156



>ref|XP_009800423.1| PREDICTED: BES1/BZR1 homolog protein 4-like isoform X1 [Nicotiana 
sylvestris]
 ref|XP_009800424.1| PREDICTED: BES1/BZR1 homolog protein 4-like isoform X2 [Nicotiana 
sylvestris]
Length=326

 Score =   154 bits (389),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 136/155 (88%), Positives = 140/155 (90%), Gaps = 0/155 (0%)
 Frame = +2

Query  125  MTSGTRLPTWkerennkrrerrrraiaakiFAGLRMYGNYKLPKHCDNNEVLKALCKEAG  304
            MTSGTRLPTWKERENNKRRERRRRAIAAKIFAGLRMYGNYKLPKHCDNNEVLKALCKEAG
Sbjct  1    MTSGTRLPTWKERENNKRRERRRRAIAAKIFAGLRMYGNYKLPKHCDNNEVLKALCKEAG  60

Query  305  WIVEEDGTTYRKGCKPTERMDIMGssvsvspcssyqpsqGpsynpspasssfpspvssRY  484
            WIVE+DGTTYRKGCKP   MDI+G S SVSPCSSYQ S G SYNPSPASSS PSPVSS Y
Sbjct  61   WIVEDDGTTYRKGCKPVHHMDIIGGSASVSPCSSYQLSPGASYNPSPASSSIPSPVSSHY  120

Query  485  ITNNNNDTDPNSLIPWLKNLssgsspsssKLPHHL  589
            I N  N++DPNSLIPWLKNLSSGSSPSSS  PHHL
Sbjct  121  IANVQNNSDPNSLIPWLKNLSSGSSPSSSNFPHHL  155



>ref|XP_006358089.1| PREDICTED: BES1/BZR1 homolog protein 4-like isoform X3 [Solanum 
tuberosum]
 ref|XP_006358090.1| PREDICTED: BES1/BZR1 homolog protein 4-like isoform X4 [Solanum 
tuberosum]
Length=325

 Score =   154 bits (388),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 137/155 (88%), Positives = 142/155 (92%), Gaps = 1/155 (1%)
 Frame = +2

Query  125  MTSGTRLPTWkerennkrrerrrraiaakiFAGLRMYGNYKLPKHCDNNEVLKALCKEAG  304
            MTSGTR PTWKERENNKRRERRRRAIAAKIFAGLRMYGNYKLPKHCDNNEVLKALCKEAG
Sbjct  1    MTSGTRQPTWKERENNKRRERRRRAIAAKIFAGLRMYGNYKLPKHCDNNEVLKALCKEAG  60

Query  305  WIVEEDGTTYRKGCKPTERMDIMGssvsvspcssyqpsqGpsynpspasssfpspvssRY  484
            WIVEEDGTTYRKGCKP ERMDI G SVSVSPCSSYQ S G SYNPSP SSS PSP+SS Y
Sbjct  61   WIVEEDGTTYRKGCKPVERMDI-GGSVSVSPCSSYQLSPGASYNPSPVSSSIPSPISSHY  119

Query  485  ITNNNNDTDPNSLIPWLKNLssgsspsssKLPHHL  589
            ++N  N++DPNSLIPWLKNLSSGSSPSSSK PHHL
Sbjct  120  VSNVQNNSDPNSLIPWLKNLSSGSSPSSSKFPHHL  154



>ref|XP_009785426.1| PREDICTED: BES1/BZR1 homolog protein 4-like [Nicotiana sylvestris]
Length=323

 Score =   154 bits (388),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 137/156 (88%), Positives = 143/156 (92%), Gaps = 0/156 (0%)
 Frame = +2

Query  125  MTSGTRLPTWkerennkrrerrrraiaakiFAGLRMYGNYKLPKHCDNNEVLKALCKEAG  304
            MTSGTRLP+WKERENNKRRERRRRAIAAKIFAGLRMYGN+KLPKHCDNNEVLKALC EAG
Sbjct  1    MTSGTRLPSWKERENNKRRERRRRAIAAKIFAGLRMYGNFKLPKHCDNNEVLKALCNEAG  60

Query  305  WIVEEDGTTYRKGCKPTERMDIMGssvsvspcssyqpsqGpsynpspasssfpspvssRY  484
            WIVEEDGTTY+KGCKP +RMD +  S SVSPCSSYQPS G SYNPSPASSSFPSPVSS Y
Sbjct  61   WIVEEDGTTYKKGCKPVQRMDNICYSASVSPCSSYQPSPGASYNPSPASSSFPSPVSSHY  120

Query  485  ITNNNNDTDPNSLIPWLKNLssgsspsssKLPHHLY  592
            I N  N+TDPNSLIPWLKNLSSGSSPSSSK PHHLY
Sbjct  121  IANAQNNTDPNSLIPWLKNLSSGSSPSSSKFPHHLY  156



>gb|EYU28125.1| hypothetical protein MIMGU_mgv1a007967mg [Erythranthe guttata]
Length=389

 Score =   155 bits (391),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 135/157 (86%), Positives = 142/157 (90%), Gaps = 2/157 (1%)
 Frame = +2

Query  125  MTSGTRLPTWkerennkrrerrrraiaakiFAGLRMYGNYKLPKHCDNNEVLKALCKEAG  304
            MTSGTRLPTWKERENNKRRERRRRAIAAKIF+GLRMYGNYKLPKHCDNNEVLKALC EAG
Sbjct  53   MTSGTRLPTWKERENNKRRERRRRAIAAKIFSGLRMYGNYKLPKHCDNNEVLKALCNEAG  112

Query  305  WIVEEDGTTYRKGCKPTERMDIMGssvsvspcssyqpsqGpsynpspasssfpspvssRY  484
            WIVEEDGTTYRKGCKP ERMDIMG S +VSPC+SYQPS G S+NPSP+SSSF SPVSS Y
Sbjct  113  WIVEEDGTTYRKGCKPVERMDIMG-SSAVSPCTSYQPSPGTSFNPSPSSSSFASPVSSHY  171

Query  485  ITNNNNDTDPNSLIPWLKNLssgss-psssKLPHHLY  592
            + N  N  DPNSLIPWLKNLSSG + PSSSKLPHHLY
Sbjct  172  VGNATNTADPNSLIPWLKNLSSGGTLPSSSKLPHHLY  208



>ref|XP_004234074.1| PREDICTED: BES1/BZR1 homolog protein 4 isoform X1 [Solanum lycopersicum]
 ref|XP_004234075.1| PREDICTED: BES1/BZR1 homolog protein 4 isoform X2 [Solanum lycopersicum]
 ref|XP_006356092.1| PREDICTED: BES1/BZR1 homolog protein 4-like isoform X1 [Solanum 
tuberosum]
 ref|XP_006356093.1| PREDICTED: BES1/BZR1 homolog protein 4-like isoform X2 [Solanum 
tuberosum]
Length=323

 Score =   153 bits (387),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 136/156 (87%), Positives = 143/156 (92%), Gaps = 0/156 (0%)
 Frame = +2

Query  125  MTSGTRLPTWkerennkrrerrrraiaakiFAGLRMYGNYKLPKHCDNNEVLKALCKEAG  304
            MTSGTRLPTWKERENNKRRERRRRAIAAKIFAGLRMYGNYKLPKHCDNNEVLKALCKEAG
Sbjct  1    MTSGTRLPTWKERENNKRRERRRRAIAAKIFAGLRMYGNYKLPKHCDNNEVLKALCKEAG  60

Query  305  WIVEEDGTTYRKGCKPTERMDIMGssvsvspcssyqpsqGpsynpspasssfpspvssRY  484
            WIVEEDGTTY+KGCKP   +DI+G S SVSPCSSYQPS G SYNPSPASSSFPSPVSS Y
Sbjct  61   WIVEEDGTTYKKGCKPVGHVDIIGYSASVSPCSSYQPSPGASYNPSPASSSFPSPVSSNY  120

Query  485  ITNNNNDTDPNSLIPWLKNLssgsspsssKLPHHLY  592
            + N  N+ DPN+LIPWLKNLSSGSSPSSS+ PHHLY
Sbjct  121  VANVQNNHDPNTLIPWLKNLSSGSSPSSSRFPHHLY  156



>ref|XP_011033513.1| PREDICTED: BES1/BZR1 homolog protein 4-like isoform X1 [Populus 
euphratica]
 ref|XP_011033514.1| PREDICTED: BES1/BZR1 homolog protein 4-like isoform X2 [Populus 
euphratica]
 ref|XP_011010915.1| PREDICTED: BES1/BZR1 homolog protein 4-like isoform X1 [Populus 
euphratica]
 ref|XP_011010916.1| PREDICTED: BES1/BZR1 homolog protein 4-like isoform X2 [Populus 
euphratica]
Length=331

 Score =   152 bits (385),  Expect = 5e-41, Method: Compositional matrix adjust.
 Identities = 131/156 (84%), Positives = 137/156 (88%), Gaps = 0/156 (0%)
 Frame = +2

Query  125  MTSGTRLPTWkerennkrrerrrraiaakiFAGLRMYGNYKLPKHCDNNEVLKALCKEAG  304
            MTSGTR+PTWKERENNKRRERRRRAIAAKI++GLRMYGNYKLPKHCDNNEVLKALCKEAG
Sbjct  1    MTSGTRMPTWKERENNKRRERRRRAIAAKIYSGLRMYGNYKLPKHCDNNEVLKALCKEAG  60

Query  305  WIVEEDGTTYRKGCKPTERMDIMGssvsvspcssyqpsqGpsynpspasssfpspvssRY  484
            W VEEDGTTYRKGCKP ERMDIMG S S SPCSSY  S   SYNPSPASSSFPSPVSS Y
Sbjct  61   WTVEEDGTTYRKGCKPVERMDIMGGSASASPCSSYHRSPCASYNPSPASSSFPSPVSSHY  120

Query  485  ITNNNNDTDPNSLIPWLKNLssgsspsssKLPHHLY  592
              N N + DPNSLIPWLKNLSSGSS +S K PHHL+
Sbjct  121  AANANGNADPNSLIPWLKNLSSGSSSASPKHPHHLF  156



>ref|XP_002305719.1| hypothetical protein POPTR_0004s06100g [Populus trichocarpa]
 gb|EEE86230.1| hypothetical protein POPTR_0004s06100g [Populus trichocarpa]
Length=331

 Score =   152 bits (385),  Expect = 5e-41, Method: Compositional matrix adjust.
 Identities = 131/156 (84%), Positives = 137/156 (88%), Gaps = 0/156 (0%)
 Frame = +2

Query  125  MTSGTRLPTWkerennkrrerrrraiaakiFAGLRMYGNYKLPKHCDNNEVLKALCKEAG  304
            MTSGTR+PTWKERENNKRRERRRRAIAAKI++GLRMYGNYKLPKHCDNNEVLKALCKEAG
Sbjct  1    MTSGTRMPTWKERENNKRRERRRRAIAAKIYSGLRMYGNYKLPKHCDNNEVLKALCKEAG  60

Query  305  WIVEEDGTTYRKGCKPTERMDIMGssvsvspcssyqpsqGpsynpspasssfpspvssRY  484
            W VEEDGTTYRKGCKP ERMDIMG S S SPCSSY  S   SYNPSPASSSFPSPVSS Y
Sbjct  61   WTVEEDGTTYRKGCKPVERMDIMGGSASASPCSSYHRSPCASYNPSPASSSFPSPVSSHY  120

Query  485  ITNNNNDTDPNSLIPWLKNLssgsspsssKLPHHLY  592
              N N + DPNSLIPWLKNLSSGSS +S K PHHL+
Sbjct  121  AANANGNADPNSLIPWLKNLSSGSSSASPKHPHHLF  156



>ref|XP_010242162.1| PREDICTED: BES1/BZR1 homolog protein 4 [Nelumbo nucifera]
Length=327

 Score =   152 bits (384),  Expect = 6e-41, Method: Compositional matrix adjust.
 Identities = 132/156 (85%), Positives = 137/156 (88%), Gaps = 0/156 (0%)
 Frame = +2

Query  125  MTSGTRLPTWkerennkrrerrrraiaakiFAGLRMYGNYKLPKHCDNNEVLKALCKEAG  304
            MTSGTRLPTWKERENNKRRERRRRAIAAKIFAGLRMYGNYKLPKHCDNNEVLKALC EAG
Sbjct  1    MTSGTRLPTWKERENNKRRERRRRAIAAKIFAGLRMYGNYKLPKHCDNNEVLKALCNEAG  60

Query  305  WIVEEDGTTYRKGCKPTERMDIMGssvsvspcssyqpsqGpsynpspasssfpspvssRY  484
            W VEEDGTTYRKGCKP ERMD++G S S SPCSSYQPS   SYNPSPA+SSFPSP SS Y
Sbjct  61   WTVEEDGTTYRKGCKPVERMDVVGGSASASPCSSYQPSPCASYNPSPATSSFPSPASSSY  120

Query  485  ITNNNNDTDPNSLIPWLKNLssgsspsssKLPHHLY  592
              N N + D NSLIPWLKNLSS SS +SSKLPHHLY
Sbjct  121  AANANANGDGNSLIPWLKNLSSVSSSASSKLPHHLY  156



>ref|XP_002522271.1| BRASSINAZOLE-RESISTANT 2 protein, putative [Ricinus communis]
 gb|EEF40129.1| BRASSINAZOLE-RESISTANT 2 protein, putative [Ricinus communis]
Length=331

 Score =   150 bits (380),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 132/156 (85%), Positives = 137/156 (88%), Gaps = 0/156 (0%)
 Frame = +2

Query  125  MTSGTRLPTWkerennkrrerrrraiaakiFAGLRMYGNYKLPKHCDNNEVLKALCKEAG  304
            MT+GTR+PTWKERENNKRRERRRRAIAAKI+AGLRMYGNYKLPKHCDNNEVLKALC EAG
Sbjct  1    MTAGTRMPTWKERENNKRRERRRRAIAAKIYAGLRMYGNYKLPKHCDNNEVLKALCNEAG  60

Query  305  WIVEEDGTTYRKGCKPTERMDIMGssvsvspcssyqpsqGpsynpspasssfpspvssRY  484
            W VEEDGTTYRKGCKP ERMDIMG S S SPCSSY PS   SYNPSP SSSFPSPVSSRY
Sbjct  61   WTVEEDGTTYRKGCKPVERMDIMGGSASASPCSSYHPSPCASYNPSPGSSSFPSPVSSRY  120

Query  485  ITNNNNDTDPNSLIPWLKNLssgsspsssKLPHHLY  592
              N N + D NSLIPWLKNLSSGSS +SSK PHHLY
Sbjct  121  TANTNGNADANSLIPWLKNLSSGSSSASSKHPHHLY  156



>gb|KDP21147.1| hypothetical protein JCGZ_21618 [Jatropha curcas]
Length=331

 Score =   150 bits (380),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 133/156 (85%), Positives = 137/156 (88%), Gaps = 0/156 (0%)
 Frame = +2

Query  125  MTSGTRLPTWkerennkrrerrrraiaakiFAGLRMYGNYKLPKHCDNNEVLKALCKEAG  304
            MTSGTR+PTWKERENNKRRERRRRAIAAKI+AGLRMYGNYKLPKHCDNNEVLKALC EAG
Sbjct  1    MTSGTRMPTWKERENNKRRERRRRAIAAKIYAGLRMYGNYKLPKHCDNNEVLKALCNEAG  60

Query  305  WIVEEDGTTYRKGCKPTERMDIMGssvsvspcssyqpsqGpsynpspasssfpspvssRY  484
            W VEEDGTTYRKGCKP ERMDIMG S S SPCSSY PS   SYNPSP SSSFPSPVSSRY
Sbjct  61   WTVEEDGTTYRKGCKPMERMDIMGGSASASPCSSYHPSPCASYNPSPGSSSFPSPVSSRY  120

Query  485  ITNNNNDTDPNSLIPWLKNLssgsspsssKLPHHLY  592
              N N + D NSLIPWLKNLSSGSS +SSK PHHLY
Sbjct  121  TANTNGNPDANSLIPWLKNLSSGSSSASSKHPHHLY  156



>ref|XP_006358087.1| PREDICTED: BES1/BZR1 homolog protein 4-like isoform X1 [Solanum 
tuberosum]
 ref|XP_006358088.1| PREDICTED: BES1/BZR1 homolog protein 4-like isoform X2 [Solanum 
tuberosum]
Length=326

 Score =   149 bits (377),  Expect = 6e-40, Method: Compositional matrix adjust.
 Identities = 137/156 (88%), Positives = 142/156 (91%), Gaps = 2/156 (1%)
 Frame = +2

Query  125  MTSGTRLPTWkerennkrrerrrraiaakiFAGLRMYGNYKLPKHCDNNEVLKALCKEAG  304
            MTSGTR PTWKERENNKRRERRRRAIAAKIFAGLRMYGNYKLPKHCDNNEVLKALCKEAG
Sbjct  1    MTSGTRQPTWKERENNKRRERRRRAIAAKIFAGLRMYGNYKLPKHCDNNEVLKALCKEAG  60

Query  305  WIVEEDGTTYRK-GCKPTERMDIMGssvsvspcssyqpsqGpsynpspasssfpspvssR  481
            WIVEEDGTTYRK GCKP ERMDI G SVSVSPCSSYQ S G SYNPSP SSS PSP+SS 
Sbjct  61   WIVEEDGTTYRKQGCKPVERMDI-GGSVSVSPCSSYQLSPGASYNPSPVSSSIPSPISSH  119

Query  482  YITNNNNDTDPNSLIPWLKNLssgsspsssKLPHHL  589
            Y++N  N++DPNSLIPWLKNLSSGSSPSSSK PHHL
Sbjct  120  YVSNVQNNSDPNSLIPWLKNLSSGSSPSSSKFPHHL  155



>ref|XP_007025289.1| BES1/BZR1 [Theobroma cacao]
 gb|EOY27911.1| BES1/BZR1 [Theobroma cacao]
Length=327

 Score =   147 bits (372),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 129/156 (83%), Positives = 136/156 (87%), Gaps = 0/156 (0%)
 Frame = +2

Query  125  MTSGTRLPTWkerennkrrerrrraiaakiFAGLRMYGNYKLPKHCDNNEVLKALCKEAG  304
            MTSGTR+PTWKERENNKRRERRRRAIAAKIFAGLRMYGNYKLPKHCDNNEVLKALC EAG
Sbjct  1    MTSGTRMPTWKERENNKRRERRRRAIAAKIFAGLRMYGNYKLPKHCDNNEVLKALCNEAG  60

Query  305  WIVEEDGTTYRKGCKPTERMDIMGssvsvspcssyqpsqGpsynpspasssfpspvssRY  484
            W VEEDGTTYRKGCKP +RMDI+G S S SPCSSY PS   SYNPSPASSSFPSP SS Y
Sbjct  61   WTVEEDGTTYRKGCKPVDRMDIVGGSASASPCSSYHPSPCASYNPSPASSSFPSPASSHY  120

Query  485  ITNNNNDTDPNSLIPWLKNLssgsspsssKLPHHLY  592
             +N N + D NSLIPWLKNL+S SS +SSKL HHLY
Sbjct  121  TSNANGNGDANSLIPWLKNLTSSSSSASSKLAHHLY  156



>gb|KJB68362.1| hypothetical protein B456_010G240700 [Gossypium raimondii]
Length=269

 Score =   145 bits (366),  Expect = 7e-39, Method: Compositional matrix adjust.
 Identities = 129/156 (83%), Positives = 135/156 (87%), Gaps = 0/156 (0%)
 Frame = +2

Query  125  MTSGTRLPTWkerennkrrerrrraiaakiFAGLRMYGNYKLPKHCDNNEVLKALCKEAG  304
            MTSGTR+PTWKERENNKRRERRRRAIAAKIFAGLRMYGNYKLPKHCDNNEVLKALC EAG
Sbjct  1    MTSGTRMPTWKERENNKRRERRRRAIAAKIFAGLRMYGNYKLPKHCDNNEVLKALCDEAG  60

Query  305  WIVEEDGTTYRKGCKPTERMDIMGssvsvspcssyqpsqGpsynpspasssfpspvssRY  484
            W VEEDGTTY+KGCKP +RMDI+G S S SPCSSY PS   SYNPSP SSSFPSP SS Y
Sbjct  61   WTVEEDGTTYKKGCKPVDRMDILGGSASASPCSSYHPSPCASYNPSPGSSSFPSPASSHY  120

Query  485  ITNNNNDTDPNSLIPWLKNLssgsspsssKLPHHLY  592
              N N + D NSLIPWLKNLSSGSS +SSKL HHLY
Sbjct  121  RANGNGNADANSLIPWLKNLSSGSSSASSKLAHHLY  156



>gb|KHG20428.1| BES1/BZR1 4 -like protein [Gossypium arboreum]
Length=322

 Score =   146 bits (369),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 128/156 (82%), Positives = 134/156 (86%), Gaps = 0/156 (0%)
 Frame = +2

Query  125  MTSGTRLPTWkerennkrrerrrraiaakiFAGLRMYGNYKLPKHCDNNEVLKALCKEAG  304
            MTSGTR+PTWKERENNKRRERRRRAIAAKIFAGLRMYGNYKLPKHCDNNEVLKALC EAG
Sbjct  1    MTSGTRMPTWKERENNKRRERRRRAIAAKIFAGLRMYGNYKLPKHCDNNEVLKALCDEAG  60

Query  305  WIVEEDGTTYRKGCKPTERMDIMGssvsvspcssyqpsqGpsynpspasssfpspvssRY  484
            W VEEDGTTY+KGCKP +RMDI+G S S S CSSY PS   SYNPSP SSSFPSP SS Y
Sbjct  61   WTVEEDGTTYKKGCKPVDRMDILGGSASASRCSSYHPSPCASYNPSPGSSSFPSPASSHY  120

Query  485  ITNNNNDTDPNSLIPWLKNLssgsspsssKLPHHLY  592
              N N + D NSLIPWLKNLSSGSS +SSKL HHLY
Sbjct  121  RANGNGNADANSLIPWLKNLSSGSSSASSKLAHHLY  156



>gb|KJB68361.1| hypothetical protein B456_010G240700 [Gossypium raimondii]
Length=322

 Score =   146 bits (368),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 129/156 (83%), Positives = 135/156 (87%), Gaps = 0/156 (0%)
 Frame = +2

Query  125  MTSGTRLPTWkerennkrrerrrraiaakiFAGLRMYGNYKLPKHCDNNEVLKALCKEAG  304
            MTSGTR+PTWKERENNKRRERRRRAIAAKIFAGLRMYGNYKLPKHCDNNEVLKALC EAG
Sbjct  1    MTSGTRMPTWKERENNKRRERRRRAIAAKIFAGLRMYGNYKLPKHCDNNEVLKALCDEAG  60

Query  305  WIVEEDGTTYRKGCKPTERMDIMGssvsvspcssyqpsqGpsynpspasssfpspvssRY  484
            W VEEDGTTY+KGCKP +RMDI+G S S SPCSSY PS   SYNPSP SSSFPSP SS Y
Sbjct  61   WTVEEDGTTYKKGCKPVDRMDILGGSASASPCSSYHPSPCASYNPSPGSSSFPSPASSHY  120

Query  485  ITNNNNDTDPNSLIPWLKNLssgsspsssKLPHHLY  592
              N N + D NSLIPWLKNLSSGSS +SSKL HHLY
Sbjct  121  RANGNGNADANSLIPWLKNLSSGSSSASSKLAHHLY  156



>ref|XP_004233053.1| PREDICTED: BES1/BZR1 homolog protein 4 isoform X3 [Solanum lycopersicum]
 ref|XP_010316857.1| PREDICTED: BES1/BZR1 homolog protein 4 isoform X2 [Solanum lycopersicum]
Length=324

 Score =   146 bits (368),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 128/155 (83%), Positives = 132/155 (85%), Gaps = 2/155 (1%)
 Frame = +2

Query  125  MTSGTRLPTWkerennkrrerrrraiaakiFAGLRMYGNYKLPKHCDNNEVLKALCKEAG  304
            MTSGTRLPTWKERENNKRRERRRRAIAAKIFAGLRMYGNYKLPKHCDNNEVLKALCKEAG
Sbjct  1    MTSGTRLPTWKERENNKRRERRRRAIAAKIFAGLRMYGNYKLPKHCDNNEVLKALCKEAG  60

Query  305  WIVEEDGTTYRKGCKPTERMDIMGssvsvspcssyqpsqGpsynpspasssfpspvssRY  484
            WIVEEDGTTYRKGCKP  R+DI G        SSYQ S G SYNPSP SSS PSPVSS Y
Sbjct  61   WIVEEDGTTYRKGCKPVTRIDIGG--SVSVSSSSYQLSPGASYNPSPVSSSIPSPVSSHY  118

Query  485  ITNNNNDTDPNSLIPWLKNLssgsspsssKLPHHL  589
            + N  N++DPNSLIPWLKNLSSGSSPS S  PHHL
Sbjct  119  VANVQNNSDPNSLIPWLKNLSSGSSPSLSNFPHHL  153



>ref|XP_004147390.1| PREDICTED: BES1/BZR1 homolog protein 4-like [Cucumis sativus]
 ref|XP_004172293.1| PREDICTED: BES1/BZR1 homolog protein 4-like [Cucumis sativus]
 gb|KGN65601.1| hypothetical protein Csa_1G467200 [Cucumis sativus]
Length=327

 Score =   145 bits (366),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 134/157 (85%), Positives = 140/157 (89%), Gaps = 2/157 (1%)
 Frame = +2

Query  125  MTSGTRLPTWkerennkrrerrrraiaakiFAGLRMYGNYKLPKHCDNNEVLKALCKEAG  304
            MTSGTR+PTWKERENNKRRERRRRAIAAKIF GLRMYGNYKLPKHCDNNEVLKALC EAG
Sbjct  1    MTSGTRMPTWKERENNKRRERRRRAIAAKIFLGLRMYGNYKLPKHCDNNEVLKALCDEAG  60

Query  305  WIVEEDGTTYRKGCKPTERMDIMGssvsvspcssyqpsqGpsynpspasssfpspvssRY  484
            W VEEDGTTYRKGCKP ER +IMG S S SPCSSYQPS   SYNPSPASSSFPSP SSRY
Sbjct  61   WTVEEDGTTYRKGCKPVER-NIMGGSASASPCSSYQPSPRASYNPSPASSSFPSPKSSRY  119

Query  485  ITN-NNNDTDPNSLIPWLKNLssgsspsssKLPHHLY  592
              N N+N TDPNSLIPWLKNLSSGSS +SS+LPHHL+
Sbjct  120  AMNGNDNGTDPNSLIPWLKNLSSGSSSASSRLPHHLF  156



>ref|XP_008443587.1| PREDICTED: BES1/BZR1 homolog protein 4 [Cucumis melo]
Length=327

 Score =   145 bits (365),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 134/157 (85%), Positives = 140/157 (89%), Gaps = 2/157 (1%)
 Frame = +2

Query  125  MTSGTRLPTWkerennkrrerrrraiaakiFAGLRMYGNYKLPKHCDNNEVLKALCKEAG  304
            MTSGTR+PTWKERENNKRRERRRRAIAAKIF GLRMYGNYKLPKHCDNNEVLKALC EAG
Sbjct  1    MTSGTRMPTWKERENNKRRERRRRAIAAKIFLGLRMYGNYKLPKHCDNNEVLKALCDEAG  60

Query  305  WIVEEDGTTYRKGCKPTERMDIMGssvsvspcssyqpsqGpsynpspasssfpspvssRY  484
            W VEEDGTTYRKGCKP ER +IMG S S SPCSSYQPS   SYNPSPASSSFPSP SSRY
Sbjct  61   WTVEEDGTTYRKGCKPVER-NIMGGSASGSPCSSYQPSPRASYNPSPASSSFPSPKSSRY  119

Query  485  ITN-NNNDTDPNSLIPWLKNLssgsspsssKLPHHLY  592
              N N+N TDPNSLIPWLKNLSSGSS +SS+LPHHL+
Sbjct  120  AMNSNDNGTDPNSLIPWLKNLSSGSSSASSRLPHHLF  156



>ref|XP_010052157.1| PREDICTED: BES1/BZR1 homolog protein 4 isoform X1 [Eucalyptus 
grandis]
 ref|XP_010052158.1| PREDICTED: BES1/BZR1 homolog protein 4 isoform X2 [Eucalyptus 
grandis]
 gb|KCW76060.1| hypothetical protein EUGRSUZ_D00428 [Eucalyptus grandis]
Length=320

 Score =   144 bits (364),  Expect = 5e-38, Method: Compositional matrix adjust.
 Identities = 129/156 (83%), Positives = 136/156 (87%), Gaps = 0/156 (0%)
 Frame = +2

Query  125  MTSGTRLPTWkerennkrrerrrraiaakiFAGLRMYGNYKLPKHCDNNEVLKALCKEAG  304
            MTSGTR PTWKERENNKRRERRRRAIAAKIFAGLRMYGNYKLPKHCDNNEVLKALCKEAG
Sbjct  1    MTSGTRTPTWKERENNKRRERRRRAIAAKIFAGLRMYGNYKLPKHCDNNEVLKALCKEAG  60

Query  305  WIVEEDGTTYRKGCKPTERMDIMGssvsvspcssyqpsqGpsynpspasssfpspvssRY  484
            W VEEDGTTYRKGC+P ERMDIMG S S SPCSSY PS   SYNPSPASSSFPSP  S Y
Sbjct  61   WTVEEDGTTYRKGCRPLERMDIMGGSTSASPCSSYHPSPCASYNPSPASSSFPSPARSPY  120

Query  485  ITNNNNDTDPNSLIPWLKNLssgsspsssKLPHHLY  592
              + + + D +SLIPWLKNLSSGSS +SSKLPHHL+
Sbjct  121  PGHPHGNPDADSLIPWLKNLSSGSSSASSKLPHHLF  156



>ref|XP_011039378.1| PREDICTED: BES1/BZR1 homolog protein 4-like [Populus euphratica]
Length=333

 Score =   142 bits (359),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 129/158 (82%), Positives = 136/158 (86%), Gaps = 2/158 (1%)
 Frame = +2

Query  125  MTSGTRLPTWkerennkrrerrrraiaakiFAGLRMYGNYKLPKHCDNNEVLKALCKEAG  304
            MTSGTR+PTWKERENNKRRERRRRAIAAKI+AGLRMYGNYKLPKHCDNNEVLKALC EAG
Sbjct  1    MTSGTRMPTWKERENNKRRERRRRAIAAKIYAGLRMYGNYKLPKHCDNNEVLKALCNEAG  60

Query  305  WIVEEDGTTYRKGCKPTERMDIMGssvsvspcssyqpsqGpsynpspasssfpspvssRY  484
            W VEEDGTTYRKGCKP ERMDI G S S SPCSSY+ S   SYNPSPASSSFPSPVSSRY
Sbjct  61   WTVEEDGTTYRKGCKPVERMDITGGSASASPCSSYRQSPCASYNPSPASSSFPSPVSSRY  120

Query  485  ITNNNN--DTDPNSLIPWLKNLssgsspsssKLPHHLY  592
              N N   D D NSLIPWL+NLSSGSS +S K P+HL+
Sbjct  121  AANGNGNVDADANSLIPWLRNLSSGSSSASPKHPNHLF  158



>ref|XP_010316856.1| PREDICTED: BES1/BZR1 homolog protein 4 isoform X1 [Solanum lycopersicum]
Length=325

 Score =   141 bits (356),  Expect = 6e-37, Method: Compositional matrix adjust.
 Identities = 128/156 (82%), Positives = 132/156 (85%), Gaps = 3/156 (2%)
 Frame = +2

Query  125  MTSGTRLPTWkerennkrrerrrraiaakiFAGLRMYGNYKLPKHCDNNEVLKALCKEAG  304
            MTSGTRLPTWKERENNKRRERRRRAIAAKIFAGLRMYGNYKLPKHCDNNEVLKALCKEAG
Sbjct  1    MTSGTRLPTWKERENNKRRERRRRAIAAKIFAGLRMYGNYKLPKHCDNNEVLKALCKEAG  60

Query  305  WIVEEDGTTYRK-GCKPTERMDIMGssvsvspcssyqpsqGpsynpspasssfpspvssR  481
            WIVEEDGTTYRK GCKP  R+DI G        SSYQ S G SYNPSP SSS PSPVSS 
Sbjct  61   WIVEEDGTTYRKQGCKPVTRIDIGG--SVSVSSSSYQLSPGASYNPSPVSSSIPSPVSSH  118

Query  482  YITNNNNDTDPNSLIPWLKNLssgsspsssKLPHHL  589
            Y+ N  N++DPNSLIPWLKNLSSGSSPS S  PHHL
Sbjct  119  YVANVQNNSDPNSLIPWLKNLSSGSSPSLSNFPHHL  154



>ref|XP_006449559.1| hypothetical protein CICLE_v10015910mg [Citrus clementina]
 ref|XP_006467592.1| PREDICTED: BES1/BZR1 homolog protein 4-like isoform X1 [Citrus 
sinensis]
 ref|XP_006467593.1| PREDICTED: BES1/BZR1 homolog protein 4-like isoform X2 [Citrus 
sinensis]
 gb|ESR62799.1| hypothetical protein CICLE_v10015910mg [Citrus clementina]
 gb|KDO77944.1| hypothetical protein CISIN_1g020318mg [Citrus sinensis]
 gb|KDO77945.1| hypothetical protein CISIN_1g020318mg [Citrus sinensis]
Length=327

 Score =   140 bits (354),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 123/156 (79%), Positives = 131/156 (84%), Gaps = 0/156 (0%)
 Frame = +2

Query  125  MTSGTRLPTWkerennkrrerrrraiaakiFAGLRMYGNYKLPKHCDNNEVLKALCKEAG  304
            MTSGTR+PTWKER+NNKRRERRRRAIAAKI+AGLRMYGNY+LPKHCDNNEVLKALC EAG
Sbjct  1    MTSGTRMPTWKERDNNKRRERRRRAIAAKIYAGLRMYGNYRLPKHCDNNEVLKALCNEAG  60

Query  305  WIVEEDGTTYRKGCKPTERMDIMGssvsvspcssyqpsqGpsynpspasssfpspvssRY  484
            W VEEDGTTYRKGCKP E MD+MG S S S CSSYQ S   SYNPSP SSSFPSP SS Y
Sbjct  61   WTVEEDGTTYRKGCKPVEYMDVMGGSASASACSSYQQSPCASYNPSPGSSSFPSPRSSHY  120

Query  485  ITNNNNDTDPNSLIPWLKNLssgsspsssKLPHHLY  592
              + N   D NSLIPWLKNLSS SS +SSK PHH+Y
Sbjct  121  TPHANGSADANSLIPWLKNLSSSSSSASSKDPHHMY  156



>gb|EPS61611.1| hypothetical protein M569_13185 [Genlisea aurea]
Length=307

 Score =   137 bits (345),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 106/156 (68%), Positives = 111/156 (71%), Gaps = 16/156 (10%)
 Frame = +2

Query  125  MTSGTRLPTWkerennkrrerrrraiaakiFAGLRMYGNYKLPKHCDNNEVLKALCKEAG  304
            MTS TRLPTWKERENNKRRERRRRAIAAKIFAGLRMYGNYKLPKHCDNNEVLKALC EAG
Sbjct  1    MTSSTRLPTWKERENNKRRERRRRAIAAKIFAGLRMYGNYKLPKHCDNNEVLKALCHEAG  60

Query  305  WIVEEDGTTYRKGCKPTERMDIMGssvsvspcssyqpsqGpsynpspasssfpspvssRY  484
            WIVE+DGTTYRKGCKP ER+DI+    S  P SS   S     +                
Sbjct  61   WIVEDDGTTYRKGCKPVERVDIITPCSSYPPSSSGTSSFASPVSS---------------  105

Query  485  ITNNNNDTDPNSLIPWLKNLssgsspsssKLPHHLY  592
             T   + TDPNSLIPWLKNLSS S P  SK PH LY
Sbjct  106  -TIPKHSTDPNSLIPWLKNLSSSSIPVPSKRPHQLY  140



>ref|XP_010518826.1| PREDICTED: BES1/BZR1 homolog protein 3 isoform X2 [Tarenaya hassleriana]
Length=294

 Score =   135 bits (341),  Expect = 6e-35, Method: Compositional matrix adjust.
 Identities = 117/140 (84%), Positives = 122/140 (87%), Gaps = 0/140 (0%)
 Frame = +2

Query  125  MTSGTRLPTWkerennkrrerrrraiaakiFAGLRMYGNYKLPKHCDNNEVLKALCKEAG  304
            MTSGTR PTWKERENNKRRERRRRAIAAKIFAGLRMYGNYKLPKHCDNNEVLKALCKEAG
Sbjct  1    MTSGTRTPTWKERENNKRRERRRRAIAAKIFAGLRMYGNYKLPKHCDNNEVLKALCKEAG  60

Query  305  WIVEEDGTTYRKGCKPTERMDIMGssvsvspcssyqpsqGpsynpspasssfpspvssRY  484
            W VEEDGTTYRKGCKP  RMDI+G S S SPCSSYQPS   SYNPSP+SSSFPSP +S Y
Sbjct  61   WTVEEDGTTYRKGCKPVNRMDIIGGSTSASPCSSYQPSPRASYNPSPSSSSFPSPRASHY  120

Query  485  ITNNNNDTDPNSLIPWLKNL  544
             ++ N   D NSLIPWLKNL
Sbjct  121  PSSTNPFGDANSLIPWLKNL  140



>ref|XP_009352718.1| PREDICTED: BES1/BZR1 homolog protein 4-like [Pyrus x bretschneideri]
Length=331

 Score =   136 bits (343),  Expect = 7e-35, Method: Compositional matrix adjust.
 Identities = 107/161 (66%), Positives = 120/161 (75%), Gaps = 6/161 (4%)
 Frame = +2

Query  125  MTSGTRLPTWkerennkrrerrrraiaakiFAGLRMYGNYKLPKHCDNNEVLKALCKEAG  304
            MTSGTR+PTWKERENNK+RERR  A AAKI++GLRMYGNYKLPKHCDNNEVLKALC EAG
Sbjct  2    MTSGTRMPTWKERENNKKRERRGPATAAKIYSGLRMYGNYKLPKHCDNNEVLKALCNEAG  61

Query  305  WIVEEDGTTYRKGCKPTERMDIMGssvsvspcss------yqpsqGpsynpspasssfps  466
            W VEEDGTTYRKGCKP +RMDIMG S S SPCSS         +  P  + +P+ +S   
Sbjct  62   WTVEEDGTTYRKGCKPVDRMDIMGGSTSASPCSSYQPSPCASYNPSPGASYNPSPASSSF  121

Query  467  pvssRYITNNNNDTDPNSLIPWLKNLssgsspsssKLPHHL  589
            P  +RY  N N + D NSLIPWLK LSSGSS + SKLP   
Sbjct  122  PSPARYHANENGNADANSLIPWLKTLSSGSSSAMSKLPQFF  162



>ref|XP_010518825.1| PREDICTED: BES1/BZR1 homolog protein 3 isoform X1 [Tarenaya hassleriana]
Length=311

 Score =   135 bits (340),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 117/140 (84%), Positives = 122/140 (87%), Gaps = 0/140 (0%)
 Frame = +2

Query  125  MTSGTRLPTWkerennkrrerrrraiaakiFAGLRMYGNYKLPKHCDNNEVLKALCKEAG  304
            MTSGTR PTWKERENNKRRERRRRAIAAKIFAGLRMYGNYKLPKHCDNNEVLKALCKEAG
Sbjct  1    MTSGTRTPTWKERENNKRRERRRRAIAAKIFAGLRMYGNYKLPKHCDNNEVLKALCKEAG  60

Query  305  WIVEEDGTTYRKGCKPTERMDIMGssvsvspcssyqpsqGpsynpspasssfpspvssRY  484
            W VEEDGTTYRKGCKP  RMDI+G S S SPCSSYQPS   SYNPSP+SSSFPSP +S Y
Sbjct  61   WTVEEDGTTYRKGCKPVNRMDIIGGSTSASPCSSYQPSPRASYNPSPSSSSFPSPRASHY  120

Query  485  ITNNNNDTDPNSLIPWLKNL  544
             ++ N   D NSLIPWLKNL
Sbjct  121  PSSTNPFGDANSLIPWLKNL  140



>ref|XP_008371512.1| PREDICTED: BES1/BZR1 homolog protein 4-like [Malus domestica]
 ref|XP_009351745.1| PREDICTED: BES1/BZR1 homolog protein 4-like [Pyrus x bretschneideri]
Length=331

 Score =   135 bits (341),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 114/159 (72%), Positives = 127/159 (80%), Gaps = 6/159 (4%)
 Frame = +2

Query  125  MTSGTRLPTWkerennkrrerrrraiaakiFAGLRMYGNYKLPKHCDNNEVLKALCKEAG  304
            MTSGTR+PTWKERENNK+RERRRRAIAAKI++GLRMYGNYKLPKHCDNNEVLKALC EAG
Sbjct  2    MTSGTRMPTWKERENNKKRERRRRAIAAKIYSGLRMYGNYKLPKHCDNNEVLKALCNEAG  61

Query  305  WIVEEDGTTYRKGCKPTERMDIMGssvsvspcssyqps------qGpsynpspasssfps  466
            W VEEDGTTYRKGCKP +RMDIMG S S SPCSSYQPS        P  + +P+ +S   
Sbjct  62   WTVEEDGTTYRKGCKPVDRMDIMGGSTSASPCSSYQPSPCASYNPSPGASYNPSPASSSF  121

Query  467  pvssRYITNNNNDTDPNSLIPWLKNLssgsspsssKLPH  583
            P  +RY  N N + D NSLIPWLK LSSGSS ++SKLP 
Sbjct  122  PSPARYPANGNGNADANSLIPWLKTLSSGSSSATSKLPQ  160



>gb|KJB69669.1| hypothetical protein B456_011G036300 [Gossypium raimondii]
Length=213

 Score =   132 bits (333),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 124/156 (79%), Positives = 130/156 (83%), Gaps = 8/156 (5%)
 Frame = +2

Query  125  MTSGTRLPTWkerennkrrerrrraiaakiFAGLRMYGNYKLPKHCDNNEVLKALCKEAG  304
            MTSGTR+PTWKERENNKRRERRRRAIAAKIFAGLRMYGNYKLPKHCDNNEVLKALC EAG
Sbjct  1    MTSGTRMPTWKERENNKRRERRRRAIAAKIFAGLRMYGNYKLPKHCDNNEVLKALCNEAG  60

Query  305  WIVEEDGTTYRKGCKPTERMDIMGssvsvspcssyqpsqGpsynpspasssfpspvssRY  484
            W VEEDGTTYRKGCKP +RMDIMG S S SPC         SY+PSP SSSFPSP SS Y
Sbjct  61   WTVEEDGTTYRKGCKPVDRMDIMGGSASASPC--------SSYHPSPGSSSFPSPASSHY  112

Query  485  ITNNNNDTDPNSLIPWLKNLssgsspsssKLPHHLY  592
              N N + D NSLIPWLKNLSSGSS +SSKL HHL+
Sbjct  113  TANANGNADANSLIPWLKNLSSGSSSASSKLAHHLF  148



>ref|XP_008383594.1| PREDICTED: BES1/BZR1 homolog protein 4-like [Malus domestica]
Length=331

 Score =   135 bits (340),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 114/161 (71%), Positives = 126/161 (78%), Gaps = 6/161 (4%)
 Frame = +2

Query  125  MTSGTRLPTWkerennkrrerrrraiaakiFAGLRMYGNYKLPKHCDNNEVLKALCKEAG  304
            MTSGTR+PTWKERENNK+RERRRRAIAAKI++GLRMYGNYKLPKHCDNNEVLKALC EAG
Sbjct  2    MTSGTRMPTWKERENNKKRERRRRAIAAKIYSGLRMYGNYKLPKHCDNNEVLKALCNEAG  61

Query  305  WIVEEDGTTYRKGCKPTERMDIMGssvsvspcssyqps------qGpsynpspasssfps  466
            W VEEDGTTYRKGCKP +RMDIMG S S SPCSSYQPS        P  + +P+ +S   
Sbjct  62   WTVEEDGTTYRKGCKPVDRMDIMGGSTSASPCSSYQPSPCASYNPSPGASYNPSPASSSF  121

Query  467  pvssRYITNNNNDTDPNSLIPWLKNLssgsspsssKLPHHL  589
            P  +RY  N N   D NSLIPWLK LSSGSS ++SKLP   
Sbjct  122  PSPARYHANENGXADANSLIPWLKTLSSGSSSATSKLPQFF  162



>emb|CDP06034.1| unnamed protein product [Coffea canephora]
Length=327

 Score =   134 bits (338),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 118/140 (84%), Positives = 120/140 (86%), Gaps = 2/140 (1%)
 Frame = +2

Query  125  MTSGTRLPTWkerennkrrerrrraiaakiFAGLRMYGNYKLPKHCDNNEVLKALCKEAG  304
            MTSGTRLPTWKERENNKRRERRRRAIAA IFAGLRMYGNYKLPKHCDNNEVLKALC EAG
Sbjct  1    MTSGTRLPTWKERENNKRRERRRRAIAANIFAGLRMYGNYKLPKHCDNNEVLKALCNEAG  60

Query  305  WIVEEDGTTYRKGCKPTERMDIMGssvsvspcssyqpsqGpsynpspasssfpspvssRY  484
            W VE DGTTYRKGC+P +RMDIMG S S SPCSSY PS G SYNPSPASSSFPSP SS Y
Sbjct  61   WTVEPDGTTYRKGCRPVDRMDIMGGSTSASPCSSYHPSPGTSYNPSPASSSFPSPASSPY  120

Query  485  ITNNNNDTDPNSLIPWLKNL  544
              N N D   NSLIPWLKNL
Sbjct  121  AANINGDG--NSLIPWLKNL  138



>ref|XP_008796066.1| PREDICTED: protein BZR1 homolog 3 [Phoenix dactylifera]
Length=338

 Score =   134 bits (338),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 113/160 (71%), Positives = 120/160 (75%), Gaps = 4/160 (3%)
 Frame = +2

Query  125  MTSGTRLPTWkerennkrrerrrraiaakiFAGLRMYGNYKLPKHCDNNEVLKALCKEAG  304
            M SGTRLPTW+ERENNKRRERRRRAIAAKIFAGLRMYGNYKLPKHCDNNEVLKALC EAG
Sbjct  1    MPSGTRLPTWRERENNKRRERRRRAIAAKIFAGLRMYGNYKLPKHCDNNEVLKALCNEAG  60

Query  305  WIVEEDGTTYRKGCKPTERMDIMGssvsvspcssyqpsqGpsyn-pspasssfpspvssR  481
            W VEEDGTTYRKGCKP ERMD++    SVSP         P  +     +SS     SS 
Sbjct  61   WTVEEDGTTYRKGCKPVERMDVVAVGGSVSPSPCTSYQPSPRASYNPSPASSSFPSPSSS  120

Query  482  YITNNNNDTDPNSLIPWLKNL-ssgsspsssKL--PHHLY  592
            YITN    TD NSLIPWLKNL S+ SS SSSKL  PHHL+
Sbjct  121  YITNAYKGTDGNSLIPWLKNLSSASSSTSSSKLPNPHHLF  160



>gb|KJB69670.1| hypothetical protein B456_011G036300 [Gossypium raimondii]
Length=285

 Score =   133 bits (334),  Expect = 5e-34, Method: Compositional matrix adjust.
 Identities = 124/156 (79%), Positives = 130/156 (83%), Gaps = 8/156 (5%)
 Frame = +2

Query  125  MTSGTRLPTWkerennkrrerrrraiaakiFAGLRMYGNYKLPKHCDNNEVLKALCKEAG  304
            MTSGTR+PTWKERENNKRRERRRRAIAAKIFAGLRMYGNYKLPKHCDNNEVLKALC EAG
Sbjct  1    MTSGTRMPTWKERENNKRRERRRRAIAAKIFAGLRMYGNYKLPKHCDNNEVLKALCNEAG  60

Query  305  WIVEEDGTTYRKGCKPTERMDIMGssvsvspcssyqpsqGpsynpspasssfpspvssRY  484
            W VEEDGTTYRKGCKP +RMDIMG S S SPC         SY+PSP SSSFPSP SS Y
Sbjct  61   WTVEEDGTTYRKGCKPVDRMDIMGGSASASPC--------SSYHPSPGSSSFPSPASSHY  112

Query  485  ITNNNNDTDPNSLIPWLKNLssgsspsssKLPHHLY  592
              N N + D NSLIPWLKNLSSGSS +SSKL HHL+
Sbjct  113  TANANGNADANSLIPWLKNLSSGSSSASSKLAHHLF  148



>gb|KHG25078.1| BES1/BZR1 4 -like protein [Gossypium arboreum]
Length=319

 Score =   133 bits (335),  Expect = 6e-34, Method: Compositional matrix adjust.
 Identities = 124/156 (79%), Positives = 130/156 (83%), Gaps = 8/156 (5%)
 Frame = +2

Query  125  MTSGTRLPTWkerennkrrerrrraiaakiFAGLRMYGNYKLPKHCDNNEVLKALCKEAG  304
            MTSGTR+PTWKERENNKRRERRRRAIAAKIFAGLRMYGNYKLPKHCDNNEVLKALC EAG
Sbjct  1    MTSGTRMPTWKERENNKRRERRRRAIAAKIFAGLRMYGNYKLPKHCDNNEVLKALCNEAG  60

Query  305  WIVEEDGTTYRKGCKPTERMDIMGssvsvspcssyqpsqGpsynpspasssfpspvssRY  484
            W VEEDGTTYRKGCKP +RMDIMG S S SPC         SY+PSP SSSFPSP SS Y
Sbjct  61   WTVEEDGTTYRKGCKPVDRMDIMGGSASASPC--------SSYHPSPGSSSFPSPASSHY  112

Query  485  ITNNNNDTDPNSLIPWLKNLssgsspsssKLPHHLY  592
              N N + D NSLIPWLKNLSSGSS +SSKL HHL+
Sbjct  113  TANANGNADANSLIPWLKNLSSGSSSASSKLAHHLF  148



>gb|KJB69668.1| hypothetical protein B456_011G036300 [Gossypium raimondii]
 gb|KJB69671.1| hypothetical protein B456_011G036300 [Gossypium raimondii]
Length=319

 Score =   133 bits (335),  Expect = 7e-34, Method: Compositional matrix adjust.
 Identities = 124/156 (79%), Positives = 130/156 (83%), Gaps = 8/156 (5%)
 Frame = +2

Query  125  MTSGTRLPTWkerennkrrerrrraiaakiFAGLRMYGNYKLPKHCDNNEVLKALCKEAG  304
            MTSGTR+PTWKERENNKRRERRRRAIAAKIFAGLRMYGNYKLPKHCDNNEVLKALC EAG
Sbjct  1    MTSGTRMPTWKERENNKRRERRRRAIAAKIFAGLRMYGNYKLPKHCDNNEVLKALCNEAG  60

Query  305  WIVEEDGTTYRKGCKPTERMDIMGssvsvspcssyqpsqGpsynpspasssfpspvssRY  484
            W VEEDGTTYRKGCKP +RMDIMG S S SPC         SY+PSP SSSFPSP SS Y
Sbjct  61   WTVEEDGTTYRKGCKPVDRMDIMGGSASASPC--------SSYHPSPGSSSFPSPASSHY  112

Query  485  ITNNNNDTDPNSLIPWLKNLssgsspsssKLPHHLY  592
              N N + D NSLIPWLKNLSSGSS +SSKL HHL+
Sbjct  113  TANANGNADANSLIPWLKNLSSGSSSASSKLAHHLF  148



>gb|KHG15415.1| BES1/BZR1 4 -like protein [Gossypium arboreum]
Length=325

 Score =   133 bits (334),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 118/140 (84%), Positives = 121/140 (86%), Gaps = 2/140 (1%)
 Frame = +2

Query  125  MTSGTRLPTWkerennkrrerrrraiaakiFAGLRMYGNYKLPKHCDNNEVLKALCKEAG  304
            MTSGTRLPTWKERENNKRRERRRRAIAAKIFAGLRMYGNYKLPKHCDNNEVLKALC EAG
Sbjct  1    MTSGTRLPTWKERENNKRRERRRRAIAAKIFAGLRMYGNYKLPKHCDNNEVLKALCNEAG  60

Query  305  WIVEEDGTTYRKGCKPTERMDIMGssvsvspcssyqpsqGpsynpspasssfpspvssRY  484
            W VE DGTTYRKGCKP ERMDI+G S +VSPCSSY PS   SYNPSPASSSFPSP SS Y
Sbjct  61   WTVEPDGTTYRKGCKPVERMDIVGGSATVSPCSSYHPSPRASYNPSPASSSFPSPASSSY  120

Query  485  ITNNNNDTDPNSLIPWLKNL  544
            + N N D   NSL PWLKNL
Sbjct  121  VVNPNGDV--NSLFPWLKNL  138



>ref|XP_008451746.1| PREDICTED: BES1/BZR1 homolog protein 4 [Cucumis melo]
 ref|XP_008451748.1| PREDICTED: BES1/BZR1 homolog protein 4 [Cucumis melo]
Length=325

 Score =   133 bits (334),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 122/155 (79%), Positives = 133/155 (86%), Gaps = 3/155 (2%)
 Frame = +2

Query  125  MTSGTRLPTWkerennkrrerrrraiaakiFAGLRMYGNYKLPKHCDNNEVLKALCKEAG  304
            MTSGTRLPTW+ERENNKRRERRRRAIAAKIFAGLRMYGNYKLPKHCDNNEVLKALC EAG
Sbjct  1    MTSGTRLPTWRERENNKRRERRRRAIAAKIFAGLRMYGNYKLPKHCDNNEVLKALCNEAG  60

Query  305  WIVEEDGTTYRKGCKPTERMDIMGssvsvspcssyqpsqGpsynpspasssfpspvssRY  484
            W VE DGTTYRKGCKP ERMD++G S + SP +S+QPS   S+NPSP SSSFPSP SS Y
Sbjct  61   WTVEPDGTTYRKGCKPIERMDVVGGSAAASPYTSHQPSPCASFNPSPGSSSFPSPASSSY  120

Query  485  ITNNNNDTDPNSLIPWLKNL-ssgsspsssKLPHH  586
            + N N  TD +SLIPWLKNL +S SS SSSKLP+H
Sbjct  121  VGNPN--TDGSSLIPWLKNLSTSSSSASSSKLPNH  153



>ref|XP_010915465.1| PREDICTED: protein BZR1 homolog 3-like [Elaeis guineensis]
Length=343

 Score =   133 bits (334),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 132/162 (81%), Positives = 136/162 (84%), Gaps = 6/162 (4%)
 Frame = +2

Query  125  MTSGTRLPTWkerennkrrerrrraiaakiFAGLRMYGNYKLPKHCDNNEVLKALCKEAG  304
            MTSGTRLPTWKERENNKRRERRRRAIAAKI+AGLRMYGNYKLPKHCDNNEVLKALC EAG
Sbjct  1    MTSGTRLPTWKERENNKRRERRRRAIAAKIYAGLRMYGNYKLPKHCDNNEVLKALCNEAG  60

Query  305  WIVEEDGTTYRKGC--KPTERMDIMGssvsvspcssyqpsqGpsynpspasssfpspvss  478
            W VE DGTTYRKGC   P ERMD++G SVS SPCSSYQPS   SYNPSPASSSFPSP SS
Sbjct  61   WTVESDGTTYRKGCNPPPAERMDVVGCSVSPSPCSSYQPSPRASYNPSPASSSFPSPASS  120

Query  479  RYITNNNND---TDPNSLIPWLKNLssgsspsssKLP-HHLY  592
             YITN NN     D  SLIPWLKNLSS SS S+SK P HHLY
Sbjct  121  SYITNANNAISVADGKSLIPWLKNLSSVSSGSASKFPQHHLY  162



>ref|XP_006442380.1| hypothetical protein CICLE_v10021151mg [Citrus clementina]
 gb|ESR55620.1| hypothetical protein CICLE_v10021151mg [Citrus clementina]
Length=324

 Score =   132 bits (332),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 126/154 (82%), Positives = 129/154 (84%), Gaps = 4/154 (3%)
 Frame = +2

Query  125  MTSGTRLPTWkerennkrrerrrraiaakiFAGLRMYGNYKLPKHCDNNEVLKALCKEAG  304
            MTSG RLPTWKERENNKRRERRRRAIAAKIFAGLRMYGNYKLPKHCDNNEVLKALC EAG
Sbjct  1    MTSGARLPTWKERENNKRRERRRRAIAAKIFAGLRMYGNYKLPKHCDNNEVLKALCNEAG  60

Query  305  WIVEEDGTTYRKGCKPTERMDIMGssvsvspcssyqpsqGpsynpspasssfpspvssRY  484
            W VE DGTTYRKGCKP ERMDI+G S   SPCSSY PS   SYNPSP SSSFPSP SS Y
Sbjct  61   WTVEPDGTTYRKGCKPVERMDIVGGSAVASPCSSYHPSPCASYNPSPTSSSFPSPASSSY  120

Query  485  ITNNNNDTDPNSLIPWLKNL-ssgsspsssKLPH  583
              N N+D   NSLIPWLKNL S+ SS SSSKLPH
Sbjct  121  AANPNSD---NSLIPWLKNLSSASSSASSSKLPH  151



>ref|XP_007021866.1| BES1/BZR1 [Theobroma cacao]
 gb|EOY13391.1| BES1/BZR1 [Theobroma cacao]
Length=325

 Score =   132 bits (332),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 125/154 (81%), Positives = 132/154 (86%), Gaps = 3/154 (2%)
 Frame = +2

Query  125  MTSGTRLPTWkerennkrrerrrraiaakiFAGLRMYGNYKLPKHCDNNEVLKALCKEAG  304
            MTSGTRLPTWKERENNKRRERRRRAIAAKIF+GLRM+GNYKLPKHCDNNEVLKALC EAG
Sbjct  1    MTSGTRLPTWKERENNKRRERRRRAIAAKIFSGLRMFGNYKLPKHCDNNEVLKALCNEAG  60

Query  305  WIVEEDGTTYRKGCKPTERMDIMGssvsvspcssyqpsqGpsynpspasssfpspvssRY  484
            W VE DGTTYRKGCKP ERMDI+G S ++SPCSSY PS   SYNPSP SSSFPSP SS Y
Sbjct  61   WTVESDGTTYRKGCKPVERMDIVGGSATMSPCSSYHPSPCASYNPSPVSSSFPSPASSSY  120

Query  485  ITNNNNDTDPNSLIPWLKNL-ssgsspsssKLPH  583
            + N N D   NSLIPWLKNL S+ SS SSSKLPH
Sbjct  121  VVNPNGDG--NSLIPWLKNLSSASSSASSSKLPH  152



>ref|XP_004137229.1| PREDICTED: BES1/BZR1 homolog protein 4-like [Cucumis sativus]
 ref|XP_004156512.1| PREDICTED: BES1/BZR1 homolog protein 4-like [Cucumis sativus]
 gb|KGN53574.1| hypothetical protein Csa_4G083490 [Cucumis sativus]
Length=325

 Score =   132 bits (332),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 122/155 (79%), Positives = 132/155 (85%), Gaps = 3/155 (2%)
 Frame = +2

Query  125  MTSGTRLPTWkerennkrrerrrraiaakiFAGLRMYGNYKLPKHCDNNEVLKALCKEAG  304
            MTSGTRLPTW+ERENNKRRERRRRAIAAKIFAGLRMYGNYKLPKHCDNNEVLKALC EAG
Sbjct  1    MTSGTRLPTWRERENNKRRERRRRAIAAKIFAGLRMYGNYKLPKHCDNNEVLKALCNEAG  60

Query  305  WIVEEDGTTYRKGCKPTERMDIMGssvsvspcssyqpsqGpsynpspasssfpspvssRY  484
            W VE DGTTYRKGCKP ERMD++G S + SP +S+QPS   S+NPSP SSSFPSP SS Y
Sbjct  61   WTVEPDGTTYRKGCKPIERMDVVGGSAAASPYTSHQPSPCASFNPSPGSSSFPSPASSSY  120

Query  485  ITNNNNDTDPNSLIPWLKNL-ssgsspsssKLPHH  586
            I N N D   +SLIPWLKNL +S SS SSSKLP+H
Sbjct  121  IGNPNADG--SSLIPWLKNLSTSSSSASSSKLPNH  153



>ref|XP_006477843.1| PREDICTED: BES1/BZR1 homolog protein 4-like isoform X1 [Citrus 
sinensis]
 ref|XP_006477844.1| PREDICTED: BES1/BZR1 homolog protein 4-like isoform X2 [Citrus 
sinensis]
 gb|KDO43794.1| hypothetical protein CISIN_1g020567mg [Citrus sinensis]
Length=324

 Score =   131 bits (330),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 127/154 (82%), Positives = 129/154 (84%), Gaps = 4/154 (3%)
 Frame = +2

Query  125  MTSGTRLPTWkerennkrrerrrraiaakiFAGLRMYGNYKLPKHCDNNEVLKALCKEAG  304
            MTSG RLPTWKERENNKRRERRRRAIAAKIFAGLRMYGNYKLPKHCDNNEVLKALC EAG
Sbjct  1    MTSGARLPTWKERENNKRRERRRRAIAAKIFAGLRMYGNYKLPKHCDNNEVLKALCNEAG  60

Query  305  WIVEEDGTTYRKGCKPTERMDIMGssvsvspcssyqpsqGpsynpspasssfpspvssRY  484
            W VE DGTTYRKGCKP ERMDI+G S   SPCSSY PS   SYNPSPASSSFPSP SS Y
Sbjct  61   WTVEPDGTTYRKGCKPVERMDIVGGSAVASPCSSYHPSPCASYNPSPASSSFPSPASSSY  120

Query  485  ITNNNNDTDPNSLIPWLKNL-ssgsspsssKLPH  583
              N N D   NSLIPWLKNL S+ SS SSSKLPH
Sbjct  121  AANPNAD---NSLIPWLKNLSSASSSASSSKLPH  151



>ref|XP_010644097.1| PREDICTED: BES1/BZR1 homolog protein 4 [Vitis vinifera]
Length=326

 Score =   131 bits (330),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 128/154 (83%), Positives = 130/154 (84%), Gaps = 3/154 (2%)
 Frame = +2

Query  125  MTSGTRLPTWkerennkrrerrrraiaakiFAGLRMYGNYKLPKHCDNNEVLKALCKEAG  304
            MTSG RLPTWKERENNKRRERRRRAIAAKIFAGLRMYGNYKLPKHCDNNEVLKALC EAG
Sbjct  1    MTSGARLPTWKERENNKRRERRRRAIAAKIFAGLRMYGNYKLPKHCDNNEVLKALCNEAG  60

Query  305  WIVEEDGTTYRKGCKPTERMDIMGssvsvspcssyqpsqGpsynpspasssfpspvssRY  484
            W VE DGTTYRKGCKP ERMDI+G S S SPCSSY PS   SYNPSPASSSFPSP SS Y
Sbjct  61   WTVEPDGTTYRKGCKPVERMDIVGGSASASPCSSYHPSPCASYNPSPASSSFPSPASSSY  120

Query  485  ITNNNNDTDPNSLIPWLKNL-ssgsspsssKLPH  583
              N N D   NSLIPWLKNL S+ SS SSSKLPH
Sbjct  121  AANPNADG--NSLIPWLKNLSSASSSASSSKLPH  152



>ref|XP_010916623.1| PREDICTED: protein BZR1 homolog 3-like [Elaeis guineensis]
Length=340

 Score =   131 bits (330),  Expect = 5e-33, Method: Compositional matrix adjust.
 Identities = 96/143 (67%), Positives = 103/143 (72%), Gaps = 3/143 (2%)
 Frame = +2

Query  125  MTSGTRLPTWkerennkrrerrrraiaakiFAGLRMYGNYKLPKHCDNNEVLKALCKEAG  304
            M SGTRLPTW+ERENNKRRERRRRAIAAKIFAGLRMYGNY+LPKHCDNNEVLKALC EAG
Sbjct  1    MPSGTRLPTWRERENNKRRERRRRAIAAKIFAGLRMYGNYRLPKHCDNNEVLKALCNEAG  60

Query  305  WIVEEDGTTYRKGCKPTERMDIMGssvsvspcssyqpsqGpsynpspasssfpspvssRY  484
            W VEEDGTTYR+GCKP ERMD+           +       +      +SS     SS Y
Sbjct  61   WTVEEDGTTYRQGCKPVERMDVGVGGSVSPSPCTSYQPSPHASYNPSPASSSFPSPSSSY  120

Query  485  ITNNNN---DTDPNSLIPWLKNL  544
            ITN NN    TD NSLIPWLKNL
Sbjct  121  ITNANNANKGTDGNSLIPWLKNL  143



>gb|KJB13026.1| hypothetical protein B456_002G052400 [Gossypium raimondii]
 gb|KJB13027.1| hypothetical protein B456_002G052400 [Gossypium raimondii]
 gb|KJB13028.1| hypothetical protein B456_002G052400 [Gossypium raimondii]
 gb|KJB13029.1| hypothetical protein B456_002G052400 [Gossypium raimondii]
Length=325

 Score =   130 bits (328),  Expect = 9e-33, Method: Compositional matrix adjust.
 Identities = 117/140 (84%), Positives = 120/140 (86%), Gaps = 2/140 (1%)
 Frame = +2

Query  125  MTSGTRLPTWkerennkrrerrrraiaakiFAGLRMYGNYKLPKHCDNNEVLKALCKEAG  304
            MTSGTRLPTWKERENNKRRERRRRAIAAKIFAGLRMYGNYKLPKHCDNNEVLKALC EAG
Sbjct  1    MTSGTRLPTWKERENNKRRERRRRAIAAKIFAGLRMYGNYKLPKHCDNNEVLKALCNEAG  60

Query  305  WIVEEDGTTYRKGCKPTERMDIMGssvsvspcssyqpsqGpsynpspasssfpspvssRY  484
            W VE DGTTYR GCKP ERMDI+G S +VSPCSSY PS   SYNPSPASSSFPSP SS Y
Sbjct  61   WTVEPDGTTYRNGCKPVERMDIVGGSATVSPCSSYHPSSRASYNPSPASSSFPSPASSSY  120

Query  485  ITNNNNDTDPNSLIPWLKNL  544
            + N N D   NSL PWLKNL
Sbjct  121  MVNPNGDV--NSLFPWLKNL  138



>ref|XP_006370100.1| hypothetical protein POPTR_0001s39520g [Populus trichocarpa]
 ref|XP_006370101.1| brassinosteroid signaling positive regulator-related family protein 
[Populus trichocarpa]
 gb|ABK93591.1| unknown [Populus trichocarpa]
 gb|ERP66669.1| hypothetical protein POPTR_0001s39520g [Populus trichocarpa]
 gb|ERP66670.1| brassinosteroid signaling positive regulator-related family protein 
[Populus trichocarpa]
Length=328

 Score =   129 bits (325),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 124/156 (79%), Positives = 129/156 (83%), Gaps = 2/156 (1%)
 Frame = +2

Query  125  MTSGTRLPTWkerennkrrerrrraiaakiFAGLRMYGNYKLPKHCDNNEVLKALCKEAG  304
            MTSGTRLPTWKERENNKRRERRRRAIAAKIF+GLRMYGNYKLPKHCDNNEVLKALC EAG
Sbjct  1    MTSGTRLPTWKERENNKRRERRRRAIAAKIFSGLRMYGNYKLPKHCDNNEVLKALCNEAG  60

Query  305  WIVEEDGTTYRKGCKPTERMDIMGssvsvspcssyqpsqGpsynpspasssfpspvssRY  484
            W VE DGTT+RKGCKP ERMDI+G S + SPCSSY PS   SYNPSP SSSFPSP SS Y
Sbjct  61   WTVEPDGTTFRKGCKPVERMDILGVSATTSPCSSYHPSPCASYNPSPGSSSFPSPASSSY  120

Query  485  ITNNNNDTDPNSLIPWLKNLssgsspsssKLPHHLY  592
              N N D   NSLIPWLKNLSS SS +SS    HLY
Sbjct  121  AANANMDC--NSLIPWLKNLSSASSSASSSKFPHLY  154



>ref|XP_011002762.1| PREDICTED: BES1/BZR1 homolog protein 4 isoform X1 [Populus euphratica]
 ref|XP_011002763.1| PREDICTED: BES1/BZR1 homolog protein 4 isoform X2 [Populus euphratica]
Length=328

 Score =   129 bits (325),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 124/156 (79%), Positives = 129/156 (83%), Gaps = 2/156 (1%)
 Frame = +2

Query  125  MTSGTRLPTWkerennkrrerrrraiaakiFAGLRMYGNYKLPKHCDNNEVLKALCKEAG  304
            MTSGTRLPTWKERENNKRRERRRRAIAAKIF+GLRMYGNYKLPKHCDNNEVLKALC EAG
Sbjct  1    MTSGTRLPTWKERENNKRRERRRRAIAAKIFSGLRMYGNYKLPKHCDNNEVLKALCNEAG  60

Query  305  WIVEEDGTTYRKGCKPTERMDIMGssvsvspcssyqpsqGpsynpspasssfpspvssRY  484
            W VE DGTT+RKGCKP ERMDI+G S + SPCSSY PS   SYNPSP SSSFPSP SS Y
Sbjct  61   WTVEPDGTTFRKGCKPVERMDILGVSATTSPCSSYHPSPCASYNPSPGSSSFPSPASSSY  120

Query  485  ITNNNNDTDPNSLIPWLKNLssgsspsssKLPHHLY  592
              N N D   NSLIPWLKNLSS SS +SS    HLY
Sbjct  121  AANANMDC--NSLIPWLKNLSSASSSASSSKFPHLY  154



>ref|XP_004489001.1| PREDICTED: BES1/BZR1 homolog protein 4-like isoform X1 [Cicer 
arietinum]
 ref|XP_004489002.1| PREDICTED: BES1/BZR1 homolog protein 4-like isoform X2 [Cicer 
arietinum]
Length=321

 Score =   129 bits (324),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 118/153 (77%), Positives = 126/153 (82%), Gaps = 5/153 (3%)
 Frame = +2

Query  125  MTSGTRLPTWkerennkrrerrrraiaakiFAGLRMYGNYKLPKHCDNNEVLKALCKEAG  304
            MT GTRLPTWKERENNK+RERRRRAIAAKIF+GLRMYGN++LPKHCDNNEVLKALC EAG
Sbjct  1    MTLGTRLPTWKERENNKKRERRRRAIAAKIFSGLRMYGNFRLPKHCDNNEVLKALCNEAG  60

Query  305  WIVEEDGTTYRKGCKPTERMDIMGssvsvspcssyqpsqGpsynpspasssfpspvssRY  484
            W VE DGTTYRKGCKP E MDI+G S + SPCSSY  S   SYNPSP SSSFPSP SS Y
Sbjct  61   WTVEPDGTTYRKGCKPLEHMDIVGGSSAASPCSSYHQSPCASYNPSPVSSSFPSPSSSPY  120

Query  485  ITNNNNDTDPNSLIPWLKNLssgsspsssKLPH  583
             TN+N   D NSLIPWLKNL   S+ SS KLPH
Sbjct  121  TTNHN--VDGNSLIPWLKNL---STASSPKLPH  148



>gb|KJB45771.1| hypothetical protein B456_007G327000 [Gossypium raimondii]
Length=317

 Score =   129 bits (323),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 117/154 (76%), Positives = 125/154 (81%), Gaps = 11/154 (7%)
 Frame = +2

Query  125  MTSGTRLPTWkerennkrrerrrraiaakiFAGLRMYGNYKLPKHCDNNEVLKALCKEAG  304
            MTSGTR+PTWKERENNKRRERRRRAIAAKIFAGLRMYGNYKLPKHCDNNEVLKALC EAG
Sbjct  1    MTSGTRMPTWKERENNKRRERRRRAIAAKIFAGLRMYGNYKLPKHCDNNEVLKALCNEAG  60

Query  305  WIVEEDGTTYRKGCKPTERMDIMGssvsvspcssyqpsqGpsynpspasssfpspvssRY  484
            W VE DGTTYRKGCKP ERMDI+G S + SP          SY+PSP SSSFPS  SS Y
Sbjct  61   WTVEPDGTTYRKGCKPLERMDIVGGSATASPS--------SSYHPSPMSSSFPSSASSSY  112

Query  485  ITNNNNDTDPNSLIPWLKNL-ssgsspsssKLPH  583
            + N+N D   +SLIPWLKNL S+ SSP SSKLPH
Sbjct  113  VVNSNGDG--SSLIPWLKNLSSASSSPMSSKLPH  144



>ref|XP_002317445.1| brassinosteroid signaling positive regulator-related family protein 
[Populus trichocarpa]
 gb|EEE98057.1| brassinosteroid signaling positive regulator-related family protein 
[Populus trichocarpa]
Length=319

 Score =   129 bits (323),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 123/153 (80%), Positives = 128/153 (84%), Gaps = 5/153 (3%)
 Frame = +2

Query  125  MTSGTRLPTWkerennkrrerrrraiaakiFAGLRMYGNYKLPKHCDNNEVLKALCKEAG  304
            MTSGTRLPTWKERENNKRRERRRRAIAAKIF+GLRMYGN+KLPKHCDNNEVLKALC EAG
Sbjct  1    MTSGTRLPTWKERENNKRRERRRRAIAAKIFSGLRMYGNFKLPKHCDNNEVLKALCNEAG  60

Query  305  WIVEEDGTTYRKGCKPTERMDIMGssvsvspcssyqpsqGpsynpspasssfpspvssRY  484
            W VE DGTTYRKGCKP E MDI+G S + SPCSSY PS   SYNPSP SSSFPSPVSS Y
Sbjct  61   WAVEPDGTTYRKGCKPAEHMDIIGGSATASPCSSYLPSPCASYNPSPGSSSFPSPVSSSY  120

Query  485  ITNNNNDTDPNSLIPWLKNLssgsspsssKLPH  583
              N N D   NSL+PWLKNL   SS SSSKLPH
Sbjct  121  AANANLDD--NSLLPWLKNL---SSASSSKLPH  148



>ref|XP_009359371.1| PREDICTED: BES1/BZR1 homolog protein 4-like [Pyrus x bretschneideri]
Length=324

 Score =   128 bits (322),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 109/140 (78%), Positives = 114/140 (81%), Gaps = 2/140 (1%)
 Frame = +2

Query  125  MTSGTRLPTWkerennkrrerrrraiaakiFAGLRMYGNYKLPKHCDNNEVLKALCKEAG  304
            MTSGTR+PTWKERENNKRRERRRRAIAAKIFAGLR+YGNYKLPKHCDNNEVLKALC EAG
Sbjct  1    MTSGTRMPTWKERENNKRRERRRRAIAAKIFAGLRLYGNYKLPKHCDNNEVLKALCDEAG  60

Query  305  WIVEEDGTTYRKGCKPTERMDIMGssvsvspcssyqpsqGpsynpspasssfpspvssRY  484
            W VE DGTTYRKGCKP E+MD+MG S   SP SS+  S   SYNPSP SSS PSP SS Y
Sbjct  61   WTVELDGTTYRKGCKPVEQMDVMGGSTLASPSSSFLQSNRASYNPSPGSSSIPSPTSSSY  120

Query  485  ITNNNNDTDPNSLIPWLKNL  544
              N N D    SLIPWLKNL
Sbjct  121  AANQNADG--RSLIPWLKNL  138



>ref|XP_006833072.1| hypothetical protein AMTR_s00170p00061300 [Amborella trichopoda]
 gb|ERM98350.1| hypothetical protein AMTR_s00170p00061300 [Amborella trichopoda]
Length=293

 Score =   127 bits (319),  Expect = 8e-32, Method: Compositional matrix adjust.
 Identities = 107/140 (76%), Positives = 114/140 (81%), Gaps = 8/140 (6%)
 Frame = +2

Query  125  MTSGTRLPTWkerennkrrerrrraiaakiFAGLRMYGNYKLPKHCDNNEVLKALCKEAG  304
            MTSGTRLPTWKERENNKRRERRRRAIAAKI+AGLRMYGNYKLPKHCDNNEVLKALC EAG
Sbjct  1    MTSGTRLPTWKERENNKRRERRRRAIAAKIYAGLRMYGNYKLPKHCDNNEVLKALCAEAG  60

Query  305  WIVEEDGTTYRKGCKPTERMDIMGssvsvspcssyqpsqGpsynpspasssfpspvssRY  484
            W VEEDGTTYRKGCKP ERMDI+G S S SPCSSY PS G         S  PSP SS +
Sbjct  61   WTVEEDGTTYRKGCKPVERMDIVGGSASASPCSSYHPSPG--------PSYNPSPASSSF  112

Query  485  ITNNNNDTDPNSLIPWLKNL  544
             +  ++ TD +SLIPWLKNL
Sbjct  113  PSPASSYTDGSSLIPWLKNL  132



>ref|XP_009334016.1| PREDICTED: BES1/BZR1 homolog protein 4-like [Pyrus x bretschneideri]
Length=324

 Score =   128 bits (321),  Expect = 9e-32, Method: Compositional matrix adjust.
 Identities = 112/140 (80%), Positives = 116/140 (83%), Gaps = 2/140 (1%)
 Frame = +2

Query  125  MTSGTRLPTWkerennkrrerrrraiaakiFAGLRMYGNYKLPKHCDNNEVLKALCKEAG  304
            MTSGTRLPT KERENNKRRERRRRAIAAKIFAGLRMYGNYKLPKHCDNNEVLKALC EAG
Sbjct  1    MTSGTRLPTSKERENNKRRERRRRAIAAKIFAGLRMYGNYKLPKHCDNNEVLKALCDEAG  60

Query  305  WIVEEDGTTYRKGCKPTERMDIMGssvsvspcssyqpsqGpsynpspasssfpspvssRY  484
            W VE DGTTYRKGCKP ERMD+MG S   SP SS+ PS   SYNPSP SSSFPSP SS Y
Sbjct  61   WTVELDGTTYRKGCKPVERMDVMGGSTVASPSSSFHPSNCASYNPSPGSSSFPSPTSSSY  120

Query  485  ITNNNNDTDPNSLIPWLKNL  544
              N N D+   SLIPWL+NL
Sbjct  121  AANQNADS--RSLIPWLRNL  138



>ref|XP_007149549.1| hypothetical protein PHAVU_005G079400g [Phaseolus vulgaris]
 gb|ESW21543.1| hypothetical protein PHAVU_005G079400g [Phaseolus vulgaris]
Length=325

 Score =   127 bits (320),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 124/154 (81%), Positives = 130/154 (84%), Gaps = 3/154 (2%)
 Frame = +2

Query  125  MTSGTRLPTWkerennkrrerrrraiaakiFAGLRMYGNYKLPKHCDNNEVLKALCKEAG  304
            MTSGTRLPTWKERENNKRRERRRRAIAAKIFAGLRMYGN+KLPKHCDNNEVLKALC EAG
Sbjct  1    MTSGTRLPTWKERENNKRRERRRRAIAAKIFAGLRMYGNFKLPKHCDNNEVLKALCNEAG  60

Query  305  WIVEEDGTTYRKGCKPTERMDIMGssvsvspcssyqpsqGpsynpspasssfpspvssRY  484
            W VE DGTTYRKGCKP ERMDI+G S + SPCSSY PS   SYNPSP SSSFPSP SS Y
Sbjct  61   WTVEPDGTTYRKGCKPLERMDIVGGSSAASPCSSYHPSPCASYNPSPGSSSFPSPSSSPY  120

Query  485  ITNNNNDTDPNSLIPWLKNLssgsspsss-KLPH  583
               N  + D NSLIPWLKNLS+ SS +SS KLPH
Sbjct  121  --TNIPNADGNSLIPWLKNLSTASSSASSPKLPH  152



>ref|XP_004489004.1| PREDICTED: BES1/BZR1 homolog protein 4-like isoform X2 [Cicer 
arietinum]
Length=325

 Score =   127 bits (319),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 113/140 (81%), Positives = 117/140 (84%), Gaps = 2/140 (1%)
 Frame = +2

Query  125  MTSGTRLPTWkerennkrrerrrraiaakiFAGLRMYGNYKLPKHCDNNEVLKALCKEAG  304
            MTSGTR PTWKERENNKRRERRRRAIAAKIF+GLRMYGNYKLPKHCDNNEVLKALC EAG
Sbjct  1    MTSGTRQPTWKERENNKRRERRRRAIAAKIFSGLRMYGNYKLPKHCDNNEVLKALCNEAG  60

Query  305  WIVEEDGTTYRKGCKPTERMDIMGssvsvspcssyqpsqGpsynpspasssfpspvssRY  484
            WIVE DGTTYRKGCKP ERMD+ G S   +PCSSY PS   SYNPSP SSSFPSP SS +
Sbjct  61   WIVEPDGTTYRKGCKPIERMDVAGGSAMATPCSSYHPSPCASYNPSPGSSSFPSPRSSSH  120

Query  485  ITNNNNDTDPNSLIPWLKNL  544
              N N D   NSLIPWLKNL
Sbjct  121  AVNPNGDG--NSLIPWLKNL  138



>ref|XP_004489003.1| PREDICTED: BES1/BZR1 homolog protein 4-like isoform X1 [Cicer 
arietinum]
Length=342

 Score =   127 bits (319),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 113/140 (81%), Positives = 117/140 (84%), Gaps = 2/140 (1%)
 Frame = +2

Query  125  MTSGTRLPTWkerennkrrerrrraiaakiFAGLRMYGNYKLPKHCDNNEVLKALCKEAG  304
            MTSGTR PTWKERENNKRRERRRRAIAAKIF+GLRMYGNYKLPKHCDNNEVLKALC EAG
Sbjct  1    MTSGTRQPTWKERENNKRRERRRRAIAAKIFSGLRMYGNYKLPKHCDNNEVLKALCNEAG  60

Query  305  WIVEEDGTTYRKGCKPTERMDIMGssvsvspcssyqpsqGpsynpspasssfpspvssRY  484
            WIVE DGTTYRKGCKP ERMD+ G S   +PCSSY PS   SYNPSP SSSFPSP SS +
Sbjct  61   WIVEPDGTTYRKGCKPIERMDVAGGSAMATPCSSYHPSPCASYNPSPGSSSFPSPRSSSH  120

Query  485  ITNNNNDTDPNSLIPWLKNL  544
              N N D   NSLIPWLKNL
Sbjct  121  AVNPNGDG--NSLIPWLKNL  138



>ref|XP_007211588.1| hypothetical protein PRUPE_ppa008637mg [Prunus persica]
 gb|EMJ12787.1| hypothetical protein PRUPE_ppa008637mg [Prunus persica]
Length=324

 Score =   126 bits (317),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 113/140 (81%), Positives = 116/140 (83%), Gaps = 2/140 (1%)
 Frame = +2

Query  125  MTSGTRLPTWkerennkrrerrrraiaakiFAGLRMYGNYKLPKHCDNNEVLKALCKEAG  304
            MT GTR+PTWKERENNKRRERRRRAIAAKIFAGLRMYGNYKLPKHCDNNEVLKALC EAG
Sbjct  1    MTYGTRMPTWKERENNKRRERRRRAIAAKIFAGLRMYGNYKLPKHCDNNEVLKALCDEAG  60

Query  305  WIVEEDGTTYRKGCKPTERMDIMGssvsvspcssyqpsqGpsynpspasssfpspvssRY  484
            W VE DGTTYRKGCKP ERMD++G S   SPCSSY PS   SYNPSP SSSFPSP SS Y
Sbjct  61   WTVEPDGTTYRKGCKPAERMDVVGGSTLASPCSSYHPSTCASYNPSPGSSSFPSPASSSY  120

Query  485  ITNNNNDTDPNSLIPWLKNL  544
              N N D    SLIPWLKNL
Sbjct  121  AANQNADG--RSLIPWLKNL  138



>ref|XP_007211637.1| hypothetical protein PRUPE_ppa008675mg [Prunus persica]
 ref|XP_008225238.1| PREDICTED: BES1/BZR1 homolog protein 4 isoform X1 [Prunus mume]
 ref|XP_008225239.1| PREDICTED: BES1/BZR1 homolog protein 4 isoform X2 [Prunus mume]
 gb|EMJ12836.1| hypothetical protein PRUPE_ppa008675mg [Prunus persica]
Length=323

 Score =   126 bits (317),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 114/153 (75%), Positives = 127/153 (83%), Gaps = 2/153 (1%)
 Frame = +2

Query  125  MTSGTRLPTWkerennkrrerrrraiaakiFAGLRMYGNYKLPKHCDNNEVLKALCKEAG  304
            MTSGTR+PTWKERENNK+RERRRRAIAAKI++GLRMYGNYKLPKHCDNNEVLKALC EAG
Sbjct  2    MTSGTRMPTWKERENNKKRERRRRAIAAKIYSGLRMYGNYKLPKHCDNNEVLKALCNEAG  61

Query  305  WIVEEDGTTYRKGCKPTERMDIMGssvsvspcssyqpsqGpsynpspasssfpspvssRY  484
            W VEEDGTTYRKGCKP +RMDIMG S S SPCSSYQPS  P  + +P+ +S   P  +RY
Sbjct  62   WTVEEDGTTYRKGCKPVDRMDIMGGSTSASPCSSYQPS--PCQSYNPSPASSSFPSPARY  119

Query  485  ITNNNNDTDPNSLIPWLKNLssgsspsssKLPH  583
              N N + D NSLIPWLK LSSGSS ++SKLP 
Sbjct  120  PANANGNADANSLIPWLKTLSSGSSSATSKLPQ  152



>gb|KHG21553.1| BES1/BZR1 4 -like protein [Gossypium arboreum]
Length=317

 Score =   125 bits (315),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 117/154 (76%), Positives = 125/154 (81%), Gaps = 11/154 (7%)
 Frame = +2

Query  125  MTSGTRLPTWkerennkrrerrrraiaakiFAGLRMYGNYKLPKHCDNNEVLKALCKEAG  304
            MTSGTR+PTWKERENNKRRERRRRAIAAKIFAGLRMYGNYKLPKHCDNNEVLKALC EAG
Sbjct  1    MTSGTRMPTWKERENNKRRERRRRAIAAKIFAGLRMYGNYKLPKHCDNNEVLKALCNEAG  60

Query  305  WIVEEDGTTYRKGCKPTERMDIMGssvsvspcssyqpsqGpsynpspasssfpspvssRY  484
            W VE DGTTYRK CKP ERMDI+G S + SP          SY+PSP SSSFPSP SS Y
Sbjct  61   WTVEPDGTTYRKDCKPLERMDIVGGSATASPS--------SSYHPSPMSSSFPSPASSSY  112

Query  485  ITNNNNDTDPNSLIPWLKNL-ssgsspsssKLPH  583
            + N+N D   +SLIPWLKNL S+ SSP SSKLPH
Sbjct  113  VVNSNGDG--SSLIPWLKNLSSASSSPMSSKLPH  144



>ref|XP_009768995.1| PREDICTED: BES1/BZR1 homolog protein 4-like [Nicotiana sylvestris]
Length=316

 Score =   125 bits (315),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 123/154 (80%), Positives = 128/154 (83%), Gaps = 3/154 (2%)
 Frame = +2

Query  125  MTSGTRLPTWkerennkrrerrrraiaakiFAGLRMYGNYKLPKHCDNNEVLKALCKEAG  304
            MTSGTR+PTWKERENNKRRERRRRAIAAKIFAGLRMYGNY+LPKHCDNNEVLKALC EAG
Sbjct  1    MTSGTRMPTWKERENNKRRERRRRAIAAKIFAGLRMYGNYQLPKHCDNNEVLKALCNEAG  60

Query  305  WIVEEDGTTYRKGCKPTERMDIMGssvsvspcssyqpsqGpsynpspasssfpspvssRY  484
            W VE DGTTYRKGCKP ER+D +G S S+SPCSSYQPS   S NPSPASSS  SP SS Y
Sbjct  61   WTVEPDGTTYRKGCKPMERLDFIGGSTSISPCSSYQPSPFTSNNPSPASSSLHSPASSSY  120

Query  485  ITNNNNDTDPNSLIPWLKNL-ssgsspsssKLPH  583
             TN N D    SLIPWLKNL S  SS SSSKLPH
Sbjct  121  ATNLNMDG--KSLIPWLKNLSSGSSSASSSKLPH  152



>ref|XP_009416433.1| PREDICTED: protein BZR1 homolog 3 [Musa acuminata subsp. malaccensis]
Length=337

 Score =   126 bits (316),  Expect = 5e-31, Method: Compositional matrix adjust.
 Identities = 102/146 (70%), Positives = 112/146 (77%), Gaps = 11/146 (8%)
 Frame = +2

Query  104  RNGRRREMTSGTRLPTWkerennkrrerrrraiaakiFAGLRMYGNYKLPKHCDNNEVLK  283
            + GR  EMTSGTR+PTW+ERENNKRRERRRRAIAAKI+AGLRMYGNYKLPKHCDNN VLK
Sbjct  2    KEGRVEEMTSGTRMPTWRERENNKRRERRRRAIAAKIYAGLRMYGNYKLPKHCDNNAVLK  61

Query  284  ALCKEAGWIVEEDGTTYRKGCKPTERMDIMGssvsvspcssyqpsqGpsynpspasssfp  463
            ALC+EAGW VEEDGTTYRKGCKP E +DI+GSS S SPC SY PS   S   SP SS+  
Sbjct  62   ALCEEAGWAVEEDGTTYRKGCKPVEHVDIVGSSASPSPCVSYNPSPASSTLASPMSST--  119

Query  464  spvssRYITNNNN---DTDPNSLIPW  532
                   ITN  N    T+ NSL+PW
Sbjct  120  ------LITNAKNLTSGTEGNSLVPW  139



>ref|XP_011044050.1| PREDICTED: BES1/BZR1 homolog protein 4-like [Populus euphratica]
Length=319

 Score =   125 bits (315),  Expect = 5e-31, Method: Compositional matrix adjust.
 Identities = 121/153 (79%), Positives = 126/153 (82%), Gaps = 5/153 (3%)
 Frame = +2

Query  125  MTSGTRLPTWkerennkrrerrrraiaakiFAGLRMYGNYKLPKHCDNNEVLKALCKEAG  304
            MTSGTRLPTWKERENNKRRERRRRAIAAKIF+GLRMYGN+KLPKHCDNNEVLKALC EAG
Sbjct  1    MTSGTRLPTWKERENNKRRERRRRAIAAKIFSGLRMYGNFKLPKHCDNNEVLKALCNEAG  60

Query  305  WIVEEDGTTYRKGCKPTERMDIMGssvsvspcssyqpsqGpsynpspasssfpspvssRY  484
            W VE DGTTYRKGCK  E MDI+G S + SPCSSY PS   SYNPSP SSSFPS VSS Y
Sbjct  61   WAVEPDGTTYRKGCKTAEHMDIIGGSATASPCSSYLPSPCASYNPSPGSSSFPSSVSSSY  120

Query  485  ITNNNNDTDPNSLIPWLKNLssgsspsssKLPH  583
              N N   D NSL+PWLKNL   SS SSSKLPH
Sbjct  121  AANAN--VDDNSLLPWLKNL---SSASSSKLPH  148



>ref|XP_009622768.1| PREDICTED: BES1/BZR1 homolog protein 4-like [Nicotiana tomentosiformis]
Length=316

 Score =   124 bits (312),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 123/154 (80%), Positives = 127/154 (82%), Gaps = 3/154 (2%)
 Frame = +2

Query  125  MTSGTRLPTWkerennkrrerrrraiaakiFAGLRMYGNYKLPKHCDNNEVLKALCKEAG  304
            MTSGTR+PTWKERENNKRRERRRRAIAAKIFAGLRMYGNY+LPKHCDNNEVLKALC EAG
Sbjct  1    MTSGTRMPTWKERENNKRRERRRRAIAAKIFAGLRMYGNYQLPKHCDNNEVLKALCNEAG  60

Query  305  WIVEEDGTTYRKGCKPTERMDIMGssvsvspcssyqpsqGpsynpspasssfpspvssRY  484
            W VE DGTTYRKGCKP ER+D  G S S+SPCSSYQPS   S NPSPASSS  SP SS Y
Sbjct  61   WTVEPDGTTYRKGCKPMERLDFKGGSTSISPCSSYQPSPFTSNNPSPASSSLHSPASSSY  120

Query  485  ITNNNNDTDPNSLIPWLKNL-ssgsspsssKLPH  583
             TN N D    SLIPWLKNL S  SS SSSKLPH
Sbjct  121  ATNLNMDG--KSLIPWLKNLSSGSSSASSSKLPH  152



>ref|XP_008386283.1| PREDICTED: BES1/BZR1 homolog protein 4-like [Malus domestica]
Length=324

 Score =   125 bits (313),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 111/140 (79%), Positives = 114/140 (81%), Gaps = 2/140 (1%)
 Frame = +2

Query  125  MTSGTRLPTWkerennkrrerrrraiaakiFAGLRMYGNYKLPKHCDNNEVLKALCKEAG  304
            MTSGTR+PTWKERENNKRRERRRRAIAAKIF GLRMYGNYKLPKHCDNNEVLKALC EAG
Sbjct  1    MTSGTRMPTWKERENNKRRERRRRAIAAKIFXGLRMYGNYKLPKHCDNNEVLKALCDEAG  60

Query  305  WIVEEDGTTYRKGCKPTERMDIMGssvsvspcssyqpsqGpsynpspasssfpspvssRY  484
            W VE DGTTYRKGCKP E MD+MG S   SP SS+ PS   SYNPSP SSSFPSP SS Y
Sbjct  61   WTVELDGTTYRKGCKPVEHMDVMGGSTLASPSSSFLPSNCASYNPSPGSSSFPSPTSSSY  120

Query  485  ITNNNNDTDPNSLIPWLKNL  544
              N N D    SLIPWLKNL
Sbjct  121  AXNXNADG--RSLIPWLKNL  138



>ref|XP_002267082.1| PREDICTED: BES1/BZR1 homolog protein 4 [Vitis vinifera]
Length=341

 Score =   125 bits (313),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 125/170 (74%), Positives = 132/170 (78%), Gaps = 16/170 (9%)
 Frame = +2

Query  131  SGTRLPTWkerennkrrerrrraiaakiFAGLRMYGNYKLPKHCDNNEVLKALCKEAGWI  310
            +GTRLPTWKERENNKRRERRRRAIAAKI++GLRMYGNYKLPKHCDNNEVLKALC EAGW 
Sbjct  2    TGTRLPTWKERENNKRRERRRRAIAAKIYSGLRMYGNYKLPKHCDNNEVLKALCNEAGWT  61

Query  311  VEEDGTTYRKGCKPTERMDIMGssvsvspcssyqpsqGpsynpspasssfpspvss----  478
            VEEDGTTYRKGCKP ERMDIMG S S SPCSSYQPS   SYNPSP +S  PSP +S    
Sbjct  62   VEEDGTTYRKGCKPVERMDIMGGSASASPCSSYQPSPCASYNPSPCASYNPSPCASYNPS  121

Query  479  ------------RYITNNNNDTDPNSLIPWLKNLssgsspsssKLPHHLY  592
                        RY  N N   D N+LIPWLKNLSSGSS +SSK PHHLY
Sbjct  122  PASSSFPSPVSSRYAANANASADANALIPWLKNLSSGSSSTSSKFPHHLY  171



>emb|CBI20158.3| unnamed protein product [Vitis vinifera]
Length=106

 Score =   119 bits (297),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 78/84 (93%), Positives = 79/84 (94%), Gaps = 0/84 (0%)
 Frame = +2

Query  125  MTSGTRLPTWkerennkrrerrrraiaakiFAGLRMYGNYKLPKHCDNNEVLKALCKEAG  304
            MTSG RLPTWKERENNKRRERRRRAIAAKIFAGLRMYGNYKLPKHCDNNEVLKALC EAG
Sbjct  1    MTSGARLPTWKERENNKRRERRRRAIAAKIFAGLRMYGNYKLPKHCDNNEVLKALCNEAG  60

Query  305  WIVEEDGTTYRKGCKPTERMDIMG  376
            W VE DGTTYRKGCKP ERMDI+G
Sbjct  61   WTVEPDGTTYRKGCKPVERMDIVG  84



>ref|XP_003540501.1| PREDICTED: BES1/BZR1 homolog protein 4-like isoform X1 [Glycine 
max]
Length=330

 Score =   124 bits (312),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 111/141 (79%), Positives = 116/141 (82%), Gaps = 3/141 (2%)
 Frame = +2

Query  125  MTSGTRLPTWkerennkrrerrrraiaakiFAGLRMYGNYKLPKHCDNNEVLKALCKEAG  304
            MTSG R PTWKERENNKRRERRRRAIAAKIF+GLRMYGNYKLPKHCDNNEVLKALC EAG
Sbjct  1    MTSGARQPTWKERENNKRRERRRRAIAAKIFSGLRMYGNYKLPKHCDNNEVLKALCNEAG  60

Query  305  WIVEEDGTTYRKGCK-PTERMDIMGssvsvspcssyqpsqGpsynpspasssfpspvssR  481
            W VE DGTTYRKGCK P ERMDI+G S + SPCSSY PS   SYNPSP SS  PSP +S 
Sbjct  61   WTVEADGTTYRKGCKPPVERMDIVGGSAAASPCSSYHPSPCASYNPSPGSSCLPSPRASP  120

Query  482  YITNNNNDTDPNSLIPWLKNL  544
            Y  N+N D   NSLIPWLKNL
Sbjct  121  YPPNHNADG--NSLIPWLKNL  139



>ref|XP_006592939.1| PREDICTED: BES1/BZR1 homolog protein 4-like isoform X2 [Glycine 
max]
Length=334

 Score =   124 bits (312),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 111/141 (79%), Positives = 116/141 (82%), Gaps = 3/141 (2%)
 Frame = +2

Query  125  MTSGTRLPTWkerennkrrerrrraiaakiFAGLRMYGNYKLPKHCDNNEVLKALCKEAG  304
            MTSG R PTWKERENNKRRERRRRAIAAKIF+GLRMYGNYKLPKHCDNNEVLKALC EAG
Sbjct  1    MTSGARQPTWKERENNKRRERRRRAIAAKIFSGLRMYGNYKLPKHCDNNEVLKALCNEAG  60

Query  305  WIVEEDGTTYRKGCK-PTERMDIMGssvsvspcssyqpsqGpsynpspasssfpspvssR  481
            W VE DGTTYRKGCK P ERMDI+G S + SPCSSY PS   SYNPSP SS  PSP +S 
Sbjct  61   WTVEADGTTYRKGCKPPVERMDIVGGSAAASPCSSYHPSPCASYNPSPGSSCLPSPRASP  120

Query  482  YITNNNNDTDPNSLIPWLKNL  544
            Y  N+N D   NSLIPWLKNL
Sbjct  121  YPPNHNADG--NSLIPWLKNL  139



>ref|XP_003596275.1| Brassinosteroid signaling positive regulator-related protein 
[Medicago truncatula]
 gb|AES66526.1| brassinazole-resistant 1 protein [Medicago truncatula]
Length=323

 Score =   124 bits (311),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 111/140 (79%), Positives = 117/140 (84%), Gaps = 3/140 (2%)
 Frame = +2

Query  125  MTSGTRLPTWkerennkrrerrrraiaakiFAGLRMYGNYKLPKHCDNNEVLKALCKEAG  304
            MTSGTR PTWKERENNKRRERRRRAIAAKIF+GLRMYGNYKLPKHCDNNEVLKALC EAG
Sbjct  1    MTSGTRQPTWKERENNKRRERRRRAIAAKIFSGLRMYGNYKLPKHCDNNEVLKALCNEAG  60

Query  305  WIVEEDGTTYRKGCKPTERMDIMGssvsvspcssyqpsqGpsynpspasssfpspvssRY  484
            WIVE DGTTYRKGCKP ER+D++G S   SPCSSY  S   SYNPSP SSSFPSP SS  
Sbjct  61   WIVEPDGTTYRKGCKPAERIDVIGGSTMGSPCSSYHVSPCASYNPSPGSSSFPSPRSSHA  120

Query  485  ITNNNNDTDPNSLIPWLKNL  544
            +   N + D NSLIPWLKNL
Sbjct  121  V---NPNGDGNSLIPWLKNL  137



>ref|XP_004244287.1| PREDICTED: BES1/BZR1 homolog protein 4 [Solanum lycopersicum]
Length=315

 Score =   124 bits (310),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 114/140 (81%), Positives = 119/140 (85%), Gaps = 2/140 (1%)
 Frame = +2

Query  125  MTSGTRLPTWkerennkrrerrrraiaakiFAGLRMYGNYKLPKHCDNNEVLKALCKEAG  304
            MTSGTR+PTWKERENNKRRERRRRAIAAKIFAGLRMYGNY+LPKHCDNNEVLKALC EAG
Sbjct  1    MTSGTRMPTWKERENNKRRERRRRAIAAKIFAGLRMYGNYQLPKHCDNNEVLKALCNEAG  60

Query  305  WIVEEDGTTYRKGCKPTERMDIMGssvsvspcssyqpsqGpsynpspasssfpspvssRY  484
            W VE DGTTYRKGCKP ER+D +G S S+SPCSSYQPS   S NPSPASSSFPSP SS Y
Sbjct  61   WTVEPDGTTYRKGCKPMERLDFLGGSTSLSPCSSYQPSPFTSNNPSPASSSFPSPASSSY  120

Query  485  ITNNNNDTDPNSLIPWLKNL  544
              N N D    SLIPWLKNL
Sbjct  121  AANLNMDG--KSLIPWLKNL  138



>ref|XP_006348323.1| PREDICTED: BES1/BZR1 homolog protein 4-like [Solanum tuberosum]
Length=315

 Score =   124 bits (310),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 114/140 (81%), Positives = 119/140 (85%), Gaps = 2/140 (1%)
 Frame = +2

Query  125  MTSGTRLPTWkerennkrrerrrraiaakiFAGLRMYGNYKLPKHCDNNEVLKALCKEAG  304
            MTSGTR+PTWKERENNKRRERRRRAIAAKIFAGLRMYGNY+LPKHCDNNEVLKALC EAG
Sbjct  1    MTSGTRMPTWKERENNKRRERRRRAIAAKIFAGLRMYGNYQLPKHCDNNEVLKALCNEAG  60

Query  305  WIVEEDGTTYRKGCKPTERMDIMGssvsvspcssyqpsqGpsynpspasssfpspvssRY  484
            W VE DGTTYRKGCKP ER+D +G S S+SPCSSYQPS   S NPSPASSSFPSP SS Y
Sbjct  61   WTVELDGTTYRKGCKPVERLDFLGGSTSLSPCSSYQPSPFTSNNPSPASSSFPSPASSSY  120

Query  485  ITNNNNDTDPNSLIPWLKNL  544
              N N D    SLIPWLKNL
Sbjct  121  AANLNMDG--KSLIPWLKNL  138



>ref|XP_010665681.1| PREDICTED: BES1/BZR1 homolog protein 4 [Beta vulgaris subsp. 
vulgaris]
Length=329

 Score =   124 bits (310),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 103/140 (74%), Positives = 115/140 (82%), Gaps = 2/140 (1%)
 Frame = +2

Query  131  SGTRLPTWkerennkrrerrrraiaakiFAGLRMYGNYKLPKHCDNNEVLKALCKEAGWI  310
            +GTR+PTW+ERENNK+RERRRRAIAAKI+ GLRMYGNYKLPKHCDNNEVLKAL +EAGW+
Sbjct  2    TGTRMPTWRERENNKKRERRRRAIAAKIYTGLRMYGNYKLPKHCDNNEVLKALAREAGWV  61

Query  311  VEEDGTTYRKGCKPTERMDIMGssvsvs--pcssyqpsqGpsynpspasssfpspvssRY  484
            VEEDGTTYR+GCKP E +DI+G S SVS        P  G SYNPSPASSSFPSP  S +
Sbjct  62   VEEDGTTYRQGCKPMEPIDIIGGSASVSPCSSYPVSPRAGASYNPSPASSSFPSPAHSYF  121

Query  485  ITNNNNDTDPNSLIPWLKNL  544
              + N  TDPNSLIPWLKNL
Sbjct  122  APSANGTTDPNSLIPWLKNL  141



>ref|XP_003543195.1| PREDICTED: BES1/BZR1 homolog protein 4-like [Glycine max]
Length=325

 Score =   123 bits (309),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 123/154 (80%), Positives = 128/154 (83%), Gaps = 3/154 (2%)
 Frame = +2

Query  125  MTSGTRLPTWkerennkrrerrrraiaakiFAGLRMYGNYKLPKHCDNNEVLKALCKEAG  304
            MTSGTRLPT KERENNKRRERRRRAIAAKIFAGLRMYGN+KLPKHCDNNEVLKALC EAG
Sbjct  1    MTSGTRLPTSKERENNKRRERRRRAIAAKIFAGLRMYGNFKLPKHCDNNEVLKALCNEAG  60

Query  305  WIVEEDGTTYRKGCKPTERMDIMGssvsvspcssyqpsqGpsynpspasssfpspvssRY  484
            W VE DGTTYRKGCKP ERMDI+G S + SPCSSY PS   SYNPSP SSSFPSP SS Y
Sbjct  61   WTVEPDGTTYRKGCKPLERMDIVGGSSAASPCSSYHPSPCASYNPSPGSSSFPSPSSSPY  120

Query  485  ITNNNNDTDPNSLIPWLKNLssgsspsss-KLPH  583
                N D   NSLIPWLKNLS+ SS +SS KLPH
Sbjct  121  TQIPNADG--NSLIPWLKNLSTASSSASSPKLPH  152



>ref|XP_008381083.1| PREDICTED: BES1/BZR1 homolog protein 4 [Malus domestica]
Length=324

 Score =   123 bits (309),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 110/140 (79%), Positives = 115/140 (82%), Gaps = 2/140 (1%)
 Frame = +2

Query  125  MTSGTRLPTWkerennkrrerrrraiaakiFAGLRMYGNYKLPKHCDNNEVLKALCKEAG  304
            MTSGTRLPT KERENNKRRERRRRAIAAKIFAGLRMYGNYKLPKHCDNNEVLKALC EAG
Sbjct  1    MTSGTRLPTSKERENNKRRERRRRAIAAKIFAGLRMYGNYKLPKHCDNNEVLKALCDEAG  60

Query  305  WIVEEDGTTYRKGCKPTERMDIMGssvsvspcssyqpsqGpsynpspasssfpspvssRY  484
            W VE DGTTYRKGCKP ERM++M  S   SP SS+ PS   SYNPSP SSSFPSP SS Y
Sbjct  61   WTVELDGTTYRKGCKPVERMEVMXGSTVASPSSSFHPSNCASYNPSPGSSSFPSPTSSSY  120

Query  485  ITNNNNDTDPNSLIPWLKNL  544
              N N D+   SLIPWL+NL
Sbjct  121  XANQNADS--RSLIPWLRNL  138



>gb|KHN36918.1| BES1/BZR1 like protein 4 [Glycine soja]
Length=331

 Score =   123 bits (308),  Expect = 6e-30, Method: Compositional matrix adjust.
 Identities = 123/154 (80%), Positives = 128/154 (83%), Gaps = 3/154 (2%)
 Frame = +2

Query  125  MTSGTRLPTWkerennkrrerrrraiaakiFAGLRMYGNYKLPKHCDNNEVLKALCKEAG  304
            MTSGTRLPT KERENNKRRERRRRAIAAKIFAGLRMYGN+KLPKHCDNNEVLKALC EAG
Sbjct  1    MTSGTRLPTSKERENNKRRERRRRAIAAKIFAGLRMYGNFKLPKHCDNNEVLKALCNEAG  60

Query  305  WIVEEDGTTYRKGCKPTERMDIMGssvsvspcssyqpsqGpsynpspasssfpspvssRY  484
            W VE DGTTYRKGCKP ERMDI+G S + SPCSSY PS   SYNPSP SSSFPSP SS Y
Sbjct  61   WTVEPDGTTYRKGCKPLERMDIVGGSSAASPCSSYHPSPCASYNPSPGSSSFPSPSSSPY  120

Query  485  ITNNNNDTDPNSLIPWLKNLssgsspsss-KLPH  583
                N D   NSLIPWLKNLS+ SS +SS KLPH
Sbjct  121  TQIPNADG--NSLIPWLKNLSTASSSASSPKLPH  152



>ref|XP_009381197.1| PREDICTED: BES1/BZR1 homolog protein 4-like [Musa acuminata subsp. 
malaccensis]
Length=411

 Score =   124 bits (311),  Expect = 6e-30, Method: Compositional matrix adjust.
 Identities = 111/152 (73%), Positives = 119/152 (78%), Gaps = 4/152 (3%)
 Frame = +2

Query  101  KRNGRRREMTSGTRLPTWkerennkrrerrrraiaakiFAGLRMYGNYKLPKHCDNNEVL  280
            +  G    MTSGTR+PTW+ERENN+RRERRRRAIAA I+AGLRMYGNYKLPKHCDNNEVL
Sbjct  50   EAGGSCEGMTSGTRMPTWRERENNRRRERRRRAIAANIYAGLRMYGNYKLPKHCDNNEVL  109

Query  281  KALCKEAGWIVEEDGTTYRKGCKPT-ERMDIMGssvsvspcssyqpsqGpsynpspasss  457
            KALC EAGW VE DGTTYRKG KP+ E MD++G S S SP SS Q S   SYN SPASSS
Sbjct  110  KALCDEAGWTVEPDGTTYRKGSKPSVECMDVVGGSTSPSPYSSNQASPCASYNHSPASSS  169

Query  458  fpspvssRYITNNNND---TDPNSLIPWLKNL  544
            F SP SS YITN NN     D NSLIPWLKNL
Sbjct  170  FASPASSSYITNTNNSINGADGNSLIPWLKNL  201



>ref|XP_010924706.1| PREDICTED: protein BZR1 homolog 3-like [Elaeis guineensis]
Length=339

 Score =   123 bits (308),  Expect = 7e-30, Method: Compositional matrix adjust.
 Identities = 102/162 (63%), Positives = 109/162 (67%), Gaps = 6/162 (4%)
 Frame = +2

Query  125  MTSGTRLPTWkerennkrrerrrraiaakiFAGLRMYGNYKLPKHCDNNEVLKALCKEAG  304
            M SGTRLPTW+ERENNKRRERRRRAIAAKI+ GLRMYGN+KLPKHCDNNEVLKALC EAG
Sbjct  1    MPSGTRLPTWRERENNKRRERRRRAIAAKIYTGLRMYGNFKLPKHCDNNEVLKALCNEAG  60

Query  305  WIVEEDGTTYRKGCKPTERMDIMGssvsvspcssyqpsqGpsynpspasssfpspvssRY  484
            W VEEDGTTYRKGCKP ERMD+     +     +       +       SS     SS Y
Sbjct  61   WTVEEDGTTYRKGCKPVERMDVGVGGSASPSPCTSYQPSPRASYNHSPPSSSLPSPSSSY  120

Query  485  I-----TNNNNDTDPNSLIPWLKNLssgsspsssKLP-HHLY  592
            I      N N  TD NS IPWLKNLSS SS S  K P HH Y
Sbjct  121  ITNTNNNNANKGTDGNSHIPWLKNLSSASSTSCLKPPNHHFY  162



>ref|XP_009397454.1| PREDICTED: protein BZR1 homolog 2-like [Musa acuminata subsp. 
malaccensis]
Length=337

 Score =   123 bits (308),  Expect = 7e-30, Method: Compositional matrix adjust.
 Identities = 114/158 (72%), Positives = 124/158 (78%), Gaps = 4/158 (3%)
 Frame = +2

Query  125  MTSGTRLPTWkerennkrrerrrraiaakiFAGLRMYGNYKLPKHCDNNEVLKALCKEAG  304
            MTSGTR+PTW+ERENN+RRERRRRA+AAKI+ GLRMYGNYKLPKHCDNNEVLKALC EAG
Sbjct  1    MTSGTRMPTWRERENNRRRERRRRAVAAKIYTGLRMYGNYKLPKHCDNNEVLKALCDEAG  60

Query  305  WIVEEDGTTYRKGCK-PTERMDIMGssvsvspcssyqpsqGpsynpspasssfpspvssR  481
            W VE DGTTYRKGCK P E MDI+G S S SP SS QPS   SYNPSPASSS+ SP SS 
Sbjct  61   WSVEPDGTTYRKGCKPPAEHMDIVGGSNSHSPYSSNQPSPCTSYNPSPASSSYASPASSS  120

Query  482  YITNNNND---TDPNSLIPWLKNLssgsspsssKLPHH  586
            YI   NN     D NSLIPWLKNLSS S+   ++  H 
Sbjct  121  YIVATNNSINAADANSLIPWLKNLSSASTSDLTRFLHQ  158



>ref|XP_008226380.1| PREDICTED: BES1/BZR1 homolog protein 4-like [Prunus mume]
Length=324

 Score =   122 bits (307),  Expect = 7e-30, Method: Compositional matrix adjust.
 Identities = 111/140 (79%), Positives = 114/140 (81%), Gaps = 2/140 (1%)
 Frame = +2

Query  125  MTSGTRLPTWkerennkrrerrrraiaakiFAGLRMYGNYKLPKHCDNNEVLKALCKEAG  304
            MT GTR+PTWKERENNKRRERRRRAIAAKIFAGLRMYGNYKLPKHCDNNEVLKALC EAG
Sbjct  1    MTYGTRMPTWKERENNKRRERRRRAIAAKIFAGLRMYGNYKLPKHCDNNEVLKALCDEAG  60

Query  305  WIVEEDGTTYRKGCKPTERMDIMGssvsvspcssyqpsqGpsynpspasssfpspvssRY  484
            W VE DGTTYRKGCKP E MD++G S   SPCSS  PS   SYNPSP SSSFPSP SS Y
Sbjct  61   WTVEPDGTTYRKGCKPAECMDVVGGSTLASPCSSCHPSTCASYNPSPGSSSFPSPASSSY  120

Query  485  ITNNNNDTDPNSLIPWLKNL  544
              N N D    SLIPWLKNL
Sbjct  121  AANQNADG--RSLIPWLKNL  138



>ref|XP_004294130.1| PREDICTED: BES1/BZR1 homolog protein 4-like [Fragaria vesca subsp. 
vesca]
Length=324

 Score =   122 bits (307),  Expect = 8e-30, Method: Compositional matrix adjust.
 Identities = 112/140 (80%), Positives = 118/140 (84%), Gaps = 2/140 (1%)
 Frame = +2

Query  125  MTSGTRLPTWkerennkrrerrrraiaakiFAGLRMYGNYKLPKHCDNNEVLKALCKEAG  304
            MTSGTRLP+WKERENNKRRERRRRAIAAKIFAGLRMYGNYKLPKHCDNNEVLKALC EAG
Sbjct  1    MTSGTRLPSWKERENNKRRERRRRAIAAKIFAGLRMYGNYKLPKHCDNNEVLKALCNEAG  60

Query  305  WIVEEDGTTYRKGCKPTERMDIMGssvsvspcssyqpsqGpsynpspasssfpspvssRY  484
            W VE DGTTYRKGCKP ERMDI+  S + SPCSSY PS   SYNPSP SSSFPSP SS Y
Sbjct  61   WTVELDGTTYRKGCKPVERMDIVDGSAAASPCSSYHPSNYASYNPSPGSSSFPSPASSSY  120

Query  485  ITNNNNDTDPNSLIPWLKNL  544
              + N   D +SLIPWLK+L
Sbjct  121  AAHQN--VDGSSLIPWLKHL  138



>gb|ABK21940.1| unknown [Picea sitchensis]
Length=367

 Score =   122 bits (306),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 75/84 (89%), Positives = 82/84 (98%), Gaps = 0/84 (0%)
 Frame = +2

Query  125  MTSGTRLPTWkerennkrrerrrraiaakiFAGLRMYGNYKLPKHCDNNEVLKALCKEAG  304
            MTSG+RLPTWKERENNK+RERRRRAIAAKI+AGLRMYGNYKLPKHCDNNEVLKALC EAG
Sbjct  1    MTSGSRLPTWKERENNKKRERRRRAIAAKIYAGLRMYGNYKLPKHCDNNEVLKALCAEAG  60

Query  305  WIVEEDGTTYRKGCKPTERMDIMG  376
            W+VEEDGTTYRKGCKPTER+++ G
Sbjct  61   WMVEEDGTTYRKGCKPTERIEVAG  84



>gb|AES66525.2| brassinazole-resistant 1 protein [Medicago truncatula]
Length=517

 Score =   123 bits (308),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 115/157 (73%), Positives = 124/157 (79%), Gaps = 11/157 (7%)
 Frame = +2

Query  125  MTSGTRLPTWkerennkrrerrrraiaakiFAGLRMYGNYKLPKHCDNNEVLKALCKEAG  304
            MTSGTRLPTWKERENNKRRERRRRAIAAKIF+GLRMYGN++LPKHCDNNEVLKALC EAG
Sbjct  1    MTSGTRLPTWKERENNKRRERRRRAIAAKIFSGLRMYGNFRLPKHCDNNEVLKALCNEAG  60

Query  305  WIVEEDGTTYRKGCKPTERMDIMGssvsvspcssyqpsqGpsynpspasssfpspvssRY  484
            W VE DGTTYRKGCKP E MD++G S + SPC         SY+PSP SSSFPSP SS Y
Sbjct  61   WTVEPDGTTYRKGCKPLENMDMVGGSSAASPC--------SSYHPSPGSSSFPSPSSSPY  112

Query  485  ITNNNNDTDPNSLIPWLKNLssgsspsss-KLPHHLY  592
              N N   D NSLIPWLKNLS+ SS  SS KLPH  +
Sbjct  113  AANRN--ADGNSLIPWLKNLSTASSSGSSPKLPHPYF  147



>ref|XP_003596274.1| Brassinosteroid signaling positive regulator-related protein 
[Medicago truncatula]
Length=447

 Score =   122 bits (307),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 115/157 (73%), Positives = 124/157 (79%), Gaps = 11/157 (7%)
 Frame = +2

Query  125  MTSGTRLPTWkerennkrrerrrraiaakiFAGLRMYGNYKLPKHCDNNEVLKALCKEAG  304
            MTSGTRLPTWKERENNKRRERRRRAIAAKIF+GLRMYGN++LPKHCDNNEVLKALC EAG
Sbjct  1    MTSGTRLPTWKERENNKRRERRRRAIAAKIFSGLRMYGNFRLPKHCDNNEVLKALCNEAG  60

Query  305  WIVEEDGTTYRKGCKPTERMDIMGssvsvspcssyqpsqGpsynpspasssfpspvssRY  484
            W VE DGTTYRKGCKP E MD++G S + SPC         SY+PSP SSSFPSP SS Y
Sbjct  61   WTVEPDGTTYRKGCKPLENMDMVGGSSAASPC--------SSYHPSPGSSSFPSPSSSPY  112

Query  485  ITNNNNDTDPNSLIPWLKNLssgsspsss-KLPHHLY  592
              N N   D NSLIPWLKNLS+ SS  SS KLPH  +
Sbjct  113  AANRN--ADGNSLIPWLKNLSTASSSGSSPKLPHPYF  147



>ref|XP_003540502.1| PREDICTED: BES1/BZR1 homolog protein 4 [Glycine max]
Length=322

 Score =   120 bits (300),  Expect = 6e-29, Method: Compositional matrix adjust.
 Identities = 102/154 (66%), Positives = 114/154 (74%), Gaps = 8/154 (5%)
 Frame = +2

Query  125  MTSGTRLPTWkerennkrrerrrraiaakiFAGLRMYGNYKLPKHCDNNEVLKALCKEAG  304
            MTSGTRLPTWKERENNK+RERRRRAIAAKIFAGLRMYGN+KLPKHCDNNEVLKALC +AG
Sbjct  1    MTSGTRLPTWKERENNKKRERRRRAIAAKIFAGLRMYGNFKLPKHCDNNEVLKALCNKAG  60

Query  305  WIVEEDGTTYRKGCKPTERMDIMGssvsvspcssyqpsqGpsynpspasssfpspvssRY  484
            W VE DGTTYRKGCKP+E M+I+G S + +   S        +    AS +     SS Y
Sbjct  61   WTVEPDGTTYRKGCKPSEGMEIVGGSSAAASPCS------SYHPSPCASYNPSPGSSSPY  114

Query  485  ITNNNNDTDPNSLIPWLKNL-ssgsspsssKLPH  583
             T   N  D NSLIPWLKNL ++ SS SS KLPH
Sbjct  115  YTQIPNP-DGNSLIPWLKNLSTASSSASSPKLPH  147



>ref|XP_010925590.1| PREDICTED: protein BZR1 homolog 3-like [Elaeis guineensis]
Length=337

 Score =   120 bits (301),  Expect = 7e-29, Method: Compositional matrix adjust.
 Identities = 120/161 (75%), Positives = 127/161 (79%), Gaps = 5/161 (3%)
 Frame = +2

Query  125  MTSGTRLPTWkerennkrrerrrraiaakiFAGLRMYGNYKLPKHCDNNEVLKALCKEAG  304
            MTSGTR+PTWKERENNKRRERRRRAIAAKI++GLRM GNYKLPKHCDNNEVLKALC EAG
Sbjct  1    MTSGTRIPTWKERENNKRRERRRRAIAAKIYSGLRMCGNYKLPKHCDNNEVLKALCNEAG  60

Query  305  WIVEEDGTTYRKGCK--PTERMDIMGssvsvspcssyqpsqGpsynpspasssfpspvss  478
            W VE DGTTYRKGCK  P E MD++G S S S CSSYQPS   SYNPSPA SSF SP SS
Sbjct  61   WTVEPDGTTYRKGCKPPPAECMDVVGCSTSPSLCSSYQPSPCASYNPSPALSSFASPASS  120

Query  479  RYITNNNND---TDPNSLIPWLKNLssgsspsssKLPHHLY  592
             YITN +N     D NSLIP LKNLSS  S S+    HHLY
Sbjct  121  SYITNAHNADHFVDGNSLIPRLKNLSSACSASTKFPQHHLY  161



>ref|XP_004309625.1| PREDICTED: BES1/BZR1 homolog protein 4 [Fragaria vesca subsp. 
vesca]
Length=329

 Score =   120 bits (300),  Expect = 7e-29, Method: Compositional matrix adjust.
 Identities = 74/84 (88%), Positives = 81/84 (96%), Gaps = 0/84 (0%)
 Frame = +2

Query  125  MTSGTRLPTWkerennkrrerrrraiaakiFAGLRMYGNYKLPKHCDNNEVLKALCKEAG  304
            MT+GTR+PTWKERENNK+RERRRRAIAAKI++GLRMYGNYKLPKHCDNNEVLKALC EAG
Sbjct  2    MTTGTRMPTWKERENNKKRERRRRAIAAKIYSGLRMYGNYKLPKHCDNNEVLKALCNEAG  61

Query  305  WIVEEDGTTYRKGCKPTERMDIMG  376
            W VEEDGTTYRKGCKP +RMDI+G
Sbjct  62   WTVEEDGTTYRKGCKPVDRMDIIG  85



>gb|ACU18376.1| unknown [Glycine max]
Length=125

 Score =   115 bits (287),  Expect = 7e-29, Method: Compositional matrix adjust.
 Identities = 73/84 (87%), Positives = 80/84 (95%), Gaps = 0/84 (0%)
 Frame = +2

Query  125  MTSGTRLPTWkerennkrrerrrraiaakiFAGLRMYGNYKLPKHCDNNEVLKALCKEAG  304
            MTSGTRLPTWKERENNK+RERRRRAIAAKIFAGLR+YGN+KLPKHCDNNEVLKALC +AG
Sbjct  1    MTSGTRLPTWKERENNKKRERRRRAIAAKIFAGLRVYGNFKLPKHCDNNEVLKALCNKAG  60

Query  305  WIVEEDGTTYRKGCKPTERMDIMG  376
            W VE DGTTYRKGCKP+E M+I+G
Sbjct  61   WTVEPDGTTYRKGCKPSEGMEIVG  84



>ref|XP_009415180.1| PREDICTED: protein BZR1 homolog 3-like [Musa acuminata subsp. 
malaccensis]
Length=337

 Score =   120 bits (301),  Expect = 8e-29, Method: Compositional matrix adjust.
 Identities = 111/162 (69%), Positives = 128/162 (79%), Gaps = 6/162 (4%)
 Frame = +2

Query  125  MTSGTRLPTWkerennkrrerrrraiaakiFAGLRMYGNYKLPKHCDNNEVLKALCKEAG  304
            MTSG+R PTW+ERENNKRRERRRRAIAAK+++GLR+YGNYKLPKHCDNN VL+ALC+EAG
Sbjct  1    MTSGSRTPTWRERENNKRRERRRRAIAAKMYSGLRLYGNYKLPKHCDNNAVLRALCEEAG  60

Query  305  WIVEEDGTTYRKGCKPTERMDIMGssvsvspcssyqpsqG-psynpspasssfpspvssR  481
            W VEEDGTTYRKGCKPTE  D++G S S SP SS        SYNPSPASS+  SP SS 
Sbjct  61   WTVEEDGTTYRKGCKPTEGRDVVGPSASPSPRSSSHQPSPCISYNPSPASSTLASPESST  120

Query  482  YITNNNN---DTDPNSLIPWLKNLssgsspsssKLP--HHLY  592
             +TN  N    T+ NSL+PWLK+LS  SS +SSK+P  HHLY
Sbjct  121  LVTNTKNTASGTEGNSLVPWLKSLSPASSSTSSKIPNIHHLY  162



>ref|XP_006594721.1| PREDICTED: BES1/BZR1 homolog protein 4-like isoform X2 [Glycine 
max]
Length=330

 Score =   119 bits (299),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 109/141 (77%), Positives = 114/141 (81%), Gaps = 3/141 (2%)
 Frame = +2

Query  125  MTSGTRLPTWkerennkrrerrrraiaakiFAGLRMYGNYKLPKHCDNNEVLKALCKEAG  304
            MTS  R PTWKERENNKRRERRRRAIAAKIF+GLRMYGNYKLPKHCDNNEVLKALC EAG
Sbjct  1    MTSVARQPTWKERENNKRRERRRRAIAAKIFSGLRMYGNYKLPKHCDNNEVLKALCNEAG  60

Query  305  WIVEEDGTTYRKGCK-PTERMDIMGssvsvspcssyqpsqGpsynpspasssfpspvssR  481
            W VE DGTTYRKGCK P ERMDI+G S + SPCSSY PS   SYNPSP SS  PSP +S 
Sbjct  61   WTVEADGTTYRKGCKPPVERMDIVGGSAAASPCSSYHPSPCASYNPSPGSSCLPSPRASP  120

Query  482  YITNNNNDTDPNSLIPWLKNL  544
            +  N N D   NSLIPWLKNL
Sbjct  121  FPPNPNADG--NSLIPWLKNL  139



>ref|XP_003543196.1| PREDICTED: BES1/BZR1 homolog protein 4-like isoform X1 [Glycine 
max]
Length=334

 Score =   119 bits (299),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 109/141 (77%), Positives = 114/141 (81%), Gaps = 3/141 (2%)
 Frame = +2

Query  125  MTSGTRLPTWkerennkrrerrrraiaakiFAGLRMYGNYKLPKHCDNNEVLKALCKEAG  304
            MTS  R PTWKERENNKRRERRRRAIAAKIF+GLRMYGNYKLPKHCDNNEVLKALC EAG
Sbjct  1    MTSVARQPTWKERENNKRRERRRRAIAAKIFSGLRMYGNYKLPKHCDNNEVLKALCNEAG  60

Query  305  WIVEEDGTTYRKGCK-PTERMDIMGssvsvspcssyqpsqGpsynpspasssfpspvssR  481
            W VE DGTTYRKGCK P ERMDI+G S + SPCSSY PS   SYNPSP SS  PSP +S 
Sbjct  61   WTVEADGTTYRKGCKPPVERMDIVGGSAAASPCSSYHPSPCASYNPSPGSSCLPSPRASP  120

Query  482  YITNNNNDTDPNSLIPWLKNL  544
            +  N N D   NSLIPWLKNL
Sbjct  121  FPPNPNADG--NSLIPWLKNL  139



>ref|XP_009136969.1| PREDICTED: BES1/BZR1 homolog protein 3-like [Brassica rapa]
Length=276

 Score =   118 bits (296),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 95/141 (67%), Positives = 107/141 (76%), Gaps = 10/141 (7%)
 Frame = +2

Query  125  MTSGTRLPTWkerennkrrerrrraiaakiFAGLRMYGNYKLPKHCDNNEVLKALCKEAG  304
            MTSGTR PTWKERENNKRRERRRRAIAAKIFAGLR++GN+KLPKHCDNNEVLKALC EAG
Sbjct  1    MTSGTRTPTWKERENNKRRERRRRAIAAKIFAGLRIHGNFKLPKHCDNNEVLKALCNEAG  60

Query  305  WIVEEDGTTYRKGCKPTERMDIM-GssvsvspcssyqpsqGpsynpspasssfpspvssR  481
            W VE+DGTTYRKGCKPT+RM++M GS+ +    S     +G         S  PSP SS 
Sbjct  61   WTVEDDGTTYRKGCKPTDRMELMNGSTSASPCSSYQPSPRG---------SYNPSPSSSS  111

Query  482  YITNNNNDTDPNSLIPWLKNL  544
            + +  N   D NSLIPWLKNL
Sbjct  112  FPSPTNPFGDANSLIPWLKNL  132



>emb|CDY01563.1| BnaC07g35530D [Brassica napus]
Length=276

 Score =   118 bits (296),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 95/141 (67%), Positives = 107/141 (76%), Gaps = 10/141 (7%)
 Frame = +2

Query  125  MTSGTRLPTWkerennkrrerrrraiaakiFAGLRMYGNYKLPKHCDNNEVLKALCKEAG  304
            MTSGTR PTWKERENNKRRERRRRAIAAKIFAGLR++GN+KLPKHCDNNEVLKALC EAG
Sbjct  1    MTSGTRTPTWKERENNKRRERRRRAIAAKIFAGLRIHGNFKLPKHCDNNEVLKALCNEAG  60

Query  305  WIVEEDGTTYRKGCKPTERMDIM-GssvsvspcssyqpsqGpsynpspasssfpspvssR  481
            W VE+DGTTYRKGCKPT+RM++M GS+ +    S     +G         S  PSP SS 
Sbjct  61   WTVEDDGTTYRKGCKPTDRMELMNGSTSASPCSSYQPSPRG---------SYNPSPSSSS  111

Query  482  YITNNNNDTDPNSLIPWLKNL  544
            + +  N   D NSLIPWLKNL
Sbjct  112  FPSPTNPFGDANSLIPWLKNL  132



>emb|CDX98592.1| BnaA03g43770D [Brassica napus]
Length=276

 Score =   118 bits (295),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 95/141 (67%), Positives = 107/141 (76%), Gaps = 10/141 (7%)
 Frame = +2

Query  125  MTSGTRLPTWkerennkrrerrrraiaakiFAGLRMYGNYKLPKHCDNNEVLKALCKEAG  304
            MTSGTR PTWKERENNKRRERRRRAIAAKIFAGLR++GN+KLPKHCDNNEVLKALC EAG
Sbjct  1    MTSGTRTPTWKERENNKRRERRRRAIAAKIFAGLRIHGNFKLPKHCDNNEVLKALCNEAG  60

Query  305  WIVEEDGTTYRKGCKPTERMDIM-GssvsvspcssyqpsqGpsynpspasssfpspvssR  481
            W VE+DGTTYRKGCKPT+RM++M GS+ +    S     +G         S  PSP SS 
Sbjct  61   WTVEDDGTTYRKGCKPTDRMELMNGSTSASPCSSYQPSPRG---------SYNPSPSSSS  111

Query  482  YITNNNNDTDPNSLIPWLKNL  544
            + +  N   D NSLIPWLKNL
Sbjct  112  FPSPTNPFGDANSLIPWLKNL  132



>ref|XP_011082785.1| PREDICTED: BES1/BZR1 homolog protein 4 [Sesamum indicum]
 ref|XP_011082786.1| PREDICTED: BES1/BZR1 homolog protein 4 [Sesamum indicum]
Length=325

 Score =   118 bits (296),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 112/140 (80%), Positives = 121/140 (86%), Gaps = 2/140 (1%)
 Frame = +2

Query  125  MTSGTRLPTWkerennkrrerrrraiaakiFAGLRMYGNYKLPKHCDNNEVLKALCKEAG  304
            MT GTR+P+WKERENNKRRERRRRAIAAKIFAGLR+YGNYKLPKHCDNNEVLKALC EAG
Sbjct  1    MTGGTRMPSWKERENNKRRERRRRAIAAKIFAGLRLYGNYKLPKHCDNNEVLKALCDEAG  60

Query  305  WIVEEDGTTYRKGCKPTERMDIMGssvsvspcssyqpsqGpsynpspasssfpspvssRY  484
            W VE DGTTYRKGC+P E MDI+G S SV+PCSSYQPS   SYNPSPASSSFPSPVSS Y
Sbjct  61   WTVEPDGTTYRKGCRPAENMDILGGSASVTPCSSYQPSPHTSYNPSPASSSFPSPVSSAY  120

Query  485  ITNNNNDTDPNSLIPWLKNL  544
              + +   D NSLIPWL+NL
Sbjct  121  --DPSIVADGNSLIPWLRNL  138



>ref|XP_009388695.1| PREDICTED: protein BZR1 homolog 3-like [Musa acuminata subsp. 
malaccensis]
Length=337

 Score =   119 bits (297),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 115/158 (73%), Positives = 126/158 (80%), Gaps = 4/158 (3%)
 Frame = +2

Query  125  MTSGTRLPTWkerennkrrerrrraiaakiFAGLRMYGNYKLPKHCDNNEVLKALCKEAG  304
            MTS +R+PTW+ERENN+RRERRRRAIAAKI+AGLRMYGNY+LPKHCDNNEVLKALC EAG
Sbjct  1    MTSRSRMPTWRERENNRRRERRRRAIAAKIYAGLRMYGNYRLPKHCDNNEVLKALCDEAG  60

Query  305  WIVEEDGTTYRKGCK-PTERMDIMGssvsvspcssyqpsqGpsynpspasssfpspvssR  481
            WIVE DGTTYRKGCK P + MD++G S S SP SS QPS   SYNPSPASSS+ SP SS 
Sbjct  61   WIVEPDGTTYRKGCKPPADHMDVVGGSTSPSPYSSNQPSPCASYNPSPASSSYASPASSS  120

Query  482  YITNNNND---TDPNSLIPWLKNLssgsspsssKLPHH  586
            YI   NN     D NSLIPWLKNLSS SS   SK+ H 
Sbjct  121  YIATANNSINGADANSLIPWLKNLSSASSSGPSKILHQ  158



>ref|XP_006284265.1| hypothetical protein CARUB_v10005431mg [Capsella rubella]
 gb|EOA17163.1| hypothetical protein CARUB_v10005431mg [Capsella rubella]
Length=284

 Score =   117 bits (293),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 100/140 (71%), Positives = 109/140 (78%), Gaps = 8/140 (6%)
 Frame = +2

Query  125  MTSGTRLPTWkerennkrrerrrraiaakiFAGLRMYGNYKLPKHCDNNEVLKALCKEAG  304
            MTSGTR PTWKERENNKRRERRRRAIAAKIFAGLR++GN+KLPKHCDNNEVLKALC EAG
Sbjct  1    MTSGTRTPTWKERENNKRRERRRRAIAAKIFAGLRIHGNFKLPKHCDNNEVLKALCNEAG  60

Query  305  WIVEEDGTTYRKGCKPTERMDIMGssvsvspcssyqpsqGpsynpspasssfpspvssRY  484
            W VEEDGTTYRKGCKP +RM++M  S S SPC         SY  SP +S  PSP SS +
Sbjct  61   WTVEEDGTTYRKGCKPMDRMELMNGSTSASPC--------SSYQHSPRASYNPSPSSSSF  112

Query  485  ITNNNNDTDPNSLIPWLKNL  544
             +  N   D NSLIPWLKNL
Sbjct  113  PSPTNPFGDANSLIPWLKNL  132



>ref|NP_193624.1| BES1/BZR1-like protein 3 [Arabidopsis thaliana]
 sp|O49404.1|BEH3_ARATH RecName: Full=BES1/BZR1 homolog protein 3 [Arabidopsis thaliana]
 emb|CAA16746.1| putative protein [Arabidopsis thaliana]
 emb|CAB78891.1| putative protein [Arabidopsis thaliana]
 gb|AAM65918.1| unknown [Arabidopsis thaliana]
 dbj|BAC43438.1| unknown protein [Arabidopsis thaliana]
 gb|ABD19693.1| At4g18890 [Arabidopsis thaliana]
 gb|AEE84102.1| BES1/BZR1-like protein 3 [Arabidopsis thaliana]
Length=284

 Score =   117 bits (293),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 100/140 (71%), Positives = 109/140 (78%), Gaps = 8/140 (6%)
 Frame = +2

Query  125  MTSGTRLPTWkerennkrrerrrraiaakiFAGLRMYGNYKLPKHCDNNEVLKALCKEAG  304
            MTSGTR PTWKERENNKRRERRRRAIAAKIFAGLR++GN+KLPKHCDNNEVLKALC EAG
Sbjct  1    MTSGTRTPTWKERENNKRRERRRRAIAAKIFAGLRIHGNFKLPKHCDNNEVLKALCNEAG  60

Query  305  WIVEEDGTTYRKGCKPTERMDIMGssvsvspcssyqpsqGpsynpspasssfpspvssRY  484
            W VE+DGTTYRKGCKP +RMD+M  S S SPC         SY  SP +S  PSP SS +
Sbjct  61   WTVEDDGTTYRKGCKPMDRMDLMNGSTSASPC--------SSYQHSPRASYNPSPSSSSF  112

Query  485  ITNNNNDTDPNSLIPWLKNL  544
             +  N   D NSLIPWLKNL
Sbjct  113  PSPTNPFGDANSLIPWLKNL  132



>ref|XP_009132289.1| PREDICTED: BES1/BZR1 homolog protein 3 [Brassica rapa]
 emb|CDX78903.1| BnaA01g09700D [Brassica napus]
Length=276

 Score =   117 bits (292),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 95/141 (67%), Positives = 106/141 (75%), Gaps = 10/141 (7%)
 Frame = +2

Query  125  MTSGTRLPTWkerennkrrerrrraiaakiFAGLRMYGNYKLPKHCDNNEVLKALCKEAG  304
            MTSGTR PTWKERENNKRRERRRRAIAAKIFAGLR++GN+KLPKHCDNNEVLKALC EAG
Sbjct  1    MTSGTRTPTWKERENNKRRERRRRAIAAKIFAGLRIHGNFKLPKHCDNNEVLKALCNEAG  60

Query  305  WIVEEDGTTYRKGCKPTERMDIM-GssvsvspcssyqpsqGpsynpspasssfpspvssR  481
            W VEEDGTTYRKGCKP +RM++M GS+ +    S     +G         S  PSP SS 
Sbjct  61   WTVEEDGTTYRKGCKPMDRMELMNGSTSASPCSSYQPSPRG---------SYNPSPSSSS  111

Query  482  YITNNNNDTDPNSLIPWLKNL  544
            + +  N   D NSLIPWLKNL
Sbjct  112  FPSPTNIFGDANSLIPWLKNL  132



>ref|XP_010429699.1| PREDICTED: BES1/BZR1 homolog protein 4-like [Camelina sativa]
Length=325

 Score =   118 bits (295),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 118/160 (74%), Positives = 131/160 (82%), Gaps = 6/160 (4%)
 Frame = +2

Query  125  MTSGTRLPTWkerennkrrerrrraiaakiFAGLRMYGNYKLPKHCDNNEVLKALCKEAG  304
            MTSGTR+PTW+ERENNKRRERRRRAIAAKIF GLRMYGNY+LPKHCDNNEVLKALC EAG
Sbjct  1    MTSGTRMPTWRERENNKRRERRRRAIAAKIFTGLRMYGNYELPKHCDNNEVLKALCNEAG  60

Query  305  WIVEEDGTTYRKGC-KPTERMDIMGssvsvspcssyqpsqGpsynpspasssfpspvssR  481
            WIVE DGTTYRKGC +P ERM+I G S + SPCSSYQPS   SYNPSPASS+F SP SS 
Sbjct  61   WIVEPDGTTYRKGCSRPVERMEIGGGSATASPCSSYQPSPCASYNPSPASSNFMSPASSS  120

Query  482  YITNNNNDTDPNSLIPWLKNL---ssgsspsssKLPHHLY  592
            +   N    D  SLIPWLK+L   SS S+ SSS+LP++LY
Sbjct  121  FA--NLTSGDGQSLIPWLKHLSTTSSSSASSSSRLPNYLY  158



>ref|XP_010062789.1| PREDICTED: BES1/BZR1 homolog protein 4-like [Eucalyptus grandis]
 gb|KCW69907.1| hypothetical protein EUGRSUZ_F03236 [Eucalyptus grandis]
Length=320

 Score =   117 bits (294),  Expect = 5e-28, Method: Compositional matrix adjust.
 Identities = 105/154 (68%), Positives = 117/154 (76%), Gaps = 7/154 (5%)
 Frame = +2

Query  125  MTSGTRLPTWkerennkrrerrrraiaakiFAGLRMYGNYKLPKHCDNNEVLKALCKEAG  304
            MTSG+R+PTW+ERENNKRRERRRRA+AAKIF+GLRMYGNYKLPKHCDNNEVLKALC EAG
Sbjct  1    MTSGSRMPTWRERENNKRRERRRRAVAAKIFSGLRMYGNYKLPKHCDNNEVLKALCDEAG  60

Query  305  WIVEEDGTTYRKGCKPTERMDIMGssvsvspcssyqpsqGpsynpspasssfpspvssRY  484
            WIVE DGTTYRKGCKP E +D++  S +VSP SSY P+  PS   S   S   S     Y
Sbjct  61   WIVEADGTTYRKGCKPVEHVDMVARSETVSPSSSYYPTHNPSPGSSSFPSPASSF----Y  116

Query  485  ITNNNNDTDPNSLIPWLKNL-ssgsspsssKLPH  583
              N N D   + LIPWLKN  S+ SS SSSKLPH
Sbjct  117  AANANADG--SFLIPWLKNFSSASSSASSSKLPH  148



>ref|XP_010417476.1| PREDICTED: BES1/BZR1 homolog protein 4 [Camelina sativa]
Length=325

 Score =   117 bits (294),  Expect = 5e-28, Method: Compositional matrix adjust.
 Identities = 118/160 (74%), Positives = 131/160 (82%), Gaps = 6/160 (4%)
 Frame = +2

Query  125  MTSGTRLPTWkerennkrrerrrraiaakiFAGLRMYGNYKLPKHCDNNEVLKALCKEAG  304
            MTSGTR+PTW+ERENNKRRERRRRAIAAKIF GLRMYGNY+LPKHCDNNEVLKALC EAG
Sbjct  1    MTSGTRMPTWRERENNKRRERRRRAIAAKIFTGLRMYGNYELPKHCDNNEVLKALCNEAG  60

Query  305  WIVEEDGTTYRKGC-KPTERMDIMGssvsvspcssyqpsqGpsynpspasssfpspvssR  481
            WIVE DGTTYRKGC +P ERM+I G S + SPCSSYQPS   SYNPSPASS+F SP SS 
Sbjct  61   WIVEPDGTTYRKGCSRPVERMEIGGGSATASPCSSYQPSPCASYNPSPASSNFMSPASSS  120

Query  482  YITNNNNDTDPNSLIPWLKNL---ssgsspsssKLPHHLY  592
            +   N    D  SLIPWLK+L   SS S+ SSS+LP++LY
Sbjct  121  FA--NLTSGDGQSLIPWLKHLSTTSSSSASSSSRLPNYLY  158



>ref|XP_010088009.1| hypothetical protein L484_004599 [Morus notabilis]
 gb|EXB31125.1| hypothetical protein L484_004599 [Morus notabilis]
Length=368

 Score =   118 bits (296),  Expect = 5e-28, Method: Compositional matrix adjust.
 Identities = 130/180 (72%), Positives = 138/180 (77%), Gaps = 24/180 (13%)
 Frame = +2

Query  125  MTSGTRLPTWkerennkrrerrrraiaakiFAGLRMYGNYKLPKHCDNNEVLKALCKEAG  304
            MTSGTR+PTWKERENNKRRERRRRAIAAKI+ GLR YGNYKLPKHCDNNEVLKALC EAG
Sbjct  1    MTSGTRMPTWKERENNKRRERRRRAIAAKIYTGLRKYGNYKLPKHCDNNEVLKALCNEAG  60

Query  305  WIVEEDGTTYRK---------------------GCKPT-ERMDIMGssvsvspcssyqps  418
            W VEEDGTTYRK                     G KP  +RMDIMG S S SPCSSYQPS
Sbjct  61   WTVEEDGTTYRKIPGGKFHYPFFSFDLETMHMMGSKPVLDRMDIMGGSTSASPCSSYQPS  120

Query  419  qGpsynpspasssfpspvssRYITN-NNNDTDPNSLIPWLKNL-ssgsspsssKLPHHLY  592
               SYNPSPASSSFPSPVSS Y T+ NN + DPNSLIPWLKNL SSGSS ++SK PHHL+
Sbjct  121  PCASYNPSPASSSFPSPVSSHYKTSTNNTNHDPNSLIPWLKNLSSSGSSSATSKFPHHLF  180



>ref|XP_010537716.1| PREDICTED: BES1/BZR1 homolog protein 4 [Tarenaya hassleriana]
Length=309

 Score =   117 bits (293),  Expect = 5e-28, Method: Compositional matrix adjust.
 Identities = 73/81 (90%), Positives = 77/81 (95%), Gaps = 0/81 (0%)
 Frame = +2

Query  125  MTSGTRLPTWkerennkrrerrrraiaakiFAGLRMYGNYKLPKHCDNNEVLKALCKEAG  304
            MTSGTR+PTW+ERENNKRRERRRRA+AAKIFAGLRMYGNYKLPKHCDNNEVLKALC EAG
Sbjct  1    MTSGTRMPTWRERENNKRRERRRRAMAAKIFAGLRMYGNYKLPKHCDNNEVLKALCNEAG  60

Query  305  WIVEEDGTTYRKGCKPTERMD  367
            WIVE DGTTYRKGCKP ER +
Sbjct  61   WIVEPDGTTYRKGCKPVERTN  81



>ref|XP_006389963.1| hypothetical protein EUTSA_v10018888mg [Eutrema salsugineum]
 gb|ESQ27249.1| hypothetical protein EUTSA_v10018888mg [Eutrema salsugineum]
Length=319

 Score =   117 bits (293),  Expect = 6e-28, Method: Compositional matrix adjust.
 Identities = 115/159 (72%), Positives = 129/159 (81%), Gaps = 5/159 (3%)
 Frame = +2

Query  125  MTSGTRLPTWkerennkrrerrrraiaakiFAGLRMYGNYKLPKHCDNNEVLKALCKEAG  304
            MTSGTR+PTW+ERENNKRRERRRRAIAAKIF GLRM+GNY+LPKHCDNNEVLKALC EAG
Sbjct  1    MTSGTRMPTWRERENNKRRERRRRAIAAKIFTGLRMFGNYELPKHCDNNEVLKALCNEAG  60

Query  305  WIVEEDGTTYRKGCKPTERMDIMGssvsvspcssyqpsqGpsynpspasssfpspvssRY  484
            WIVE DGTTYRKG +P ERM+I G S + SPCSSYQPS   SYNPSP SS+F SP SS +
Sbjct  61   WIVEPDGTTYRKGSRPVERMEIGGGSATASPCSSYQPSPCASYNPSPGSSNFMSPASSSF  120

Query  485  ITNNNNDTDPNSLIPWLKNL---ssgsspsssKLPHHLY  592
               N    D  SLIPWLK+L   SS S+ SSS+LP++LY
Sbjct  121  --PNLTSGDGQSLIPWLKHLSTTSSSSASSSSRLPNYLY  157



>ref|NP_565187.1| BES1/BZR1 homolog 4 [Arabidopsis thaliana]
 sp|Q9ZV88.1|BEH4_ARATH RecName: Full=BES1/BZR1 homolog protein 4 [Arabidopsis thaliana]
 gb|AAC83038.1| EST gb|R30300 comes from this gene [Arabidopsis thaliana]
 gb|AAK91446.1| At1g78700/F9K20_26 [Arabidopsis thaliana]
 gb|AAL90992.1| At1g78700/F9K20_26 [Arabidopsis thaliana]
 gb|AEE36140.1| BES1/BZR1 homolog 4 [Arabidopsis thaliana]
Length=325

 Score =   117 bits (293),  Expect = 7e-28, Method: Compositional matrix adjust.
 Identities = 117/160 (73%), Positives = 130/160 (81%), Gaps = 6/160 (4%)
 Frame = +2

Query  125  MTSGTRLPTWkerennkrrerrrraiaakiFAGLRMYGNYKLPKHCDNNEVLKALCKEAG  304
            MTSGTR+PTW+ERENNKRRERRRRAIAAKIF GLRMYGNY+LPKHCDNNEVLKALC EAG
Sbjct  1    MTSGTRMPTWRERENNKRRERRRRAIAAKIFTGLRMYGNYELPKHCDNNEVLKALCNEAG  60

Query  305  WIVEEDGTTYRKGC-KPTERMDIMGssvsvspcssyqpsqGpsynpspasssfpspvssR  481
            WIVE DGTTYRKGC +P ERM+I G S + SPCSSYQPS   SYNPSP SS+F SP SS 
Sbjct  61   WIVEPDGTTYRKGCSRPVERMEIGGGSATASPCSSYQPSPCASYNPSPGSSNFMSPASSS  120

Query  482  YITNNNNDTDPNSLIPWLKNL---ssgsspsssKLPHHLY  592
            +   N    D  SLIPWLK+L   SS S+ SSS+LP++LY
Sbjct  121  FA--NLTSGDGQSLIPWLKHLSTTSSSSASSSSRLPNYLY  158



>gb|KFK28557.1| hypothetical protein AALP_AA7G011700 [Arabis alpina]
Length=284

 Score =   116 bits (290),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 100/140 (71%), Positives = 110/140 (79%), Gaps = 8/140 (6%)
 Frame = +2

Query  125  MTSGTRLPTWkerennkrrerrrraiaakiFAGLRMYGNYKLPKHCDNNEVLKALCKEAG  304
            MTSGTR PTWKERENNKRRERRRRAIAAKIFAGLR++GN+KLPKHCDNNEVLKALC EAG
Sbjct  1    MTSGTRTPTWKERENNKRRERRRRAIAAKIFAGLRIHGNFKLPKHCDNNEVLKALCTEAG  60

Query  305  WIVEEDGTTYRKGCKPTERMDIMGssvsvspcssyqpsqGpsynpspasssfpspvssRY  484
            W VE+DGTTYRKGCKP +RM++M  S S SPC         SY PSP +S  PSP SS +
Sbjct  61   WTVEDDGTTYRKGCKPMDRMELMNGSTSASPC--------SSYQPSPRASYNPSPSSSSF  112

Query  485  ITNNNNDTDPNSLIPWLKNL  544
             +  N   D NSLIPWLKNL
Sbjct  113  ASPTNPFGDANSLIPWLKNL  132



>ref|XP_002887754.1| hypothetical protein ARALYDRAFT_895772 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH64013.1| hypothetical protein ARALYDRAFT_895772 [Arabidopsis lyrata subsp. 
lyrata]
Length=324

 Score =   116 bits (291),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 115/160 (72%), Positives = 129/160 (81%), Gaps = 6/160 (4%)
 Frame = +2

Query  125  MTSGTRLPTWkerennkrrerrrraiaakiFAGLRMYGNYKLPKHCDNNEVLKALCKEAG  304
            MTSGTR+PTW+ERENNKRRERRRRAIAAKIF GLRMYGNY+LPKHCDNNEVLKALC EAG
Sbjct  1    MTSGTRMPTWRERENNKRRERRRRAIAAKIFTGLRMYGNYELPKHCDNNEVLKALCNEAG  60

Query  305  WIVEEDGTTYRKGC-KPTERMDIMGssvsvspcssyqpsqGpsynpspasssfpspvssR  481
            WIVE DGTTYRKGC +P ERM++ G S + SPCSSYQPS   SYNPSP  S+F SP SS 
Sbjct  61   WIVEPDGTTYRKGCSRPVERMEVGGGSATASPCSSYQPSPCASYNPSPGPSNFMSPASSS  120

Query  482  YITNNNNDTDPNSLIPWLKNL---ssgsspsssKLPHHLY  592
            +   N    D  SLIPWLK+L   SS S+ SSS+LP++LY
Sbjct  121  FA--NLTSGDGQSLIPWLKHLSTTSSSSASSSSRLPNYLY  158



>ref|XP_010434483.1| PREDICTED: BES1/BZR1 homolog protein 3 [Camelina sativa]
 ref|XP_010439796.1| PREDICTED: BES1/BZR1 homolog protein 3 [Camelina sativa]
 ref|XP_010449452.1| PREDICTED: BES1/BZR1 homolog protein 3 [Camelina sativa]
Length=284

 Score =   115 bits (288),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 99/140 (71%), Positives = 109/140 (78%), Gaps = 8/140 (6%)
 Frame = +2

Query  125  MTSGTRLPTWkerennkrrerrrraiaakiFAGLRMYGNYKLPKHCDNNEVLKALCKEAG  304
            MTSGTR PTWKERENNKRRERRRRAIAAKIFAGLR++GN+KLPKHCDNNEVLKALC EAG
Sbjct  1    MTSGTRTPTWKERENNKRRERRRRAIAAKIFAGLRIHGNFKLPKHCDNNEVLKALCNEAG  60

Query  305  WIVEEDGTTYRKGCKPTERMDIMGssvsvspcssyqpsqGpsynpspasssfpspvssRY  484
            W VE+DGTTYRKGCKP +RM++M  S S SPC         SY  SP +S  PSP SS +
Sbjct  61   WTVEDDGTTYRKGCKPMDRMELMNGSTSASPC--------SSYQHSPRASYNPSPSSSSF  112

Query  485  ITNNNNDTDPNSLIPWLKNL  544
             +  N   D NSLIPWLKNL
Sbjct  113  PSPTNPFGDANSLIPWLKNL  132



>ref|XP_006302567.1| hypothetical protein CARUB_v10020674mg [Capsella rubella]
 gb|EOA35465.1| hypothetical protein CARUB_v10020674mg [Capsella rubella]
Length=317

 Score =   115 bits (289),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 112/160 (70%), Positives = 123/160 (77%), Gaps = 14/160 (9%)
 Frame = +2

Query  125  MTSGTRLPTWkerennkrrerrrraiaakiFAGLRMYGNYKLPKHCDNNEVLKALCKEAG  304
            MTSGTR+PTW+ERENNKRRERRRRAIAAKIF GLRMYGNY+LPKHCDNNEVLKALC EAG
Sbjct  1    MTSGTRMPTWRERENNKRRERRRRAIAAKIFTGLRMYGNYELPKHCDNNEVLKALCNEAG  60

Query  305  WIVEEDGTTYRKGC-KPTERMDIMGssvsvspcssyqpsqGpsynpspasssfpspvssR  481
            WIVE DGTTYRKGC +P ERM+I G S + SPCSSYQPS   S   SPASSSF       
Sbjct  61   WIVELDGTTYRKGCSRPVERMEIGGGSATASPCSSYQPSPASSNFMSPASSSFA------  114

Query  482  YITNNNNDTDPNSLIPWLKNL---ssgsspsssKLPHHLY  592
                N    D  SLIPWLK+L   SS S+ SSS+LP++LY
Sbjct  115  ----NLTSGDGQSLIPWLKHLSTTSSSSASSSSRLPNYLY  150



>ref|XP_006414043.1| hypothetical protein EUTSA_v10025918mg [Eutrema salsugineum]
 gb|ESQ55496.1| hypothetical protein EUTSA_v10025918mg [Eutrema salsugineum]
Length=285

 Score =   115 bits (287),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 93/141 (66%), Positives = 106/141 (75%), Gaps = 10/141 (7%)
 Frame = +2

Query  125  MTSGTRLPTWkerennkrrerrrraiaakiFAGLRMYGNYKLPKHCDNNEVLKALCKEAG  304
            MTSGTR PTWKERENNKRRERRRRAIAAKIF+GLR++GN+KLPKHCDNNEVLKALC EAG
Sbjct  1    MTSGTRTPTWKERENNKRRERRRRAIAAKIFSGLRIHGNFKLPKHCDNNEVLKALCNEAG  60

Query  305  WIVEEDGTTYRKGCKPTERMDIM-GssvsvspcssyqpsqGpsynpspasssfpspvssR  481
            W VE+DGTTYRKGCKP +RM++M GS+ +    S     +G         S  PSP SS 
Sbjct  61   WTVEDDGTTYRKGCKPMDRMELMNGSTSASPCSSYQPSPRG---------SYNPSPSSSS  111

Query  482  YITNNNNDTDPNSLIPWLKNL  544
            + +  N   D NSLIPWLKNL
Sbjct  112  FPSPTNPFGDANSLIPWLKNL  132



>ref|XP_002870016.1| hypothetical protein ARALYDRAFT_492971 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH46275.1| hypothetical protein ARALYDRAFT_492971 [Arabidopsis lyrata subsp. 
lyrata]
Length=284

 Score =   114 bits (285),  Expect = 5e-27, Method: Compositional matrix adjust.
 Identities = 98/140 (70%), Positives = 109/140 (78%), Gaps = 8/140 (6%)
 Frame = +2

Query  125  MTSGTRLPTWkerennkrrerrrraiaakiFAGLRMYGNYKLPKHCDNNEVLKALCKEAG  304
            MTSGTR PTWKERENNKRRERRRRAIAAKIFAGLR++GN+KLPKHCDNNEVLKALC EAG
Sbjct  1    MTSGTRTPTWKERENNKRRERRRRAIAAKIFAGLRIHGNFKLPKHCDNNEVLKALCNEAG  60

Query  305  WIVEEDGTTYRKGCKPTERMDIMGssvsvspcssyqpsqGpsynpspasssfpspvssRY  484
            W VE+DGTTYRKGC+P +RM++M  S S SPC         SY  SP +S  PSP SS +
Sbjct  61   WTVEDDGTTYRKGCRPMDRMELMNGSTSASPC--------SSYQHSPRASYNPSPSSSTF  112

Query  485  ITNNNNDTDPNSLIPWLKNL  544
             +  N   D NSLIPWLKNL
Sbjct  113  PSPTNPFGDANSLIPWLKNL  132



>ref|XP_010472705.1| PREDICTED: BES1/BZR1 homolog protein 4-like [Camelina sativa]
Length=325

 Score =   114 bits (285),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 116/160 (73%), Positives = 129/160 (81%), Gaps = 6/160 (4%)
 Frame = +2

Query  125  MTSGTRLPTWkerennkrrerrrraiaakiFAGLRMYGNYKLPKHCDNNEVLKALCKEAG  304
            MTSGTR+PTW+ERENNKRRERRRRAIAAKIF GLRMYGNY+LPKHCDNNEVLKALC EAG
Sbjct  1    MTSGTRMPTWRERENNKRRERRRRAIAAKIFTGLRMYGNYELPKHCDNNEVLKALCNEAG  60

Query  305  WIVEEDGTTYRKG-CKPTERMDIMGssvsvspcssyqpsqGpsynpspasssfpspvssR  481
            WIVE DGTTYRKG  +P ERM+I G S + SPCSSYQPS   SYNPSP SS+F SP SS 
Sbjct  61   WIVEPDGTTYRKGSSRPVERMEIGGGSATASPCSSYQPSPCASYNPSPVSSNFMSPASSS  120

Query  482  YITNNNNDTDPNSLIPWLKNL---ssgsspsssKLPHHLY  592
            +   N    D  SLIPWLK+L   SS S+ SSS+LP++LY
Sbjct  121  FA--NLTSGDGQSLIPWLKHLSTTSSSSASSSSRLPNYLY  158



>ref|XP_002983955.1| hypothetical protein SELMODRAFT_451483 [Selaginella moellendorffii]
 gb|EFJ14967.1| hypothetical protein SELMODRAFT_451483 [Selaginella moellendorffii]
Length=531

 Score =   115 bits (289),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 70/82 (85%), Positives = 77/82 (94%), Gaps = 0/82 (0%)
 Frame = +2

Query  125  MTSGTRLPTWkerennkrrerrrraiaakiFAGLRMYGNYKLPKHCDNNEVLKALCKEAG  304
            MTSG RLPTWKERENNK+RERRRRAIA+KIF+GLR +GNYKLPKHCDNNEVLKALC EAG
Sbjct  1    MTSGARLPTWKERENNKKRERRRRAIASKIFSGLRQFGNYKLPKHCDNNEVLKALCAEAG  60

Query  305  WIVEEDGTTYRKGCKPTERMDI  370
            W+VEEDGTTYRKG KP ERM++
Sbjct  61   WVVEEDGTTYRKGAKPVERMEV  82



>ref|XP_002960716.1| hypothetical protein SELMODRAFT_437216 [Selaginella moellendorffii]
 gb|EFJ38255.1| hypothetical protein SELMODRAFT_437216 [Selaginella moellendorffii]
Length=530

 Score =   115 bits (289),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 70/82 (85%), Positives = 77/82 (94%), Gaps = 0/82 (0%)
 Frame = +2

Query  125  MTSGTRLPTWkerennkrrerrrraiaakiFAGLRMYGNYKLPKHCDNNEVLKALCKEAG  304
            MTSG RLPTWKERENNK+RERRRRAIA+KIF+GLR +GNYKLPKHCDNNEVLKALC EAG
Sbjct  1    MTSGARLPTWKERENNKKRERRRRAIASKIFSGLRQFGNYKLPKHCDNNEVLKALCAEAG  60

Query  305  WIVEEDGTTYRKGCKPTERMDI  370
            W+VEEDGTTYRKG KP ERM++
Sbjct  61   WVVEEDGTTYRKGAKPVERMEV  82



>ref|XP_008792311.1| PREDICTED: protein BZR1 homolog 3-like [Phoenix dactylifera]
Length=339

 Score =   112 bits (281),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 94/161 (58%), Positives = 103/161 (64%), Gaps = 5/161 (3%)
 Frame = +2

Query  125  MTSGTRLPTWkerennkrrerrrraiaakiFAGLRMYGNYKLPKHCDNNEVLKALCKEAG  304
            M SG RLPTW+ERENNKRRERRRRAIAAKI+ GLR YG++KLPKHCDNNEVLKALC EAG
Sbjct  1    MPSGARLPTWRERENNKRRERRRRAIAAKIYTGLRAYGDFKLPKHCDNNEVLKALCNEAG  60

Query  305  WIVEEDGTTYRKGCKPTERMDIMGssvsvspcssyqpsqGpsynpspasssfpspvssRY  484
            W VEEDGTTYR G KP  R+D      +     +       +       SS     SS Y
Sbjct  61   WTVEEDGTTYRTGSKPAARVDAAAGGSASPSPCTSYQPSPRASYNPSPPSSSFPSPSSSY  120

Query  485  IT---NNNNDTDPNSLIPWLKNLssgsspsssKLP--HHLY  592
            +T   N N   D  SLIPWLKNLSS SS SS   P  HH Y
Sbjct  121  VTHAHNANQGADGTSLIPWLKNLSSASSTSSLNPPSHHHFY  161



>ref|XP_008790049.1| PREDICTED: protein BZR1 homolog 3-like [Phoenix dactylifera]
Length=315

 Score =   112 bits (279),  Expect = 5e-26, Method: Compositional matrix adjust.
 Identities = 76/86 (88%), Positives = 79/86 (92%), Gaps = 2/86 (2%)
 Frame = +2

Query  125  MTSGTRLPTWkerennkrrerrrraiaakiFAGLRMYGNYKLPKHCDNNEVLKALCKEAG  304
            MTSGTRLPTWKERENNKRRERRRRAIAAKI+ GLRMYGNYKLPKHCDNNEVLKALC EAG
Sbjct  1    MTSGTRLPTWKERENNKRRERRRRAIAAKIYTGLRMYGNYKLPKHCDNNEVLKALCNEAG  60

Query  305  WIVEEDGTTYRKGCK--PTERMDIMG  376
            WIVE DGTTYRKG K  P ERMD++G
Sbjct  61   WIVEPDGTTYRKGYKPPPAERMDVVG  86



>emb|CDY14593.1| BnaC02g25200D [Brassica napus]
Length=293

 Score =   111 bits (277),  Expect = 8e-26, Method: Compositional matrix adjust.
 Identities = 97/160 (61%), Positives = 108/160 (68%), Gaps = 27/160 (17%)
 Frame = +2

Query  125  MTSGTRLPTWkerennkrrerrrraiaakiFAGLRMYGNYKLPKHCDNNEVLKALCKEAG  304
            MTSGTR+PTW+ERENNKRRERRRRAIAAKIF GLRMYGNY+LPKHCDNNEVLKALC EAG
Sbjct  1    MTSGTRMPTWRERENNKRRERRRRAIAAKIFTGLRMYGNYELPKHCDNNEVLKALCNEAG  60

Query  305  WIVEEDGTTYRKG-CKPTERMDIMGssvsvspcssyqpsqGpsynpspasssfpspvssR  481
            WIVE DGTTYRKG  +P ERM+I GS  S +  S    S                     
Sbjct  61   WIVEPDGTTYRKGSSRPVERMEIGGSPCSSNFMSPASSSFA-------------------  101

Query  482  YITNNNNDTDPNSLIPWLKNL---ssgsspsssKLPHHLY  592
                N    D  SLIPWLK+L   SS S+ SSS+LP++LY
Sbjct  102  ----NLTPGDGQSLIPWLKHLSTTSSSSASSSSRLPNYLY  137



>emb|CDY26877.1| BnaA02g19020D [Brassica napus]
Length=293

 Score =   111 bits (277),  Expect = 8e-26, Method: Compositional matrix adjust.
 Identities = 97/160 (61%), Positives = 108/160 (68%), Gaps = 27/160 (17%)
 Frame = +2

Query  125  MTSGTRLPTWkerennkrrerrrraiaakiFAGLRMYGNYKLPKHCDNNEVLKALCKEAG  304
            MTSGTR+PTW+ERENNKRRERRRRAIAAKIF GLRMYGNY+LPKHCDNNEVLKALC EAG
Sbjct  1    MTSGTRMPTWRERENNKRRERRRRAIAAKIFTGLRMYGNYELPKHCDNNEVLKALCNEAG  60

Query  305  WIVEEDGTTYRKG-CKPTERMDIMGssvsvspcssyqpsqGpsynpspasssfpspvssR  481
            WIVE DGTTYRKG  +P ERM+I GS  S +  S    S                     
Sbjct  61   WIVEPDGTTYRKGSSRPVERMEIGGSPCSSNFMSPASSSFA-------------------  101

Query  482  YITNNNNDTDPNSLIPWLKNL---ssgsspsssKLPHHLY  592
                N    D  SLIPWLK+L   SS S+ SSS+LP++LY
Sbjct  102  ----NLTPGDGQSLIPWLKHLSTTSSSSASSSSRLPNYLY  137



>ref|XP_009128310.1| PREDICTED: BES1/BZR1 homolog protein 4 [Brassica rapa]
Length=292

 Score =   111 bits (277),  Expect = 9e-26, Method: Compositional matrix adjust.
 Identities = 97/160 (61%), Positives = 108/160 (68%), Gaps = 27/160 (17%)
 Frame = +2

Query  125  MTSGTRLPTWkerennkrrerrrraiaakiFAGLRMYGNYKLPKHCDNNEVLKALCKEAG  304
            MTSGTR+PTW+ERENNKRRERRRRAIAAKIF GLRMYGNY+LPKHCDNNEVLKALC EAG
Sbjct  1    MTSGTRMPTWRERENNKRRERRRRAIAAKIFTGLRMYGNYELPKHCDNNEVLKALCNEAG  60

Query  305  WIVEEDGTTYRKG-CKPTERMDIMGssvsvspcssyqpsqGpsynpspasssfpspvssR  481
            WIVE DGTTYRKG  +P ERM+I GS  S +  S    S                     
Sbjct  61   WIVEPDGTTYRKGSSRPVERMEIGGSPCSSNFMSPASSSFA-------------------  101

Query  482  YITNNNNDTDPNSLIPWLKNL---ssgsspsssKLPHHLY  592
                N    D  SLIPWLK+L   SS S+ SSS+LP++LY
Sbjct  102  ----NLTPGDGQSLIPWLKHLSTTSSSSASSSSRLPNYLY  137



>emb|CDX88466.1| BnaC06g39100D [Brassica napus]
Length=307

 Score =   110 bits (276),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 72/83 (87%), Positives = 78/83 (94%), Gaps = 1/83 (1%)
 Frame = +2

Query  125  MTSGTRLPTWkerennkrrerrrraiaakiFAGLRMYGNYKLPKHCDNNEVLKALCKEAG  304
            MTSGTR+PTW+ERENNKRRERRRRAIAAKIF GLRMYGNY+LPKHCDNNEVLKALC EAG
Sbjct  1    MTSGTRMPTWRERENNKRRERRRRAIAAKIFTGLRMYGNYELPKHCDNNEVLKALCNEAG  60

Query  305  WIVEEDGTTYRKG-CKPTERMDI  370
            WIVE+DGTTYRKG  +P ERM+I
Sbjct  61   WIVEQDGTTYRKGSSRPVERMEI  83



>emb|CDX87440.1| BnaA07g34330D [Brassica napus]
Length=307

 Score =   109 bits (272),  Expect = 5e-25, Method: Compositional matrix adjust.
 Identities = 71/83 (86%), Positives = 78/83 (94%), Gaps = 1/83 (1%)
 Frame = +2

Query  125  MTSGTRLPTWkerennkrrerrrraiaakiFAGLRMYGNYKLPKHCDNNEVLKALCKEAG  304
            MTSGTR+PTW+ERENNKRRERRRRAIAAKIF GLRMYGNY+LPKHCDNNEVLKALC EAG
Sbjct  1    MTSGTRMPTWRERENNKRRERRRRAIAAKIFTGLRMYGNYELPKHCDNNEVLKALCNEAG  60

Query  305  WIVEEDGTTYRKG-CKPTERMDI  370
            WIVE+DGTTYRKG  +P ERM++
Sbjct  61   WIVEQDGTTYRKGSSRPVERMEM  83



>ref|XP_002437132.1| hypothetical protein SORBIDRAFT_10g021750 [Sorghum bicolor]
 gb|EER88499.1| hypothetical protein SORBIDRAFT_10g021750 [Sorghum bicolor]
Length=356

 Score =   109 bits (273),  Expect = 5e-25, Method: Compositional matrix adjust.
 Identities = 120/161 (75%), Positives = 127/161 (79%), Gaps = 9/161 (6%)
 Frame = +2

Query  137  TRLPTWkerennkrrerrrraiaakiFAGLRMYGNYKLPKHCDNNEVLKALCKEAGWIVE  316
            TR+PTW+ERENN+RRERRRRAIAAKIFAGLR YGNY LPKHCDNNEVLKALC EAGW VE
Sbjct  15   TRVPTWRERENNRRRERRRRAIAAKIFAGLRAYGNYNLPKHCDNNEVLKALCNEAGWTVE  74

Query  317  EDGTTYRKGCKP--TERMDIMGssvsvspcssyqpsqGpsynpspasssfpspvssRYIT  490
             DGTTYRKGCKP  TER D +G S S SPCSSYQPS   SYNPSPASSSFPS  SS +IT
Sbjct  75   PDGTTYRKGCKPLATERPDPIGRSASPSPCSSYQPSPRASYNPSPASSSFPSSGSSSHIT  134

Query  491  NNNND----TDPNSLIPWLKNL-ssgsspsssKLP--HHLY  592
               N+     + NSLIPWLKNL SS S  SSSK P  HHLY
Sbjct  135  LGGNNFMGGVEGNSLIPWLKNLSSSSSFASSSKFPQLHHLY  175



>ref|XP_009106588.1| PREDICTED: BES1/BZR1 homolog protein 4-like [Brassica rapa]
Length=307

 Score =   108 bits (271),  Expect = 7e-25, Method: Compositional matrix adjust.
 Identities = 71/83 (86%), Positives = 78/83 (94%), Gaps = 1/83 (1%)
 Frame = +2

Query  125  MTSGTRLPTWkerennkrrerrrraiaakiFAGLRMYGNYKLPKHCDNNEVLKALCKEAG  304
            MTSGTR+PTW+ERENNKRRERRRRAIAAKIF GLRMYGNY+LPKHCDNNEVLKALC EAG
Sbjct  1    MTSGTRMPTWRERENNKRRERRRRAIAAKIFTGLRMYGNYELPKHCDNNEVLKALCNEAG  60

Query  305  WIVEEDGTTYRKG-CKPTERMDI  370
            WIVE+DGTTYRKG  +P ERM++
Sbjct  61   WIVEQDGTTYRKGSSRPVERMEM  83



>gb|ABR18463.1| unknown [Picea sitchensis]
Length=407

 Score =   109 bits (272),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 71/82 (87%), Positives = 76/82 (93%), Gaps = 0/82 (0%)
 Frame = +2

Query  131  SGTRLPTWkerennkrrerrrraiaakiFAGLRMYGNYKLPKHCDNNEVLKALCKEAGWI  310
            +G+RLPTWKERENNKRRERRRRAIAAKI++GLRMYGNYKLPKHCDNNEVLKALC EAGW 
Sbjct  2    TGSRLPTWKERENNKRRERRRRAIAAKIYSGLRMYGNYKLPKHCDNNEVLKALCNEAGWQ  61

Query  311  VEEDGTTYRKGCKPTERMDIMG  376
            VEEDGTTYRKGC P ERM+  G
Sbjct  62   VEEDGTTYRKGCPPPERMETGG  83



>ref|XP_001782551.1| predicted protein [Physcomitrella patens]
 gb|EDQ52626.1| predicted protein [Physcomitrella patens]
Length=633

 Score =   111 bits (277),  Expect = 1e-24, Method: Composition-based stats.
 Identities = 72/77 (94%), Positives = 74/77 (96%), Gaps = 0/77 (0%)
 Frame = +2

Query  122  EMTSGTRLPTWkerennkrrerrrraiaakiFAGLRMYGNYKLPKHCDNNEVLKALCKEA  301
            +MTSGTRLPTWKERENNKRRERRRRAIAAKIFAGLR+YGNYKLPKHCDNNEVLKALC EA
Sbjct  177  DMTSGTRLPTWKERENNKRRERRRRAIAAKIFAGLRLYGNYKLPKHCDNNEVLKALCVEA  236

Query  302  GWIVEEDGTTYRKGCKP  352
            GW VEEDGTTYRKG KP
Sbjct  237  GWTVEEDGTTYRKGSKP  253



>ref|XP_004965584.1| PREDICTED: BES1/BZR1 homolog protein 4-like [Setaria italica]
Length=356

 Score =   108 bits (270),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 119/161 (74%), Positives = 127/161 (79%), Gaps = 9/161 (6%)
 Frame = +2

Query  137  TRLPTWkerennkrrerrrraiaakiFAGLRMYGNYKLPKHCDNNEVLKALCKEAGWIVE  316
            TR+PTW+ERENN+RRERRRRAIAAKIFAGLR YGNY LPKHCDNNEVLKALC EAGW VE
Sbjct  14   TRVPTWRERENNRRRERRRRAIAAKIFAGLRAYGNYNLPKHCDNNEVLKALCNEAGWTVE  73

Query  317  EDGTTYRKGCKPT--ERMDIMGssvsvspcssyqpsqGpsynpspasssfpspvssRYIT  490
             DGTTYRKGCKPT  ER D +G S S SPCSSYQPS   SYNPSPASSSFPS  SS +IT
Sbjct  74   PDGTTYRKGCKPTAAERHDPIGRSASPSPCSSYQPSPRASYNPSPASSSFPSSGSSSHIT  133

Query  491  NNNND----TDPNSLIPWLKNL-ssgsspsssKLP--HHLY  592
               N+     + +SLIPWLKNL SS S  SSSK P  HHLY
Sbjct  134  LGGNNFIGGVEGSSLIPWLKNLSSSSSIASSSKFPQLHHLY  174



>ref|XP_010675300.1| PREDICTED: BES1/BZR1 homolog protein 4 [Beta vulgaris subsp. 
vulgaris]
Length=286

 Score =   107 bits (267),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 103/152 (68%), Positives = 120/152 (79%), Gaps = 3/152 (2%)
 Frame = +2

Query  128  TSGTRLPTWkerennkrrerrrraiaakiFAGLRMYGNYKLPKHCDNNEVLKALCKEAGW  307
            ++ TR P+WKERENNK+RER+RRAI+AKIF+GLR YGNYKLPKHCDNN+VLKALC EAGW
Sbjct  9    STSTRTPSWKERENNKKRERKRRAISAKIFSGLRTYGNYKLPKHCDNNQVLKALCNEAGW  68

Query  308  IVEEDGTTYRKGCKPTERMDIMGssvsvspcssyqpsqGpsynpspasssfpspvssRYI  487
             VE DGTTYRKGCKP + +DI+ +S+S SP SSYQPS+  S++ SPASSS  SP SS Y 
Sbjct  69   TVEPDGTTYRKGCKPIKPLDIIHTSISTSPNSSYQPSRSASFHASPASSSLASPASSSY-  127

Query  488  TNNNNDTDPNSLIPWLKNLssgsspsssKLPH  583
            T N       SLIPWLKN+   S  SSSKLPH
Sbjct  128  TANTIFLQGTSLIPWLKNI--SSPASSSKLPH  157



>ref|XP_010559011.1| PREDICTED: BES1/BZR1 homolog protein 3-like [Tarenaya hassleriana]
Length=135

 Score =   103 bits (258),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 70/72 (97%), Positives = 70/72 (97%), Gaps = 0/72 (0%)
 Frame = +2

Query  125  MTSGTRLPTWkerennkrrerrrraiaakiFAGLRMYGNYKLPKHCDNNEVLKALCKEAG  304
            MTSGTR PTWKERENNKRRERRRRAIAAKIFAGLRMYGNYKLPKHCDNNEVLKALCKEAG
Sbjct  1    MTSGTRTPTWKERENNKRRERRRRAIAAKIFAGLRMYGNYKLPKHCDNNEVLKALCKEAG  60

Query  305  WIVEEDGTTYRK  340
            W VEEDGTTYRK
Sbjct  61   WTVEEDGTTYRK  72



>ref|NP_001136786.1| BES transcription factor [Zea mays]
 gb|ACF82630.1| unknown [Zea mays]
 gb|ACG34754.1| brassinazole-resistant 1 protein [Zea mays]
 gb|ACR37890.1| unknown [Zea mays]
 gb|ADX60154.1| BES transcription factor [Zea mays]
 gb|ADX60163.1| MYBGA transcription factor, partial [Zea mays]
 gb|AFW86961.1| brassinazole-resistant 1 protein [Zea mays]
Length=355

 Score =   107 bits (267),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 118/161 (73%), Positives = 125/161 (78%), Gaps = 9/161 (6%)
 Frame = +2

Query  137  TRLPTWkerennkrrerrrraiaakiFAGLRMYGNYKLPKHCDNNEVLKALCKEAGWIVE  316
            TR+PTW+ERENN+RRERRRRAIAAKIFAGLR YGNY LPKHCDNNEVLKALC EAGW VE
Sbjct  15   TRVPTWRERENNRRRERRRRAIAAKIFAGLRAYGNYNLPKHCDNNEVLKALCNEAGWTVE  74

Query  317  EDGTTYRKGCKP--TERMDIMGssvsvspcssyqpsqGpsynpspasssfpspvssRYIT  490
             DGTTYRKGCKP  TER D +G S S SPCSSYQPS   SYNPS ASSSFPS  SS +IT
Sbjct  75   PDGTTYRKGCKPLATERPDPIGRSASPSPCSSYQPSPRASYNPSAASSSFPSSGSSSHIT  134

Query  491  ----NNNNDTDPNSLIPWLKNL-ssgsspsssKLP--HHLY  592
                N     + +SLIPWLKNL SS S  SSSK P  HHLY
Sbjct  135  LGGSNFMGGVEGSSLIPWLKNLSSSSSFASSSKFPQLHHLY  175



>ref|XP_001782618.1| predicted protein [Physcomitrella patens]
 gb|EDQ52607.1| predicted protein [Physcomitrella patens]
Length=356

 Score =   107 bits (267),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 72/79 (91%), Positives = 74/79 (94%), Gaps = 0/79 (0%)
 Frame = +2

Query  125  MTSGTRLPTWkerennkrrerrrraiaakiFAGLRMYGNYKLPKHCDNNEVLKALCKEAG  304
            MTSGTRLPTWKERENNKRRERRRRAIAAKIFAGLR+YGNYKLPKHCDNNEVLKALC EAG
Sbjct  1    MTSGTRLPTWKERENNKRRERRRRAIAAKIFAGLRLYGNYKLPKHCDNNEVLKALCVEAG  60

Query  305  WIVEEDGTTYRKGCKPTER  361
            W VEEDGTTYRKG KP  +
Sbjct  61   WTVEEDGTTYRKGSKPPAQ  79



>gb|EYU29527.1| hypothetical protein MIMGU_mgv1a010055mg [Erythranthe guttata]
Length=324

 Score =   107 bits (266),  Expect = 5e-24, Method: Compositional matrix adjust.
 Identities = 71/85 (84%), Positives = 75/85 (88%), Gaps = 2/85 (2%)
 Frame = +2

Query  125  MTSG--TRLPTWkerennkrrerrrraiaakiFAGLRMYGNYKLPKHCDNNEVLKALCKE  298
            MT G   R+P+WKERENNKRRERRRRAIAAKIFAGLR+YGNYKLPKHCDNNEVLKALC E
Sbjct  1    MTGGGAARMPSWKERENNKRRERRRRAIAAKIFAGLRLYGNYKLPKHCDNNEVLKALCDE  60

Query  299  AGWIVEEDGTTYRKGCKPTERMDIM  373
            AGW VE DGTTYRKGC+P E MD M
Sbjct  61   AGWTVEHDGTTYRKGCRPVENMDTM  85



>ref|XP_003565213.1| PREDICTED: protein BZR1 homolog 2 [Brachypodium distachyon]
Length=355

 Score =   106 bits (265),  Expect = 7e-24, Method: Compositional matrix adjust.
 Identities = 67/79 (85%), Positives = 74/79 (94%), Gaps = 0/79 (0%)
 Frame = +2

Query  140  RLPTWkerennkrrerrrraiaakiFAGLRMYGNYKLPKHCDNNEVLKALCKEAGWIVEE  319
            R+PTW+ERENNKRRERRRRAIAAKIF+GLR +G YKLPKHCDNNEVLKALC EAGW+VE 
Sbjct  22   RMPTWRERENNKRRERRRRAIAAKIFSGLRSHGGYKLPKHCDNNEVLKALCNEAGWVVEP  81

Query  320  DGTTYRKGCKPTERMDIMG  376
            DGTTYRKGC+PTERMD +G
Sbjct  82   DGTTYRKGCRPTERMDAIG  100



>gb|KFK42252.1| hypothetical protein AALP_AA2G231000 [Arabis alpina]
Length=317

 Score =   105 bits (263),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 113/160 (71%), Positives = 128/160 (80%), Gaps = 6/160 (4%)
 Frame = +2

Query  125  MTSGTRLPTWkerennkrrerrrraiaakiFAGLRMYGNYKLPKHCDNNEVLKALCKEAG  304
            MTSGTR+PT++ERENNKRRERRRRAIAAKIF GLRMYGNY+LPKHCDNNEVLKALC EAG
Sbjct  1    MTSGTRMPTYRERENNKRRERRRRAIAAKIFTGLRMYGNYELPKHCDNNEVLKALCNEAG  60

Query  305  WIVEEDGTTYRKG-CKPTERMDIMGssvsvspcssyqpsqGpsynpspasssfpspvssR  481
            WIVE DGTTYRKG  +P ERM++   S + SPCSSYQPS   SYNPSP SS+F SP SS 
Sbjct  61   WIVELDGTTYRKGSSRPIERMELGNGSATASPCSSYQPSPCASYNPSPGSSNFMSPNSSS  120

Query  482  YITNNNNDTDPNSLIPWLKNL---ssgsspsssKLPHHLY  592
            +   N    D  SLIPWLK+L   SS S+ SSS+LP++LY
Sbjct  121  FA--NLTSGDGQSLIPWLKHLSTTSSSSASSSSRLPNYLY  158



>gb|EMT21245.1| hypothetical protein F775_32777 [Aegilops tauschii]
Length=335

 Score =   103 bits (258),  Expect = 7e-23, Method: Compositional matrix adjust.
 Identities = 66/79 (84%), Positives = 72/79 (91%), Gaps = 0/79 (0%)
 Frame = +2

Query  140  RLPTWkerennkrrerrrraiaakiFAGLRMYGNYKLPKHCDNNEVLKALCKEAGWIVEE  319
            R+PTW+ERENNKRRERRRRAIAAKI+ GLR YGNY LPKHCDNNEVLKALC EAGW+VE 
Sbjct  25   RMPTWRERENNKRRERRRRAIAAKIYTGLRAYGNYNLPKHCDNNEVLKALCNEAGWVVEP  84

Query  320  DGTTYRKGCKPTERMDIMG  376
            DGTTYRKGC+P ERMD +G
Sbjct  85   DGTTYRKGCRPAERMDGIG  103



>gb|EEC80795.1| hypothetical protein OsI_23332 [Oryza sativa Indica Group]
Length=354

 Score =   103 bits (256),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 115/161 (71%), Positives = 123/161 (76%), Gaps = 9/161 (6%)
 Frame = +2

Query  137  TRLPTWkerennkrrerrrraiaakiFAGLRMYGNYKLPKHCDNNEVLKALCKEAGWIVE  316
            TR+PTW+ERENN+RRERRRRAIAAKI+AGLR YGNY LPKHCDNNEVLKALC EAGW VE
Sbjct  16   TRVPTWRERENNRRRERRRRAIAAKIYAGLRAYGNYNLPKHCDNNEVLKALCNEAGWTVE  75

Query  317  EDGTTYRKGCKP--TERMDIMGssvsvspcssyqpsqGpsynpspasssfpspvssRYIT  490
             DGTTYRKGCKP   ER D +G S S SPCSSYQPS   SYNPSPASSSFPS  SS +IT
Sbjct  76   PDGTTYRKGCKPPQAERPDPIGRSASPSPCSSYQPSPRASYNPSPASSSFPSSGSSSHIT  135

Query  491  NNNND----TDPNSLIPWLKNLs-sgsspsssKLP--HHLY  592
               N      + +SLIPWLK L  S S  SSSK P  HHLY
Sbjct  136  IGGNSLIGGVEGSSLIPWLKTLPLSSSYASSSKFPQLHHLY  176



>ref|NP_001057840.1| Os06g0552300 [Oryza sativa Japonica Group]
 sp|Q5Z9E5.1|BZR3_ORYSJ RecName: Full=Protein BZR1 homolog 3; Short=OsBZR3; AltName: 
Full=Protein BRASSINAZOLE-RESISTANT 1 homolog 3 [Oryza sativa 
Japonica Group]
 dbj|BAD53662.1| putative mature anther-specific protein LAT61 [Oryza sativa Japonica 
Group]
 dbj|BAF19754.1| Os06g0552300 [Oryza sativa Japonica Group]
 dbj|BAG94965.1| unnamed protein product [Oryza sativa Japonica Group]
Length=355

 Score =   103 bits (256),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 115/161 (71%), Positives = 123/161 (76%), Gaps = 9/161 (6%)
 Frame = +2

Query  137  TRLPTWkerennkrrerrrraiaakiFAGLRMYGNYKLPKHCDNNEVLKALCKEAGWIVE  316
            TR+PTW+ERENN+RRERRRRAIAAKI+AGLR YGNY LPKHCDNNEVLKALC EAGW VE
Sbjct  17   TRVPTWRERENNRRRERRRRAIAAKIYAGLRAYGNYNLPKHCDNNEVLKALCNEAGWTVE  76

Query  317  EDGTTYRKGCKP--TERMDIMGssvsvspcssyqpsqGpsynpspasssfpspvssRYIT  490
             DGTTYRKGCKP   ER D +G S S SPCSSYQPS   SYNPSPASSSFPS  SS +IT
Sbjct  77   PDGTTYRKGCKPPQAERPDPIGRSASPSPCSSYQPSPRASYNPSPASSSFPSSGSSSHIT  136

Query  491  NNNND----TDPNSLIPWLKNLs-sgsspsssKLP--HHLY  592
               N      + +SLIPWLK L  S S  SSSK P  HHLY
Sbjct  137  IGGNSLIGGVEGSSLIPWLKTLPLSSSYASSSKFPQLHHLY  177



>ref|XP_002454981.1| hypothetical protein SORBIDRAFT_03g002480 [Sorghum bicolor]
 gb|EES00101.1| hypothetical protein SORBIDRAFT_03g002480 [Sorghum bicolor]
Length=348

 Score =   103 bits (256),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 67/79 (85%), Positives = 72/79 (91%), Gaps = 0/79 (0%)
 Frame = +2

Query  140  RLPTWkerennkrrerrrraiaakiFAGLRMYGNYKLPKHCDNNEVLKALCKEAGWIVEE  319
            R+PTW+ERENNKRRERRRRAIAAKIFAGLR +G YKLPKHCDNNEVLKALC EAGW+VE 
Sbjct  21   RMPTWRERENNKRRERRRRAIAAKIFAGLRAHGGYKLPKHCDNNEVLKALCNEAGWVVEP  80

Query  320  DGTTYRKGCKPTERMDIMG  376
            DGTTYRKG KP ERMD +G
Sbjct  81   DGTTYRKGSKPMERMDHIG  99



>ref|XP_004968562.1| PREDICTED: BES1/BZR1 homolog protein 4-like [Setaria italica]
Length=347

 Score =   103 bits (256),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 99/137 (72%), Positives = 109/137 (80%), Gaps = 2/137 (1%)
 Frame = +2

Query  140  RLPTWkerennkrrerrrraiaakiFAGLRMYGNYKLPKHCDNNEVLKALCKEAGWIVEE  319
            R+PTW+ERENNKRRERRRRAIAAKIFAGLR +G YKLPKHCDNNEVLKALC EAGW+VE 
Sbjct  21   RMPTWRERENNKRRERRRRAIAAKIFAGLRAHGGYKLPKHCDNNEVLKALCNEAGWVVEP  80

Query  320  DGTTYRKGCKPTERMDIMGssvsvspcssyqpsqGpsynpspasssfpspvssRYITNNN  499
            DGTTYRKG KP ER+D +G SVS SPCSSYQ S   SYN SP SSSFPS  SS ++  N 
Sbjct  81   DGTTYRKGSKPQERVDAIGCSVSPSPCSSYQLSPRASYNASPTSSSFPSGASSPFLPPNE  140

Query  500  --NDTDPNSLIPWLKNL  544
              N  D N ++PWLK L
Sbjct  141  MANGIDGNPILPWLKTL  157



>dbj|BAB33003.1| unknown protein [Oryza sativa Japonica Group]
Length=354

 Score =   102 bits (255),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 100/138 (72%), Positives = 112/138 (81%), Gaps = 3/138 (2%)
 Frame = +2

Query  140  RLPTWkerennkrrerrrraiaakiFAGLRMYGNYKLPKHCDNNEVLKALCKEAGWIVEE  319
            R+PTW+ERENNKRRERRRRAIAAKIFAGLR +G YKLPKHCDNNEVLKALC EAGW+VE 
Sbjct  20   RMPTWRERENNKRRERRRRAIAAKIFAGLRAHGGYKLPKHCDNNEVLKALCNEAGWVVEP  79

Query  320  DGTTYRKGCKPTERMDIMGssvsvspcssyqpsqGpsynpspasssfpspvssRYITNNN  499
            DGTTYRKG KP ERM+++G SVS SPCSSYQPS   SYN SP SSSFPS  SS ++ + N
Sbjct  80   DGTTYRKGYKPPERMEVIGCSVSPSPCSSYQPSPRASYNASPTSSSFPSGASSPFLPHPN  139

Query  500  ---NDTDPNSLIPWLKNL  544
               N  D N ++PWLK L
Sbjct  140  NMANGVDGNPILPWLKTL  157



>ref|NP_001042330.1| Os01g0203000 [Oryza sativa Japonica Group]
 sp|Q0JPT4.1|BZR2_ORYSJ RecName: Full=Protein BZR1 homolog 2; Short=OsBZR2; AltName: 
Full=Protein BRASSINAZOLE-RESISTANT 1 homolog 2 [Oryza sativa 
Japonica Group]
 dbj|BAF04244.1| Os01g0203000, partial [Oryza sativa Japonica Group]
Length=365

 Score =   102 bits (255),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 100/138 (72%), Positives = 112/138 (81%), Gaps = 3/138 (2%)
 Frame = +2

Query  140  RLPTWkerennkrrerrrraiaakiFAGLRMYGNYKLPKHCDNNEVLKALCKEAGWIVEE  319
            R+PTW+ERENNKRRERRRRAIAAKIFAGLR +G YKLPKHCDNNEVLKALC EAGW+VE 
Sbjct  31   RMPTWRERENNKRRERRRRAIAAKIFAGLRAHGGYKLPKHCDNNEVLKALCNEAGWVVEP  90

Query  320  DGTTYRKGCKPTERMDIMGssvsvspcssyqpsqGpsynpspasssfpspvssRYITNNN  499
            DGTTYRKG KP ERM+++G SVS SPCSSYQPS   SYN SP SSSFPS  SS ++ + N
Sbjct  91   DGTTYRKGYKPPERMEVIGCSVSPSPCSSYQPSPRASYNASPTSSSFPSGASSPFLPHPN  150

Query  500  ---NDTDPNSLIPWLKNL  544
               N  D N ++PWLK L
Sbjct  151  NMANGVDGNPILPWLKTL  168



>ref|XP_003563774.1| PREDICTED: protein BZR1 homolog 3 [Brachypodium distachyon]
Length=355

 Score =   102 bits (255),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 114/161 (71%), Positives = 125/161 (78%), Gaps = 9/161 (6%)
 Frame = +2

Query  137  TRLPTWkerennkrrerrrraiaakiFAGLRMYGNYKLPKHCDNNEVLKALCKEAGWIVE  316
            TR+PTW+ERENN+RRERRRRAIAAKI+ GLR YGNY LPKHCDNNEVLKALC EAGW+VE
Sbjct  17   TRVPTWRERENNRRRERRRRAIAAKIYTGLRAYGNYNLPKHCDNNEVLKALCNEAGWVVE  76

Query  317  EDGTTYRKGCK--PTERMDIMGssvsvspcssyqpsqGpsynpspasssfpspvssRYIT  490
             DGTTYRKGCK  P  R D +G S S SPCSSYQPS   SYNPSPASSSFPS  SS +IT
Sbjct  77   PDGTTYRKGCKPPPQARHDPLGRSASPSPCSSYQPSPRASYNPSPASSSFPSSGSSSHIT  136

Query  491  NNNND----TDPNSLIPWLKNL-ssgsspsssKLP--HHLY  592
               N+     + +SLIPWLKNL S+ S  SSSK P  HHLY
Sbjct  137  LGGNNLIGGVEGSSLIPWLKNLSSNPSFASSSKFPQLHHLY  177



>ref|NP_001132634.1| uncharacterized protein LOC100194109 [Zea mays]
 gb|ACF81562.1| unknown [Zea mays]
 gb|ACG40609.1| brassinazole-resistant 1 protein [Zea mays]
Length=345

 Score =   102 bits (254),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 66/79 (84%), Positives = 72/79 (91%), Gaps = 0/79 (0%)
 Frame = +2

Query  140  RLPTWkerennkrrerrrraiaakiFAGLRMYGNYKLPKHCDNNEVLKALCKEAGWIVEE  319
            R+PTW+ERENNKRRERRRRAIAAKIFAGLR +G YKLPKHCDNNEVLKALC EAGW+VE 
Sbjct  17   RMPTWRERENNKRRERRRRAIAAKIFAGLRAHGGYKLPKHCDNNEVLKALCNEAGWVVEP  76

Query  320  DGTTYRKGCKPTERMDIMG  376
            DGTTYR+G KP ERMD +G
Sbjct  77   DGTTYRQGSKPMERMDPIG  95



>gb|ACG41016.1| brassinazole-resistant 1 protein [Zea mays]
Length=346

 Score =   102 bits (254),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 66/79 (84%), Positives = 72/79 (91%), Gaps = 0/79 (0%)
 Frame = +2

Query  140  RLPTWkerennkrrerrrraiaakiFAGLRMYGNYKLPKHCDNNEVLKALCKEAGWIVEE  319
            R+PTW+ERENNKRRERRRRAIAAKIFAGLR +G YKLPKHCDNNEVLKALC EAGW+VE 
Sbjct  17   RMPTWRERENNKRRERRRRAIAAKIFAGLRAHGGYKLPKHCDNNEVLKALCNEAGWVVEP  76

Query  320  DGTTYRKGCKPTERMDIMG  376
            DGTTYR+G KP ERMD +G
Sbjct  77   DGTTYRQGSKPMERMDPIG  95



>ref|XP_010254939.1| PREDICTED: BES1/BZR1 homolog protein 2 [Nelumbo nucifera]
Length=316

 Score =   102 bits (254),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 68/74 (92%), Positives = 70/74 (95%), Gaps = 0/74 (0%)
 Frame = +2

Query  131  SGTRLPTWkerennkrrerrrraiaakiFAGLRMYGNYKLPKHCDNNEVLKALCKEAGWI  310
            S  RLPTWKERENNKRRERRRRAIAAKI++GLR YGNYKLPKHCDNNEVLKALC EAGWI
Sbjct  5    SSGRLPTWKERENNKRRERRRRAIAAKIYSGLRAYGNYKLPKHCDNNEVLKALCAEAGWI  64

Query  311  VEEDGTTYRKGCKP  352
            VEEDGTTYRKGCKP
Sbjct  65   VEEDGTTYRKGCKP  78



>ref|XP_006377532.1| hypothetical protein POPTR_0011s06810g [Populus trichocarpa]
 gb|ERP55329.1| hypothetical protein POPTR_0011s06810g [Populus trichocarpa]
Length=124

 Score = 98.2 bits (243),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 67/72 (93%), Positives = 70/72 (97%), Gaps = 0/72 (0%)
 Frame = +2

Query  125  MTSGTRLPTWkerennkrrerrrraiaakiFAGLRMYGNYKLPKHCDNNEVLKALCKEAG  304
            MTSGTR+PTWKERENNKRRERRRRAIAAKI+AGLRMYG+YKLPKHCDNNEVLKALC EAG
Sbjct  1    MTSGTRMPTWKERENNKRRERRRRAIAAKIYAGLRMYGSYKLPKHCDNNEVLKALCNEAG  60

Query  305  WIVEEDGTTYRK  340
            W VEEDGTTYRK
Sbjct  61   WTVEEDGTTYRK  72



>emb|CDM82126.1| unnamed protein product [Triticum aestivum]
Length=333

 Score =   101 bits (252),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 65/78 (83%), Positives = 72/78 (92%), Gaps = 0/78 (0%)
 Frame = +2

Query  143  LPTWkerennkrrerrrraiaakiFAGLRMYGNYKLPKHCDNNEVLKALCKEAGWIVEED  322
            +PTW+ERENNKRRERRRRAIAAKIF+GLR +G YKLPKHCDNNEVLKALC EAGW+VE D
Sbjct  1    MPTWRERENNKRRERRRRAIAAKIFSGLRAHGGYKLPKHCDNNEVLKALCNEAGWVVEPD  60

Query  323  GTTYRKGCKPTERMDIMG  376
            GTTYRKGC+P ERMD +G
Sbjct  61   GTTYRKGCRPAERMDGIG  78



>gb|EEC70129.1| hypothetical protein OsI_00807 [Oryza sativa Indica Group]
Length=334

 Score =   100 bits (250),  Expect = 7e-22, Method: Compositional matrix adjust.
 Identities = 99/137 (72%), Positives = 111/137 (81%), Gaps = 3/137 (2%)
 Frame = +2

Query  143  LPTWkerennkrrerrrraiaakiFAGLRMYGNYKLPKHCDNNEVLKALCKEAGWIVEED  322
            +PTW+ERENNKRRERRRRAIAAKIFAGLR +G YKLPKHCDNNEVLKALC EAGW+VE D
Sbjct  1    MPTWRERENNKRRERRRRAIAAKIFAGLRAHGGYKLPKHCDNNEVLKALCNEAGWVVEPD  60

Query  323  GTTYRKGCKPTERMDIMGssvsvspcssyqpsqGpsynpspasssfpspvssRYITNNN-  499
            GTTYRKG KP ERM+++G SVS SPCSSYQPS   SYN SP SSSFPS  SS ++ + N 
Sbjct  61   GTTYRKGYKPPERMEVIGCSVSPSPCSSYQPSPRASYNASPTSSSFPSGASSPFLPHPNN  120

Query  500  --NDTDPNSLIPWLKNL  544
              N  D N ++PWLK L
Sbjct  121  MANGVDGNPILPWLKTL  137



>gb|EEE54074.1| hypothetical protein OsJ_00786 [Oryza sativa Japonica Group]
Length=334

 Score =   100 bits (250),  Expect = 7e-22, Method: Compositional matrix adjust.
 Identities = 99/137 (72%), Positives = 111/137 (81%), Gaps = 3/137 (2%)
 Frame = +2

Query  143  LPTWkerennkrrerrrraiaakiFAGLRMYGNYKLPKHCDNNEVLKALCKEAGWIVEED  322
            +PTW+ERENNKRRERRRRAIAAKIFAGLR +G YKLPKHCDNNEVLKALC EAGW+VE D
Sbjct  1    MPTWRERENNKRRERRRRAIAAKIFAGLRAHGGYKLPKHCDNNEVLKALCNEAGWVVEPD  60

Query  323  GTTYRKGCKPTERMDIMGssvsvspcssyqpsqGpsynpspasssfpspvssRYITNNN-  499
            GTTYRKG KP ERM+++G SVS SPCSSYQPS   SYN SP SSSFPS  SS ++ + N 
Sbjct  61   GTTYRKGYKPPERMEVIGCSVSPSPCSSYQPSPRASYNASPTSSSFPSGASSPFLPHPNN  120

Query  500  --NDTDPNSLIPWLKNL  544
              N  D N ++PWLK L
Sbjct  121  MANGVDGNPILPWLKTL  137



>ref|XP_002965931.1| hypothetical protein SELMODRAFT_407084 [Selaginella moellendorffii]
 gb|EFJ33351.1| hypothetical protein SELMODRAFT_407084 [Selaginella moellendorffii]
Length=358

 Score =   100 bits (250),  Expect = 8e-22, Method: Compositional matrix adjust.
 Identities = 66/81 (81%), Positives = 74/81 (91%), Gaps = 0/81 (0%)
 Frame = +2

Query  125  MTSGTRLPTWkerennkrrerrrraiaakiFAGLRMYGNYKLPKHCDNNEVLKALCKEAG  304
            MTSG+R PT++ERENNKRRERRRRAIAAKIF GLR  GNY LPKHCDNNEVLKALC+EAG
Sbjct  1    MTSGSRTPTFRERENNKRRERRRRAIAAKIFNGLRQLGNYNLPKHCDNNEVLKALCREAG  60

Query  305  WIVEEDGTTYRKGCKPTERMD  367
            W+VE+DGTTYRKG +P ER+D
Sbjct  61   WVVEDDGTTYRKGSRPMERLD  81



>ref|XP_010093488.1| hypothetical protein L484_017551 [Morus notabilis]
 gb|EXB54112.1| hypothetical protein L484_017551 [Morus notabilis]
Length=391

 Score =   100 bits (249),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 68/72 (94%), Positives = 69/72 (96%), Gaps = 0/72 (0%)
 Frame = +2

Query  125  MTSGTRLPTWkerennkrrerrrraiaakiFAGLRMYGNYKLPKHCDNNEVLKALCKEAG  304
            MTSGTRLPTWKERENNK+RERRRRAIAAKIFAGLRMYGNYKLPKHCDNNEVLKALC EAG
Sbjct  1    MTSGTRLPTWKERENNKKRERRRRAIAAKIFAGLRMYGNYKLPKHCDNNEVLKALCNEAG  60

Query  305  WIVEEDGTTYRK  340
            W VE DGTTYRK
Sbjct  61   WTVEPDGTTYRK  72



>ref|XP_002968357.1| hypothetical protein SELMODRAFT_409126 [Selaginella moellendorffii]
 gb|EFJ30611.1| hypothetical protein SELMODRAFT_409126 [Selaginella moellendorffii]
Length=359

 Score =   100 bits (249),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 66/81 (81%), Positives = 74/81 (91%), Gaps = 0/81 (0%)
 Frame = +2

Query  125  MTSGTRLPTWkerennkrrerrrraiaakiFAGLRMYGNYKLPKHCDNNEVLKALCKEAG  304
            MTSG+R PT++ERENNKRRERRRRAIAAKIF GLR  GNY LPKHCDNNEVLKALC+EAG
Sbjct  1    MTSGSRTPTFRERENNKRRERRRRAIAAKIFNGLRQLGNYNLPKHCDNNEVLKALCREAG  60

Query  305  WIVEEDGTTYRKGCKPTERMD  367
            W+VE+DGTTYRKG +P ER+D
Sbjct  61   WVVEDDGTTYRKGSRPMERLD  81



>ref|XP_009349751.1| PREDICTED: BES1/BZR1 homolog protein 2-like [Pyrus x bretschneideri]
Length=316

 Score = 99.8 bits (247),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 68/82 (83%), Positives = 74/82 (90%), Gaps = 1/82 (1%)
 Frame = +2

Query  131  SGTRLPTWkerennkrrerrrraiaakiFAGLRMYGNYKLPKHCDNNEVLKALCKEAGWI  310
            S  RLPTWKERENNKRRERRRRAIAAKI++GLR  G+YKLPKHCDNNEVLKALC EAGW+
Sbjct  6    SSGRLPTWKERENNKRRERRRRAIAAKIYSGLRAQGSYKLPKHCDNNEVLKALCAEAGWV  65

Query  311  VEEDGTTYRKGCKPTERMDIMG  376
            VEEDGTTYRKGCKP+  M+I G
Sbjct  66   VEEDGTTYRKGCKPSP-MEIAG  86



>ref|XP_006383240.1| hypothetical protein POPTR_0005s12790g [Populus trichocarpa]
 gb|ERP61037.1| hypothetical protein POPTR_0005s12790g [Populus trichocarpa]
Length=319

 Score = 99.8 bits (247),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 66/74 (89%), Positives = 67/74 (91%), Gaps = 0/74 (0%)
 Frame = +2

Query  131  SGTRLPTWkerennkrrerrrraiaakiFAGLRMYGNYKLPKHCDNNEVLKALCKEAGWI  310
            S  RLPTWKERENN RRERRRRAIAAKI+ GLR  GNYKLPKHCDNNEVLKALC EAGWI
Sbjct  6    SSARLPTWKERENNMRRERRRRAIAAKIYTGLRTQGNYKLPKHCDNNEVLKALCAEAGWI  65

Query  311  VEEDGTTYRKGCKP  352
            VEEDGTTYRKGCKP
Sbjct  66   VEEDGTTYRKGCKP  79



>ref|XP_008795632.1| PREDICTED: protein BZR1 homolog 1-like [Phoenix dactylifera]
Length=309

 Score = 99.8 bits (247),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 68/77 (88%), Positives = 72/77 (94%), Gaps = 1/77 (1%)
 Frame = +2

Query  125  MTSGT-RLPTWkerennkrrerrrraiaakiFAGLRMYGNYKLPKHCDNNEVLKALCKEA  301
            MTSG  RLPTW+ERENNKRRERRRRAIAAKIF+GLR  GNYKLPKHCDNNEVLKALC EA
Sbjct  1    MTSGGGRLPTWRERENNKRRERRRRAIAAKIFSGLRTLGNYKLPKHCDNNEVLKALCSEA  60

Query  302  GWIVEEDGTTYRKGCKP  352
            GW+VE+DGTTYRKGCKP
Sbjct  61   GWVVEDDGTTYRKGCKP  77



>ref|XP_009379188.1| PREDICTED: BES1/BZR1 homolog protein 2-like [Pyrus x bretschneideri]
Length=316

 Score = 99.4 bits (246),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 68/82 (83%), Positives = 74/82 (90%), Gaps = 1/82 (1%)
 Frame = +2

Query  131  SGTRLPTWkerennkrrerrrraiaakiFAGLRMYGNYKLPKHCDNNEVLKALCKEAGWI  310
            S  RLPTWKERENNKRRERRRRAIAAKI++GLR  G+YKLPKHCDNNEVLKALC EAGW+
Sbjct  6    SSGRLPTWKERENNKRRERRRRAIAAKIYSGLRAQGSYKLPKHCDNNEVLKALCAEAGWV  65

Query  311  VEEDGTTYRKGCKPTERMDIMG  376
            VEEDGTTYRKGCKP+  M+I G
Sbjct  66   VEEDGTTYRKGCKPSP-MEIAG  86



>ref|XP_006383241.1| hypothetical protein POPTR_0005s12790g [Populus trichocarpa]
 gb|ABK96008.1| unknown [Populus trichocarpa]
 gb|ERP61038.1| hypothetical protein POPTR_0005s12790g [Populus trichocarpa]
Length=331

 Score = 99.4 bits (246),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 66/74 (89%), Positives = 67/74 (91%), Gaps = 0/74 (0%)
 Frame = +2

Query  131  SGTRLPTWkerennkrrerrrraiaakiFAGLRMYGNYKLPKHCDNNEVLKALCKEAGWI  310
            S  RLPTWKERENN RRERRRRAIAAKI+ GLR  GNYKLPKHCDNNEVLKALC EAGWI
Sbjct  6    SSARLPTWKERENNMRRERRRRAIAAKIYTGLRTQGNYKLPKHCDNNEVLKALCAEAGWI  65

Query  311  VEEDGTTYRKGCKP  352
            VEEDGTTYRKGCKP
Sbjct  66   VEEDGTTYRKGCKP  79



>emb|CDX99414.1| BnaC01g11380D [Brassica napus]
Length=308

 Score = 99.4 bits (246),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 94/173 (54%), Positives = 106/173 (61%), Gaps = 42/173 (24%)
 Frame = +2

Query  125  MTSGTRLPTWkerennkrrerrrraiaakiFAGLRMYGNYKLPKHCDNNEVLKALCKEAG  304
            MTSGTR PTWKERENNKRRERRRRAIAAKIFAGLR++GN+KLPKHCDNNEVLKALC EAG
Sbjct  1    MTSGTRTPTWKERENNKRRERRRRAIAAKIFAGLRIHGNFKLPKHCDNNEVLKALCNEAG  60

Query  305  WIVEEDGTTYRK--------------------------------GCKPTERMDIM-Gssv  385
            W VEEDGTTYRK                                GCKP +R+++M GS+ 
Sbjct  61   WTVEEDGTTYRKRKRKILMMQIGRLRFSFYRFSGHGKRQIETVLGCKPMDRVELMNGSTS  120

Query  386  svspcssyqpsqGpsynpspasssfpspvssRYITNNNNDTDPNSLIPWLKNL  544
            +    S     +G         S  PSP SS + +  N   D NSLIPWLKNL
Sbjct  121  ASPCSSYQPSPRG---------SYNPSPSSSSFPSPTNIFGDANSLIPWLKNL  164



>ref|XP_010680895.1| PREDICTED: BES1/BZR1 homolog protein 2-like [Beta vulgaris subsp. 
vulgaris]
Length=320

 Score = 99.4 bits (246),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 67/79 (85%), Positives = 71/79 (90%), Gaps = 1/79 (1%)
 Frame = +2

Query  140  RLPTWkerennkrrerrrraiaakiFAGLRMYGNYKLPKHCDNNEVLKALCKEAGWIVEE  319
            RLPTWKERENNK+RERRRRAIAAKIF GLR  G+YKLPKHCDNNEVLKALC+EAGWIVEE
Sbjct  7    RLPTWKERENNKKRERRRRAIAAKIFTGLRAQGSYKLPKHCDNNEVLKALCREAGWIVEE  66

Query  320  DGTTYRKGCKPTERMDIMG  376
            DGTTYRKGC P   MD+ G
Sbjct  67   DGTTYRKGCNPPP-MDMAG  84



>gb|EYU44662.1| hypothetical protein MIMGU_mgv1a010729mg [Erythranthe guttata]
Length=304

 Score = 99.4 bits (246),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 65/75 (87%), Positives = 70/75 (93%), Gaps = 0/75 (0%)
 Frame = +2

Query  128  TSGTRLPTWkerennkrrerrrraiaakiFAGLRMYGNYKLPKHCDNNEVLKALCKEAGW  307
            +S  RLPTWKERENNK+RERRRRAIAAKI+AGLR  GNYKLPKHCDNNEVLKALC EAGW
Sbjct  6    SSTGRLPTWKERENNKKRERRRRAIAAKIYAGLRSQGNYKLPKHCDNNEVLKALCSEAGW  65

Query  308  IVEEDGTTYRKGCKP  352
            +VE+DGTTYRKGCKP
Sbjct  66   VVEDDGTTYRKGCKP  80



>ref|XP_010999949.1| PREDICTED: BES1/BZR1 homolog protein 2-like [Populus euphratica]
Length=332

 Score = 99.4 bits (246),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 66/74 (89%), Positives = 67/74 (91%), Gaps = 0/74 (0%)
 Frame = +2

Query  131  SGTRLPTWkerennkrrerrrraiaakiFAGLRMYGNYKLPKHCDNNEVLKALCKEAGWI  310
            S  RLPTWKERENN RRERRRRAIAAKI+ GLR  GNYKLPKHCDNNEVLKALC EAGWI
Sbjct  6    SSARLPTWKERENNMRRERRRRAIAAKIYTGLRTQGNYKLPKHCDNNEVLKALCAEAGWI  65

Query  311  VEEDGTTYRKGCKP  352
            VEEDGTTYRKGCKP
Sbjct  66   VEEDGTTYRKGCKP  79



>ref|XP_009374228.1| PREDICTED: BES1/BZR1 homolog protein 2 [Pyrus x bretschneideri]
Length=315

 Score = 99.0 bits (245),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 68/82 (83%), Positives = 74/82 (90%), Gaps = 1/82 (1%)
 Frame = +2

Query  131  SGTRLPTWkerennkrrerrrraiaakiFAGLRMYGNYKLPKHCDNNEVLKALCKEAGWI  310
            S  RLPTWKERENNKRRERRRRAIAAKI++GLR  G+YKLPKHCDNNEVLKALC EAGW+
Sbjct  6    SSGRLPTWKERENNKRRERRRRAIAAKIYSGLRAQGSYKLPKHCDNNEVLKALCAEAGWV  65

Query  311  VEEDGTTYRKGCKPTERMDIMG  376
            VEEDGTTYRKGCKP+  M+I G
Sbjct  66   VEEDGTTYRKGCKPSP-MEIAG  86



>ref|XP_009389663.1| PREDICTED: protein BZR1 homolog 1-like [Musa acuminata subsp. 
malaccensis]
Length=310

 Score = 99.0 bits (245),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 69/76 (91%), Positives = 72/76 (95%), Gaps = 1/76 (1%)
 Frame = +2

Query  125  MTSGT-RLPTWkerennkrrerrrraiaakiFAGLRMYGNYKLPKHCDNNEVLKALCKEA  301
            MTSG  RLPTWKERENNKRRERRRRAIAAKIF+GLR  GNYKLPKHCDNNEVLKALC+EA
Sbjct  1    MTSGGGRLPTWKERENNKRRERRRRAIAAKIFSGLRALGNYKLPKHCDNNEVLKALCREA  60

Query  302  GWIVEEDGTTYRKGCK  349
            GWIVE+DGTTYRKGCK
Sbjct  61   GWIVEDDGTTYRKGCK  76



>ref|XP_008241630.1| PREDICTED: BES1/BZR1 homolog protein 2 [Prunus mume]
Length=317

 Score = 99.0 bits (245),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 68/82 (83%), Positives = 74/82 (90%), Gaps = 1/82 (1%)
 Frame = +2

Query  131  SGTRLPTWkerennkrrerrrraiaakiFAGLRMYGNYKLPKHCDNNEVLKALCKEAGWI  310
            S  RLPTWKERENNKRRERRRRAIAAKI++GLR  G+YKLPKHCDNNEVLKALC EAGW+
Sbjct  6    SSGRLPTWKERENNKRRERRRRAIAAKIYSGLRAQGSYKLPKHCDNNEVLKALCAEAGWV  65

Query  311  VEEDGTTYRKGCKPTERMDIMG  376
            VEEDGTTYRKGCKP+  M+I G
Sbjct  66   VEEDGTTYRKGCKPSP-MEIAG  86



>ref|XP_008338783.1| PREDICTED: BES1/BZR1 homolog protein 2-like [Malus domestica]
Length=316

 Score = 99.0 bits (245),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 68/82 (83%), Positives = 74/82 (90%), Gaps = 1/82 (1%)
 Frame = +2

Query  131  SGTRLPTWkerennkrrerrrraiaakiFAGLRMYGNYKLPKHCDNNEVLKALCKEAGWI  310
            S  RLPTWKERENNKRRERRRRAIAAKI++GLR  G+YKLPKHCDNNEVLKALC EAGW+
Sbjct  6    SSGRLPTWKERENNKRRERRRRAIAAKIYSGLRAQGSYKLPKHCDNNEVLKALCAEAGWV  65

Query  311  VEEDGTTYRKGCKPTERMDIMG  376
            VEEDGTTYRKGCKP+  M+I G
Sbjct  66   VEEDGTTYRKGCKPSP-MEIAG  86



>ref|XP_002273547.1| PREDICTED: BES1/BZR1 homolog protein 2 [Vitis vinifera]
Length=316

 Score = 99.0 bits (245),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 66/74 (89%), Positives = 68/74 (92%), Gaps = 0/74 (0%)
 Frame = +2

Query  131  SGTRLPTWkerennkrrerrrraiaakiFAGLRMYGNYKLPKHCDNNEVLKALCKEAGWI  310
            S  RLPTWKERENNK+RERRRRAIAAKI+AGLR  GNYKLPKHCDNNEVLKALC EAGW 
Sbjct  6    SSGRLPTWKERENNKKRERRRRAIAAKIYAGLRAQGNYKLPKHCDNNEVLKALCSEAGWT  65

Query  311  VEEDGTTYRKGCKP  352
            VEEDGTTYRKGCKP
Sbjct  66   VEEDGTTYRKGCKP  79



>ref|XP_007202252.1| hypothetical protein PRUPE_ppa008842mg [Prunus persica]
 gb|EMJ03451.1| hypothetical protein PRUPE_ppa008842mg [Prunus persica]
Length=317

 Score = 99.0 bits (245),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 68/82 (83%), Positives = 74/82 (90%), Gaps = 1/82 (1%)
 Frame = +2

Query  131  SGTRLPTWkerennkrrerrrraiaakiFAGLRMYGNYKLPKHCDNNEVLKALCKEAGWI  310
            S  RLPTWKERENNKRRERRRRAIAAKI++GLR  G+YKLPKHCDNNEVLKALC EAGW+
Sbjct  6    SSGRLPTWKERENNKRRERRRRAIAAKIYSGLRAQGSYKLPKHCDNNEVLKALCAEAGWV  65

Query  311  VEEDGTTYRKGCKPTERMDIMG  376
            VEEDGTTYRKGCKP+  M+I G
Sbjct  66   VEEDGTTYRKGCKPSP-MEIAG  86



>ref|XP_010907212.1| PREDICTED: protein BZR1 homolog 1-like [Elaeis guineensis]
Length=309

 Score = 98.2 bits (243),  Expect = 6e-21, Method: Compositional matrix adjust.
 Identities = 65/75 (87%), Positives = 68/75 (91%), Gaps = 0/75 (0%)
 Frame = +2

Query  128  TSGTRLPTWkerennkrrerrrraiaakiFAGLRMYGNYKLPKHCDNNEVLKALCKEAGW  307
            + G RLPTWKERENNKRRERRRRAI AKIF GLR  GNYKLPKHCDNNEVLKALC EAGW
Sbjct  3    SGGGRLPTWKERENNKRRERRRRAIGAKIFYGLRTQGNYKLPKHCDNNEVLKALCAEAGW  62

Query  308  IVEEDGTTYRKGCKP  352
            +VEEDGTTYR+GCKP
Sbjct  63   VVEEDGTTYRRGCKP  77



>gb|KDP38469.1| hypothetical protein JCGZ_04394 [Jatropha curcas]
Length=312

 Score = 97.8 bits (242),  Expect = 7e-21, Method: Compositional matrix adjust.
 Identities = 65/90 (72%), Positives = 74/90 (82%), Gaps = 1/90 (1%)
 Frame = +2

Query  107  NGRRREMTSGTRLPTWkerennkrrerrrraiaakiFAGLRMYGNYKLPKHCDNNEVLKA  286
            +G      +  R P+W+ERENN+RRERRRRAIAAKIFAGLR  GNY LPKHCDNNEVLKA
Sbjct  4    DGATSTSAAPRRKPSWRERENNRRRERRRRAIAAKIFAGLRAQGNYNLPKHCDNNEVLKA  63

Query  287  LCKEAGWIVEEDGTTYRKGCKPTERMDIMG  376
            LC EAGW+VE+DGTTYRKGCKP   +DI+G
Sbjct  64   LCSEAGWVVEDDGTTYRKGCKPPP-IDIVG  92



>ref|XP_009411027.1| PREDICTED: protein BZR1 homolog 1 [Musa acuminata subsp. malaccensis]
Length=310

 Score = 97.8 bits (242),  Expect = 7e-21, Method: Compositional matrix adjust.
 Identities = 69/76 (91%), Positives = 70/76 (92%), Gaps = 1/76 (1%)
 Frame = +2

Query  125  MTSGT-RLPTWkerennkrrerrrraiaakiFAGLRMYGNYKLPKHCDNNEVLKALCKEA  301
            MTSG  R PTWKERENNKRRERRRRAIAAKIF GLR  GNYKLPKHCDNNEVLKALC+EA
Sbjct  1    MTSGGGRQPTWKERENNKRRERRRRAIAAKIFTGLRAMGNYKLPKHCDNNEVLKALCREA  60

Query  302  GWIVEEDGTTYRKGCK  349
            GWIVEEDGTTYRKGCK
Sbjct  61   GWIVEEDGTTYRKGCK  76



>ref|XP_011097209.1| PREDICTED: BES1/BZR1 homolog protein 2-like [Sesamum indicum]
Length=316

 Score = 97.8 bits (242),  Expect = 7e-21, Method: Compositional matrix adjust.
 Identities = 64/75 (85%), Positives = 70/75 (93%), Gaps = 0/75 (0%)
 Frame = +2

Query  128  TSGTRLPTWkerennkrrerrrraiaakiFAGLRMYGNYKLPKHCDNNEVLKALCKEAGW  307
            +S  RLP+W+ERENNKRRERRRRAIAAKI++GLR  GNYKLPKHCDNNEVLKALC EAGW
Sbjct  6    SSTGRLPSWRERENNKRRERRRRAIAAKIYSGLRAQGNYKLPKHCDNNEVLKALCAEAGW  65

Query  308  IVEEDGTTYRKGCKP  352
            +VEEDGTTYRKGCKP
Sbjct  66   VVEEDGTTYRKGCKP  80



>ref|XP_002525100.1| BRASSINAZOLE-RESISTANT 1 protein, putative [Ricinus communis]
 gb|EEF37227.1| BRASSINAZOLE-RESISTANT 1 protein, putative [Ricinus communis]
Length=317

 Score = 97.8 bits (242),  Expect = 8e-21, Method: Compositional matrix adjust.
 Identities = 66/74 (89%), Positives = 69/74 (93%), Gaps = 0/74 (0%)
 Frame = +2

Query  131  SGTRLPTWkerennkrrerrrraiaakiFAGLRMYGNYKLPKHCDNNEVLKALCKEAGWI  310
            S  RLPTWKERENNKRRERRRRAIAAKI++GLR  GN+KLPKHCDNNEVLKALC EAGWI
Sbjct  6    SSGRLPTWKERENNKRRERRRRAIAAKIYSGLRAQGNFKLPKHCDNNEVLKALCAEAGWI  65

Query  311  VEEDGTTYRKGCKP  352
            VEEDGTTYRKGCKP
Sbjct  66   VEEDGTTYRKGCKP  79



>ref|XP_011099590.1| PREDICTED: BES1/BZR1 homolog protein 2 [Sesamum indicum]
Length=316

 Score = 97.8 bits (242),  Expect = 8e-21, Method: Compositional matrix adjust.
 Identities = 66/75 (88%), Positives = 70/75 (93%), Gaps = 0/75 (0%)
 Frame = +2

Query  128  TSGTRLPTWkerennkrrerrrraiaakiFAGLRMYGNYKLPKHCDNNEVLKALCKEAGW  307
            +S  RLPTWKERENNKRRERRRRAIAAKI++GLR  GNY+LPKHCDNNEVLKALC EAGW
Sbjct  6    SSTGRLPTWKERENNKRRERRRRAIAAKIYSGLRAQGNYRLPKHCDNNEVLKALCAEAGW  65

Query  308  IVEEDGTTYRKGCKP  352
            IVEEDGTTYRKGCKP
Sbjct  66   IVEEDGTTYRKGCKP  80



>dbj|BAJ97997.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ91390.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=357

 Score = 97.8 bits (242),  Expect = 9e-21, Method: Compositional matrix adjust.
 Identities = 93/161 (58%), Positives = 107/161 (66%), Gaps = 9/161 (6%)
 Frame = +2

Query  137  TRLPTWkerennkrrerrrraiaakiFAGLRMYGNYKLPKHCDNNEVLKALCKEAGWIVE  316
            TR+PTW+ERENN+RRERRRRAIAAKI+ GLR YGNY LPKHCDNNEVLKALC EAGW+VE
Sbjct  17   TRVPTWRERENNRRRERRRRAIAAKIYTGLRAYGNYNLPKHCDNNEVLKALCNEAGWVVE  76

Query  317  EDGTTYRKGCK--PTERMDIMGssvsvspcssyqpsqGpsynpspasssfpspvssRYIT  490
             DGTTYR+GCK  P  R D M S+ +    S     +        +SS   S  SS    
Sbjct  77   PDGTTYRRGCKPPPQARPDPMRSASASPCSSYQPSPRASYNPSPASSSFPSSGSSSHITL  136

Query  491  NNNND----TDPNSLIPWLKNL-ssgsspsssKLP--HHLY  592
               N+     + +SLIPWLKNL S+ S  SSSKLP  HHLY
Sbjct  137  GGGNNFIGGVEGSSLIPWLKNLSSNPSFASSSKLPQLHHLY  177



>ref|XP_011025717.1| PREDICTED: LOW QUALITY PROTEIN: BES1/BZR1 homolog protein 2 [Populus 
euphratica]
Length=336

 Score = 97.4 bits (241),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 67/74 (91%), Positives = 68/74 (92%), Gaps = 0/74 (0%)
 Frame = +2

Query  131  SGTRLPTWkerennkrrerrrraiaakiFAGLRMYGNYKLPKHCDNNEVLKALCKEAGWI  310
            S  RLPTWKERENNKRRERRRRAIAAKI+ GLR  GNYKLPKHCDNNEVLKALC EAGWI
Sbjct  6    SSGRLPTWKERENNKRRERRRRAIAAKIYTGLRTQGNYKLPKHCDNNEVLKALCAEAGWI  65

Query  311  VEEDGTTYRKGCKP  352
            VEEDGTTYRKGCKP
Sbjct  66   VEEDGTTYRKGCKP  79



>ref|XP_004958130.1| PREDICTED: BES1/BZR1 homolog protein 2-like [Setaria italica]
Length=326

 Score = 97.4 bits (241),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 65/75 (87%), Positives = 68/75 (91%), Gaps = 0/75 (0%)
 Frame = +2

Query  140  RLPTWkerennkrrerrrraiaakiFAGLRMYGNYKLPKHCDNNEVLKALCKEAGWIVEE  319
            R PTWKERENNKRRERRRRAIAAKIF GLR  GNYKLPKHCDNNEVLKALC+EAGW+VE+
Sbjct  18   RTPTWKERENNKRRERRRRAIAAKIFTGLRALGNYKLPKHCDNNEVLKALCREAGWVVED  77

Query  320  DGTTYRKGCKPTERM  364
            DGTTYRKGCKP   M
Sbjct  78   DGTTYRKGCKPPPGM  92



>ref|XP_009394366.1| PREDICTED: protein BZR1 homolog 1-like [Musa acuminata subsp. 
malaccensis]
Length=299

 Score = 96.7 bits (239),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 64/72 (89%), Positives = 67/72 (93%), Gaps = 0/72 (0%)
 Frame = +2

Query  134  GTRLPTWkerennkrrerrrraiaakiFAGLRMYGNYKLPKHCDNNEVLKALCKEAGWIV  313
            G R PTWKERENNKRRERRRRAIA++IF+GLR  GNYKLPKHCDNNEVLKALC EAGWIV
Sbjct  5    GGRQPTWKERENNKRRERRRRAIASQIFSGLRAMGNYKLPKHCDNNEVLKALCHEAGWIV  64

Query  314  EEDGTTYRKGCK  349
            EEDGTTYRKGCK
Sbjct  65   EEDGTTYRKGCK  76



>ref|XP_007156899.1| hypothetical protein PHAVU_002G0267001g, partial [Phaseolus vulgaris]
 gb|ESW28893.1| hypothetical protein PHAVU_002G0267001g, partial [Phaseolus vulgaris]
Length=94

 Score = 92.4 bits (228),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 66/79 (84%), Positives = 69/79 (87%), Gaps = 0/79 (0%)
 Frame = +2

Query  140  RLPTWkerennkrrerrrraiaakiFAGLRMYGNYKLPKHCDNNEVLKALCKEAGWIVEE  319
            R+PTWKERENNKRRERRRRAIAAKI+ GLR  GNYKLPKHCDNNEVLKALC EAGWIVEE
Sbjct  9    RMPTWKERENNKRRERRRRAIAAKIYTGLRAQGNYKLPKHCDNNEVLKALCAEAGWIVEE  68

Query  320  DGTTYRKGCKPTERMDIMG  376
            DGTTYRKGCK     +I G
Sbjct  69   DGTTYRKGCKRPTGSEIGG  87



>ref|XP_003537545.1| PREDICTED: BES1/BZR1 homolog protein 2-like [Glycine max]
Length=310

 Score = 96.7 bits (239),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 67/79 (85%), Positives = 69/79 (87%), Gaps = 0/79 (0%)
 Frame = +2

Query  140  RLPTWkerennkrrerrrraiaakiFAGLRMYGNYKLPKHCDNNEVLKALCKEAGWIVEE  319
            RLPTWKERENNKRRERRRRAIAAKI+ GLR  GNYKLPKHCDNNEVLKALC EAGWIVEE
Sbjct  9    RLPTWKERENNKRRERRRRAIAAKIYTGLRAQGNYKLPKHCDNNEVLKALCAEAGWIVEE  68

Query  320  DGTTYRKGCKPTERMDIMG  376
            DGTTYRKGCK     +I G
Sbjct  69   DGTTYRKGCKRPSASEIGG  87



>ref|XP_010558116.1| PREDICTED: BES1/BZR1 homolog protein 1 [Tarenaya hassleriana]
Length=273

 Score = 96.3 bits (238),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 63/73 (86%), Positives = 68/73 (93%), Gaps = 0/73 (0%)
 Frame = +2

Query  140  RLPTWkerennkrrerrrraiaakiFAGLRMYGNYKLPKHCDNNEVLKALCKEAGWIVEE  319
            R PTWKERENNKRRERRRRA+AAKIFAGLR  GN+KLPKHCDNNEVLKALC EAGWIVE+
Sbjct  13   RTPTWKERENNKRRERRRRAVAAKIFAGLRAQGNFKLPKHCDNNEVLKALCSEAGWIVED  72

Query  320  DGTTYRKGCKPTE  358
            DGTTYRKGC+P +
Sbjct  73   DGTTYRKGCRPKQ  85



>sp|Q6EUF1.2|BZR4_ORYSJ RecName: Full=Protein BZR1 homolog 4; Short=OsBZR4; AltName: 
Full=Protein BRASSINAZOLE-RESISTANT 1 homolog 4 [Oryza sativa 
Japonica Group]
Length=351

 Score = 97.1 bits (240),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 66/83 (80%), Positives = 72/83 (87%), Gaps = 2/83 (2%)
 Frame = +2

Query  134  GTRLPTWkerennkrrerrrraiaakiFAGLRMYGNYKLPKHCDNNEVLKALCKEAGWIV  313
            G R+PTW+ERENN+RRERRRRAIAAKI+AGLR YGNY LPKHCDNNEVLKALC EAGW V
Sbjct  7    GGRVPTWRERENNRRRERRRRAIAAKIYAGLRAYGNYTLPKHCDNNEVLKALCNEAGWTV  66

Query  314  EEDGTTYRKGCKP--TERMDIMG  376
            E DGTTYRKGCKP  +E  D +G
Sbjct  67   EPDGTTYRKGCKPPASELADQLG  89



>ref|XP_007047017.1| Brassinosteroid signaling positive regulator family protein isoform 
1 [Theobroma cacao]
 gb|EOX91174.1| Brassinosteroid signaling positive regulator family protein isoform 
1 [Theobroma cacao]
Length=320

 Score = 96.7 bits (239),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 66/71 (93%), Positives = 67/71 (94%), Gaps = 0/71 (0%)
 Frame = +2

Query  140  RLPTWkerennkrrerrrraiaakiFAGLRMYGNYKLPKHCDNNEVLKALCKEAGWIVEE  319
            RLPTWKERENNKRRERRRRAIAAKI+ GLR  GNYKLPKHCDNNEVLKALC EAGWIVEE
Sbjct  7    RLPTWKERENNKRRERRRRAIAAKIYTGLRAQGNYKLPKHCDNNEVLKALCAEAGWIVEE  66

Query  320  DGTTYRKGCKP  352
            DGTTYRKGCKP
Sbjct  67   DGTTYRKGCKP  77



>emb|CAN83287.1| hypothetical protein VITISV_033232 [Vitis vinifera]
Length=307

 Score = 96.3 bits (238),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 41/54 (76%), Positives = 45/54 (83%), Gaps = 0/54 (0%)
 Frame = +2

Query  215  FAGLRMYGNYKLPKHCDNNEVLKALCKEAGWIVEEDGTTYRKGCKPTERMDIMG  376
            +AGLR  GNY+LPKHCDNNEVLKALC EAGW VE+DGTTYRKGCKP    +I G
Sbjct  35   YAGLRAQGNYRLPKHCDNNEVLKALCSEAGWTVEDDGTTYRKGCKPPPSTEIAG  88



>ref|XP_010531182.1| PREDICTED: BES1/BZR1 homolog protein 2-like [Tarenaya hassleriana]
Length=302

 Score = 96.3 bits (238),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 64/75 (85%), Positives = 68/75 (91%), Gaps = 0/75 (0%)
 Frame = +2

Query  128  TSGTRLPTWkerennkrrerrrraiaakiFAGLRMYGNYKLPKHCDNNEVLKALCKEAGW  307
            +S  R PTWKERENNKRRERRRRAI AKI+AGLR  GNYKLPKHCDNNEVLKALC EAGW
Sbjct  6    SSTGRTPTWKERENNKRRERRRRAITAKIYAGLRAQGNYKLPKHCDNNEVLKALCAEAGW  65

Query  308  IVEEDGTTYRKGCKP  352
            IVE+DGTTYR+GCKP
Sbjct  66   IVEDDGTTYRQGCKP  80



>ref|XP_002283352.1| PREDICTED: protein BRASSINAZOLE-RESISTANT 1 [Vitis vinifera]
Length=307

 Score = 96.3 bits (238),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 41/54 (76%), Positives = 45/54 (83%), Gaps = 0/54 (0%)
 Frame = +2

Query  215  FAGLRMYGNYKLPKHCDNNEVLKALCKEAGWIVEEDGTTYRKGCKPTERMDIMG  376
            +AGLR  GNY+LPKHCDNNEVLKALC EAGW VE+DGTTYRKGCKP    +I G
Sbjct  35   YAGLRAQGNYRLPKHCDNNEVLKALCSEAGWTVEDDGTTYRKGCKPPPSTEIAG  88



>ref|XP_010943157.1| PREDICTED: protein BZR1 homolog 1-like [Elaeis guineensis]
Length=309

 Score = 96.3 bits (238),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 67/76 (88%), Positives = 71/76 (93%), Gaps = 1/76 (1%)
 Frame = +2

Query  125  MTSGT-RLPTWkerennkrrerrrraiaakiFAGLRMYGNYKLPKHCDNNEVLKALCKEA  301
            MTSG  RLPTW+ERENNKRRERRRRAIAAKIF+GLR  GNYKLPKHCDNNEVLKALC EA
Sbjct  1    MTSGGGRLPTWRERENNKRRERRRRAIAAKIFSGLRTLGNYKLPKHCDNNEVLKALCGEA  60

Query  302  GWIVEEDGTTYRKGCK  349
            GW+VE+DGTTYRKGCK
Sbjct  61   GWVVEDDGTTYRKGCK  76



>emb|CDP02805.1| unnamed protein product [Coffea canephora]
Length=317

 Score = 96.3 bits (238),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 67/75 (89%), Positives = 69/75 (92%), Gaps = 0/75 (0%)
 Frame = +2

Query  128  TSGTRLPTWkerennkrrerrrraiaakiFAGLRMYGNYKLPKHCDNNEVLKALCKEAGW  307
            +S  RLPTWKERENNKRRERRRRAIAAKIFAGLR  GNYKLPKHCDNNEVLKALC EAGW
Sbjct  8    SSSGRLPTWKERENNKRRERRRRAIAAKIFAGLRAQGNYKLPKHCDNNEVLKALCSEAGW  67

Query  308  IVEEDGTTYRKGCKP  352
            IVE+DGTTYRKG KP
Sbjct  68   IVEDDGTTYRKGGKP  82



>ref|XP_002310201.1| hypothetical protein POPTR_0007s12370g [Populus trichocarpa]
 gb|ABK92480.1| unknown [Populus trichocarpa]
 gb|EEE90651.1| hypothetical protein POPTR_0007s12370g [Populus trichocarpa]
Length=317

 Score = 96.3 bits (238),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 66/74 (89%), Positives = 68/74 (92%), Gaps = 0/74 (0%)
 Frame = +2

Query  131  SGTRLPTWkerennkrrerrrraiaakiFAGLRMYGNYKLPKHCDNNEVLKALCKEAGWI  310
            S  RLPTWKERENNKRRERRRRAIAAKI+ GLR  GN+KLPKHCDNNEVLKALC EAGWI
Sbjct  6    SSGRLPTWKERENNKRRERRRRAIAAKIYTGLRTQGNFKLPKHCDNNEVLKALCAEAGWI  65

Query  311  VEEDGTTYRKGCKP  352
            VEEDGTTYRKGCKP
Sbjct  66   VEEDGTTYRKGCKP  79



>emb|CBI19651.3| unnamed protein product [Vitis vinifera]
Length=286

 Score = 95.9 bits (237),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 41/54 (76%), Positives = 45/54 (83%), Gaps = 0/54 (0%)
 Frame = +2

Query  215  FAGLRMYGNYKLPKHCDNNEVLKALCKEAGWIVEEDGTTYRKGCKPTERMDIMG  376
            +AGLR  GNY+LPKHCDNNEVLKALC EAGW VE+DGTTYRKGCKP    +I G
Sbjct  35   YAGLRAQGNYRLPKHCDNNEVLKALCSEAGWTVEDDGTTYRKGCKPPPSTEIAG  88



>ref|XP_002463083.1| hypothetical protein SORBIDRAFT_02g037500 [Sorghum bicolor]
 gb|EER99604.1| hypothetical protein SORBIDRAFT_02g037500 [Sorghum bicolor]
Length=336

 Score = 96.3 bits (238),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 65/75 (87%), Positives = 68/75 (91%), Gaps = 0/75 (0%)
 Frame = +2

Query  140  RLPTWkerennkrrerrrraiaakiFAGLRMYGNYKLPKHCDNNEVLKALCKEAGWIVEE  319
            R PTWKERENNKRRERRRRAIAAKIF GLR  GNYKLPKHCDNNEVLKALC+EAGW+VE+
Sbjct  17   RTPTWKERENNKRRERRRRAIAAKIFTGLRALGNYKLPKHCDNNEVLKALCREAGWVVED  76

Query  320  DGTTYRKGCKPTERM  364
            DGTTYRKGCKP   M
Sbjct  77   DGTTYRKGCKPPPGM  91



>ref|XP_008653282.1| PREDICTED: protein BZR1 homolog 1-like [Zea mays]
 tpg|DAA63315.1| TPA: BES1/BZR1 protein [Zea mays]
Length=317

 Score = 96.3 bits (238),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 64/75 (85%), Positives = 68/75 (91%), Gaps = 0/75 (0%)
 Frame = +2

Query  140  RLPTWkerennkrrerrrraiaakiFAGLRMYGNYKLPKHCDNNEVLKALCKEAGWIVEE  319
            R PTWKERENNKRRERRRRAIAAKIF GLR  GNYKLPKHCDNNEVLKALC+EAGW+VE+
Sbjct  13   RTPTWKERENNKRRERRRRAIAAKIFTGLRALGNYKLPKHCDNNEVLKALCREAGWVVED  72

Query  320  DGTTYRKGCKPTERM  364
            DGTTYRKGC+P   M
Sbjct  73   DGTTYRKGCRPPPGM  87



>ref|XP_004300602.1| PREDICTED: BES1/BZR1 homolog protein 2 [Fragaria vesca subsp. 
vesca]
Length=322

 Score = 95.9 bits (237),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 67/82 (82%), Positives = 73/82 (89%), Gaps = 2/82 (2%)
 Frame = +2

Query  131  SGTRLPTWkerennkrrerrrraiaakiFAGLRMYGNYKLPKHCDNNEVLKALCKEAGWI  310
            S  RLPTWKERENNKRRERRRRAIAAKI++GLR  G+YKLPKHCDNNEVLKALC EAGW+
Sbjct  6    SSGRLPTWKERENNKRRERRRRAIAAKIYSGLRAQGSYKLPKHCDNNEVLKALCAEAGWV  65

Query  311  VEEDGTTYRKGCKPTERMDIMG  376
            VEEDGTTYRKGCKP   ++I G
Sbjct  66   VEEDGTTYRKGCKPP--IEIAG  85



>gb|KDP31804.1| hypothetical protein JCGZ_12265 [Jatropha curcas]
Length=318

 Score = 95.9 bits (237),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 70/87 (80%), Positives = 75/87 (86%), Gaps = 4/87 (5%)
 Frame = +2

Query  125  MTSGT---RLPTWkerennkrrerrrraiaakiFAGLRMYGNYKLPKHCDNNEVLKALCK  295
            MT+G    RLPTWKERENNKRRERRRRAIAAKI++GLR  GNYKLPKHCDNNEVLKALC 
Sbjct  1    MTAGGCSGRLPTWKERENNKRRERRRRAIAAKIYSGLRAQGNYKLPKHCDNNEVLKALCA  60

Query  296  EAGWIVEEDGTTYRKGCKPTERMDIMG  376
            EAGWIVEEDGTTYRKG KP   ++I G
Sbjct  61   EAGWIVEEDGTTYRKGSKPPP-LEIAG  86



>emb|CDX90690.1| BnaA03g40910D [Brassica napus]
Length=285

 Score = 95.9 bits (237),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 64/73 (88%), Positives = 67/73 (92%), Gaps = 0/73 (0%)
 Frame = +2

Query  140  RLPTWkerennkrrerrrraiaakiFAGLRMYGNYKLPKHCDNNEVLKALCKEAGWIVEE  319
            R+PTWKERENNK+RERRRRAIAAKIF GLR  GNYKLPKHCDNNEVLKALC EAGWIV E
Sbjct  19   RMPTWKERENNKKRERRRRAIAAKIFTGLRSQGNYKLPKHCDNNEVLKALCVEAGWIVHE  78

Query  320  DGTTYRKGCKPTE  358
            DGTTYRKG +PTE
Sbjct  79   DGTTYRKGSRPTE  91



>sp|Q7XI96.1|BZR1_ORYSJ RecName: Full=Protein BZR1 homolog 1; Short=OsBZR1; AltName: 
Full=Protein BRASSINAZOLE-RESISTANT 1 homolog 1 [Oryza sativa 
Japonica Group]
 sp|B8B7S5.1|BZR1_ORYSI RecName: Full=Protein BZR1 homolog 1; Short=OsBZR1; AltName: 
Full=Protein BRASSINAZOLE-RESISTANT 1 homolog 1 [Oryza sativa 
Indica Group]
 dbj|BAC79822.1| putative mature anther-specific protein LAT61 [Oryza sativa Japonica 
Group]
 gb|EAZ40428.1| hypothetical protein OsJ_24880 [Oryza sativa Japonica Group]
 dbj|BAG97818.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEC82329.1| hypothetical protein OsI_26618 [Oryza sativa Indica Group]
Length=298

 Score = 95.9 bits (237),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 67/80 (84%), Positives = 70/80 (88%), Gaps = 4/80 (5%)
 Frame = +2

Query  125  MTSGT----RLPTWkerennkrrerrrraiaakiFAGLRMYGNYKLPKHCDNNEVLKALC  292
            MTSG     R PTWKERENNKRRERRRRAIAAKIF GLR  GNY LPKHCDNNEVLKALC
Sbjct  1    MTSGAAAAGRTPTWKERENNKRRERRRRAIAAKIFTGLRALGNYNLPKHCDNNEVLKALC  60

Query  293  KEAGWIVEEDGTTYRKGCKP  352
            +EAGW+VE+DGTTYRKGCKP
Sbjct  61   REAGWVVEDDGTTYRKGCKP  80



>ref|NP_001060100.2| Os07g0580500 [Oryza sativa Japonica Group]
 dbj|BAF22014.2| Os07g0580500, partial [Oryza sativa Japonica Group]
Length=304

 Score = 95.9 bits (237),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 67/80 (84%), Positives = 70/80 (88%), Gaps = 4/80 (5%)
 Frame = +2

Query  125  MTSGT----RLPTWkerennkrrerrrraiaakiFAGLRMYGNYKLPKHCDNNEVLKALC  292
            MTSG     R PTWKERENNKRRERRRRAIAAKIF GLR  GNY LPKHCDNNEVLKALC
Sbjct  7    MTSGAAAAGRTPTWKERENNKRRERRRRAIAAKIFTGLRALGNYNLPKHCDNNEVLKALC  66

Query  293  KEAGWIVEEDGTTYRKGCKP  352
            +EAGW+VE+DGTTYRKGCKP
Sbjct  67   REAGWVVEDDGTTYRKGCKP  86



>ref|XP_009136556.1| PREDICTED: BES1/BZR1 homolog protein 1 [Brassica rapa]
Length=285

 Score = 95.5 bits (236),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 64/73 (88%), Positives = 67/73 (92%), Gaps = 0/73 (0%)
 Frame = +2

Query  140  RLPTWkerennkrrerrrraiaakiFAGLRMYGNYKLPKHCDNNEVLKALCKEAGWIVEE  319
            R+PTWKERENNK+RERRRRAIAAKIF GLR  GNYKLPKHCDNNEVLKALC EAGWIV E
Sbjct  19   RMPTWKERENNKKRERRRRAIAAKIFTGLRSQGNYKLPKHCDNNEVLKALCVEAGWIVHE  78

Query  320  DGTTYRKGCKPTE  358
            DGTTYRKG +PTE
Sbjct  79   DGTTYRKGSRPTE  91



>gb|ADE77805.1| unknown [Picea sitchensis]
Length=302

 Score = 95.5 bits (236),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 66/81 (81%), Positives = 71/81 (88%), Gaps = 0/81 (0%)
 Frame = +2

Query  125  MTSGTRLPTWkerennkrrerrrraiaakiFAGLRMYGNYKLPKHCDNNEVLKALCKEAG  304
            MTSG RLPT KERENNKRRERRRRAIAA+IFAGLR+YGNYKLPKHCDNNEVLKALC EAG
Sbjct  1    MTSGGRLPTSKERENNKRRERRRRAIAARIFAGLRLYGNYKLPKHCDNNEVLKALCAEAG  60

Query  305  WIVEEDGTTYRKGCKPTERMD  367
            WIV++DGTTYR G     R+ 
Sbjct  61   WIVDQDGTTYRPGTHGCTRIS  81



>ref|XP_007156901.1| hypothetical protein PHAVU_002G0268001g, partial [Phaseolus vulgaris]
 gb|ESW28895.1| hypothetical protein PHAVU_002G0268001g, partial [Phaseolus vulgaris]
Length=94

 Score = 91.7 bits (226),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 65/79 (82%), Positives = 69/79 (87%), Gaps = 0/79 (0%)
 Frame = +2

Query  140  RLPTWkerennkrrerrrraiaakiFAGLRMYGNYKLPKHCDNNEVLKALCKEAGWIVEE  319
            R+PTWKERENNKRRERRRRAIAAKI+ GLR  GN+KLPKHCDNNEVLKALC EAGWIVEE
Sbjct  9    RMPTWKERENNKRRERRRRAIAAKIYTGLRAQGNFKLPKHCDNNEVLKALCAEAGWIVEE  68

Query  320  DGTTYRKGCKPTERMDIMG  376
            DGTTYRKGCK     +I G
Sbjct  69   DGTTYRKGCKRPTGSEIGG  87



>ref|NP_190644.1| BES1/BZR1 1 [Arabidopsis thaliana]
 sp|Q9S7F3.1|BEH1_ARATH RecName: Full=BES1/BZR1 homolog protein 1 [Arabidopsis thaliana]
 emb|CAB42904.1| putative protein [Arabidopsis thaliana]
 emb|CAB62444.1| putative protein [Arabidopsis thaliana]
 gb|AAO00812.1| putative protein [Arabidopsis thaliana]
 gb|AAP13418.1| At3g50750 [Arabidopsis thaliana]
 gb|AEE78704.1| BES1/BZR1 1 [Arabidopsis thaliana]
Length=276

 Score = 95.1 bits (235),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 64/73 (88%), Positives = 67/73 (92%), Gaps = 0/73 (0%)
 Frame = +2

Query  140  RLPTWkerennkrrerrrraiaakiFAGLRMYGNYKLPKHCDNNEVLKALCKEAGWIVEE  319
            R+PTWKERENNK+RERRRRAIAAKIF GLR  GNYKLPKHCDNNEVLKALC EAGWIV E
Sbjct  14   RMPTWKERENNKKRERRRRAIAAKIFTGLRSQGNYKLPKHCDNNEVLKALCLEAGWIVHE  73

Query  320  DGTTYRKGCKPTE  358
            DGTTYRKG +PTE
Sbjct  74   DGTTYRKGSRPTE  86



>ref|XP_002510347.1| BRASSINAZOLE-RESISTANT 1 protein, putative [Ricinus communis]
 gb|EEF52534.1| BRASSINAZOLE-RESISTANT 1 protein, putative [Ricinus communis]
Length=321

 Score = 95.5 bits (236),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 62/79 (78%), Positives = 71/79 (90%), Gaps = 1/79 (1%)
 Frame = +2

Query  140  RLPTWkerennkrrerrrraiaakiFAGLRMYGNYKLPKHCDNNEVLKALCKEAGWIVEE  319
            R P+W+ERENN+RRERRRRAIAAKIF+GLR  GNY LPKHCDNNEVLKALC EAGW+VE+
Sbjct  18   RKPSWRERENNRRRERRRRAIAAKIFSGLRAQGNYNLPKHCDNNEVLKALCSEAGWVVED  77

Query  320  DGTTYRKGCKPTERMDIMG  376
            DGTTYRKGC+P   +DI+G
Sbjct  78   DGTTYRKGCRPPP-IDIVG  95



>ref|XP_003517250.1| PREDICTED: BES1/BZR1 homolog protein 2-like [Glycine max]
Length=308

 Score = 95.5 bits (236),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 67/76 (88%), Positives = 69/76 (91%), Gaps = 1/76 (1%)
 Frame = +2

Query  140  RLPTWkerennkrrerrrraiaakiFAGLRMYGNYKLPKHCDNNEVLKALCKEAGWIVEE  319
            RLPTWKERENNKRRERRRRAIAAKI+ GLR  GNYKLPKHCDNNEVLKALC EAGWIVEE
Sbjct  9    RLPTWKERENNKRRERRRRAIAAKIYTGLRAQGNYKLPKHCDNNEVLKALCAEAGWIVEE  68

Query  320  DGTTYRKGCK-PTERM  364
            DGTTYRKGCK PT  +
Sbjct  69   DGTTYRKGCKRPTSEI  84



>ref|NP_001151195.1| BES1/BZR1 protein [Zea mays]
 gb|ACG41944.1| BES1/BZR1 protein [Zea mays]
Length=313

 Score = 95.5 bits (236),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 64/75 (85%), Positives = 68/75 (91%), Gaps = 0/75 (0%)
 Frame = +2

Query  140  RLPTWkerennkrrerrrraiaakiFAGLRMYGNYKLPKHCDNNEVLKALCKEAGWIVEE  319
            R PTWKERENNKRRERRRRAIAAKIF GLR  GNYKLPKHCDNNEVLKALC+EAGW+VE+
Sbjct  14   RTPTWKERENNKRRERRRRAIAAKIFTGLRALGNYKLPKHCDNNEVLKALCREAGWVVED  73

Query  320  DGTTYRKGCKPTERM  364
            DGTTYRKGC+P   M
Sbjct  74   DGTTYRKGCRPPPGM  88



>ref|XP_008806188.1| PREDICTED: protein BZR1 homolog 1-like [Phoenix dactylifera]
Length=308

 Score = 95.5 bits (236),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 67/76 (88%), Positives = 70/76 (92%), Gaps = 1/76 (1%)
 Frame = +2

Query  125  MTSGT-RLPTWkerennkrrerrrraiaakiFAGLRMYGNYKLPKHCDNNEVLKALCKEA  301
            MTSG  RLPTWKERENNKRRERRRRAIAAKIF+GLR  G YKLPKHCDNNEVLKALC EA
Sbjct  1    MTSGGGRLPTWKERENNKRRERRRRAIAAKIFSGLRTLGKYKLPKHCDNNEVLKALCAEA  60

Query  302  GWIVEEDGTTYRKGCK  349
            GW+VEEDGTTYR+GCK
Sbjct  61   GWVVEEDGTTYRRGCK  76



>gb|KDO79470.1| hypothetical protein CISIN_1g020929mg [Citrus sinensis]
Length=319

 Score = 95.1 bits (235),  Expect = 6e-20, Method: Compositional matrix adjust.
 Identities = 65/74 (88%), Positives = 68/74 (92%), Gaps = 0/74 (0%)
 Frame = +2

Query  131  SGTRLPTWkerennkrrerrrraiaakiFAGLRMYGNYKLPKHCDNNEVLKALCKEAGWI  310
            S  RLPTWKERENNKRRERRRRAIAAKIF+GLR  GN+KLPKHCDNNEVLKALC EAGWI
Sbjct  6    SSGRLPTWKERENNKRRERRRRAIAAKIFSGLRAEGNFKLPKHCDNNEVLKALCAEAGWI  65

Query  311  VEEDGTTYRKGCKP  352
            VEEDGTTYRKG +P
Sbjct  66   VEEDGTTYRKGSRP  79



>ref|XP_008440681.1| PREDICTED: BES1/BZR1 homolog protein 2 [Cucumis melo]
Length=319

 Score = 95.1 bits (235),  Expect = 6e-20, Method: Compositional matrix adjust.
 Identities = 65/74 (88%), Positives = 67/74 (91%), Gaps = 0/74 (0%)
 Frame = +2

Query  131  SGTRLPTWkerennkrrerrrraiaakiFAGLRMYGNYKLPKHCDNNEVLKALCKEAGWI  310
            S  R PTWKERENNKRRERRRRAIAAKI+ GLR  GNYKLPKHCDNNEVLKALC EAGW+
Sbjct  6    SSGRTPTWKERENNKRRERRRRAIAAKIYTGLRAQGNYKLPKHCDNNEVLKALCNEAGWV  65

Query  311  VEEDGTTYRKGCKP  352
            VEEDGTTYRKGCKP
Sbjct  66   VEEDGTTYRKGCKP  79



>ref|XP_004143497.1| PREDICTED: BES1/BZR1 homolog protein 2-like [Cucumis sativus]
 ref|XP_004160145.1| PREDICTED: BES1/BZR1 homolog protein 2-like [Cucumis sativus]
 gb|KGN48804.1| hypothetical protein Csa_6G501930 [Cucumis sativus]
Length=319

 Score = 95.1 bits (235),  Expect = 6e-20, Method: Compositional matrix adjust.
 Identities = 65/74 (88%), Positives = 67/74 (91%), Gaps = 0/74 (0%)
 Frame = +2

Query  131  SGTRLPTWkerennkrrerrrraiaakiFAGLRMYGNYKLPKHCDNNEVLKALCKEAGWI  310
            S  R PTWKERENNKRRERRRRAIAAKI+ GLR  GNYKLPKHCDNNEVLKALC EAGW+
Sbjct  6    SSGRTPTWKERENNKRRERRRRAIAAKIYTGLRAQGNYKLPKHCDNNEVLKALCNEAGWV  65

Query  311  VEEDGTTYRKGCKP  352
            VEEDGTTYRKGCKP
Sbjct  66   VEEDGTTYRKGCKP  79



>ref|XP_006466728.1| PREDICTED: BES1/BZR1 homolog protein 2-like [Citrus sinensis]
Length=319

 Score = 95.1 bits (235),  Expect = 7e-20, Method: Compositional matrix adjust.
 Identities = 65/74 (88%), Positives = 68/74 (92%), Gaps = 0/74 (0%)
 Frame = +2

Query  131  SGTRLPTWkerennkrrerrrraiaakiFAGLRMYGNYKLPKHCDNNEVLKALCKEAGWI  310
            S  RLPTWKERENNKRRERRRRAIAAKIF+GLR  GN+KLPKHCDNNEVLKALC EAGWI
Sbjct  6    SSGRLPTWKERENNKRRERRRRAIAAKIFSGLRAEGNFKLPKHCDNNEVLKALCAEAGWI  65

Query  311  VEEDGTTYRKGCKP  352
            VEEDGTTYRKG +P
Sbjct  66   VEEDGTTYRKGSRP  79



>ref|XP_010070026.1| PREDICTED: BES1/BZR1 homolog protein 2-like [Eucalyptus grandis]
 gb|KCW58581.1| hypothetical protein EUGRSUZ_H01239 [Eucalyptus grandis]
Length=320

 Score = 95.1 bits (235),  Expect = 7e-20, Method: Compositional matrix adjust.
 Identities = 67/79 (85%), Positives = 70/79 (89%), Gaps = 1/79 (1%)
 Frame = +2

Query  140  RLPTWkerennkrrerrrraiaakiFAGLRMYGNYKLPKHCDNNEVLKALCKEAGWIVEE  319
            RLPTWKERENNKRRERRRRAIAAKI+ GLR  GNYKLPKHCDNNEVLKALC EAGW+VEE
Sbjct  8    RLPTWKERENNKRRERRRRAIAAKIYTGLRAQGNYKLPKHCDNNEVLKALCTEAGWVVEE  67

Query  320  DGTTYRKGCKPTERMDIMG  376
            DGTTYRKG KP    +IMG
Sbjct  68   DGTTYRKGSKPPP-GEIMG  85



>ref|XP_006404006.1| hypothetical protein EUTSA_v10010593mg [Eutrema salsugineum]
 gb|ESQ45459.1| hypothetical protein EUTSA_v10010593mg [Eutrema salsugineum]
Length=290

 Score = 94.7 bits (234),  Expect = 7e-20, Method: Compositional matrix adjust.
 Identities = 65/73 (89%), Positives = 67/73 (92%), Gaps = 0/73 (0%)
 Frame = +2

Query  140  RLPTWkerennkrrerrrraiaakiFAGLRMYGNYKLPKHCDNNEVLKALCKEAGWIVEE  319
            R+PTWKERENNKRRERRRRAIAAKIF GLR  GNYKLPKHCDNNEVLKALC EAGWIV E
Sbjct  20   RMPTWKERENNKRRERRRRAIAAKIFTGLRSQGNYKLPKHCDNNEVLKALCLEAGWIVHE  79

Query  320  DGTTYRKGCKPTE  358
            DGTTYRKG +PTE
Sbjct  80   DGTTYRKGSRPTE  92



>ref|XP_002877766.1| hypothetical protein ARALYDRAFT_485421 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH54025.1| hypothetical protein ARALYDRAFT_485421 [Arabidopsis lyrata subsp. 
lyrata]
Length=286

 Score = 94.7 bits (234),  Expect = 8e-20, Method: Compositional matrix adjust.
 Identities = 68/84 (81%), Positives = 72/84 (86%), Gaps = 1/84 (1%)
 Frame = +2

Query  110  GRRREMTSGT-RLPTWkerennkrrerrrraiaakiFAGLRMYGNYKLPKHCDNNEVLKA  286
            G   E T+ T R+PTWKERENNKRRERRRRAIAAKIF GLR  GNYKLPKHCDNNEVLKA
Sbjct  6    GGEGESTAATGRMPTWKERENNKRRERRRRAIAAKIFTGLRSQGNYKLPKHCDNNEVLKA  65

Query  287  LCKEAGWIVEEDGTTYRKGCKPTE  358
            LC EAGWIV EDG+TYRKG +PTE
Sbjct  66   LCLEAGWIVHEDGSTYRKGSRPTE  89



>ref|XP_006425734.1| hypothetical protein CICLE_v10026102mg [Citrus clementina]
 gb|ESR38974.1| hypothetical protein CICLE_v10026102mg [Citrus clementina]
Length=319

 Score = 95.1 bits (235),  Expect = 8e-20, Method: Compositional matrix adjust.
 Identities = 65/74 (88%), Positives = 68/74 (92%), Gaps = 0/74 (0%)
 Frame = +2

Query  131  SGTRLPTWkerennkrrerrrraiaakiFAGLRMYGNYKLPKHCDNNEVLKALCKEAGWI  310
            S  RLPTWKERENNKRRERRRRAIAAKIF+GLR  GN+KLPKHCDNNEVLKALC EAGWI
Sbjct  6    SSGRLPTWKERENNKRRERRRRAIAAKIFSGLRAEGNFKLPKHCDNNEVLKALCAEAGWI  65

Query  311  VEEDGTTYRKGCKP  352
            VEEDGTTYRKG +P
Sbjct  66   VEEDGTTYRKGSRP  79



>ref|XP_007017466.1| Brassinosteroid signaling positive regulator family protein [Theobroma 
cacao]
 gb|EOY14691.1| Brassinosteroid signaling positive regulator family protein [Theobroma 
cacao]
Length=311

 Score = 94.7 bits (234),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 63/79 (80%), Positives = 69/79 (87%), Gaps = 1/79 (1%)
 Frame = +2

Query  140  RLPTWkerennkrrerrrraiaakiFAGLRMYGNYKLPKHCDNNEVLKALCKEAGWIVEE  319
            R P+W+ERENN+RRERRRRAIAAKI+ GLR  GNY LPKHCDNNEVLKALC EAGW+VEE
Sbjct  14   RKPSWRERENNRRRERRRRAIAAKIYTGLRAQGNYNLPKHCDNNEVLKALCAEAGWVVEE  73

Query  320  DGTTYRKGCKPTERMDIMG  376
            DGTTYRKGCKP   +DI G
Sbjct  74   DGTTYRKGCKPPP-IDIPG  91



>gb|KJB59824.1| hypothetical protein B456_009G274000 [Gossypium raimondii]
Length=314

 Score = 94.7 bits (234),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 42/55 (76%), Positives = 45/55 (82%), Gaps = 1/55 (2%)
 Frame = +2

Query  215  FAGLRMYGNYKLPKHCDNNEVLKALCKEAGWIVEEDGTTYRKGCKPTER-MDIMG  376
            + GLR  GNY LPKHCDNNEVLKALC EAGW+VEEDGTTYRKGCKP     DI+G
Sbjct  40   YTGLRALGNYNLPKHCDNNEVLKALCAEAGWVVEEDGTTYRKGCKPPRAPTDILG  94



>ref|XP_006342599.1| PREDICTED: protein BRASSINAZOLE-RESISTANT 1-like [Solanum tuberosum]
Length=330

 Score = 94.7 bits (234),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 64/81 (79%), Positives = 70/81 (86%), Gaps = 1/81 (1%)
 Frame = +2

Query  134  GTRLPTWkerennkrrerrrraiaakiFAGLRMYGNYKLPKHCDNNEVLKALCKEAGWIV  313
            G R P+W+ERENN+RRERRRRA+AAKI+ GLR  GNY LPKHCDNNEVLKALC EAGWIV
Sbjct  35   GRRKPSWRERENNRRRERRRRAVAAKIYTGLRAQGNYNLPKHCDNNEVLKALCTEAGWIV  94

Query  314  EEDGTTYRKGCKPTERMDIMG  376
            E DGTTYRKGCKPT  M+I G
Sbjct  95   EPDGTTYRKGCKPTP-MEIGG  114



>emb|CDP07559.1| unnamed protein product [Coffea canephora]
Length=333

 Score = 94.7 bits (234),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 61/76 (80%), Positives = 68/76 (89%), Gaps = 0/76 (0%)
 Frame = +2

Query  125  MTSGTRLPTWkerennkrrerrrraiaakiFAGLRMYGNYKLPKHCDNNEVLKALCKEAG  304
            + +G R P+W+ERENN+RRERRRRAIAAKI+AGLR  GNY LPKHCDNNEVLKALC EAG
Sbjct  34   VVNGRRKPSWRERENNRRRERRRRAIAAKIYAGLRAQGNYNLPKHCDNNEVLKALCAEAG  93

Query  305  WIVEEDGTTYRKGCKP  352
            WIVE DGTTYRKGC+P
Sbjct  94   WIVESDGTTYRKGCRP  109



>ref|XP_010471609.1| PREDICTED: protein BRASSINAZOLE-RESISTANT 1-like [Camelina sativa]
Length=317

 Score = 94.0 bits (232),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 59/82 (72%), Positives = 68/82 (83%), Gaps = 0/82 (0%)
 Frame = +2

Query  107  NGRRREMTSGTRLPTWkerennkrrerrrraiaakiFAGLRMYGNYKLPKHCDNNEVLKA  286
            +G      +  R P+W+ERENN+RRERRRRA+AAKI+ GLR  G+Y LPKHCDNNEVLKA
Sbjct  4    DGATSTSAAARRKPSWRERENNRRRERRRRAVAAKIYTGLRAQGDYNLPKHCDNNEVLKA  63

Query  287  LCKEAGWIVEEDGTTYRKGCKP  352
            LC EAGW+VEEDGTTYRKGCKP
Sbjct  64   LCSEAGWVVEEDGTTYRKGCKP  85



>emb|CDY64371.1| BnaC07g50000D [Brassica napus]
Length=285

 Score = 93.6 bits (231),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 63/73 (86%), Positives = 66/73 (90%), Gaps = 0/73 (0%)
 Frame = +2

Query  140  RLPTWkerennkrrerrrraiaakiFAGLRMYGNYKLPKHCDNNEVLKALCKEAGWIVEE  319
            R+PTWKERENNK+RERRRRAIAAKIF GLR  GNY LPKHCDNNEVLKALC EAGWIV E
Sbjct  19   RMPTWKERENNKKRERRRRAIAAKIFTGLRSQGNYNLPKHCDNNEVLKALCVEAGWIVHE  78

Query  320  DGTTYRKGCKPTE  358
            DGTTYRKG +PTE
Sbjct  79   DGTTYRKGSRPTE  91



>ref|XP_003571150.2| PREDICTED: protein BZR1 homolog 3-like [Brachypodium distachyon]
Length=378

 Score = 94.0 bits (232),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 62/80 (78%), Positives = 68/80 (85%), Gaps = 0/80 (0%)
 Frame = +2

Query  137  TRLPTWkerennkrrerrrraiaakiFAGLRMYGNYKLPKHCDNNEVLKALCKEAGWIVE  316
            +R+PTW+ERENN+RRERRRRAIAAKIF+GLR YGNY LPKHCDNNEVLKALC EAGW VE
Sbjct  17   SRVPTWRERENNRRRERRRRAIAAKIFSGLRSYGNYTLPKHCDNNEVLKALCDEAGWTVE  76

Query  317  EDGTTYRKGCKPTERMDIMG  376
             DGTTYRKG KP    +  G
Sbjct  77   PDGTTYRKGSKPPTAAERAG  96



>gb|EMT29878.1| hypothetical protein F775_52316 [Aegilops tauschii]
Length=355

 Score = 93.6 bits (231),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 70/135 (52%), Positives = 81/135 (60%), Gaps = 9/135 (7%)
 Frame = +2

Query  215  FAGLRMYGNYKLPKHCDNNEVLKALCKEAGWIVEEDGTTYRKGCK--PTERMDIMGssvs  388
            + GLR YGNY LPKHCDNNEVLKALC EAGW+VE DGTTYR+GCK  P  R D M S+ +
Sbjct  42   YTGLRAYGNYNLPKHCDNNEVLKALCNEAGWVVEPDGTTYRRGCKPPPQARTDPMRSASA  101

Query  389  vspcssyqpsqGpsynpspasssfpspvssRYITNNNND----TDPNSLIPWLKNL-ssg  553
                S     +        +SS   S  SS       N+     + +SLIPWLKNL S+ 
Sbjct  102  SPCSSYQPSPRASYNPSPASSSFPSSGSSSHITLGGGNNFIGGVEGSSLIPWLKNLSSNP  161

Query  554  sspsssKLP--HHLY  592
            S  SSSKLP  HHLY
Sbjct  162  SFASSSKLPQLHHLY  176



>ref|XP_010521471.1| PREDICTED: BES1/BZR1 homolog protein 1-like [Tarenaya hassleriana]
Length=274

 Score = 93.2 bits (230),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 61/73 (84%), Positives = 67/73 (92%), Gaps = 0/73 (0%)
 Frame = +2

Query  134  GTRLPTWkerennkrrerrrraiaakiFAGLRMYGNYKLPKHCDNNEVLKALCKEAGWIV  313
            G R PTWKERENNKRRERRRRA+AAKIFAGLR  GN++LPKHCDNNEVLKALC +AGWIV
Sbjct  7    GARTPTWKERENNKRRERRRRAVAAKIFAGLRAQGNFRLPKHCDNNEVLKALCADAGWIV  66

Query  314  EEDGTTYRKGCKP  352
            E+DGTTYRKG +P
Sbjct  67   EDDGTTYRKGSRP  79



>gb|AFK40796.1| unknown [Lotus japonicus]
Length=240

 Score = 92.8 bits (229),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 65/73 (89%), Positives = 67/73 (92%), Gaps = 0/73 (0%)
 Frame = +2

Query  131  SGTRLPTWkerennkrrerrrraiaakiFAGLRMYGNYKLPKHCDNNEVLKALCKEAGWI  310
            S  RLPTWKERENNKRRERRRRAIAAKIF GLR  GN+KLPKHCDNNEVLKALC EAGWI
Sbjct  7    STGRLPTWKERENNKRRERRRRAIAAKIFTGLRAQGNFKLPKHCDNNEVLKALCAEAGWI  66

Query  311  VEEDGTTYRKGCK  349
            VEEDGTTYRKGC+
Sbjct  67   VEEDGTTYRKGCR  79



>emb|CBI20161.3| unnamed protein product [Vitis vinifera]
Length=264

 Score = 92.8 bits (229),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 65/72 (90%), Positives = 67/72 (93%), Gaps = 0/72 (0%)
 Frame = +2

Query  125  MTSGTRLPTWkerennkrrerrrraiaakiFAGLRMYGNYKLPKHCDNNEVLKALCKEAG  304
            MTSGTRLPTWKERENN RRERRRRAIAAKIF+ LRMYGNYKLPKHCDNNEVLKALC +AG
Sbjct  91   MTSGTRLPTWKERENNNRRERRRRAIAAKIFSRLRMYGNYKLPKHCDNNEVLKALCNKAG  150

Query  305  WIVEEDGTTYRK  340
            W VE DGTTYRK
Sbjct  151  WTVELDGTTYRK  162



>gb|KHN36916.1| Protein BRASSINAZOLE-RESISTANT 2 [Glycine soja]
Length=95

 Score = 89.4 bits (220),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 65/72 (90%), Positives = 66/72 (92%), Gaps = 0/72 (0%)
 Frame = +2

Query  125  MTSGTRLPTWkerennkrrerrrraiaakiFAGLRMYGNYKLPKHCDNNEVLKALCKEAG  304
            MTS  R PTWKERENNKRRERRRRAIAAKIF+GLRMYGNYKLPKHCDNNEVLKALC EAG
Sbjct  1    MTSVARQPTWKERENNKRRERRRRAIAAKIFSGLRMYGNYKLPKHCDNNEVLKALCNEAG  60

Query  305  WIVEEDGTTYRK  340
            W VE DGTTYRK
Sbjct  61   WTVEADGTTYRK  72



>gb|KJB58324.1| hypothetical protein B456_009G204600 [Gossypium raimondii]
 gb|KJB58325.1| hypothetical protein B456_009G204600 [Gossypium raimondii]
Length=313

 Score = 93.2 bits (230),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 62/79 (78%), Positives = 69/79 (87%), Gaps = 1/79 (1%)
 Frame = +2

Query  140  RLPTWkerennkrrerrrraiaakiFAGLRMYGNYKLPKHCDNNEVLKALCKEAGWIVEE  319
            R P+W+ERENN+RRERRRRAIAAKI+ GLR  GNY LPKHCDNNEVLKALC EAGW+VE+
Sbjct  16   RKPSWRERENNRRRERRRRAIAAKIYTGLRAQGNYNLPKHCDNNEVLKALCVEAGWVVED  75

Query  320  DGTTYRKGCKPTERMDIMG  376
            DGTTYRKGCKP   +DI G
Sbjct  76   DGTTYRKGCKPPP-IDIAG  93



>ref|NP_001234745.1| mature anther-specific protein LAT61 [Solanum lycopersicum]
 gb|AAK71662.1|AF395901_1 mature anther-specific protein LAT61 [Solanum lycopersicum]
Length=333

 Score = 93.2 bits (230),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 63/79 (80%), Positives = 69/79 (87%), Gaps = 1/79 (1%)
 Frame = +2

Query  140  RLPTWkerennkrrerrrraiaakiFAGLRMYGNYKLPKHCDNNEVLKALCKEAGWIVEE  319
            R P+W+ERENN+RRERRRRA+AAKI+ GLR  GNY LPKHCDNNEVLKALC EAGWIVE 
Sbjct  40   RKPSWRERENNRRRERRRRAVAAKIYTGLRAQGNYNLPKHCDNNEVLKALCTEAGWIVEP  99

Query  320  DGTTYRKGCKPTERMDIMG  376
            DGTTYRKGCKPT  M+I G
Sbjct  100  DGTTYRKGCKPTP-MEIGG  117



>ref|XP_007047018.1| Brassinosteroid signaling positive regulator family protein isoform 
2, partial [Theobroma cacao]
 gb|EOX91175.1| Brassinosteroid signaling positive regulator family protein isoform 
2, partial [Theobroma cacao]
Length=302

 Score = 93.2 bits (230),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 41/46 (89%), Positives = 42/46 (91%), Gaps = 0/46 (0%)
 Frame = +2

Query  215  FAGLRMYGNYKLPKHCDNNEVLKALCKEAGWIVEEDGTTYRKGCKP  352
            + GLR  GNYKLPKHCDNNEVLKALC EAGWIVEEDGTTYRKGCKP
Sbjct  14   YTGLRAQGNYKLPKHCDNNEVLKALCAEAGWIVEEDGTTYRKGCKP  59



>gb|ADE77262.1| unknown [Picea sitchensis]
Length=305

 Score = 93.2 bits (230),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 63/82 (77%), Positives = 70/82 (85%), Gaps = 0/82 (0%)
 Frame = +2

Query  125  MTSGTRLPTWkerennkrrerrrraiaakiFAGLRMYGNYKLPKHCDNNEVLKALCKEAG  304
            MT+G+ LPT KERENNK+RER+RRA+AAKIFAGLR+YGNYKLPKHCDNNEVLKALC EAG
Sbjct  1    MTAGSALPTSKERENNKKRERKRRALAAKIFAGLRLYGNYKLPKHCDNNEVLKALCAEAG  60

Query  305  WIVEEDGTTYRKGCKPTERMDI  370
            WIV  DGTTYR      ER D+
Sbjct  61   WIVHPDGTTYRPDTGIPERADM  82



>ref|XP_006367310.1| PREDICTED: protein BRASSINAZOLE-RESISTANT 1-like [Solanum tuberosum]
Length=331

 Score = 92.8 bits (229),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 62/79 (78%), Positives = 70/79 (89%), Gaps = 1/79 (1%)
 Frame = +2

Query  140  RLPTWkerennkrrerrrraiaakiFAGLRMYGNYKLPKHCDNNEVLKALCKEAGWIVEE  319
            R P+W+ERENN+RRERRRRA+AAKI++GLR  GNY LPKHCDNNEVLKALC EAGWIVE 
Sbjct  36   RKPSWRERENNRRRERRRRAMAAKIYSGLRAQGNYNLPKHCDNNEVLKALCVEAGWIVEP  95

Query  320  DGTTYRKGCKPTERMDIMG  376
            DGTTYRKGC+PT  M+I G
Sbjct  96   DGTTYRKGCRPTP-MEIGG  113



>ref|XP_011083731.1| PREDICTED: protein BRASSINAZOLE-RESISTANT 1 [Sesamum indicum]
Length=324

 Score = 92.8 bits (229),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 64/79 (81%), Positives = 69/79 (87%), Gaps = 1/79 (1%)
 Frame = +2

Query  140  RLPTWkerennkrrerrrraiaakiFAGLRMYGNYKLPKHCDNNEVLKALCKEAGWIVEE  319
            R P+W+ERENN+RRERRRRAIAAKI+AGLR  GNY LPKHCDNNEVLKALC EAGWIVE 
Sbjct  28   RKPSWRERENNRRRERRRRAIAAKIYAGLRAQGNYNLPKHCDNNEVLKALCAEAGWIVEP  87

Query  320  DGTTYRKGCKPTERMDIMG  376
            DGTTYRKGCKP   M+I G
Sbjct  88   DGTTYRKGCKPCP-MEIGG  105



>ref|NP_195396.4| BES1/BZR1-like protein 2 [Arabidopsis thaliana]
 gb|AEE86700.1| BES1/BZR1-like protein 2 [Arabidopsis thaliana]
Length=265

 Score = 92.4 bits (228),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 64/79 (81%), Positives = 68/79 (86%), Gaps = 1/79 (1%)
 Frame = +2

Query  140  RLPTWkerennkrrerrrraiaakiFAGLRMYGNYKLPKHCDNNEVLKALCKEAGWIVEE  319
            R PTWKERENNK+RERRRRAI AKI++GLR  GNYKLPKHCDNNEVLKALC EAGWIVE+
Sbjct  16   RTPTWKERENNKKRERRRRAITAKIYSGLRAQGNYKLPKHCDNNEVLKALCLEAGWIVED  75

Query  320  DGTTYRKGCKPTERMDIMG  376
            DGTTYRKG KP    DI G
Sbjct  76   DGTTYRKGFKPPAS-DISG  93



>gb|AFK43588.1| unknown [Medicago truncatula]
Length=323

 Score = 92.8 bits (229),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 64/73 (88%), Positives = 67/73 (92%), Gaps = 0/73 (0%)
 Frame = +2

Query  131  SGTRLPTWkerennkrrerrrraiaakiFAGLRMYGNYKLPKHCDNNEVLKALCKEAGWI  310
            S  RLPTWKERENNKRRERRRRAIAAKI++GLR  GN+KLPKHCDNNEVLKALC EAGWI
Sbjct  6    SSGRLPTWKERENNKRRERRRRAIAAKIYSGLRAQGNFKLPKHCDNNEVLKALCSEAGWI  65

Query  311  VEEDGTTYRKGCK  349
            VEEDGTTYRKG K
Sbjct  66   VEEDGTTYRKGSK  78



>ref|XP_006583443.1| PREDICTED: protein argonaute 4-like [Glycine max]
Length=253

 Score = 92.0 bits (227),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 69/106 (65%), Positives = 76/106 (72%), Gaps = 2/106 (2%)
 Frame = +2

Query  65   FG*EPRRPVSSEKRNGRRREMTSGT--RLPTWkerennkrrerrrraiaakiFAGLRMYG  238
            F  + RR V + K          G+  RLPTWKERENNKRRERR+RAIAAKI+ GLR  G
Sbjct  57   FAFDDRRGVETNKLRFAETMTGGGSTGRLPTWKERENNKRRERRQRAIAAKIYTGLRAQG  116

Query  239  NYKLPKHCDNNEVLKALCKEAGWIVEEDGTTYRKGCKPTERMDIMG  376
            NYKL KHCDNNEV+KALC E GWIVEEDGTTYRKGCK     +I G
Sbjct  117  NYKLLKHCDNNEVVKALCAEVGWIVEEDGTTYRKGCKRPSASEIEG  162



>ref|XP_010426615.1| PREDICTED: BES1/BZR1 homolog protein 1 [Camelina sativa]
Length=279

 Score = 92.4 bits (228),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 64/73 (88%), Positives = 66/73 (90%), Gaps = 0/73 (0%)
 Frame = +2

Query  140  RLPTWkerennkrrerrrraiaakiFAGLRMYGNYKLPKHCDNNEVLKALCKEAGWIVEE  319
            R+PTWKERENNKRRERRRRAIAAKIF GLR  GNYKLPKHCDNNEVLKALC EAGWIV E
Sbjct  18   RMPTWKERENNKRRERRRRAIAAKIFTGLRSQGNYKLPKHCDNNEVLKALCLEAGWIVHE  77

Query  320  DGTTYRKGCKPTE  358
            DGTTYRKG +P E
Sbjct  78   DGTTYRKGSRPME  90



>ref|XP_003611934.1| BES1/BZR1-like protein [Medicago truncatula]
 gb|AES94892.1| brassinazole-resistant 1 protein [Medicago truncatula]
Length=323

 Score = 92.8 bits (229),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 64/73 (88%), Positives = 67/73 (92%), Gaps = 0/73 (0%)
 Frame = +2

Query  131  SGTRLPTWkerennkrrerrrraiaakiFAGLRMYGNYKLPKHCDNNEVLKALCKEAGWI  310
            S  RLPTWKERENNKRRERRRRAIAAKI++GLR  GN+KLPKHCDNNEVLKALC EAGWI
Sbjct  6    SSGRLPTWKERENNKRRERRRRAIAAKIYSGLRAQGNFKLPKHCDNNEVLKALCSEAGWI  65

Query  311  VEEDGTTYRKGCK  349
            VEEDGTTYRKG K
Sbjct  66   VEEDGTTYRKGSK  78



>ref|XP_010548357.1| PREDICTED: BES1/BZR1 homolog protein 2-like [Tarenaya hassleriana]
Length=306

 Score = 92.4 bits (228),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 63/79 (80%), Positives = 69/79 (87%), Gaps = 2/79 (3%)
 Frame = +2

Query  128  TSGTRLPTWkerennkrrerrrraiaakiFAGLRMYGNYKLPKHCDNNEVLKALCKEAGW  307
            +S  R PTWKER+NNKRRERRRRAI AKI+AGLR  GN+KLPKHCDNNEVLKALC EAGW
Sbjct  6    SSTGRTPTWKERDNNKRRERRRRAITAKIYAGLRAQGNFKLPKHCDNNEVLKALCAEAGW  65

Query  308  IVEEDGTTYRKGC--KPTE  358
            IVE+DGTTYRKGC  +P E
Sbjct  66   IVEDDGTTYRKGCTLQPAE  84



>gb|EYU45114.1| hypothetical protein MIMGU_mgv1a009718mg [Erythranthe guttata]
Length=333

 Score = 92.8 bits (229),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 63/79 (80%), Positives = 70/79 (89%), Gaps = 1/79 (1%)
 Frame = +2

Query  140  RLPTWkerennkrrerrrraiaakiFAGLRMYGNYKLPKHCDNNEVLKALCKEAGWIVEE  319
            R P+W+ERENN+RRERRRRAIAAKI+AGLR  GNY LPKHCDNNEVLKALC EAGWIVE 
Sbjct  30   RKPSWRERENNRRRERRRRAIAAKIYAGLRAQGNYNLPKHCDNNEVLKALCNEAGWIVEP  89

Query  320  DGTTYRKGCKPTERMDIMG  376
            DGTTYRKGC+P+  M+I G
Sbjct  90   DGTTYRKGCRPSP-MEIGG  107



>ref|XP_004238228.1| PREDICTED: protein BRASSINAZOLE-RESISTANT 1 [Solanum lycopersicum]
Length=328

 Score = 92.4 bits (228),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 63/79 (80%), Positives = 70/79 (89%), Gaps = 1/79 (1%)
 Frame = +2

Query  140  RLPTWkerennkrrerrrraiaakiFAGLRMYGNYKLPKHCDNNEVLKALCKEAGWIVEE  319
            R P+W+ERENN+RRERRRRAIAAKI++GLR  GNY LPKHCDNNEVLKALC EAGWIVE 
Sbjct  33   RKPSWRERENNRRRERRRRAIAAKIYSGLRAQGNYNLPKHCDNNEVLKALCVEAGWIVEP  92

Query  320  DGTTYRKGCKPTERMDIMG  376
            DGTTYRKGC+PT  M+I G
Sbjct  93   DGTTYRKGCRPTP-MEIGG  110



>ref|XP_008220760.1| PREDICTED: protein BRASSINAZOLE-RESISTANT 1 [Prunus mume]
Length=294

 Score = 92.4 bits (228),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 61/84 (73%), Positives = 69/84 (82%), Gaps = 0/84 (0%)
 Frame = +2

Query  107  NGRRREMTSGTRLPTWkerennkrrerrrraiaakiFAGLRMYGNYKLPKHCDNNEVLKA  286
            +G     T   R P+W+ERENN+RRERRRRAIAAKIFAGLR  GN+ LPKHCDNNEVLKA
Sbjct  4    DGATSAATVARRKPSWRERENNRRRERRRRAIAAKIFAGLRAQGNFNLPKHCDNNEVLKA  63

Query  287  LCKEAGWIVEEDGTTYRKGCKPTE  358
            LC +AGW VE+DGTTYRKG KPT+
Sbjct  64   LCLQAGWTVEDDGTTYRKGLKPTQ  87



>gb|KJB29554.1| hypothetical protein B456_005G107000 [Gossypium raimondii]
Length=313

 Score = 92.4 bits (228),  Expect = 6e-19, Method: Compositional matrix adjust.
 Identities = 62/79 (78%), Positives = 69/79 (87%), Gaps = 1/79 (1%)
 Frame = +2

Query  140  RLPTWkerennkrrerrrraiaakiFAGLRMYGNYKLPKHCDNNEVLKALCKEAGWIVEE  319
            R P+W+ERENN+RRERRRRAIAAKI+ GLR  GNY LPKHCDNNEVLKALC EAGW+VE+
Sbjct  14   RKPSWRERENNRRRERRRRAIAAKIYTGLRAQGNYNLPKHCDNNEVLKALCSEAGWVVED  73

Query  320  DGTTYRKGCKPTERMDIMG  376
            DGTTYRKGCKP   +DI G
Sbjct  74   DGTTYRKGCKPPP-IDIGG  91



>ref|XP_010539923.1| PREDICTED: protein BRASSINAZOLE-RESISTANT 1 [Tarenaya hassleriana]
Length=328

 Score = 92.4 bits (228),  Expect = 6e-19, Method: Compositional matrix adjust.
 Identities = 62/79 (78%), Positives = 69/79 (87%), Gaps = 1/79 (1%)
 Frame = +2

Query  140  RLPTWkerennkrrerrrraiaakiFAGLRMYGNYKLPKHCDNNEVLKALCKEAGWIVEE  319
            R P+W+ERENN+RRERRRRAIAAKI++GLR  G+Y LPKHCDNNEVLKALC EAGW+VEE
Sbjct  20   RKPSWRERENNRRRERRRRAIAAKIYSGLRAQGSYNLPKHCDNNEVLKALCAEAGWVVEE  79

Query  320  DGTTYRKGCKPTERMDIMG  376
            DGTTYRKGCKP    DI G
Sbjct  80   DGTTYRKGCKPPPG-DIAG  97



>gb|KFK30297.1| hypothetical protein AALP_AA7G243400 [Arabis alpina]
Length=314

 Score = 92.4 bits (228),  Expect = 6e-19, Method: Compositional matrix adjust.
 Identities = 62/71 (87%), Positives = 65/71 (92%), Gaps = 0/71 (0%)
 Frame = +2

Query  140  RLPTWkerennkrrerrrraiaakiFAGLRMYGNYKLPKHCDNNEVLKALCKEAGWIVEE  319
            R PTWKERENNK+RERRRRAI AKI++GLR  GNYKLPKHCDNNEVLKALC EAGWIVEE
Sbjct  16   RTPTWKERENNKKRERRRRAITAKIYSGLRAQGNYKLPKHCDNNEVLKALCIEAGWIVEE  75

Query  320  DGTTYRKGCKP  352
            DGTTYRKG KP
Sbjct  76   DGTTYRKGFKP  86



>ref|XP_009142040.1| PREDICTED: BES1/BZR1 homolog protein 2 [Brassica rapa]
 emb|CDX75598.1| BnaA01g01040D [Brassica napus]
Length=303

 Score = 92.0 bits (227),  Expect = 6e-19, Method: Compositional matrix adjust.
 Identities = 62/72 (86%), Positives = 66/72 (92%), Gaps = 0/72 (0%)
 Frame = +2

Query  140  RLPTWkerennkrrerrrraiaakiFAGLRMYGNYKLPKHCDNNEVLKALCKEAGWIVEE  319
            R PTWKERENNK+RERRRRAI AKI++GLR  GNYKLPKHCDNNEVLKALC EAGWIVE+
Sbjct  13   RTPTWKERENNKKRERRRRAITAKIYSGLRAQGNYKLPKHCDNNEVLKALCLEAGWIVED  72

Query  320  DGTTYRKGCKPT  355
            DGTTYRKG KPT
Sbjct  73   DGTTYRKGFKPT  84



>ref|XP_011074507.1| PREDICTED: protein BRASSINAZOLE-RESISTANT 1 isoform X2 [Sesamum 
indicum]
Length=328

 Score = 92.4 bits (228),  Expect = 7e-19, Method: Compositional matrix adjust.
 Identities = 63/79 (80%), Positives = 69/79 (87%), Gaps = 1/79 (1%)
 Frame = +2

Query  140  RLPTWkerennkrrerrrraiaakiFAGLRMYGNYKLPKHCDNNEVLKALCKEAGWIVEE  319
            R P+W+ERENN+RRERRRRAIAAKI+AGLR  GNY LPKHCDNNEVLKALC EAGW+VE 
Sbjct  32   RKPSWRERENNRRRERRRRAIAAKIYAGLRAQGNYNLPKHCDNNEVLKALCAEAGWVVEP  91

Query  320  DGTTYRKGCKPTERMDIMG  376
            DGTTYRKGCKP   M+I G
Sbjct  92   DGTTYRKGCKPIP-MEIGG  109



>gb|EMS63049.1| hypothetical protein TRIUR3_11319 [Triticum urartu]
Length=544

 Score = 94.4 bits (233),  Expect = 7e-19, Method: Compositional matrix adjust.
 Identities = 91/159 (57%), Positives = 105/159 (66%), Gaps = 9/159 (6%)
 Frame = +2

Query  143  LPTWkerennkrrerrrraiaakiFAGLRMYGNYKLPKHCDNNEVLKALCKEAGWIVEED  322
            +PTW+ERENN+RRERRRRAIAAKI+ GLR YGNY LPKHCDNNEVLKALC EAGW+VE D
Sbjct  207  VPTWRERENNRRRERRRRAIAAKIYTGLRAYGNYNLPKHCDNNEVLKALCNEAGWVVEPD  266

Query  323  GTTYRKGCK--PTERMDIMGssvsvspcssyqpsqGpsynpspasssfpspvssRYITNN  496
            GTTYR+GCK  P  R D M S+ +    S     +        +SS   S  SS      
Sbjct  267  GTTYRRGCKPPPQARPDPMRSASASPCSSYQPSPRASYNPSPASSSFPSSGSSSHITLGG  326

Query  497  NND----TDPNSLIPWLKNL-ssgsspsssKLP--HHLY  592
             N+     + +SLIPWLKNL S+ S  SSSKLP  HHLY
Sbjct  327  GNNFIGGVEGSSLIPWLKNLSSNPSFASSSKLPQLHHLY  365



>emb|CDY62653.1| BnaAnng18240D [Brassica napus]
Length=309

 Score = 92.0 bits (227),  Expect = 7e-19, Method: Compositional matrix adjust.
 Identities = 64/79 (81%), Positives = 69/79 (87%), Gaps = 1/79 (1%)
 Frame = +2

Query  140  RLPTWkerennkrrerrrraiaakiFAGLRMYGNYKLPKHCDNNEVLKALCKEAGWIVEE  319
            R PTWKERENNKRRERRRRAI AKI++GLR  GNYKLPKHCDNNEVLKALC EAGWIVE+
Sbjct  15   RTPTWKERENNKRRERRRRAITAKIYSGLRGQGNYKLPKHCDNNEVLKALCLEAGWIVED  74

Query  320  DGTTYRKGCKPTERMDIMG  376
            DGTTYRKG KP    D++G
Sbjct  75   DGTTYRKGSKPIAS-DMLG  92



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 764930893160