BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFF035H21

Length=577
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

gb|EYU36508.1|  hypothetical protein MIMGU_mgv1a008665mg                223   5e-68   Erythranthe guttata [common monkey flower]
ref|XP_011074175.1|  PREDICTED: uncharacterized methyltransferase...    216   3e-65   Sesamum indicum [beniseed]
emb|CDP01043.1|  unnamed protein product                                208   3e-62   Coffea canephora [robusta coffee]
ref|XP_003522802.1|  PREDICTED: uncharacterized methyltransferase...    204   2e-60   Glycine max [soybeans]
ref|XP_007136240.1|  hypothetical protein PHAVU_009G030200g             201   2e-59   Phaseolus vulgaris [French bean]
gb|AFK47008.1|  unknown                                                 201   2e-59   Lotus japonicus
ref|XP_008219673.1|  PREDICTED: uncharacterized methyltransferase...    200   3e-59   Prunus mume [ume]
gb|KHN19749.1|  Putative methyltransferase, chloroplastic               199   1e-58   Glycine soja [wild soybean]
ref|XP_004500619.1|  PREDICTED: uncharacterized methyltransferase...    198   1e-58   Cicer arietinum [garbanzo]
ref|XP_007222212.1|  hypothetical protein PRUPE_ppa007824mg             199   1e-58   Prunus persica
ref|XP_002302290.2|  hypothetical protein POPTR_0002s09570g             198   2e-58   Populus trichocarpa [western balsam poplar]
ref|XP_006386404.1|  hypothetical protein POPTR_0002s09570g             198   2e-58   
ref|XP_002285799.1|  PREDICTED: uncharacterized methyltransferase...    196   8e-58   Vitis vinifera
gb|KEH34908.1|  S-adenosylmethionine-dependent methyltransferase        195   3e-57   Medicago truncatula
ref|XP_011016296.1|  PREDICTED: uncharacterized methyltransferase...    196   3e-57   Populus euphratica
gb|KDO80936.1|  hypothetical protein CISIN_1g018003mg                   190   1e-56   Citrus sinensis [apfelsine]
ref|XP_006434006.1|  hypothetical protein CICLE_v10001682mg             191   3e-56   
gb|KDO80930.1|  hypothetical protein CISIN_1g018003mg                   190   2e-55   Citrus sinensis [apfelsine]
gb|KDO80931.1|  hypothetical protein CISIN_1g018003mg                   191   2e-55   Citrus sinensis [apfelsine]
ref|XP_006434005.1|  hypothetical protein CICLE_v10001682mg             190   2e-55   
ref|XP_006472620.1|  PREDICTED: uncharacterized methyltransferase...    190   4e-55   
gb|KDO80933.1|  hypothetical protein CISIN_1g018003mg                   190   4e-55   Citrus sinensis [apfelsine]
ref|XP_010269234.1|  PREDICTED: uncharacterized methyltransferase...    188   1e-54   Nelumbo nucifera [Indian lotus]
ref|XP_010059991.1|  PREDICTED: uncharacterized methyltransferase...    189   1e-54   Eucalyptus grandis [rose gum]
ref|XP_008391080.1|  PREDICTED: uncharacterized methyltransferase...    182   5e-52   
ref|XP_004299641.1|  PREDICTED: uncharacterized methyltransferase...    181   6e-52   Fragaria vesca subsp. vesca
ref|XP_008348560.1|  PREDICTED: uncharacterized methyltransferase...    183   7e-52   
ref|XP_010064389.1|  PREDICTED: uncharacterized methyltransferase...    174   2e-49   
ref|XP_002889176.1|  predicted protein                                  173   7e-49   
ref|XP_006390018.1|  hypothetical protein EUTSA_v10018789mg             172   3e-48   Eutrema salsugineum [saltwater cress]
gb|KDP41368.1|  hypothetical protein JCGZ_15775                         171   4e-48   Jatropha curcas
ref|XP_007018799.1|  S-adenosylmethionine-dependent methyltransfe...    171   6e-48   
ref|XP_006300528.1|  hypothetical protein CARUB_v10020572mg             170   1e-47   
ref|XP_010061813.1|  PREDICTED: uncharacterized methyltransferase...    169   3e-47   Eucalyptus grandis [rose gum]
ref|XP_002513908.1|  S-adenosylmethionine-dependent methyltransfe...    168   6e-47   
ref|XP_010472019.1|  PREDICTED: uncharacterized methyltransferase...    167   1e-46   Camelina sativa [gold-of-pleasure]
ref|XP_010472020.1|  PREDICTED: uncharacterized methyltransferase...    167   1e-46   Camelina sativa [gold-of-pleasure]
ref|XP_010064206.1|  PREDICTED: uncharacterized methyltransferase...    167   1e-46   Eucalyptus grandis [rose gum]
ref|XP_009373157.1|  PREDICTED: uncharacterized methyltransferase...    167   2e-46   Pyrus x bretschneideri [bai li]
gb|AAG52104.1|AC012680_15  hypothetical protein; 38642-36701            166   2e-46   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008374425.1|  PREDICTED: uncharacterized methyltransferase...    166   3e-46   
ref|XP_010428930.1|  PREDICTED: uncharacterized methyltransferase...    166   4e-46   Camelina sativa [gold-of-pleasure]
ref|XP_008374562.1|  PREDICTED: uncharacterized methyltransferase...    166   4e-46   
ref|XP_010428929.1|  PREDICTED: uncharacterized methyltransferase...    166   4e-46   Camelina sativa [gold-of-pleasure]
ref|NP_565170.1|  S-adenosyl-L-methionine-dependent methyltransfe...    166   5e-46   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009128280.1|  PREDICTED: uncharacterized methyltransferase...    165   7e-46   Brassica rapa
ref|XP_009394965.1|  PREDICTED: uncharacterized methyltransferase...    165   1e-45   
emb|CDY26853.1|  BnaA02g18780D                                          165   1e-45   Brassica napus [oilseed rape]
ref|XP_010416782.1|  PREDICTED: uncharacterized methyltransferase...    165   1e-45   Camelina sativa [gold-of-pleasure]
ref|XP_010416783.1|  PREDICTED: uncharacterized methyltransferase...    165   1e-45   Camelina sativa [gold-of-pleasure]
ref|XP_009394966.1|  PREDICTED: uncharacterized methyltransferase...    164   1e-45   
ref|XP_009394964.1|  PREDICTED: uncharacterized methyltransferase...    163   5e-45   
gb|KCW67137.1|  hypothetical protein EUGRSUZ_F00926                     161   7e-45   Eucalyptus grandis [rose gum]
ref|XP_010534072.1|  PREDICTED: uncharacterized methyltransferase...    160   2e-44   
ref|XP_008356589.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...    159   2e-44   
ref|XP_010534070.1|  PREDICTED: uncharacterized methyltransferase...    161   4e-44   Tarenaya hassleriana [spider flower]
ref|XP_010534071.1|  PREDICTED: uncharacterized methyltransferase...    160   5e-44   
emb|CDY14625.1|  BnaC02g24880D                                          160   5e-44   Brassica napus [oilseed rape]
ref|XP_006472621.1|  PREDICTED: uncharacterized methyltransferase...    157   8e-43   
ref|XP_008374488.1|  PREDICTED: uncharacterized methyltransferase...    157   8e-43   
gb|KJB59929.1|  hypothetical protein B456_009G281700                    157   1e-42   Gossypium raimondii
emb|CDX88421.1|  BnaC06g38650D                                          156   2e-42   
ref|XP_010937469.1|  PREDICTED: uncharacterized methyltransferase...    154   1e-41   Elaeis guineensis
gb|KHG01878.1|  hypothetical protein F383_23026                         154   1e-41   Gossypium arboreum [tree cotton]
ref|XP_008808068.1|  PREDICTED: uncharacterized methyltransferase...    152   5e-41   Phoenix dactylifera
ref|XP_009106463.1|  PREDICTED: uncharacterized methyltransferase...    151   2e-40   
gb|KJB59930.1|  hypothetical protein B456_009G281700                    147   5e-40   Gossypium raimondii
ref|XP_008391145.1|  PREDICTED: uncharacterized methyltransferase...    148   1e-39   
ref|XP_008466034.1|  PREDICTED: uncharacterized methyltransferase...    148   3e-39   Cucumis melo [Oriental melon]
ref|XP_009106462.1|  PREDICTED: uncharacterized methyltransferase...    148   3e-39   Brassica rapa
gb|KJB59931.1|  hypothetical protein B456_009G281700                    147   3e-39   Gossypium raimondii
emb|CDX87473.1|  BnaA07g34000D                                          147   7e-39   
ref|XP_004136403.1|  PREDICTED: uncharacterized methyltransferase...    145   2e-38   
ref|XP_010105909.1|  putative methyltransferase                         144   2e-38   
ref|XP_004161765.1|  PREDICTED: uncharacterized methyltransferase...    145   8e-38   
ref|XP_008790838.1|  PREDICTED: uncharacterized methyltransferase...    142   2e-37   Phoenix dactylifera
ref|XP_008790837.1|  PREDICTED: uncharacterized methyltransferase...    142   3e-37   
ref|XP_010042876.1|  PREDICTED: uncharacterized methyltransferase...    138   3e-37   
ref|XP_002268200.1|  PREDICTED: uncharacterized methyltransferase...    141   1e-36   Vitis vinifera
emb|CBI25578.3|  unnamed protein product                                141   1e-36   Vitis vinifera
ref|XP_010656529.1|  PREDICTED: uncharacterized methyltransferase...    141   1e-36   Vitis vinifera
emb|CDP10502.1|  unnamed protein product                                140   2e-36   Coffea canephora [robusta coffee]
ref|XP_010667997.1|  PREDICTED: uncharacterized methyltransferase...    140   3e-36   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_011017926.1|  PREDICTED: uncharacterized methyltransferase...    139   4e-36   Populus euphratica
gb|KJB53959.1|  hypothetical protein B456_009G013400                    137   8e-36   Gossypium raimondii
gb|KJB14720.1|  hypothetical protein B456_002G140100                    139   2e-35   Gossypium raimondii
gb|KJB53958.1|  hypothetical protein B456_009G013400                    137   2e-35   Gossypium raimondii
ref|XP_008788786.1|  PREDICTED: uncharacterized methyltransferase...    137   3e-35   
ref|XP_009363912.1|  PREDICTED: uncharacterized methyltransferase...    137   4e-35   Pyrus x bretschneideri [bai li]
ref|XP_010939635.1|  PREDICTED: uncharacterized methyltransferase...    136   4e-35   Elaeis guineensis
gb|KJB27061.1|  hypothetical protein B456_004G275300                    136   6e-35   Gossypium raimondii
gb|KJB27062.1|  hypothetical protein B456_004G275300                    136   7e-35   Gossypium raimondii
ref|XP_006473930.1|  PREDICTED: uncharacterized methyltransferase...    135   1e-34   
ref|XP_004973409.1|  PREDICTED: uncharacterized methyltransferase...    135   2e-34   Setaria italica
gb|KDO59315.1|  hypothetical protein CISIN_1g019950mg                   134   3e-34   Citrus sinensis [apfelsine]
ref|XP_002324579.2|  methyltransferase-related family protein           134   3e-34   
ref|XP_006659389.1|  PREDICTED: uncharacterized methyltransferase...    135   3e-34   
ref|XP_011470680.1|  PREDICTED: uncharacterized methyltransferase...    134   3e-34   Fragaria vesca subsp. vesca
ref|XP_006453728.1|  hypothetical protein CICLE_v10008875mg             134   4e-34   Citrus clementina [clementine]
gb|KDO59317.1|  hypothetical protein CISIN_1g019950mg                   134   4e-34   Citrus sinensis [apfelsine]
gb|KDO59316.1|  hypothetical protein CISIN_1g019950mg                   134   4e-34   Citrus sinensis [apfelsine]
gb|ACJ84583.1|  unknown                                                 134   4e-34   Medicago truncatula
gb|AFK46366.1|  unknown                                                 134   5e-34   Medicago truncatula
ref|XP_009802104.1|  PREDICTED: uncharacterized methyltransferase...    134   5e-34   Nicotiana sylvestris
gb|KDO59313.1|  hypothetical protein CISIN_1g019950mg                   134   5e-34   Citrus sinensis [apfelsine]
gb|KHG26587.1|  hypothetical protein F383_01046                         134   6e-34   Gossypium arboreum [tree cotton]
gb|ABR16838.1|  unknown                                                 133   6e-34   Picea sitchensis
ref|XP_006359517.1|  PREDICTED: uncharacterized methyltransferase...    134   7e-34   Solanum tuberosum [potatoes]
ref|XP_008336951.1|  PREDICTED: uncharacterized methyltransferase...    134   8e-34   
ref|XP_004287240.1|  PREDICTED: uncharacterized methyltransferase...    133   1e-33   Fragaria vesca subsp. vesca
ref|XP_011470644.1|  PREDICTED: uncharacterized methyltransferase...    132   1e-33   Fragaria vesca subsp. vesca
ref|XP_010687777.1|  PREDICTED: uncharacterized methyltransferase...    132   1e-33   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_002445476.1|  hypothetical protein SORBIDRAFT_07g020130          133   1e-33   Sorghum bicolor [broomcorn]
ref|XP_004965743.1|  PREDICTED: uncharacterized methyltransferase...    132   2e-33   Setaria italica
ref|XP_011020252.1|  PREDICTED: uncharacterized methyltransferase...    132   2e-33   Populus euphratica
ref|XP_006852799.1|  hypothetical protein AMTR_s00033p00159870          132   2e-33   
ref|XP_002531454.1|  phosphatidylethanolamine n-methyltransferase...    131   3e-33   
ref|NP_001132053.1|  uncharacterized LOC100193465                       132   3e-33   Zea mays [maize]
ref|XP_004488470.1|  PREDICTED: uncharacterized methyltransferase...    132   3e-33   Cicer arietinum [garbanzo]
ref|XP_011078555.1|  PREDICTED: uncharacterized methyltransferase...    132   3e-33   Sesamum indicum [beniseed]
gb|ACG27569.1|  S-adenosylmethionine-dependent methyltransferase        132   3e-33   Zea mays [maize]
gb|ACF85541.1|  unknown                                                 132   3e-33   Zea mays [maize]
ref|XP_004965742.1|  PREDICTED: uncharacterized methyltransferase...    132   3e-33   Setaria italica
ref|XP_002268107.1|  PREDICTED: uncharacterized methyltransferase...    131   4e-33   Vitis vinifera
ref|XP_004242718.1|  PREDICTED: uncharacterized methyltransferase...    131   4e-33   Solanum lycopersicum
ref|XP_008389527.1|  PREDICTED: uncharacterized methyltransferase...    130   4e-33   
ref|XP_002438745.1|  hypothetical protein SORBIDRAFT_10g025400          132   4e-33   Sorghum bicolor [broomcorn]
ref|XP_004974685.1|  PREDICTED: uncharacterized methyltransferase...    131   5e-33   
gb|EMT07919.1|  Putative methyltransferase                              131   6e-33   
ref|XP_003574470.1|  PREDICTED: uncharacterized methyltransferase...    131   8e-33   Brachypodium distachyon [annual false brome]
gb|KJB53960.1|  hypothetical protein B456_009G013400                    130   8e-33   Gossypium raimondii
ref|XP_004242719.1|  PREDICTED: uncharacterized methyltransferase...    130   8e-33   Solanum lycopersicum
gb|KDP30197.1|  hypothetical protein JCGZ_16979                         130   1e-32   Jatropha curcas
ref|XP_006359516.1|  PREDICTED: uncharacterized methyltransferase...    130   1e-32   Solanum tuberosum [potatoes]
ref|XP_002988667.1|  hypothetical protein SELMODRAFT_46133              128   2e-32   
dbj|BAF93193.1|  putative methyltransferase-like                        125   2e-32   Hordeum vulgare [barley]
ref|XP_003563313.1|  PREDICTED: uncharacterized methyltransferase...    130   2e-32   Brachypodium distachyon [annual false brome]
ref|XP_010099510.1|  putative methyltransferase                         129   3e-32   Morus notabilis
gb|KHG21340.1|  hypothetical protein F383_03824                         130   4e-32   Gossypium arboreum [tree cotton]
gb|EEC83568.1|  hypothetical protein OsI_29220                          129   4e-32   Oryza sativa Indica Group [Indian rice]
ref|NP_001061786.1|  Os08g0411200                                       129   5e-32   
ref|XP_010928269.1|  PREDICTED: uncharacterized methyltransferase...    128   5e-32   
ref|XP_010928267.1|  PREDICTED: uncharacterized methyltransferase...    129   6e-32   Elaeis guineensis
ref|XP_003546595.1|  PREDICTED: uncharacterized methyltransferase...    128   6e-32   Glycine max [soybeans]
ref|XP_007013645.1|  S-adenosyl-L-methionine-dependent methyltran...    128   6e-32   
ref|XP_002986403.1|  hypothetical protein SELMODRAFT_235009             128   7e-32   Selaginella moellendorffii
gb|EEE68668.1|  hypothetical protein OsJ_27281                          129   7e-32   Oryza sativa Japonica Group [Japonica rice]
ref|XP_009358530.1|  PREDICTED: uncharacterized methyltransferase...    128   9e-32   
ref|XP_009338403.1|  PREDICTED: uncharacterized methyltransferase...    128   1e-31   Pyrus x bretschneideri [bai li]
ref|XP_009338401.1|  PREDICTED: uncharacterized methyltransferase...    127   1e-31   Pyrus x bretschneideri [bai li]
dbj|BAJ94151.1|  predicted protein                                      127   1e-31   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_006381066.1|  methyltransferase-related family protein           127   1e-31   
gb|EYU34934.1|  hypothetical protein MIMGU_mgv1a009522mg                127   2e-31   Erythranthe guttata [common monkey flower]
dbj|BAJ91607.1|  predicted protein                                      127   2e-31   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|NP_001150427.1|  S-adenosylmethionine-dependent methyltransfe...    127   2e-31   Zea mays [maize]
gb|AEJ88263.1|  putative S-adenosylmethionine-dependent methyltra...    125   3e-31   Wolffia arrhiza
gb|KHN28439.1|  Putative methyltransferase, chloroplastic               126   3e-31   Glycine soja [wild soybean]
ref|XP_009386973.1|  PREDICTED: uncharacterized methyltransferase...    126   5e-31   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010250394.1|  PREDICTED: uncharacterized protein LOC104592660    129   5e-31   
ref|XP_010533098.1|  PREDICTED: uncharacterized methyltransferase...    125   6e-31   Tarenaya hassleriana [spider flower]
ref|XP_007202300.1|  hypothetical protein PRUPE_ppa007882mg             125   9e-31   Prunus persica
ref|NP_001242875.1|  uncharacterized protein LOC100798970               125   1e-30   
gb|EMT30153.1|  Putative methyltransferase                              126   1e-30   
ref|XP_010050326.1|  PREDICTED: uncharacterized methyltransferase...    125   1e-30   Eucalyptus grandis [rose gum]
ref|XP_001778776.1|  predicted protein                                  124   1e-30   
ref|XP_009141962.1|  PREDICTED: uncharacterized methyltransferase...    124   2e-30   Brassica rapa
emb|CDY57579.1|  BnaC04g56820D                                          124   3e-30   Brassica napus [oilseed rape]
ref|XP_004287239.1|  PREDICTED: uncharacterized methyltransferase...    122   4e-30   Fragaria vesca subsp. vesca
gb|KCW45297.1|  hypothetical protein EUGRSUZ_L01041                     121   4e-30   Eucalyptus grandis [rose gum]
gb|KDO59312.1|  hypothetical protein CISIN_1g019950mg                   122   9e-30   Citrus sinensis [apfelsine]
ref|XP_010928270.1|  PREDICTED: uncharacterized methyltransferase...    122   1e-29   
ref|XP_010928268.1|  PREDICTED: uncharacterized methyltransferase...    122   1e-29   
ref|XP_006657188.1|  PREDICTED: uncharacterized methyltransferase...    122   1e-29   
ref|XP_010040339.1|  PREDICTED: uncharacterized methyltransferase...    121   1e-29   Eucalyptus grandis [rose gum]
ref|XP_009595293.1|  PREDICTED: uncharacterized methyltransferase...    118   1e-29   Nicotiana tomentosiformis
ref|XP_009595292.1|  PREDICTED: uncharacterized methyltransferase...    118   1e-29   Nicotiana tomentosiformis
ref|NP_001058196.1|  Os06g0646000                                       122   2e-29   
gb|KCW79027.1|  hypothetical protein EUGRSUZ_C00449                     121   2e-29   Eucalyptus grandis [rose gum]
gb|AFW76187.1|  hypothetical protein ZEAMMB73_680706                    118   2e-29   
gb|KCW79026.1|  hypothetical protein EUGRSUZ_C00449                     121   2e-29   Eucalyptus grandis [rose gum]
ref|XP_010047200.1|  PREDICTED: uncharacterized methyltransferase...    121   2e-29   Eucalyptus grandis [rose gum]
gb|AAD12007.1|  hypothetical protein                                    119   3e-29   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006411367.1|  hypothetical protein EUTSA_v10016844mg             121   3e-29   Eutrema salsugineum [saltwater cress]
ref|XP_002306578.1|  methyltransferase-related family protein           119   3e-29   
ref|XP_004167998.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...    120   4e-29   
ref|XP_006293382.1|  hypothetical protein CARUB_v10023510mg             120   5e-29   Capsella rubella
ref|XP_008456627.1|  PREDICTED: uncharacterized methyltransferase...    120   5e-29   Cucumis melo [Oriental melon]
ref|XP_006586686.1|  PREDICTED: uncharacterized protein LOC100798...    120   5e-29   Glycine max [soybeans]
ref|XP_008456635.1|  PREDICTED: uncharacterized methyltransferase...    120   5e-29   Cucumis melo [Oriental melon]
ref|XP_010505866.1|  PREDICTED: uncharacterized methyltransferase...    120   6e-29   Camelina sativa [gold-of-pleasure]
ref|NP_181637.2|  uncharacterized methyltransferase                     120   6e-29   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010508773.1|  PREDICTED: uncharacterized methyltransferase...    120   6e-29   Camelina sativa [gold-of-pleasure]
ref|XP_010517586.1|  PREDICTED: uncharacterized methyltransferase...    119   2e-28   Camelina sativa [gold-of-pleasure]
ref|XP_004139262.1|  PREDICTED: uncharacterized methyltransferase...    119   2e-28   Cucumis sativus [cucumbers]
gb|KGN60753.1|  hypothetical protein Csa_2G009410                       119   2e-28   Cucumis sativus [cucumbers]
emb|CDY06948.1|  BnaA04g23670D                                          122   2e-28   
gb|KFK36957.1|  hypothetical protein AALP_AA4G194500                    118   4e-28   Arabis alpina [alpine rockcress]
ref|XP_002879904.1|  hypothetical protein ARALYDRAFT_903411             115   3e-27   
gb|EPS57983.1|  hypothetical protein M569_16834                         109   4e-27   Genlisea aurea
gb|KDO80932.1|  hypothetical protein CISIN_1g018003mg                   111   2e-26   Citrus sinensis [apfelsine]
ref|XP_006434004.1|  hypothetical protein CICLE_v10001682mg             111   2e-26   
ref|XP_006826926.1|  hypothetical protein AMTR_s00010p00172800          110   5e-26   
gb|EMT00494.1|  Putative methyltransferase                              113   6e-26   
gb|EMT14235.1|  Putative methyltransferase                              111   3e-25   
ref|XP_008242913.1|  PREDICTED: uncharacterized methyltransferase...    107   2e-24   
ref|XP_008336947.1|  PREDICTED: uncharacterized methyltransferase...    106   7e-24   
ref|XP_008336950.1|  PREDICTED: uncharacterized methyltransferase...    106   7e-24   
dbj|BAC99645.1|  hypothetical protein                                   104   3e-23   Oryza sativa Japonica Group [Japonica rice]
gb|ACF86599.1|  unknown                                                 100   8e-23   Zea mays [maize]
emb|CDP12319.1|  unnamed protein product                              99.0    1e-22   Coffea canephora [robusta coffee]
gb|KEH37884.1|  S-adenosylmethionine-dependent methyltransferase        101   2e-22   Medicago truncatula
ref|XP_005643537.1|  S-adenosyl-L-methionine-dependent methyltran...  99.8    2e-21   Coccomyxa subellipsoidea C-169
gb|KHN03912.1|  Putative methyltransferase, chloroplastic             96.7    5e-21   Glycine soja [wild soybean]
ref|XP_003527908.1|  PREDICTED: uncharacterized methyltransferase...  97.1    7e-21   
gb|KGN60338.1|  hypothetical protein Csa_3G895840                     94.0    3e-20   Cucumis sativus [cucumbers]
ref|XP_005842697.1|  hypothetical protein CHLNCDRAFT_136276           91.7    2e-19   Chlorella variabilis
ref|XP_008344066.1|  PREDICTED: uncharacterized methyltransferase...  88.6    1e-17   
ref|XP_002954755.1|  hypothetical protein VOLCADRAFT_106536           88.6    1e-17   Volvox carteri f. nagariensis
ref|XP_001694737.1|  predicted protein                                87.0    3e-17   Chlamydomonas reinhardtii
ref|XP_002968407.1|  hypothetical protein SELMODRAFT_89857            87.0    4e-17   
ref|XP_006473932.1|  PREDICTED: uncharacterized methyltransferase...  80.5    1e-15   Citrus sinensis [apfelsine]
ref|XP_006474605.1|  PREDICTED: uncharacterized methyltransferase...  80.1    2e-15   Citrus sinensis [apfelsine]
gb|KGN60339.1|  hypothetical protein Csa_3G895850                     81.3    2e-15   Cucumis sativus [cucumbers]
emb|CAN77779.1|  hypothetical protein VITISV_004172                   80.5    5e-14   Vitis vinifera
ref|XP_002306577.1|  hypothetical protein POPTR_0005s17000g           75.1    9e-14   
ref|XP_002960327.1|  hypothetical protein SELMODRAFT_402502           75.9    2e-12   
ref|XP_002967385.1|  hypothetical protein SELMODRAFT_408369           71.6    4e-11   
ref|XP_003056709.1|  predicted protein                                67.4    5e-10   Micromonas pusilla CCMP1545
gb|KCW45298.1|  hypothetical protein EUGRSUZ_L01042                   63.5    1e-09   Eucalyptus grandis [rose gum]
ref|XP_010040340.1|  PREDICTED: uncharacterized methyltransferase...  63.2    1e-09   
ref|XP_007510827.1|  predicted protein                                63.5    1e-08   Bathycoccus prasinos
ref|XP_005824779.1|  hypothetical protein GUITHDRAFT_116106           62.4    2e-08   Guillardia theta CCMP2712
ref|XP_002992310.1|  hypothetical protein SELMODRAFT_430530           60.1    5e-08   
gb|EWM24600.1|  phosphatidylethanolamine n                            58.5    5e-07   Nannochloropsis gaditana
ref|XP_002500021.1|  predicted protein                                57.0    2e-06   Micromonas commoda
dbj|BAH19476.1|  AT2G41040                                            54.7    2e-06   Arabidopsis thaliana [mouse-ear cress]
ref|XP_005855405.1|  hypothetical protein NGA_2005920                 57.0    2e-06   Nannochloropsis gaditana CCMP526
ref|XP_005781281.1|  hypothetical protein EMIHUDRAFT_442892           56.6    2e-06   Emiliania huxleyi CCMP1516
ref|XP_002185698.1|  predicted protein                                56.2    3e-06   Phaeodactylum tricornutum CCAP 1055/1
ref|XP_002506188.1|  predicted protein                                56.2    3e-06   Micromonas commoda
gb|EJK66010.1|  hypothetical protein THAOC_13088                      56.2    3e-06   Thalassiosira oceanica
ref|XP_005713645.1|  unnamed protein product                          54.7    7e-06   Chondrus crispus [carageen]
tpg|DAA49105.1|  TPA: hypothetical protein ZEAMMB73_519956            52.4    1e-05   
ref|XP_005536724.1|  hypothetical protein, conserved                  53.5    3e-05   Cyanidioschyzon merolae strain 10D
emb|CBJ26935.1|  S-adenosyl-L-methionine-dependent methyltransfer...  53.1    3e-05   Ectocarpus siliculosus
ref|XP_001418638.1|  predicted protein                                50.4    2e-04   Ostreococcus lucimarinus CCE9901
ref|XP_003057905.1|  predicted protein                                50.4    2e-04   Micromonas pusilla CCMP1545
ref|XP_003080221.1|  methyltransferase-related (ISS)                  50.8    2e-04   Ostreococcus tauri



>gb|EYU36508.1| hypothetical protein MIMGU_mgv1a008665mg [Erythranthe guttata]
Length=366

 Score =   223 bits (569),  Expect = 5e-68, Method: Compositional matrix adjust.
 Identities = 109/183 (60%), Positives = 137/183 (75%), Gaps = 10/183 (5%)
 Frame = +2

Query  59   AVLVTRKLGYNS-----KFSFSPLTPKAN---RLFAVKIRALST--TFVEDKPVRLIDEK  208
            A L+  +L +N      +   SPL+  A    RLF  K+RA S+    +E  P  ++DEK
Sbjct  19   AALLPSRLRFNPMPSCLRVVKSPLSIPARIRRRLFTDKVRASSSAAVVIETTPDPIVDEK  78

Query  209  KVEIRTNLLACPICYDAFTWNGNPGLSLSSMAQSNLECSTCRKKYSGNETHVDLTIAGGG  388
            K+ IR N+LACPIC++   WNG+  LSL S+A+S+LEC TC+K YSG ++H+DLTI GGG
Sbjct  79   KLNIRKNVLACPICFERVIWNGDSNLSLESVARSSLECKTCKKLYSGKDSHLDLTITGGG  138

Query  389  KAYGEALAASTELFRLPLVSFLYERGWRQSFSLWGGFPGPEKEFELMQDYLKPVMGGNII  568
            K YGE + ASTELFR PLVSFLYERGWRQSFS+WGGFPGPEKEFEL++DYLKPV+GG+II
Sbjct  139  KVYGEPMPASTELFRFPLVSFLYERGWRQSFSIWGGFPGPEKEFELIKDYLKPVLGGSII  198

Query  569  DAS  577
            DAS
Sbjct  199  DAS  201



>ref|XP_011074175.1| PREDICTED: uncharacterized methyltransferase At1g78140, chloroplastic 
[Sesamum indicum]
Length=360

 Score =   216 bits (550),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 98/149 (66%), Positives = 119/149 (80%), Gaps = 0/149 (0%)
 Frame = +2

Query  131  RLFAVKIRALSTTFVEDKPVRLIDEKKVEIRTNLLACPICYDAFTWNGNPGLSLSSMAQS  310
            RL   ++RA S   VE KP  ++ E K+ IR N+LACPICY+   WNG+P LSL S+A+S
Sbjct  48   RLLTHEVRASSAATVETKPDPVVKETKLNIRKNILACPICYERLIWNGDPDLSLESVARS  107

Query  311  NLECSTCRKKYSGNETHVDLTIAGGGKAYGEALAASTELFRLPLVSFLYERGWRQSFSLW  490
             L+CSTCRK YSG  +H+DLTI G GK YG+ +AASTE+FR PLVSFLYERGWRQSFS W
Sbjct  108  TLQCSTCRKTYSGEGSHLDLTITGRGKVYGDPVAASTEIFRSPLVSFLYERGWRQSFSFW  167

Query  491  GGFPGPEKEFELMQDYLKPVMGGNIIDAS  577
            GGFPGPEKE+ L+++YLKPV+GGNIIDAS
Sbjct  168  GGFPGPEKEYVLVKEYLKPVLGGNIIDAS  196



>emb|CDP01043.1| unnamed protein product [Coffea canephora]
Length=358

 Score =   208 bits (530),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 98/158 (62%), Positives = 114/158 (72%), Gaps = 1/158 (1%)
 Frame = +2

Query  104  FSPLTPKANRLFAVKIRALSTTFVEDKPVRLIDEKKVEIRTNLLACPICYDAFTWNGNPG  283
            F P T K N   A +IRA ST  VE KP  ++DEKK++   N LACPICY    +  +  
Sbjct  38   FIPQTIK-NAFAATRIRATSTLLVETKPDTILDEKKLDSCKNTLACPICYTPLIYTADSS  96

Query  284  LSLSSMAQSNLECSTCRKKYSGNETHVDLTIAGGGKAYGEALAASTELFRLPLVSFLYER  463
                S A+ NL C TCRK YSGN+TH+DLTI  G K YGEA+ ASTELFR P VSFLYER
Sbjct  97   FPADSAARPNLRCRTCRKAYSGNDTHLDLTITSGSKGYGEAMPASTELFRFPFVSFLYER  156

Query  464  GWRQSFSLWGGFPGPEKEFELMQDYLKPVMGGNIIDAS  577
            GWRQSFS+WGGFPGPEKEFEL++DYL PV+GG I+DAS
Sbjct  157  GWRQSFSIWGGFPGPEKEFELIKDYLNPVLGGTIVDAS  194



>ref|XP_003522802.1| PREDICTED: uncharacterized methyltransferase At1g78140, chloroplastic-like 
[Glycine max]
Length=352

 Score =   204 bits (518),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 92/151 (61%), Positives = 121/151 (80%), Gaps = 6/151 (4%)
 Frame = +2

Query  143  VKIRALSTTFV--EDKPVR---LIDEKKVEIRT-NLLACPICYDAFTWNGNPGLSLSSMA  304
            ++ RA ST+F+  E  P     ++ EK V  R+ N LACP+CYD+ TWNG+PG S+ ++ 
Sbjct  38   LQFRASSTSFIDTETNPRESNVVVVEKDVSSRSSNSLACPVCYDSLTWNGDPGFSVDTIT  97

Query  305  QSNLECSTCRKKYSGNETHVDLTIAGGGKAYGEALAASTELFRLPLVSFLYERGWRQSFS  484
             S+ +CSTC+K Y GN+TH+DLT  GG K+YGE++ ASTELFR+PL+SFLYERGWRQ+FS
Sbjct  98   GSSFQCSTCQKTYIGNQTHLDLTATGGAKSYGESMPASTELFRVPLISFLYERGWRQTFS  157

Query  485  LWGGFPGPEKEFELMQDYLKPVMGGNIIDAS  577
            +WGGFPGPEKEFELM+ +LKP++GGNIIDAS
Sbjct  158  VWGGFPGPEKEFELMKGFLKPILGGNIIDAS  188



>ref|XP_007136240.1| hypothetical protein PHAVU_009G030200g [Phaseolus vulgaris]
 gb|ESW08234.1| hypothetical protein PHAVU_009G030200g [Phaseolus vulgaris]
Length=376

 Score =   201 bits (512),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 91/163 (56%), Positives = 121/163 (74%), Gaps = 3/163 (2%)
 Frame = +2

Query  98   FSFSPLTPKANRLFAVKIRALSTTFVE---DKPVRLIDEKKVEIRTNLLACPICYDAFTW  268
            FS S    K     ++++RA ST  +    +    ++ EK+V    N LACP+CYD+  W
Sbjct  50   FSASDFAAKLRFPPSIRLRASSTAVINTETNSTESVVVEKEVGNSCNSLACPVCYDSLAW  109

Query  269  NGNPGLSLSSMAQSNLECSTCRKKYSGNETHVDLTIAGGGKAYGEALAASTELFRLPLVS  448
            NG PGLS+ +++ S+ +C TC+K Y GN+TH+DLT  GG K+YGE + ASTELFR+PL+S
Sbjct  110  NGGPGLSIDTISGSSFQCGTCQKTYVGNQTHIDLTATGGAKSYGETMPASTELFRVPLIS  169

Query  449  FLYERGWRQSFSLWGGFPGPEKEFELMQDYLKPVMGGNIIDAS  577
            FLYERGWRQ+FS+WGGFPGPEKEFELM+ +LKPV+GGNI+DAS
Sbjct  170  FLYERGWRQTFSVWGGFPGPEKEFELMKGFLKPVLGGNIVDAS  212



>gb|AFK47008.1| unknown [Lotus japonicus]
Length=352

 Score =   201 bits (510),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 90/151 (60%), Positives = 119/151 (79%), Gaps = 4/151 (3%)
 Frame = +2

Query  137  FAVKIRALSTT--FVEDKPVR--LIDEKKVEIRTNLLACPICYDAFTWNGNPGLSLSSMA  304
            F +++RA ST    V+ KP    ++D+K+V   +N LACP+C+D+ TW G+ GLS+ S+ 
Sbjct  38   FPLQLRAFSTASPIVDPKPTDSIVVDDKEVRRSSNSLACPVCFDSLTWTGDSGLSVDSIP  97

Query  305  QSNLECSTCRKKYSGNETHVDLTIAGGGKAYGEALAASTELFRLPLVSFLYERGWRQSFS  484
             S+L+CSTC+K Y GN+TH+DLT   G K YG+ + ASTELFR+PL+SFLYERGWRQ+FS
Sbjct  98   VSSLQCSTCQKTYVGNQTHLDLTATSGAKNYGDLMPASTELFRVPLISFLYERGWRQTFS  157

Query  485  LWGGFPGPEKEFELMQDYLKPVMGGNIIDAS  577
            +WGGFPGPEKEFELM+ +L PV+GGNIIDAS
Sbjct  158  VWGGFPGPEKEFELMKGFLNPVLGGNIIDAS  188



>ref|XP_008219673.1| PREDICTED: uncharacterized methyltransferase At1g78140, chloroplastic 
[Prunus mume]
Length=354

 Score =   200 bits (509),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 98/187 (52%), Positives = 130/187 (70%), Gaps = 10/187 (5%)
 Frame = +2

Query  44   LGYVSAVLVTRKLGYNSKFSFSPLTPKANRLF-----AVKIRALSTTFVE----DKPVRL  196
            +G ++   +  +LG NS+     L P    +F     A+  RA ST F+E    D    +
Sbjct  5    IGNITPAFLLSRLG-NSRPCVVKLRPCTAPVFRRSFAAITARAASTAFIEVESTDTNPIV  63

Query  197  IDEKKVEIRTNLLACPICYDAFTWNGNPGLSLSSMAQSNLECSTCRKKYSGNETHVDLTI  376
            +  +      N+LACPIC+D F+ + +PGLS++S + S+ +CSTC+K Y GN+TH+DLT 
Sbjct  64   VQNEVTTSSNNILACPICFDQFSSSADPGLSVNSASGSSFQCSTCKKTYFGNQTHIDLTT  123

Query  377  AGGGKAYGEALAASTELFRLPLVSFLYERGWRQSFSLWGGFPGPEKEFELMQDYLKPVMG  556
            A G K YGE++  STELFR PLVSFLYERGWRQSFS+WGGFPGPEKEFEL++D+LKPV+G
Sbjct  124  ASGSKNYGESMPVSTELFRTPLVSFLYERGWRQSFSVWGGFPGPEKEFELIKDFLKPVLG  183

Query  557  GNIIDAS  577
            GNIIDAS
Sbjct  184  GNIIDAS  190



>gb|KHN19749.1| Putative methyltransferase, chloroplastic [Glycine soja]
Length=353

 Score =   199 bits (506),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 92/152 (61%), Positives = 121/152 (80%), Gaps = 7/152 (5%)
 Frame = +2

Query  143  VKIRALSTTFV--EDKPVR---LIDEKKVEIRT-NLLACPICYDAFTWNGNPGLSLSSMA  304
            ++ RA ST+F+  E  P     ++ EK V  R+ N LACP+CYD+ TWNG+PG S+ ++ 
Sbjct  38   LQFRASSTSFIDTETNPRESNVVVVEKDVSSRSSNSLACPVCYDSLTWNGDPGFSVDTIT  97

Query  305  QSNLECSTCRKKYSGNETHVDLTIAGGGKAYGEALAASTELFR-LPLVSFLYERGWRQSF  481
             S+ +CSTC+K Y GN+TH+DLT  GG K+YGE++ ASTELFR +PL+SFLYERGWRQ+F
Sbjct  98   GSSFQCSTCQKTYIGNQTHLDLTATGGAKSYGESMPASTELFRQVPLISFLYERGWRQTF  157

Query  482  SLWGGFPGPEKEFELMQDYLKPVMGGNIIDAS  577
            S+WGGFPGPEKEFELM+ +LKP++GGNIIDAS
Sbjct  158  SVWGGFPGPEKEFELMKGFLKPILGGNIIDAS  189



>ref|XP_004500619.1| PREDICTED: uncharacterized methyltransferase At1g78140, chloroplastic-like 
[Cicer arietinum]
Length=338

 Score =   198 bits (504),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 91/158 (58%), Positives = 121/158 (77%), Gaps = 5/158 (3%)
 Frame = +2

Query  104  FSPLTPKANRLFAVKIRALSTTFVEDKPVRLIDEKKVEIRTNLLACPICYDAFTWNGNPG  283
            F P T K    F ++++A S+T   D      D   V   +N LACPICY++  W  +PG
Sbjct  22   FFPATAK----FPLRLQASSSTAFIDT-TNQTDSVAVTRSSNPLACPICYNSLIWITDPG  76

Query  284  LSLSSMAQSNLECSTCRKKYSGNETHVDLTIAGGGKAYGEALAASTELFRLPLVSFLYER  463
            LS+ ++ +S+L+CSTC+K Y+GN+TH+DLT+  G K+YGE++ ASTELFR+PL+SFLYER
Sbjct  77   LSVDTIPRSSLQCSTCQKTYNGNQTHLDLTVTSGAKSYGESMPASTELFRMPLISFLYER  136

Query  464  GWRQSFSLWGGFPGPEKEFELMQDYLKPVMGGNIIDAS  577
            GWRQ+FS+WGGFPGPEKEFELM+ +LKPV+GGNIIDAS
Sbjct  137  GWRQTFSVWGGFPGPEKEFELMKSFLKPVLGGNIIDAS  174



>ref|XP_007222212.1| hypothetical protein PRUPE_ppa007824mg [Prunus persica]
 gb|EMJ23411.1| hypothetical protein PRUPE_ppa007824mg [Prunus persica]
Length=354

 Score =   199 bits (505),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 90/150 (60%), Positives = 115/150 (77%), Gaps = 4/150 (3%)
 Frame = +2

Query  140  AVKIRALSTTFVEDKPVR----LIDEKKVEIRTNLLACPICYDAFTWNGNPGLSLSSMAQ  307
            A+  RA ST F+E +P      ++  +      N+LACPIC+D F+ + +PGLS++S + 
Sbjct  41   AITARAASTAFIEVEPRDTNPIVVQNEVTTSSNNILACPICFDQFSSSADPGLSVNSASG  100

Query  308  SNLECSTCRKKYSGNETHVDLTIAGGGKAYGEALAASTELFRLPLVSFLYERGWRQSFSL  487
            S+ +CSTC+K Y GN+TH+DLT A G K YGE++  STELFR PLVSFLYERGWRQSFS+
Sbjct  101  SSFQCSTCKKTYFGNQTHIDLTTASGSKNYGESMPVSTELFRTPLVSFLYERGWRQSFSV  160

Query  488  WGGFPGPEKEFELMQDYLKPVMGGNIIDAS  577
            WGGFPGPEKEFEL +D+LKPV+GGNIIDAS
Sbjct  161  WGGFPGPEKEFELTKDFLKPVLGGNIIDAS  190



>ref|XP_002302290.2| hypothetical protein POPTR_0002s09570g [Populus trichocarpa]
 gb|EEE81563.2| hypothetical protein POPTR_0002s09570g [Populus trichocarpa]
Length=349

 Score =   198 bits (504),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 99/181 (55%), Positives = 129/181 (71%), Gaps = 4/181 (2%)
 Frame = +2

Query  44   LGYVSAVLVTRKLGYNSKFSFSP-LTPKANRL-FAVKIRALSTTFVEDKPVR-LIDEKKV  214
            L  +S+  +  +L  +S+  F+P  TP   R  FA KIRA ST FVE +P   ++ EK V
Sbjct  6    LSNLSSAFLPSQLSKSSRALFTPHCTPTFKRTSFAAKIRASSTAFVETRPTDPVVVEKDV  65

Query  215  EIRTNLLACPICYDAFTWNGNPGLSLSSMAQSNLECSTCRKKYSGNETHVDLTIAGGGKA  394
                N+LACP+CY+  T  G   LS+ S   S+L+CSTC+K YSG ETH++LT+A G KA
Sbjct  66   SSSKNILACPVCYEPVTLIGANVLSVDSARGSSLQCSTCKKTYSGKETHLELTVASGSKA  125

Query  395  YGEALAASTELFRLPLVSFLYERGWRQSFSLWGGFPGPEKEFELMQDYLKPVMGGNIIDA  574
            Y +A+  +TE FR P +SFLYERGWRQ+F +WGGFPGPEKEFE+M+DYLKPV+GGNI+DA
Sbjct  126  YDDAMPMATEFFRTPFISFLYERGWRQNF-VWGGFPGPEKEFEMMKDYLKPVLGGNILDA  184

Query  575  S  577
            S
Sbjct  185  S  185



>ref|XP_006386404.1| hypothetical protein POPTR_0002s09570g [Populus trichocarpa]
 gb|ERP64201.1| hypothetical protein POPTR_0002s09570g [Populus trichocarpa]
Length=355

 Score =   198 bits (503),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 99/181 (55%), Positives = 129/181 (71%), Gaps = 4/181 (2%)
 Frame = +2

Query  44   LGYVSAVLVTRKLGYNSKFSFSP-LTPKANRL-FAVKIRALSTTFVEDKPVR-LIDEKKV  214
            L  +S+  +  +L  +S+  F+P  TP   R  FA KIRA ST FVE +P   ++ EK V
Sbjct  6    LSNLSSAFLPSQLSKSSRALFTPHCTPTFKRTSFAAKIRASSTAFVETRPTDPVVVEKDV  65

Query  215  EIRTNLLACPICYDAFTWNGNPGLSLSSMAQSNLECSTCRKKYSGNETHVDLTIAGGGKA  394
                N+LACP+CY+  T  G   LS+ S   S+L+CSTC+K YSG ETH++LT+A G KA
Sbjct  66   SSSKNILACPVCYEPVTLIGANVLSVDSARGSSLQCSTCKKTYSGKETHLELTVASGSKA  125

Query  395  YGEALAASTELFRLPLVSFLYERGWRQSFSLWGGFPGPEKEFELMQDYLKPVMGGNIIDA  574
            Y +A+  +TE FR P +SFLYERGWRQ+F +WGGFPGPEKEFE+M+DYLKPV+GGNI+DA
Sbjct  126  YDDAMPMATEFFRTPFISFLYERGWRQNF-VWGGFPGPEKEFEMMKDYLKPVLGGNILDA  184

Query  575  S  577
            S
Sbjct  185  S  185



>ref|XP_002285799.1| PREDICTED: uncharacterized methyltransferase At1g78140, chloroplastic 
[Vitis vinifera]
 emb|CBI19149.3| unnamed protein product [Vitis vinifera]
Length=350

 Score =   196 bits (499),  Expect = 8e-58, Method: Compositional matrix adjust.
 Identities = 99/177 (56%), Positives = 124/177 (70%), Gaps = 6/177 (3%)
 Frame = +2

Query  62   VLVTRKLGYNSKFSFSPL--TPKANRLFAVKIRALST---TFVEDKPVRLIDEKKVEIRT  226
            V V  +LG      F PL   P  N +FA K+RA ST     VE KP  +  EK++ I  
Sbjct  11   VFVPGQLGQPRDPFFKPLFSPPTVNFVFAAKLRASSTPAAVVVETKPDPISVEKEISIGK  70

Query  227  NLLACPICYDAFTWNGNPGLSLSSMAQSNLECSTCRKKYSGNETHVDLTIAGGGKAYGEA  406
            ++LACPICY  FTWNG+ GLS+ SM  S+  CS+C+K   GNETH+DLT+A G K Y E+
Sbjct  71   SILACPICYQPFTWNGDLGLSVESMPGSSFHCSSCKKACFGNETHLDLTVATGAKEYDES  130

Query  407  LAASTELFRLPLVSFLYERGWRQSFSLWGGFPGPEKEFELMQDYLKPVMGGNIIDAS  577
            + A+TE+FR PL+SFLYERGWRQ+F +WGGFPG EKEFEL + YLKPV+GG I+DAS
Sbjct  131  MPAATEIFRTPLISFLYERGWRQNF-IWGGFPGLEKEFELAKGYLKPVLGGTIVDAS  186



>gb|KEH34908.1| S-adenosylmethionine-dependent methyltransferase [Medicago truncatula]
Length=342

 Score =   195 bits (495),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 91/163 (56%), Positives = 125/163 (77%), Gaps = 3/163 (2%)
 Frame = +2

Query  92   SKFSFSPLTPKANRLFAVKIRALSTTFVEDKPV-RLIDEKKVEIRTNLLACPICYDAFTW  268
            ++F FSP TPK  +L  ++  + STTF++  P   +I EK++   +N LACP+CY++ TW
Sbjct  18   TRFFFSP-TPKL-QLRLLRASSSSTTFLDTNPTDSVIVEKEITRSSNPLACPVCYNSLTW  75

Query  269  NGNPGLSLSSMAQSNLECSTCRKKYSGNETHVDLTIAGGGKAYGEALAASTELFRLPLVS  448
              NP LS+ +++ S+L+CSTC+K Y+ ++TH++LT       YGE++ ASTELFR PLVS
Sbjct  76   TTNPALSIDTISGSSLQCSTCQKTYTSDQTHLELTTISKANNYGESMPASTELFRTPLVS  135

Query  449  FLYERGWRQSFSLWGGFPGPEKEFELMQDYLKPVMGGNIIDAS  577
            FLYERGWRQ+FS+WGGFPGPEKEFE M+ +LKPV+GGNIIDAS
Sbjct  136  FLYERGWRQTFSVWGGFPGPEKEFEQMKGFLKPVLGGNIIDAS  178



>ref|XP_011016296.1| PREDICTED: uncharacterized methyltransferase At1g78140, chloroplastic 
[Populus euphratica]
Length=379

 Score =   196 bits (497),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 98/181 (54%), Positives = 129/181 (71%), Gaps = 4/181 (2%)
 Frame = +2

Query  44   LGYVSAVLVTRKLGYNSKFSFSP-LTPKANRL-FAVKIRALSTTFVEDKPVR-LIDEKKV  214
            LG +S+  +  +L  +S+  F+P  TP   R  FA KIRA ST FVE +P   ++ EK V
Sbjct  36   LGNLSSAFLPSQLSKSSRPLFTPHCTPTFKRTSFAAKIRASSTAFVETRPTDPVVVEKDV  95

Query  215  EIRTNLLACPICYDAFTWNGNPGLSLSSMAQSNLECSTCRKKYSGNETHVDLTIAGGGKA  394
                N++ACP+CY+  T  G   LS+ S   S+L CSTC+K YSG ETH++LT+A G K+
Sbjct  96   SSSKNIVACPVCYEPVTLIGANVLSVDSARGSSLLCSTCKKTYSGKETHLELTVASGSKS  155

Query  395  YGEALAASTELFRLPLVSFLYERGWRQSFSLWGGFPGPEKEFELMQDYLKPVMGGNIIDA  574
            Y +A+  +TE FR P +SFLYERGWRQ+F +WGGFPGPEKEFE+M+DYLKPV+GGNI+DA
Sbjct  156  YDDAMPMATEFFRTPFISFLYERGWRQNF-VWGGFPGPEKEFEMMKDYLKPVLGGNILDA  214

Query  575  S  577
            S
Sbjct  215  S  215



>gb|KDO80936.1| hypothetical protein CISIN_1g018003mg [Citrus sinensis]
Length=232

 Score =   190 bits (483),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 95/169 (56%), Positives = 118/169 (70%), Gaps = 3/169 (2%)
 Frame = +2

Query  77   KLGYNSKFSFSP-LTPKANRLFAVKIRALSTTFVEDKPVR-LIDEKKVEIRTNLLACPIC  250
            +LG + + S  P  +P   R F  KIRA ST FVE KP      E +     N+LACPIC
Sbjct  18   RLGNSRRCSVKPNPSPIFIRKFVAKIRASSTAFVETKPSEPSFVENEASTSKNVLACPIC  77

Query  251  YDAFTWNGNPGLSLSSMAQSNLECSTCRKKYSGNETHVDLTIAGGGKAYGEALAASTELF  430
            Y   TW G+  LS+ S A S+L+C+TC+K YSG  TH D+T A G K YGE ++ +TE F
Sbjct  78   YKPLTWIGDSSLSIESAAGSSLQCNTCKKTYSGVGTHFDMTAASGSKDYGELMSPATEFF  137

Query  431  RLPLVSFLYERGWRQSFSLWGGFPGPEKEFELMQDYLKPVMGGNIIDAS  577
            R+P +SF+YERGWRQ+F +WGGFPGPEKEFELM+ YLKPV+GGNIIDAS
Sbjct  138  RMPFMSFIYERGWRQNF-VWGGFPGPEKEFELMKGYLKPVLGGNIIDAS  185



>ref|XP_006434006.1| hypothetical protein CICLE_v10001682mg [Citrus clementina]
 gb|ESR47246.1| hypothetical protein CICLE_v10001682mg [Citrus clementina]
 gb|KDO80934.1| hypothetical protein CISIN_1g018003mg [Citrus sinensis]
 gb|KDO80935.1| hypothetical protein CISIN_1g018003mg [Citrus sinensis]
Length=288

 Score =   191 bits (484),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 95/169 (56%), Positives = 118/169 (70%), Gaps = 3/169 (2%)
 Frame = +2

Query  77   KLGYNSKFSFSP-LTPKANRLFAVKIRALSTTFVEDKPVR-LIDEKKVEIRTNLLACPIC  250
            +LG + + S  P  +P   R F  KIRA ST FVE KP      E +     N+LACPIC
Sbjct  18   RLGNSRRCSVKPNPSPIFIRKFVAKIRASSTAFVETKPSEPSFVENEASTSKNVLACPIC  77

Query  251  YDAFTWNGNPGLSLSSMAQSNLECSTCRKKYSGNETHVDLTIAGGGKAYGEALAASTELF  430
            Y   TW G+  LS+ S A S+L+C+TC+K YSG  TH D+T A G K YGE ++ +TE F
Sbjct  78   YKPLTWIGDSSLSIESAAGSSLQCNTCKKTYSGVGTHFDMTAASGSKDYGELMSPATEFF  137

Query  431  RLPLVSFLYERGWRQSFSLWGGFPGPEKEFELMQDYLKPVMGGNIIDAS  577
            R+P +SF+YERGWRQ+F +WGGFPGPEKEFELM+ YLKPV+GGNIIDAS
Sbjct  138  RMPFMSFIYERGWRQNF-VWGGFPGPEKEFELMKGYLKPVLGGNIIDAS  185



>gb|KDO80930.1| hypothetical protein CISIN_1g018003mg [Citrus sinensis]
Length=334

 Score =   190 bits (483),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 95/169 (56%), Positives = 118/169 (70%), Gaps = 3/169 (2%)
 Frame = +2

Query  77   KLGYNSKFSFSP-LTPKANRLFAVKIRALSTTFVEDKPVR-LIDEKKVEIRTNLLACPIC  250
            +LG + + S  P  +P   R F  KIRA ST FVE KP      E +     N+LACPIC
Sbjct  18   RLGNSRRCSVKPNPSPIFIRKFVAKIRASSTAFVETKPSEPSFVENEASTSKNVLACPIC  77

Query  251  YDAFTWNGNPGLSLSSMAQSNLECSTCRKKYSGNETHVDLTIAGGGKAYGEALAASTELF  430
            Y   TW G+  LS+ S A S+L+C+TC+K YSG  TH D+T A G K YGE ++ +TE F
Sbjct  78   YKPLTWIGDSSLSIESAAGSSLQCNTCKKTYSGVGTHFDMTAASGSKDYGELMSPATEFF  137

Query  431  RLPLVSFLYERGWRQSFSLWGGFPGPEKEFELMQDYLKPVMGGNIIDAS  577
            R+P +SF+YERGWRQ+F +WGGFPGPEKEFELM+ YLKPV+GGNIIDAS
Sbjct  138  RMPFMSFIYERGWRQNF-VWGGFPGPEKEFELMKGYLKPVLGGNIIDAS  185



>gb|KDO80931.1| hypothetical protein CISIN_1g018003mg [Citrus sinensis]
Length=351

 Score =   191 bits (484),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 95/169 (56%), Positives = 118/169 (70%), Gaps = 3/169 (2%)
 Frame = +2

Query  77   KLGYNSKFSFSP-LTPKANRLFAVKIRALSTTFVEDKPVR-LIDEKKVEIRTNLLACPIC  250
            +LG + + S  P  +P   R F  KIRA ST FVE KP      E +     N+LACPIC
Sbjct  18   RLGNSRRCSVKPNPSPIFIRKFVAKIRASSTAFVETKPSEPSFVENEASTSKNVLACPIC  77

Query  251  YDAFTWNGNPGLSLSSMAQSNLECSTCRKKYSGNETHVDLTIAGGGKAYGEALAASTELF  430
            Y   TW G+  LS+ S A S+L+C+TC+K YSG  TH D+T A G K YGE ++ +TE F
Sbjct  78   YKPLTWIGDSSLSIESAAGSSLQCNTCKKTYSGVGTHFDMTAASGSKDYGELMSPATEFF  137

Query  431  RLPLVSFLYERGWRQSFSLWGGFPGPEKEFELMQDYLKPVMGGNIIDAS  577
            R+P +SF+YERGWRQ+F +WGGFPGPEKEFELM+ YLKPV+GGNIIDAS
Sbjct  138  RMPFMSFIYERGWRQNF-VWGGFPGPEKEFELMKGYLKPVLGGNIIDAS  185



>ref|XP_006434005.1| hypothetical protein CICLE_v10001682mg [Citrus clementina]
 ref|XP_006434007.1| hypothetical protein CICLE_v10001682mg [Citrus clementina]
 gb|ESR47245.1| hypothetical protein CICLE_v10001682mg [Citrus clementina]
 gb|ESR47247.1| hypothetical protein CICLE_v10001682mg [Citrus clementina]
Length=349

 Score =   190 bits (483),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 95/169 (56%), Positives = 118/169 (70%), Gaps = 3/169 (2%)
 Frame = +2

Query  77   KLGYNSKFSFSP-LTPKANRLFAVKIRALSTTFVEDKPVR-LIDEKKVEIRTNLLACPIC  250
            +LG + + S  P  +P   R F  KIRA ST FVE KP      E +     N+LACPIC
Sbjct  18   RLGNSRRCSVKPNPSPIFIRKFVAKIRASSTAFVETKPSEPSFVENEASTSKNVLACPIC  77

Query  251  YDAFTWNGNPGLSLSSMAQSNLECSTCRKKYSGNETHVDLTIAGGGKAYGEALAASTELF  430
            Y   TW G+  LS+ S A S+L+C+TC+K YSG  TH D+T A G K YGE ++ +TE F
Sbjct  78   YKPLTWIGDSSLSIESAAGSSLQCNTCKKTYSGVGTHFDMTAASGSKDYGELMSPATEFF  137

Query  431  RLPLVSFLYERGWRQSFSLWGGFPGPEKEFELMQDYLKPVMGGNIIDAS  577
            R+P +SF+YERGWRQ+F +WGGFPGPEKEFELM+ YLKPV+GGNIIDAS
Sbjct  138  RMPFMSFIYERGWRQNF-VWGGFPGPEKEFELMKGYLKPVLGGNIIDAS  185



>ref|XP_006472620.1| PREDICTED: uncharacterized methyltransferase At1g78140, chloroplastic-like 
isoform X1 [Citrus sinensis]
Length=351

 Score =   190 bits (482),  Expect = 4e-55, Method: Compositional matrix adjust.
 Identities = 94/169 (56%), Positives = 117/169 (69%), Gaps = 3/169 (2%)
 Frame = +2

Query  77   KLGYNSKFSFSP-LTPKANRLFAVKIRALSTTFVEDKPVR-LIDEKKVEIRTNLLACPIC  250
            +LG + + S  P  +P   R F  KIRA ST F+E KP      E +     N+LACPIC
Sbjct  18   RLGNSRRCSVKPNPSPIFIRKFVAKIRASSTAFIETKPSEPSFVENEASTSKNVLACPIC  77

Query  251  YDAFTWNGNPGLSLSSMAQSNLECSTCRKKYSGNETHVDLTIAGGGKAYGEALAASTELF  430
            Y   TW G+  LS+ S A S+L+C+TC+K YSG  TH D+T A G K YGE +  +TE F
Sbjct  78   YKPLTWIGDSSLSIESAAGSSLQCNTCKKTYSGMGTHFDMTAASGSKDYGELMTPTTEFF  137

Query  431  RLPLVSFLYERGWRQSFSLWGGFPGPEKEFELMQDYLKPVMGGNIIDAS  577
            R+P +SF+YERGWRQ+F +WGGFPGPEKEFELM+ YLKPV+GGNIIDAS
Sbjct  138  RMPFMSFIYERGWRQNF-VWGGFPGPEKEFELMKGYLKPVLGGNIIDAS  185



>gb|KDO80933.1| hypothetical protein CISIN_1g018003mg [Citrus sinensis]
Length=362

 Score =   190 bits (482),  Expect = 4e-55, Method: Compositional matrix adjust.
 Identities = 95/169 (56%), Positives = 118/169 (70%), Gaps = 3/169 (2%)
 Frame = +2

Query  77   KLGYNSKFSFSP-LTPKANRLFAVKIRALSTTFVEDKPVR-LIDEKKVEIRTNLLACPIC  250
            +LG + + S  P  +P   R F  KIRA ST FVE KP      E +     N+LACPIC
Sbjct  18   RLGNSRRCSVKPNPSPIFIRKFVAKIRASSTAFVETKPSEPSFVENEASTSKNVLACPIC  77

Query  251  YDAFTWNGNPGLSLSSMAQSNLECSTCRKKYSGNETHVDLTIAGGGKAYGEALAASTELF  430
            Y   TW G+  LS+ S A S+L+C+TC+K YSG  TH D+T A G K YGE ++ +TE F
Sbjct  78   YKPLTWIGDSSLSIESAAGSSLQCNTCKKTYSGVGTHFDMTAASGSKDYGELMSPATEFF  137

Query  431  RLPLVSFLYERGWRQSFSLWGGFPGPEKEFELMQDYLKPVMGGNIIDAS  577
            R+P +SF+YERGWRQ+F +WGGFPGPEKEFELM+ YLKPV+GGNIIDAS
Sbjct  138  RMPFMSFIYERGWRQNF-VWGGFPGPEKEFELMKGYLKPVLGGNIIDAS  185



>ref|XP_010269234.1| PREDICTED: uncharacterized methyltransferase At1g78140, chloroplastic 
[Nelumbo nucifera]
Length=349

 Score =   188 bits (478),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 91/181 (50%), Positives = 115/181 (64%), Gaps = 3/181 (2%)
 Frame = +2

Query  44   LGYVSAVLVTRKLGYNSKFSFSPLTPKANRLFAVKIRALSTTF---VEDKPVRLIDEKKV  214
            +  VS V + R++G +      P+       FA  IRA ST      E KP  ++D  + 
Sbjct  5    ISRVSTVFLPRQIGDSRHCFLKPVKTTVRIPFAATIRASSTATSIDFEIKPDVIVDRMES  64

Query  215  EIRTNLLACPICYDAFTWNGNPGLSLSSMAQSNLECSTCRKKYSGNETHVDLTIAGGGKA  394
                ++ ACPICYD  TWNG+PGL +     S  +C TC K Y  N+ ++DLT A G K 
Sbjct  65   STSKDIFACPICYDPLTWNGDPGLPVKFTPGSRFQCRTCTKTYFNNKQYLDLTAASGAKE  124

Query  395  YGEALAASTELFRLPLVSFLYERGWRQSFSLWGGFPGPEKEFELMQDYLKPVMGGNIIDA  574
            YGE+   STELFR PLVSFLYERGWRQSFS +GGFPGP+KEFE+ +DYLKPV+GG I+DA
Sbjct  125  YGESTPPSTELFRTPLVSFLYERGWRQSFSFFGGFPGPDKEFEMAKDYLKPVLGGKIVDA  184

Query  575  S  577
            S
Sbjct  185  S  185



>ref|XP_010059991.1| PREDICTED: uncharacterized methyltransferase At1g78140, chloroplastic-like 
[Eucalyptus grandis]
 gb|KCW66499.1| hypothetical protein EUGRSUZ_F00306 [Eucalyptus grandis]
 gb|KCW66500.1| hypothetical protein EUGRSUZ_F00306 [Eucalyptus grandis]
Length=364

 Score =   189 bits (479),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 99/193 (51%), Positives = 127/193 (66%), Gaps = 16/193 (8%)
 Frame = +2

Query  47   GYVSAVLVTRKLGYNSKFSFSP-LTPKANRLFAVKIRALST-------TFVEDKPVRL--  196
            G +++V   R+ G + +F+  P  T    +L A  +RA S+        FVE K      
Sbjct  8    GGLASVFAPRRRGSSRRFALKPGETSFQRQLLAPNVRASSSSSSSSSSAFVETKQPPSPP  67

Query  197  ------IDEKKVEIRTNLLACPICYDAFTWNGNPGLSLSSMAQSNLECSTCRKKYSGNET  358
                  +D++K+    N+LACPICY+  T+ G+  LS+ S + S LEC TC+K Y GNET
Sbjct  68   SPPEATVDKEKLGSNQNVLACPICYEPLTFTGDLVLSVDSASGSTLECGTCKKTYVGNET  127

Query  359  HVDLTIAGGGKAYGEALAASTELFRLPLVSFLYERGWRQSFSLWGGFPGPEKEFELMQDY  538
            H DLT A G K YGE +A STELFR PLVS+LYERGWRQSFS+WGGFPGPEKEFEL + +
Sbjct  128  HFDLTAASGTKEYGEPMALSTELFRTPLVSYLYERGWRQSFSVWGGFPGPEKEFELTKGF  187

Query  539  LKPVMGGNIIDAS  577
            LKPV+GGNI+DAS
Sbjct  188  LKPVLGGNIVDAS  200



>ref|XP_008391080.1| PREDICTED: uncharacterized methyltransferase At1g78140, chloroplastic-like 
[Malus domestica]
Length=355

 Score =   182 bits (461),  Expect = 5e-52, Method: Compositional matrix adjust.
 Identities = 85/141 (60%), Positives = 108/141 (77%), Gaps = 2/141 (1%)
 Frame = +2

Query  161  STTFVEDKPVRLIDEKKVEIRTN-LLACPICYDAFTWNGNPGLSLSSMAQSNLECSTCRK  337
            S   VE +P   I  +   I +N +LACPICYD  + +G+PGLS+ S + S+ +C TC+K
Sbjct  51   SGALVEVEPTEPIVVQNDGISSNNILACPICYDPLSSSGDPGLSVESASGSSFQCGTCKK  110

Query  338  KYSGNETHVDLTIAGGGKAYGEALAASTELFRLPLVSFLYERGWRQSFSLWGGFPGPEKE  517
             Y GNETH+DLT A G K YGE++  +TE+FR PLVS+LYERGWRQSF++WGGFPGPEKE
Sbjct  111  TYFGNETHIDLTTASGTKDYGESMPVTTEIFRTPLVSYLYERGWRQSFTVWGGFPGPEKE  170

Query  518  FELMQDYLKPVM-GGNIIDAS  577
            FEL +D+LKPV+ GGNIIDAS
Sbjct  171  FELTKDFLKPVLGGGNIIDAS  191



>ref|XP_004299641.1| PREDICTED: uncharacterized methyltransferase At1g78140, chloroplastic 
[Fragaria vesca subsp. vesca]
Length=345

 Score =   181 bits (459),  Expect = 6e-52, Method: Compositional matrix adjust.
 Identities = 87/146 (60%), Positives = 110/146 (75%), Gaps = 7/146 (5%)
 Frame = +2

Query  143  VKIRALSTTFVEDKPVRLID-EKKVEIRTNLLACPICYDAFTWNGNPGLSLSSMAQSNLE  319
            + +RA ST FVE  P   I+ + +  I  +LLACPIC+D F+          S + S+ E
Sbjct  42   ITVRASSTAFVETTPSEPIEVQNEATICNDLLACPICFDRFS------SKGESGSGSSFE  95

Query  320  CSTCRKKYSGNETHVDLTIAGGGKAYGEALAASTELFRLPLVSFLYERGWRQSFSLWGGF  499
            CSTC+K YS NETH+DLT+A G K YGE++ ASTE FR+PL+SFLYERGWRQSFS+WGGF
Sbjct  96   CSTCKKTYSSNETHLDLTLASGAKNYGESMPASTEFFRIPLISFLYERGWRQSFSVWGGF  155

Query  500  PGPEKEFELMQDYLKPVMGGNIIDAS  577
            PGPEKEFEL++D +KPV+GG+IIDAS
Sbjct  156  PGPEKEFELIKDCIKPVLGGSIIDAS  181



>ref|XP_008348560.1| PREDICTED: uncharacterized methyltransferase At1g78140, chloroplastic-like 
[Malus domestica]
Length=433

 Score =   183 bits (465),  Expect = 7e-52, Method: Compositional matrix adjust.
 Identities = 86/141 (61%), Positives = 110/141 (78%), Gaps = 2/141 (1%)
 Frame = +2

Query  161  STTFVEDKPVRLIDEKKVEIRTN-LLACPICYDAFTWNGNPGLSLSSMAQSNLECSTCRK  337
            S   VE +P   I  +   I +N +LACPICYD F+ +G+PGLS+ S + S+ +C TC+K
Sbjct  51   SGAVVEVEPTEPIVVQNGGISSNNILACPICYDPFSSSGDPGLSVESASGSSFQCGTCKK  110

Query  338  KYSGNETHVDLTIAGGGKAYGEALAASTELFRLPLVSFLYERGWRQSFSLWGGFPGPEKE  517
             Y GNETH+DLT A G K YGE++  +TE+FR PLVS+LYERGWRQSF++WGGFPGPEKE
Sbjct  111  TYFGNETHIDLTTASGTKDYGESMPVTTEIFRTPLVSYLYERGWRQSFTVWGGFPGPEKE  170

Query  518  FELMQDYLKPVM-GGNIIDAS  577
            FEL++D+LKPV+ GGNIIDAS
Sbjct  171  FELIKDFLKPVLGGGNIIDAS  191



>ref|XP_010064389.1| PREDICTED: uncharacterized methyltransferase At1g78140, chloroplastic-like 
[Eucalyptus grandis]
Length=354

 Score =   174 bits (442),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 88/183 (48%), Positives = 120/183 (66%), Gaps = 6/183 (3%)
 Frame = +2

Query  47   GYVSAVLVTRKLGYNSKFSF-SPLTPKANRLFAVKIRALSTTFVEDKPV-----RLIDEK  208
            G + +V    +LG + +F   S  T    R+ A K+RA S+ ++E +P        + ++
Sbjct  8    GNLVSVFSASQLGSSRRFVLRSGETSFERRVLAPKLRASSSAYIETRPPPPPLESTVRQE  67

Query  209  KVEIRTNLLACPICYDAFTWNGNPGLSLSSMAQSNLECSTCRKKYSGNETHVDLTIAGGG  388
            K+    N LACPIC++  T+ G+P LS++S + S L+C TC+K Y GNETH DLT  GG 
Sbjct  68   KLGGNQNALACPICFEPLTFTGDPVLSVNSASGSTLQCCTCKKAYVGNETHFDLTTTGGT  127

Query  389  KAYGEALAASTELFRLPLVSFLYERGWRQSFSLWGGFPGPEKEFELMQDYLKPVMGGNII  568
            K YGE +  ++ELFR PLVS+LYERGWRQ F    G PGPEKEFEL+  +LKPV+GGNI+
Sbjct  128  KEYGEPVPFASELFRTPLVSYLYERGWRQYFGSLAGSPGPEKEFELIMGFLKPVLGGNIV  187

Query  569  DAS  577
            DAS
Sbjct  188  DAS  190



>ref|XP_002889176.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH65435.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
Length=352

 Score =   173 bits (439),  Expect = 7e-49, Method: Compositional matrix adjust.
 Identities = 78/129 (60%), Positives = 100/129 (78%), Gaps = 2/129 (2%)
 Frame = +2

Query  194  LIDEKKVEIRTNLLACPICYDAFTWNGNP-GLSLSSMAQSNLECSTCRKKYSGNETHVDL  370
            +I+++K      +LACPICY++  W   P GL  S+ + + L+C+TC++ YSGNETH+DL
Sbjct  60   VIEKEKTRGEKKVLACPICYNSLAWISQPNGLIESATSGTQLQCNTCKRSYSGNETHLDL  119

Query  371  TIAGGGKAYGEALAASTELFRLPLVSFLYERGWRQSFSLWGGFPGPEKEFELMQDYLKPV  550
             +A G K Y E +  STELFR PLVSFLYERGWRQ+F +WGGFPGPEKEFE+ +DYLKPV
Sbjct  120  AVASGSKTYSEPMPLSTELFRTPLVSFLYERGWRQNF-IWGGFPGPEKEFEMAKDYLKPV  178

Query  551  MGGNIIDAS  577
            +GGNIIDAS
Sbjct  179  LGGNIIDAS  187



>ref|XP_006390018.1| hypothetical protein EUTSA_v10018789mg [Eutrema salsugineum]
 gb|ESQ27304.1| hypothetical protein EUTSA_v10018789mg [Eutrema salsugineum]
Length=351

 Score =   172 bits (435),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 77/129 (60%), Positives = 99/129 (77%), Gaps = 2/129 (2%)
 Frame = +2

Query  194  LIDEKKVEIRTNLLACPICYDAFTWNGNP-GLSLSSMAQSNLECSTCRKKYSGNETHVDL  370
            +++++K     N+LACPICY++  W   P GL   + + + L+C+TC+K YSGNETH+DL
Sbjct  58   VVEKEKNRGEKNILACPICYNSLAWISQPNGLVEPTASGTQLQCNTCKKSYSGNETHLDL  117

Query  371  TIAGGGKAYGEALAASTELFRLPLVSFLYERGWRQSFSLWGGFPGPEKEFELMQDYLKPV  550
             +A G   Y E +  STELFR PLVSFLYERGWRQ+F +WGGFPGPEKEFE+ +DYLKPV
Sbjct  118  AVASGSNQYSEPMPLSTELFRTPLVSFLYERGWRQNF-IWGGFPGPEKEFEMAKDYLKPV  176

Query  551  MGGNIIDAS  577
            +GGNIIDAS
Sbjct  177  LGGNIIDAS  185



>gb|KDP41368.1| hypothetical protein JCGZ_15775 [Jatropha curcas]
Length=350

 Score =   171 bits (434),  Expect = 4e-48, Method: Compositional matrix adjust.
 Identities = 86/152 (57%), Positives = 111/152 (73%), Gaps = 4/152 (3%)
 Frame = +2

Query  128  NRLFAVKIRALSTT-FVEDKPVR-LIDEKKVEIRTNLLACPICYDAFTWNGNPGLSLSSM  301
            +R FA KIRA S T FVE KP   ++ EK+     N+LACPICY+  +  G+  LS+ + 
Sbjct  37   HRNFAAKIRASSATAFVETKPADPVVVEKEANTGKNILACPICYEPLSLIGDSVLSVDT-  95

Query  302  AQSNLECSTCRKKYSGNETHVDLTIAGGGKAYGEALAASTELFRLPLVSFLYERGWRQSF  481
            A S L+C  C+K YSG ETH++LT+A G + Y +    +TE FR PL+SFLYERGWRQSF
Sbjct  96   AGSILQCGCCKKSYSGKETHIELTVASGLRTYDDTKPLATEFFRTPLISFLYERGWRQSF  155

Query  482  SLWGGFPGPEKEFELMQDYLKPVMGGNIIDAS  577
             +WGGFPGPEKEF+L+++YLKPV+G NIIDAS
Sbjct  156  -IWGGFPGPEKEFDLIKNYLKPVLGKNIIDAS  186



>ref|XP_007018799.1| S-adenosylmethionine-dependent methyltransferase, putative [Theobroma 
cacao]
 gb|EOY16024.1| S-adenosylmethionine-dependent methyltransferase, putative [Theobroma 
cacao]
Length=366

 Score =   171 bits (434),  Expect = 6e-48, Method: Compositional matrix adjust.
 Identities = 91/192 (47%), Positives = 121/192 (63%), Gaps = 20/192 (10%)
 Frame = +2

Query  59   AVLVTRKLGYNSKFSFSPLT-PKANRLFAVKIRALSTTFVEDKPVRLIDEKKVEIR--TN  229
            A+  ++  G +++F F P T P   R    K+RA ST FVE KP   + E+K +    +N
Sbjct  12   AIFPSQLNGNSARFLFRPFTTPVFKRSLTAKVRAFSTAFVETKPTEPVVEEKEDTGGGSN  71

Query  230  LLACPICYDAFTWNGNPGLSLSSMAQSNLECSTCRKKYSGNETHVDLTIAGGGKAYGEAL  409
             LACPICYD     G     + S A SNL+C+TC+K Y GNETH+DL  + G K Y E++
Sbjct  72   GLACPICYDPLIRIGESTSYVGSTAGSNLQCNTCKKTYRGNETHLDLVASSGSKQYDESM  131

Query  410  AASTELF----------------RLPLVSFLYERGWRQSFSLWGGFPGPEKEFELMQDYL  541
              +TE+F                + P+VSFLYERGWRQ+F L+GGFPGPEKEF++ ++YL
Sbjct  132  PLATEVFSTTWIIYNVALTANVLKTPVVSFLYERGWRQNF-LFGGFPGPEKEFDMAKNYL  190

Query  542  KPVMGGNIIDAS  577
            KPV+GGNIIDAS
Sbjct  191  KPVLGGNIIDAS  202



>ref|XP_006300528.1| hypothetical protein CARUB_v10020572mg [Capsella rubella]
 gb|EOA33426.1| hypothetical protein CARUB_v10020572mg [Capsella rubella]
Length=348

 Score =   170 bits (431),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 76/117 (65%), Positives = 94/117 (80%), Gaps = 2/117 (2%)
 Frame = +2

Query  230  LLACPICYDAFTWNGNP-GLSLSSMAQSNLECSTCRKKYSGNETHVDLTIAGGGKAYGEA  406
            +LACPICY++F W   P GL  S  + + L+C+TC++ YSGNETH+DL +A G K Y E 
Sbjct  66   ILACPICYNSFAWISQPNGLVESGASGAQLQCNTCKRSYSGNETHLDLAVASGSKQYSEP  125

Query  407  LAASTELFRLPLVSFLYERGWRQSFSLWGGFPGPEKEFELMQDYLKPVMGGNIIDAS  577
            +  +TELFR PLVSFLYERGWRQ+F +WGGFPGPEKEFE+ +DYLKPV+GGNIIDAS
Sbjct  126  MPLATELFRTPLVSFLYERGWRQNF-VWGGFPGPEKEFEMAKDYLKPVLGGNIIDAS  181



>ref|XP_010061813.1| PREDICTED: uncharacterized methyltransferase At1g78140, chloroplastic-like 
[Eucalyptus grandis]
 gb|KCW68836.1| hypothetical protein EUGRSUZ_F02436 [Eucalyptus grandis]
Length=346

 Score =   169 bits (428),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 81/151 (54%), Positives = 111/151 (74%), Gaps = 4/151 (3%)
 Frame = +2

Query  125  ANRLFAVKIRALSTTFVEDKPVRLIDEKKVEIRTNLLACPICYDAFTWNGNPGLSLSSMA  304
            + R+ A ++RA   T   D P+ ++DEK V  +  +LACPICY   T  G P LS+ +++
Sbjct  36   SRRVHAARVRAAVQTATPD-PI-VVDEK-VASKKGILACPICYHPLTHAG-PALSMDNLS  91

Query  305  QSNLECSTCRKKYSGNETHVDLTIAGGGKAYGEALAASTELFRLPLVSFLYERGWRQSFS  484
            +S L CSTC+K Y GN+TH++L  + G K Y EA+A +TE FRLPL+S++YERGWRQ FS
Sbjct  92   ESTLLCSTCKKTYLGNKTHLELVASSGAKEYTEAMAPATEFFRLPLISYIYERGWRQGFS  151

Query  485  LWGGFPGPEKEFELMQDYLKPVMGGNIIDAS  577
              GG+PGP+KEFEL++ YL+PV+GGNIIDAS
Sbjct  152  AVGGWPGPQKEFELIKGYLEPVLGGNIIDAS  182



>ref|XP_002513908.1| S-adenosylmethionine-dependent methyltransferase, putative [Ricinus 
communis]
 gb|EEF48491.1| S-adenosylmethionine-dependent methyltransferase, putative [Ricinus 
communis]
Length=351

 Score =   168 bits (426),  Expect = 6e-47, Method: Compositional matrix adjust.
 Identities = 88/177 (50%), Positives = 121/177 (68%), Gaps = 12/177 (7%)
 Frame = +2

Query  77   KLGYNSKFSFSPLT-PKANRL-FAVKIRALST-----TFVEDKPVRLIDEKKVEIR---T  226
            + G + +F F+P T P   R  FA K+RA S+       +E KP   +  +K E+    T
Sbjct  13   QFGNSRQFLFNPYTRPIFKRSNFAAKVRASSSTSTSTALLESKPADAVVVEKEEVSRSST  72

Query  227  NLLACPICYDAFTWNGNPGLSLSSMAQSNLECSTCRKKYSGNETHVDLTIAGGGKAYGEA  406
            N++ACPICY+  +  G+  LS+  + + +L C +C+K Y G ETH++LT+A G   Y +A
Sbjct  73   NIIACPICYEPLSLIGDRLLSVD-IGECSLRCGSCKKIYYGKETHIELTVASGASKYDDA  131

Query  407  LAASTELFRLPLVSFLYERGWRQSFSLWGGFPGPEKEFELMQDYLKPVMGGNIIDAS  577
            +  +TE FRL L+SFLYERGWRQ+F +WGGFPGPEKEFEL++DYLKPV+GGNIIDAS
Sbjct  132  MPLATEFFRLSLISFLYERGWRQNF-IWGGFPGPEKEFELIKDYLKPVLGGNIIDAS  187



>ref|XP_010472019.1| PREDICTED: uncharacterized methyltransferase At1g78140, chloroplastic 
isoform X1 [Camelina sativa]
Length=357

 Score =   167 bits (424),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 79/131 (60%), Positives = 98/131 (75%), Gaps = 5/131 (4%)
 Frame = +2

Query  197  IDEKKVEIR--TNLLACPICYDAFTWNGNPGLSLSSMAQS--NLECSTCRKKYSGNETHV  364
            + EK+ + R    +LACPICY++  W   P   + S A S   L+C+TC++ YSGNETH+
Sbjct  63   VIEKETKNRGEKKILACPICYNSLAWISQPNGFVESTASSGTQLQCNTCKRGYSGNETHL  122

Query  365  DLTIAGGGKAYGEALAASTELFRLPLVSFLYERGWRQSFSLWGGFPGPEKEFELMQDYLK  544
            DL +A G K Y E +  STELFR PLVSFLYERGWRQ+F +WGGFPGPEKEFE+ +DYLK
Sbjct  123  DLAVASGTKQYSEPMPLSTELFRTPLVSFLYERGWRQNF-IWGGFPGPEKEFEMAKDYLK  181

Query  545  PVMGGNIIDAS  577
            PV+GGNIIDAS
Sbjct  182  PVLGGNIIDAS  192



>ref|XP_010472020.1| PREDICTED: uncharacterized methyltransferase At1g78140, chloroplastic 
isoform X2 [Camelina sativa]
Length=356

 Score =   167 bits (424),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 79/131 (60%), Positives = 98/131 (75%), Gaps = 5/131 (4%)
 Frame = +2

Query  197  IDEKKVEIR--TNLLACPICYDAFTWNGNPGLSLSSMAQS--NLECSTCRKKYSGNETHV  364
            + EK+ + R    +LACPICY++  W   P   + S A S   L+C+TC++ YSGNETH+
Sbjct  62   VIEKETKNRGEKKILACPICYNSLAWISQPNGFVESTASSGTQLQCNTCKRGYSGNETHL  121

Query  365  DLTIAGGGKAYGEALAASTELFRLPLVSFLYERGWRQSFSLWGGFPGPEKEFELMQDYLK  544
            DL +A G K Y E +  STELFR PLVSFLYERGWRQ+F +WGGFPGPEKEFE+ +DYLK
Sbjct  122  DLAVASGTKQYSEPMPLSTELFRTPLVSFLYERGWRQNF-IWGGFPGPEKEFEMAKDYLK  180

Query  545  PVMGGNIIDAS  577
            PV+GGNIIDAS
Sbjct  181  PVLGGNIIDAS  191



>ref|XP_010064206.1| PREDICTED: uncharacterized methyltransferase At1g78140, chloroplastic-like 
[Eucalyptus grandis]
 gb|KCW66498.1| hypothetical protein EUGRSUZ_F00305 [Eucalyptus grandis]
Length=354

 Score =   167 bits (424),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 86/179 (48%), Positives = 116/179 (65%), Gaps = 6/179 (3%)
 Frame = +2

Query  59   AVLVTRKLGYNSKFSF-SPLTPKANRLFAVKIRALSTTFVEDKPV-----RLIDEKKVEI  220
            +V    +LG + +F   S  T    R+ A K+RA  + +VE +P        + ++K+  
Sbjct  12   SVFGASQLGSSRQFVLRSGETSFERRVLAPKLRASYSAYVETRPPPPPLESTVRQEKLGG  71

Query  221  RTNLLACPICYDAFTWNGNPGLSLSSMAQSNLECSTCRKKYSGNETHVDLTIAGGGKAYG  400
              N LACPIC++   + G+P LS++S + S L+C TC+K Y GNETH DLT  GG K YG
Sbjct  72   NQNALACPICFEPLRFTGDPVLSVNSASGSTLQCGTCKKAYVGNETHFDLTTTGGTKEYG  131

Query  401  EALAASTELFRLPLVSFLYERGWRQSFSLWGGFPGPEKEFELMQDYLKPVMGGNIIDAS  577
            E +  ++ELFR PLVS+LYERGWRQ F    G PGPEKEFEL+  +LKPV+GGNI+DAS
Sbjct  132  EPVPFASELFRTPLVSYLYERGWRQYFESLLGSPGPEKEFELIMGFLKPVLGGNIVDAS  190



>ref|XP_009373157.1| PREDICTED: uncharacterized methyltransferase At1g78140, chloroplastic-like 
[Pyrus x bretschneideri]
Length=348

 Score =   167 bits (423),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 76/118 (64%), Positives = 94/118 (80%), Gaps = 8/118 (7%)
 Frame = +2

Query  227  NLLACPICYDAFTWNGNPGLSLSSMAQSNLECSTCRKKYSGNETHVDLTIAGGGKAYGEA  406
            N+LACPICYD F+ +G+ GLS+        +C TC+K Y GNETH+DLT A G K YGE+
Sbjct  74   NILACPICYDPFSSSGDLGLSI-------FQCRTCKKTYFGNETHIDLTTASGAKDYGES  126

Query  407  LAASTELFRLPLVSFLYERGWRQSFSLWGGFPGPEKEFELMQDYLKPVM-GGNIIDAS  577
               STE+FR PLVS+LYERGWRQSF++WGGFPGPEKEFEL++D+ KPV+ GGN+IDAS
Sbjct  127  KPISTEMFRTPLVSYLYERGWRQSFNVWGGFPGPEKEFELIKDFFKPVLGGGNVIDAS  184



>gb|AAG52104.1|AC012680_15 hypothetical protein; 38642-36701 [Arabidopsis thaliana]
Length=317

 Score =   166 bits (420),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 79/133 (59%), Positives = 99/133 (74%), Gaps = 4/133 (3%)
 Frame = +2

Query  188  VRLIDEKKVEIR--TNLLACPICYDAFTWNGNP-GLSLSSMAQSNLECSTCRKKYSGNET  358
            V  + EKK + R    +LACPICY++  W   P GL  S+ +   ++C+TC++ YSGNET
Sbjct  59   VDFVIEKKDKNRGEKKILACPICYNSLAWISQPNGLIESAASGIQVQCNTCKRSYSGNET  118

Query  359  HVDLTIAGGGKAYGEALAASTELFRLPLVSFLYERGWRQSFSLWGGFPGPEKEFELMQDY  538
            H+DL +A G K Y E +  STELFR PLVSFLYERGWRQ+F +WGGFPGPEKEFE+ + Y
Sbjct  119  HLDLAVASGSKRYSEPMPLSTELFRTPLVSFLYERGWRQNF-IWGGFPGPEKEFEMAKAY  177

Query  539  LKPVMGGNIIDAS  577
            LKPV+GGNIIDAS
Sbjct  178  LKPVLGGNIIDAS  190



>ref|XP_008374425.1| PREDICTED: uncharacterized methyltransferase At1g78140, chloroplastic-like 
isoform X1 [Malus domestica]
Length=355

 Score =   166 bits (421),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 75/118 (64%), Positives = 94/118 (80%), Gaps = 1/118 (1%)
 Frame = +2

Query  227  NLLACPICYDAFTWNGNPGLSLSSMAQSNLECSTCRKKYSGNETHVDLTIAGGGKAYGEA  406
            N+LACPICYD F+ +G+PGLS+ S + S+  CSTC+K Y GNETH+DLT A G K YGE+
Sbjct  74   NILACPICYDPFSSSGDPGLSVESASGSSFHCSTCKKTYFGNETHIDLTTASGAKXYGES  133

Query  407  LAASTELFRLPLVSFLYERGWRQSFSLWGGFPGPEKEFELMQDYLKPVM-GGNIIDAS  577
            +   TE+FR PL+S+LYERGWRQSF+   G PGPEKEFE  +++LKPV+ GGNIIDAS
Sbjct  134  MPVITEMFRTPLISYLYERGWRQSFTGLIGLPGPEKEFEWTKNFLKPVLGGGNIIDAS  191



>ref|XP_010428930.1| PREDICTED: uncharacterized methyltransferase At1g78140, chloroplastic 
isoform X2 [Camelina sativa]
Length=355

 Score =   166 bits (421),  Expect = 4e-46, Method: Compositional matrix adjust.
 Identities = 77/127 (61%), Positives = 93/127 (73%), Gaps = 3/127 (2%)
 Frame = +2

Query  203  EKKVEIRTNLLACPICYDAFTWNGNPGLSLSSMAQS--NLECSTCRKKYSGNETHVDLTI  376
            E K      +LACPICY++  W   P   + S   S   L+C+TC++ YSGNETH+DL +
Sbjct  65   ENKNSGEKKILACPICYNSLAWISPPNGFVESTVSSGTQLQCNTCKRSYSGNETHLDLAV  124

Query  377  AGGGKAYGEALAASTELFRLPLVSFLYERGWRQSFSLWGGFPGPEKEFELMQDYLKPVMG  556
            A G K Y E +  STELFR PLVSFLYERGWRQ+F +WGGFPGPEKEFE+ +DYLKPV+G
Sbjct  125  ASGTKHYSEPMPLSTELFRTPLVSFLYERGWRQNF-IWGGFPGPEKEFEMAKDYLKPVLG  183

Query  557  GNIIDAS  577
            GNIIDAS
Sbjct  184  GNIIDAS  190



>ref|XP_008374562.1| PREDICTED: uncharacterized methyltransferase At1g78140, chloroplastic-like 
isoform X3 [Malus domestica]
Length=334

 Score =   166 bits (419),  Expect = 4e-46, Method: Compositional matrix adjust.
 Identities = 75/118 (64%), Positives = 94/118 (80%), Gaps = 1/118 (1%)
 Frame = +2

Query  227  NLLACPICYDAFTWNGNPGLSLSSMAQSNLECSTCRKKYSGNETHVDLTIAGGGKAYGEA  406
            N+LACPICYD F+ +G+PGLS+ S + S+  CSTC+K Y GNETH+DLT A G K YGE+
Sbjct  74   NILACPICYDPFSSSGDPGLSVESASGSSFHCSTCKKTYFGNETHIDLTTASGAKXYGES  133

Query  407  LAASTELFRLPLVSFLYERGWRQSFSLWGGFPGPEKEFELMQDYLKPVM-GGNIIDAS  577
            +   TE+FR PL+S+LYERGWRQSF+   G PGPEKEFE  +++LKPV+ GGNIIDAS
Sbjct  134  MPVITEMFRTPLISYLYERGWRQSFTGLIGLPGPEKEFEWTKNFLKPVLGGGNIIDAS  191



>ref|XP_010428929.1| PREDICTED: uncharacterized methyltransferase At1g78140, chloroplastic 
isoform X1 [Camelina sativa]
Length=356

 Score =   166 bits (421),  Expect = 4e-46, Method: Compositional matrix adjust.
 Identities = 77/127 (61%), Positives = 93/127 (73%), Gaps = 3/127 (2%)
 Frame = +2

Query  203  EKKVEIRTNLLACPICYDAFTWNGNPGLSLSSMAQS--NLECSTCRKKYSGNETHVDLTI  376
            E K      +LACPICY++  W   P   + S   S   L+C+TC++ YSGNETH+DL +
Sbjct  66   ENKNSGEKKILACPICYNSLAWISPPNGFVESTVSSGTQLQCNTCKRSYSGNETHLDLAV  125

Query  377  AGGGKAYGEALAASTELFRLPLVSFLYERGWRQSFSLWGGFPGPEKEFELMQDYLKPVMG  556
            A G K Y E +  STELFR PLVSFLYERGWRQ+F +WGGFPGPEKEFE+ +DYLKPV+G
Sbjct  126  ASGTKHYSEPMPLSTELFRTPLVSFLYERGWRQNF-IWGGFPGPEKEFEMAKDYLKPVLG  184

Query  557  GNIIDAS  577
            GNIIDAS
Sbjct  185  GNIIDAS  191



>ref|NP_565170.1| S-adenosyl-L-methionine-dependent methyltransferases superfamily 
protein [Arabidopsis thaliana]
 sp|Q8LBV4.1|Y1814_ARATH RecName: Full=Uncharacterized methyltransferase At1g78140, chloroplastic; 
Flags: Precursor [Arabidopsis thaliana]
 gb|AAM64539.1| unknown [Arabidopsis thaliana]
 gb|AAO42148.1| unknown protein [Arabidopsis thaliana]
 gb|AAO50518.1| unknown protein [Arabidopsis thaliana]
 gb|AEE36071.1| S-adenosyl-L-methionine-dependent methyltransferases superfamily 
protein [Arabidopsis thaliana]
Length=355

 Score =   166 bits (420),  Expect = 5e-46, Method: Compositional matrix adjust.
 Identities = 79/133 (59%), Positives = 99/133 (74%), Gaps = 4/133 (3%)
 Frame = +2

Query  188  VRLIDEKKVEIR--TNLLACPICYDAFTWNGNP-GLSLSSMAQSNLECSTCRKKYSGNET  358
            V  + EKK + R    +LACPICY++  W   P GL  S+ +   ++C+TC++ YSGNET
Sbjct  59   VDFVIEKKDKNRGEKKILACPICYNSLAWISQPNGLIESAASGIQVQCNTCKRSYSGNET  118

Query  359  HVDLTIAGGGKAYGEALAASTELFRLPLVSFLYERGWRQSFSLWGGFPGPEKEFELMQDY  538
            H+DL +A G K Y E +  STELFR PLVSFLYERGWRQ+F +WGGFPGPEKEFE+ + Y
Sbjct  119  HLDLAVASGSKRYSEPMPLSTELFRTPLVSFLYERGWRQNF-IWGGFPGPEKEFEMAKAY  177

Query  539  LKPVMGGNIIDAS  577
            LKPV+GGNIIDAS
Sbjct  178  LKPVLGGNIIDAS  190



>ref|XP_009128280.1| PREDICTED: uncharacterized methyltransferase At1g78140, chloroplastic-like 
[Brassica rapa]
Length=341

 Score =   165 bits (418),  Expect = 7e-46, Method: Compositional matrix adjust.
 Identities = 76/123 (62%), Positives = 94/123 (76%), Gaps = 2/123 (2%)
 Frame = +2

Query  212  VEIRTNLLACPICYDAFTWNGNP-GLSLSSMAQSNLECSTCRKKYSGNETHVDLTIAGGG  388
            VE   ++LACPICY++      P GL  S+ + + L+C+TC+K YSGNETH+DL +A G 
Sbjct  54   VEKEKDILACPICYNSLALISKPNGLVGSAASGTQLQCNTCKKSYSGNETHLDLAVASGS  113

Query  389  KAYGEALAASTELFRLPLVSFLYERGWRQSFSLWGGFPGPEKEFELMQDYLKPVMGGNII  568
              Y E +  STE+FR PLVSFLYERGWRQ+F +WGGFPGPEKEFE+ +DYLKPV GGNII
Sbjct  114  NQYTEPMPLSTEIFRTPLVSFLYERGWRQNF-IWGGFPGPEKEFEMAKDYLKPVFGGNII  172

Query  569  DAS  577
            DAS
Sbjct  173  DAS  175



>ref|XP_009394965.1| PREDICTED: uncharacterized methyltransferase At1g78140, chloroplastic 
isoform X2 [Musa acuminata subsp. malaccensis]
Length=352

 Score =   165 bits (418),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 93/189 (49%), Positives = 115/189 (61%), Gaps = 15/189 (8%)
 Frame = +2

Query  44   LGYVSAVLVTRKLGYNSKFSFSP---LTPKANRLF-AVKIRALST-------TFVEDKPV  190
            LG V  VL+   L +   F F+P   L PK + L   V IRA +T       T   D   
Sbjct  5    LGNVGGVLLHLPLRH---FLFNPRRSLIPKPHLLARGVVIRAATTSSSSPPGTATGDSNP  61

Query  191  RLIDEKKVEIRTNLLACPICYDAFTWNGNPGLSLSSMAQSNLECSTCRKKYSGNETHVDL  370
             L ++ KV     +LACPICY++      PGL L+  + SNLEC TC+K Y  N  ++DL
Sbjct  62   DLTEDAKVSTGIPILACPICYNSLISKNGPGLKLAFQSASNLECHTCKKDYQNNGIYLDL  121

Query  371  TIAGGGKAYGEALAASTELFRLPLVSFLYERGWRQSFSLWGGFPGPEKEFELMQDYLKPV  550
             +A G K Y E + A TELFR PLVSFLYERGWRQ+F +WGGFPGPE+EFE+ + YLKP 
Sbjct  122  AVASGSKDYAETMPAMTELFRSPLVSFLYERGWRQNF-VWGGFPGPEREFEMAKGYLKPS  180

Query  551  MGGNIIDAS  577
             GG IIDAS
Sbjct  181  TGGTIIDAS  189



>emb|CDY26853.1| BnaA02g18780D [Brassica napus]
Length=341

 Score =   165 bits (417),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 76/123 (62%), Positives = 94/123 (76%), Gaps = 2/123 (2%)
 Frame = +2

Query  212  VEIRTNLLACPICYDAFTWNGNP-GLSLSSMAQSNLECSTCRKKYSGNETHVDLTIAGGG  388
            VE   ++LACPICY++      P GL  S+ + + L+C+TC+K YSGN+TH+DL +A G 
Sbjct  54   VEKEKDILACPICYNSLALISKPNGLVGSAASGTQLQCNTCKKSYSGNDTHLDLAVASGS  113

Query  389  KAYGEALAASTELFRLPLVSFLYERGWRQSFSLWGGFPGPEKEFELMQDYLKPVMGGNII  568
              Y E +  STELFR PLVSFLYERGWRQ+F +WGGFPGPEKEFE+ +DYLKPV GGNII
Sbjct  114  NQYTEPMPLSTELFRTPLVSFLYERGWRQNF-IWGGFPGPEKEFEMAKDYLKPVFGGNII  172

Query  569  DAS  577
            DAS
Sbjct  173  DAS  175



>ref|XP_010416782.1| PREDICTED: uncharacterized methyltransferase At1g78140, chloroplastic-like 
isoform X1 [Camelina sativa]
Length=360

 Score =   165 bits (418),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 78/131 (60%), Positives = 98/131 (75%), Gaps = 5/131 (4%)
 Frame = +2

Query  197  IDEKKVEIR--TNLLACPICYDAFTWNGNPGLSLSSMAQS--NLECSTCRKKYSGNETHV  364
            + EK+ + R    +LACPICY++  W   P   + S A S   L+C+TC++ YSGNETH+
Sbjct  66   VIEKETKNRGEKKILACPICYNSLAWISPPNGFVESTASSGTQLQCNTCKRGYSGNETHL  125

Query  365  DLTIAGGGKAYGEALAASTELFRLPLVSFLYERGWRQSFSLWGGFPGPEKEFELMQDYLK  544
            DL +A G + Y E +  STELFR PLVSFLYERGWRQ+F +WGGFPGPEKEFE+ +DYLK
Sbjct  126  DLAVASGTEQYSEPMPLSTELFRTPLVSFLYERGWRQNF-IWGGFPGPEKEFEMAKDYLK  184

Query  545  PVMGGNIIDAS  577
            PV+GGNIIDAS
Sbjct  185  PVLGGNIIDAS  195



>ref|XP_010416783.1| PREDICTED: uncharacterized methyltransferase At1g78140, chloroplastic-like 
isoform X2 [Camelina sativa]
Length=359

 Score =   165 bits (417),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 78/131 (60%), Positives = 98/131 (75%), Gaps = 5/131 (4%)
 Frame = +2

Query  197  IDEKKVEIR--TNLLACPICYDAFTWNGNPGLSLSSMAQS--NLECSTCRKKYSGNETHV  364
            + EK+ + R    +LACPICY++  W   P   + S A S   L+C+TC++ YSGNETH+
Sbjct  65   VIEKETKNRGEKKILACPICYNSLAWISPPNGFVESTASSGTQLQCNTCKRGYSGNETHL  124

Query  365  DLTIAGGGKAYGEALAASTELFRLPLVSFLYERGWRQSFSLWGGFPGPEKEFELMQDYLK  544
            DL +A G + Y E +  STELFR PLVSFLYERGWRQ+F +WGGFPGPEKEFE+ +DYLK
Sbjct  125  DLAVASGTEQYSEPMPLSTELFRTPLVSFLYERGWRQNF-IWGGFPGPEKEFEMAKDYLK  183

Query  545  PVMGGNIIDAS  577
            PV+GGNIIDAS
Sbjct  184  PVLGGNIIDAS  194



>ref|XP_009394966.1| PREDICTED: uncharacterized methyltransferase At1g78140, chloroplastic 
isoform X3 [Musa acuminata subsp. malaccensis]
Length=312

 Score =   164 bits (414),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 93/192 (48%), Positives = 117/192 (61%), Gaps = 18/192 (9%)
 Frame = +2

Query  44   LGYVSAVLVTRKLGYNSKFSFSP---LTPKANRLF-AVKIRALSTTFV--------EDKP  187
            LG V  VL+   L +   F F+P   L PK + L   V IRA +T+          +  P
Sbjct  5    LGNVGGVLLHLPLRH---FLFNPRRSLIPKPHLLARGVVIRAATTSSSSPPGTATGDSNP  61

Query  188  VR--LIDEKKVEIRTNLLACPICYDAFTWNGNPGLSLSSMAQSNLECSTCRKKYSGNETH  361
            V   L ++ KV     +LACPICY++      PGL L+  + SNLEC TC+K Y  N  +
Sbjct  62   VTQDLTEDAKVSTGIPILACPICYNSLISKNGPGLKLAFQSASNLECHTCKKDYQNNGIY  121

Query  362  VDLTIAGGGKAYGEALAASTELFRLPLVSFLYERGWRQSFSLWGGFPGPEKEFELMQDYL  541
            +DL +A G K Y E + A TELFR PLVSFLYERGWRQ+F +WGGFPGPE+EFE+ + YL
Sbjct  122  LDLAVASGSKDYAETMPAMTELFRSPLVSFLYERGWRQNF-VWGGFPGPEREFEMAKGYL  180

Query  542  KPVMGGNIIDAS  577
            KP  GG IIDAS
Sbjct  181  KPSTGGTIIDAS  192



>ref|XP_009394964.1| PREDICTED: uncharacterized methyltransferase At1g78140, chloroplastic 
isoform X1 [Musa acuminata subsp. malaccensis]
Length=355

 Score =   163 bits (413),  Expect = 5e-45, Method: Compositional matrix adjust.
 Identities = 93/192 (48%), Positives = 117/192 (61%), Gaps = 18/192 (9%)
 Frame = +2

Query  44   LGYVSAVLVTRKLGYNSKFSFSP---LTPKANRLF-AVKIRALSTTFV--------EDKP  187
            LG V  VL+   L +   F F+P   L PK + L   V IRA +T+          +  P
Sbjct  5    LGNVGGVLLHLPLRH---FLFNPRRSLIPKPHLLARGVVIRAATTSSSSPPGTATGDSNP  61

Query  188  VR--LIDEKKVEIRTNLLACPICYDAFTWNGNPGLSLSSMAQSNLECSTCRKKYSGNETH  361
            V   L ++ KV     +LACPICY++      PGL L+  + SNLEC TC+K Y  N  +
Sbjct  62   VTQDLTEDAKVSTGIPILACPICYNSLISKNGPGLKLAFQSASNLECHTCKKDYQNNGIY  121

Query  362  VDLTIAGGGKAYGEALAASTELFRLPLVSFLYERGWRQSFSLWGGFPGPEKEFELMQDYL  541
            +DL +A G K Y E + A TELFR PLVSFLYERGWRQ+F +WGGFPGPE+EFE+ + YL
Sbjct  122  LDLAVASGSKDYAETMPAMTELFRSPLVSFLYERGWRQNF-VWGGFPGPEREFEMAKGYL  180

Query  542  KPVMGGNIIDAS  577
            KP  GG IIDAS
Sbjct  181  KPSTGGTIIDAS  192



>gb|KCW67137.1| hypothetical protein EUGRSUZ_F00926, partial [Eucalyptus grandis]
Length=294

 Score =   161 bits (408),  Expect = 7e-45, Method: Compositional matrix adjust.
 Identities = 73/127 (57%), Positives = 94/127 (74%), Gaps = 0/127 (0%)
 Frame = +2

Query  197  IDEKKVEIRTNLLACPICYDAFTWNGNPGLSLSSMAQSNLECSTCRKKYSGNETHVDLTI  376
            + ++K+    N LACPIC++  T+ G+P LS++S + S L+C TC+K Y GNETH DLT 
Sbjct  4    VRQEKLGGNQNALACPICFEPLTFTGDPVLSVNSASGSTLQCCTCKKAYVGNETHFDLTT  63

Query  377  AGGGKAYGEALAASTELFRLPLVSFLYERGWRQSFSLWGGFPGPEKEFELMQDYLKPVMG  556
             GG K YGE +  ++ELFR PLVS+LYERGWRQ F    G PGPEKEFEL+  +LKPV+G
Sbjct  64   TGGTKEYGEPVPFASELFRTPLVSYLYERGWRQYFGSLAGSPGPEKEFELIMGFLKPVLG  123

Query  557  GNIIDAS  577
            GNI+DAS
Sbjct  124  GNIVDAS  130



>ref|XP_010534072.1| PREDICTED: uncharacterized methyltransferase At1g78140, chloroplastic-like 
isoform X3 [Tarenaya hassleriana]
Length=283

 Score =   160 bits (405),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 84/152 (55%), Positives = 106/152 (70%), Gaps = 10/152 (7%)
 Frame = +2

Query  149  IRALSTTF-VEDKPVR---LIDEKKVEIRTNLLACPICYDAFTWNGNP-GLSLSSMAQS-  310
            IRA S    +E KP      + EK+     N+LACPIC+++      P G+ +  + +S 
Sbjct  43   IRASSAAVSIETKPKEDPVPVAEKENIGEKNVLACPICFNSLARVNQPNGIEIWHIREST  102

Query  311  ---NLECSTCRKKYSGNETHVDLTIAGGGKAYGEALAASTELFRLPLVSFLYERGWRQSF  481
               +L+C TC+K YSG ETH+DLT+AG  K YGE +  STELFRLPLVSFLYERGWRQSF
Sbjct  103  LGTSLQCVTCKKNYSGCETHLDLTVAGETKQYGEQMPLSTELFRLPLVSFLYERGWRQSF  162

Query  482  SLWGGFPGPEKEFELMQDYLKPVMGGNIIDAS  577
             +WGGFPGPE+EFE+ +DYLKP +GG IIDAS
Sbjct  163  -IWGGFPGPEREFEMAKDYLKPALGGKIIDAS  193



>ref|XP_008356589.1| PREDICTED: LOW QUALITY PROTEIN: uncharacterized methyltransferase 
At1g78140, chloroplastic-like [Malus domestica]
Length=259

 Score =   159 bits (402),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 80/149 (54%), Positives = 104/149 (70%), Gaps = 8/149 (5%)
 Frame = +2

Query  146  KIRALSTTFVEDKPVRLIDEKKVE----IRTNLLACPICYDAFTWNGNPGLSLSSMAQSN  313
            ++ A S   VE   V LI+   V+      TN+LA PICYD F+   +PGL + S + S+
Sbjct  16   QLAAASGAVVE---VELIEPIMVQNDGISSTNILAGPICYDPFSSXXDPGLFVESASGSS  72

Query  314  LECSTCRKKYSGNETHVDLTIAGGGKAYGEALAASTELFRLPLVSFLYERGWRQSFSLWG  493
             +C TC+K Y GNETH+ LT A   K YGE++  + E+FR PLV +LYE+GWRQSF++WG
Sbjct  73   FQCGTCKKTYFGNETHIXLTTASSAKNYGESMPVAXEMFRTPLVLYLYEKGWRQSFTVWG  132

Query  494  GFPGPEKEFELMQDYLKPVM-GGNIIDAS  577
            GFPG EKEFEL +D+LKPV+ GGNIIDAS
Sbjct  133  GFPGLEKEFELTKDFLKPVLGGGNIIDAS  161



>ref|XP_010534070.1| PREDICTED: uncharacterized methyltransferase At1g78140, chloroplastic-like 
isoform X1 [Tarenaya hassleriana]
Length=356

 Score =   161 bits (407),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 84/152 (55%), Positives = 106/152 (70%), Gaps = 10/152 (7%)
 Frame = +2

Query  149  IRALSTTF-VEDKPVR---LIDEKKVEIRTNLLACPICYDAFTWNGNP-GLSLSSMAQS-  310
            IRA S    +E KP      + EK+     N+LACPIC+++      P G+ +  + +S 
Sbjct  43   IRASSAAVSIETKPKEDPVPVAEKENIGEKNVLACPICFNSLARVNQPNGIEIWHIREST  102

Query  311  ---NLECSTCRKKYSGNETHVDLTIAGGGKAYGEALAASTELFRLPLVSFLYERGWRQSF  481
               +L+C TC+K YSG ETH+DLT+AG  K YGE +  STELFRLPLVSFLYERGWRQSF
Sbjct  103  LGTSLQCVTCKKNYSGCETHLDLTVAGETKQYGEQMPLSTELFRLPLVSFLYERGWRQSF  162

Query  482  SLWGGFPGPEKEFELMQDYLKPVMGGNIIDAS  577
             +WGGFPGPE+EFE+ +DYLKP +GG IIDAS
Sbjct  163  -IWGGFPGPEREFEMAKDYLKPALGGKIIDAS  193



>ref|XP_010534071.1| PREDICTED: uncharacterized methyltransferase At1g78140, chloroplastic-like 
isoform X2 [Tarenaya hassleriana]
Length=349

 Score =   160 bits (406),  Expect = 5e-44, Method: Compositional matrix adjust.
 Identities = 83/147 (56%), Positives = 103/147 (70%), Gaps = 7/147 (5%)
 Frame = +2

Query  149  IRALSTTF-VEDKPVR---LIDEKKVEIRTNLLACPICYDAFTWNGNPGLSLSSMAQSNL  316
            IRA S    +E KP      + EK+     N+LACPIC+++      P  +  S   ++L
Sbjct  43   IRASSAAVSIETKPKEDPVPVAEKENIGEKNVLACPICFNSLARVNQP--NGESTLGTSL  100

Query  317  ECSTCRKKYSGNETHVDLTIAGGGKAYGEALAASTELFRLPLVSFLYERGWRQSFSLWGG  496
            +C TC+K YSG ETH+DLT+AG  K YGE +  STELFRLPLVSFLYERGWRQSF +WGG
Sbjct  101  QCVTCKKNYSGCETHLDLTVAGETKQYGEQMPLSTELFRLPLVSFLYERGWRQSF-IWGG  159

Query  497  FPGPEKEFELMQDYLKPVMGGNIIDAS  577
            FPGPE+EFE+ +DYLKP +GG IIDAS
Sbjct  160  FPGPEREFEMAKDYLKPALGGKIIDAS  186



>emb|CDY14625.1| BnaC02g24880D [Brassica napus]
Length=339

 Score =   160 bits (405),  Expect = 5e-44, Method: Compositional matrix adjust.
 Identities = 74/122 (61%), Positives = 91/122 (75%), Gaps = 2/122 (2%)
 Frame = +2

Query  212  VEIRTNLLACPICYDAFTWNGNPGLSLSSMAQSNLECSTCRKKYSGNETHVDLTIAGGGK  391
            VE   ++LACPICY++      P   L   A + L+C+TC+  YSGNETH+DL +A G  
Sbjct  54   VEKEKDILACPICYNSLALISQPN-GLVGSAGTQLQCNTCKGSYSGNETHLDLAVASGSN  112

Query  392  AYGEALAASTELFRLPLVSFLYERGWRQSFSLWGGFPGPEKEFELMQDYLKPVMGGNIID  571
             Y E +  STELFR PLVSFLYERGWRQ+F +WGGFPGPEKEFE+ ++YLKPV+GGNIID
Sbjct  113  QYTEPMPLSTELFRTPLVSFLYERGWRQNF-IWGGFPGPEKEFEMAREYLKPVLGGNIID  171

Query  572  AS  577
            AS
Sbjct  172  AS  173



>ref|XP_006472621.1| PREDICTED: uncharacterized methyltransferase At1g78140, chloroplastic-like 
isoform X2 [Citrus sinensis]
Length=333

 Score =   157 bits (397),  Expect = 8e-43, Method: Compositional matrix adjust.
 Identities = 84/169 (50%), Positives = 103/169 (61%), Gaps = 21/169 (12%)
 Frame = +2

Query  77   KLGYNSKFSFSP-LTPKANRLFAVKIRALSTTFVEDKPVR-LIDEKKVEIRTNLLACPIC  250
            +LG + + S  P  +P   R F  KIRA ST F+E KP      E +     N+LACPIC
Sbjct  18   RLGNSRRCSVKPNPSPIFIRKFVAKIRASSTAFIETKPSEPSFVENEASTSKNVLACPIC  77

Query  251  YDAFTWNGNPGLSLSSMAQSNLECSTCRKKYSGNETHVDLTIAGGGKAYGEALAASTELF  430
            Y   TW G+  LS+                  G  TH D+T A G K YGE +  +TE F
Sbjct  78   YKPLTWIGDSSLSI------------------GMGTHFDMTAASGSKDYGELMTPTTEFF  119

Query  431  RLPLVSFLYERGWRQSFSLWGGFPGPEKEFELMQDYLKPVMGGNIIDAS  577
            R+P +SF+YERGWRQ+F +WGGFPGPEKEFELM+ YLKPV+GGNIIDAS
Sbjct  120  RMPFMSFIYERGWRQNF-VWGGFPGPEKEFELMKGYLKPVLGGNIIDAS  167



>ref|XP_008374488.1| PREDICTED: uncharacterized methyltransferase At1g78140, chloroplastic-like 
isoform X2 [Malus domestica]
Length=348

 Score =   157 bits (398),  Expect = 8e-43, Method: Compositional matrix adjust.
 Identities = 73/118 (62%), Positives = 90/118 (76%), Gaps = 8/118 (7%)
 Frame = +2

Query  227  NLLACPICYDAFTWNGNPGLSLSSMAQSNLECSTCRKKYSGNETHVDLTIAGGGKAYGEA  406
            N+LACPICYD F+ +G+PGLS+         CSTC+K Y GNETH+DLT A G K YGE+
Sbjct  74   NILACPICYDPFSSSGDPGLSV-------FHCSTCKKTYFGNETHIDLTTASGAKXYGES  126

Query  407  LAASTELFRLPLVSFLYERGWRQSFSLWGGFPGPEKEFELMQDYLKPVM-GGNIIDAS  577
            +   TE+FR PL+S+LYERGWRQSF+   G PGPEKEFE  +++LKPV+ GGNIIDAS
Sbjct  127  MPVITEMFRTPLISYLYERGWRQSFTGLIGLPGPEKEFEWTKNFLKPVLGGGNIIDAS  184



>gb|KJB59929.1| hypothetical protein B456_009G281700 [Gossypium raimondii]
Length=349

 Score =   157 bits (397),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 81/168 (48%), Positives = 109/168 (65%), Gaps = 10/168 (6%)
 Frame = +2

Query  89   NSKFSFSPLTPKA-NRLFAVKIRALSTTFVEDKPVRLIDEKKVEIRTNL----LACPICY  253
            +++F F P T     R    K+RA    FVE KP   I  +K E         LACPICY
Sbjct  22   SARFLFRPFTTLVFTRSLTAKVRA----FVETKPTAPIAVEKEESGGGGGSCGLACPICY  77

Query  254  DAFTWNGNPGLSLSSMAQSNLECSTCRKKYSGNETHVDLTIAGGGKAYGEALAASTELFR  433
            +  T   +  + + S   SNL+C+TC+K YSG +TH+DL  + G K Y E++  +TELFR
Sbjct  78   NPLTVISDSPIYVGSTVGSNLQCNTCKKTYSGTQTHLDLVASSGSKQYDESMPLATELFR  137

Query  434  LPLVSFLYERGWRQSFSLWGGFPGPEKEFELMQDYLKPVMGGNIIDAS  577
             P+VSFLYERGWRQ+F ++GGFPGPEKEF++ ++YLK V+GG I+DAS
Sbjct  138  TPVVSFLYERGWRQNF-VFGGFPGPEKEFDMAKNYLKRVLGGKIVDAS  184



>emb|CDX88421.1| BnaC06g38650D [Brassica napus]
Length=353

 Score =   156 bits (395),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 80/147 (54%), Positives = 100/147 (68%), Gaps = 6/147 (4%)
 Frame = +2

Query  143  VKIRALSTTFVEDKPVRLIDEKKVEIRTNLLACPICYDAFT-WNGNPGLSLSSMAQ-SNL  316
            +  RA S +      V  + EK+   + N+LACPICY++       P  S  S A  ++L
Sbjct  40   ISARASSASVETKSSVDYVVEKE---KKNILACPICYNSLAALISQPHESAESPASGTHL  96

Query  317  ECSTCRKKYSGNETHVDLTIAGGGKAYGEALAASTELFRLPLVSFLYERGWRQSFSLWGG  496
            +C TC K YS NETH+DLT+A G K Y E L  S EL+R PLVSFLYERGWRQ+F +WGG
Sbjct  97   QCKTCNKSYSANETHLDLTVASGTKQYTEPLPLSIELYRNPLVSFLYERGWRQNF-MWGG  155

Query  497  FPGPEKEFELMQDYLKPVMGGNIIDAS  577
            FPGPEKEFE+ ++YLK V+GGNIIDAS
Sbjct  156  FPGPEKEFEMAKEYLKHVLGGNIIDAS  182



>ref|XP_010937469.1| PREDICTED: uncharacterized methyltransferase At1g78140, chloroplastic-like 
[Elaeis guineensis]
Length=345

 Score =   154 bits (390),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 76/149 (51%), Positives = 96/149 (64%), Gaps = 3/149 (2%)
 Frame = +2

Query  137  FAVKIRALS--TTFVEDKPVRLIDEKKVEIRTNLLACPICYDAFTWNGNPGLSLSSMAQS  310
             + +IRA S  T  VE  PV LI + KV    N L CP+CY       N   ++ S A S
Sbjct  31   LSARIRASSSATASVEADPVALIPDAKVSTGINNLGCPVCYYPLISQSNASQTIESTAGS  90

Query  311  NLECSTCRKKYSGNETHVDLTIAGGGKAYGEALAASTELFRLPLVSFLYERGWRQSFSLW  490
             +EC  C+K Y  N T++DLT+AGG K Y E +   TELFR  LVSFLYERGWRQ+F +W
Sbjct  91   YVECHICKKAYFSNGTYLDLTVAGGSKEYTETMPGGTELFRSQLVSFLYERGWRQNF-IW  149

Query  491  GGFPGPEKEFELMQDYLKPVMGGNIIDAS  577
            GGFPGP++EFE+ + YL P +GG I+DAS
Sbjct  150  GGFPGPQREFEMAKVYLTPTIGGTIVDAS  178



>gb|KHG01878.1| hypothetical protein F383_23026 [Gossypium arboreum]
Length=349

 Score =   154 bits (389),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 80/168 (48%), Positives = 108/168 (64%), Gaps = 10/168 (6%)
 Frame = +2

Query  89   NSKFSFSPLTPKA-NRLFAVKIRALSTTFVEDKPVRLIDEKKVEIRTNL----LACPICY  253
            +++F F P T     R    K+RA    FVE KP   I  +K E         LACPICY
Sbjct  22   SAQFLFRPFTTLVFTRSLTAKVRA----FVETKPTAPIAVEKEESGGGSGSCGLACPICY  77

Query  254  DAFTWNGNPGLSLSSMAQSNLECSTCRKKYSGNETHVDLTIAGGGKAYGEALAASTELFR  433
            +      +  + + S   +NL+C+TC+K YSG +TH+DL  + G K Y E++  +TELFR
Sbjct  78   NLLMVITDSPIYVGSTVGTNLQCNTCKKTYSGTQTHLDLVASSGSKQYDESMPLATELFR  137

Query  434  LPLVSFLYERGWRQSFSLWGGFPGPEKEFELMQDYLKPVMGGNIIDAS  577
             P+VSFLYERGWRQ+F ++GGFPGPEKEF++ ++YLK V+GG IIDAS
Sbjct  138  TPVVSFLYERGWRQNF-VFGGFPGPEKEFDMAKNYLKRVLGGKIIDAS  184



>ref|XP_008808068.1| PREDICTED: uncharacterized methyltransferase At1g78140, chloroplastic-like 
[Phoenix dactylifera]
Length=339

 Score =   152 bits (385),  Expect = 5e-41, Method: Compositional matrix adjust.
 Identities = 76/155 (49%), Positives = 99/155 (64%), Gaps = 3/155 (2%)
 Frame = +2

Query  119  PKANRLFAVKIRALS--TTFVEDKPVRLIDEKKVEIRTNLLACPICYDAFTWNGNPGLSL  292
            P A    +V+IRA S  T  VE  PV  I + KV    N L CP+CY       N   ++
Sbjct  23   PSAKPPLSVRIRASSSVTASVEANPVDPIPDAKVSTGMNNLGCPVCYYPLISKSNASQTV  82

Query  293  SSMAQSNLECSTCRKKYSGNETHVDLTIAGGGKAYGEALAASTELFRLPLVSFLYERGWR  472
            +S A S++EC  C+K Y  N  ++DLT++ G K Y E + A TELFR  LVSFLYERGWR
Sbjct  83   ASPAGSDVECHICKKDYFNNGIYLDLTVSSGSKEYTETVPAGTELFRSQLVSFLYERGWR  142

Query  473  QSFSLWGGFPGPEKEFELMQDYLKPVMGGNIIDAS  577
            Q+F +WGGFPGP++EFE+ + YL P +GG I+DAS
Sbjct  143  QNF-IWGGFPGPQREFEMAKVYLTPTIGGTIVDAS  176



>ref|XP_009106463.1| PREDICTED: uncharacterized methyltransferase At1g78140, chloroplastic-like 
isoform X2 [Brassica rapa]
Length=337

 Score =   151 bits (381),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 81/160 (51%), Positives = 104/160 (65%), Gaps = 8/160 (5%)
 Frame = +2

Query  110  PLTPKANRLFAVKIRA--LSTTFVEDKPVRLIDEKKVEIRTNLLACPICYDAFT-WNGNP  280
            P+    +RL +VK  A  L  + +    V  + EK+   +  +LACPICY++       P
Sbjct  16   PIGLSVSRLLSVKYAAQRLPVSVLISARVDYVVEKE---KKKILACPICYNSLAALISQP  72

Query  281  GLSLSSMAQ-SNLECSTCRKKYSGNETHVDLTIAGGGKAYGEALAASTELFRLPLVSFLY  457
              S    A  ++L+C  C+K YS NETH+DLT+A G K Y E L  S EL+R PLVSFLY
Sbjct  73   HESAEYPASGTHLQCKYCKKSYSANETHLDLTVASGTKQYTEPLPLSIELYRNPLVSFLY  132

Query  458  ERGWRQSFSLWGGFPGPEKEFELMQDYLKPVMGGNIIDAS  577
            ERGWRQ+F +WGGFPGPEKEFE+  +YLK V+GGNIIDAS
Sbjct  133  ERGWRQNF-MWGGFPGPEKEFEMASEYLKHVLGGNIIDAS  171



>gb|KJB59930.1| hypothetical protein B456_009G281700 [Gossypium raimondii]
Length=258

 Score =   147 bits (372),  Expect = 5e-40, Method: Compositional matrix adjust.
 Identities = 74/163 (45%), Positives = 105/163 (64%), Gaps = 10/163 (6%)
 Frame = +2

Query  89   NSKFSFSPLTPKANRLFAVKIRALSTTFVEDKPVRLIDEKKVEIRTNLLACPICYDAFTW  268
            +++F F P T     +F   + A +   VE       +E      +  LACPICY+  T 
Sbjct  22   SARFLFRPFT---TLVFTRSLTAKAPIAVEK------EESGGGGGSCGLACPICYNPLTV  72

Query  269  NGNPGLSLSSMAQSNLECSTCRKKYSGNETHVDLTIAGGGKAYGEALAASTELFRLPLVS  448
              +  + + S   SNL+C+TC+K YSG +TH+DL  + G K Y E++  +TELFR P+VS
Sbjct  73   ISDSPIYVGSTVGSNLQCNTCKKTYSGTQTHLDLVASSGSKQYDESMPLATELFRTPVVS  132

Query  449  FLYERGWRQSFSLWGGFPGPEKEFELMQDYLKPVMGGNIIDAS  577
            FLYERGWRQ+F ++GGFPGPEKEF++ ++YLK V+GG I+DAS
Sbjct  133  FLYERGWRQNF-VFGGFPGPEKEFDMAKNYLKRVLGGKIVDAS  174



>ref|XP_008391145.1| PREDICTED: uncharacterized methyltransferase At1g78140, chloroplastic-like 
[Malus domestica]
Length=291

 Score =   148 bits (373),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 66/95 (69%), Positives = 81/95 (85%), Gaps = 1/95 (1%)
 Frame = +2

Query  296  SMAQSNLECSTCRKKYSGNETHVDLTIAGGGKAYGEALAASTELFRLPLVSFLYERGWRQ  475
            S++ S+ +C TC+K Y GNETH+DLT A G K YGE+   STE+FR PLVS+LYERGWRQ
Sbjct  33   SVSGSSFQCRTCKKTYFGNETHIDLTTASGAKDYGESKPVSTEMFRTPLVSYLYERGWRQ  92

Query  476  SFSLWGGFPGPEKEFELMQDYLKPVM-GGNIIDAS  577
            SF++WGGFPGPEKEFEL++D+LKPV+ GGNIIDAS
Sbjct  93   SFTVWGGFPGPEKEFELIKDFLKPVLGGGNIIDAS  127



>ref|XP_008466034.1| PREDICTED: uncharacterized methyltransferase At1g78140, chloroplastic 
[Cucumis melo]
Length=356

 Score =   148 bits (374),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 71/128 (55%), Positives = 98/128 (77%), Gaps = 2/128 (2%)
 Frame = +2

Query  194  LIDEKKVEIRTNLLACPICYDAFTWNGNPGLSLSSMAQSNLECSTCRKKYSGNETHVDLT  373
            +ID++  +I+ N+LAC IC    T   + GLS+ S     LEC TC+K ++G+E+H+DLT
Sbjct  67   MIDKEVNKIK-NILACSICRGPLTAAADSGLSVESTNGYQLECGTCKKSFTGSESHLDLT  125

Query  374  IAGGGKAYGEALAASTELFRLPLVSFLYERGWRQSFSLWGGFPGPEKEFELMQDYLKPVM  553
            I GG  + GE++ A+TE+FR  LVSFLYERGWRQSFS+  GFPGPEKEFEL+++++ PV+
Sbjct  126  ITGGINS-GESMPAATEIFRTRLVSFLYERGWRQSFSVLLGFPGPEKEFELIKNFITPVL  184

Query  554  GGNIIDAS  577
            GG+IIDAS
Sbjct  185  GGSIIDAS  192



>ref|XP_009106462.1| PREDICTED: uncharacterized methyltransferase At1g78140, chloroplastic-like 
isoform X1 [Brassica rapa]
Length=348

 Score =   148 bits (373),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 84/156 (54%), Positives = 104/156 (67%), Gaps = 9/156 (6%)
 Frame = +2

Query  125  ANRL-FAVKIRALSTTF-VEDKP-VRLIDEKKVEIRTNLLACPICYDAFT-WNGNPGLSL  292
            A RL  +V I A   +F VE K  V  + EK+   +  +LACPICY++       P  S 
Sbjct  31   AQRLPVSVLISARVCSFAVETKSSVDYVVEKE---KKKILACPICYNSLAALISQPHESA  87

Query  293  SSMAQ-SNLECSTCRKKYSGNETHVDLTIAGGGKAYGEALAASTELFRLPLVSFLYERGW  469
               A  ++L+C  C+K YS NETH+DLT+A G K Y E L  S EL+R PLVSFLYERGW
Sbjct  88   EYPASGTHLQCKYCKKSYSANETHLDLTVASGTKQYTEPLPLSIELYRNPLVSFLYERGW  147

Query  470  RQSFSLWGGFPGPEKEFELMQDYLKPVMGGNIIDAS  577
            RQ+F +WGGFPGPEKEFE+  +YLK V+GGNIIDAS
Sbjct  148  RQNF-MWGGFPGPEKEFEMASEYLKHVLGGNIIDAS  182



>gb|KJB59931.1| hypothetical protein B456_009G281700 [Gossypium raimondii]
Length=339

 Score =   147 bits (372),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 74/163 (45%), Positives = 105/163 (64%), Gaps = 10/163 (6%)
 Frame = +2

Query  89   NSKFSFSPLTPKANRLFAVKIRALSTTFVEDKPVRLIDEKKVEIRTNLLACPICYDAFTW  268
            +++F F P T     +F   + A +   VE       +E      +  LACPICY+  T 
Sbjct  22   SARFLFRPFT---TLVFTRSLTAKAPIAVEK------EESGGGGGSCGLACPICYNPLTV  72

Query  269  NGNPGLSLSSMAQSNLECSTCRKKYSGNETHVDLTIAGGGKAYGEALAASTELFRLPLVS  448
              +  + + S   SNL+C+TC+K YSG +TH+DL  + G K Y E++  +TELFR P+VS
Sbjct  73   ISDSPIYVGSTVGSNLQCNTCKKTYSGTQTHLDLVASSGSKQYDESMPLATELFRTPVVS  132

Query  449  FLYERGWRQSFSLWGGFPGPEKEFELMQDYLKPVMGGNIIDAS  577
            FLYERGWRQ+F ++GGFPGPEKEF++ ++YLK V+GG I+DAS
Sbjct  133  FLYERGWRQNF-VFGGFPGPEKEFDMAKNYLKRVLGGKIVDAS  174



>emb|CDX87473.1| BnaA07g34000D [Brassica napus]
Length=356

 Score =   147 bits (371),  Expect = 7e-39, Method: Compositional matrix adjust.
 Identities = 83/156 (53%), Positives = 105/156 (67%), Gaps = 9/156 (6%)
 Frame = +2

Query  125  ANRL-FAVKIRALSTTF-VEDKP-VRLIDEKKVEIRTNLLACPICYDAFT-WNGNPGLSL  292
            A RL  +V I A   +F VE K  V  + EK+   +  +LACPICY++       P  S 
Sbjct  31   AQRLPVSVLISARVCSFAVETKSSVDYVVEKE---KKKILACPICYNSLAALISQPHESA  87

Query  293  SSMAQ-SNLECSTCRKKYSGNETHVDLTIAGGGKAYGEALAASTELFRLPLVSFLYERGW  469
               A  ++L+C  C+K YS NETH+DLT+A G K Y E L  S EL+R PLVSFLYERGW
Sbjct  88   EYPASATHLQCKYCKKSYSANETHLDLTVASGTKQYTEPLPLSIELYRNPLVSFLYERGW  147

Query  470  RQSFSLWGGFPGPEKEFELMQDYLKPVMGGNIIDAS  577
            RQ+F +WGGFPGPEKEFE+ +++LK V+GGNIIDAS
Sbjct  148  RQNF-MWGGFPGPEKEFEMAKEHLKHVLGGNIIDAS  182



>ref|XP_004136403.1| PREDICTED: uncharacterized methyltransferase At1g78140, chloroplastic-like 
[Cucumis sativus]
Length=313

 Score =   145 bits (365),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 67/117 (57%), Positives = 89/117 (76%), Gaps = 1/117 (1%)
 Frame = +2

Query  227  NLLACPICYDAFTWNGNPGLSLSSMAQSNLECSTCRKKYSGNETHVDLTIAGGGKAYGEA  406
            N+LAC IC+   T     GL + S     LEC TC+K ++G+E+H+DLTI GG  + GE+
Sbjct  34   NILACSICHGPLTAAAGSGLPVESTNGYQLECGTCKKSFTGSESHLDLTITGGTDS-GES  92

Query  407  LAASTELFRLPLVSFLYERGWRQSFSLWGGFPGPEKEFELMQDYLKPVMGGNIIDAS  577
            + A+TE+FR  LVSFLYERGWRQSFS+  GFPGPEKEFEL+++++ PV+GG+IIDAS
Sbjct  93   MPAATEIFRTRLVSFLYERGWRQSFSVLLGFPGPEKEFELIKNFITPVLGGSIIDAS  149



>ref|XP_010105909.1| putative methyltransferase [Morus notabilis]
 gb|EXC06728.1| putative methyltransferase [Morus notabilis]
Length=266

 Score =   144 bits (362),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 66/97 (68%), Positives = 79/97 (81%), Gaps = 0/97 (0%)
 Frame = +2

Query  287  SLSSMAQSNLECSTCRKKYSGNETHVDLTIAGGGKAYGEALAASTELFRLPLVSFLYERG  466
            S  S++ S+L+CSTCRK Y G ETH++LT A G K YGE +  +TELFR  LVSFLYERG
Sbjct  6    SRESVSGSSLQCSTCRKTYFGIETHLELTAASGAKNYGEPMPIATELFRTQLVSFLYERG  65

Query  467  WRQSFSLWGGFPGPEKEFELMQDYLKPVMGGNIIDAS  577
            WRQSFS+WGGFPGPEKEFEL + +L+PV GGNI+DAS
Sbjct  66   WRQSFSVWGGFPGPEKEFELTKKFLEPVFGGNIVDAS  102



>ref|XP_004161765.1| PREDICTED: uncharacterized methyltransferase At1g78140, chloroplastic-like 
[Cucumis sativus]
Length=376

 Score =   145 bits (365),  Expect = 8e-38, Method: Compositional matrix adjust.
 Identities = 67/117 (57%), Positives = 89/117 (76%), Gaps = 1/117 (1%)
 Frame = +2

Query  227  NLLACPICYDAFTWNGNPGLSLSSMAQSNLECSTCRKKYSGNETHVDLTIAGGGKAYGEA  406
            N+LAC IC+   T     GL + S     LEC TC+K ++G+E+H+DLTI GG  + GE+
Sbjct  97   NILACSICHGPLTAAAGSGLPVESTNGYQLECGTCKKSFTGSESHLDLTITGGTDS-GES  155

Query  407  LAASTELFRLPLVSFLYERGWRQSFSLWGGFPGPEKEFELMQDYLKPVMGGNIIDAS  577
            + A+TE+FR  LVSFLYERGWRQSFS+  GFPGPEKEFEL+++++ PV+GG+IIDAS
Sbjct  156  MPAATEIFRTRLVSFLYERGWRQSFSVLLGFPGPEKEFELIKNFITPVLGGSIIDAS  212



>ref|XP_008790838.1| PREDICTED: uncharacterized methyltransferase At1g78140, chloroplastic-like 
isoform X2 [Phoenix dactylifera]
Length=313

 Score =   142 bits (358),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 68/135 (50%), Positives = 88/135 (65%), Gaps = 1/135 (1%)
 Frame = +2

Query  173  VEDKPVRLIDEKKVEIRTNLLACPICYDAFTWNGNPGLSLSSMAQSNLECSTCRKKYSGN  352
            VE  P  LI + KV    N+ ACP+CY +F    +  LS++S A S  EC  C+K Y  N
Sbjct  17   VEANPEDLIPDTKVGTGLNIFACPVCYHSFIDQSDSSLSITSPAGSCFECHACKKAYLNN  76

Query  353  ETHVDLTIAGGGKAYGEALAASTELFRLPLVSFLYERGWRQSFSLWGGFPGPEKEFELMQ  532
              ++DLTIAGG + Y + L   T+ FR  L+S+LYERGWRQSF  WGGFPGPE+E E+ +
Sbjct  77   GIYLDLTIAGGLREYDQTLPFLTKFFRGALISYLYERGWRQSFR-WGGFPGPERELEMAK  135

Query  533  DYLKPVMGGNIIDAS  577
             YL+P  GG I+DAS
Sbjct  136  YYLRPAKGGTIVDAS  150



>ref|XP_008790837.1| PREDICTED: uncharacterized methyltransferase At1g78140, chloroplastic-like 
isoform X1 [Phoenix dactylifera]
Length=315

 Score =   142 bits (358),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 68/135 (50%), Positives = 88/135 (65%), Gaps = 1/135 (1%)
 Frame = +2

Query  173  VEDKPVRLIDEKKVEIRTNLLACPICYDAFTWNGNPGLSLSSMAQSNLECSTCRKKYSGN  352
            VE  P  LI + KV    N+ ACP+CY +F    +  LS++S A S  EC  C+K Y  N
Sbjct  17   VEANPEDLIPDTKVGTGLNIFACPVCYHSFIDQSDSSLSITSPAGSCFECHACKKAYLNN  76

Query  353  ETHVDLTIAGGGKAYGEALAASTELFRLPLVSFLYERGWRQSFSLWGGFPGPEKEFELMQ  532
              ++DLTIAGG + Y + L   T+ FR  L+S+LYERGWRQSF  WGGFPGPE+E E+ +
Sbjct  77   GIYLDLTIAGGLREYDQTLPFLTKFFRGALISYLYERGWRQSFR-WGGFPGPERELEMAK  135

Query  533  DYLKPVMGGNIIDAS  577
             YL+P  GG I+DAS
Sbjct  136  YYLRPAKGGTIVDAS  150



>ref|XP_010042876.1| PREDICTED: uncharacterized methyltransferase At1g78140, chloroplastic-like, 
partial [Eucalyptus grandis]
Length=170

 Score =   138 bits (347),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 67/134 (50%), Positives = 89/134 (66%), Gaps = 5/134 (4%)
 Frame = +2

Query  131  RLFAVKIRALSTTFVEDKPV-----RLIDEKKVEIRTNLLACPICYDAFTWNGNPGLSLS  295
            R+ A K+RA  + +VE +P        + ++K+    N LACPIC++  T+ G+P LS++
Sbjct  37   RVLAPKLRASYSAYVETRPPPPPLESTVRQEKLGGNQNALACPICFEPLTFTGDPVLSVN  96

Query  296  SMAQSNLECSTCRKKYSGNETHVDLTIAGGGKAYGEALAASTELFRLPLVSFLYERGWRQ  475
            S + S L+C TC+K Y GNETH DLT  GG K YGE +  ++ELFR PLVS+LYERGWRQ
Sbjct  97   SASGSTLQCGTCKKAYVGNETHFDLTTTGGTKEYGEPVPFASELFRTPLVSYLYERGWRQ  156

Query  476  SFSLWGGFPGPEKE  517
             F    G PGPEKE
Sbjct  157  YFESLLGSPGPEKE  170



>ref|XP_002268200.1| PREDICTED: uncharacterized methyltransferase At2g41040, chloroplastic-like 
isoform X2 [Vitis vinifera]
Length=340

 Score =   141 bits (355),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 67/147 (46%), Positives = 95/147 (65%), Gaps = 4/147 (3%)
 Frame = +2

Query  137  FAVKIRALSTTFVEDKPVRLIDEKKVEIRTNLLACPICYDAFTWNGNPGLSLSSMAQSNL  316
            F  + RA S   +E +    ++    ++  +L +CP+CY+     G PGL+L ++ +S  
Sbjct  36   FPSRFRASSAVALEPESSPQLNN---DMDFDLFSCPVCYEPLIRKGPPGLNLPAIYRSGF  92

Query  317  ECSTCRKKYSGNETHVDLTIAGGGKAYGEALAASTELFRLPLVSFLYERGWRQSFSLWGG  496
            +C TC K YS  + ++DLTI  G KAY EA    TELFR PLVSFLYERGWRQ+F+L  G
Sbjct  93   KCKTCNKSYSSKDMYLDLTITAGSKAYNEAQPVRTELFRSPLVSFLYERGWRQNFNL-RG  151

Query  497  FPGPEKEFELMQDYLKPVMGGNIIDAS  577
            FPGP++EF++ Q+Y KP  GG ++D S
Sbjct  152  FPGPDEEFKMAQEYFKPAAGGLLVDVS  178



>emb|CBI25578.3| unnamed protein product [Vitis vinifera]
Length=338

 Score =   141 bits (355),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 67/147 (46%), Positives = 95/147 (65%), Gaps = 4/147 (3%)
 Frame = +2

Query  137  FAVKIRALSTTFVEDKPVRLIDEKKVEIRTNLLACPICYDAFTWNGNPGLSLSSMAQSNL  316
            F  + RA S   +E +    ++    ++  +L +CP+CY+     G PGL+L ++ +S  
Sbjct  34   FPSRFRASSAVALEPESSPQLNN---DMDFDLFSCPVCYEPLIRKGPPGLNLPAIYRSGF  90

Query  317  ECSTCRKKYSGNETHVDLTIAGGGKAYGEALAASTELFRLPLVSFLYERGWRQSFSLWGG  496
            +C TC K YS  + ++DLTI  G KAY EA    TELFR PLVSFLYERGWRQ+F+L  G
Sbjct  91   KCKTCNKSYSSKDMYLDLTITAGSKAYNEAQPVRTELFRSPLVSFLYERGWRQNFNL-RG  149

Query  497  FPGPEKEFELMQDYLKPVMGGNIIDAS  577
            FPGP++EF++ Q+Y KP  GG ++D S
Sbjct  150  FPGPDEEFKMAQEYFKPAAGGLLVDVS  176



>ref|XP_010656529.1| PREDICTED: uncharacterized methyltransferase At2g41040, chloroplastic-like 
isoform X1 [Vitis vinifera]
Length=343

 Score =   141 bits (355),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 67/147 (46%), Positives = 95/147 (65%), Gaps = 4/147 (3%)
 Frame = +2

Query  137  FAVKIRALSTTFVEDKPVRLIDEKKVEIRTNLLACPICYDAFTWNGNPGLSLSSMAQSNL  316
            F  + RA S   +E +    ++    ++  +L +CP+CY+     G PGL+L ++ +S  
Sbjct  36   FPSRFRASSAVALEPESSPQLNN---DMDFDLFSCPVCYEPLIRKGPPGLNLPAIYRSGF  92

Query  317  ECSTCRKKYSGNETHVDLTIAGGGKAYGEALAASTELFRLPLVSFLYERGWRQSFSLWGG  496
            +C TC K YS  + ++DLTI  G KAY EA    TELFR PLVSFLYERGWRQ+F+L  G
Sbjct  93   KCKTCNKSYSSKDMYLDLTITAGSKAYNEAQPVRTELFRSPLVSFLYERGWRQNFNL-RG  151

Query  497  FPGPEKEFELMQDYLKPVMGGNIIDAS  577
            FPGP++EF++ Q+Y KP  GG ++D S
Sbjct  152  FPGPDEEFKMAQEYFKPAAGGLLVDVS  178



>emb|CDP10502.1| unnamed protein product [Coffea canephora]
Length=335

 Score =   140 bits (353),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 76/164 (46%), Positives = 99/164 (60%), Gaps = 5/164 (3%)
 Frame = +2

Query  86   YNSKFSFSPLTPKANRLFAVKIRALSTTFVEDKPVRLIDEKKVEIRTNLLACPICYDAFT  265
            YNS  S  PL   + + F   IRA S   +E  P   I E K  ++ +L ACPICYD   
Sbjct  19   YNS-LSHPPLRCSSPQQFRQIIRATSAVALE--PEAQI-ESKEGLKIDLFACPICYDPLV  74

Query  266  WNGNPGLSLSSMAQSNLECSTCRKKYSGNETHVDLTIAGGGKAYGEALAASTELFRLPLV  445
              G  G +L ++ +S  +C TC K YS    ++DLT+  G K Y E   A TELFR PLV
Sbjct  75   RKGPSGFNLPAIYRSGFKCRTCNKTYSSKNIYLDLTVTAGSKDYNEFKPAGTELFRSPLV  134

Query  446  SFLYERGWRQSFSLWGGFPGPEKEFELMQDYLKPVMGGNIIDAS  577
            SFLYERGWRQ+F+   GFPGP+ EF++ Q+Y +PV GG ++D S
Sbjct  135  SFLYERGWRQNFN-RSGFPGPDDEFKMAQEYFQPVEGGVLVDVS  177



>ref|XP_010667997.1| PREDICTED: uncharacterized methyltransferase At1g78140, chloroplastic 
[Beta vulgaris subsp. vulgaris]
Length=349

 Score =   140 bits (352),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 62/145 (43%), Positives = 95/145 (66%), Gaps = 1/145 (1%)
 Frame = +2

Query  143  VKIRALSTTFVEDKPVRLIDEKKVEIRTNLLACPICYDAFTWNGNPGLSLSSMAQSNLEC  322
            +++R  S   +E  P  +  +K  +   ++L CPICY+  TW+G+  LS+ +++ + L+ 
Sbjct  42   LRLRVSSIAVIETTPESVTTDKNSDTNKSILGCPICYEPLTWSGDSTLSIETVSGTTLQS  101

Query  323  STCRKKYSGNETHVDLTIAGGGKAYGEALAASTELFRLPLVSFLYERGWRQSFSLWGGFP  502
             T +K Y  N+   DLT + G K Y E++   TE F  P +S+LYERGWRQ+F L GG+P
Sbjct  102  QTSKKTYYENKFIFDLTTSSGAKDYVESMPLVTEFFSTPFMSYLYERGWRQNFGL-GGYP  160

Query  503  GPEKEFELMQDYLKPVMGGNIIDAS  577
            G +KEFE+ ++Y KPV+GGNI+DAS
Sbjct  161  GADKEFEMAKEYFKPVLGGNIVDAS  185



>ref|XP_011017926.1| PREDICTED: uncharacterized methyltransferase At2g41040, chloroplastic-like 
[Populus euphratica]
 ref|XP_011017927.1| PREDICTED: uncharacterized methyltransferase At2g41040, chloroplastic-like 
[Populus euphratica]
 ref|XP_011017928.1| PREDICTED: uncharacterized methyltransferase At2g41040, chloroplastic-like 
[Populus euphratica]
Length=336

 Score =   139 bits (351),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 75/167 (45%), Positives = 97/167 (58%), Gaps = 9/167 (5%)
 Frame = +2

Query  77   KLGYNSKFSFSPLTPKANRLFAVKIRALSTTFVEDKPVRLIDEKKVEIRTNLLACPICYD  256
             L +NS FS S L   + R F   IRA S   +E        E   +    + ACP+CY+
Sbjct  20   HLSHNSLFSPSRLRFTSLR-FPSTIRATSAVVLEP-------ELSTQQNQAIFACPVCYE  71

Query  257  AFTWNGNPGLSLSSMAQSNLECSTCRKKYSGNETHVDLTIAGGGKAYGEALAASTELFRL  436
                 G PG +L ++ QS+ +C  C K YS  + ++DLTI  G K Y E     TELFR 
Sbjct  72   PLIRKGPPGFNLPAIYQSSFKCKKCTKTYSSKDNYLDLTITAGMKDYTEINPVRTELFRS  131

Query  437  PLVSFLYERGWRQSFSLWGGFPGPEKEFELMQDYLKPVMGGNIIDAS  577
            PLVSFLYERGWRQSF+   GFPGP++EFE+ Q+Y KP  GG ++D S
Sbjct  132  PLVSFLYERGWRQSFN-QSGFPGPDEEFEMAQEYFKPAGGGLLVDVS  177



>gb|KJB53959.1| hypothetical protein B456_009G013400 [Gossypium raimondii]
Length=269

 Score =   137 bits (345),  Expect = 8e-36, Method: Compositional matrix adjust.
 Identities = 66/160 (41%), Positives = 94/160 (59%), Gaps = 4/160 (3%)
 Frame = +2

Query  107  SPLTPK---ANRLFAVKIRALSTTFVEDKPVRLIDEKKVEIRTNLLACPICYDAFTWNGN  277
            SP  P    ++R F + +RA S   +E        ++   + T L +CP+CY+     G 
Sbjct  26   SPFRPSLYFSSRPFRLTVRASSAVALEQDLRTQATQQNQTVETELFSCPVCYEPLIRKGP  85

Query  278  PGLSLSSMAQSNLECSTCRKKYSGNETHVDLTIAGGGKAYGEALAASTELFRLPLVSFLY  457
            PGL+L ++ +S  +C  C K YS  +  +DLT+  G + Y E     TELFR PLVSFLY
Sbjct  86   PGLNLDAIYRSGFKCKKCNKSYSSKDVFLDLTVTTGLRNYTEVKPVRTELFRSPLVSFLY  145

Query  458  ERGWRQSFSLWGGFPGPEKEFELMQDYLKPVMGGNIIDAS  577
            ERGWRQ+F+L  GFPG ++EF + Q+Y KP  GG ++D S
Sbjct  146  ERGWRQNFNL-SGFPGADEEFRMAQEYFKPAEGGTLVDVS  184



>gb|KJB14720.1| hypothetical protein B456_002G140100, partial [Gossypium raimondii]
Length=386

 Score =   139 bits (349),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 78/187 (42%), Positives = 102/187 (55%), Gaps = 41/187 (22%)
 Frame = +2

Query  137  FAVKIRALSTTFVEDKPV-----------RLIDEKKVEIRTNLLACPICYDAFTWNGNPG  283
             A K+   ST FVE  P             ++ EK+     N+LACPICYD  TW     
Sbjct  40   LAAKVLVSSTAFVETHPTICKQQNLYQWEPVVVEKEDSGSDNVLACPICYDPLTWTVGSP  99

Query  284  LSLSSMAQSNLECSTCRKKYSGNETHVDLTIAGGGKAYGEALAASTELFRLPLVSFLYER  463
              + S + SNL+  TC+K Y GN+TH+DL  +GG K Y  ++  +TELFR P+VSFLYER
Sbjct  100  SYVGSKSGSNLQSKTCKKSYFGNQTHLDLVASGGSKQYDNSMPLATELFRTPVVSFLYER  159

Query  464  GWRQSFSLWGGFPG----------------------PEKE-------FELMQDYLKPVMG  556
            GWRQ+F ++GGFPG                      P+ E       FE+ + YLKPV+G
Sbjct  160  GWRQNF-IFGGFPGSIMKLFWNIYQNIRIFEASSSYPKVEGRSACLDFEMAKKYLKPVLG  218

Query  557  GNIIDAS  577
            GNI+DAS
Sbjct  219  GNIVDAS  225



>gb|KJB53958.1| hypothetical protein B456_009G013400 [Gossypium raimondii]
Length=343

 Score =   137 bits (346),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 66/160 (41%), Positives = 94/160 (59%), Gaps = 4/160 (3%)
 Frame = +2

Query  107  SPLTPK---ANRLFAVKIRALSTTFVEDKPVRLIDEKKVEIRTNLLACPICYDAFTWNGN  277
            SP  P    ++R F + +RA S   +E        ++   + T L +CP+CY+     G 
Sbjct  26   SPFRPSLYFSSRPFRLTVRASSAVALEQDLRTQATQQNQTVETELFSCPVCYEPLIRKGP  85

Query  278  PGLSLSSMAQSNLECSTCRKKYSGNETHVDLTIAGGGKAYGEALAASTELFRLPLVSFLY  457
            PGL+L ++ +S  +C  C K YS  +  +DLT+  G + Y E     TELFR PLVSFLY
Sbjct  86   PGLNLDAIYRSGFKCKKCNKSYSSKDVFLDLTVTTGLRNYTEVKPVRTELFRSPLVSFLY  145

Query  458  ERGWRQSFSLWGGFPGPEKEFELMQDYLKPVMGGNIIDAS  577
            ERGWRQ+F+L  GFPG ++EF + Q+Y KP  GG ++D S
Sbjct  146  ERGWRQNFNL-SGFPGADEEFRMAQEYFKPAEGGTLVDVS  184



>ref|XP_008788786.1| PREDICTED: uncharacterized methyltransferase At2g41040, chloroplastic 
[Phoenix dactylifera]
Length=348

 Score =   137 bits (345),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 69/155 (45%), Positives = 96/155 (62%), Gaps = 6/155 (4%)
 Frame = +2

Query  113  LTPKANRLFAVKIRALSTTFVEDKPVRLIDEKKVEIRTNLLACPICYDAFTWNGNPGLSL  292
            L+P + R F ++  A + T   D  V     K+  +  +LLACPICY+  T  G  GL+L
Sbjct  35   LSPPSLRGFRLRATAAALTVEPDTQV-----KQDSLELDLLACPICYEPLTRKGPSGLNL  89

Query  293  SSMAQSNLECSTCRKKYSGNETHVDLTIAGGGKAYGEALAASTELFRLPLVSFLYERGWR  472
             ++ +S  +C  C K +S  + ++DLTI  G K Y E     TELFR P+VSFLYERGWR
Sbjct  90   PAIYRSGFKCLKCNKSFSSKDVYLDLTITSGTKEYNEFKPTRTELFRSPIVSFLYERGWR  149

Query  473  QSFSLWGGFPGPEKEFELMQDYLKPVMGGNIIDAS  577
            Q+F+   GFPGP++EF + Q+Y KPV GG ++D S
Sbjct  150  QNFN-RSGFPGPDEEFNMAQEYFKPVAGGLLVDVS  183



>ref|XP_009363912.1| PREDICTED: uncharacterized methyltransferase At2g41040, chloroplastic-like 
[Pyrus x bretschneideri]
Length=344

 Score =   137 bits (345),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 73/167 (44%), Positives = 100/167 (60%), Gaps = 3/167 (2%)
 Frame = +2

Query  80   LGYNSKFSFSPLTPKANRLFAVKIRALST-TFVEDKPVRLIDEKKVEIRTNLLACPICYD  256
            L  NS+F   P     +R  +  IRA ST T   ++  R  + +   +   LLACP+CY+
Sbjct  21   LRRNSQFG-HPRLRLPSRHHSHPIRATSTVTLPPERRSRAEEIQSSGVDLELLACPVCYE  79

Query  257  AFTWNGNPGLSLSSMAQSNLECSTCRKKYSGNETHVDLTIAGGGKAYGEALAASTELFRL  436
                 G PGL+L ++ +S  +C  C K YS  + ++DLT+  G K Y E     TELFR 
Sbjct  80   PLIRKGPPGLNLRAIYRSGFKCRKCDKSYSSKDVYLDLTVTAGLKEYVEVQPIQTELFRS  139

Query  437  PLVSFLYERGWRQSFSLWGGFPGPEKEFELMQDYLKPVMGGNIIDAS  577
            PLVSFLYERGWRQ+F+L  GFPGP++EF++ QDY K   GG ++D S
Sbjct  140  PLVSFLYERGWRQNFNL-SGFPGPDEEFKMAQDYFKSAEGGVLVDVS  185



>ref|XP_010939635.1| PREDICTED: uncharacterized methyltransferase At1g78140, chloroplastic-like 
[Elaeis guineensis]
Length=313

 Score =   136 bits (342),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 68/139 (49%), Positives = 88/139 (63%), Gaps = 1/139 (1%)
 Frame = +2

Query  161  STTFVEDKPVRLIDEKKVEIRTNLLACPICYDAFTWNGNPGLSLSSMAQSNLECSTCRKK  340
            S+  VE  P  LI + KV    N+LACPICY +F    N  LS++S   S +EC  C+K 
Sbjct  13   SSPAVEANPEDLIPDTKVGTGLNILACPICYRSFIDQNNSSLSITSPDGSCIECHGCKKA  72

Query  341  YSGNETHVDLTIAGGGKAYGEALAASTELFRLPLVSFLYERGWRQSFSLWGGFPGPEKEF  520
            Y  N  ++DLTI GG K Y + L   T  FR   +S+LYERGWRQSF  WGGFPG ++E 
Sbjct  73   YLNNGIYLDLTITGGLKEYDQTLPFLTGFFRSSWISYLYERGWRQSFR-WGGFPGLQREI  131

Query  521  ELMQDYLKPVMGGNIIDAS  577
            E+ ++YL+P  GG I+DAS
Sbjct  132  EMAKNYLRPAKGGTIVDAS  150



>gb|KJB27061.1| hypothetical protein B456_004G275300 [Gossypium raimondii]
Length=332

 Score =   136 bits (342),  Expect = 6e-35, Method: Compositional matrix adjust.
 Identities = 67/149 (45%), Positives = 93/149 (62%), Gaps = 4/149 (3%)
 Frame = +2

Query  131  RLFAVKIRALSTTFVEDKPVRLIDEKKVEIRTNLLACPICYDAFTWNGNPGLSLSSMAQS  310
            R F    RA ST  +E     L  +K     T+L +CP+CY+     G PGL+L+++ +S
Sbjct  34   RPFRFTARASSTVSLETD---LSIQKNQTEETDLFSCPVCYEPLIRKGPPGLNLAAIYRS  90

Query  311  NLECSTCRKKYSGNETHVDLTIAGGGKAYGEALAASTELFRLPLVSFLYERGWRQSFSLW  490
              +C  C K YS  +T++DLT+  G + Y E   A TELFR P VSF+YERGWRQ+F+  
Sbjct  91   GFKCKQCDKSYSSKDTYLDLTVTAGLRDYTEVKPAGTELFRSPFVSFVYERGWRQNFN-R  149

Query  491  GGFPGPEKEFELMQDYLKPVMGGNIIDAS  577
             GFPGP++EF + Q+Y KPV GG ++D S
Sbjct  150  RGFPGPDEEFRMAQEYFKPVEGGILVDVS  178



>gb|KJB27062.1| hypothetical protein B456_004G275300 [Gossypium raimondii]
Length=337

 Score =   136 bits (343),  Expect = 7e-35, Method: Compositional matrix adjust.
 Identities = 67/149 (45%), Positives = 93/149 (62%), Gaps = 4/149 (3%)
 Frame = +2

Query  131  RLFAVKIRALSTTFVEDKPVRLIDEKKVEIRTNLLACPICYDAFTWNGNPGLSLSSMAQS  310
            R F    RA ST  +E     L  +K     T+L +CP+CY+     G PGL+L+++ +S
Sbjct  34   RPFRFTARASSTVSLETD---LSIQKNQTEETDLFSCPVCYEPLIRKGPPGLNLAAIYRS  90

Query  311  NLECSTCRKKYSGNETHVDLTIAGGGKAYGEALAASTELFRLPLVSFLYERGWRQSFSLW  490
              +C  C K YS  +T++DLT+  G + Y E   A TELFR P VSF+YERGWRQ+F+  
Sbjct  91   GFKCKQCDKSYSSKDTYLDLTVTAGLRDYTEVKPAGTELFRSPFVSFVYERGWRQNFN-R  149

Query  491  GGFPGPEKEFELMQDYLKPVMGGNIIDAS  577
             GFPGP++EF + Q+Y KPV GG ++D S
Sbjct  150  RGFPGPDEEFRMAQEYFKPVEGGILVDVS  178



>ref|XP_006473930.1| PREDICTED: uncharacterized methyltransferase At2g41040, chloroplastic-like 
[Citrus sinensis]
Length=333

 Score =   135 bits (341),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 68/157 (43%), Positives = 99/157 (63%), Gaps = 7/157 (4%)
 Frame = +2

Query  107  SPLTPKANRLFAVKIRALSTTFVEDKPVRLIDEKKVEIRTNLLACPICYDAFTWNGNPGL  286
            SP  P++ R F+  IRA++      +PV+    + +E+  +L +CPICY+     G  GL
Sbjct  25   SPRLPQSLR-FSSTIRAVTL-----QPVKSERNQTLELEGDLFSCPICYEPLIRKGPTGL  78

Query  287  SLSSMAQSNLECSTCRKKYSGNETHVDLTIAGGGKAYGEALAASTELFRLPLVSFLYERG  466
            +L ++ +S  +C  C K YS  + ++DLT+  G K Y E   ASTELFR P VSFLYERG
Sbjct  79   TLGAIYRSGFKCRKCDKTYSSKDNYLDLTVISGLKDYTEVKPASTELFRSPFVSFLYERG  138

Query  467  WRQSFSLWGGFPGPEKEFELMQDYLKPVMGGNIIDAS  577
            WRQ+F+   GFPGP++EF++ Q+Y K   GG ++D S
Sbjct  139  WRQNFN-RSGFPGPDEEFKMAQEYFKSAQGGLLVDVS  174



>ref|XP_004973409.1| PREDICTED: uncharacterized methyltransferase At1g78140, chloroplastic-like 
[Setaria italica]
Length=350

 Score =   135 bits (341),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 66/125 (53%), Positives = 84/125 (67%), Gaps = 6/125 (5%)
 Frame = +2

Query  203  EKKVEIRTNLLACPICYDAFTWNGNPGLSLSSMAQSNLECSTCRKKYSGNETHVDLTIAG  382
            E   E + + LACPICY  F    +P     S   S+LECSTC+K Y   + + DLT+A 
Sbjct  69   EPAPETKLSKLACPICYYPFVSASDP-----SGDASSLECSTCKKVYPNKQDYWDLTVAV  123

Query  383  GGKAYGEALAASTELFRLPLVSFLYERGWRQSFSLWGGFPGPEKEFELMQDYLKPVMGGN  562
            G   Y E+  A+TE+FR PLVSFLYERGWRQ+F +WGGFPG E+EFE+ + YL P +GG 
Sbjct  124  GSTEYSESKPAATEIFRTPLVSFLYERGWRQNF-IWGGFPGLEREFEMAKTYLNPTIGGT  182

Query  563  IIDAS  577
            I+DAS
Sbjct  183  IVDAS  187



>gb|KDO59315.1| hypothetical protein CISIN_1g019950mg [Citrus sinensis]
Length=304

 Score =   134 bits (337),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 67/157 (43%), Positives = 98/157 (62%), Gaps = 7/157 (4%)
 Frame = +2

Query  107  SPLTPKANRLFAVKIRALSTTFVEDKPVRLIDEKKVEIRTNLLACPICYDAFTWNGNPGL  286
            SP  P++ R F+  IRA++      +P +    + +E+  +L +CPICY+     G  GL
Sbjct  25   SPRLPQSLR-FSSTIRAVTL-----QPAKSERNQTLELEGDLFSCPICYEPLIRKGPTGL  78

Query  287  SLSSMAQSNLECSTCRKKYSGNETHVDLTIAGGGKAYGEALAASTELFRLPLVSFLYERG  466
            +L ++ +S  +C  C K YS  + ++DLT+  G K Y E   ASTELFR P VSFLYERG
Sbjct  79   TLGAIYRSGFKCRKCDKTYSSKDNYLDLTVISGLKDYTEVKPASTELFRSPFVSFLYERG  138

Query  467  WRQSFSLWGGFPGPEKEFELMQDYLKPVMGGNIIDAS  577
            WRQ+F+   GFPGP++EF++ Q+Y K   GG ++D S
Sbjct  139  WRQNFN-RSGFPGPDEEFKMAQEYFKSAQGGLLVDVS  174



>ref|XP_002324579.2| methyltransferase-related family protein [Populus trichocarpa]
 gb|EEF03144.2| methyltransferase-related family protein [Populus trichocarpa]
Length=332

 Score =   134 bits (338),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 61/130 (47%), Positives = 82/130 (63%), Gaps = 1/130 (1%)
 Frame = +2

Query  188  VRLIDEKKVEIRTNLLACPICYDAFTWNGNPGLSLSSMAQSNLECSTCRKKYSGNETHVD  367
            +R      +E    + ACP+CY+     G PG +L ++ +S+ +C  C K YS  + ++D
Sbjct  45   IRATSAVALEPNQAIFACPVCYEPLIRKGPPGFNLPAIYRSSFKCKKCTKTYSSKDNYLD  104

Query  368  LTIAGGGKAYGEALAASTELFRLPLVSFLYERGWRQSFSLWGGFPGPEKEFELMQDYLKP  547
            LTI  G K Y E     TELFR PLVSFLYERGWRQSF+   GFPGP++EFE+ Q+Y KP
Sbjct  105  LTITAGMKDYTEINPVRTELFRSPLVSFLYERGWRQSFN-QSGFPGPDEEFEMAQEYFKP  163

Query  548  VMGGNIIDAS  577
              GG ++D S
Sbjct  164  ARGGLLVDVS  173



>ref|XP_006659389.1| PREDICTED: uncharacterized methyltransferase At1g78140, chloroplastic-like 
[Oryza brachyantha]
Length=358

 Score =   135 bits (339),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 73/156 (47%), Positives = 95/156 (61%), Gaps = 8/156 (5%)
 Frame = +2

Query  125  ANRLFAVKIRA-LSTTFVEDKPVRLIDEKKVEI----RTNLLACPICYDAFTWNGNPGLS  289
            A R+    +RA  S   V   P  ++ E  VE     + + LACPICY     + +  L 
Sbjct  43   AKRVLRSSLRASASPDVVSTVPDEVVAEPSVEPEAEKKLSKLACPICYYPLASSSDQSLP  102

Query  290  LSSMAQSNLECSTCRKKYSGNETHVDLTIAGGGKAYGEALAASTELFRLPLVSFLYERGW  469
            L+    S+L+CSTC+K Y     + D+T+A G   Y E+   STELFR PLVSFLYERGW
Sbjct  103  LN--VASSLQCSTCKKFYPNRGDYWDMTVAVGSTVYSESTTVSTELFRTPLVSFLYERGW  160

Query  470  RQSFSLWGGFPGPEKEFELMQDYLKPVMGGNIIDAS  577
            RQ+F +WGGFPGPE+E+E  + YLKP  GG I+DAS
Sbjct  161  RQNF-IWGGFPGPEREYETAKAYLKPTAGGIIVDAS  195



>ref|XP_011470680.1| PREDICTED: uncharacterized methyltransferase At2g41040, chloroplastic-like 
isoform X3 [Fragaria vesca subsp. vesca]
Length=336

 Score =   134 bits (338),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 70/167 (42%), Positives = 98/167 (59%), Gaps = 10/167 (6%)
 Frame = +2

Query  77   KLGYNSKFSFSPLTPKANRLFAVKIRALSTTFVEDKPVRLIDEKKVEIRTNLLACPICYD  256
            +L +NS      L+P   R  ++ IRA + T  +    +      +E     L+CP+CY+
Sbjct  20   RLHHNSH-----LSPPRLRFHSLPIRATTITLQQSSSTQKSQSSGIE----FLSCPVCYE  70

Query  257  AFTWNGNPGLSLSSMAQSNLECSTCRKKYSGNETHVDLTIAGGGKAYGEALAASTELFRL  436
                 G  GL+L ++ +S  +C  C K YS  + ++DLT+  G K Y E   A TELFR 
Sbjct  71   PLIRKGPTGLNLEAIYRSGFKCRKCDKSYSSKDIYLDLTVTAGLKQYVEVNPARTELFRS  130

Query  437  PLVSFLYERGWRQSFSLWGGFPGPEKEFELMQDYLKPVMGGNIIDAS  577
            PLVSFLYERGWRQ+FS   GFPGP++EF++ QDY KP  GG ++D S
Sbjct  131  PLVSFLYERGWRQNFS-SSGFPGPDEEFKMAQDYFKPAEGGLLVDVS  176



>ref|XP_006453728.1| hypothetical protein CICLE_v10008875mg [Citrus clementina]
 gb|ESR66968.1| hypothetical protein CICLE_v10008875mg [Citrus clementina]
Length=333

 Score =   134 bits (337),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 67/157 (43%), Positives = 98/157 (62%), Gaps = 7/157 (4%)
 Frame = +2

Query  107  SPLTPKANRLFAVKIRALSTTFVEDKPVRLIDEKKVEIRTNLLACPICYDAFTWNGNPGL  286
            SP  P++ R F+  IRA++      +P +    + +E+  +L +CPICY+     G  GL
Sbjct  25   SPRLPQSLR-FSSTIRAVTL-----QPAKSERNQTLELEGDLFSCPICYEPLIRKGPTGL  78

Query  287  SLSSMAQSNLECSTCRKKYSGNETHVDLTIAGGGKAYGEALAASTELFRLPLVSFLYERG  466
            +L ++ +S  +C  C K YS  + ++DLT+  G K Y E   ASTELFR P VSFLYERG
Sbjct  79   TLGAIYRSGFKCRKCNKTYSSKDNYLDLTVISGLKDYTEVKPASTELFRSPFVSFLYERG  138

Query  467  WRQSFSLWGGFPGPEKEFELMQDYLKPVMGGNIIDAS  577
            WRQ+F+   GFPGP++EF++ Q+Y K   GG ++D S
Sbjct  139  WRQNFN-RSGFPGPDEEFKMAQEYFKSAQGGLLVDVS  174



>gb|KDO59317.1| hypothetical protein CISIN_1g019950mg [Citrus sinensis]
Length=319

 Score =   134 bits (336),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 67/157 (43%), Positives = 98/157 (62%), Gaps = 7/157 (4%)
 Frame = +2

Query  107  SPLTPKANRLFAVKIRALSTTFVEDKPVRLIDEKKVEIRTNLLACPICYDAFTWNGNPGL  286
            SP  P++ R F+  IRA++      +P +    + +E+  +L +CPICY+     G  GL
Sbjct  25   SPRLPQSLR-FSSTIRAVTL-----QPAKSERNQTLELEGDLFSCPICYEPLIRKGPTGL  78

Query  287  SLSSMAQSNLECSTCRKKYSGNETHVDLTIAGGGKAYGEALAASTELFRLPLVSFLYERG  466
            +L ++ +S  +C  C K YS  + ++DLT+  G K Y E   ASTELFR P VSFLYERG
Sbjct  79   TLGAIYRSGFKCRKCDKTYSSKDNYLDLTVISGLKDYTEVKPASTELFRSPFVSFLYERG  138

Query  467  WRQSFSLWGGFPGPEKEFELMQDYLKPVMGGNIIDAS  577
            WRQ+F+   GFPGP++EF++ Q+Y K   GG ++D S
Sbjct  139  WRQNFN-RSGFPGPDEEFKMAQEYFKSAQGGLLVDVS  174



>gb|KDO59316.1| hypothetical protein CISIN_1g019950mg [Citrus sinensis]
Length=314

 Score =   134 bits (336),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 67/157 (43%), Positives = 98/157 (62%), Gaps = 7/157 (4%)
 Frame = +2

Query  107  SPLTPKANRLFAVKIRALSTTFVEDKPVRLIDEKKVEIRTNLLACPICYDAFTWNGNPGL  286
            SP  P++ R F+  IRA++      +P +    + +E+  +L +CPICY+     G  GL
Sbjct  25   SPRLPQSLR-FSSTIRAVTL-----QPAKSERNQTLELEGDLFSCPICYEPLIRKGPTGL  78

Query  287  SLSSMAQSNLECSTCRKKYSGNETHVDLTIAGGGKAYGEALAASTELFRLPLVSFLYERG  466
            +L ++ +S  +C  C K YS  + ++DLT+  G K Y E   ASTELFR P VSFLYERG
Sbjct  79   TLGAIYRSGFKCRKCDKTYSSKDNYLDLTVISGLKDYTEVKPASTELFRSPFVSFLYERG  138

Query  467  WRQSFSLWGGFPGPEKEFELMQDYLKPVMGGNIIDAS  577
            WRQ+F+   GFPGP++EF++ Q+Y K   GG ++D S
Sbjct  139  WRQNFN-RSGFPGPDEEFKMAQEYFKSAQGGLLVDVS  174



>gb|ACJ84583.1| unknown [Medicago truncatula]
 gb|KEH37883.1| S-adenosylmethionine-dependent methyltransferase [Medicago truncatula]
Length=342

 Score =   134 bits (337),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 65/143 (45%), Positives = 89/143 (62%), Gaps = 2/143 (1%)
 Frame = +2

Query  149  IRALSTTFVEDKPVRLIDEKKVEIRTNLLACPICYDAFTWNGNPGLSLSSMAQSNLECST  328
            IRA S   V D P+ L  +K    + +L ACPICY+     G  GL+L ++ +S  +C  
Sbjct  43   IRATSAVVV-DSPLDLSTKKDQGTQVDLFACPICYEPLIRKGPIGLNLPAIYRSGFKCKR  101

Query  329  CRKKYSGNETHVDLTIAGGGKAYGEALAASTELFRLPLVSFLYERGWRQSFSLWGGFPGP  508
            C+K Y+  + ++DLT+  G + Y E     TELFR PLVSFLYERGWRQ+F    GFPGP
Sbjct  102  CQKSYTSKDGYLDLTVTSGLRDYVEVQPNRTELFRSPLVSFLYERGWRQNFR-QSGFPGP  160

Query  509  EKEFELMQDYLKPVMGGNIIDAS  577
            ++EF + Q+Y +P  GG I+D S
Sbjct  161  DEEFRMAQEYFEPAKGGRIVDVS  183



>gb|AFK46366.1| unknown [Medicago truncatula]
Length=342

 Score =   134 bits (337),  Expect = 5e-34, Method: Compositional matrix adjust.
 Identities = 65/143 (45%), Positives = 89/143 (62%), Gaps = 2/143 (1%)
 Frame = +2

Query  149  IRALSTTFVEDKPVRLIDEKKVEIRTNLLACPICYDAFTWNGNPGLSLSSMAQSNLECST  328
            IRA S   V D P+ L  +K    + +L ACPICY+     G  GL+L ++ +S  +C  
Sbjct  43   IRATSAVVV-DSPLDLSTKKDQGTQVDLFACPICYEPLIRKGPIGLNLPAIYRSGFKCKR  101

Query  329  CRKKYSGNETHVDLTIAGGGKAYGEALAASTELFRLPLVSFLYERGWRQSFSLWGGFPGP  508
            C+K Y+  + ++DLT+  G + Y E     TELFR PLVSFLYERGWRQ+F    GFPGP
Sbjct  102  CQKSYTSKDGYLDLTVTSGLRDYVEVQPNRTELFRSPLVSFLYERGWRQNFR-QSGFPGP  160

Query  509  EKEFELMQDYLKPVMGGNIIDAS  577
            ++EF + Q+Y +P  GG I+D S
Sbjct  161  DEEFRMAQEYFEPAKGGRIVDVS  183



>ref|XP_009802104.1| PREDICTED: uncharacterized methyltransferase At2g41040, chloroplastic-like 
[Nicotiana sylvestris]
Length=345

 Score =   134 bits (337),  Expect = 5e-34, Method: Compositional matrix adjust.
 Identities = 69/151 (46%), Positives = 93/151 (62%), Gaps = 4/151 (3%)
 Frame = +2

Query  125  ANRLFAVKIRALSTTFVEDKPVRLIDEKKVEIRTNLLACPICYDAFTWNGNPGLSLSSMA  304
            ++R F  +IRA S   VE +  R + +   E  T L ACPICY+     G  G ++ ++ 
Sbjct  40   SSRGFTSRIRASSAIAVEPES-RTLGQDATE--TELFACPICYEPLMRKGPSGFNVPAIY  96

Query  305  QSNLECSTCRKKYSGNETHVDLTIAGGGKAYGEALAASTELFRLPLVSFLYERGWRQSFS  484
            +S  +C  C K YS    ++DLTI  G K Y E+  A TELFR PLVSFLYERGWRQ+F+
Sbjct  97   RSGFKCRKCNKSYSSKSIYLDLTITSGTKEYSESKPARTELFRSPLVSFLYERGWRQAFN  156

Query  485  LWGGFPGPEKEFELMQDYLKPVMGGNIIDAS  577
               GFPGP++EF++ Q+Y K   GG +ID S
Sbjct  157  R-SGFPGPDEEFKMAQEYFKVAEGGVVIDVS  186



>gb|KDO59313.1| hypothetical protein CISIN_1g019950mg [Citrus sinensis]
 gb|KDO59314.1| hypothetical protein CISIN_1g019950mg [Citrus sinensis]
Length=333

 Score =   134 bits (336),  Expect = 5e-34, Method: Compositional matrix adjust.
 Identities = 67/157 (43%), Positives = 98/157 (62%), Gaps = 7/157 (4%)
 Frame = +2

Query  107  SPLTPKANRLFAVKIRALSTTFVEDKPVRLIDEKKVEIRTNLLACPICYDAFTWNGNPGL  286
            SP  P++ R F+  IRA++      +P +    + +E+  +L +CPICY+     G  GL
Sbjct  25   SPRLPQSLR-FSSTIRAVTL-----QPAKSERNQTLELEGDLFSCPICYEPLIRKGPTGL  78

Query  287  SLSSMAQSNLECSTCRKKYSGNETHVDLTIAGGGKAYGEALAASTELFRLPLVSFLYERG  466
            +L ++ +S  +C  C K YS  + ++DLT+  G K Y E   ASTELFR P VSFLYERG
Sbjct  79   TLGAIYRSGFKCRKCDKTYSSKDNYLDLTVISGLKDYTEVKPASTELFRSPFVSFLYERG  138

Query  467  WRQSFSLWGGFPGPEKEFELMQDYLKPVMGGNIIDAS  577
            WRQ+F+   GFPGP++EF++ Q+Y K   GG ++D S
Sbjct  139  WRQNFN-RSGFPGPDEEFKMAQEYFKSAQGGLLVDVS  174



>gb|KHG26587.1| hypothetical protein F383_01046 [Gossypium arboreum]
Length=337

 Score =   134 bits (336),  Expect = 6e-34, Method: Compositional matrix adjust.
 Identities = 59/125 (47%), Positives = 84/125 (67%), Gaps = 1/125 (1%)
 Frame = +2

Query  203  EKKVEIRTNLLACPICYDAFTWNGNPGLSLSSMAQSNLECSTCRKKYSGNETHVDLTIAG  382
            +K     T+L +CP+CY+     G PGL+L+++ +S  +C  C K YS  +T++DLT+  
Sbjct  55   QKNQTEETDLFSCPVCYEPLIRKGPPGLNLAAIYRSGFKCKQCDKSYSSKDTYLDLTVTA  114

Query  383  GGKAYGEALAASTELFRLPLVSFLYERGWRQSFSLWGGFPGPEKEFELMQDYLKPVMGGN  562
            G + Y E   A TELFR P VSF+YERGWRQ+F+   GFPGP++EF + Q+Y KPV GG 
Sbjct  115  GLRDYTEVKPAGTELFRSPFVSFVYERGWRQNFN-RRGFPGPDEEFRMAQEYFKPVEGGI  173

Query  563  IIDAS  577
            ++D S
Sbjct  174  LVDVS  178



>gb|ABR16838.1| unknown [Picea sitchensis]
Length=326

 Score =   133 bits (335),  Expect = 6e-34, Method: Compositional matrix adjust.
 Identities = 64/143 (45%), Positives = 90/143 (63%), Gaps = 5/143 (3%)
 Frame = +2

Query  149  IRALSTTFVEDKPVRLIDEKKVEIRTNLLACPICYDAFTWNGNPGLSLSSMAQSNLECST  328
            IRA +T    D  V    +  VE   ++L+CPICY      G  GL++S +++S  +C  
Sbjct  57   IRAAATVEAPDVKV----DSNVETTVDVLSCPICYKPLIRKGPSGLNMSFISRSGFQCGN  112

Query  329  CRKKYSGNETHVDLTIAGGGKAYGEALAASTELFRLPLVSFLYERGWRQSFSLWGGFPGP  508
            C+K YS  + ++DLT+  G   Y E    +TELFR PLVSF+YERGWRQ+F+  GGFPGP
Sbjct  113  CKKAYSTRDVYIDLTVTAGSSEYDEYRPLTTELFRSPLVSFVYERGWRQNFA-SGGFPGP  171

Query  509  EKEFELMQDYLKPVMGGNIIDAS  577
            ++EF + Q  L+P  GG ++DAS
Sbjct  172  DEEFRMAQKILEPAAGGLLVDAS  194



>ref|XP_006359517.1| PREDICTED: uncharacterized methyltransferase At2g41040, chloroplastic-like 
[Solanum tuberosum]
Length=345

 Score =   134 bits (336),  Expect = 7e-34, Method: Compositional matrix adjust.
 Identities = 72/174 (41%), Positives = 99/174 (57%), Gaps = 6/174 (3%)
 Frame = +2

Query  56   SAVLVTRKLGYNSKFSFSPLTPKANRLFAVKIRALSTTFVEDKPVRLIDEKKVEIRTNLL  235
            S V + R +  NSK      T  ++  +  +IRA S   VE +   L    +V     L 
Sbjct  19   SLVPIQRGVSLNSKIRVP--TRFSSNGYTSRIRATSAVAVEPE---LRTPAQVVTEAELF  73

Query  236  ACPICYDAFTWNGNPGLSLSSMAQSNLECSTCRKKYSGNETHVDLTIAGGGKAYGEALAA  415
            ACPICY+     G  G ++ ++ +S  +C  C K YS    ++DLT+  G K Y E+   
Sbjct  74   ACPICYEPLIRKGPSGFNVPAIYRSGFKCRKCNKSYSSKNIYLDLTVTSGTKEYNESKPT  133

Query  416  STELFRLPLVSFLYERGWRQSFSLWGGFPGPEKEFELMQDYLKPVMGGNIIDAS  577
             TELFR P+VSFLYERGWRQSF+  GGFPGP++EF++ QDY K   GG ++D S
Sbjct  134  GTELFRSPVVSFLYERGWRQSFN-RGGFPGPDEEFKMAQDYFKVAEGGVLVDVS  186



>ref|XP_008336951.1| PREDICTED: uncharacterized methyltransferase At2g41040, chloroplastic-like 
[Malus domestica]
 ref|XP_008336952.1| PREDICTED: uncharacterized methyltransferase At2g41040, chloroplastic-like 
[Malus domestica]
Length=348

 Score =   134 bits (336),  Expect = 8e-34, Method: Compositional matrix adjust.
 Identities = 70/167 (42%), Positives = 101/167 (60%), Gaps = 3/167 (2%)
 Frame = +2

Query  80   LGYNSKFSFSPLTPKANRLFAVKIRALSTTFVEDKPVRLIDEKKVE-IRTNLLACPICYD  256
            L +N++F   P     +R  +  IRA ST  ++ +     +E +   +   LLACP+CY+
Sbjct  25   LHHNTQFR-PPHLCLTSRHSSHPIRATSTVTLQPERRSTAEEGQSSGVDLELLACPVCYE  83

Query  257  AFTWNGNPGLSLSSMAQSNLECSTCRKKYSGNETHVDLTIAGGGKAYGEALAASTELFRL  436
                 G PGL+L ++ +S  +C  C K YS  + ++DLT+  G K Y E   A TELFR 
Sbjct  84   PLIRKGPPGLNLRAIYRSGFKCRKCDKSYSSKDIYLDLTVTAGLKEYVEVKPAGTELFRS  143

Query  437  PLVSFLYERGWRQSFSLWGGFPGPEKEFELMQDYLKPVMGGNIIDAS  577
            P+VSFLYERGWRQ+F+   GFPGP++EF++ QDY K   GG ++D S
Sbjct  144  PIVSFLYERGWRQNFN-RRGFPGPDEEFKMAQDYFKSAEGGVLVDVS  189



>ref|XP_004287240.1| PREDICTED: uncharacterized methyltransferase At2g41040, chloroplastic-like 
isoform X1 [Fragaria vesca subsp. vesca]
Length=338

 Score =   133 bits (334),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 70/167 (42%), Positives = 99/167 (59%), Gaps = 8/167 (5%)
 Frame = +2

Query  77   KLGYNSKFSFSPLTPKANRLFAVKIRALSTTFVEDKPVRLIDEKKVEIRTNLLACPICYD  256
            +L +NS      L+P   R  ++ IRA + T  +++       +   I    L+CP+CY+
Sbjct  20   RLHHNSH-----LSPPRLRFHSLPIRATTITLQQEQSSSTQKSQSSGI--EFLSCPVCYE  72

Query  257  AFTWNGNPGLSLSSMAQSNLECSTCRKKYSGNETHVDLTIAGGGKAYGEALAASTELFRL  436
                 G  GL+L ++ +S  +C  C K YS  + ++DLT+  G K Y E   A TELFR 
Sbjct  73   PLIRKGPTGLNLEAIYRSGFKCRKCDKSYSSKDIYLDLTVTAGLKQYVEVNPARTELFRS  132

Query  437  PLVSFLYERGWRQSFSLWGGFPGPEKEFELMQDYLKPVMGGNIIDAS  577
            PLVSFLYERGWRQ+FS   GFPGP++EF++ QDY KP  GG ++D S
Sbjct  133  PLVSFLYERGWRQNFS-SSGFPGPDEEFKMAQDYFKPAEGGLLVDVS  178



>ref|XP_011470644.1| PREDICTED: uncharacterized methyltransferase At2g41040, chloroplastic-like 
isoform X2 [Fragaria vesca subsp. vesca]
Length=337

 Score =   132 bits (333),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 70/167 (42%), Positives = 99/167 (59%), Gaps = 8/167 (5%)
 Frame = +2

Query  77   KLGYNSKFSFSPLTPKANRLFAVKIRALSTTFVEDKPVRLIDEKKVEIRTNLLACPICYD  256
            +L +NS      L+P   R  ++ IRA + T  +++       +   I    L+CP+CY+
Sbjct  20   RLHHNSH-----LSPPRLRFHSLPIRATTITLQQEQSSSTQKSQSSGI--EFLSCPVCYE  72

Query  257  AFTWNGNPGLSLSSMAQSNLECSTCRKKYSGNETHVDLTIAGGGKAYGEALAASTELFRL  436
                 G  GL+L ++ +S  +C  C K YS  + ++DLT+  G K Y E   A TELFR 
Sbjct  73   PLIRKGPTGLNLEAIYRSGFKCRKCDKSYSSKDIYLDLTVTAGLKQYVEVNPARTELFRS  132

Query  437  PLVSFLYERGWRQSFSLWGGFPGPEKEFELMQDYLKPVMGGNIIDAS  577
            PLVSFLYERGWRQ+FS   GFPGP++EF++ QDY KP  GG ++D S
Sbjct  133  PLVSFLYERGWRQNFS-SSGFPGPDEEFKMAQDYFKPAEGGLLVDVS  178



>ref|XP_010687777.1| PREDICTED: uncharacterized methyltransferase At2g41040, chloroplastic 
[Beta vulgaris subsp. vulgaris]
Length=339

 Score =   132 bits (333),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 59/120 (49%), Positives = 82/120 (68%), Gaps = 1/120 (1%)
 Frame = +2

Query  218  IRTNLLACPICYDAFTWNGNPGLSLSSMAQSNLECSTCRKKYSGNETHVDLTIAGGGKAY  397
            ++ +LLACPIC++     G PGL+L ++ +S  +C TC K YS    ++DLT+  G + Y
Sbjct  62   VQNDLLACPICFETLMRRGPPGLNLEAIYRSGFKCQTCNKSYSSKNVYLDLTVTAGSEEY  121

Query  398  GEALAASTELFRLPLVSFLYERGWRQSFSLWGGFPGPEKEFELMQDYLKPVMGGNIIDAS  577
             E    STELFR P+VSFLYERGWRQ+F+   GFPG E+EF++ Q+Y KP  GG ++D S
Sbjct  122  SENKPTSTELFRSPVVSFLYERGWRQNFN-RSGFPGLEEEFKMAQEYFKPAEGGLLVDVS  180



>ref|XP_002445476.1| hypothetical protein SORBIDRAFT_07g020130 [Sorghum bicolor]
 gb|EES14971.1| hypothetical protein SORBIDRAFT_07g020130 [Sorghum bicolor]
Length=352

 Score =   133 bits (334),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 67/125 (54%), Positives = 83/125 (66%), Gaps = 6/125 (5%)
 Frame = +2

Query  203  EKKVEIRTNLLACPICYDAFTWNGNPGLSLSSMAQSNLECSTCRKKYSGNETHVDLTIAG  382
            E   E +   LACPICY         G S  S   S+LECSTC+K Y   + + DLT++ 
Sbjct  71   EPAAETKLRKLACPICYYPLA-----GSSDQSDDASSLECSTCKKSYPNKQDYWDLTVSV  125

Query  383  GGKAYGEALAASTELFRLPLVSFLYERGWRQSFSLWGGFPGPEKEFELMQDYLKPVMGGN  562
            G   Y E++ A+TELFR PLVSFLYERGWRQ+F +WGGFPG E+EFE+ + YLKP  GG 
Sbjct  126  GSIEYSESMPAATELFRTPLVSFLYERGWRQNF-IWGGFPGLEREFEMAKTYLKPTFGGT  184

Query  563  IIDAS  577
            I+DAS
Sbjct  185  IVDAS  189



>ref|XP_004965743.1| PREDICTED: uncharacterized methyltransferase At2g41040, chloroplastic-like 
isoform X2 [Setaria italica]
Length=299

 Score =   132 bits (331),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 59/126 (47%), Positives = 84/126 (67%), Gaps = 1/126 (1%)
 Frame = +2

Query  200  DEKKVEIRTNLLACPICYDAFTWNGNPGLSLSSMAQSNLECSTCRKKYSGNETHVDLTIA  379
            D++     T + ACP+CY+A    G PG++L ++ +S  +CS C K ++  +  +DLT+ 
Sbjct  9    DQQNSISETEVFACPVCYEALIRKGPPGINLPAIYRSGFKCSKCNKSFTSKDIFLDLTVT  68

Query  380  GGGKAYGEALAASTELFRLPLVSFLYERGWRQSFSLWGGFPGPEKEFELMQDYLKPVMGG  559
             G K Y E   A TELFR PLVSFLYERGWRQ+F+   GFPG ++EF++ QDY +PV GG
Sbjct  69   SGTKEYTEQKPARTELFRSPLVSFLYERGWRQNFN-RSGFPGLDEEFQMAQDYFQPVAGG  127

Query  560  NIIDAS  577
             ++D S
Sbjct  128  ILLDVS  133



>ref|XP_011020252.1| PREDICTED: uncharacterized methyltransferase At2g41040, chloroplastic-like 
[Populus euphratica]
Length=338

 Score =   132 bits (332),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 71/167 (43%), Positives = 97/167 (58%), Gaps = 5/167 (3%)
 Frame = +2

Query  77   KLGYNSKFSFSPLTPKANRLFAVKIRALSTTFVEDKPVRLIDEKKVEIRTNLLACPICYD  256
             L +NS+F  + L     R F   IRA S   +E +   L  ++   +  +  ACPICY 
Sbjct  18   HLFHNSRFPATRLRFTYLR-FPSTIRATSAVSLEPE---LSTQQSQTLEVDPFACPICYQ  73

Query  257  AFTWNGNPGLSLSSMAQSNLECSTCRKKYSGNETHVDLTIAGGGKAYGEALAASTELFRL  436
                 G  G +L ++ +S  +C+ C K YS  E ++DLTI  G K Y E     TELFR 
Sbjct  74   PLIRKGPTGFNLPAIYRSGFKCNRCNKTYSSKENYLDLTITAGMKDYTEVKPVRTELFRS  133

Query  437  PLVSFLYERGWRQSFSLWGGFPGPEKEFELMQDYLKPVMGGNIIDAS  577
            PLVSFLYERGWRQ+F+   GFPGP++EF++ Q+Y KP  GG ++D S
Sbjct  134  PLVSFLYERGWRQNFN-QSGFPGPDEEFKMAQEYFKPTEGGLLVDVS  179



>ref|XP_006852799.1| hypothetical protein AMTR_s00033p00159870 [Amborella trichopoda]
 gb|ERN14266.1| hypothetical protein AMTR_s00033p00159870 [Amborella trichopoda]
Length=343

 Score =   132 bits (332),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 60/120 (50%), Positives = 81/120 (68%), Gaps = 1/120 (1%)
 Frame = +2

Query  218  IRTNLLACPICYDAFTWNGNPGLSLSSMAQSNLECSTCRKKYSGNETHVDLTIAGGGKAY  397
            ++ NL ACPICY+     G  GL+L ++ +S  +C TCRK YS  +  +DLT+  G K Y
Sbjct  42   LQYNLFACPICYEPLIRKGPSGLTLPAVYRSGFKCQTCRKSYSSKDVFLDLTVTSGTKDY  101

Query  398  GEALAASTELFRLPLVSFLYERGWRQSFSLWGGFPGPEKEFELMQDYLKPVMGGNIIDAS  577
             E     TELFR PLVSFLYERGWRQ+FS   GFPGP++EF++ Q++ +P  GG ++D S
Sbjct  102  NEFKPPRTELFRSPLVSFLYERGWRQTFS-GSGFPGPDEEFKMAQEFFEPAAGGLLVDVS  160



>ref|XP_002531454.1| phosphatidylethanolamine n-methyltransferase, putative [Ricinus 
communis]
 gb|EEF30941.1| phosphatidylethanolamine n-methyltransferase, putative [Ricinus 
communis]
Length=290

 Score =   131 bits (329),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 58/117 (50%), Positives = 79/117 (68%), Gaps = 1/117 (1%)
 Frame = +2

Query  227  NLLACPICYDAFTWNGNPGLSLSSMAQSNLECSTCRKKYSGNETHVDLTIAGGGKAYGEA  406
            ++ ACP+CY+     G PG +LS++ +S  +C  C K YS  + ++DLTI    K Y E 
Sbjct  14   DVFACPVCYEPLIRKGPPGFNLSAIYRSGFKCKKCNKTYSSKDNYLDLTITASMKEYTEV  73

Query  407  LAASTELFRLPLVSFLYERGWRQSFSLWGGFPGPEKEFELMQDYLKPVMGGNIIDAS  577
              A TELFR PLVSFLYERGWRQ+F+   GFPGP++EF++ Q+Y KP  GG ++D S
Sbjct  74   KPARTELFRSPLVSFLYERGWRQNFN-QSGFPGPDEEFKMAQEYFKPAEGGILVDVS  129



>ref|NP_001132053.1| uncharacterized LOC100193465 [Zea mays]
 gb|ACF80738.1| unknown [Zea mays]
 gb|AFW76186.1| LOW QUALITY PROTEIN: S-adenosylmethionine-dependent methyltransferase 
[Zea mays]
Length=356

 Score =   132 bits (332),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 56/126 (44%), Positives = 85/126 (67%), Gaps = 1/126 (1%)
 Frame = +2

Query  200  DEKKVEIRTNLLACPICYDAFTWNGNPGLSLSSMAQSNLECSTCRKKYSGNETHVDLTIA  379
            +++ + + T + ACP+CY+     G PG++L ++ +S  +CS C K ++  +  +DLT+ 
Sbjct  66   EQQNIIMETEVFACPVCYEPLMRKGPPGINLPAIYRSGFKCSKCNKSFTSKDIFLDLTVT  125

Query  380  GGGKAYGEALAASTELFRLPLVSFLYERGWRQSFSLWGGFPGPEKEFELMQDYLKPVMGG  559
             G K Y E   A TELFR PLVSFLYERGWRQ+F+   GFPG ++EF++ QDY +P+ GG
Sbjct  126  AGTKEYSEQKPARTELFRSPLVSFLYERGWRQNFN-RSGFPGLDEEFQMAQDYFQPIAGG  184

Query  560  NIIDAS  577
             ++D S
Sbjct  185  ILLDVS  190



>ref|XP_004488470.1| PREDICTED: uncharacterized methyltransferase At2g41040, chloroplastic-like 
[Cicer arietinum]
Length=346

 Score =   132 bits (332),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 64/143 (45%), Positives = 88/143 (62%), Gaps = 3/143 (2%)
 Frame = +2

Query  149  IRALSTTFVEDKPVRLIDEKKVEIRTNLLACPICYDAFTWNGNPGLSLSSMAQSNLECST  328
            IRA S   V +    L  +  +  + +L ACPICY+     G  G +LS++ +S  +C  
Sbjct  48   IRATSAAVVVESD--LTTQHDLNTQVDLFACPICYEPLIRKGPVGFNLSAIYRSGFKCKR  105

Query  329  CRKKYSGNETHVDLTIAGGGKAYGEALAASTELFRLPLVSFLYERGWRQSFSLWGGFPGP  508
            C+K Y+  + ++DLT+  G + Y E     TELFR PLVSFLYERGWRQ+F    GFPGP
Sbjct  106  CQKAYTSKDGYLDLTVTSGLRDYTEVQPVRTELFRSPLVSFLYERGWRQNFR-QSGFPGP  164

Query  509  EKEFELMQDYLKPVMGGNIIDAS  577
            E+EF++ Q+Y +P  GG IID S
Sbjct  165  EEEFKMAQEYFEPAKGGLIIDVS  187



>ref|XP_011078555.1| PREDICTED: uncharacterized methyltransferase At2g41040, chloroplastic 
[Sesamum indicum]
Length=338

 Score =   132 bits (331),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 71/182 (39%), Positives = 99/182 (54%), Gaps = 13/182 (7%)
 Frame = +2

Query  59   AVLVTRKLGYNSKFSFSPLTPKANR---------LFAVKIRALSTTFVEDKPVRLIDEKK  211
            AV     L +    +F P  P+  R         + + +IRA S   +E +   L  E +
Sbjct  2    AVAAQASLRFYQNSAFFPRNPRLFRDSRLRPPPGVCSARIRASSAVALEPE---LTTEAQ  58

Query  212  VEIRTNLLACPICYDAFTWNGNPGLSLSSMAQSNLECSTCRKKYSGNETHVDLTIAGGGK  391
                 +L ACPICY+     G  G +L ++ +S  +C  C K YS    ++DLT+  G K
Sbjct  59   DTTDVDLFACPICYEPLIRKGPSGFNLPAIYRSGFKCRKCNKSYSSKNIYLDLTVTSGTK  118

Query  392  AYGEALAASTELFRLPLVSFLYERGWRQSFSLWGGFPGPEKEFELMQDYLKPVMGGNIID  571
             Y E   A TELFR PLVSF+YERGWRQ+F+   GFPGP++EF + Q+Y KP  GG ++D
Sbjct  119  EYNEFKPAGTELFRSPLVSFVYERGWRQNFN-RSGFPGPDEEFNMAQEYFKPAEGGVLVD  177

Query  572  AS  577
             S
Sbjct  178  VS  179



>gb|ACG27569.1| S-adenosylmethionine-dependent methyltransferase [Zea mays]
Length=344

 Score =   132 bits (331),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 56/126 (44%), Positives = 85/126 (67%), Gaps = 1/126 (1%)
 Frame = +2

Query  200  DEKKVEIRTNLLACPICYDAFTWNGNPGLSLSSMAQSNLECSTCRKKYSGNETHVDLTIA  379
            +++ + + T + ACP+CY+     G PG++L ++ +S  +CS C K ++  +  +DLT+ 
Sbjct  54   EQQNIIMETEVFACPVCYEPLMRKGPPGINLPAIYRSGFKCSKCNKSFTSKDIFLDLTVT  113

Query  380  GGGKAYGEALAASTELFRLPLVSFLYERGWRQSFSLWGGFPGPEKEFELMQDYLKPVMGG  559
             G K Y E   A TELFR PLVSFLYERGWRQ+F+   GFPG ++EF++ QDY +P+ GG
Sbjct  114  AGTKEYSEQKPARTELFRSPLVSFLYERGWRQNFN-RSGFPGLDEEFQMAQDYFQPIAGG  172

Query  560  NIIDAS  577
             ++D S
Sbjct  173  ILLDVS  178



>gb|ACF85541.1| unknown [Zea mays]
 gb|ACF88073.1| unknown [Zea mays]
Length=346

 Score =   132 bits (331),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 56/126 (44%), Positives = 85/126 (67%), Gaps = 1/126 (1%)
 Frame = +2

Query  200  DEKKVEIRTNLLACPICYDAFTWNGNPGLSLSSMAQSNLECSTCRKKYSGNETHVDLTIA  379
            +++ + + T + ACP+CY+     G PG++L ++ +S  +CS C K ++  +  +DLT+ 
Sbjct  56   EQQNIIMETEVFACPVCYEPLMRKGPPGINLPAIYRSGFKCSKCNKSFTSKDIFLDLTVT  115

Query  380  GGGKAYGEALAASTELFRLPLVSFLYERGWRQSFSLWGGFPGPEKEFELMQDYLKPVMGG  559
             G K Y E   A TELFR PLVSFLYERGWRQ+F+   GFPG ++EF++ QDY +P+ GG
Sbjct  116  AGTKEYSEQKPARTELFRSPLVSFLYERGWRQNFN-RSGFPGLDEEFQMAQDYFQPIAGG  174

Query  560  NIIDAS  577
             ++D S
Sbjct  175  ILLDVS  180



>ref|XP_004965742.1| PREDICTED: uncharacterized methyltransferase At2g41040, chloroplastic-like 
isoform X1 [Setaria italica]
Length=354

 Score =   132 bits (331),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 59/126 (47%), Positives = 84/126 (67%), Gaps = 1/126 (1%)
 Frame = +2

Query  200  DEKKVEIRTNLLACPICYDAFTWNGNPGLSLSSMAQSNLECSTCRKKYSGNETHVDLTIA  379
            D++     T + ACP+CY+A    G PG++L ++ +S  +CS C K ++  +  +DLT+ 
Sbjct  64   DQQNSISETEVFACPVCYEALIRKGPPGINLPAIYRSGFKCSKCNKSFTSKDIFLDLTVT  123

Query  380  GGGKAYGEALAASTELFRLPLVSFLYERGWRQSFSLWGGFPGPEKEFELMQDYLKPVMGG  559
             G K Y E   A TELFR PLVSFLYERGWRQ+F+   GFPG ++EF++ QDY +PV GG
Sbjct  124  SGTKEYTEQKPARTELFRSPLVSFLYERGWRQNFN-RSGFPGLDEEFQMAQDYFQPVAGG  182

Query  560  NIIDAS  577
             ++D S
Sbjct  183  ILLDVS  188



>ref|XP_002268107.1| PREDICTED: uncharacterized methyltransferase At2g41040, chloroplastic 
[Vitis vinifera]
 emb|CBI25579.3| unnamed protein product [Vitis vinifera]
Length=343

 Score =   131 bits (330),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 63/147 (43%), Positives = 93/147 (63%), Gaps = 4/147 (3%)
 Frame = +2

Query  137  FAVKIRALSTTFVEDKPVRLIDEKKVEIRTNLLACPICYDAFTWNGNPGLSLSSMAQSNL  316
            F  +IRA S   +E +    ++     +  +L +CP+CY+     G PGL+L ++ +S  
Sbjct  36   FPSRIRASSAVALEPESSTQLNNG---LEFDLFSCPVCYEPLIRKGPPGLNLPAIYRSGF  92

Query  317  ECSTCRKKYSGNETHVDLTIAGGGKAYGEALAASTELFRLPLVSFLYERGWRQSFSLWGG  496
            +C +C K YS  + ++DLTI  G K Y E     TELFR PLVSFLYERGWRQ+F+   G
Sbjct  93   KCRSCNKSYSSKDMYLDLTITAGSKDYNELQPNRTELFRSPLVSFLYERGWRQNFN-QSG  151

Query  497  FPGPEKEFELMQDYLKPVMGGNIIDAS  577
            FPG ++EF++ Q+Y +PV+GG ++D S
Sbjct  152  FPGRDEEFKMAQEYFEPVIGGLLVDVS  178



>ref|XP_004242718.1| PREDICTED: uncharacterized methyltransferase At2g41040, chloroplastic-like 
[Solanum lycopersicum]
Length=339

 Score =   131 bits (330),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 63/147 (43%), Positives = 89/147 (61%), Gaps = 4/147 (3%)
 Frame = +2

Query  137  FAVKIRALSTTFVEDKPVRLIDEKKVEIRTNLLACPICYDAFTWNGNPGLSLSSMAQSNL  316
            F  +IRA S    E +   L    +  +   L ACPICY+  T  G  G ++ ++ +S  
Sbjct  38   FTSRIRATSAVVAEPE---LRTPAQDSMEAELFACPICYEPLTRKGPSGFNVPAIYRSGF  94

Query  317  ECSTCRKKYSGNETHVDLTIAGGGKAYGEALAASTELFRLPLVSFLYERGWRQSFSLWGG  496
            +C  C K YS  + ++DLT+  G K Y E   A +ELFR P+VSFLYERGWRQ+F+L  G
Sbjct  95   KCRKCNKSYSSKDIYLDLTVTSGTKQYNEVKPARSELFRSPIVSFLYERGWRQNFNL-SG  153

Query  497  FPGPEKEFELMQDYLKPVMGGNIIDAS  577
            FPGP++EF++ Q+Y K   GG ++D S
Sbjct  154  FPGPDEEFKMAQEYFKVAEGGVLVDVS  180



>ref|XP_008389527.1| PREDICTED: uncharacterized methyltransferase At2g41040, chloroplastic-like 
[Malus domestica]
Length=304

 Score =   130 bits (328),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 67/146 (46%), Positives = 91/146 (62%), Gaps = 6/146 (4%)
 Frame = +2

Query  149  IRALSTTFVEDKPVRLIDEKKVE---IRTNLLACPICYDAFTWNGNPGLSLSSMAQSNLE  319
            IRA ST  V   P R    ++++   +   +LACPICY+     G PGL+L ++ +S  +
Sbjct  43   IRATST--VALPPERRSRAEEIQSSGVDLEVLACPICYEPLIRRGPPGLNLRAIYRSGFK  100

Query  320  CSTCRKKYSGNETHVDLTIAGGGKAYGEALAASTELFRLPLVSFLYERGWRQSFSLWGGF  499
            C  C K YS  + ++DLT+  G K Y E     TELFR PLVSFLYERGWRQ+F+   GF
Sbjct  101  CRKCDKXYSSKDXYLDLTVTAGLKEYVEVQPXXTELFRSPLVSFLYERGWRQNFN-RSGF  159

Query  500  PGPEKEFELMQDYLKPVMGGNIIDAS  577
            PGP++EF++ QDY K   GG ++D S
Sbjct  160  PGPDEEFKMAQDYFKSAEGGVLVDVS  185



>ref|XP_002438745.1| hypothetical protein SORBIDRAFT_10g025400 [Sorghum bicolor]
 gb|EER90112.1| hypothetical protein SORBIDRAFT_10g025400 [Sorghum bicolor]
Length=352

 Score =   132 bits (331),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 58/120 (48%), Positives = 81/120 (68%), Gaps = 1/120 (1%)
 Frame = +2

Query  218  IRTNLLACPICYDAFTWNGNPGLSLSSMAQSNLECSTCRKKYSGNETHVDLTIAGGGKAY  397
            + T + ACP+CY+     G PG++L ++ +S  +CS C K ++  +  +DLT+  G K Y
Sbjct  68   METEVFACPVCYEPLMRKGPPGINLPAIYRSGFKCSKCNKSFTSKDIFLDLTVTAGTKEY  127

Query  398  GEALAASTELFRLPLVSFLYERGWRQSFSLWGGFPGPEKEFELMQDYLKPVMGGNIIDAS  577
             E   A TELFR PLVSFLYERGWRQ+F+   GFPG ++EFE+ QDY +PV GG ++D S
Sbjct  128  SEQKPARTELFRSPLVSFLYERGWRQNFN-RSGFPGLDEEFEMAQDYFQPVAGGILLDVS  186



>ref|XP_004974685.1| PREDICTED: uncharacterized methyltransferase At1g78140, chloroplastic-like, 
partial [Setaria italica]
Length=323

 Score =   131 bits (329),  Expect = 5e-33, Method: Compositional matrix adjust.
 Identities = 66/134 (49%), Positives = 87/134 (65%), Gaps = 6/134 (4%)
 Frame = +2

Query  176  EDKPVRLIDEKKVEIRTNLLACPICYDAFTWNGNPGLSLSSMAQSNLECSTCRKKYSGNE  355
            +++   L+ E   E++ + LACPICY  F        S  S   S+LECSTC+K Y   +
Sbjct  34   DEEVAELLVETVPEMKLSKLACPICYYPFV-----SASDQSGDASSLECSTCKKVYPNKQ  88

Query  356  THVDLTIAGGGKAYGEALAASTELFRLPLVSFLYERGWRQSFSLWGGFPGPEKEFELMQD  535
             + DLT+A G   Y E++ A+TELFR  LVSFLYERGWRQ+F  WGGFPG  +EFE+ + 
Sbjct  89   DYWDLTVAVGSTEYTESMPAATELFRTSLVSFLYERGWRQTFR-WGGFPGRTREFEMAKT  147

Query  536  YLKPVMGGNIIDAS  577
            YL P +GG I+DAS
Sbjct  148  YLNPTIGGTIVDAS  161



>gb|EMT07919.1| Putative methyltransferase [Aegilops tauschii]
Length=358

 Score =   131 bits (330),  Expect = 6e-33, Method: Compositional matrix adjust.
 Identities = 61/131 (47%), Positives = 85/131 (65%), Gaps = 5/131 (4%)
 Frame = +2

Query  197  IDEKKVEI----RTNLLACPICYDAFTWNGNPGLSLSSMAQSNLECSTCRKKYSGNETHV  364
              E K E+    +T + ACP+CY+     G PG++L ++ +S  +CS C K ++  +  +
Sbjct  63   FQEIKTELNDTPKTEVFACPVCYEPLIRKGPPGMNLPAIYRSGFKCSKCNKSFTSKDVFL  122

Query  365  DLTIAGGGKAYGEALAASTELFRLPLVSFLYERGWRQSFSLWGGFPGPEKEFELMQDYLK  544
            DLT+  G K Y E   A TELFR PLVSFLYERGWRQ+F+   GFPG ++EF++ QDY K
Sbjct  123  DLTVTSGMKEYSELKPARTELFRSPLVSFLYERGWRQNFN-RSGFPGRDEEFQMAQDYFK  181

Query  545  PVMGGNIIDAS  577
            PV GG ++D S
Sbjct  182  PVAGGILVDVS  192



>ref|XP_003574470.1| PREDICTED: uncharacterized methyltransferase At1g78140, chloroplastic 
[Brachypodium distachyon]
 ref|XP_010235114.1| PREDICTED: uncharacterized methyltransferase At1g78140, chloroplastic 
[Brachypodium distachyon]
Length=361

 Score =   131 bits (329),  Expect = 8e-33, Method: Compositional matrix adjust.
 Identities = 73/159 (46%), Positives = 98/159 (62%), Gaps = 14/159 (9%)
 Frame = +2

Query  107  SPLTPKANRLFAVKI--RALSTTFVEDKPVRLIDEKKVEIRTNLLACPICYDAFTWNGNP  280
            S L   A++ F   +   A++   VE +PV  + +         LACPICY  +    + 
Sbjct  52   SALRASASQAFTAGVPDEAVAEPLVEAEPVAELGK---------LACPICY--YPLVSSL  100

Query  281  GLSLSSMAQSNLECSTCRKKYSGNETHVDLTIAGGGKAYGEALAASTELFRLPLVSFLYE  460
              S  S + S+LEC TC+K YS  + + DLT+A G   Y E++ A+TELFR  LVSFLYE
Sbjct  101  DQSAPSKSDSSLECPTCKKVYSDEDGYWDLTVAVGSTEYSESMPAATELFRTQLVSFLYE  160

Query  461  RGWRQSFSLWGGFPGPEKEFELMQDYLKPVMGGNIIDAS  577
            RGWRQ+F +WGGFPG E+EFE+ + YLKP  GG I+DAS
Sbjct  161  RGWRQNF-IWGGFPGLEREFEMAKTYLKPTTGGIIVDAS  198



>gb|KJB53960.1| hypothetical protein B456_009G013400 [Gossypium raimondii]
Length=300

 Score =   130 bits (326),  Expect = 8e-33, Method: Compositional matrix adjust.
 Identities = 57/125 (46%), Positives = 80/125 (64%), Gaps = 1/125 (1%)
 Frame = +2

Query  203  EKKVEIRTNLLACPICYDAFTWNGNPGLSLSSMAQSNLECSTCRKKYSGNETHVDLTIAG  382
            ++   + T L +CP+CY+     G PGL+L ++ +S  +C  C K YS  +  +DLT+  
Sbjct  18   QQNQTVETELFSCPVCYEPLIRKGPPGLNLDAIYRSGFKCKKCNKSYSSKDVFLDLTVTT  77

Query  383  GGKAYGEALAASTELFRLPLVSFLYERGWRQSFSLWGGFPGPEKEFELMQDYLKPVMGGN  562
            G + Y E     TELFR PLVSFLYERGWRQ+F+L  GFPG ++EF + Q+Y KP  GG 
Sbjct  78   GLRNYTEVKPVRTELFRSPLVSFLYERGWRQNFNL-SGFPGADEEFRMAQEYFKPAEGGT  136

Query  563  IIDAS  577
            ++D S
Sbjct  137  LVDVS  141



>ref|XP_004242719.1| PREDICTED: uncharacterized methyltransferase At2g41040, chloroplastic 
[Solanum lycopersicum]
Length=341

 Score =   130 bits (328),  Expect = 8e-33, Method: Compositional matrix adjust.
 Identities = 66/150 (44%), Positives = 89/150 (59%), Gaps = 10/150 (7%)
 Frame = +2

Query  137  FAVKIRALSTTFVEDK---PVRLIDEKKVEIRTNLLACPICYDAFTWNGNPGLSLSSMAQ  307
            F  +IRA S   VE +   P + + E +      L ACPICY+     G  G ++ ++ +
Sbjct  40   FTSRIRATSAVAVEPELRTPAQDVAEAE------LFACPICYEPLIRKGPSGFNVPAVYR  93

Query  308  SNLECSTCRKKYSGNETHVDLTIAGGGKAYGEALAASTELFRLPLVSFLYERGWRQSFSL  487
            S  +C  C K YS    ++DLT+  G K Y E+    TELFR P+VSFLYERGWRQSF+ 
Sbjct  94   SGFKCRKCNKSYSSKNIYLDLTVTSGTKEYNESKPTGTELFRSPVVSFLYERGWRQSFN-  152

Query  488  WGGFPGPEKEFELMQDYLKPVMGGNIIDAS  577
             GGFPGP++EF + QDY K   GG ++D S
Sbjct  153  RGGFPGPDEEFNMAQDYFKVAEGGVLVDVS  182



>gb|KDP30197.1| hypothetical protein JCGZ_16979 [Jatropha curcas]
Length=345

 Score =   130 bits (328),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 68/166 (41%), Positives = 98/166 (59%), Gaps = 3/166 (2%)
 Frame = +2

Query  80   LGYNSKFSFSPLTPKANRLFAVKIRALSTTFVEDKPVRLIDEKKVEIRTNLLACPICYDA  259
            L  NS+  F P    ++  F   IRA S   +E + +   +E+   +  +  ACPICY+ 
Sbjct  22   LSRNSRI-FHPRLQFSSLRFHSTIRATSAVALE-RDLGKQEEQSQTLEVDPFACPICYEP  79

Query  260  FTWNGNPGLSLSSMAQSNLECSTCRKKYSGNETHVDLTIAGGGKAYGEALAASTELFRLP  439
                G PG +LS++ +S  +C  C K Y+  + ++DLTI    K Y E   A +ELFR P
Sbjct  80   LIRKGPPGFNLSAIYRSGFKCKKCNKTYTSKDKYLDLTITAAMKEYTEVKPARSELFRSP  139

Query  440  LVSFLYERGWRQSFSLWGGFPGPEKEFELMQDYLKPVMGGNIIDAS  577
            LVSFLYERGWRQ+F+   GFPGP++EF++ Q+Y K   GG ++D S
Sbjct  140  LVSFLYERGWRQNFNR-SGFPGPDEEFKMAQEYFKQAEGGLLVDVS  184



>ref|XP_006359516.1| PREDICTED: uncharacterized methyltransferase At2g41040, chloroplastic-like 
[Solanum tuberosum]
Length=343

 Score =   130 bits (327),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 64/147 (44%), Positives = 91/147 (62%), Gaps = 4/147 (3%)
 Frame = +2

Query  137  FAVKIRALSTTFVEDKPVRLIDEKKVEIRTNLLACPICYDAFTWNGNPGLSLSSMAQSNL  316
            +  +IRA S   VE + +R   +   E    L ACPICY+     G  G ++ ++ +S  
Sbjct  42   YTSRIRATSAVAVEPE-LRTPAQDATE--AELFACPICYEPLIRKGPSGFNVPAIYRSGF  98

Query  317  ECSTCRKKYSGNETHVDLTIAGGGKAYGEALAASTELFRLPLVSFLYERGWRQSFSLWGG  496
            +CS C K YS  + ++DLT+  G K Y E   A +ELFR P+VSFLYERGWRQ+F+L  G
Sbjct  99   KCSKCNKSYSSKDIYLDLTVTSGTKQYNEVKPARSELFRSPIVSFLYERGWRQNFNL-SG  157

Query  497  FPGPEKEFELMQDYLKPVMGGNIIDAS  577
            FPGP++EF++ Q+Y K   GG ++D S
Sbjct  158  FPGPDEEFKMAQEYFKVAEGGVLVDVS  184



>ref|XP_002988667.1| hypothetical protein SELMODRAFT_46133, partial [Selaginella moellendorffii]
 gb|EFJ10178.1| hypothetical protein SELMODRAFT_46133, partial [Selaginella moellendorffii]
Length=269

 Score =   128 bits (322),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 57/117 (49%), Positives = 79/117 (68%), Gaps = 1/117 (1%)
 Frame = +2

Query  227  NLLACPICYDAFTWNGNPGLSLSSMAQSNLECSTCRKKYSGNETHVDLTIAGGGKAYGEA  406
             LLACPIC+DA    G PG++  ++A+S  +CSTC++ +S    ++DLT+  G K Y E 
Sbjct  1    ELLACPICFDALLRKGPPGINQFAIAKSGFQCSTCKRSFSSRNEYLDLTVTSGAKDYVEV  60

Query  407  LAASTELFRLPLVSFLYERGWRQSFSLWGGFPGPEKEFELMQDYLKPVMGGNIIDAS  577
                TELFR PLVS +YERGWRQ+F    GFPGP++E ++  +YL+P  GG I+D S
Sbjct  61   PPTGTELFRNPLVSLIYERGWRQNFE-RSGFPGPDEELKMALEYLRPAFGGVIVDVS  116



>dbj|BAF93193.1| putative methyltransferase-like [Hordeum vulgare]
Length=165

 Score =   125 bits (314),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 55/119 (46%), Positives = 79/119 (66%), Gaps = 1/119 (1%)
 Frame = +2

Query  221  RTNLLACPICYDAFTWNGNPGLSLSSMAQSNLECSTCRKKYSGNETHVDLTIAGGGKAYG  400
            +T + ACP+CY+     G PG++L ++ +S  +C  C K ++  +  +DLT+  G K Y 
Sbjct  18   KTEVFACPVCYEPLIRKGPPGMNLPAIYRSGFKCPKCNKSFTSKDVFLDLTVTSGMKQYS  77

Query  401  EALAASTELFRLPLVSFLYERGWRQSFSLWGGFPGPEKEFELMQDYLKPVMGGNIIDAS  577
            E   A TELFR PLVSFLYERGWRQ+F+   GFPG ++EF++ QDY + V GG ++D S
Sbjct  78   ELKPARTELFRSPLVSFLYERGWRQNFN-RSGFPGRDEEFQMAQDYFQSVAGGILVDVS  135



>ref|XP_003563313.1| PREDICTED: uncharacterized methyltransferase At2g41040, chloroplastic 
[Brachypodium distachyon]
Length=356

 Score =   130 bits (326),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 57/116 (49%), Positives = 80/116 (69%), Gaps = 1/116 (1%)
 Frame = +2

Query  230  LLACPICYDAFTWNGNPGLSLSSMAQSNLECSTCRKKYSGNETHVDLTIAGGGKAYGEAL  409
            + ACP+CY+     G PG++L ++ +S  +CS C+K ++  +  +DLT+  G K Y E  
Sbjct  76   VFACPVCYEPLIRKGPPGINLPAIYRSGFKCSKCKKSFTSKDIFLDLTVTSGTKEYSELK  135

Query  410  AASTELFRLPLVSFLYERGWRQSFSLWGGFPGPEKEFELMQDYLKPVMGGNIIDAS  577
             A TELFR PLVSFLYERGWRQ+F+   GFPG ++EF++ QDY +PV GG +ID S
Sbjct  136  PARTELFRSPLVSFLYERGWRQNFN-RSGFPGLDEEFQMAQDYFQPVAGGILIDVS  190



>ref|XP_010099510.1| putative methyltransferase [Morus notabilis]
 gb|EXB79361.1| putative methyltransferase [Morus notabilis]
Length=346

 Score =   129 bits (324),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 62/143 (43%), Positives = 90/143 (63%), Gaps = 2/143 (1%)
 Frame = +2

Query  149  IRALSTTFVEDKPVRLIDEKKVEIRTNLLACPICYDAFTWNGNPGLSLSSMAQSNLECST  328
            IRA S+  +  +P   ++E +    + + ACP+CY+     G  GL+L ++ +S  +C  
Sbjct  47   IRATSSV-IALEPSSSVEENRSSEVSEVFACPVCYEPLIRKGPSGLNLEAIYRSGFKCKK  105

Query  329  CRKKYSGNETHVDLTIAGGGKAYGEALAASTELFRLPLVSFLYERGWRQSFSLWGGFPGP  508
            C K YS  + ++DLT+  G + Y E   A TELFR PLVSFLYERGWRQ+F+   GFPGP
Sbjct  106  CNKSYSSKDIYLDLTVTAGLRDYTEVKPAGTELFRSPLVSFLYERGWRQNFN-RSGFPGP  164

Query  509  EKEFELMQDYLKPVMGGNIIDAS  577
            ++EF++ Q Y K V GG ++D S
Sbjct  165  DEEFKMAQGYFKSVEGGLLVDVS  187



>gb|KHG21340.1| hypothetical protein F383_03824 [Gossypium arboreum]
Length=394

 Score =   130 bits (326),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 63/160 (39%), Positives = 93/160 (58%), Gaps = 4/160 (3%)
 Frame = +2

Query  107  SPLTPK---ANRLFAVKIRALSTTFVEDKPVRLIDEKKVEIRTNLLACPICYDAFTWNGN  277
            SP  P    +++ F + +RA S   +E        ++   + T L +CP+CY+     G 
Sbjct  77   SPFRPSLHFSSKPFRLTVRASSAVALEQDLRTQGTQQNQTVETELFSCPVCYEPLIRKGP  136

Query  278  PGLSLSSMAQSNLECSTCRKKYSGNETHVDLTIAGGGKAYGEALAASTELFRLPLVSFLY  457
             GL+L ++ +S  +C  C K +S  +  +DLT+  G + Y E     TELFR PLVSFLY
Sbjct  137  LGLNLDAIYRSGFKCKKCNKSFSSKDVFLDLTVTAGLRNYTEVKPVRTELFRSPLVSFLY  196

Query  458  ERGWRQSFSLWGGFPGPEKEFELMQDYLKPVMGGNIIDAS  577
            ERGWRQ+F+L  GFPG ++EF + Q+Y KP  GG ++D S
Sbjct  197  ERGWRQNFNL-SGFPGADEEFRMAQEYFKPAEGGTLVDVS  235



>gb|EEC83568.1| hypothetical protein OsI_29220 [Oryza sativa Indica Group]
Length=352

 Score =   129 bits (323),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 67/147 (46%), Positives = 91/147 (62%), Gaps = 7/147 (5%)
 Frame = +2

Query  155  ALSTTFVEDKPVRLIDEKKVEI------RTNLLACPICYDAFTWNGNPGLSLSSMAQSNL  316
            +++  FV   P   ++E  VE       +   LACPICY     + +    +S+ + S+L
Sbjct  52   SVTPEFVTASPDEAVEESSVEREPAAENKLRKLACPICYYPLISSSDQSAPVSAASSSSL  111

Query  317  ECSTCRKKYSGNETHVDLTIAGGGKAYGEALAASTELFRLPLVSFLYERGWRQSFSLWGG  496
            ECSTC+K Y     + D+T+A G   Y E+   +TE+FR PLVSFLYERGWRQ+F +W G
Sbjct  112  ECSTCKKFYPNRGDYWDMTVAVGSTEYSESTTVTTEVFRTPLVSFLYERGWRQNF-IWSG  170

Query  497  FPGPEKEFELMQDYLKPVMGGNIIDAS  577
            FPG E+EFE+ Q YLKP  GG I+DAS
Sbjct  171  FPGLEREFEMAQTYLKPTTGGIIVDAS  197



>ref|NP_001061786.1| Os08g0411200 [Oryza sativa Japonica Group]
 dbj|BAF23700.1| Os08g0411200 [Oryza sativa Japonica Group]
 dbj|BAH00216.1| unnamed protein product [Oryza sativa Japonica Group]
Length=358

 Score =   129 bits (323),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 67/147 (46%), Positives = 91/147 (62%), Gaps = 7/147 (5%)
 Frame = +2

Query  155  ALSTTFVEDKPVRLIDEKKVEI------RTNLLACPICYDAFTWNGNPGLSLSSMAQSNL  316
            +++  FV   P   ++E  VE       +   LACPICY     + +    +S+ + S+L
Sbjct  50   SVTPEFVTAAPDEAVEESSVEREPAAENKLRKLACPICYYPLISSSDQSAPVSAASSSSL  109

Query  317  ECSTCRKKYSGNETHVDLTIAGGGKAYGEALAASTELFRLPLVSFLYERGWRQSFSLWGG  496
            ECSTC+K Y     + D+T+A G   Y E+   +TE+FR PLVSFLYERGWRQ+F +W G
Sbjct  110  ECSTCKKFYPNRGDYWDMTVAVGSTEYSESTTVTTEVFRTPLVSFLYERGWRQNF-IWSG  168

Query  497  FPGPEKEFELMQDYLKPVMGGNIIDAS  577
            FPG E+EFE+ Q YLKP  GG I+DAS
Sbjct  169  FPGLEREFEMAQTYLKPTTGGIIVDAS  195



>ref|XP_010928269.1| PREDICTED: uncharacterized methyltransferase At2g41040, chloroplastic 
isoform X3 [Elaeis guineensis]
Length=315

 Score =   128 bits (321),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 61/133 (46%), Positives = 84/133 (63%), Gaps = 6/133 (5%)
 Frame = +2

Query  194  LIDEKKVEIR-----TNLLACPICYDAFTWNGNPGLSLSSMAQSNLECSTCRKKYSGNET  358
            L+D +  +++      NLLACPICY+     G  GL+L ++ +S  +C  C K +S  + 
Sbjct  19   LLDIQDTQVKQDFLEVNLLACPICYEPLMRKGPSGLNLPAIYRSGFKCLKCNKSFSSKDV  78

Query  359  HVDLTIAGGGKAYGEALAASTELFRLPLVSFLYERGWRQSFSLWGGFPGPEKEFELMQDY  538
            ++DLTI  G K Y E     TELFR P VSFLYERGWRQ+F+   GFPGP++EF + Q+Y
Sbjct  79   YLDLTITSGTKEYNELKPTRTELFRSPFVSFLYERGWRQNFN-RSGFPGPDEEFNMAQEY  137

Query  539  LKPVMGGNIIDAS  577
             K V GG ++D S
Sbjct  138  FKTVAGGLLVDVS  150



>ref|XP_010928267.1| PREDICTED: uncharacterized methyltransferase At2g41040, chloroplastic 
isoform X1 [Elaeis guineensis]
Length=355

 Score =   129 bits (323),  Expect = 6e-32, Method: Compositional matrix adjust.
 Identities = 66/149 (44%), Positives = 89/149 (60%), Gaps = 6/149 (4%)
 Frame = +2

Query  131  RLFAVKIRALSTTFVEDKPVRLIDEKKVEIRTNLLACPICYDAFTWNGNPGLSLSSMAQS  310
            R F ++  A + T   D  V     K+  +  NLLACPICY+     G  GL+L ++ +S
Sbjct  48   RGFPLRATAAALTVEPDTQV-----KQDFLEVNLLACPICYEPLMRKGPSGLNLPAIYRS  102

Query  311  NLECSTCRKKYSGNETHVDLTIAGGGKAYGEALAASTELFRLPLVSFLYERGWRQSFSLW  490
              +C  C K +S  + ++DLTI  G K Y E     TELFR P VSFLYERGWRQ+F+  
Sbjct  103  GFKCLKCNKSFSSKDVYLDLTITSGTKEYNELKPTRTELFRSPFVSFLYERGWRQNFN-R  161

Query  491  GGFPGPEKEFELMQDYLKPVMGGNIIDAS  577
             GFPGP++EF + Q+Y K V GG ++D S
Sbjct  162  SGFPGPDEEFNMAQEYFKTVAGGLLVDVS  190



>ref|XP_003546595.1| PREDICTED: uncharacterized methyltransferase At2g41040, chloroplastic-like 
[Glycine max]
 gb|KHN41316.1| Putative methyltransferase, chloroplastic [Glycine soja]
Length=341

 Score =   128 bits (322),  Expect = 6e-32, Method: Compositional matrix adjust.
 Identities = 62/143 (43%), Positives = 88/143 (62%), Gaps = 4/143 (3%)
 Frame = +2

Query  149  IRALSTTFVEDKPVRLIDEKKVEIRTNLLACPICYDAFTWNGNPGLSLSSMAQSNLECST  328
            IRA+S    E +   L  ++   I  ++ ACP+CY+     G  GL+L ++ +S   C  
Sbjct  44   IRAISAVAAESE---LGTQQDQAIEADIFACPVCYEPLIRKGPSGLNLPAIYRSGFMCKR  100

Query  329  CRKKYSGNETHVDLTIAGGGKAYGEALAASTELFRLPLVSFLYERGWRQSFSLWGGFPGP  508
            C+K YS  + ++DLT+  G + Y E   A TELFR PLVSFLYERGWRQ+F    GFPGP
Sbjct  101  CKKSYSSKDRYLDLTVTAGLRDYTEIQPARTELFRSPLVSFLYERGWRQNFR-QSGFPGP  159

Query  509  EKEFELMQDYLKPVMGGNIIDAS  577
            ++EF++ Q+Y +   GG I+D S
Sbjct  160  DEEFKMAQEYFESAKGGLIVDVS  182



>ref|XP_007013645.1| S-adenosyl-L-methionine-dependent methyltransferases superfamily 
protein [Theobroma cacao]
 gb|EOY31264.1| S-adenosyl-L-methionine-dependent methyltransferases superfamily 
protein [Theobroma cacao]
Length=340

 Score =   128 bits (322),  Expect = 6e-32, Method: Compositional matrix adjust.
 Identities = 62/158 (39%), Positives = 92/158 (58%), Gaps = 4/158 (3%)
 Frame = +2

Query  104  FSPLTPKANRLFAVKIRALSTTFVEDKPVRLIDEKKVEIRTNLLACPICYDAFTWNGNPG  283
            F P    +++     +RA S   +E     L  ++   + T+L +CP+CY+     G  G
Sbjct  28   FRPSLHFSSQPLRFTVRASSAVALEPD---LSSQRNQTVDTDLFSCPVCYEPLIRKGPSG  84

Query  284  LSLSSMAQSNLECSTCRKKYSGNETHVDLTIAGGGKAYGEALAASTELFRLPLVSFLYER  463
            L+L ++ +S  +C  C K YS  + ++DLTI  G + Y E     TELFR P VSF+YER
Sbjct  85   LNLEAIYRSGFKCKKCNKSYSSKDVYLDLTITAGLRDYTEVKPVGTELFRSPFVSFVYER  144

Query  464  GWRQSFSLWGGFPGPEKEFELMQDYLKPVMGGNIIDAS  577
            GWRQ+F+   GFPGP++EF + Q+Y KP  GG ++D S
Sbjct  145  GWRQNFNR-SGFPGPDEEFRMAQEYFKPAEGGILVDVS  181



>ref|XP_002986403.1| hypothetical protein SELMODRAFT_235009 [Selaginella moellendorffii]
 gb|EFJ12612.1| hypothetical protein SELMODRAFT_235009 [Selaginella moellendorffii]
Length=340

 Score =   128 bits (322),  Expect = 7e-32, Method: Compositional matrix adjust.
 Identities = 57/117 (49%), Positives = 79/117 (68%), Gaps = 1/117 (1%)
 Frame = +2

Query  227  NLLACPICYDAFTWNGNPGLSLSSMAQSNLECSTCRKKYSGNETHVDLTIAGGGKAYGEA  406
             LLACPIC+DA    G PG++  ++A+S  +CSTC++ +S    ++DLT+  G K Y E 
Sbjct  71   ELLACPICFDALLRKGPPGINQFAIAKSGFQCSTCKRSFSSRNEYLDLTVTSGAKDYVEV  130

Query  407  LAASTELFRLPLVSFLYERGWRQSFSLWGGFPGPEKEFELMQDYLKPVMGGNIIDAS  577
                TELFR PLVS +YERGWRQ+F    GFPGP++E ++  +YL+P  GG I+D S
Sbjct  131  PPTGTELFRNPLVSLIYERGWRQNFE-RSGFPGPDEELKMALEYLRPAFGGVIVDVS  186



>gb|EEE68668.1| hypothetical protein OsJ_27281 [Oryza sativa Japonica Group]
Length=369

 Score =   129 bits (323),  Expect = 7e-32, Method: Compositional matrix adjust.
 Identities = 67/147 (46%), Positives = 91/147 (62%), Gaps = 7/147 (5%)
 Frame = +2

Query  155  ALSTTFVEDKPVRLIDEKKVEI------RTNLLACPICYDAFTWNGNPGLSLSSMAQSNL  316
            +++  FV   P   ++E  VE       +   LACPICY     + +    +S+ + S+L
Sbjct  50   SVTPEFVTAAPDEAVEESSVEREPAAENKLRKLACPICYYPLISSSDQSAPVSAASSSSL  109

Query  317  ECSTCRKKYSGNETHVDLTIAGGGKAYGEALAASTELFRLPLVSFLYERGWRQSFSLWGG  496
            ECSTC+K Y     + D+T+A G   Y E+   +TE+FR PLVSFLYERGWRQ+F +W G
Sbjct  110  ECSTCKKFYPNRGDYWDMTVAVGSTEYSESTTVTTEVFRTPLVSFLYERGWRQNF-IWSG  168

Query  497  FPGPEKEFELMQDYLKPVMGGNIIDAS  577
            FPG E+EFE+ Q YLKP  GG I+DAS
Sbjct  169  FPGLEREFEMAQTYLKPTTGGIIVDAS  195



>ref|XP_009358530.1| PREDICTED: uncharacterized methyltransferase At2g41040, chloroplastic-like 
[Pyrus x bretschneideri]
Length=345

 Score =   128 bits (321),  Expect = 9e-32, Method: Compositional matrix adjust.
 Identities = 70/167 (42%), Positives = 98/167 (59%), Gaps = 3/167 (2%)
 Frame = +2

Query  80   LGYNSKFSFSPLTPKANRLFAVKIRALSTTFVEDKPVRLIDEKKVEI-RTNLLACPICYD  256
            L +NS+F   P   + +R  +  IRA ST  ++ +     +E +       LLACPICY+
Sbjct  22   LHHNSQFR-PPHLCRPSRHSSHPIRATSTVILQPRRRSPAEESQSSGGDLELLACPICYE  80

Query  257  AFTWNGNPGLSLSSMAQSNLECSTCRKKYSGNETHVDLTIAGGGKAYGEALAASTELFRL  436
                 G  GL+L ++ +S  +C  C K YS  + ++DLT+  G K Y E   A TELFR 
Sbjct  81   PLIRKGPSGLNLRAIYRSGFKCRKCDKSYSSKDIYLDLTVTAGLKEYVEVKPAGTELFRS  140

Query  437  PLVSFLYERGWRQSFSLWGGFPGPEKEFELMQDYLKPVMGGNIIDAS  577
            PLVSFLYERGWRQ+F+   GFPGP++EF++ QDY      G ++D S
Sbjct  141  PLVSFLYERGWRQNFNR-RGFPGPDEEFKMAQDYFISAEAGVLVDVS  186



>ref|XP_009338403.1| PREDICTED: uncharacterized methyltransferase At2g41040, chloroplastic-like 
isoform X2 [Pyrus x bretschneideri]
Length=345

 Score =   128 bits (321),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 70/167 (42%), Positives = 98/167 (59%), Gaps = 3/167 (2%)
 Frame = +2

Query  80   LGYNSKFSFSPLTPKANRLFAVKIRALSTTFVEDKPVRLIDEKKVEI-RTNLLACPICYD  256
            L +NS+F   P   + +R  +  IRA ST  ++ +     +E +       LLACPICY+
Sbjct  22   LHHNSQFR-PPHLCRPSRHSSHPIRATSTVILQPERRAAAEESQSSGGDLELLACPICYE  80

Query  257  AFTWNGNPGLSLSSMAQSNLECSTCRKKYSGNETHVDLTIAGGGKAYGEALAASTELFRL  436
                 G  GL+L ++ +S  +C  C K YS  + ++DLT+  G K Y E   A TELFR 
Sbjct  81   PLIRKGPSGLNLRAIYRSGFKCRKCDKSYSSKDIYLDLTVTAGLKEYVEVKPAGTELFRS  140

Query  437  PLVSFLYERGWRQSFSLWGGFPGPEKEFELMQDYLKPVMGGNIIDAS  577
            PLVSFLYERGWRQ+F+   GFPGP++EF++ QDY      G ++D S
Sbjct  141  PLVSFLYERGWRQNFNR-RGFPGPDEEFKMAQDYFISAEAGVLVDVS  186



>ref|XP_009338401.1| PREDICTED: uncharacterized methyltransferase At2g41040, chloroplastic-like 
isoform X1 [Pyrus x bretschneideri]
Length=350

 Score =   127 bits (320),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 70/167 (42%), Positives = 98/167 (59%), Gaps = 3/167 (2%)
 Frame = +2

Query  80   LGYNSKFSFSPLTPKANRLFAVKIRALSTTFVEDKPVRLIDEKKVEI-RTNLLACPICYD  256
            L +NS+F   P   + +R  +  IRA ST  ++ +     +E +       LLACPICY+
Sbjct  22   LHHNSQFR-PPHLCRPSRHSSHPIRATSTVILQPERRAAAEESQSSGGDLELLACPICYE  80

Query  257  AFTWNGNPGLSLSSMAQSNLECSTCRKKYSGNETHVDLTIAGGGKAYGEALAASTELFRL  436
                 G  GL+L ++ +S  +C  C K YS  + ++DLT+  G K Y E   A TELFR 
Sbjct  81   PLIRKGPSGLNLRAIYRSGFKCRKCDKSYSSKDIYLDLTVTAGLKEYVEVKPAGTELFRS  140

Query  437  PLVSFLYERGWRQSFSLWGGFPGPEKEFELMQDYLKPVMGGNIIDAS  577
            PLVSFLYERGWRQ+F+   GFPGP++EF++ QDY      G ++D S
Sbjct  141  PLVSFLYERGWRQNFNR-RGFPGPDEEFKMAQDYFISAEAGVLVDVS  186



>dbj|BAJ94151.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=348

 Score =   127 bits (320),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 57/119 (48%), Positives = 80/119 (67%), Gaps = 1/119 (1%)
 Frame = +2

Query  221  RTNLLACPICYDAFTWNGNPGLSLSSMAQSNLECSTCRKKYSGNETHVDLTIAGGGKAYG  400
            +T + ACPICY+     G PG++L ++ +S  +CS C K ++  +  +DLT+  G K Y 
Sbjct  65   KTEVFACPICYEPLIRKGPPGMNLPAIYRSGFKCSKCNKSFTSKDVFLDLTVTSGMKQYS  124

Query  401  EALAASTELFRLPLVSFLYERGWRQSFSLWGGFPGPEKEFELMQDYLKPVMGGNIIDAS  577
            E   A TELFR PLVSFLYERGWRQ+F+   GFPG ++EF++ QDY + V GG ++D S
Sbjct  125  ELKPARTELFRSPLVSFLYERGWRQNFN-RSGFPGRDEEFQMAQDYFQSVAGGILVDVS  182



>ref|XP_006381066.1| methyltransferase-related family protein [Populus trichocarpa]
 gb|ERP58863.1| methyltransferase-related family protein [Populus trichocarpa]
Length=308

 Score =   127 bits (318),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 59/128 (46%), Positives = 80/128 (63%), Gaps = 1/128 (1%)
 Frame = +2

Query  194  LIDEKKVEIRTNLLACPICYDAFTWNGNPGLSLSSMAQSNLECSTCRKKYSGNETHVDLT  373
            L  ++   +  +  ACPICY      G  G +L ++ +S  +C+ C K YS  E ++DLT
Sbjct  23   LSTQQSQTLEVDPFACPICYQPLIRKGPKGFNLPAIYRSGFKCNRCNKTYSSKENYLDLT  82

Query  374  IAGGGKAYGEALAASTELFRLPLVSFLYERGWRQSFSLWGGFPGPEKEFELMQDYLKPVM  553
            I  G K Y E     TELFR PLVSFLYERGWRQ+F+   GFPGP++EF++ Q+Y KP  
Sbjct  83   ITAGMKDYTEVKPVRTELFRSPLVSFLYERGWRQNFNQ-SGFPGPDEEFKMAQEYFKPTE  141

Query  554  GGNIIDAS  577
            GG ++D S
Sbjct  142  GGLLVDVS  149



>gb|EYU34934.1| hypothetical protein MIMGU_mgv1a009522mg [Erythranthe guttata]
Length=339

 Score =   127 bits (319),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 70/182 (38%), Positives = 98/182 (54%), Gaps = 13/182 (7%)
 Frame = +2

Query  59   AVLVTRKLGYNSKFSFSPLTPKANRLFAVK---------IRALSTTFVEDKPVRLIDEKK  211
            AV +   L ++    F P +P  +R   ++         IRA S   ++ +  R   E +
Sbjct  2    AVALQPSLRFHHNSPFFPKSPHLSRNSQIRPNPSFATASIRASSAVALDTESSR---EAQ  58

Query  212  VEIRTNLLACPICYDAFTWNGNPGLSLSSMAQSNLECSTCRKKYSGNETHVDLTIAGGGK  391
                  L AC ICY+     G  G +L ++ +S  +C  C K YS    ++DLT+  G K
Sbjct  59   STSDVELFACAICYEPLIRKGPSGFNLQAIYRSGFKCRNCNKSYSSKNLYLDLTVTSGTK  118

Query  392  AYGEALAASTELFRLPLVSFLYERGWRQSFSLWGGFPGPEKEFELMQDYLKPVMGGNIID  571
             Y E   A TELFR PLVSF+YERGWRQ+F+   GFPGP++EF + Q+Y KP  GG +ID
Sbjct  119  EYNEFQPAGTELFRSPLVSFVYERGWRQNFN-SRGFPGPDEEFSMAQEYFKPAEGGVLID  177

Query  572  AS  577
             S
Sbjct  178  VS  179



>dbj|BAJ91607.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=348

 Score =   127 bits (318),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 56/119 (47%), Positives = 80/119 (67%), Gaps = 1/119 (1%)
 Frame = +2

Query  221  RTNLLACPICYDAFTWNGNPGLSLSSMAQSNLECSTCRKKYSGNETHVDLTIAGGGKAYG  400
            +T + ACP+CY+     G PG++L ++ +S  +CS C K ++  +  +DLT+  G K Y 
Sbjct  65   KTEVFACPVCYEPLIRKGPPGMNLPAIYRSGFKCSKCNKSFTSKDVFLDLTVTSGMKQYS  124

Query  401  EALAASTELFRLPLVSFLYERGWRQSFSLWGGFPGPEKEFELMQDYLKPVMGGNIIDAS  577
            E   A TELFR PLVSFLYERGWRQ+F+   GFPG ++EF++ QDY + V GG ++D S
Sbjct  125  ELKPARTELFRSPLVSFLYERGWRQNFN-RSGFPGRDEEFQMAQDYFQSVAGGILVDVS  182



>ref|NP_001150427.1| S-adenosylmethionine-dependent methyltransferase [Zea mays]
 gb|ACG39054.1| S-adenosylmethionine-dependent methyltransferase [Zea mays]
 tpg|DAA49108.1| TPA: S-adenosylmethionine-dependent methyltransferase [Zea mays]
Length=348

 Score =   127 bits (318),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 61/121 (50%), Positives = 80/121 (66%), Gaps = 6/121 (5%)
 Frame = +2

Query  215  EIRTNLLACPICYDAFTWNGNPGLSLSSMAQSNLECSTCRKKYSGNETHVDLTIAGGGKA  394
            E +   LACPICY     + +     +S     LEC TC+K Y   + + DLT++ G   
Sbjct  71   ETKLRKLACPICYYPLASSSDQLDDATS-----LECPTCKKCYPNKQDYWDLTVSVGSTE  125

Query  395  YGEALAASTELFRLPLVSFLYERGWRQSFSLWGGFPGPEKEFELMQDYLKPVMGGNIIDA  574
            Y E++  +TELFR PLVSFLYERGWRQ+F +WGGFPG E+EFE+ + YLKP +GG I+DA
Sbjct  126  YSESMPVATELFRTPLVSFLYERGWRQNF-IWGGFPGLEREFEMAKTYLKPTIGGTIVDA  184

Query  575  S  577
            S
Sbjct  185  S  185



>gb|AEJ88263.1| putative S-adenosylmethionine-dependent methyltransferase [Wolffia 
arrhiza]
Length=274

 Score =   125 bits (314),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 61/131 (47%), Positives = 82/131 (63%), Gaps = 7/131 (5%)
 Frame = +2

Query  203  EKKVEIRTN------LLACPICYDAFTWNGNPGLSLSSMAQSNLECSTCRKKYSGNETHV  364
            EK+ E R N        +CP+CY      G PGL+LS++ +S   C +C K +S   T++
Sbjct  63   EKESESRGNETSESDKFSCPVCYRPLIRTGPPGLNLSAIYRSGFLCKSCNKPFSSRNTYL  122

Query  365  DLTIAGGGKAYGEALAASTELFRLPLVSFLYERGWRQSFSLWGGFPGPEKEFELMQDYLK  544
            DLT+  G K Y E+  + TELFR P VSFLYERGWRQ+F    GFPG ++EF + Q+Y K
Sbjct  123  DLTVTSGAKEYNESKPSRTELFRSPFVSFLYERGWRQNFR-NSGFPGLDEEFRMAQEYFK  181

Query  545  PVMGGNIIDAS  577
            PV GG ++D S
Sbjct  182  PVEGGFLLDVS  192



>gb|KHN28439.1| Putative methyltransferase, chloroplastic [Glycine soja]
Length=341

 Score =   126 bits (317),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 61/143 (43%), Positives = 88/143 (62%), Gaps = 4/143 (3%)
 Frame = +2

Query  149  IRALSTTFVEDKPVRLIDEKKVEIRTNLLACPICYDAFTWNGNPGLSLSSMAQSNLECST  328
            IRA+S    E +   L  ++   I  ++ ACP+CY+     G  GL+L ++ +S   C  
Sbjct  44   IRAISAVAAESE---LGTQQDHAIEADIFACPVCYEPLIRKGPSGLNLPAIYRSGFMCKR  100

Query  329  CRKKYSGNETHVDLTIAGGGKAYGEALAASTELFRLPLVSFLYERGWRQSFSLWGGFPGP  508
            C+K YS  + ++DLT+  G + Y E   A TELFR PLVSFLYERGWRQ+F    GFPGP
Sbjct  101  CKKTYSSKDRYLDLTVTAGLRDYTEIQPARTELFRSPLVSFLYERGWRQNFR-QSGFPGP  159

Query  509  EKEFELMQDYLKPVMGGNIIDAS  577
            ++EF++ Q+Y +   GG ++D S
Sbjct  160  DEEFKMAQEYFESAEGGLLVDVS  182



>ref|XP_009386973.1| PREDICTED: uncharacterized methyltransferase At2g41040, chloroplastic 
[Musa acuminata subsp. malaccensis]
Length=353

 Score =   126 bits (316),  Expect = 5e-31, Method: Compositional matrix adjust.
 Identities = 64/153 (42%), Positives = 96/153 (63%), Gaps = 6/153 (4%)
 Frame = +2

Query  119  PKANRLFAVKIRALSTTFVEDKPVRLIDEKKVEIRTNLLACPICYDAFTWNGNPGLSLSS  298
            P+++R   +++ A +   VE +  R+     ++++  LLACPICY+     G  GL++ S
Sbjct  42   PRSSR--GLRVSATAALSVEQE-TRVQHNDSMDLQ--LLACPICYEPLIRKGPAGLNVPS  96

Query  299  MAQSNLECSTCRKKYSGNETHVDLTIAGGGKAYGEALAASTELFRLPLVSFLYERGWRQS  478
            + +S  +C  C K ++  + ++DLTI  G   Y E   A TELFR PLVSFLYERGWRQ+
Sbjct  97   IYRSGFKCQKCNKSFTSKDVYLDLTITSGTTEYSEFKPARTELFRSPLVSFLYERGWRQN  156

Query  479  FSLWGGFPGPEKEFELMQDYLKPVMGGNIIDAS  577
            F+   GFPG ++EF + Q+Y KPV GG ++D S
Sbjct  157  FN-RSGFPGLDEEFNMAQEYFKPVAGGLLVDVS  188



>ref|XP_010250394.1| PREDICTED: uncharacterized protein LOC104592660 [Nelumbo nucifera]
Length=795

 Score =   129 bits (325),  Expect = 5e-31, Method: Compositional matrix adjust.
 Identities = 65/144 (45%), Positives = 89/144 (62%), Gaps = 4/144 (3%)
 Frame = +2

Query  146  KIRALSTTFVEDKPVRLIDEKKVEIRTNLLACPICYDAFTWNGNPGLSLSSMAQSNLECS  325
            +IRA S   V  +PV    +        + ACP+CY+     G PGL+L ++ +S  +C 
Sbjct  40   RIRASSA--VATEPVTSTQQNNA-FEFEVFACPVCYEPLIRKGPPGLNLPAIYRSGFQCQ  96

Query  326  TCRKKYSGNETHVDLTIAGGGKAYGEALAASTELFRLPLVSFLYERGWRQSFSLWGGFPG  505
             C KKYS  + ++DLT+  G K Y E   A TELFR PLVSFLYERGWRQ+F+   GFPG
Sbjct  97   RCNKKYSSRDIYLDLTVIAGTKEYTEFKPARTELFRSPLVSFLYERGWRQNFNR-SGFPG  155

Query  506  PEKEFELMQDYLKPVMGGNIIDAS  577
            P++EF++  +Y KP  GG ++D S
Sbjct  156  PDEEFKMALEYFKPAEGGLLVDVS  179



>ref|XP_010533098.1| PREDICTED: uncharacterized methyltransferase At2g41040, chloroplastic 
[Tarenaya hassleriana]
Length=345

 Score =   125 bits (315),  Expect = 6e-31, Method: Compositional matrix adjust.
 Identities = 55/128 (43%), Positives = 81/128 (63%), Gaps = 1/128 (1%)
 Frame = +2

Query  194  LIDEKKVEIRTNLLACPICYDAFTWNGNPGLSLSSMAQSNLECSTCRKKYSGNETHVDLT  373
            LI  K   + T++ ACP+CY+     G PG++L ++ +S  +C  C K YS  + ++DLT
Sbjct  60   LITPKTQTLETDIFACPVCYEPLVRKGPPGINLQAIYRSGFKCRECEKTYSSKDGYLDLT  119

Query  374  IAGGGKAYGEALAASTELFRLPLVSFLYERGWRQSFSLWGGFPGPEKEFELMQDYLKPVM  553
            +      + E    +TELFR PLVSFLYERGWRQ+F+   GFPGP++EF + Q+Y +   
Sbjct  120  VTADSGNFDEVKPITTELFRSPLVSFLYERGWRQNFN-RSGFPGPDEEFRMAQEYFRSAE  178

Query  554  GGNIIDAS  577
            GG ++D S
Sbjct  179  GGLLVDVS  186



>ref|XP_007202300.1| hypothetical protein PRUPE_ppa007882mg [Prunus persica]
 gb|EMJ03499.1| hypothetical protein PRUPE_ppa007882mg [Prunus persica]
Length=352

 Score =   125 bits (314),  Expect = 9e-31, Method: Compositional matrix adjust.
 Identities = 59/116 (51%), Positives = 78/116 (67%), Gaps = 1/116 (1%)
 Frame = +2

Query  230  LLACPICYDAFTWNGNPGLSLSSMAQSNLECSTCRKKYSGNETHVDLTIAGGGKAYGEAL  409
            LLACP+CY+     G PGL+L ++ +S  +C  C K YS  + ++DLT+  G K Y E  
Sbjct  79   LLACPVCYEPLIRKGPPGLNLQAIYRSAFKCKKCDKSYSSKDIYLDLTVIAGLKEYVEVK  138

Query  410  AASTELFRLPLVSFLYERGWRQSFSLWGGFPGPEKEFELMQDYLKPVMGGNIIDAS  577
             A TELFR PLVSFLYERGWRQ+F+   GFPG ++EF++ QDY K   GG ++D S
Sbjct  139  PAGTELFRNPLVSFLYERGWRQNFN-RSGFPGLDEEFKMAQDYFKSAEGGVLLDVS  193



>ref|NP_001242875.1| uncharacterized protein LOC100798970 [Glycine max]
 gb|ACU18789.1| unknown [Glycine max]
Length=341

 Score =   125 bits (313),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 60/143 (42%), Positives = 88/143 (62%), Gaps = 4/143 (3%)
 Frame = +2

Query  149  IRALSTTFVEDKPVRLIDEKKVEIRTNLLACPICYDAFTWNGNPGLSLSSMAQSNLECST  328
            IRA+S    E +   L  ++   I  ++ ACP+CY+     G  GL+L ++ +S   C  
Sbjct  44   IRAISAVAAESE---LGTQQDHAIEADIFACPVCYEPLIRKGPSGLNLPAIYRSGFMCKR  100

Query  329  CRKKYSGNETHVDLTIAGGGKAYGEALAASTELFRLPLVSFLYERGWRQSFSLWGGFPGP  508
            C+K YS  + ++DLT+  G + Y E   A TELFR PLVSFL+ERGWRQ+F    GFPGP
Sbjct  101  CKKTYSSKDRYLDLTVTAGLRDYTEIQPARTELFRSPLVSFLHERGWRQNFR-QSGFPGP  159

Query  509  EKEFELMQDYLKPVMGGNIIDAS  577
            ++EF++ Q+Y +   GG ++D S
Sbjct  160  DEEFKMAQEYFESAEGGLLVDVS  182



>gb|EMT30153.1| Putative methyltransferase [Aegilops tauschii]
Length=416

 Score =   126 bits (316),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 57/132 (43%), Positives = 83/132 (63%), Gaps = 1/132 (1%)
 Frame = +2

Query  182  KPVRLIDEKKVEIRTNLLACPICYDAFTWNGNPGLSLSSMAQSNLECSTCRKKYSGNETH  361
            +P     E+     T + ACP+CY+     G PG++L ++ +S  +CS C K ++  +  
Sbjct  120  EPAETKTEQNDTSETEVFACPVCYEPLIRKGPPGMNLPAIYRSGFKCSKCNKSFTSKDVF  179

Query  362  VDLTIAGGGKAYGEALAASTELFRLPLVSFLYERGWRQSFSLWGGFPGPEKEFELMQDYL  541
            +DLT+  G K Y E   A TELFR PLVS+LYERGWRQ+F+   GFPG ++EF++ QDY 
Sbjct  180  LDLTVTSGMKEYSELKPARTELFRSPLVSYLYERGWRQNFNR-SGFPGRDEEFQMAQDYF  238

Query  542  KPVMGGNIIDAS  577
            + V GG ++D S
Sbjct  239  QSVAGGILVDVS  250



>ref|XP_010050326.1| PREDICTED: uncharacterized methyltransferase At2g41040, chloroplastic-like 
[Eucalyptus grandis]
Length=350

 Score =   125 bits (313),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 58/125 (46%), Positives = 80/125 (64%), Gaps = 1/125 (1%)
 Frame = +2

Query  203  EKKVEIRTNLLACPICYDAFTWNGNPGLSLSSMAQSNLECSTCRKKYSGNETHVDLTIAG  382
            +K   + + + +CPICY++    G  GL+L +M  S  +C+ C+K YS N   +DLT+  
Sbjct  68   QKDQTLESEIFSCPICYESLIRRGPSGLNLEAMHGSGFKCNRCKKSYSSNGNFLDLTLTA  127

Query  383  GGKAYGEALAASTELFRLPLVSFLYERGWRQSFSLWGGFPGPEKEFELMQDYLKPVMGGN  562
            G + Y E     TELFR PLVSFLYERGWRQ+F    GFPG E+EF++ Q+Y KP  GG 
Sbjct  128  GLRNYIEVKPRQTELFRSPLVSFLYERGWRQNFK-HSGFPGQEEEFKMAQEYFKPAEGGL  186

Query  563  IIDAS  577
            ++D S
Sbjct  187  LLDVS  191



>ref|XP_001778776.1| predicted protein [Physcomitrella patens]
 gb|EDQ56362.1| predicted protein [Physcomitrella patens]
Length=309

 Score =   124 bits (311),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 57/135 (42%), Positives = 84/135 (62%), Gaps = 1/135 (1%)
 Frame = +2

Query  173  VEDKPVRLIDEKKVEIRTNLLACPICYDAFTWNGNPGLSLSSMAQSNLECSTCRKKYSGN  352
            +  +P   +D ++    + LL CPIC+      G  GL+ +++  S   C +CR+K+S  
Sbjct  12   LRQEPRSNLDREEENSTSELLCCPICHKPLQRTGPSGLTQNAIRSSGFSCHSCRRKFSNR  71

Query  353  ETHVDLTIAGGGKAYGEALAASTELFRLPLVSFLYERGWRQSFSLWGGFPGPEKEFELMQ  532
              +VDLTI  G + Y E   A  E+FR P+VSF+YERGWRQ+F+   GFPGP++EF++ Q
Sbjct  72   GDYVDLTILDGTRVYDENTTAGAEIFRSPVVSFVYERGWRQNFAR-AGFPGPDEEFKMAQ  130

Query  533  DYLKPVMGGNIIDAS  577
            +Y K V GG I+D S
Sbjct  131  NYFKSVQGGVILDVS  145



>ref|XP_009141962.1| PREDICTED: uncharacterized methyltransferase At2g41040, chloroplastic 
[Brassica rapa]
Length=355

 Score =   124 bits (312),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 55/127 (43%), Positives = 83/127 (65%), Gaps = 2/127 (2%)
 Frame = +2

Query  200  DEKKVE-IRTNLLACPICYDAFTWNGNPGLSLSSMAQSNLECSTCRKKYSGNETHVDLTI  376
            D+K+ E + T + ACP+CY+     G  G++L ++ +S  +C  C K YS  + ++DLT+
Sbjct  70   DKKETETVETQVFACPVCYEPLMRKGPSGINLQAIYRSGFKCGQCNKTYSSKDEYLDLTV  129

Query  377  AGGGKAYGEALAASTELFRLPLVSFLYERGWRQSFSLWGGFPGPEKEFELMQDYLKPVMG  556
              G  ++ E    +TELFR PLVSFLYERGWRQ+F+   GFPGP++EF + ++Y K   G
Sbjct  130  TAGFDSFNEVKPITTELFRSPLVSFLYERGWRQNFAR-SGFPGPDEEFRMAEEYFKEAEG  188

Query  557  GNIIDAS  577
            G ++D S
Sbjct  189  GVLVDVS  195



>emb|CDY57579.1| BnaC04g56820D [Brassica napus]
Length=353

 Score =   124 bits (310),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 59/151 (39%), Positives = 92/151 (61%), Gaps = 3/151 (2%)
 Frame = +2

Query  128  NRLFAVKIRALS-TTFVEDKPVRLIDEKKVEIRTNLLACPICYDAFTWNGNPGLSLSSMA  304
            +R  +  IRA++    + + P   I E +  + T + ACP+CY+     G  G++L ++ 
Sbjct  45   SRFTSASIRAVALEPELNETPSSDIKETET-VETQVFACPVCYEPLMRKGPSGINLQAIY  103

Query  305  QSNLECSTCRKKYSGNETHVDLTIAGGGKAYGEALAASTELFRLPLVSFLYERGWRQSFS  484
            +S  +C  C K YS  + ++DLT+  G  ++ E    +TELFR PLVSFLYERGWRQ+F+
Sbjct  104  RSGFKCGQCNKTYSSKDEYLDLTVTAGFDSFNEVKPITTELFRSPLVSFLYERGWRQNFA  163

Query  485  LWGGFPGPEKEFELMQDYLKPVMGGNIIDAS  577
               GFPGP++EF + ++Y K   GG ++D S
Sbjct  164  R-SGFPGPDEEFRMAEEYFKEAEGGVLVDVS  193



>ref|XP_004287239.1| PREDICTED: uncharacterized methyltransferase At2g41040, chloroplastic-like 
[Fragaria vesca subsp. vesca]
Length=289

 Score =   122 bits (307),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 57/127 (45%), Positives = 83/127 (65%), Gaps = 3/127 (2%)
 Frame = +2

Query  197  IDEKKVEIRTNLLACPICYDAFTWNGNPGLSLSSMAQSNLECSTCRKKYSGNETHVDLTI  376
            ++E   E+   LL+CP+CY+  T  G PGL L ++ +S+ EC  C K YS  + ++DLT+
Sbjct  8    LNESSAEV--ELLSCPVCYEPLTRVGPPGLILQAICRSSFECKKCYKSYSSKKNYLDLTV  65

Query  377  AGGGKAYGEALAASTELFRLPLVSFLYERGWRQSFSLWGGFPGPEKEFELMQDYLKPVMG  556
              G K Y EA    TELFR  ++SF+YE+G+RQ F  + GFPGP++EF++ QDY K   G
Sbjct  66   TAGLKKYVEAKPIGTELFRSIIMSFIYEKGYRQCFKRY-GFPGPDEEFKMAQDYFKSAEG  124

Query  557  GNIIDAS  577
            G ++D S
Sbjct  125  GVLVDVS  131



>gb|KCW45297.1| hypothetical protein EUGRSUZ_L01041 [Eucalyptus grandis]
Length=239

 Score =   121 bits (304),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 67/171 (39%), Positives = 95/171 (56%), Gaps = 15/171 (9%)
 Frame = +2

Query  98   FSFSPLTPKANRL-----FA------VKIRALSTTFVEDKPVRLIDEKKVEIRTNLLACP  244
            F+  PL P+  RL     F+        +RA S   VE   +    +K   +   + +CP
Sbjct  11   FARHPLLPRTCRLQPRPRFSSVRFPPFSVRASSAVAVE---LDTGTQKDPTLDGEIFSCP  67

Query  245  ICYDAFTWNGNPGLSLSSMAQSNLECSTCRKKYSGNETHVDLTIAGGGKAYGEALAASTE  424
            ICY+     G  GL+L ++ +S  +C  C K YS     +DLT+  G + Y E   A TE
Sbjct  68   ICYEPLIRRGPSGLNLEAVYRSGFKCKKCNKSYSSKNNFLDLTLTAGLRDYVEVKPARTE  127

Query  425  LFRLPLVSFLYERGWRQSFSLWGGFPGPEKEFELMQDYLKPVMGGNIIDAS  577
            LFR P+VSFLYERGWRQ+F+   GFPG ++EF++ Q+Y KP  GG ++D S
Sbjct  128  LFRSPVVSFLYERGWRQNFN-QSGFPGQDEEFKMAQEYFKPAEGGLLVDVS  177



>gb|KDO59312.1| hypothetical protein CISIN_1g019950mg [Citrus sinensis]
Length=328

 Score =   122 bits (306),  Expect = 9e-30, Method: Compositional matrix adjust.
 Identities = 65/157 (41%), Positives = 94/157 (60%), Gaps = 12/157 (8%)
 Frame = +2

Query  107  SPLTPKANRLFAVKIRALSTTFVEDKPVRLIDEKKVEIRTNLLACPICYDAFTWNGNPGL  286
            SP  P++ R F+  IRA++      +P +    + +E+  +L +CPICY+     G  GL
Sbjct  25   SPRLPQSLR-FSSTIRAVTL-----QPAKSERNQTLELEGDLFSCPICYEPLIRKGPTGL  78

Query  287  SLSSMAQSNLECSTCRKKYSGNETHVDLTIAGGGKAYGEALAASTELFRLPLVSFLYERG  466
            +L ++ +S  +C  C K YS  + ++DLT+  G K Y E   ASTELFR P VSFLYERG
Sbjct  79   TLGAIYRSGFKCRKCDKTYSSKDNYLDLTVISGLKDYTEVKPASTELFRSPFVSFLYERG  138

Query  467  WRQSFSLWGGFPGPEKEFELMQDYLKPVMGGNIIDAS  577
            WRQ+F+   GFPGP++E     +Y K   GG ++D S
Sbjct  139  WRQNFN-RSGFPGPDEE-----EYFKSAQGGLLVDVS  169



>ref|XP_010928270.1| PREDICTED: uncharacterized methyltransferase At2g41040, chloroplastic 
isoform X4 [Elaeis guineensis]
Length=314

 Score =   122 bits (305),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 60/133 (45%), Positives = 83/133 (62%), Gaps = 7/133 (5%)
 Frame = +2

Query  194  LIDEKKVEIR-----TNLLACPICYDAFTWNGNPGLSLSSMAQSNLECSTCRKKYSGNET  358
            L+D +  +++      NLLACPICY+     G  GL+L ++ +S  +C  C K +S  + 
Sbjct  19   LLDIQDTQVKQDFLEVNLLACPICYEPLMRKGPSGLNLPAIYRSGFKCLKCNKSFSSKDV  78

Query  359  HVDLTIAGGGKAYGEALAASTELFRLPLVSFLYERGWRQSFSLWGGFPGPEKEFELMQDY  538
            ++DLTI  G K Y E     TELF  P VSFLYERGWRQ+F+   GFPGP++EF + Q+Y
Sbjct  79   YLDLTITSGTKEYNELKPTRTELFS-PFVSFLYERGWRQNFN-RSGFPGPDEEFNMAQEY  136

Query  539  LKPVMGGNIIDAS  577
             K V GG ++D S
Sbjct  137  FKTVAGGLLVDVS  149



>ref|XP_010928268.1| PREDICTED: uncharacterized methyltransferase At2g41040, chloroplastic 
isoform X2 [Elaeis guineensis]
Length=354

 Score =   122 bits (307),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 65/149 (44%), Positives = 88/149 (59%), Gaps = 7/149 (5%)
 Frame = +2

Query  131  RLFAVKIRALSTTFVEDKPVRLIDEKKVEIRTNLLACPICYDAFTWNGNPGLSLSSMAQS  310
            R F ++  A + T   D  V     K+  +  NLLACPICY+     G  GL+L ++ +S
Sbjct  48   RGFPLRATAAALTVEPDTQV-----KQDFLEVNLLACPICYEPLMRKGPSGLNLPAIYRS  102

Query  311  NLECSTCRKKYSGNETHVDLTIAGGGKAYGEALAASTELFRLPLVSFLYERGWRQSFSLW  490
              +C  C K +S  + ++DLTI  G K Y E     TELF  P VSFLYERGWRQ+F+  
Sbjct  103  GFKCLKCNKSFSSKDVYLDLTITSGTKEYNELKPTRTELFS-PFVSFLYERGWRQNFN-R  160

Query  491  GGFPGPEKEFELMQDYLKPVMGGNIIDAS  577
             GFPGP++EF + Q+Y K V GG ++D S
Sbjct  161  SGFPGPDEEFNMAQEYFKTVAGGLLVDVS  189



>ref|XP_006657188.1| PREDICTED: uncharacterized methyltransferase At2g41040, chloroplastic-like 
[Oryza brachyantha]
Length=353

 Score =   122 bits (307),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 55/118 (47%), Positives = 78/118 (66%), Gaps = 1/118 (1%)
 Frame = +2

Query  224  TNLLACPICYDAFTWNGNPGLSLSSMAQSNLECSTCRKKYSGNETHVDLTIAGGGKAYGE  403
            T + ACP+CY+     G  G++L ++ +S  +CS C K ++  +  +DLT+  G K Y E
Sbjct  71   TEVFACPVCYEPLIRKGPSGINLPAIYRSGFKCSKCNKSFTSKDIFLDLTVTSGTKEYSE  130

Query  404  ALAASTELFRLPLVSFLYERGWRQSFSLWGGFPGPEKEFELMQDYLKPVMGGNIIDAS  577
               A TELFR PLVSFLYERGWRQ+F+   GFPG ++EF++ QDY + V GG ++D S
Sbjct  131  LKPARTELFRSPLVSFLYERGWRQNFN-RSGFPGLDEEFQMAQDYFQSVTGGVLLDVS  187



>ref|XP_010040339.1| PREDICTED: uncharacterized methyltransferase At2g41040, chloroplastic-like 
[Eucalyptus grandis]
Length=269

 Score =   121 bits (303),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 67/171 (39%), Positives = 95/171 (56%), Gaps = 15/171 (9%)
 Frame = +2

Query  98   FSFSPLTPKANRL-----FA------VKIRALSTTFVEDKPVRLIDEKKVEIRTNLLACP  244
            F+  PL P+  RL     F+        +RA S   VE   +    +K   +   + +CP
Sbjct  11   FARHPLLPRTCRLQPRPRFSSVRFPPFSVRASSAVAVE---LDTGTQKDPTLDGEIFSCP  67

Query  245  ICYDAFTWNGNPGLSLSSMAQSNLECSTCRKKYSGNETHVDLTIAGGGKAYGEALAASTE  424
            ICY+     G  GL+L ++ +S  +C  C K YS     +DLT+  G + Y E   A TE
Sbjct  68   ICYEPLIRRGPSGLNLEAVYRSGFKCKKCNKSYSSKNNFLDLTLTAGLRDYVEVKPARTE  127

Query  425  LFRLPLVSFLYERGWRQSFSLWGGFPGPEKEFELMQDYLKPVMGGNIIDAS  577
            LFR P+VSFLYERGWRQ+F+   GFPG ++EF++ Q+Y KP  GG ++D S
Sbjct  128  LFRSPVVSFLYERGWRQNFN-QSGFPGQDEEFKMAQEYFKPAEGGLLVDVS  177



>ref|XP_009595293.1| PREDICTED: uncharacterized methyltransferase At2g41040, chloroplastic-like 
isoform X2 [Nicotiana tomentosiformis]
Length=169

 Score =   118 bits (296),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 61/135 (45%), Positives = 83/135 (61%), Gaps = 4/135 (3%)
 Frame = +2

Query  125  ANRLFAVKIRALSTTFVEDKPVRLIDEKKVEIRTNLLACPICYDAFTWNGNPGLSLSSMA  304
            ++R F  +IRA S   VE + +R   +   E    L +CPICY+     G PG +L ++ 
Sbjct  39   SSRGFNSRIRASSAVAVEPE-LRTPAQDATE--AELFSCPICYEPLMRKGPPGFNLPAIY  95

Query  305  QSNLECSTCRKKYSGNETHVDLTIAGGGKAYGEALAASTELFRLPLVSFLYERGWRQSFS  484
            +S  +C  C K YS    ++DLTI  G K Y E+  A TELFR P+VSFLYERGWRQ+F+
Sbjct  96   RSGFKCRKCNKSYSSKNIYLDLTITSGTKEYSESKPARTELFRSPVVSFLYERGWRQNFN  155

Query  485  LWGGFPGPEKEFELM  529
            L  GFPGP++E +L 
Sbjct  156  L-SGFPGPDEEVKLF  169



>ref|XP_009595292.1| PREDICTED: uncharacterized methyltransferase At2g41040, chloroplastic-like 
isoform X1 [Nicotiana tomentosiformis]
Length=173

 Score =   118 bits (295),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 62/138 (45%), Positives = 83/138 (60%), Gaps = 6/138 (4%)
 Frame = +2

Query  125  ANRLFAVKIRALSTTFVED---KPVRLIDEKKVEIRTNLLACPICYDAFTWNGNPGLSLS  295
            ++R F  +IRA S   VE    K +R   +   E    L +CPICY+     G PG +L 
Sbjct  39   SSRGFNSRIRASSAVAVEPVIAKELRTPAQDATE--AELFSCPICYEPLMRKGPPGFNLP  96

Query  296  SMAQSNLECSTCRKKYSGNETHVDLTIAGGGKAYGEALAASTELFRLPLVSFLYERGWRQ  475
            ++ +S  +C  C K YS    ++DLTI  G K Y E+  A TELFR P+VSFLYERGWRQ
Sbjct  97   AIYRSGFKCRKCNKSYSSKNIYLDLTITSGTKEYSESKPARTELFRSPVVSFLYERGWRQ  156

Query  476  SFSLWGGFPGPEKEFELM  529
            +F+L  GFPGP++E +L 
Sbjct  157  NFNL-SGFPGPDEEVKLF  173



>ref|NP_001058196.1| Os06g0646000 [Oryza sativa Japonica Group]
 dbj|BAD37452.1| methyltransferase-like [Oryza sativa Japonica Group]
 dbj|BAD37605.1| methyltransferase-like [Oryza sativa Japonica Group]
 dbj|BAF20110.1| Os06g0646000 [Oryza sativa Japonica Group]
 dbj|BAG91023.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEC81074.1| hypothetical protein OsI_23892 [Oryza sativa Indica Group]
Length=345

 Score =   122 bits (305),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 59/129 (46%), Positives = 81/129 (63%), Gaps = 5/129 (4%)
 Frame = +2

Query  203  EKKVEIRTN----LLACPICYDAFTWNGNPGLSLSSMAQSNLECSTCRKKYSGNETHVDL  370
            E KV    N    + ACP+CY+     G  G++L S+ +S  +CS C K ++  +  +DL
Sbjct  53   ENKVPQSNNSEAEVFACPVCYEPLIRKGPSGINLPSIYRSGFKCSKCNKSFTSKDIFLDL  112

Query  371  TIAGGGKAYGEALAASTELFRLPLVSFLYERGWRQSFSLWGGFPGPEKEFELMQDYLKPV  550
            T+  G K Y E   A TELFR PLVSFLYERGWRQ+F+   GFPG ++EF++ QDY + V
Sbjct  113  TVTSGTKEYSELKPARTELFRSPLVSFLYERGWRQNFN-RSGFPGLDEEFQMAQDYFQSV  171

Query  551  MGGNIIDAS  577
             GG ++D S
Sbjct  172  AGGVLLDVS  180



>gb|KCW79027.1| hypothetical protein EUGRSUZ_C00449 [Eucalyptus grandis]
Length=304

 Score =   121 bits (303),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 66/171 (39%), Positives = 94/171 (55%), Gaps = 15/171 (9%)
 Frame = +2

Query  98   FSFSPLTPKANRLF-----------AVKIRALSTTFVEDKPVRLIDEKKVEIRTNLLACP  244
            F+  PL P+  RL            +  +RA S   VE   +    +K   +   + +CP
Sbjct  11   FARHPLLPRTCRLQPRPRFSSVRFPSFSVRASSAVAVE---LDTGTQKDPTLDGEIFSCP  67

Query  245  ICYDAFTWNGNPGLSLSSMAQSNLECSTCRKKYSGNETHVDLTIAGGGKAYGEALAASTE  424
            ICY+     G  GL+L ++ +S  +C  C K YS     +DLT+  G + Y E   A TE
Sbjct  68   ICYEPLIRRGPSGLNLEAVYRSGFKCKKCNKSYSSKNNFLDLTLTAGLRDYVEVKPARTE  127

Query  425  LFRLPLVSFLYERGWRQSFSLWGGFPGPEKEFELMQDYLKPVMGGNIIDAS  577
            LFR P+VSFLYERGWRQ+F+   GFPG ++EF++ Q+Y KP  GG ++D S
Sbjct  128  LFRSPVVSFLYERGWRQNFN-QSGFPGQDEEFKMAQEYFKPAEGGLLVDVS  177



>gb|AFW76187.1| hypothetical protein ZEAMMB73_680706 [Zea mays]
Length=187

 Score =   118 bits (295),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 51/114 (45%), Positives = 76/114 (67%), Gaps = 1/114 (1%)
 Frame = +2

Query  200  DEKKVEIRTNLLACPICYDAFTWNGNPGLSLSSMAQSNLECSTCRKKYSGNETHVDLTIA  379
            +++ + + T + ACP+CY+     G PG++L ++ +S  +CS C K ++  +  +DLT+ 
Sbjct  66   EQQNIIMETEVFACPVCYEPLMRKGPPGINLPAIYRSGFKCSKCNKSFTSKDIFLDLTVT  125

Query  380  GGGKAYGEALAASTELFRLPLVSFLYERGWRQSFSLWGGFPGPEKEFELMQDYL  541
             G K Y E   A TELFR PLVSFLYERGWRQ+F+   GFPG ++EF++ QDY 
Sbjct  126  AGTKEYSEQKPARTELFRSPLVSFLYERGWRQNFNR-SGFPGLDEEFQMAQDYF  178



>gb|KCW79026.1| hypothetical protein EUGRSUZ_C00449 [Eucalyptus grandis]
Length=305

 Score =   121 bits (303),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 66/171 (39%), Positives = 94/171 (55%), Gaps = 15/171 (9%)
 Frame = +2

Query  98   FSFSPLTPKANRLF-----------AVKIRALSTTFVEDKPVRLIDEKKVEIRTNLLACP  244
            F+  PL P+  RL            +  +RA S   VE   +    +K   +   + +CP
Sbjct  11   FARHPLLPRTCRLQPRPRFSSVRFPSFSVRASSAVAVE---LDTGTQKDPTLDGEIFSCP  67

Query  245  ICYDAFTWNGNPGLSLSSMAQSNLECSTCRKKYSGNETHVDLTIAGGGKAYGEALAASTE  424
            ICY+     G  GL+L ++ +S  +C  C K YS     +DLT+  G + Y E   A TE
Sbjct  68   ICYEPLIRRGPSGLNLEAVYRSGFKCKKCNKSYSSKNNFLDLTLTAGLRDYVEVKPARTE  127

Query  425  LFRLPLVSFLYERGWRQSFSLWGGFPGPEKEFELMQDYLKPVMGGNIIDAS  577
            LFR P+VSFLYERGWRQ+F+   GFPG ++EF++ Q+Y KP  GG ++D S
Sbjct  128  LFRSPVVSFLYERGWRQNFN-QSGFPGQDEEFKMAQEYFKPAEGGLLVDVS  177



>ref|XP_010047200.1| PREDICTED: uncharacterized methyltransferase At2g41040, chloroplastic-like 
[Eucalyptus grandis]
 gb|KCW79025.1| hypothetical protein EUGRSUZ_C00449 [Eucalyptus grandis]
Length=336

 Score =   121 bits (304),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 66/171 (39%), Positives = 94/171 (55%), Gaps = 15/171 (9%)
 Frame = +2

Query  98   FSFSPLTPKANRLF-----------AVKIRALSTTFVEDKPVRLIDEKKVEIRTNLLACP  244
            F+  PL P+  RL            +  +RA S   VE   +    +K   +   + +CP
Sbjct  11   FARHPLLPRTCRLQPRPRFSSVRFPSFSVRASSAVAVE---LDTGTQKDPTLDGEIFSCP  67

Query  245  ICYDAFTWNGNPGLSLSSMAQSNLECSTCRKKYSGNETHVDLTIAGGGKAYGEALAASTE  424
            ICY+     G  GL+L ++ +S  +C  C K YS     +DLT+  G + Y E   A TE
Sbjct  68   ICYEPLIRRGPSGLNLEAVYRSGFKCKKCNKSYSSKNNFLDLTLTAGLRDYVEVKPARTE  127

Query  425  LFRLPLVSFLYERGWRQSFSLWGGFPGPEKEFELMQDYLKPVMGGNIIDAS  577
            LFR P+VSFLYERGWRQ+F+   GFPG ++EF++ Q+Y KP  GG ++D S
Sbjct  128  LFRSPVVSFLYERGWRQNFN-QSGFPGQDEEFKMAQEYFKPAEGGLLVDVS  177



>gb|AAD12007.1| hypothetical protein [Arabidopsis thaliana]
Length=262

 Score =   119 bits (299),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 54/123 (44%), Positives = 78/123 (63%), Gaps = 2/123 (2%)
 Frame = +2

Query  209  KVEIR-TNLLACPICYDAFTWNGNPGLSLSSMAQSNLECSTCRKKYSGNETHVDLTIAGG  385
            K+EI  T + ACP+CY+     G  G++L ++ +S  +C  C K YS  + ++DLT+   
Sbjct  68   KIEIEETQVFACPVCYEPLMRKGPSGINLQAIYRSGFKCGQCNKTYSSKDEYLDLTVTAD  127

Query  386  GKAYGEALAASTELFRLPLVSFLYERGWRQSFSLWGGFPGPEKEFELMQDYLKPVMGGNI  565
               Y E    +TELFR PLVSFLYERGWRQ+F    GFPGP++EF + ++Y K   GG +
Sbjct  128  LDDYNEVKPITTELFRSPLVSFLYERGWRQAFK-RSGFPGPDEEFRMAEEYFKEAEGGLL  186

Query  566  IDA  574
            +D+
Sbjct  187  VDS  189



>ref|XP_006411367.1| hypothetical protein EUTSA_v10016844mg [Eutrema salsugineum]
 gb|ESQ52820.1| hypothetical protein EUTSA_v10016844mg [Eutrema salsugineum]
Length=363

 Score =   121 bits (304),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 63/155 (41%), Positives = 91/155 (59%), Gaps = 8/155 (5%)
 Frame = +2

Query  131  RLFAVKIRALSTTFVEDKPVRLIDEKK-----VEIR-TNLLACPICYDAFTWNGNPGLSL  292
            R  ++ IRA++    E    R  D+K+     +EI  T + ACP+CY+     G  G++L
Sbjct  51   RFPSLAIRAVALE-SESNETRSSDQKENQTQSIEIEETQVFACPVCYEPLMRKGPSGINL  109

Query  293  SSMAQSNLECSTCRKKYSGNETHVDLTIAGGGKAYGEALAASTELFRLPLVSFLYERGWR  472
             ++ +S  +C  C K YS  + ++DLT+      Y E    +TELFR PLVSFLYERGWR
Sbjct  110  KAIYRSGFKCGQCNKTYSSKDEYLDLTVTADLDDYNEVKPITTELFRSPLVSFLYERGWR  169

Query  473  QSFSLWGGFPGPEKEFELMQDYLKPVMGGNIIDAS  577
            Q+FS   GFPGP++EF + + Y K   GG ++D S
Sbjct  170  QNFSR-SGFPGPDEEFRMAERYFKEAEGGVLVDVS  203



>ref|XP_002306578.1| methyltransferase-related family protein [Populus trichocarpa]
 gb|EEE93574.1| methyltransferase-related family protein [Populus trichocarpa]
Length=244

 Score =   119 bits (298),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 54/77 (70%), Positives = 66/77 (86%), Gaps = 2/77 (3%)
 Frame = +2

Query  350  NETHVDLTIAGGGKAYGE-ALAASTELFRLPLVSFLYERGWRQSFSLWGGFPGPEKEFEL  526
             ETH++LT+A G K YG+ A+  +TE FR P +SFLYERGWRQ+F +WGGFPGPEKEFEL
Sbjct  5    KETHLELTVASGSKGYGDIAMPLATEFFRTPFMSFLYERGWRQNF-VWGGFPGPEKEFEL  63

Query  527  MQDYLKPVMGGNIIDAS  577
            M+DYLKPV+GGNI+DAS
Sbjct  64   MKDYLKPVLGGNILDAS  80



>ref|XP_004167998.1| PREDICTED: LOW QUALITY PROTEIN: uncharacterized methyltransferase 
At2g41040, chloroplastic-like [Cucumis sativus]
Length=338

 Score =   120 bits (302),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 62/157 (39%), Positives = 90/157 (57%), Gaps = 4/157 (3%)
 Frame = +2

Query  107  SPLTPKANRLFAVKIRALSTTFVEDKPVRLIDEKKVEIRTNLLACPICYDAFTWNGNPGL  286
            SPL     R     IRA S   +E       D+    ++ ++ +CP+C++     G PG 
Sbjct  27   SPLRLSTPRSILSTIRASSALVLESDSGIQQDQN---LKIDVFSCPVCFEPLLRKGPPGF  83

Query  287  SLSSMAQSNLECSTCRKKYSGNETHVDLTIAGGGKAYGEALAASTELFRLPLVSFLYERG  466
            +LS++ +S  +C  C K Y+     +DLT+  G K Y E     TELFR PLVS+LYERG
Sbjct  84   NLSAIYRSGFKCRRCNKSYTSKNIFLDLTVTSGMKEYVEVKPGGTELFRSPLVSYLYERG  143

Query  467  WRQSFSLWGGFPGPEKEFELMQDYLKPVMGGNIIDAS  577
            WRQ+F+   GFPG ++EF++  +Y K V GG ++DAS
Sbjct  144  WRQNFN-QSGFPGLDEEFKMAMEYFKSVEGGLLVDAS  179



>ref|XP_006293382.1| hypothetical protein CARUB_v10023510mg [Capsella rubella]
 gb|EOA26280.1| hypothetical protein CARUB_v10023510mg [Capsella rubella]
Length=356

 Score =   120 bits (302),  Expect = 5e-29, Method: Compositional matrix adjust.
 Identities = 55/124 (44%), Positives = 78/124 (63%), Gaps = 2/124 (2%)
 Frame = +2

Query  209  KVEIR-TNLLACPICYDAFTWNGNPGLSLSSMAQSNLECSTCRKKYSGNETHVDLTIAGG  385
            K+EI  T + ACP+CY+     G  G++L ++ +S  +C  C K YS  + ++DLT+   
Sbjct  74   KIEIEETQVFACPVCYEPLMRKGPSGINLQAIYRSGFKCGQCNKTYSSKDEYLDLTVTAD  133

Query  386  GKAYGEALAASTELFRLPLVSFLYERGWRQSFSLWGGFPGPEKEFELMQDYLKPVMGGNI  565
               Y E    +TELFR PLVSFLYERGWRQ+F    GFPGP++EF + ++Y K   GG +
Sbjct  134  LDDYNEVKPITTELFRSPLVSFLYERGWRQNFQR-SGFPGPDEEFRMAEEYFKEAEGGVL  192

Query  566  IDAS  577
            +D S
Sbjct  193  VDVS  196



>ref|XP_008456627.1| PREDICTED: uncharacterized methyltransferase At2g41040, chloroplastic 
isoform X1 [Cucumis melo]
Length=339

 Score =   120 bits (301),  Expect = 5e-29, Method: Compositional matrix adjust.
 Identities = 64/166 (39%), Positives = 93/166 (56%), Gaps = 5/166 (3%)
 Frame = +2

Query  80   LGYNSKFSFSPLTPKANRLFAVKIRALSTTFVEDKPVRLIDEKKVEIRTNLLACPICYDA  259
            L  N +F + PL     R F   IRA S   +E       D+     + ++ +CP+C++ 
Sbjct  19   LSRNIQFRY-PLRLSTPRSFLSTIRASSALVLESDSGTQQDQNS---KIDVFSCPVCFEP  74

Query  260  FTWNGNPGLSLSSMAQSNLECSTCRKKYSGNETHVDLTIAGGGKAYGEALAASTELFRLP  439
                G PG +L ++ +S  +C  C K Y+     +DLT+  G K Y E     TELFR P
Sbjct  75   LLRKGPPGFNLPAIYRSGFKCRRCNKSYTSKNIFLDLTVTSGMKEYVEVKPGGTELFRSP  134

Query  440  LVSFLYERGWRQSFSLWGGFPGPEKEFELMQDYLKPVMGGNIIDAS  577
            LVS+LYERGWRQ+F+   GFPG ++EF++  +Y K V GG ++DAS
Sbjct  135  LVSYLYERGWRQNFN-QSGFPGLDEEFKMAMEYFKSVEGGLLVDAS  179



>ref|XP_006586686.1| PREDICTED: uncharacterized protein LOC100798970 isoform X1 [Glycine 
max]
Length=336

 Score =   120 bits (301),  Expect = 5e-29, Method: Compositional matrix adjust.
 Identities = 61/143 (43%), Positives = 85/143 (59%), Gaps = 9/143 (6%)
 Frame = +2

Query  149  IRALSTTFVEDKPVRLIDEKKVEIRTNLLACPICYDAFTWNGNPGLSLSSMAQSNLECST  328
            IRA+S    E +   L  ++   I  ++ ACP+CY+     G  GL+LS        C  
Sbjct  44   IRAISAVAAESE---LGTQQDHAIEADIFACPVCYEPLIRKGPSGLNLSGFM-----CKR  95

Query  329  CRKKYSGNETHVDLTIAGGGKAYGEALAASTELFRLPLVSFLYERGWRQSFSLWGGFPGP  508
            C+K YS  + ++DLT+  G + Y E   A TELFR PLVSFLYERGWRQ+F    GFPGP
Sbjct  96   CKKTYSSKDRYLDLTVTAGLRDYTEIQPARTELFRSPLVSFLYERGWRQNFR-QSGFPGP  154

Query  509  EKEFELMQDYLKPVMGGNIIDAS  577
            ++EF++ Q+Y +   GG ++D S
Sbjct  155  DEEFKMAQEYFESAEGGLLVDVS  177



>ref|XP_008456635.1| PREDICTED: uncharacterized methyltransferase At2g41040, chloroplastic 
isoform X2 [Cucumis melo]
Length=338

 Score =   120 bits (301),  Expect = 5e-29, Method: Compositional matrix adjust.
 Identities = 64/166 (39%), Positives = 93/166 (56%), Gaps = 5/166 (3%)
 Frame = +2

Query  80   LGYNSKFSFSPLTPKANRLFAVKIRALSTTFVEDKPVRLIDEKKVEIRTNLLACPICYDA  259
            L  N +F + PL     R F   IRA S   +E       D+     + ++ +CP+C++ 
Sbjct  19   LSRNIQFRY-PLRLSTPRSFLSTIRASSALVLESDSGTQQDQNS---KIDVFSCPVCFEP  74

Query  260  FTWNGNPGLSLSSMAQSNLECSTCRKKYSGNETHVDLTIAGGGKAYGEALAASTELFRLP  439
                G PG +L ++ +S  +C  C K Y+     +DLT+  G K Y E     TELFR P
Sbjct  75   LLRKGPPGFNLPAIYRSGFKCRRCNKSYTSKNIFLDLTVTSGMKEYVEVKPGGTELFRSP  134

Query  440  LVSFLYERGWRQSFSLWGGFPGPEKEFELMQDYLKPVMGGNIIDAS  577
            LVS+LYERGWRQ+F+   GFPG ++EF++  +Y K V GG ++DAS
Sbjct  135  LVSYLYERGWRQNFN-QSGFPGLDEEFKMAMEYFKSVEGGLLVDAS  179



>ref|XP_010505866.1| PREDICTED: uncharacterized methyltransferase At2g41040, chloroplastic-like 
[Camelina sativa]
Length=355

 Score =   120 bits (302),  Expect = 6e-29, Method: Compositional matrix adjust.
 Identities = 55/124 (44%), Positives = 79/124 (64%), Gaps = 2/124 (2%)
 Frame = +2

Query  209  KVEIR-TNLLACPICYDAFTWNGNPGLSLSSMAQSNLECSTCRKKYSGNETHVDLTIAGG  385
            K+EI  T + ACP+CY+     G  G++L ++ +S  +C  C K YS  + ++DLT+   
Sbjct  73   KIEIEETQVFACPVCYEPLMRKGPSGINLQAIYRSGFKCGQCNKTYSSKDEYLDLTVTAD  132

Query  386  GKAYGEALAASTELFRLPLVSFLYERGWRQSFSLWGGFPGPEKEFELMQDYLKPVMGGNI  565
             + Y E    +TELFR PLVSFLYERGWRQ+F    GFPGP++EF + ++Y K   GG +
Sbjct  133  LEDYDEVKPITTELFRSPLVSFLYERGWRQNFKR-SGFPGPDEEFRMAEEYFKEAEGGVL  191

Query  566  IDAS  577
            +D S
Sbjct  192  VDVS  195



>ref|NP_181637.2| uncharacterized methyltransferase [Arabidopsis thaliana]
 sp|Q0WPT7.1|Y2104_ARATH RecName: Full=Uncharacterized methyltransferase At2g41040, chloroplastic; 
Flags: Precursor [Arabidopsis thaliana]
 dbj|BAF00862.1| hypothetical protein [Arabidopsis thaliana]
 gb|AEC09918.1| uncharacterized methyltransferase [Arabidopsis thaliana]
Length=352

 Score =   120 bits (302),  Expect = 6e-29, Method: Compositional matrix adjust.
 Identities = 55/124 (44%), Positives = 78/124 (63%), Gaps = 2/124 (2%)
 Frame = +2

Query  209  KVEIR-TNLLACPICYDAFTWNGNPGLSLSSMAQSNLECSTCRKKYSGNETHVDLTIAGG  385
            K+EI  T + ACP+CY+     G  G++L ++ +S  +C  C K YS  + ++DLT+   
Sbjct  70   KIEIEETQVFACPVCYEPLMRKGPSGINLQAIYRSGFKCGQCNKTYSSKDEYLDLTVTAD  129

Query  386  GKAYGEALAASTELFRLPLVSFLYERGWRQSFSLWGGFPGPEKEFELMQDYLKPVMGGNI  565
               Y E    +TELFR PLVSFLYERGWRQ+F    GFPGP++EF + ++Y K   GG +
Sbjct  130  LDDYNEVKPITTELFRSPLVSFLYERGWRQAFKR-SGFPGPDEEFRMAEEYFKEAEGGLL  188

Query  566  IDAS  577
            +D S
Sbjct  189  VDVS  192



>ref|XP_010508773.1| PREDICTED: uncharacterized methyltransferase At2g41040, chloroplastic-like 
[Camelina sativa]
Length=356

 Score =   120 bits (302),  Expect = 6e-29, Method: Compositional matrix adjust.
 Identities = 55/124 (44%), Positives = 79/124 (64%), Gaps = 2/124 (2%)
 Frame = +2

Query  209  KVEIR-TNLLACPICYDAFTWNGNPGLSLSSMAQSNLECSTCRKKYSGNETHVDLTIAGG  385
            K+EI  T + ACP+CY+     G  G++L ++ +S  +C  C K YS  + ++DLT+   
Sbjct  74   KIEIEETQVFACPVCYEPLMRKGPSGINLQAIYRSGFKCGRCNKTYSSKDEYLDLTVTAD  133

Query  386  GKAYGEALAASTELFRLPLVSFLYERGWRQSFSLWGGFPGPEKEFELMQDYLKPVMGGNI  565
             + Y E    +TELFR PLVSFLYERGWRQ+F    GFPGP++EF + ++Y K   GG +
Sbjct  134  LEDYDEVKPITTELFRSPLVSFLYERGWRQNFKR-SGFPGPDEEFRMAEEYFKEAEGGVL  192

Query  566  IDAS  577
            +D S
Sbjct  193  VDVS  196



>ref|XP_010517586.1| PREDICTED: uncharacterized methyltransferase At2g41040, chloroplastic 
[Camelina sativa]
Length=355

 Score =   119 bits (298),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 54/124 (44%), Positives = 78/124 (63%), Gaps = 2/124 (2%)
 Frame = +2

Query  209  KVEIR-TNLLACPICYDAFTWNGNPGLSLSSMAQSNLECSTCRKKYSGNETHVDLTIAGG  385
            ++EI  T + ACP+CY+     G  G++L ++ +S  +C  C K YS  + ++DLT+   
Sbjct  73   QIEIEETQVFACPVCYEPLMRKGPSGINLQAIYRSGFKCGQCNKTYSSKDEYLDLTVTAD  132

Query  386  GKAYGEALAASTELFRLPLVSFLYERGWRQSFSLWGGFPGPEKEFELMQDYLKPVMGGNI  565
               Y E    +TELFR PLVSFLYERGWRQ+F    GFPGP++EF + ++Y K   GG +
Sbjct  133  LDDYNEVKPITTELFRSPLVSFLYERGWRQNFKR-SGFPGPDEEFRMAEEYFKEAEGGVL  191

Query  566  IDAS  577
            +D S
Sbjct  192  VDVS  195



>ref|XP_004139262.1| PREDICTED: uncharacterized methyltransferase At2g41040, chloroplastic-like 
[Cucumis sativus]
Length=338

 Score =   119 bits (297),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 61/157 (39%), Positives = 89/157 (57%), Gaps = 4/157 (3%)
 Frame = +2

Query  107  SPLTPKANRLFAVKIRALSTTFVEDKPVRLIDEKKVEIRTNLLACPICYDAFTWNGNPGL  286
            SPL     R     IRA S   +E       D+    ++ ++ +CP+C++     G PG 
Sbjct  27   SPLRLSTPRSILSTIRASSALVLESDSGIQQDQN---LKIDVFSCPVCFEPLLRKGPPGF  83

Query  287  SLSSMAQSNLECSTCRKKYSGNETHVDLTIAGGGKAYGEALAASTELFRLPLVSFLYERG  466
            +L ++ +S  +C  C K Y+     +DLT+  G K Y E     TELFR PLVS+LYERG
Sbjct  84   NLPAIYRSGFKCRRCNKSYTSKNIFLDLTVTSGMKEYVEVKPGGTELFRSPLVSYLYERG  143

Query  467  WRQSFSLWGGFPGPEKEFELMQDYLKPVMGGNIIDAS  577
            WRQ+F+   GFPG ++EF++  +Y K V GG ++DAS
Sbjct  144  WRQNFN-QSGFPGLDEEFKMAMEYFKSVEGGLLVDAS  179



>gb|KGN60753.1| hypothetical protein Csa_2G009410 [Cucumis sativus]
Length=339

 Score =   119 bits (297),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 61/157 (39%), Positives = 89/157 (57%), Gaps = 4/157 (3%)
 Frame = +2

Query  107  SPLTPKANRLFAVKIRALSTTFVEDKPVRLIDEKKVEIRTNLLACPICYDAFTWNGNPGL  286
            SPL     R     IRA S   +E       D+    ++ ++ +CP+C++     G PG 
Sbjct  27   SPLRLSTPRSILSTIRASSALVLESDSGIQQDQN---LKIDVFSCPVCFEPLLRKGPPGF  83

Query  287  SLSSMAQSNLECSTCRKKYSGNETHVDLTIAGGGKAYGEALAASTELFRLPLVSFLYERG  466
            +L ++ +S  +C  C K Y+     +DLT+  G K Y E     TELFR PLVS+LYERG
Sbjct  84   NLPAIYRSGFKCRRCNKSYTSKNIFLDLTVTSGMKEYVEVKPGGTELFRSPLVSYLYERG  143

Query  467  WRQSFSLWGGFPGPEKEFELMQDYLKPVMGGNIIDAS  577
            WRQ+F+   GFPG ++EF++  +Y K V GG ++DAS
Sbjct  144  WRQNFN-QSGFPGLDEEFKMAMEYFKSVEGGLLVDAS  179



>emb|CDY06948.1| BnaA04g23670D [Brassica napus]
Length=800

 Score =   122 bits (306),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 58/147 (39%), Positives = 90/147 (61%), Gaps = 3/147 (2%)
 Frame = +2

Query  140  AVKIRALS-TTFVEDKPVRLIDEKKVEIRTNLLACPICYDAFTWNGNPGLSLSSMAQSNL  316
            +  IRA++    + + P   I E +  + T + ACP+CY+     G  G++L ++ +S  
Sbjct  496  SASIRAVALEPELNETPSSDIKETET-VETQVFACPVCYEPLMRKGPSGINLQAIYRSGF  554

Query  317  ECSTCRKKYSGNETHVDLTIAGGGKAYGEALAASTELFRLPLVSFLYERGWRQSFSLWGG  496
            +C  C K YS  + ++DLT+  G  ++ E    +TELFR PLVSFLYERGWRQ+F+   G
Sbjct  555  KCGQCNKTYSSKDEYLDLTVTAGFDSFNEVKPITTELFRSPLVSFLYERGWRQNFAR-SG  613

Query  497  FPGPEKEFELMQDYLKPVMGGNIIDAS  577
            FPGP++EF + ++Y K   GG ++D S
Sbjct  614  FPGPDEEFRMAEEYFKEAEGGVLVDVS  640



>gb|KFK36957.1| hypothetical protein AALP_AA4G194500 [Arabis alpina]
Length=343

 Score =   118 bits (295),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 59/151 (39%), Positives = 89/151 (59%), Gaps = 8/151 (5%)
 Frame = +2

Query  128  NRLFAVKIRALS-TTFVEDKPVRLIDEKKVEIRTNLLACPICYDAFTWNGNPGLSLSSMA  304
            +R  +  IRA++  + V + P  +I+E      T + ACP+CY+     G  G++L S+ 
Sbjct  40   SRFTSASIRAVALQSDVNESPSTVIEE------TQVFACPVCYEPLLRKGPSGINLQSIY  93

Query  305  QSNLECSTCRKKYSGNETHVDLTIAGGGKAYGEALAASTELFRLPLVSFLYERGWRQSFS  484
            +S  +C  C K YS  + ++DLT+      + E    +TELFR PLVSFLYERGWR +F 
Sbjct  94   RSGFKCGQCNKTYSSKDEYLDLTVTADLANFNEVKPITTELFRSPLVSFLYERGWRDNFK  153

Query  485  LWGGFPGPEKEFELMQDYLKPVMGGNIIDAS  577
               GFPG E+EF++ ++Y K   GG ++D S
Sbjct  154  -RSGFPGAEEEFKMAEEYFKEAEGGILVDVS  183



>ref|XP_002879904.1| hypothetical protein ARALYDRAFT_903411 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH56163.1| hypothetical protein ARALYDRAFT_903411 [Arabidopsis lyrata subsp. 
lyrata]
Length=350

 Score =   115 bits (289),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 53/124 (43%), Positives = 76/124 (61%), Gaps = 2/124 (2%)
 Frame = +2

Query  209  KVEIR-TNLLACPICYDAFTWNGNPGLSLSSMAQSNLECSTCRKKYSGNETHVDLTIAGG  385
            K++I    + ACP+CY      G  G++L ++ +S  +C  C K YS  + ++DLT+   
Sbjct  68   KIKIEEAQVFACPVCYQPLMRKGPSGINLQAIYRSGFKCGQCNKTYSSKDEYLDLTVTAD  127

Query  386  GKAYGEALAASTELFRLPLVSFLYERGWRQSFSLWGGFPGPEKEFELMQDYLKPVMGGNI  565
               Y E    +TELFR PLVSFLYERGWRQ+F    GFPGP++EF + ++Y K   GG +
Sbjct  128  LDDYNEVKPITTELFRSPLVSFLYERGWRQAFKR-SGFPGPDEEFRMAEEYFKESEGGIL  186

Query  566  IDAS  577
            +D S
Sbjct  187  VDVS  190



>gb|EPS57983.1| hypothetical protein M569_16834, partial [Genlisea aurea]
Length=96

 Score =   109 bits (273),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 52/96 (54%), Positives = 65/96 (68%), Gaps = 1/96 (1%)
 Frame = +2

Query  230  LLACPICYDAFTWNGNPGLSLSSMAQSNLECSTCRKKYSGNETHVDLTIAGGGKAYGEAL  409
            L ACPIC+      G PG +L ++ +S  +CS+C K YS    ++DLTI  G K Y E +
Sbjct  2    LFACPICHLPLIRKGPPGFNLEAIYRSAFKCSSCNKSYSSKNIYLDLTITAGTKEYNEFV  61

Query  410  AASTELFRLPLVSFLYERGWRQSFSLWGGFPGPEKE  517
             A TELFR PLVSFLYERGWRQ+F+   GFPGPE+E
Sbjct  62   PARTELFRSPLVSFLYERGWRQNFNR-SGFPGPEEE  96



>gb|KDO80932.1| hypothetical protein CISIN_1g018003mg [Citrus sinensis]
Length=235

 Score =   111 bits (278),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 49/70 (70%), Positives = 60/70 (86%), Gaps = 1/70 (1%)
 Frame = +2

Query  368  LTIAGGGKAYGEALAASTELFRLPLVSFLYERGWRQSFSLWGGFPGPEKEFELMQDYLKP  547
            +T A G K YGE ++ +TE FR+P +SF+YERGWRQ+F +WGGFPGPEKEFELM+ YLKP
Sbjct  1    MTAASGSKDYGELMSPATEFFRMPFMSFIYERGWRQNF-VWGGFPGPEKEFELMKGYLKP  59

Query  548  VMGGNIIDAS  577
            V+GGNIIDAS
Sbjct  60   VLGGNIIDAS  69



>ref|XP_006434004.1| hypothetical protein CICLE_v10001682mg [Citrus clementina]
 gb|ESR47244.1| hypothetical protein CICLE_v10001682mg [Citrus clementina]
Length=233

 Score =   111 bits (277),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 49/70 (70%), Positives = 60/70 (86%), Gaps = 1/70 (1%)
 Frame = +2

Query  368  LTIAGGGKAYGEALAASTELFRLPLVSFLYERGWRQSFSLWGGFPGPEKEFELMQDYLKP  547
            +T A G K YGE ++ +TE FR+P +SF+YERGWRQ+F +WGGFPGPEKEFELM+ YLKP
Sbjct  1    MTAASGSKDYGELMSPATEFFRMPFMSFIYERGWRQNF-VWGGFPGPEKEFELMKGYLKP  59

Query  548  VMGGNIIDAS  577
            V+GGNIIDAS
Sbjct  60   VLGGNIIDAS  69



>ref|XP_006826926.1| hypothetical protein AMTR_s00010p00172800, partial [Amborella 
trichopoda]
 gb|ERM94163.1| hypothetical protein AMTR_s00010p00172800, partial [Amborella 
trichopoda]
Length=215

 Score =   110 bits (274),  Expect = 5e-26, Method: Compositional matrix adjust.
 Identities = 53/122 (43%), Positives = 74/122 (61%), Gaps = 1/122 (1%)
 Frame = +2

Query  212  VEIRTNLLACPICYDAFTWNGNPGLSLSSMAQSNLECSTCRKKYSGNETHVDLTIAGGGK  391
            V  R + LACPICY     N      + S    N  C  C+K YS  E ++DL++     
Sbjct  8    VVTRLDSLACPICYQPLIRNSGANPKILSPRGLNFRCQNCQKAYSNYEEYIDLSVTDDSN  67

Query  392  AYGEALAASTELFRLPLVSFLYERGWRQSFSLWGGFPGPEKEFELMQDYLKPVMGGNIID  571
             Y  A+ ++TE+FR PLVS+LYERG+ ++F+ W GF G +KEFE +  YL+P +GG I+D
Sbjct  68   EYVGAMPSATEVFRNPLVSYLYERGYGKNFT-WSGFSGLDKEFETVTKYLQPTLGGIIVD  126

Query  572  AS  577
            AS
Sbjct  127  AS  128



>gb|EMT00494.1| Putative methyltransferase [Aegilops tauschii]
Length=493

 Score =   113 bits (282),  Expect = 6e-26, Method: Compositional matrix adjust.
 Identities = 64/150 (43%), Positives = 87/150 (58%), Gaps = 18/150 (12%)
 Frame = +2

Query  128  NRLFAVKIRALSTTFVEDKPVRLIDEKKVEIRTNLLACPICYDAFTWNGNPGLSLSSMAQ  307
            +RLFA+      T F E K   L D  K E+     ACP+CY+     G PG++L ++ +
Sbjct  196  SRLFAI-----VTEFQEIK-TELNDASKTEV----FACPVCYEPLIRKGPPGMNLPAIYR  245

Query  308  SNLECSTCRKKYSGNETHVDLTIAGGGKAYGEALAASTELFRLPLVSFLYERGWRQSFSL  487
            S  +CS C K ++  +  +DLT+  G K Y E   A TELFR PLVSFLYERGWRQ+F+ 
Sbjct  246  SGFKCSKCNKSFTSKDVFLDLTVTSGIKEYSELKPARTELFRSPLVSFLYERGWRQNFNR  305

Query  488  WGGFPGPEKEFELMQDYLKPVMGGNIIDAS  577
              GFPG ++EF+        V GG ++D S
Sbjct  306  -SGFPGRDEEFQ-------SVAGGILVDVS  327



>gb|EMT14235.1| Putative methyltransferase [Aegilops tauschii]
Length=465

 Score =   111 bits (277),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 54/131 (41%), Positives = 77/131 (59%), Gaps = 16/131 (12%)
 Frame = +2

Query  185  PVRLIDEKKVEIRTNLLACPICYDAFTWNGNPGLSLSSMAQSNLECSTCRKKYSGNETHV  364
            P + I  +    +T + ACP+CY+     G PG++LS               ++  +  +
Sbjct  51   PFQEIKTEHDASKTEVFACPVCYEPLIRKGPPGMNLS---------------FTSKDVFL  95

Query  365  DLTIAGGGKAYGEALAASTELFRLPLVSFLYERGWRQSFSLWGGFPGPEKEFELMQDYLK  544
            DLT+  G K Y E   A TELFR PLV FLYERGWRQ+F+   GFPG ++EF++ QDY++
Sbjct  96   DLTVTSGMKEYSELKPARTELFRSPLVPFLYERGWRQNFN-RSGFPGRDEEFQMAQDYIQ  154

Query  545  PVMGGNIIDAS  577
            PV GG ++D S
Sbjct  155  PVAGGILVDVS  165



>ref|XP_008242913.1| PREDICTED: uncharacterized methyltransferase At2g41040, chloroplastic, 
partial [Prunus mume]
Length=263

 Score =   107 bits (267),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 51/103 (50%), Positives = 68/103 (66%), Gaps = 1/103 (1%)
 Frame = +2

Query  269  NGNPGLSLSSMAQSNLECSTCRKKYSGNETHVDLTIAGGGKAYGEALAASTELFRLPLVS  448
             G PGL+L ++ +S  +C  C K YS  + ++DLT+  G K Y E     TELFR PLVS
Sbjct  3    KGPPGLNLQAIYRSAFKCKKCDKSYSSKDIYLDLTVIAGLKEYVEVKPVGTELFRSPLVS  62

Query  449  FLYERGWRQSFSLWGGFPGPEKEFELMQDYLKPVMGGNIIDAS  577
            FLYERGWRQ+F+   GFPG ++EF++ QDY K   GG ++D S
Sbjct  63   FLYERGWRQNFNR-SGFPGIDEEFKMAQDYFKSAEGGVLLDVS  104



>ref|XP_008336947.1| PREDICTED: uncharacterized methyltransferase At2g41040, chloroplastic-like 
isoform X1 [Malus domestica]
 ref|XP_008336948.1| PREDICTED: uncharacterized methyltransferase At2g41040, chloroplastic-like 
isoform X1 [Malus domestica]
 ref|XP_008336949.1| PREDICTED: uncharacterized methyltransferase At2g41040, chloroplastic-like 
isoform X1 [Malus domestica]
Length=325

 Score =   106 bits (264),  Expect = 7e-24, Method: Compositional matrix adjust.
 Identities = 50/112 (45%), Positives = 70/112 (63%), Gaps = 7/112 (6%)
 Frame = +2

Query  227  NLLACPICYDAFTWNGNPGLSLSSMAQSNLECSTCRKKYSGN------ETHVDLTIAGGG  388
             LLACP+CY+     G PGL+L ++ +S  EC  C K Y+ +      + ++DLT++GG 
Sbjct  33   ELLACPVCYEPLIRKGPPGLNLQAIFRSAFECKICHKLYNSSSKSKEKDIYLDLTVSGGL  92

Query  389  KAYGEALAASTELFRLPLVSFLYERGWRQSFSLWGGFPGPEKEFELMQDYLK  544
            + Y     A T+ FR  LVSFLYERGWRQ F    GFPGP++EF++  DY +
Sbjct  93   REYIAPXPAGTDFFRYRLVSFLYERGWRQYFG-QSGFPGPDQEFKMAMDYFQ  143



>ref|XP_008336950.1| PREDICTED: uncharacterized methyltransferase At2g41040, chloroplastic-like 
isoform X2 [Malus domestica]
Length=324

 Score =   106 bits (264),  Expect = 7e-24, Method: Compositional matrix adjust.
 Identities = 50/112 (45%), Positives = 70/112 (63%), Gaps = 7/112 (6%)
 Frame = +2

Query  227  NLLACPICYDAFTWNGNPGLSLSSMAQSNLECSTCRKKYSGN------ETHVDLTIAGGG  388
             LLACP+CY+     G PGL+L ++ +S  EC  C K Y+ +      + ++DLT++GG 
Sbjct  33   ELLACPVCYEPLIRKGPPGLNLQAIFRSAFECKICHKLYNSSSKSKEKDIYLDLTVSGGL  92

Query  389  KAYGEALAASTELFRLPLVSFLYERGWRQSFSLWGGFPGPEKEFELMQDYLK  544
            + Y     A T+ FR  LVSFLYERGWRQ F    GFPGP++EF++  DY +
Sbjct  93   REYIAPXPAGTDFFRYRLVSFLYERGWRQYFG-QSGFPGPDQEFKMAMDYFQ  143



>dbj|BAC99645.1| hypothetical protein [Oryza sativa Japonica Group]
Length=323

 Score =   104 bits (260),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 55/136 (40%), Positives = 81/136 (60%), Gaps = 7/136 (5%)
 Frame = +2

Query  155  ALSTTFVEDKPVRLIDEKKVEI------RTNLLACPICYDAFTWNGNPGLSLSSMAQSNL  316
            +++  FV   P   ++E  VE       +   LACPICY     + +    +S+ + S+L
Sbjct  50   SVTPEFVTAAPDEAVEESSVEREPAAENKLRKLACPICYYPLISSSDQSAPVSAASSSSL  109

Query  317  ECSTCRKKYSGNETHVDLTIAGGGKAYGEALAASTELFRLPLVSFLYERGWRQSFSLWGG  496
            ECSTC+K Y     + D+T+A G   Y E+   +TE+FR PLVSFLYERGWRQ+F +W G
Sbjct  110  ECSTCKKFYPNRGDYWDMTVAVGSTEYSESTTVTTEVFRTPLVSFLYERGWRQNF-IWSG  168

Query  497  FPGPEKEFELMQDYLK  544
            FPG E+E +++  Y +
Sbjct  169  FPGLERERDMINIYAQ  184



>gb|ACF86599.1| unknown [Zea mays]
 tpg|DAA49106.1| TPA: hypothetical protein ZEAMMB73_519956 [Zea mays]
 tpg|DAA49107.1| TPA: hypothetical protein ZEAMMB73_519956 [Zea mays]
Length=186

 Score =   100 bits (250),  Expect = 8e-23, Method: Compositional matrix adjust.
 Identities = 50/105 (48%), Positives = 66/105 (63%), Gaps = 6/105 (6%)
 Frame = +2

Query  215  EIRTNLLACPICYDAFTWNGNPGLSLSSMAQSNLECSTCRKKYSGNETHVDLTIAGGGKA  394
            E +   LACPICY     + +     +S     LEC TC+K Y   + + DLT++ G   
Sbjct  71   ETKLRKLACPICYYPLASSSDQLDDATS-----LECPTCKKCYPNKQDYWDLTVSVGSTE  125

Query  395  YGEALAASTELFRLPLVSFLYERGWRQSFSLWGGFPGPEKEFELM  529
            Y E++  +TELFR PLVSFLYERGWRQ+F +WGGFPG E+E  L+
Sbjct  126  YSESMPVATELFRTPLVSFLYERGWRQNF-IWGGFPGLEREVMLL  169



>emb|CDP12319.1| unnamed protein product [Coffea canephora]
Length=134

 Score = 99.0 bits (245),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 48/102 (47%), Positives = 62/102 (61%), Gaps = 1/102 (1%)
 Frame = +2

Query  224  TNLLACPICYDAFTWNGNPGLSLSSMAQSNLECSTCRKKYSGNETHVDLTIAGGGKAYGE  403
            +NL+   IC D     G  G S+ ++ +S  +C  C K YS    ++DLT+  G K Y E
Sbjct  23   SNLIFNTICDDPLVRRGPSGFSVPAIYRSGFKCRVCNKTYSSKNIYLDLTVTAGSKDYNE  82

Query  404  ALAASTELFRLPLVSFLYERGWRQSFSLWGGFPGPEKEFELM  529
               A TELFR PLVSFLYERGWRQ+F+   GFPGP KE + +
Sbjct  83   LKPAGTELFRSPLVSFLYERGWRQNFNC-SGFPGPNKEVKFL  123



>gb|KEH37884.1| S-adenosylmethionine-dependent methyltransferase [Medicago truncatula]
Length=277

 Score =   101 bits (252),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 45/94 (48%), Positives = 63/94 (67%), Gaps = 1/94 (1%)
 Frame = +2

Query  296  SMAQSNLECSTCRKKYSGNETHVDLTIAGGGKAYGEALAASTELFRLPLVSFLYERGWRQ  475
            ++ +S  +C  C+K Y+  + ++DLT+  G + Y E     TELFR PLVSFLYERGWRQ
Sbjct  26   AIYRSGFKCKRCQKSYTSKDGYLDLTVTSGLRDYVEVQPNRTELFRSPLVSFLYERGWRQ  85

Query  476  SFSLWGGFPGPEKEFELMQDYLKPVMGGNIIDAS  577
            +F    GFPGP++EF + Q+Y +P  GG I+D S
Sbjct  86   NFRQ-SGFPGPDEEFRMAQEYFEPAKGGRIVDVS  118



>ref|XP_005643537.1| S-adenosyl-L-methionine-dependent methyltransferase [Coccomyxa 
subellipsoidea C-169]
 gb|EIE18993.1| S-adenosyl-L-methionine-dependent methyltransferase [Coccomyxa 
subellipsoidea C-169]
Length=357

 Score = 99.8 bits (247),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 60/151 (40%), Positives = 81/151 (54%), Gaps = 8/151 (5%)
 Frame = +2

Query  131  RLFAVKIRALSTTFVEDKPVRLIDEKKVEIRTNLLACPICYDAFTWNGNPGLSLSSMAQS  310
            RL  V  RA +   +  +P+    E+  +      ACPIC    T   +   S   +AQ+
Sbjct  42   RLRVVPCRATAQP-ISARPLGTDSERVKDSVEYNFACPIC---LTTEFSIQKSNQGLAQA  97

Query  311  NLECSTCRKKYSGNETHVDLTIAGGGKA--YGEALAASTELFRLPLVSFLYERGWRQSFS  484
             L C  C + +S NE  VDLT   G  A  Y ++    T++FR PLVSF YERGWR SF+
Sbjct  98   -LHCDRCARTFSANEKSVDLTSTSGAPARVYKQSFWGGTQIFRSPLVSFAYERGWRSSFT  156

Query  485  LWGGFPGPEKEFELMQDYLKPVMGGNIIDAS  577
             W GFPG +KEFE+  DYL+   G  ++D S
Sbjct  157  -WAGFPGEQKEFEMAMDYLQAAYGEVLVDMS  186



>gb|KHN03912.1| Putative methyltransferase, chloroplastic, partial [Glycine soja]
Length=213

 Score = 96.7 bits (239),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 40/49 (82%), Positives = 48/49 (98%), Gaps = 0/49 (0%)
 Frame = +2

Query  431  RLPLVSFLYERGWRQSFSLWGGFPGPEKEFELMQDYLKPVMGGNIIDAS  577
            R+PL+SFL+ERGWRQ+FS+WGGFPGPEKEFELM+ +LKPV+GGNIIDAS
Sbjct  2    RVPLISFLHERGWRQTFSVWGGFPGPEKEFELMKGFLKPVLGGNIIDAS  50



>ref|XP_003527908.1| PREDICTED: uncharacterized methyltransferase At1g78140, chloroplastic-like 
[Glycine max]
Length=248

 Score = 97.1 bits (240),  Expect = 7e-21, Method: Compositional matrix adjust.
 Identities = 40/49 (82%), Positives = 48/49 (98%), Gaps = 0/49 (0%)
 Frame = +2

Query  431  RLPLVSFLYERGWRQSFSLWGGFPGPEKEFELMQDYLKPVMGGNIIDAS  577
            R+PL+SFL+ERGWRQ+FS+WGGFPGPEKEFELM+ +LKPV+GGNIIDAS
Sbjct  36   RVPLISFLHERGWRQTFSVWGGFPGPEKEFELMKGFLKPVLGGNIIDAS  84



>gb|KGN60338.1| hypothetical protein Csa_3G895840 [Cucumis sativus]
Length=180

 Score = 94.0 bits (232),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 58/155 (37%), Positives = 82/155 (53%), Gaps = 8/155 (5%)
 Frame = +2

Query  80   LGYNSKFSFSPLTPKANRLFAVKIRALSTTFVEDKPVRLIDEKKVEIRT-NLLACPICYD  256
              ++S  S SP         +      ++T V+     +ID    + +  N+LAC IC+ 
Sbjct  24   FNFHSTLSISPRLSLLTLRSSSAPPMETSTNVQPSDSVMIDNDNEDNKIKNILACSICHG  83

Query  257  AFTWNGNPGLSLSSMAQSNLECSTCRKKYSGNETHVDLTIAGGGKAYGEALAASTELFRL  436
              T     GL + S     LEC TC+K ++G+E+H+DLTI GG  + GE++ A+TE+FR 
Sbjct  84   PLTAAAGSGLPVESTNGYQLECGTCKKSFTGSESHLDLTITGGTDS-GESMPAATEIFRT  142

Query  437  PLVSFLYERGWRQSFSLWGGFPGPEKEFELMQDYL  541
             LVSFLYERGWR         P P  EF L +D L
Sbjct  143  RLVSFLYERGWRPK-----EIPLPH-EFILNRDLL  171



>ref|XP_005842697.1| hypothetical protein CHLNCDRAFT_136276 [Chlorella variabilis]
 gb|EFN50565.1| hypothetical protein CHLNCDRAFT_136276 [Chlorella variabilis]
Length=190

 Score = 91.7 bits (226),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 47/106 (44%), Positives = 61/106 (58%), Gaps = 7/106 (7%)
 Frame = +2

Query  233  LACPICYDAFTWNGNPGLSLSSMAQSNLECSTCRKKYSGNETHVDLTIAGG--GKAYGEA  406
            LACPIC         P  +       +L C  C + ++   T+ DLT+  G   KAY ++
Sbjct  81   LACPICLS----TKLPLRNTQGRPTGSLSCPRCNRTFASTPTYADLTLTSGIQQKAYQQS  136

Query  407  LAASTELFRLPLVSFLYERGWRQSFSLWGGFPGPEKEFELMQDYLK  544
                T +FR PLVSF+YERGWRQ F+ W GFPG +KEFEL  DYL+
Sbjct  137  WWGGTTIFRSPLVSFVYERGWRQGFA-WAGFPGADKEFELAMDYLQ  181



>ref|XP_008344066.1| PREDICTED: uncharacterized methyltransferase At2g41040, chloroplastic-like 
[Malus domestica]
Length=327

 Score = 88.6 bits (218),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 41/74 (55%), Positives = 52/74 (70%), Gaps = 1/74 (1%)
 Frame = +2

Query  356  THVDLTIAGGGKAYGEALAASTELFRLPLVSFLYERGWRQSFSLWGGFPGPEKEFELMQD  535
             ++DLT+  G K Y E     TELFR PLVSFLYERGWRQ+F+   GFPGP++EF++ QD
Sbjct  96   VYLDLTVTAGLKEYVEVQPTRTELFRSPLVSFLYERGWRQNFNR-SGFPGPDEEFKMAQD  154

Query  536  YLKPVMGGNIIDAS  577
            Y K   GG ++D S
Sbjct  155  YFKSAEGGVLVDVS  168



>ref|XP_002954755.1| hypothetical protein VOLCADRAFT_106536 [Volvox carteri f. nagariensis]
 gb|EFJ44161.1| hypothetical protein VOLCADRAFT_106536 [Volvox carteri f. nagariensis]
Length=369

 Score = 88.6 bits (218),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 46/116 (40%), Positives = 63/116 (54%), Gaps = 12/116 (10%)
 Frame = +2

Query  233  LACPICYDAFTWNGNPGLSLSSMAQSN--LECSTCRKKYSGNETHVDLTIAGG--GKAYG  400
              CPIC            SLSSM   +  L C  C++ +  +  ++DLT+  G   + Y 
Sbjct  80   FVCPICLQTH-------FSLSSMPTQSGGLSCVRCQRTFPSSPAYLDLTLTSGVRQRVYK  132

Query  401  EALAASTELFRLPLVSFLYERGWRQSFSLWGGFPGPEKEFELMQDYLKPVMGGNII  568
            +     TELFR PLVSF YERGWRQ F+ W GFPG +KE+++   YL P   G ++
Sbjct  133  QRSWGGTELFRNPLVSFAYERGWRQGFA-WAGFPGADKEYDIAMSYLLPAAAGKVL  187



>ref|XP_001694737.1| predicted protein [Chlamydomonas reinhardtii]
 gb|EDP02321.1| predicted protein [Chlamydomonas reinhardtii]
Length=275

 Score = 87.0 bits (214),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 39/87 (45%), Positives = 57/87 (66%), Gaps = 3/87 (3%)
 Frame = +2

Query  314  LECSTCRKKYSGNETHVDLTIAGG--GKAYGEALAASTELFRLPLVSFLYERGWRQSFSL  487
            L C+ C + +  + +++DLT+  G   K Y +     TELFR PLVSF+YERGWRQ F+ 
Sbjct  11   LYCNRCVRTFPASPSYLDLTLTAGIKQKVYNQRSWGGTELFRSPLVSFVYERGWRQGFA-  69

Query  488  WGGFPGPEKEFELMQDYLKPVMGGNII  568
            W GFPG ++E+++  DYL P  GG ++
Sbjct  70   WAGFPGADREYDIAMDYLLPAAGGKVL  96



>ref|XP_002968407.1| hypothetical protein SELMODRAFT_89857 [Selaginella moellendorffii]
 gb|EFJ30661.1| hypothetical protein SELMODRAFT_89857 [Selaginella moellendorffii]
Length=315

 Score = 87.0 bits (214),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 39/104 (38%), Positives = 61/104 (59%), Gaps = 1/104 (1%)
 Frame = +2

Query  233  LACPICYDAFTWNGNPGLSLSSMAQSNLECSTCRKKYSGNETHVDLTIAGGGKAYGEALA  412
            LACP C +  + +G  G + +++A+S L C TC K +  + T +DLT+      + E L 
Sbjct  26   LACPTCLEPLSRHGPQGFNRAAIAKSILRCQTCSKDFPSDGTFIDLTLGANRSTWQETLP  85

Query  413  ASTELFRLPLVSFLYERGWRQSFSLWGGFPGPEKEFELMQDYLK  544
                LFR   +S +YE  WR+SF  + GFPGP++E EL + +L+
Sbjct  86   IGVRLFRTKWISLIYEENWRKSFEKF-GFPGPDREVELAETFLQ  128



>ref|XP_006473932.1| PREDICTED: uncharacterized methyltransferase At2g41040, chloroplastic-like 
[Citrus sinensis]
Length=139

 Score = 80.5 bits (197),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 43/112 (38%), Positives = 65/112 (58%), Gaps = 6/112 (5%)
 Frame = +2

Query  107  SPLTPKANRLFAVKIRALSTTFVEDKPVRLIDEKKVEIRTNLLACPICYDAFTWNGNPGL  286
            SP  P++ R F+  IRA++      +PV+    + +E+  +L +CPICY+     G  GL
Sbjct  25   SPRLPQSLR-FSSTIRAVTL-----QPVKSERNQTLELEGDLFSCPICYEPLIRKGPTGL  78

Query  287  SLSSMAQSNLECSTCRKKYSGNETHVDLTIAGGGKAYGEALAASTELFRLPL  442
            +L ++ +S  +C  C K YS  + ++DLT+  G K Y E   ASTELFR PL
Sbjct  79   TLGAIYRSGFKCRKCDKTYSSKDNYLDLTVISGLKDYTEVKPASTELFRTPL  130



>ref|XP_006474605.1| PREDICTED: uncharacterized methyltransferase At2g41040, chloroplastic-like 
[Citrus sinensis]
Length=160

 Score = 80.1 bits (196),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 45/121 (37%), Positives = 70/121 (58%), Gaps = 8/121 (7%)
 Frame = +2

Query  107  SPLTPKANRLFAVKIRALSTTFVEDKPVRLIDEKKVEIRTNLLACPICYDAFTWNGNPGL  286
            SP  P++ R F+  IRA++      +PV+    + +E+  +L +CPICY+     G  GL
Sbjct  25   SPRLPQSLR-FSSTIRAVTL-----QPVKSERNQTLELEGDLFSCPICYEPLIRKGPTGL  78

Query  287  SLSSMAQSNLECSTCRKKYSGNETHVDLTIAGGGKAYGEALAASTELFRLPLV--SFLYE  460
            +L ++ +S  +C  C K YS  + ++DLT+  G K Y E   ASTELFR  LV  +F +E
Sbjct  79   TLGAIYRSGFKCRKCDKTYSSKDNYLDLTVISGLKDYTEVKPASTELFRCVLVILAFFHE  138

Query  461  R  463
            +
Sbjct  139  K  139



>gb|KGN60339.1| hypothetical protein Csa_3G895850 [Cucumis sativus]
Length=220

 Score = 81.3 bits (199),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 35/46 (76%), Positives = 43/46 (93%), Gaps = 0/46 (0%)
 Frame = +2

Query  440  LVSFLYERGWRQSFSLWGGFPGPEKEFELMQDYLKPVMGGNIIDAS  577
            LVSFLYERGWRQSFS+  GFPGPEKEFEL+++++ PV+GG+IIDAS
Sbjct  11   LVSFLYERGWRQSFSVLLGFPGPEKEFELIKNFITPVLGGSIIDAS  56



>emb|CAN77779.1| hypothetical protein VITISV_004172 [Vitis vinifera]
Length=714

 Score = 80.5 bits (197),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 41/87 (47%), Positives = 53/87 (61%), Gaps = 15/87 (17%)
 Frame = +2

Query  359  HVDLTIAGGGKAYGEALAASTELFR--------------LPLVSFLYERGWRQSFSLWGG  496
            ++DLTI  G K Y E     TELFR               PLVSFLYERGWRQ+F+   G
Sbjct  2    YLDLTITAGSKDYNELQPNRTELFRNCPCLIFGXFAIVRSPLVSFLYERGWRQNFNX-SG  60

Query  497  FPGPEKEFELMQDYLKPVMGGNIIDAS  577
            FPG ++EF++ Q+Y  PV+GG ++D S
Sbjct  61   FPGRDEEFKMAQEYFXPVIGGLLVDVS  87


 Score = 74.3 bits (181),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 44/128 (34%), Positives = 61/128 (48%), Gaps = 18/128 (14%)
 Frame = +2

Query  227  NLLACPICYDAFTWNGNPGLSLSSMA----------QSNLECSTCRKKYSGNETHVDLTI  376
            +L +CP+CY+     G PGL+L  +           +S  +C TC K YS  + ++DLTI
Sbjct  232  DLFSCPVCYEXLIRKGPPGLNLXCLKNYTICRPAIYRSGFKCKTCNKSYSSKDMYLDLTI  291

Query  377  AGGGKAYGEALAASTELFR-LPLVSFLYERGWRQSFSLWGGFPGPEKEFELMQDYLKPVM  553
              G KAY EA    TELFR L      Y  G                +F++ Q+Y KP  
Sbjct  292  TAGSKAYNEAQPVRTELFRSLSPRPTGYASGTNH-------IKVDIVQFKMAQEYFKPAA  344

Query  554  GGNIIDAS  577
            GG ++D S
Sbjct  345  GGLLVDVS  352



>ref|XP_002306577.1| hypothetical protein POPTR_0005s17000g [Populus trichocarpa]
 gb|EEE93573.1| hypothetical protein POPTR_0005s17000g [Populus trichocarpa]
Length=122

 Score = 75.1 bits (183),  Expect = 9e-14, Method: Compositional matrix adjust.
 Identities = 42/85 (49%), Positives = 51/85 (60%), Gaps = 2/85 (2%)
 Frame = +2

Query  116  TPKANRL-FAVKIRALSTTFVEDKPVRLID-EKKVEIRTNLLACPICYDAFTWNGNPGLS  289
            TP   R  FA KIRA ST F E KP   +  EK V    N+LACP+CY+  T  G   LS
Sbjct  29   TPTFKRTSFATKIRASSTAFAETKPTGPVTVEKDVRSSKNILACPVCYEPVTLIGATVLS  88

Query  290  LSSMAQSNLECSTCRKKYSGNETHV  364
            + S   S+L+CSTC+K YSG ET +
Sbjct  89   VYSARGSSLQCSTCKKTYSGKETQL  113



>ref|XP_002960327.1| hypothetical protein SELMODRAFT_402502 [Selaginella moellendorffii]
 gb|EFJ37866.1| hypothetical protein SELMODRAFT_402502 [Selaginella moellendorffii]
Length=604

 Score = 75.9 bits (185),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 45/129 (35%), Positives = 73/129 (57%), Gaps = 8/129 (6%)
 Frame = +2

Query  200  DEKKVEIRTNL--LACPICYDAFTWNGNPGLSLSSMAQSNLECSTCRKKY-SGNETHVDL  370
            +E++ + RT L  LACPIC      + N  +S+ + A ++  C+ CR+ Y S +   ++L
Sbjct  52   NEQEDDARTTLKSLACPICLQPLWTSSNESVSVENAASTSFRCNGCRRSYHSSSRGIINL  111

Query  371  TIAGGGKAYGEALAASTELFRLPLVSFLYERGWRQSFSLWGGFPGPEKEFELMQDYLKPV  550
            TI G   A G  L+AS  +F  P+V+  Y++ +R       GFPG ++EF + Q+ L+P 
Sbjct  112  TIPG---ACGVPLSAS--VFENPIVARFYDKSYRDQVFQLVGFPGFDEEFTMAQEILRPC  166

Query  551  MGGNIIDAS  577
             G  I+D S
Sbjct  167  FGKAIMDLS  175



>ref|XP_002967385.1| hypothetical protein SELMODRAFT_408369 [Selaginella moellendorffii]
 gb|EFJ31984.1| hypothetical protein SELMODRAFT_408369 [Selaginella moellendorffii]
Length=776

 Score = 71.6 bits (174),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 44/129 (34%), Positives = 71/129 (55%), Gaps = 8/129 (6%)
 Frame = +2

Query  200  DEKKVEIRTNL--LACPICYDAFTWNGNPGLSLSSMAQSNLECSTCRKKY-SGNETHVDL  370
            +E+  + RT L  LACPIC      + N  +S+ + A ++  C+ CR+ Y S +   ++L
Sbjct  224  NEQDDDARTTLKSLACPICLQPLWTSSNESVSVENAASTSFRCNGCRRSYHSSSRGIINL  283

Query  371  TIAGGGKAYGEALAASTELFRLPLVSFLYERGWRQSFSLWGGFPGPEKEFELMQDYLKPV  550
            TI G   A G  L+AS  +F   +V+  Y++ +R       GFPG ++EF + Q+ L+P 
Sbjct  284  TIPG---ACGVPLSAS--VFENSIVARFYDKSYRDQVFQLVGFPGFDEEFTMAQEILRPC  338

Query  551  MGGNIIDAS  577
             G  I+D S
Sbjct  339  FGKAIMDLS  347



>ref|XP_003056709.1| predicted protein [Micromonas pusilla CCMP1545]
 gb|EEH58354.1| predicted protein [Micromonas pusilla CCMP1545]
Length=384

 Score = 67.4 bits (163),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 40/108 (37%), Positives = 55/108 (51%), Gaps = 17/108 (16%)
 Frame = +2

Query  230  LLACPICYDAFTWNGNPGLSLSSMAQSNLECSTC-RKKYSGNETHVDLTIAGGGKA--YG  400
            LLACPIC             L+     +L C+ C R  Y   +  +DL +   G A  Y 
Sbjct  63   LLACPIC-------------LTPFPAGSLRCARCARDAYPTKDGILDLCLDANGAAGAYA  109

Query  401  EALAASTELFRLPLVSFLYERGWRQSFSLWGGFPGPEKEFELMQDYLK  544
            E   + T LF+  ++S  YE GWRQSF+ W GFPG E+E E+   +L+
Sbjct  110  EPQRSGTRLFQSDVISAAYENGWRQSFA-WAGFPGEEEETEIAMTFLR  156



>gb|KCW45298.1| hypothetical protein EUGRSUZ_L01042 [Eucalyptus grandis]
Length=132

 Score = 63.5 bits (153),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 34/101 (34%), Positives = 50/101 (50%), Gaps = 3/101 (3%)
 Frame = +2

Query  131  RLFAVKIRALSTTFVEDKPVRLIDEKKVEIRTNLLACPICYDAFTWNGNPGLSLSSMAQS  310
            RL +  +RA S   VE        +K   +   + +CPICY+     G  GL+L ++ +S
Sbjct  33   RLPSFTVRASSVLAVEPD---TGTQKDQTLEVEIFSCPICYEPLIRRGPSGLNLEAVYRS  89

Query  311  NLECSTCRKKYSGNETHVDLTIAGGGKAYGEALAASTELFR  433
              +C  C K YS     +DLT+  G + Y E   A +ELFR
Sbjct  90   GFKCKNCNKSYSSKNNFLDLTLTAGLRDYVEVKPARSELFR  130



>ref|XP_010040340.1| PREDICTED: uncharacterized methyltransferase At2g41040, chloroplastic-like 
[Eucalyptus grandis]
Length=134

 Score = 63.2 bits (152),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 34/101 (34%), Positives = 50/101 (50%), Gaps = 3/101 (3%)
 Frame = +2

Query  131  RLFAVKIRALSTTFVEDKPVRLIDEKKVEIRTNLLACPICYDAFTWNGNPGLSLSSMAQS  310
            RL +  +RA S   VE        +K   +   + +CPICY+     G  GL+L ++ +S
Sbjct  35   RLPSFTVRASSVLAVEPD---TGTQKDQTLEVEIFSCPICYEPLIRRGPSGLNLEAVYRS  91

Query  311  NLECSTCRKKYSGNETHVDLTIAGGGKAYGEALAASTELFR  433
              +C  C K YS     +DLT+  G + Y E   A +ELFR
Sbjct  92   GFKCKNCNKSYSSKNNFLDLTLTAGLRDYVEVKPARSELFR  132



>ref|XP_007510827.1| predicted protein [Bathycoccus prasinos]
 emb|CCO18360.1| predicted protein [Bathycoccus prasinos]
Length=390

 Score = 63.5 bits (153),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 28/62 (45%), Positives = 40/62 (65%), Gaps = 1/62 (2%)
 Frame = +2

Query  359  HVDLTIAGGGKAYGEALAASTELFRLPLVSFLYERGWRQSFSLWGGFPGPEKEFELMQDY  538
            + DL I+    ++ EA  + T LF  P+VS  YERGWR SF+ W GFPG EKEF++   +
Sbjct  115  YTDLEISRNANSFREAKLSGTSLFETPIVSNAYERGWRDSFA-WAGFPGKEKEFDVAMRF  173

Query  539  LK  544
            ++
Sbjct  174  VR  175



>ref|XP_005824779.1| hypothetical protein GUITHDRAFT_116106 [Guillardia theta CCMP2712]
 gb|EKX37799.1| hypothetical protein GUITHDRAFT_116106 [Guillardia theta CCMP2712]
Length=365

 Score = 62.4 bits (150),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 33/77 (43%), Positives = 44/77 (57%), Gaps = 2/77 (3%)
 Frame = +2

Query  347  GNETHVDLTIAGGGKAYGEALAASTELFRLPLVSFLYERGWRQSFSLWGGFPGPEKEFEL  526
             N   V   +AG G A  +      ELFR P+VS+LYERGWR  F+   GFPG EKE+EL
Sbjct  124  ANNPLVSAFLAGAG-AQMDGQPLRQELFRTPVVSWLYERGWRAGFAS-AGFPGIEKEYEL  181

Query  527  MQDYLKPVMGGNIIDAS  577
            + D+ +      ++D S
Sbjct  182  VMDFFQEARNKTVVDLS  198



>ref|XP_002992310.1| hypothetical protein SELMODRAFT_430530 [Selaginella moellendorffii]
 gb|EFJ06586.1| hypothetical protein SELMODRAFT_430530 [Selaginella moellendorffii]
Length=212

 Score = 60.1 bits (144),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 30/57 (53%), Positives = 39/57 (68%), Gaps = 4/57 (7%)
 Frame = +2

Query  407  LAASTELFRLPLVSFLYERGWRQSFSLWGGFPGPEKEFELMQDYLKPVMGGNIIDAS  577
            L + TELFR PLVS +YERGWRQ+F    GFPG   + ++  +YL+P  GG I+D S
Sbjct  7    LPSGTELFRNPLVSLIYERGWRQNFER-SGFPG---QLKMALEYLRPAFGGVIVDVS  59



>gb|EWM24600.1| phosphatidylethanolamine n [Nannochloropsis gaditana]
Length=387

 Score = 58.5 bits (140),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 30/74 (41%), Positives = 42/74 (57%), Gaps = 4/74 (5%)
 Frame = +2

Query  338  KYSGNETHVDLTIAGGGKA---YGEALAASTELFRLPLVSFLYERGWRQSFSLWGGFPGP  508
            KY  NE ++DL  A        +  +   + ELFR PL SFLYERGWR +F    GFPG 
Sbjct  136  KYPANEVYMDLVPAEERMQVPFFSPSAIVTQELFRSPLTSFLYERGWRDNFKT-AGFPGI  194

Query  509  EKEFELMQDYLKPV  550
            ++EF  ++ +  P+
Sbjct  195  DEEFRDLEAFFAPL  208



>ref|XP_002500021.1| predicted protein [Micromonas sp. RCC299]
 gb|ACO61279.1| predicted protein [Micromonas sp. RCC299]
Length=385

 Score = 57.0 bits (136),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 28/54 (52%), Positives = 34/54 (63%), Gaps = 2/54 (4%)
 Frame = +2

Query  419  TELFRLPLVSFLYERGWRQSFSLWGGFPGPEKEFELMQDYLKPVMGGN-IIDAS  577
            T  F  P V+F YERGWR SF+   GFPGP++EF L Q  L P   G  ++DAS
Sbjct  146  TSTFETPQVAFAYERGWRDSFAR-AGFPGPDEEFRLAQAKLLPFAAGKCVVDAS  198



>dbj|BAH19476.1| AT2G41040 [Arabidopsis thaliana]
Length=141

 Score = 54.7 bits (130),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 24/72 (33%), Positives = 39/72 (54%), Gaps = 1/72 (1%)
 Frame = +2

Query  209  KVEIR-TNLLACPICYDAFTWNGNPGLSLSSMAQSNLECSTCRKKYSGNETHVDLTIAGG  385
            K+EI  T + ACP+CY+     G  G++L ++ +S  +C  C K YS  + ++DLT+   
Sbjct  70   KIEIEETQVFACPVCYEPLMRKGPSGINLQAIYRSGFKCGQCNKTYSSKDEYLDLTVTAD  129

Query  386  GKAYGEALAAST  421
               Y E    +T
Sbjct  130  LDDYNEVKPITT  141



>ref|XP_005855405.1| hypothetical protein NGA_2005920 [Nannochloropsis gaditana CCMP526]
 ref|XP_005855816.1| hypothetical protein NGA_2005910 [Nannochloropsis gaditana CCMP526]
 gb|EKU20544.1| hypothetical protein NGA_2005910 [Nannochloropsis gaditana CCMP526]
 gb|EKU20954.1| hypothetical protein NGA_2005920 [Nannochloropsis gaditana CCMP526]
Length=387

 Score = 57.0 bits (136),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 29/74 (39%), Positives = 41/74 (55%), Gaps = 4/74 (5%)
 Frame = +2

Query  338  KYSGNETHVDLTIAGGGKA---YGEALAASTELFRLPLVSFLYERGWRQSFSLWGGFPGP  508
            KY  NE ++DL           +  +   + ELFR PL SFLYERGWR +F    GFPG 
Sbjct  136  KYPANEVYMDLVPVEERMQVPFFSPSAIVTQELFRSPLTSFLYERGWRDNFKT-AGFPGI  194

Query  509  EKEFELMQDYLKPV  550
            ++EF  ++ +  P+
Sbjct  195  DEEFRDLEAFFAPL  208



>ref|XP_005781281.1| hypothetical protein EMIHUDRAFT_442892 [Emiliania huxleyi CCMP1516]
 gb|EOD28852.1| hypothetical protein EMIHUDRAFT_442892 [Emiliania huxleyi CCMP1516]
Length=459

 Score = 56.6 bits (135),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 26/57 (46%), Positives = 37/57 (65%), Gaps = 4/57 (7%)
 Frame = +2

Query  416  STELFRLPLVSFLYERGWRQSFSLWGGFPGPEKEFELMQDYLKPVMG---GNIIDAS  577
             T++FR P++ FLYERGWRQ F    GFPG EKE++ +  + +PV     G ++D S
Sbjct  106  QTQMFRTPVLGFLYERGWRQQFRA-AGFPGIEKEYDEVSAFFEPVAAQGRGVVVDMS  161



>ref|XP_002185698.1| predicted protein [Phaeodactylum tricornutum CCAP 1055/1]
 gb|ACI65168.1| predicted protein [Phaeodactylum tricornutum CCAP 1055/1]
Length=412

 Score = 56.2 bits (134),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 28/60 (47%), Positives = 33/60 (55%), Gaps = 1/60 (2%)
 Frame = +2

Query  377  AGGGKAYGEALAASTELFRLPLVSFLYERGWRQSFSLWGGFPGPEKEFELMQDYLKPVMG  556
            A  G   GE      +LF  P+VS  YERGWRQ F+   GFPG + E +L  DY  PVM 
Sbjct  174  ATAGFPMGEDYVPMRDLFTSPVVSAAYERGWRQGFA-QAGFPGADDEAQLAMDYFAPVMA  232



>ref|XP_002506188.1| predicted protein [Micromonas sp. RCC299]
 gb|ACO67446.1| predicted protein [Micromonas sp. RCC299]
Length=359

 Score = 56.2 bits (134),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 37/120 (31%), Positives = 55/120 (46%), Gaps = 20/120 (17%)
 Frame = +2

Query  200  DEKKVEIRTNLLACPICYDAFTWNGNPGLSLSSMAQSNLECSTCRKKYSGNETHV-DLTI  376
            D  + E     LACPIC  AF               +   C+ C + +   +  + DL +
Sbjct  60   DTHRRERARPQLACPICLRAFV--------------AGTTCACCARTFPTIDGKILDLCL  105

Query  377  AGGGK--AYGEA--LAASTELFRLPLVSFLYERGWRQSFSLWGGFPGPEKEFELMQDYLK  544
              GG    Y +     + T LF+   ++ +YE GWRQSF+ W GFPG   E+E   +Y+K
Sbjct  106  DAGGANGTYTDPPLRKSGTTLFQSEAIANVYENGWRQSFA-WAGFPGESTEWEYAMEYVK  164



>gb|EJK66010.1| hypothetical protein THAOC_13088 [Thalassiosira oceanica]
Length=446

 Score = 56.2 bits (134),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 24/45 (53%), Positives = 31/45 (69%), Gaps = 1/45 (2%)
 Frame = +2

Query  422  ELFRLPLVSFLYERGWRQSFSLWGGFPGPEKEFELMQDYLKPVMG  556
            +LF  P VSF YERGWRQ F    GFPG + E+EL ++Y +PV+ 
Sbjct  217  DLFTSPQVSFAYERGWRQGFQA-AGFPGADAEYELAKEYFEPVIA  260



>ref|XP_005713645.1| unnamed protein product [Chondrus crispus]
 emb|CDF33826.1| unnamed protein product [Chondrus crispus]
Length=298

 Score = 54.7 bits (130),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 36/90 (40%), Positives = 49/90 (54%), Gaps = 7/90 (8%)
 Frame = +2

Query  320  CSTCRKKYSGNETHVDLT-IAGGGKAYGEAL---AASTELFRLPLVSFLYERGWRQSFSL  487
            C+TC+ + +    +VDLT  A    +    L     S  LF+LPLVS  YERGWR +F+ 
Sbjct  40   CATCKFEPTERRGYVDLTRTASSPPSLLRNLLTQPPSQSLFQLPLVSAAYERGWRANFA-  98

Query  488  WGGFPGPEKEFELMQDYLKPVMGGNIIDAS  577
              GFPG EKE +L  D+  P     ++D S
Sbjct  99   RAGFPGIEKERDLFLDFAAP--AAAVLDMS  126



>tpg|DAA49105.1| TPA: hypothetical protein ZEAMMB73_519956 [Zea mays]
Length=138

 Score = 52.4 bits (124),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 27/73 (37%), Positives = 39/73 (53%), Gaps = 5/73 (7%)
 Frame = +2

Query  215  EIRTNLLACPICYDAFTWNGNPGLSLSSMAQSNLECSTCRKKYSGNETHVDLTIAGGGKA  394
            E +   LACPICY     + +     +S     LEC TC+K Y   + + DLT++ G   
Sbjct  71   ETKLRKLACPICYYPLASSSDQLDDATS-----LECPTCKKCYPNKQDYWDLTVSVGSTE  125

Query  395  YGEALAASTELFR  433
            Y E++  +TELFR
Sbjct  126  YSESMPVATELFR  138



>ref|XP_005536724.1| hypothetical protein, conserved [Cyanidioschyzon merolae strain 
10D]
 dbj|BAM80688.1| hypothetical protein, conserved [Cyanidioschyzon merolae strain 
10D]
Length=441

 Score = 53.5 bits (127),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 25/60 (42%), Positives = 36/60 (60%), Gaps = 4/60 (7%)
 Frame = +2

Query  389  KAYGEALAASTELFRLPLVSFLYERGWRQSFSLWGGFPGPEKEFELMQDYLKPVMGGNII  568
            +  G ++    +LF+ P V+FLYERGWR  F    GFPGP+ EF ++Q + K   G N +
Sbjct  203  RPRGPSVELRRDLFQSPFVAFLYERGWRDQFRS-SGFPGPDAEFRIVQSFFK---GANCV  258



>emb|CBJ26935.1| S-adenosyl-L-methionine-dependent methyltransferases-like [Ectocarpus 
siliculosus]
Length=471

 Score = 53.1 bits (126),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 31/62 (50%), Positives = 38/62 (61%), Gaps = 5/62 (8%)
 Frame = +2

Query  398  GEALAASTELFRLPLVSFLYERGWRQSFSLWGGFPGPEKEFELMQDYLKPVM--GGNIID  571
            GEA+   T  F+ PLVS+LYERGWRQ FS   GFPG ++EF L  +Y       G  +ID
Sbjct  253  GEAVKEGT--FQTPLVSWLYERGWRQGFSA-NGFPGIDEEFRLASEYFSSTGADGKAVID  309

Query  572  AS  577
             S
Sbjct  310  LS  311



>ref|XP_001418638.1| predicted protein, partial [Ostreococcus lucimarinus CCE9901]
 gb|ABO96931.1| predicted protein, partial [Ostreococcus lucimarinus CCE9901]
Length=227

 Score = 50.4 bits (119),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 27/54 (50%), Positives = 33/54 (61%), Gaps = 2/54 (4%)
 Frame = +2

Query  419  TELFRLPLVSFLYERGWRQSFSLWGGFPGPEKEFELMQDYL-KPVMGGNIIDAS  577
            T  F  P V+F YERGWR SF    GFPGP++E  L  D L +   GG ++DAS
Sbjct  1    TATFETPQVAFAYERGWRDSFKR-AGFPGPDEEARLAVDALGEFAKGGIVVDAS  53



>ref|XP_003057905.1| predicted protein, partial [Micromonas pusilla CCMP1545]
 gb|EEH57856.1| predicted protein, partial [Micromonas pusilla CCMP1545]
Length=235

 Score = 50.4 bits (119),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 25/54 (46%), Positives = 33/54 (61%), Gaps = 2/54 (4%)
 Frame = +2

Query  419  TELFRLPLVSFLYERGWRQSFSLWGGFPGPEKEFELMQDYLKPVMGGNI-IDAS  577
            T  F  P V+F YERGWR SF    GFPGP++E++L +  L P     + +DAS
Sbjct  1    TSTFETPQVAFAYERGWRDSFKR-AGFPGPDEEYDLARAKLLPHAADKVLVDAS  53



>ref|XP_003080221.1| methyltransferase-related (ISS) [Ostreococcus tauri]
 emb|CAL54388.1| Methyltransferase type 11 [Ostreococcus tauri]
Length=389

 Score = 50.8 bits (120),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 27/54 (50%), Positives = 32/54 (59%), Gaps = 2/54 (4%)
 Frame = +2

Query  419  TELFRLPLVSFLYERGWRQSFSLWGGFPGPEKEFELMQDYLKP-VMGGNIIDAS  577
            T  F  P V+F YERGWR SF+   GFPGP++E  L  D L      G I+DAS
Sbjct  163  TATFETPQVAFAYERGWRDSFAR-AGFPGPDEETRLAMDALGEFARDGIIVDAS  215



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 696633491985