BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFF035D23

Length=518
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_006363650.1|  PREDICTED: ferredoxin--NADP reductase, root-...    130   1e-32   Solanum tuberosum [potatoes]
sp|O04397.1|FENR2_TOBAC  RecName: Full=Ferredoxin--NADP reductase...    129   2e-32   Nicotiana tabacum [American tobacco]
ref|XP_009614066.1|  PREDICTED: ferredoxin--NADP reductase, root-...    129   2e-32   Nicotiana tomentosiformis
ref|XP_006344529.1|  PREDICTED: ferredoxin--NADP reductase, root-...    129   2e-32   Solanum tuberosum [potatoes]
ref|XP_009761528.1|  PREDICTED: ferredoxin--NADP reductase, root-...    129   2e-32   Nicotiana sylvestris
ref|XP_008225595.1|  PREDICTED: ferredoxin--NADP reductase, root ...    126   3e-31   Prunus mume [ume]
ref|XP_002523191.1|  ferredoxin--NADP reductase, putative               125   6e-31   Ricinus communis
ref|XP_004231567.1|  PREDICTED: ferredoxin--NADP reductase, root-...    125   7e-31   Solanum lycopersicum
ref|XP_002263658.2|  PREDICTED: ferredoxin--NADP reductase, root ...    125   8e-31   Vitis vinifera
ref|XP_009362229.1|  PREDICTED: ferredoxin--NADP reductase, root ...    125   8e-31   Pyrus x bretschneideri [bai li]
ref|XP_008346149.1|  PREDICTED: ferredoxin--NADP reductase, root ...    123   3e-30   Malus domestica [apple tree]
ref|XP_008383404.1|  PREDICTED: ferredoxin--NADP reductase, root ...    123   4e-30   Malus domestica [apple tree]
ref|XP_010051952.1|  PREDICTED: ferredoxin--NADP reductase, root ...    121   2e-29   Eucalyptus grandis [rose gum]
ref|XP_007211443.1|  hypothetical protein PRUPE_ppa007232mg             120   3e-29   Prunus persica
ref|XP_010098567.1|  Ferredoxin--NADP reductase, root isozyme           120   4e-29   
ref|XP_004293987.1|  PREDICTED: ferredoxin--NADP reductase, root ...    119   9e-29   Fragaria vesca subsp. vesca
gb|KDP34933.1|  hypothetical protein JCGZ_09221                         119   1e-28   Jatropha curcas
ref|XP_009344407.1|  PREDICTED: ferredoxin--NADP reductase, root ...    119   1e-28   Pyrus x bretschneideri [bai li]
ref|XP_011038878.1|  PREDICTED: ferredoxin--NADP reductase, root ...    119   2e-28   Populus euphratica
ref|XP_002298889.2|  ferredoxin-NADP reductase family protein           118   4e-28   Populus trichocarpa [western balsam poplar]
emb|CDP17310.1|  unnamed protein product                                117   5e-28   Coffea canephora [robusta coffee]
gb|ACY70395.1|  heterotrophic ferredoxin NADP+ oxidoreductase           117   7e-28   Populus tremula x Populus tremuloides
ref|XP_007147485.1|  hypothetical protein PHAVU_006G128400g             116   1e-27   Phaseolus vulgaris [French bean]
ref|XP_011085204.1|  PREDICTED: ferredoxin--NADP reductase, root-...    114   5e-27   Sesamum indicum [beniseed]
gb|KJB56287.1|  hypothetical protein B456_009G115100                    114   6e-27   Gossypium raimondii
gb|KJB56286.1|  hypothetical protein B456_009G115100                    114   9e-27   Gossypium raimondii
gb|KJB56288.1|  hypothetical protein B456_009G115100                    114   9e-27   Gossypium raimondii
ref|XP_007022877.1|  Root FNR 1 isoform 1                               114   1e-26   
ref|XP_006597058.1|  PREDICTED: uncharacterized protein LOC100807...    113   2e-26   Glycine max [soybeans]
gb|ACJ84937.1|  unknown                                                 107   2e-26   Medicago truncatula
gb|KHG02797.1|  hypothetical protein F383_08810                         112   3e-26   Gossypium arboreum [tree cotton]
ref|NP_001239798.1|  uncharacterized protein LOC100807968               111   6e-26   Glycine max [soybeans]
gb|EYU19120.1|  hypothetical protein MIMGU_mgv1a008446mg                110   1e-25   Erythranthe guttata [common monkey flower]
ref|XP_004486455.1|  PREDICTED: ferredoxin--NADP reductase, root ...    110   1e-25   Cicer arietinum [garbanzo]
ref|XP_008439552.1|  PREDICTED: ferredoxin--NADP reductase, root ...    108   6e-25   Cucumis melo [Oriental melon]
ref|XP_011096684.1|  PREDICTED: ferredoxin--NADP reductase, root-...    108   6e-25   Sesamum indicum [beniseed]
gb|KHN14331.1|  Ferredoxin--NADP reductase, root isozyme, chlorop...    108   9e-25   Glycine soja [wild soybean]
ref|XP_004134584.1|  PREDICTED: ferredoxin--NADP reductase, root ...    108   1e-24   Cucumis sativus [cucumbers]
ref|XP_003594526.1|  Ferredoxin-NADP reductase                          107   2e-24   Medicago truncatula
ref|XP_006586681.1|  PREDICTED: uncharacterized protein LOC100789...    107   3e-24   Glycine max [soybeans]
sp|Q41014.2|FENR2_PEA  RecName: Full=Ferredoxin--NADP reductase, ...    106   4e-24   Pisum sativum [garden pea]
emb|CAA67796.1|  ferrodoxin NADP oxidoreductase                         106   4e-24   Pisum sativum [garden pea]
ref|NP_001239859.1|  uncharacterized protein LOC100789291               105   7e-24   Glycine max [soybeans]
gb|AII16855.1|  ferredoxin-NADP(+) reductase                            105   9e-24   Ocimum basilicum [basil]
ref|XP_010247806.1|  PREDICTED: ferredoxin--NADP reductase, root ...    104   2e-23   Nelumbo nucifera [Indian lotus]
ref|XP_006448909.1|  hypothetical protein CICLE_v100156271mg            102   3e-23   
ref|XP_010691939.1|  PREDICTED: ferredoxin--NADP reductase, root ...    103   4e-23   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_010907335.1|  PREDICTED: ferredoxin--NADP reductase, root ...    103   4e-23   Elaeis guineensis
ref|XP_006468308.1|  PREDICTED: ferredoxin--NADP reductase, root ...    103   6e-23   Citrus sinensis [apfelsine]
gb|EYU43232.1|  hypothetical protein MIMGU_mgv1a008184mg                100   6e-22   Erythranthe guttata [common monkey flower]
ref|XP_008795712.1|  PREDICTED: ferredoxin--NADP reductase, root ...  97.8    1e-21   Phoenix dactylifera
ref|XP_006305070.1|  hypothetical protein CARUB_v10009436mg           97.4    7e-21   Capsella rubella
ref|XP_002893629.1|  ATRFNR2                                          97.1    1e-20   
ref|XP_006415461.1|  hypothetical protein EUTSA_v10007919mg           93.6    2e-19   Eutrema salsugineum [saltwater cress]
ref|XP_006844572.1|  hypothetical protein AMTR_s00016p00195680        92.8    3e-19   Amborella trichopoda
ref|XP_010907336.1|  PREDICTED: ferredoxin--NADP reductase, root ...  92.8    3e-19   Elaeis guineensis
ref|XP_011016596.1|  PREDICTED: ferredoxin--NADP reductase, root ...  92.4    4e-19   Populus euphratica
ref|XP_009397718.1|  PREDICTED: ferredoxin--NADP reductase, root ...  90.1    3e-18   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_006396605.1|  hypothetical protein EUTSA_v10028734mg           89.7    3e-18   Eutrema salsugineum [saltwater cress]
emb|CDY09570.1|  BnaC05g23490D                                        89.4    6e-18   Brassica napus [oilseed rape]
gb|KFK44862.1|  hypothetical protein AALP_AA1G312100                  89.4    6e-18   Arabis alpina [alpine rockcress]
ref|XP_006415462.1|  hypothetical protein EUTSA_v10007919mg           89.4    6e-18   Eutrema salsugineum [saltwater cress]
emb|CDY02299.1|  BnaA09g26030D                                        89.0    8e-18   
gb|KFK32212.1|  hypothetical protein AALP_AA6G212100                  89.0    8e-18   Arabis alpina [alpine rockcress]
ref|XP_010529363.1|  PREDICTED: ferredoxin--NADP reductase, root ...  88.6    1e-17   Tarenaya hassleriana [spider flower]
gb|AAM65564.1|  ferrodoxin NADP oxidoreductase, putative              88.2    1e-17   Arabidopsis thaliana [mouse-ear cress]
ref|NP_564355.1|  ferredoxin--NADP reductase, root isozyme 2          88.2    2e-17   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010460851.1|  PREDICTED: ferredoxin--NADP reductase, root ...  88.2    2e-17   Camelina sativa [gold-of-pleasure]
ref|XP_009397390.1|  PREDICTED: ferredoxin--NADP reductase, embry...  88.2    2e-17   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010422426.1|  PREDICTED: ferredoxin--NADP reductase, root ...  87.8    2e-17   Camelina sativa [gold-of-pleasure]
ref|XP_009115136.1|  PREDICTED: ferredoxin--NADP reductase, root ...  87.8    2e-17   Brassica rapa
ref|XP_010478465.1|  PREDICTED: ferredoxin--NADP reductase, root ...  87.0    3e-17   Camelina sativa [gold-of-pleasure]
ref|XP_010431466.1|  PREDICTED: ferredoxin--NADP reductase, root ...  86.3    8e-17   Camelina sativa [gold-of-pleasure]
ref|XP_006287956.1|  hypothetical protein CARUB_v10001191mg           85.9    1e-16   Capsella rubella
gb|KFK44861.1|  hypothetical protein AALP_AA1G312100                  85.1    2e-16   Arabis alpina [alpine rockcress]
ref|XP_002461452.1|  hypothetical protein SORBIDRAFT_02g002900        84.3    3e-16   Sorghum bicolor [broomcorn]
ref|XP_010431473.1|  PREDICTED: ferredoxin--NADP reductase, root ...  84.0    5e-16   Camelina sativa [gold-of-pleasure]
ref|NP_849734.1|  ferredoxin--NADP reductase, root isozyme 2          84.0    5e-16   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010460850.1|  PREDICTED: ferredoxin--NADP reductase, root ...  84.0    6e-16   Camelina sativa [gold-of-pleasure]
ref|XP_010422427.1|  PREDICTED: ferredoxin--NADP reductase, root ...  83.6    7e-16   Camelina sativa [gold-of-pleasure]
ref|XP_010478464.1|  PREDICTED: ferredoxin--NADP reductase, root ...  82.8    1e-15   Camelina sativa [gold-of-pleasure]
emb|CDY46362.1|  BnaA09g19760D                                        82.8    1e-15   Brassica napus [oilseed rape]
ref|XP_002874840.1|  ATRFNR1                                          82.0    2e-15   
gb|ABF99221.1|  Ferredoxin-NADP reductase, root isozyme, chloropl...  81.3    3e-15   Oryza sativa Japonica Group [Japonica rice]
gb|AAM64825.1|  ferredoxin--NADP+ reductase-like protein              82.0    3e-15   Arabidopsis thaliana [mouse-ear cress]
ref|NP_567293.1|  ferredoxin--NADP reductase, root isozyme 1          82.0    3e-15   Arabidopsis thaliana [mouse-ear cress]
gb|AAM96978.1|  ferredoxin--NADP+ reductase-like protein              81.6    3e-15   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006287955.1|  hypothetical protein CARUB_v10001191mg           81.6    4e-15   Capsella rubella
ref|NP_001051476.1|  Os03g0784700                                     81.3    4e-15   
emb|CDY39167.1|  BnaC09g21770D                                        80.5    1e-14   Brassica napus [oilseed rape]
dbj|BAJ93902.1|  predicted protein                                    80.1    1e-14   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_009114485.1|  PREDICTED: ferredoxin--NADP reductase, root ...  80.1    1e-14   Brassica rapa
ref|NP_001132762.1|  uncharacterized protein LOC100194249             80.1    1e-14   Zea mays [maize]
ref|XP_008650954.1|  PREDICTED: uncharacterized protein LOC100194...  80.1    2e-14   Zea mays [maize]
gb|EMT16236.1|  Ferredoxin--NADP reductase, root isozyme, chlorop...  78.2    5e-14   
ref|XP_006658277.1|  PREDICTED: ferredoxin--NADP reductase, embry...  78.2    6e-14   
ref|NP_001058890.1|  Os07g0147900                                     77.0    1e-13   
ref|XP_002463784.1|  hypothetical protein SORBIDRAFT_01g006100        77.0    2e-13   Sorghum bicolor [broomcorn]
ref|XP_006650686.1|  PREDICTED: ferredoxin--NADP reductase, root ...  76.6    2e-13   Oryza brachyantha
gb|EAZ02773.1|  hypothetical protein OsI_24896                        75.9    5e-13   Oryza sativa Indica Group [Indian rice]
gb|ACG35047.1|  ferredoxin--NADP reductase, embryo isozyme            75.5    5e-13   Zea mays [maize]
gb|EMS61290.1|  Ferredoxin--NADP reductase, root isozyme, chlorop...  75.9    6e-13   Triticum urartu
gb|AGT15976.1|  ferredoxin--NADP reductase                            75.1    8e-13   Saccharum hybrid cultivar R570
ref|XP_004955449.1|  PREDICTED: ferredoxin--NADP reductase, embry...  74.7    9e-13   Setaria italica
ref|XP_010537869.1|  PREDICTED: ferredoxin--NADP reductase, root ...  74.7    1e-12   Tarenaya hassleriana [spider flower]
gb|AEZ00858.1|  putative ferredoxin NADP+ reductase protein           72.4    2e-12   Elaeis guineensis
ref|XP_003558196.1|  PREDICTED: ferredoxin--NADP reductase, root ...  73.6    3e-12   Brachypodium distachyon [annual false brome]
gb|EPS58368.1|  hypothetical protein M569_16446                       72.8    3e-12   Genlisea aurea
ref|XP_008665551.1|  PREDICTED: ferredoxin--NADP reductase, root ...  72.8    5e-12   
emb|CAB81081.1|  ferredoxin--NADP+ reductase-like protein             72.4    5e-12   Arabidopsis thaliana [mouse-ear cress]
gb|EMS52999.1|  Ferredoxin--NADP reductase, embryo isozyme, chlor...  73.6    5e-12   Triticum urartu
ref|XP_007022878.1|  Ferredoxin--NADP reductase, root-type isozym...  71.2    9e-12   
gb|AAB40034.1|  ferredoxin-NADP reductase precursor                   71.2    1e-11   Zea mays [maize]
gb|ACG39703.1|  ferredoxin--NADP reductase, root isozyme              71.6    1e-11   Zea mays [maize]
gb|EMT31879.1|  Ferredoxin--NADP reductase, embryo isozyme, chlor...  70.9    2e-11   
gb|KJB56289.1|  hypothetical protein B456_009G115100                  66.6    4e-10   Gossypium raimondii
dbj|BAA02248.1|  ferredoxin-NADP+ reductase enzyme                    65.9    8e-10   Oryza sativa Japonica Group [Japonica rice]
ref|NP_973942.1|  ferredoxin--NADP reductase, root isozyme 2          64.7    2e-09   Arabidopsis thaliana [mouse-ear cress]
pdb|1JB9|A  Chain A, Crystal Structure Of The Ferredoxin:nadp+ Re...  62.8    1e-08   Zea mays [maize]
pdb|3LO8|A  Chain A, Crystal Structure Of The Oxidized Form Of Fe...  55.5    3e-06   Zea mays [maize]
pdb|3LVB|A  Chain A, Crystal Structure Of The Ferredoxin:nadp+ Re...  55.5    3e-06   Zea mays [maize]



>ref|XP_006363650.1| PREDICTED: ferredoxin--NADP reductase, root-type isozyme, chloroplastic-like 
[Solanum tuberosum]
Length=374

 Score =   130 bits (326),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 69/103 (67%), Positives = 80/103 (78%), Gaps = 2/103 (2%)
 Frame = +3

Query  210  AVSQLMQVSVAVALNGDSSLQRSAFKANSITFNNRSPISFQPFDLKTRNGKSRSQYVVCM  389
            A S + QVSVAV L  DSS +RS FKA S+TF+++S IS    DLK    +SRSQY+VCM
Sbjct  2    AHSAISQVSVAVPLQTDSSFRRSTFKATSLTFSDKSCISMPSIDLKAT--RSRSQYIVCM  59

Query  390  SVQQANIPKVTVSPLSLEDAKEPPLNLYKPKGPYTATIASVER  518
            SVQ A+  KV+VSPLSLEDAKEPPLN+YKPK PYTATI SVER
Sbjct  60   SVQHASKAKVSVSPLSLEDAKEPPLNIYKPKEPYTATIVSVER  102



>sp|O04397.1|FENR2_TOBAC RecName: Full=Ferredoxin--NADP reductase, root-type isozyme, 
chloroplastic; Short=FNR; Flags: Precursor [Nicotiana tabacum]
 dbj|BAA20365.1| ferredoxin-NADP oxidoreductase [Nicotiana tabacum]
Length=375

 Score =   129 bits (325),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 72/104 (69%), Positives = 81/104 (78%), Gaps = 3/104 (3%)
 Frame = +3

Query  210  AVSQLMQVSVAVALNGDSSLQRSAFKANSITFNNRSP-ISFQPFDLKTRNGKSRSQYVVC  386
            A S L QVSVAV L  DSS +RS FKA SITF++RS  IS  P DLK     SR+Q++VC
Sbjct  2    AHSALSQVSVAVPLQTDSSFRRSTFKATSITFSDRSSWISMPPIDLKA--APSRNQHIVC  59

Query  387  MSVQQANIPKVTVSPLSLEDAKEPPLNLYKPKGPYTATIASVER  518
            MSVQQA+  KV+VSPLSLEDAKEPPLN+YKPK PYTATI SVER
Sbjct  60   MSVQQASKAKVSVSPLSLEDAKEPPLNIYKPKEPYTATIVSVER  103



>ref|XP_009614066.1| PREDICTED: ferredoxin--NADP reductase, root-type isozyme, chloroplastic 
[Nicotiana tomentosiformis]
Length=375

 Score =   129 bits (325),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 72/104 (69%), Positives = 81/104 (78%), Gaps = 3/104 (3%)
 Frame = +3

Query  210  AVSQLMQVSVAVALNGDSSLQRSAFKANSITFNNRSP-ISFQPFDLKTRNGKSRSQYVVC  386
            A S L QVSVAV L  DSS +RS FKA SITF++RS  IS  P DLK     SR+Q++VC
Sbjct  2    AHSALSQVSVAVPLQTDSSFRRSTFKATSITFSDRSSWISMPPIDLKA--APSRNQHIVC  59

Query  387  MSVQQANIPKVTVSPLSLEDAKEPPLNLYKPKGPYTATIASVER  518
            MSVQQA+  KV+VSPLSLEDAKEPPLN+YKPK PYTATI SVER
Sbjct  60   MSVQQASKAKVSVSPLSLEDAKEPPLNIYKPKEPYTATIVSVER  103



>ref|XP_006344529.1| PREDICTED: ferredoxin--NADP reductase, root-type isozyme, chloroplastic-like 
[Solanum tuberosum]
Length=374

 Score =   129 bits (324),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 69/103 (67%), Positives = 80/103 (78%), Gaps = 2/103 (2%)
 Frame = +3

Query  210  AVSQLMQVSVAVALNGDSSLQRSAFKANSITFNNRSPISFQPFDLKTRNGKSRSQYVVCM  389
            A S + QVSVAV L  DSS +RS FKA S+TF+++  IS    DLK    +SRSQY+VCM
Sbjct  2    AHSAISQVSVAVPLQTDSSFRRSTFKATSLTFSDKLCISMPSIDLKA--ARSRSQYIVCM  59

Query  390  SVQQANIPKVTVSPLSLEDAKEPPLNLYKPKGPYTATIASVER  518
            SVQQA+  KV+VSPLSLEDAKEPPLN+YKPK PYTATI SVER
Sbjct  60   SVQQASKAKVSVSPLSLEDAKEPPLNIYKPKEPYTATIVSVER  102



>ref|XP_009761528.1| PREDICTED: ferredoxin--NADP reductase, root-type isozyme, chloroplastic 
[Nicotiana sylvestris]
Length=375

 Score =   129 bits (324),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 71/104 (68%), Positives = 82/104 (79%), Gaps = 3/104 (3%)
 Frame = +3

Query  210  AVSQLMQVSVAVALNGDSSLQRSAFKANSITFNNRSP-ISFQPFDLKTRNGKSRSQYVVC  386
            A S L QVSVAV L  DSS +RS FKA S+TF++RS  IS  P DLK    +SR+Q++VC
Sbjct  2    AHSALSQVSVAVPLQTDSSFRRSTFKATSVTFSDRSSWISMPPIDLKAP--RSRNQHIVC  59

Query  387  MSVQQANIPKVTVSPLSLEDAKEPPLNLYKPKGPYTATIASVER  518
            MSVQQA+  KV+VSPLSLEDAKEPPLN+YKPK PYTATI SVER
Sbjct  60   MSVQQASKAKVSVSPLSLEDAKEPPLNIYKPKEPYTATIVSVER  103



>ref|XP_008225595.1| PREDICTED: ferredoxin--NADP reductase, root isozyme, chloroplastic 
[Prunus mume]
Length=377

 Score =   126 bits (317),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 62/99 (63%), Positives = 74/99 (75%), Gaps = 0/99 (0%)
 Frame = +3

Query  222  LMQVSVAVALNGDSSLQRSAFKANSITFNNRSPISFQPFDLKTRNGKSRSQYVVCMSVQQ  401
            + QVS+   +  D S++RS FKA SI FN++S     P DLKT+NG  R+Q +VCMSVQQ
Sbjct  6    ISQVSLTAPVGSDFSIRRSVFKAQSINFNDKSWAPLLPLDLKTKNGGLRNQRIVCMSVQQ  65

Query  402  ANIPKVTVSPLSLEDAKEPPLNLYKPKGPYTATIASVER  518
            A++PKV VSPL LEDA EPPLN YKPK PYTATI SVER
Sbjct  66   ASVPKVAVSPLQLEDANEPPLNTYKPKEPYTATIRSVER  104



>ref|XP_002523191.1| ferredoxin--NADP reductase, putative [Ricinus communis]
 gb|EEF39222.1| ferredoxin--NADP reductase, putative [Ricinus communis]
Length=378

 Score =   125 bits (315),  Expect = 6e-31, Method: Compositional matrix adjust.
 Identities = 65/105 (62%), Positives = 80/105 (76%), Gaps = 0/105 (0%)
 Frame = +3

Query  204  MAAVSQLMQVSVAVALNGDSSLQRSAFKANSITFNNRSPISFQPFDLKTRNGKSRSQYVV  383
            MA  + + QVS+AV +  DS+L+RS FK +SI+F+ +S       DLK+R  + ++QYVV
Sbjct  1    MAHSAAVSQVSLAVPVGSDSTLKRSVFKTHSISFSGKSWAPSLALDLKSRKVQLKNQYVV  60

Query  384  CMSVQQANIPKVTVSPLSLEDAKEPPLNLYKPKGPYTATIASVER  518
            CMSVQQA+  KV VSPL LEDAKEPPLNLYKPK PYTATIASVER
Sbjct  61   CMSVQQASRSKVAVSPLELEDAKEPPLNLYKPKEPYTATIASVER  105



>ref|XP_004231567.1| PREDICTED: ferredoxin--NADP reductase, root-type isozyme, chloroplastic 
[Solanum lycopersicum]
Length=374

 Score =   125 bits (314),  Expect = 7e-31, Method: Compositional matrix adjust.
 Identities = 67/103 (65%), Positives = 79/103 (77%), Gaps = 2/103 (2%)
 Frame = +3

Query  210  AVSQLMQVSVAVALNGDSSLQRSAFKANSITFNNRSPISFQPFDLKTRNGKSRSQYVVCM  389
            A S + QVSVAV L  DSS +RS FKA S+TF+++S IS    DLK    +SRSQY+VCM
Sbjct  2    AHSAISQVSVAVPLQTDSSFRRSTFKATSLTFSDKSCISMPSIDLKAT--RSRSQYIVCM  59

Query  390  SVQQANIPKVTVSPLSLEDAKEPPLNLYKPKGPYTATIASVER  518
            SVQ A+  KV+VSPLSLE+A EPPLN+YKPK PYTATI SVER
Sbjct  60   SVQHASKAKVSVSPLSLENATEPPLNIYKPKEPYTATIVSVER  102



>ref|XP_002263658.2| PREDICTED: ferredoxin--NADP reductase, root isozyme, chloroplastic 
[Vitis vinifera]
 emb|CBI31015.3| unnamed protein product [Vitis vinifera]
Length=377

 Score =   125 bits (314),  Expect = 8e-31, Method: Compositional matrix adjust.
 Identities = 62/97 (64%), Positives = 76/97 (78%), Gaps = 0/97 (0%)
 Frame = +3

Query  228  QVSVAVALNGDSSLQRSAFKANSITFNNRSPISFQPFDLKTRNGKSRSQYVVCMSVQQAN  407
            QVSV V + G+SSL+RS F+ + I+F+ +S       DLKT+N + +++YVVCMSVQQA+
Sbjct  8    QVSVTVPVGGESSLRRSVFQRHIISFHEKSWAPILALDLKTKNVRLKNRYVVCMSVQQAS  67

Query  408  IPKVTVSPLSLEDAKEPPLNLYKPKGPYTATIASVER  518
            IPKV VSPL LEDAK PPLNLYKPK PYTATI SVER
Sbjct  68   IPKVAVSPLELEDAKGPPLNLYKPKEPYTATIVSVER  104



>ref|XP_009362229.1| PREDICTED: ferredoxin--NADP reductase, root isozyme, chloroplastic 
[Pyrus x bretschneideri]
Length=377

 Score =   125 bits (314),  Expect = 8e-31, Method: Compositional matrix adjust.
 Identities = 62/99 (63%), Positives = 75/99 (76%), Gaps = 0/99 (0%)
 Frame = +3

Query  222  LMQVSVAVALNGDSSLQRSAFKANSITFNNRSPISFQPFDLKTRNGKSRSQYVVCMSVQQ  401
            L Q S+ V +  D SL+RS FKA S+ FN++S     P DLKT+NG+ R+Q +VCMSVQQ
Sbjct  6    LSQGSLTVPVASDFSLRRSVFKARSVNFNDKSWAPILPLDLKTKNGQLRNQRIVCMSVQQ  65

Query  402  ANIPKVTVSPLSLEDAKEPPLNLYKPKGPYTATIASVER  518
            A+ PKV V+PL LEDA EPPLN+YKPK PYTATI SVER
Sbjct  66   ASAPKVNVAPLQLEDANEPPLNIYKPKEPYTATILSVER  104



>ref|XP_008346149.1| PREDICTED: ferredoxin--NADP reductase, root isozyme, chloroplastic 
[Malus domestica]
Length=377

 Score =   123 bits (309),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 61/99 (62%), Positives = 75/99 (76%), Gaps = 0/99 (0%)
 Frame = +3

Query  222  LMQVSVAVALNGDSSLQRSAFKANSITFNNRSPISFQPFDLKTRNGKSRSQYVVCMSVQQ  401
            L Q S+ V +  D SL+RS FKA S+ FN++S     P DLKT+NG+ R+Q +VCMSVQQ
Sbjct  6    LSQGSLTVPVASDFSLRRSVFKAQSVNFNDKSWAPILPLDLKTKNGQLRNQRIVCMSVQQ  65

Query  402  ANIPKVTVSPLSLEDAKEPPLNLYKPKGPYTATIASVER  518
            A+ PKV V+PL LEDA EPPLN++KPK PYTATI SVER
Sbjct  66   ASAPKVNVAPLQLEDANEPPLNIHKPKEPYTATILSVER  104



>ref|XP_008383404.1| PREDICTED: ferredoxin--NADP reductase, root isozyme, chloroplastic-like 
[Malus domestica]
Length=379

 Score =   123 bits (308),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 59/96 (61%), Positives = 73/96 (76%), Gaps = 0/96 (0%)
 Frame = +3

Query  231  VSVAVALNGDSSLQRSAFKANSITFNNRSPISFQPFDLKTRNGKSRSQYVVCMSVQQANI  410
            ++V V L  D SL+RS FKA S++FN++S     P D KT+NG+ R+Q ++CMSVQQA+ 
Sbjct  11   LTVTVPLGSDFSLRRSVFKARSVSFNDKSWTPILPLDFKTKNGRLRNQRILCMSVQQASA  70

Query  411  PKVTVSPLSLEDAKEPPLNLYKPKGPYTATIASVER  518
            PKV V+PL LEDA EPPLN YKPK PYTATI SVER
Sbjct  71   PKVNVAPLQLEDANEPPLNTYKPKEPYTATILSVER  106



>ref|XP_010051952.1| PREDICTED: ferredoxin--NADP reductase, root isozyme, chloroplastic 
[Eucalyptus grandis]
 gb|KCW75780.1| hypothetical protein EUGRSUZ_D00177 [Eucalyptus grandis]
Length=377

 Score =   121 bits (304),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 63/105 (60%), Positives = 78/105 (74%), Gaps = 4/105 (4%)
 Frame = +3

Query  210  AVSQLMQVSVAVALNGDSSLQRSAFKANSITFNN--RSPISFQPFDLKTRNGKSRSQYVV  383
            A S + QVSVAV +  DSS++RS FKA++++F    R+P+     DL T+N +S+  Y +
Sbjct  2    AHSAVSQVSVAVPVGSDSSIRRSVFKAHTLSFCGTLRAPV--LTLDLSTKNARSKKGYTI  59

Query  384  CMSVQQANIPKVTVSPLSLEDAKEPPLNLYKPKGPYTATIASVER  518
            CMSVQQAN PKV VSPL LEDAKEPPLN +KPK PYTATI SVER
Sbjct  60   CMSVQQANAPKVAVSPLQLEDAKEPPLNTFKPKEPYTATIVSVER  104



>ref|XP_007211443.1| hypothetical protein PRUPE_ppa007232mg [Prunus persica]
 gb|EMJ12642.1| hypothetical protein PRUPE_ppa007232mg [Prunus persica]
Length=377

 Score =   120 bits (302),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 60/99 (61%), Positives = 72/99 (73%), Gaps = 0/99 (0%)
 Frame = +3

Query  222  LMQVSVAVALNGDSSLQRSAFKANSITFNNRSPISFQPFDLKTRNGKSRSQYVVCMSVQQ  401
            + Q S+   +  D S++RS FKA SI FN++S       DLKT+NG  R+Q +VCMSVQQ
Sbjct  6    ISQGSLTAPVGSDFSIRRSVFKAQSINFNDKSWAPLLSLDLKTKNGGLRNQRIVCMSVQQ  65

Query  402  ANIPKVTVSPLSLEDAKEPPLNLYKPKGPYTATIASVER  518
            A++PKV VSPL LEDA EPPLN YKPK PYTATI SVER
Sbjct  66   ASVPKVAVSPLQLEDANEPPLNTYKPKEPYTATIRSVER  104



>ref|XP_010098567.1| Ferredoxin--NADP reductase, root isozyme [Morus notabilis]
 gb|EXB75227.1| Ferredoxin--NADP reductase, root isozyme [Morus notabilis]
Length=393

 Score =   120 bits (302),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 58/103 (56%), Positives = 78/103 (76%), Gaps = 1/103 (1%)
 Frame = +3

Query  213  VSQLMQVSVAVALNGDSSLQRSAFKANSITFNNR-SPISFQPFDLKTRNGKSRSQYVVCM  389
            + + + +SV V +  D SL+RS FK N+I+F+++   I     + KT+NG+SR   ++CM
Sbjct  18   IKEFVAISVTVPVGNDCSLRRSVFKTNNISFSDKLWVIPTLSLNFKTKNGRSRDHQILCM  77

Query  390  SVQQANIPKVTVSPLSLEDAKEPPLNLYKPKGPYTATIASVER  518
            SVQQA+ PKV+VSPL+LEDAKE PLN+YKPKGPYTATI SVER
Sbjct  78   SVQQASTPKVSVSPLNLEDAKETPLNIYKPKGPYTATIVSVER  120



>ref|XP_004293987.1| PREDICTED: ferredoxin--NADP reductase, root isozyme, chloroplastic 
[Fragaria vesca subsp. vesca]
Length=380

 Score =   119 bits (299),  Expect = 9e-29, Method: Compositional matrix adjust.
 Identities = 60/107 (56%), Positives = 81/107 (76%), Gaps = 2/107 (2%)
 Frame = +3

Query  204  MAAVSQLMQVSVA--VALNGDSSLQRSAFKANSITFNNRSPISFQPFDLKTRNGKSRSQY  377
            M+ +  L QVS+   V++  D+SL+RS FKA ++ F+++S     P DLKT++G+ R++ 
Sbjct  1    MSHLMALSQVSLGATVSVGSDASLRRSVFKAQNVNFSDKSWAPVLPLDLKTKSGRLRNKS  60

Query  378  VVCMSVQQANIPKVTVSPLSLEDAKEPPLNLYKPKGPYTATIASVER  518
            VVCMSVQQA+ PKV VSPL L++A EPPLN+YKPK PYTATI SVER
Sbjct  61   VVCMSVQQASAPKVAVSPLELDNATEPPLNIYKPKEPYTATIVSVER  107



>gb|KDP34933.1| hypothetical protein JCGZ_09221 [Jatropha curcas]
Length=379

 Score =   119 bits (299),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 61/106 (58%), Positives = 81/106 (76%), Gaps = 1/106 (1%)
 Frame = +3

Query  204  MAAVSQLMQVSVAVALNGDSSLQRSAFKA-NSITFNNRSPISFQPFDLKTRNGKSRSQYV  380
            MA  + + QVS+AV +  DS+L+RS FK  +S+TFN++S       DLK++N + +++Y+
Sbjct  1    MAHSAAVSQVSLAVPVGSDSTLRRSVFKQPHSVTFNDKSWAPSLSLDLKSKNARLKNRYM  60

Query  381  VCMSVQQANIPKVTVSPLSLEDAKEPPLNLYKPKGPYTATIASVER  518
            VCMSVQQA+  KV VSPL LEDA+EPPLN+YKPK PYTATI SVER
Sbjct  61   VCMSVQQASRSKVAVSPLELEDAEEPPLNIYKPKEPYTATIVSVER  106



>ref|XP_009344407.1| PREDICTED: ferredoxin--NADP reductase, root isozyme, chloroplastic-like 
[Pyrus x bretschneideri]
Length=379

 Score =   119 bits (298),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 58/96 (60%), Positives = 71/96 (74%), Gaps = 0/96 (0%)
 Frame = +3

Query  231  VSVAVALNGDSSLQRSAFKANSITFNNRSPISFQPFDLKTRNGKSRSQYVVCMSVQQANI  410
            ++V V L  D SL+RS FKA S+ FN++S     P D KT+ G+ R+Q ++CMSVQQA+ 
Sbjct  11   LTVTVPLGSDFSLRRSGFKARSVNFNDKSWPPILPLDFKTKRGQLRNQRILCMSVQQASA  70

Query  411  PKVTVSPLSLEDAKEPPLNLYKPKGPYTATIASVER  518
            PKV V+PL LEDA EPPLN YKPK PYTATI SVER
Sbjct  71   PKVNVAPLQLEDANEPPLNTYKPKEPYTATILSVER  106



>ref|XP_011038878.1| PREDICTED: ferredoxin--NADP reductase, root isozyme, chloroplastic-like 
[Populus euphratica]
Length=378

 Score =   119 bits (297),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 61/105 (58%), Positives = 75/105 (71%), Gaps = 0/105 (0%)
 Frame = +3

Query  204  MAAVSQLMQVSVAVALNGDSSLQRSAFKANSITFNNRSPISFQPFDLKTRNGKSRSQYVV  383
            MA ++ L QVS AV    D++L+RSAFK  +I+F ++S       DLK+RN   + + +V
Sbjct  1    MAHLAALSQVSFAVPAGSDTTLRRSAFKIQNISFGDKSWHPASSLDLKSRNAGLKKRLLV  60

Query  384  CMSVQQANIPKVTVSPLSLEDAKEPPLNLYKPKGPYTATIASVER  518
            CMSVQQA+  KV VSPL LEDAKEPPLN YKPK PYTATI SVER
Sbjct  61   CMSVQQASRSKVAVSPLGLEDAKEPPLNTYKPKEPYTATIVSVER  105



>ref|XP_002298889.2| ferredoxin-NADP reductase family protein [Populus trichocarpa]
 gb|EEE83694.2| ferredoxin-NADP reductase family protein [Populus trichocarpa]
Length=378

 Score =   118 bits (295),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 61/105 (58%), Positives = 75/105 (71%), Gaps = 0/105 (0%)
 Frame = +3

Query  204  MAAVSQLMQVSVAVALNGDSSLQRSAFKANSITFNNRSPISFQPFDLKTRNGKSRSQYVV  383
            MA ++ L QVS AV    D++L+RSAFK  +I+F ++S       DLK+RN   + + +V
Sbjct  1    MAHLAALSQVSFAVPAGSDTTLRRSAFKIQNISFGDKSWHPASSLDLKSRNTGLKKRLLV  60

Query  384  CMSVQQANIPKVTVSPLSLEDAKEPPLNLYKPKGPYTATIASVER  518
            CMSVQQA+  KV VSPL LEDAKEPPLN YKPK PYTATI SVER
Sbjct  61   CMSVQQASRSKVAVSPLGLEDAKEPPLNTYKPKEPYTATIVSVER  105



>emb|CDP17310.1| unnamed protein product [Coffea canephora]
Length=442

 Score =   117 bits (294),  Expect = 5e-28, Method: Compositional matrix adjust.
 Identities = 65/113 (58%), Positives = 83/113 (73%), Gaps = 3/113 (3%)
 Frame = +3

Query  189  LWSAIMA-AVSQLMQVSVAVA-LNGDSSLQRSAFKANSITFNNRSPISFQPFDLKTRNG-  359
             +S++MA A S L Q++ AV   N DSS +RS  K N++ F+++S IS   FDLKT+N  
Sbjct  57   FYSSMMAQAHSALSQITFAVYPCNSDSSFRRSILKTNNVRFHDKSWISVSDFDLKTKNVV  116

Query  360  KSRSQYVVCMSVQQANIPKVTVSPLSLEDAKEPPLNLYKPKGPYTATIASVER  518
             SRSQ ++C SVQQA+ PKV VSPL LED KEPP++LYKPK PY+ATI SVER
Sbjct  117  HSRSQRILCFSVQQASKPKVGVSPLLLEDPKEPPMHLYKPKEPYSATIVSVER  169



>gb|ACY70395.1| heterotrophic ferredoxin NADP+ oxidoreductase [Populus tremula 
x Populus tremuloides]
Length=378

 Score =   117 bits (292),  Expect = 7e-28, Method: Compositional matrix adjust.
 Identities = 61/105 (58%), Positives = 75/105 (71%), Gaps = 0/105 (0%)
 Frame = +3

Query  204  MAAVSQLMQVSVAVALNGDSSLQRSAFKANSITFNNRSPISFQPFDLKTRNGKSRSQYVV  383
            MA ++ L QVS A     D++L+RSAFK  +I+F ++S       DLK+RN   + + +V
Sbjct  1    MAHLAALSQVSFAAPAGSDTTLRRSAFKIQNISFGDKSWHPALSLDLKSRNTGLKKRLLV  60

Query  384  CMSVQQANIPKVTVSPLSLEDAKEPPLNLYKPKGPYTATIASVER  518
            CMSVQQA+  KV VSPL LEDAKEPPLN YKPK PYTATIASVER
Sbjct  61   CMSVQQASRSKVAVSPLELEDAKEPPLNTYKPKEPYTATIASVER  105



>ref|XP_007147485.1| hypothetical protein PHAVU_006G128400g [Phaseolus vulgaris]
 gb|ESW19479.1| hypothetical protein PHAVU_006G128400g [Phaseolus vulgaris]
Length=377

 Score =   116 bits (290),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 61/99 (62%), Positives = 75/99 (76%), Gaps = 0/99 (0%)
 Frame = +3

Query  222  LMQVSVAVALNGDSSLQRSAFKANSITFNNRSPISFQPFDLKTRNGKSRSQYVVCMSVQQ  401
            L QV+V V ++ D SL+RSAFKA ++ F ++S       DLK  + + RSQ VVCMSVQQ
Sbjct  6    LSQVAVTVPVSSDLSLRRSAFKAPNLNFWDKSWSPVLTLDLKANSSRLRSQNVVCMSVQQ  65

Query  402  ANIPKVTVSPLSLEDAKEPPLNLYKPKGPYTATIASVER  518
            A++PKV+VSPL LEDAKE PLNLYKPK PYTATI SV+R
Sbjct  66   ASVPKVSVSPLDLEDAKETPLNLYKPKEPYTATIVSVDR  104



>ref|XP_011085204.1| PREDICTED: ferredoxin--NADP reductase, root-type isozyme, chloroplastic-like 
[Sesamum indicum]
Length=393

 Score =   114 bits (286),  Expect = 5e-27, Method: Compositional matrix adjust.
 Identities = 59/103 (57%), Positives = 77/103 (75%), Gaps = 0/103 (0%)
 Frame = +3

Query  210  AVSQLMQVSVAVALNGDSSLQRSAFKANSITFNNRSPISFQPFDLKTRNGKSRSQYVVCM  389
            A S + QV VAV++N D+SL +S FK+N+++F+++S  S    D K    ++R + VVCM
Sbjct  18   AHSAITQVPVAVSINADTSLPKSVFKSNNVSFHDKSWSSRLSLDFKIAISRTRGRPVVCM  77

Query  390  SVQQANIPKVTVSPLSLEDAKEPPLNLYKPKGPYTATIASVER  518
            SVQQA+ PKV VSPLSLEDAK+PPL+LYK K PYT TI SVER
Sbjct  78   SVQQASQPKVAVSPLSLEDAKDPPLHLYKNKEPYTGTIVSVER  120



>gb|KJB56287.1| hypothetical protein B456_009G115100 [Gossypium raimondii]
Length=349

 Score =   114 bits (285),  Expect = 6e-27, Method: Compositional matrix adjust.
 Identities = 61/103 (59%), Positives = 73/103 (71%), Gaps = 0/103 (0%)
 Frame = +3

Query  210  AVSQLMQVSVAVALNGDSSLQRSAFKANSITFNNRSPISFQPFDLKTRNGKSRSQYVVCM  389
            A S + QVSVAV +  D SL+RS  K + I+F N+S  S   FDLK+RN +    Y+VCM
Sbjct  2    AQSTVSQVSVAVPVGNDISLRRSVTKRDIISFGNKSWASTLSFDLKSRNAQKNKPYIVCM  61

Query  390  SVQQANIPKVTVSPLSLEDAKEPPLNLYKPKGPYTATIASVER  518
            SVQQA+  K+ VSPL LE AKEPPLN +KPK PYTATI SVER
Sbjct  62   SVQQASKSKIAVSPLELEIAKEPPLNTFKPKEPYTATIVSVER  104



>gb|KJB56286.1| hypothetical protein B456_009G115100 [Gossypium raimondii]
Length=376

 Score =   114 bits (285),  Expect = 9e-27, Method: Compositional matrix adjust.
 Identities = 61/103 (59%), Positives = 73/103 (71%), Gaps = 0/103 (0%)
 Frame = +3

Query  210  AVSQLMQVSVAVALNGDSSLQRSAFKANSITFNNRSPISFQPFDLKTRNGKSRSQYVVCM  389
            A S + QVSVAV +  D SL+RS  K + I+F N+S  S   FDLK+RN +    Y+VCM
Sbjct  2    AQSTVSQVSVAVPVGNDISLRRSVTKRDIISFGNKSWASTLSFDLKSRNAQKNKPYIVCM  61

Query  390  SVQQANIPKVTVSPLSLEDAKEPPLNLYKPKGPYTATIASVER  518
            SVQQA+  K+ VSPL LE AKEPPLN +KPK PYTATI SVER
Sbjct  62   SVQQASKSKIAVSPLELEIAKEPPLNTFKPKEPYTATIVSVER  104



>gb|KJB56288.1| hypothetical protein B456_009G115100 [Gossypium raimondii]
Length=364

 Score =   114 bits (284),  Expect = 9e-27, Method: Compositional matrix adjust.
 Identities = 61/103 (59%), Positives = 73/103 (71%), Gaps = 0/103 (0%)
 Frame = +3

Query  210  AVSQLMQVSVAVALNGDSSLQRSAFKANSITFNNRSPISFQPFDLKTRNGKSRSQYVVCM  389
            A S + QVSVAV +  D SL+RS  K + I+F N+S  S   FDLK+RN +    Y+VCM
Sbjct  2    AQSTVSQVSVAVPVGNDISLRRSVTKRDIISFGNKSWASTLSFDLKSRNAQKNKPYIVCM  61

Query  390  SVQQANIPKVTVSPLSLEDAKEPPLNLYKPKGPYTATIASVER  518
            SVQQA+  K+ VSPL LE AKEPPLN +KPK PYTATI SVER
Sbjct  62   SVQQASKSKIAVSPLELEIAKEPPLNTFKPKEPYTATIVSVER  104



>ref|XP_007022877.1| Root FNR 1 isoform 1 [Theobroma cacao]
 gb|EOY25499.1| Root FNR 1 isoform 1 [Theobroma cacao]
Length=387

 Score =   114 bits (284),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 64/114 (56%), Positives = 78/114 (68%), Gaps = 11/114 (10%)
 Frame = +3

Query  210  AVSQLMQVSVAVALNGDSSLQRSAFK-----------ANSITFNNRSPISFQPFDLKTRN  356
            A S + QVSVAV +  D SL+RS  K            NSI+F ++S +S    DLK+RN
Sbjct  2    AHSAVSQVSVAVPIGSDISLRRSVSKFLTQKHLALLQRNSISFGDKSWVSTLSLDLKSRN  61

Query  357  GKSRSQYVVCMSVQQANIPKVTVSPLSLEDAKEPPLNLYKPKGPYTATIASVER  518
             +  +QY+VCMSVQQA+  KV VSPL LE+AKEPPLNL+KPK PYTATI SVER
Sbjct  62   IQKSNQYIVCMSVQQASKSKVAVSPLELENAKEPPLNLFKPKEPYTATIVSVER  115



>ref|XP_006597058.1| PREDICTED: uncharacterized protein LOC100807968 isoform X1 [Glycine 
max]
Length=378

 Score =   113 bits (282),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 60/105 (57%), Positives = 75/105 (71%), Gaps = 0/105 (0%)
 Frame = +3

Query  204  MAAVSQLMQVSVAVALNGDSSLQRSAFKANSITFNNRSPISFQPFDLKTRNGKSRSQYVV  383
            MA ++   Q++V V +  D SL+RSA KA ++ F ++S       DLK  N   RS++VV
Sbjct  1    MAHLALSQQMAVTVPVGNDLSLRRSAVKAPNLNFWDKSWAPVFTLDLKPNNPSLRSRHVV  60

Query  384  CMSVQQANIPKVTVSPLSLEDAKEPPLNLYKPKGPYTATIASVER  518
            CMSVQQA++ KV VSPL LEDAKEPPLNLYKPK PYTATI SV+R
Sbjct  61   CMSVQQASVSKVNVSPLELEDAKEPPLNLYKPKEPYTATIVSVDR  105



>gb|ACJ84937.1| unknown [Medicago truncatula]
Length=122

 Score =   107 bits (268),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 55/98 (56%), Positives = 72/98 (73%), Gaps = 1/98 (1%)
 Frame = +3

Query  228  QVSVAVALNGDSSLQRSAFKANSITFNNRSPISFQPFDLKTRN-GKSRSQYVVCMSVQQA  404
            Q++V V ++ D S +RS FKA++I F ++S       D+K +N G  R+Q V+CMSVQQA
Sbjct  8    QMAVTVPVSNDFSARRSVFKASNINFRDKSWAPVFALDMKAKNCGWRRNQNVICMSVQQA  67

Query  405  NIPKVTVSPLSLEDAKEPPLNLYKPKGPYTATIASVER  518
            ++PKV VSPL LE+  EPPLNL+KPK PYTATI SVER
Sbjct  68   SVPKVAVSPLELENPAEPPLNLHKPKEPYTATIVSVER  105



>gb|KHG02797.1| hypothetical protein F383_08810 [Gossypium arboreum]
Length=376

 Score =   112 bits (280),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 60/103 (58%), Positives = 72/103 (70%), Gaps = 0/103 (0%)
 Frame = +3

Query  210  AVSQLMQVSVAVALNGDSSLQRSAFKANSITFNNRSPISFQPFDLKTRNGKSRSQYVVCM  389
            A S + QVSVAV +  D SL+RS    N I+F N+S  S   FDLK+RN +    Y+VC+
Sbjct  2    AQSTVSQVSVAVPVGNDISLRRSVTNRNIISFGNKSWASTLAFDLKSRNAQKNKPYIVCL  61

Query  390  SVQQANIPKVTVSPLSLEDAKEPPLNLYKPKGPYTATIASVER  518
            SVQQA+  K+ VSPL LE AKEPPLN +KPK PYTATI SVER
Sbjct  62   SVQQASKSKIAVSPLELEIAKEPPLNTFKPKEPYTATIVSVER  104



>ref|NP_001239798.1| uncharacterized protein LOC100807968 [Glycine max]
 gb|ACU22765.1| unknown [Glycine max]
Length=377

 Score =   111 bits (278),  Expect = 6e-26, Method: Compositional matrix adjust.
 Identities = 59/99 (60%), Positives = 72/99 (73%), Gaps = 0/99 (0%)
 Frame = +3

Query  222  LMQVSVAVALNGDSSLQRSAFKANSITFNNRSPISFQPFDLKTRNGKSRSQYVVCMSVQQ  401
            L Q++V V +  D SL+RSA KA ++ F ++S       DLK  N   RS++VVCMSVQQ
Sbjct  6    LSQMAVTVPVGNDLSLRRSAVKAPNLNFWDKSWAPVFTLDLKPNNPSLRSRHVVCMSVQQ  65

Query  402  ANIPKVTVSPLSLEDAKEPPLNLYKPKGPYTATIASVER  518
            A++ KV VSPL LEDAKEPPLNLYKPK PYTATI SV+R
Sbjct  66   ASVSKVNVSPLELEDAKEPPLNLYKPKEPYTATIVSVDR  104



>gb|EYU19120.1| hypothetical protein MIMGU_mgv1a008446mg [Erythranthe guttata]
Length=373

 Score =   110 bits (276),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 58/103 (56%), Positives = 74/103 (72%), Gaps = 4/103 (4%)
 Frame = +3

Query  210  AVSQLMQVSVAVALNGDSSLQRSAFKANSITFNNRSPISFQPFDLKTRNGKSRSQYVVCM  389
            A S L QV  AV++N D+SL RS FK N+++F N+S       D K  + +S++++ VCM
Sbjct  2    ASSALSQVPAAVSVNSDTSLPRSVFKTNNVSFRNKS----WTLDSKIASSRSKNRFAVCM  57

Query  390  SVQQANIPKVTVSPLSLEDAKEPPLNLYKPKGPYTATIASVER  518
            SVQQA+ PKV VSPL LED KEPPL+LYK K PYTATI SV+R
Sbjct  58   SVQQASTPKVGVSPLDLEDVKEPPLHLYKNKQPYTATIVSVDR  100



>ref|XP_004486455.1| PREDICTED: ferredoxin--NADP reductase, root isozyme, chloroplastic-like 
[Cicer arietinum]
Length=377

 Score =   110 bits (276),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 54/97 (56%), Positives = 71/97 (73%), Gaps = 0/97 (0%)
 Frame = +3

Query  228  QVSVAVALNGDSSLQRSAFKANSITFNNRSPISFQPFDLKTRNGKSRSQYVVCMSVQQAN  407
            Q++V V ++ D S++RSAFK  ++ F ++S       DLK +N   R+  V+CMSVQQA+
Sbjct  8    QIAVTVPVSSDLSIRRSAFKGFNLNFRDKSWAPVFSLDLKAKNSGRRNHNVICMSVQQAS  67

Query  408  IPKVTVSPLSLEDAKEPPLNLYKPKGPYTATIASVER  518
            +PKV VSPL LE+A EPPLNL+KPK PYTATI SVER
Sbjct  68   VPKVAVSPLELENATEPPLNLHKPKEPYTATIVSVER  104



>ref|XP_008439552.1| PREDICTED: ferredoxin--NADP reductase, root isozyme, chloroplastic 
[Cucumis melo]
Length=379

 Score =   108 bits (271),  Expect = 6e-25, Method: Compositional matrix adjust.
 Identities = 57/105 (54%), Positives = 73/105 (70%), Gaps = 2/105 (2%)
 Frame = +3

Query  210  AVSQLMQVSVAVALNGDSSLQRSAFKANSITFNNR--SPISFQPFDLKTRNGKSRSQYVV  383
            A S   QV+VAV +  D S++RS FK +S+ F+++  SP+      L+    +   +  V
Sbjct  2    AHSTFSQVAVAVPVGSDLSVKRSVFKTSSLNFHDKPWSPVIALNLSLRGTRARGWQRQTV  61

Query  384  CMSVQQANIPKVTVSPLSLEDAKEPPLNLYKPKGPYTATIASVER  518
            CMSVQQA+ PKV+V+PL LEDAKEPPLNLYKPK PYTATI SVER
Sbjct  62   CMSVQQASAPKVSVAPLDLEDAKEPPLNLYKPKEPYTATIVSVER  106



>ref|XP_011096684.1| PREDICTED: ferredoxin--NADP reductase, root-type isozyme, chloroplastic-like 
[Sesamum indicum]
Length=401

 Score =   108 bits (271),  Expect = 6e-25, Method: Compositional matrix adjust.
 Identities = 61/107 (57%), Positives = 75/107 (70%), Gaps = 1/107 (1%)
 Frame = +3

Query  201  IMAAVSQLMQVSVAVALNGD-SSLQRSAFKANSITFNNRSPISFQPFDLKTRNGKSRSQY  377
            +  A+S L QV V V +N D SSL  S FK N+++F+N+   S    D    N + + ++
Sbjct  22   LTMALSALSQVPVPVPINTDTSSLSTSLFKNNNVSFHNKLWTSGLCLDSNIANSRLKKRF  81

Query  378  VVCMSVQQANIPKVTVSPLSLEDAKEPPLNLYKPKGPYTATIASVER  518
            VVCMSVQQA+ PKV VSPLSLEDAKEPPL+LYK K PYTATI SVER
Sbjct  82   VVCMSVQQASKPKVGVSPLSLEDAKEPPLHLYKNKEPYTATIVSVER  128



>gb|KHN14331.1| Ferredoxin--NADP reductase, root isozyme, chloroplastic [Glycine 
soja]
Length=369

 Score =   108 bits (270),  Expect = 9e-25, Method: Compositional matrix adjust.
 Identities = 57/96 (59%), Positives = 70/96 (73%), Gaps = 0/96 (0%)
 Frame = +3

Query  231  VSVAVALNGDSSLQRSAFKANSITFNNRSPISFQPFDLKTRNGKSRSQYVVCMSVQQANI  410
            ++V V +  D SL+RSA KA ++ F ++S       DLK  N   RS++VVCMSVQQA++
Sbjct  1    MAVTVPVGNDLSLRRSAVKAPNLNFWDKSWAPVFTLDLKPNNPSLRSRHVVCMSVQQASV  60

Query  411  PKVTVSPLSLEDAKEPPLNLYKPKGPYTATIASVER  518
             KV VSPL LEDAKEPPLNLYKPK PYTATI SV+R
Sbjct  61   SKVNVSPLELEDAKEPPLNLYKPKEPYTATIVSVDR  96



>ref|XP_004134584.1| PREDICTED: ferredoxin--NADP reductase, root isozyme, chloroplastic-like 
[Cucumis sativus]
 ref|XP_004172626.1| PREDICTED: LOW QUALITY PROTEIN: ferredoxin--NADP reductase, root 
isozyme, chloroplastic-like [Cucumis sativus]
 gb|KGN49459.1| hypothetical protein Csa_6G525450 [Cucumis sativus]
Length=378

 Score =   108 bits (269),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 58/104 (56%), Positives = 72/104 (69%), Gaps = 1/104 (1%)
 Frame = +3

Query  210  AVSQLMQVSVAVALNGDSSLQRSAFKANSITFNNRSPIS-FQPFDLKTRNGKSRSQYVVC  386
            A S   QV+VAV +  D S++RS FK  S+ F+++S  S     +   R  ++R    VC
Sbjct  2    AHSTFSQVAVAVPVGSDLSVKRSVFKTRSLNFHDKSWSSPVIALNSNLRGTRARGWQTVC  61

Query  387  MSVQQANIPKVTVSPLSLEDAKEPPLNLYKPKGPYTATIASVER  518
            MSVQQA+ PKV+V+PL LEDAKEPPLNLYKPK PYTATI SVER
Sbjct  62   MSVQQASAPKVSVAPLDLEDAKEPPLNLYKPKEPYTATIVSVER  105



>ref|XP_003594526.1| Ferredoxin-NADP reductase [Medicago truncatula]
 gb|AES64777.1| ferredoxin reductase-like NAD(P) binding domain protein [Medicago 
truncatula]
 gb|AFK47886.1| unknown [Medicago truncatula]
Length=378

 Score =   107 bits (267),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 55/98 (56%), Positives = 72/98 (73%), Gaps = 1/98 (1%)
 Frame = +3

Query  228  QVSVAVALNGDSSLQRSAFKANSITFNNRSPISFQPFDLKTRN-GKSRSQYVVCMSVQQA  404
            Q++V V ++ D S +RS FKA++I F ++S       D+K +N G  R+Q V+CMSVQQA
Sbjct  8    QMAVTVPVSNDFSARRSVFKASNINFRDKSWAPVFALDMKAKNCGWRRNQNVICMSVQQA  67

Query  405  NIPKVTVSPLSLEDAKEPPLNLYKPKGPYTATIASVER  518
            ++PKV VSPL LE+  EPPLNL+KPK PYTATI SVER
Sbjct  68   SVPKVAVSPLELENPAEPPLNLHKPKEPYTATIVSVER  105



>ref|XP_006586681.1| PREDICTED: uncharacterized protein LOC100789291 isoform X1 [Glycine 
max]
Length=378

 Score =   107 bits (266),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 58/105 (55%), Positives = 73/105 (70%), Gaps = 0/105 (0%)
 Frame = +3

Query  204  MAAVSQLMQVSVAVALNGDSSLQRSAFKANSITFNNRSPISFQPFDLKTRNGKSRSQYVV  383
            MA ++   Q++V V +  D SL+RSA KA +  F ++S        LK  N   RS++VV
Sbjct  1    MAHLALSQQMAVTVPVGSDLSLRRSAVKAPNFNFWDKSWAPVFTLYLKANNSSLRSRHVV  60

Query  384  CMSVQQANIPKVTVSPLSLEDAKEPPLNLYKPKGPYTATIASVER  518
             MSVQQA++PKV VSPL LEDAKEPPLNL+KPK PYTATI SV+R
Sbjct  61   FMSVQQASVPKVNVSPLELEDAKEPPLNLHKPKEPYTATIVSVDR  105



>sp|Q41014.2|FENR2_PEA RecName: Full=Ferredoxin--NADP reductase, root isozyme, chloroplastic; 
Short=FNR; Flags: Precursor [Pisum sativum]
Length=377

 Score =   106 bits (265),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 52/97 (54%), Positives = 72/97 (74%), Gaps = 0/97 (0%)
 Frame = +3

Query  228  QVSVAVALNGDSSLQRSAFKANSITFNNRSPISFQPFDLKTRNGKSRSQYVVCMSVQQAN  407
            Q++V V ++ D S++RSAFK++++ F ++S        +K +N   R+  V+CMSVQQA+
Sbjct  8    QMAVTVPVSSDFSVRRSAFKSSNLNFRDKSWAPVFTLGMKAKNCGWRNHNVICMSVQQAS  67

Query  408  IPKVTVSPLSLEDAKEPPLNLYKPKGPYTATIASVER  518
            +PKVTVSPL LE+  EPPLNL+KPK PYTATI SVER
Sbjct  68   VPKVTVSPLELENPSEPPLNLHKPKEPYTATIVSVER  104



>emb|CAA67796.1| ferrodoxin NADP oxidoreductase [Pisum sativum]
Length=378

 Score =   106 bits (265),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 52/97 (54%), Positives = 72/97 (74%), Gaps = 0/97 (0%)
 Frame = +3

Query  228  QVSVAVALNGDSSLQRSAFKANSITFNNRSPISFQPFDLKTRNGKSRSQYVVCMSVQQAN  407
            Q++V V ++ D S++RSAFK++++ F ++S        +K +N   R+  V+CMSVQQA+
Sbjct  9    QMAVTVPVSSDFSVRRSAFKSSNLNFRDKSWAPVFTLGMKAKNCGWRNHNVICMSVQQAS  68

Query  408  IPKVTVSPLSLEDAKEPPLNLYKPKGPYTATIASVER  518
            +PKVTVSPL LE+  EPPLNL+KPK PYTATI SVER
Sbjct  69   VPKVTVSPLELENPSEPPLNLHKPKEPYTATIVSVER  105



>ref|NP_001239859.1| uncharacterized protein LOC100789291 [Glycine max]
 gb|ACU18286.1| unknown [Glycine max]
 gb|KHN23002.1| Ferredoxin--NADP reductase, root isozyme, chloroplastic [Glycine 
soja]
Length=377

 Score =   105 bits (263),  Expect = 7e-24, Method: Compositional matrix adjust.
 Identities = 57/99 (58%), Positives = 70/99 (71%), Gaps = 0/99 (0%)
 Frame = +3

Query  222  LMQVSVAVALNGDSSLQRSAFKANSITFNNRSPISFQPFDLKTRNGKSRSQYVVCMSVQQ  401
            L Q++V V +  D SL+RSA KA +  F ++S        LK  N   RS++VV MSVQQ
Sbjct  6    LSQMAVTVPVGSDLSLRRSAVKAPNFNFWDKSWAPVFTLYLKANNSSLRSRHVVFMSVQQ  65

Query  402  ANIPKVTVSPLSLEDAKEPPLNLYKPKGPYTATIASVER  518
            A++PKV VSPL LEDAKEPPLNL+KPK PYTATI SV+R
Sbjct  66   ASVPKVNVSPLELEDAKEPPLNLHKPKEPYTATIVSVDR  104



>gb|AII16855.1| ferredoxin-NADP(+) reductase, partial [Ocimum basilicum]
Length=372

 Score =   105 bits (262),  Expect = 9e-24, Method: Compositional matrix adjust.
 Identities = 57/99 (58%), Positives = 71/99 (72%), Gaps = 0/99 (0%)
 Frame = +3

Query  222  LMQVSVAVALNGDSSLQRSAFKANSITFNNRSPISFQPFDLKTRNGKSRSQYVVCMSVQQ  401
            L QV VAV++  D SL+ S FK+N+++F+  S  S    D +  + KSRSQ VVCMSVQQ
Sbjct  1    LAQVPVAVSVKNDVSLRSSVFKSNNVSFHETSRASRLSMDFRATSFKSRSQPVVCMSVQQ  60

Query  402  ANIPKVTVSPLSLEDAKEPPLNLYKPKGPYTATIASVER  518
            A+  KV VSPLSLEDAK+PPL+L+K K PY  TI SVER
Sbjct  61   ASKSKVAVSPLSLEDAKDPPLHLFKNKEPYEGTIVSVER  99



>ref|XP_010247806.1| PREDICTED: ferredoxin--NADP reductase, root isozyme, chloroplastic-like 
[Nelumbo nucifera]
Length=377

 Score =   104 bits (259),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 56/103 (54%), Positives = 70/103 (68%), Gaps = 0/103 (0%)
 Frame = +3

Query  210  AVSQLMQVSVAVALNGDSSLQRSAFKANSITFNNRSPISFQPFDLKTRNGKSRSQYVVCM  389
            A S + Q SV V +  DSSL+RS FK  ++ F ++  +S    DLK  N +S S+Y +CM
Sbjct  2    AHSIVTQASVTVPVANDSSLRRSIFKTYNLKFQDKPWVSVLSSDLKINNPRSTSEYKLCM  61

Query  390  SVQQANIPKVTVSPLSLEDAKEPPLNLYKPKGPYTATIASVER  518
            SV+Q    KV VSPL LE AKEPPLN+YKPK P+TATI SVER
Sbjct  62   SVKQVTPSKVAVSPLQLEGAKEPPLNIYKPKEPHTATIVSVER  104



>ref|XP_006448909.1| hypothetical protein CICLE_v100156271mg, partial [Citrus clementina]
 gb|ESR62149.1| hypothetical protein CICLE_v100156271mg, partial [Citrus clementina]
Length=212

 Score =   102 bits (253),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 57/99 (58%), Positives = 70/99 (71%), Gaps = 3/99 (3%)
 Frame = +3

Query  228  QVSVAVALNGDSSLQRSA--FKANSITFNNRSPISFQPFDLKTRNGKSRSQYVVCMSVQQ  401
            QV+VAV +  DS+L RSA  FK  ++    +S       DLK+RN + R++YVVCMSVQQ
Sbjct  8    QVAVAVPVGTDSTL-RSAPLFKTQNLRLGEKSWAPVLSLDLKSRNPRLRNRYVVCMSVQQ  66

Query  402  ANIPKVTVSPLSLEDAKEPPLNLYKPKGPYTATIASVER  518
            A+  KV VSPL LE+  +PPLNLYKPK PYTATI SVER
Sbjct  67   ASKSKVAVSPLELEEQSQPPLNLYKPKEPYTATIVSVER  105



>ref|XP_010691939.1| PREDICTED: ferredoxin--NADP reductase, root isozyme, chloroplastic-like 
[Beta vulgaris subsp. vulgaris]
Length=376

 Score =   103 bits (258),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 54/103 (52%), Positives = 69/103 (67%), Gaps = 0/103 (0%)
 Frame = +3

Query  210  AVSQLMQVSVAVALNGDSSLQRSAFKANSITFNNRSPISFQPFDLKTRNGKSRSQYVVCM  389
            A S + +VSVA+ +  DSS++ S FK  S++F N+S       +LK +N + R   V CM
Sbjct  2    AHSAIAKVSVAIPVTNDSSVKGSVFKTYSVSFGNKSWDPVYTLNLKAKNLRLRKHSVSCM  61

Query  390  SVQQANIPKVTVSPLSLEDAKEPPLNLYKPKGPYTATIASVER  518
            SVQ+A  PKV VSPL LED KEPPL+L+K K PYT TI SVER
Sbjct  62   SVQEAITPKVAVSPLELEDTKEPPLHLFKNKEPYTGTIVSVER  104



>ref|XP_010907335.1| PREDICTED: ferredoxin--NADP reductase, root isozyme, chloroplastic-like 
isoform X1 [Elaeis guineensis]
Length=379

 Score =   103 bits (257),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 54/99 (55%), Positives = 72/99 (73%), Gaps = 2/99 (2%)
 Frame = +3

Query  228  QVSVAVALNGDSSLQRSAFKA-NSITFNNRSPISFQPFDLKTRNGKSRSQY-VVCMSVQQ  401
            QVS+++ +  D SL++S  K  N+++F+N   + F   DL++   +S+ ++ VVCMSVQQ
Sbjct  8    QVSLSLPVGTDVSLRKSGLKGCNNVSFHNNFWVPFTSLDLRSNKVQSKCRFKVVCMSVQQ  67

Query  402  ANIPKVTVSPLSLEDAKEPPLNLYKPKGPYTATIASVER  518
            A+  KV V PL LEDAKEPPLNLYKPK PYTATI SVER
Sbjct  68   ASKSKVAVKPLELEDAKEPPLNLYKPKEPYTATIVSVER  106



>ref|XP_006468308.1| PREDICTED: ferredoxin--NADP reductase, root isozyme, chloroplastic-like 
[Citrus sinensis]
 gb|KDO75263.1| hypothetical protein CISIN_1g017070mg [Citrus sinensis]
Length=378

 Score =   103 bits (257),  Expect = 6e-23, Method: Compositional matrix adjust.
 Identities = 59/105 (56%), Positives = 73/105 (70%), Gaps = 3/105 (3%)
 Frame = +3

Query  210  AVSQLMQVSVAVALNGDSSLQRSA--FKANSITFNNRSPISFQPFDLKTRNGKSRSQYVV  383
            A S + QV+VAV +  DS+L RSA  FK  ++    +S       DLK+RN + R++YVV
Sbjct  2    AHSAVSQVAVAVPVGTDSTL-RSAPLFKTQNLRLGEKSWAPVLSLDLKSRNPRLRNRYVV  60

Query  384  CMSVQQANIPKVTVSPLSLEDAKEPPLNLYKPKGPYTATIASVER  518
            CMSVQQA+  KV VSPL LE+  +PPLNLYKPK PYTATI SVER
Sbjct  61   CMSVQQASKSKVAVSPLELEERSQPPLNLYKPKEPYTATIVSVER  105



>gb|EYU43232.1| hypothetical protein MIMGU_mgv1a008184mg [Erythranthe guttata]
Length=382

 Score =   100 bits (249),  Expect = 6e-22, Method: Compositional matrix adjust.
 Identities = 57/107 (53%), Positives = 78/107 (73%), Gaps = 4/107 (4%)
 Frame = +3

Query  207  AAVSQLMQVSVAVALNGDSSLQRSAFKANSITFNNR-SPISFQPFDLKTRNGKSR--SQY  377
            +A+SQ+  V+V  + + D+SL ++ FK N+++FN + S IS    D KT N +S+  S+ 
Sbjct  4    SALSQV-PVTVCFSYSSDTSLPKTVFKGNNVSFNGKKSWISRLSSDFKTANSRSKGKSRP  62

Query  378  VVCMSVQQANIPKVTVSPLSLEDAKEPPLNLYKPKGPYTATIASVER  518
            V+CMSV+QA+  K  +SPLSLEDAKEPPL+LYK K PYTATI SVER
Sbjct  63   VICMSVEQASKEKAAISPLSLEDAKEPPLHLYKNKEPYTATIVSVER  109



>ref|XP_008795712.1| PREDICTED: ferredoxin--NADP reductase, root isozyme, chloroplastic-like 
[Phoenix dactylifera]
Length=216

 Score = 97.8 bits (242),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 52/99 (53%), Positives = 70/99 (71%), Gaps = 2/99 (2%)
 Frame = +3

Query  228  QVSVAVALNGDSSLQRSAFKA-NSITFNNRSPISFQPFDLKTRNGKSRSQY-VVCMSVQQ  401
            Q S++V +  D SL++S  K  N+++F+N   + F   DL + N +S+ Q+ VVCMS+QQ
Sbjct  8    QASLSVPVRTDVSLRKSGLKGRNNLSFHNNLWVPFTSLDLGSNNVQSKHQFKVVCMSIQQ  67

Query  402  ANIPKVTVSPLSLEDAKEPPLNLYKPKGPYTATIASVER  518
            A+  KV V PL LE+A+ PPLNLYKPK PYTATI SVER
Sbjct  68   ASRSKVAVKPLELENAQGPPLNLYKPKEPYTATIVSVER  106



>ref|XP_006305070.1| hypothetical protein CARUB_v10009436mg [Capsella rubella]
 gb|EOA37968.1| hypothetical protein CARUB_v10009436mg [Capsella rubella]
Length=382

 Score = 97.4 bits (241),  Expect = 7e-21, Method: Compositional matrix adjust.
 Identities = 56/107 (52%), Positives = 71/107 (66%), Gaps = 5/107 (5%)
 Frame = +3

Query  207  AAVSQLMQVSVAVALNGDSSLQRSAFKANSITFNNRSPISFQPFDLKTRNGKSRSQYV--  380
            A VSQ   VSV++    + SL+RS FK NSI+FN+++  S    + KT N +   +Y   
Sbjct  5    AVVSQAGAVSVSIG--NERSLRRSVFKNNSISFNSKTWSSSLALNQKTTNVRDAKRYTNT  62

Query  381  -VCMSVQQANIPKVTVSPLSLEDAKEPPLNLYKPKGPYTATIASVER  518
             +CMSVQQ +  KVTVSP+ LED K+PPLNLYKPK  YTA I SVER
Sbjct  63   TICMSVQQTSSSKVTVSPIELEDPKDPPLNLYKPKESYTAKIVSVER  109



>ref|XP_002893629.1| ATRFNR2 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH69888.1| ATRFNR2 [Arabidopsis lyrata subsp. lyrata]
Length=381

 Score = 97.1 bits (240),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 52/98 (53%), Positives = 67/98 (68%), Gaps = 3/98 (3%)
 Frame = +3

Query  234  SVAVALNGDSSLQRSAFKANSITFNNRSPISFQPFDLKT---RNGKSRSQYVVCMSVQQA  404
            +V+V++  + SL+RS FK NSI+F  +S  S    + KT   R+ K  +   +CMSVQQ 
Sbjct  11   AVSVSIGNERSLRRSVFKNNSISFKGKSWSSSLALNQKTTGIRDAKRYTNTTICMSVQQT  70

Query  405  NIPKVTVSPLSLEDAKEPPLNLYKPKGPYTATIASVER  518
            +  KVTVSP+ LEDAK+PPLNLYKPK  YTA I SVER
Sbjct  71   SSSKVTVSPIDLEDAKDPPLNLYKPKDSYTAKIVSVER  108



>ref|XP_006415461.1| hypothetical protein EUTSA_v10007919mg [Eutrema salsugineum]
 gb|ESQ33814.1| hypothetical protein EUTSA_v10007919mg [Eutrema salsugineum]
Length=381

 Score = 93.6 bits (231),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 54/107 (50%), Positives = 69/107 (64%), Gaps = 5/107 (5%)
 Frame = +3

Query  207  AAVSQLMQVSVAVALNGDSSLQRSAFKANSITFNNR---SPISFQPFDLKTRNGKSRSQY  377
            +AVSQ   VSV +    + SL RS FK NSI+FN++   S ++       TR+ K  +  
Sbjct  4    SAVSQAAAVSVPIG--NERSLSRSVFKNNSISFNSKPWSSSLALNQKTTITRDAKRYTST  61

Query  378  VVCMSVQQANIPKVTVSPLSLEDAKEPPLNLYKPKGPYTATIASVER  518
             +CMSVQQ +  KV+VSP+ LED K+PPLNLYKPK  YTA I SVER
Sbjct  62   TICMSVQQTSSSKVSVSPIELEDPKDPPLNLYKPKDSYTAKIVSVER  108



>ref|XP_006844572.1| hypothetical protein AMTR_s00016p00195680 [Amborella trichopoda]
 gb|ERN06247.1| hypothetical protein AMTR_s00016p00195680 [Amborella trichopoda]
Length=377

 Score = 92.8 bits (229),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 49/103 (48%), Positives = 67/103 (65%), Gaps = 0/103 (0%)
 Frame = +3

Query  210  AVSQLMQVSVAVALNGDSSLQRSAFKANSITFNNRSPISFQPFDLKTRNGKSRSQYVVCM  389
            A S   Q +  V  + D+S++RS+F+ +S++F  ++ +     +   +   S++ Y  CM
Sbjct  2    AYSICSQAANLVHASCDTSVRRSSFQKSSLSFQGKAWVPVLSLNGSPKTLSSKAGYTTCM  61

Query  390  SVQQANIPKVTVSPLSLEDAKEPPLNLYKPKGPYTATIASVER  518
            SVQQA   KV VSPL LEDA+EPPLNLYKPK  YTATI SVER
Sbjct  62   SVQQAKRSKVAVSPLELEDAREPPLNLYKPKDSYTATIVSVER  104



>ref|XP_010907336.1| PREDICTED: ferredoxin--NADP reductase, root isozyme, chloroplastic-like 
isoform X2 [Elaeis guineensis]
Length=360

 Score = 92.8 bits (229),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 46/78 (59%), Positives = 58/78 (74%), Gaps = 1/78 (1%)
 Frame = +3

Query  288  ANSITFNNRSPISFQPFDLKTRNGKSRSQY-VVCMSVQQANIPKVTVSPLSLEDAKEPPL  464
             N+++F+N   + F   DL++   +S+ ++ VVCMSVQQA+  KV V PL LEDAKEPPL
Sbjct  10   CNNVSFHNNFWVPFTSLDLRSNKVQSKCRFKVVCMSVQQASKSKVAVKPLELEDAKEPPL  69

Query  465  NLYKPKGPYTATIASVER  518
            NLYKPK PYTATI SVER
Sbjct  70   NLYKPKEPYTATIVSVER  87



>ref|XP_011016596.1| PREDICTED: ferredoxin--NADP reductase, root isozyme 1, chloroplastic-like 
[Populus euphratica]
Length=355

 Score = 92.4 bits (228),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 46/79 (58%), Positives = 56/79 (71%), Gaps = 0/79 (0%)
 Frame = +3

Query  282  FKANSITFNNRSPISFQPFDLKTRNGKSRSQYVVCMSVQQANIPKVTVSPLSLEDAKEPP  461
             +  +I+F ++S       DLK+RN   + + +VCMSVQQA+  KV VSPL LEDAKEPP
Sbjct  4    LQIQNISFGDKSWHPASSLDLKSRNAGLKKRLLVCMSVQQASRSKVAVSPLGLEDAKEPP  63

Query  462  LNLYKPKGPYTATIASVER  518
            LN YKPK PYTATI SVER
Sbjct  64   LNTYKPKEPYTATIVSVER  82



>ref|XP_009397718.1| PREDICTED: ferredoxin--NADP reductase, root isozyme, chloroplastic-like 
[Musa acuminata subsp. malaccensis]
Length=379

 Score = 90.1 bits (222),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 49/97 (51%), Positives = 68/97 (70%), Gaps = 2/97 (2%)
 Frame = +3

Query  234  SVAVALNGDSSLQRSAFK-ANSITFNNRSPISFQPFDLKTRNGKSRSQY-VVCMSVQQAN  407
            SV+ ++  D+SL+++ FK  N + F+N+  I+    +LK+R   ++ Q+ V+ MSVQQA 
Sbjct  10   SVSPSVGTDASLRKTGFKDHNKLRFDNKLWITLSSVNLKSRYSSTKYQFKVMSMSVQQAV  69

Query  408  IPKVTVSPLSLEDAKEPPLNLYKPKGPYTATIASVER  518
              K+ V PL LE+A EPPLNLYKPK PYTATI SVER
Sbjct  70   RSKIPVQPLELENANEPPLNLYKPKEPYTATIVSVER  106



>ref|XP_006396605.1| hypothetical protein EUTSA_v10028734mg [Eutrema salsugineum]
 gb|ESQ38058.1| hypothetical protein EUTSA_v10028734mg [Eutrema salsugineum]
Length=377

 Score = 89.7 bits (221),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 52/105 (50%), Positives = 65/105 (62%), Gaps = 1/105 (1%)
 Frame = +3

Query  204  MAAVSQLMQVSVAVALNGDSSLQRSAFKANSITFNNRSPISFQPFDLKTRNGKSRSQYVV  383
            MA  +   Q+SVA+    D S  RS  K  SI+F  +S       D K+R    + +  +
Sbjct  1    MALSTHPSQMSVALPTGIDGS-SRSMIKVQSISFTEKSWGPLLRLDSKSRKLSLKKRSTI  59

Query  384  CMSVQQANIPKVTVSPLSLEDAKEPPLNLYKPKGPYTATIASVER  518
            CMS+QQA+  KV+V+PL LED KE PLNLYKPK PYTATI SVER
Sbjct  60   CMSLQQASRSKVSVTPLELEDPKETPLNLYKPKEPYTATIVSVER  104



>emb|CDY09570.1| BnaC05g23490D [Brassica napus]
Length=382

 Score = 89.4 bits (220),  Expect = 6e-18, Method: Compositional matrix adjust.
 Identities = 56/108 (52%), Positives = 67/108 (62%), Gaps = 6/108 (6%)
 Frame = +3

Query  207  AAVSQLMQVSVAVALNGDSSLQRSAFKAN-SITFNNRSPISFQPFDLKT---RNGKSRSQ  374
            +AVSQ   VSV++    + SL RS FK N SI+FN +   S      KT   R+ K  S 
Sbjct  4    SAVSQAAAVSVSIG--NERSLTRSVFKHNNSISFNTKPWSSSLALTQKTSTIRDAKRYSN  61

Query  375  YVVCMSVQQANIPKVTVSPLSLEDAKEPPLNLYKPKGPYTATIASVER  518
              +CMSVQQA+  KV VSP+ LED  +PPLNLYKPK  YTA I SVER
Sbjct  62   TTICMSVQQASSSKVNVSPIELEDPTDPPLNLYKPKDSYTAKIVSVER  109



>gb|KFK44862.1| hypothetical protein AALP_AA1G312100 [Arabis alpina]
Length=383

 Score = 89.4 bits (220),  Expect = 6e-18, Method: Compositional matrix adjust.
 Identities = 50/95 (53%), Positives = 61/95 (64%), Gaps = 3/95 (3%)
 Frame = +3

Query  243  VALNGDSSLQRSAFKANSITFNNRSPISFQPFDLKT---RNGKSRSQYVVCMSVQQANIP  413
            V+   + SL+RS FK NSI+FN++S  S      +T   R  K  +   +CMSVQQ +  
Sbjct  16   VSSGNERSLKRSIFKNNSISFNSKSWASSLALSQRTTSLREAKRCTNTTICMSVQQTSSS  75

Query  414  KVTVSPLSLEDAKEPPLNLYKPKGPYTATIASVER  518
            KV V+PL LED KEPPLNLYKPK  YTA I SVER
Sbjct  76   KVAVTPLELEDPKEPPLNLYKPKSSYTAKIVSVER  110



>ref|XP_006415462.1| hypothetical protein EUTSA_v10007919mg [Eutrema salsugineum]
 gb|ESQ33815.1| hypothetical protein EUTSA_v10007919mg [Eutrema salsugineum]
Length=382

 Score = 89.4 bits (220),  Expect = 6e-18, Method: Compositional matrix adjust.
 Identities = 54/108 (50%), Positives = 69/108 (64%), Gaps = 6/108 (6%)
 Frame = +3

Query  207  AAVSQLMQVSVAVALNGDSSLQRSAFKAN-SITFNNR---SPISFQPFDLKTRNGKSRSQ  374
            +AVSQ   VSV +    + SL RS FK N SI+FN++   S ++       TR+ K  + 
Sbjct  4    SAVSQAAAVSVPIG--NERSLSRSVFKQNNSISFNSKPWSSSLALNQKTTITRDAKRYTS  61

Query  375  YVVCMSVQQANIPKVTVSPLSLEDAKEPPLNLYKPKGPYTATIASVER  518
              +CMSVQQ +  KV+VSP+ LED K+PPLNLYKPK  YTA I SVER
Sbjct  62   TTICMSVQQTSSSKVSVSPIELEDPKDPPLNLYKPKDSYTAKIVSVER  109



>emb|CDY02299.1| BnaA09g26030D [Brassica napus]
Length=382

 Score = 89.0 bits (219),  Expect = 8e-18, Method: Compositional matrix adjust.
 Identities = 56/108 (52%), Positives = 67/108 (62%), Gaps = 6/108 (6%)
 Frame = +3

Query  207  AAVSQLMQVSVAVALNGDSSLQRSAFKAN-SITFNNRSPISFQPFDLKT---RNGKSRSQ  374
            +AVSQ   VSV++    + SL RS FK N SI+FN +   S      KT   R+ K  S 
Sbjct  4    SAVSQAAAVSVSIG--NERSLTRSVFKQNNSISFNTKPWSSSLALTQKTSTIRDAKRYSN  61

Query  375  YVVCMSVQQANIPKVTVSPLSLEDAKEPPLNLYKPKGPYTATIASVER  518
              +CMSVQQA+  KV VSP+ LED  +PPLNLYKPK  YTA I SVER
Sbjct  62   TTICMSVQQASSSKVNVSPIELEDPTDPPLNLYKPKDSYTAKIVSVER  109



>gb|KFK32212.1| hypothetical protein AALP_AA6G212100 [Arabis alpina]
Length=377

 Score = 89.0 bits (219),  Expect = 8e-18, Method: Compositional matrix adjust.
 Identities = 51/105 (49%), Positives = 65/105 (62%), Gaps = 1/105 (1%)
 Frame = +3

Query  204  MAAVSQLMQVSVAVALNGDSSLQRSAFKANSITFNNRSPISFQPFDLKTRNGKSRSQYVV  383
            MA  + + Q+SV+  L G     RS  K  SI+F  +S       D K+R+   + Q  +
Sbjct  1    MALSTPISQMSVSF-LTGVDGSTRSMIKVQSISFTEKSWSPLLGLDSKSRSLGVKKQSTI  59

Query  384  CMSVQQANIPKVTVSPLSLEDAKEPPLNLYKPKGPYTATIASVER  518
            CMS+QQA+  KV V+PL LE+ KE PLNLYKPK PYTATI SVER
Sbjct  60   CMSLQQASKSKVLVTPLELEEPKETPLNLYKPKEPYTATIVSVER  104



>ref|XP_010529363.1| PREDICTED: ferredoxin--NADP reductase, root isozyme 1, chloroplastic 
[Tarenaya hassleriana]
Length=377

 Score = 88.6 bits (218),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 54/107 (50%), Positives = 69/107 (64%), Gaps = 4/107 (4%)
 Frame = +3

Query  198  AIMAAVSQLMQVSVAVALNGDSSLQRSAFKANSITFNNRSPISFQPFDLKTRNGKSRSQY  377
            A+ AA SQ+   SV     GDSS + S  K  SI+F  +S       + ++RN     + 
Sbjct  2    ALSAAASQM---SVLPLPAGDSS-RGSMLKVQSISFGEKSWAPVLRLESRSRNLCVTKRG  57

Query  378  VVCMSVQQANIPKVTVSPLSLEDAKEPPLNLYKPKGPYTATIASVER  518
             +CMSVQQA+  KV+V+PL LEDAKEPPL+L+KPK PYTATI SVER
Sbjct  58   TICMSVQQASKSKVSVTPLELEDAKEPPLHLHKPKEPYTATIVSVER  104



>gb|AAM65564.1| ferrodoxin NADP oxidoreductase, putative [Arabidopsis thaliana]
Length=381

 Score = 88.2 bits (217),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 58/107 (54%), Positives = 71/107 (66%), Gaps = 5/107 (5%)
 Frame = +3

Query  207  AAVSQLMQVSVAVALNGDSSLQRSAFKANSITFNNRSPISFQPFDLKT---RNGKSRSQY  377
            +AVSQ   VSV++      SL+RS FK NSI+FN++S  S    + KT   R+GK     
Sbjct  4    SAVSQAGAVSVSI--ENQRSLRRSVFKNNSISFNSKSWSSSLALNQKTTSIRDGKRYPST  61

Query  378  VVCMSVQQANIPKVTVSPLSLEDAKEPPLNLYKPKGPYTATIASVER  518
             +CMSVQQ +  KVTVSP+ LED K+PPLNLYKPK  YTA I SVER
Sbjct  62   TICMSVQQTSSSKVTVSPIELEDPKDPPLNLYKPKESYTAKIVSVER  108



>ref|NP_564355.1| ferredoxin--NADP reductase, root isozyme 2 [Arabidopsis thaliana]
 gb|AEE31236.1| ferredoxin--NADP reductase, root isozyme 2 [Arabidopsis thaliana]
Length=381

 Score = 88.2 bits (217),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 58/107 (54%), Positives = 71/107 (66%), Gaps = 5/107 (5%)
 Frame = +3

Query  207  AAVSQLMQVSVAVALNGDSSLQRSAFKANSITFNNRSPISFQPFDLKT---RNGKSRSQY  377
            +AVSQ   VSV++      SL+RS FK NSI+FN++S  S    + KT   R+GK     
Sbjct  4    SAVSQAGAVSVSI--ENQRSLRRSVFKNNSISFNSKSWSSSLALNQKTTSIRDGKRYPST  61

Query  378  VVCMSVQQANIPKVTVSPLSLEDAKEPPLNLYKPKGPYTATIASVER  518
             +CMSVQQ +  KVTVSP+ LED K+PPLNLYKPK  YTA I SVER
Sbjct  62   TICMSVQQTSSSKVTVSPIELEDPKDPPLNLYKPKESYTAKIVSVER  108



>ref|XP_010460851.1| PREDICTED: ferredoxin--NADP reductase, root isozyme 2, chloroplastic-like 
isoform X2 [Camelina sativa]
Length=382

 Score = 88.2 bits (217),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 57/107 (53%), Positives = 71/107 (66%), Gaps = 5/107 (5%)
 Frame = +3

Query  207  AAVSQLMQVSVAVALNGDSSLQRSAFKANSITFNNRSPISFQPFDLKTRNGKSRSQYV--  380
            A VSQ   VSV++    + SL+RS FK NSI+FN++S  S    + KT N +   +Y   
Sbjct  5    AVVSQAGAVSVSIG--NERSLRRSVFKNNSISFNSKSWSSSLAMNQKTTNVRDAKRYTNR  62

Query  381  -VCMSVQQANIPKVTVSPLSLEDAKEPPLNLYKPKGPYTATIASVER  518
             +CMSVQQ +  KVTVSP+ LED K+PPLNLYKPK  YTA I SVER
Sbjct  63   TICMSVQQTSSSKVTVSPIELEDPKDPPLNLYKPKESYTAKIVSVER  109



>ref|XP_009397390.1| PREDICTED: ferredoxin--NADP reductase, embryo isozyme, chloroplastic-like 
[Musa acuminata subsp. malaccensis]
Length=379

 Score = 88.2 bits (217),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 53/105 (50%), Positives = 71/105 (68%), Gaps = 4/105 (4%)
 Frame = +3

Query  210  AVSQLMQVSVAVALNGDSSLQRSAFKANS-ITFNNRSPISFQPFDLKTRNGKSRSQY-VV  383
            A+  L  VS +VA   D+SL+++ FK N+ ++++N+  I     +LK+R   ++ Q  VV
Sbjct  4    ALGALASVSPSVA--ADASLRKAGFKINNNLSYDNKLWIPLSSVNLKSRFSSTKFQCKVV  61

Query  384  CMSVQQANIPKVTVSPLSLEDAKEPPLNLYKPKGPYTATIASVER  518
             MSVQQ    K+ V PL LE+AKEPPLNLYKPK PYTATI SVER
Sbjct  62   SMSVQQTVQSKIPVQPLELENAKEPPLNLYKPKEPYTATIVSVER  106



>ref|XP_010422426.1| PREDICTED: ferredoxin--NADP reductase, root isozyme 1, chloroplastic-like 
isoform X1 [Camelina sativa]
Length=377

 Score = 87.8 bits (216),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 53/105 (50%), Positives = 65/105 (62%), Gaps = 1/105 (1%)
 Frame = +3

Query  204  MAAVSQLMQVSVAVALNGDSSLQRSAFKANSITFNNRSPISFQPFDLKTRNGKSRSQYVV  383
            MA  + L Q+SVA+    D S  RS  K  SI+F  +S       D K+R+     +  V
Sbjct  1    MALSTPLSQISVALPTGIDGS-SRSMIKLQSISFTEKSWGPRLRLDSKSRSLCVNKRSTV  59

Query  384  CMSVQQANIPKVTVSPLSLEDAKEPPLNLYKPKGPYTATIASVER  518
            CMS+QQA+  KV V+PL LED KE PLNLY+PK PYTATI SVER
Sbjct  60   CMSLQQASKSKVLVTPLELEDPKETPLNLYRPKEPYTATIVSVER  104



>ref|XP_009115136.1| PREDICTED: ferredoxin--NADP reductase, root isozyme 2, chloroplastic 
[Brassica rapa]
Length=382

 Score = 87.8 bits (216),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 56/108 (52%), Positives = 67/108 (62%), Gaps = 6/108 (6%)
 Frame = +3

Query  207  AAVSQLMQVSVAVALNGDSSLQRSAFKAN-SITFNNRSPISFQPFDLKT---RNGKSRSQ  374
            +AVSQ   VSV++    + SL RS FK N SI+FN +   S      KT   R+ K  S 
Sbjct  4    SAVSQAAAVSVSIG--NERSLTRSVFKQNNSISFNTKPWSSSLALTQKTSTIRDAKRYSN  61

Query  375  YVVCMSVQQANIPKVTVSPLSLEDAKEPPLNLYKPKGPYTATIASVER  518
              +CMSVQQA+  KV VSP+ LED  +PPLNLYKPK  YTA I SVER
Sbjct  62   TTLCMSVQQASSSKVNVSPVELEDPTDPPLNLYKPKDSYTAKIVSVER  109



>ref|XP_010478465.1| PREDICTED: ferredoxin--NADP reductase, root isozyme 2, chloroplastic 
isoform X2 [Camelina sativa]
Length=382

 Score = 87.0 bits (214),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 56/107 (52%), Positives = 70/107 (65%), Gaps = 5/107 (5%)
 Frame = +3

Query  207  AAVSQLMQVSVAVALNGDSSLQRSAFKANSITFNNRSPISFQPFDLKTRNGKSRSQYV--  380
            A VSQ   VSV++    + SL+RS FK NSI+FN++S  S    + KT N +   +Y   
Sbjct  5    AVVSQAGAVSVSIG--NERSLRRSVFKNNSISFNSKSWSSSLALNQKTTNVRDAKRYTSR  62

Query  381  -VCMSVQQANIPKVTVSPLSLEDAKEPPLNLYKPKGPYTATIASVER  518
             +CMSVQQ +  KVTVSP+ LED  +PPLNLYKPK  YTA I SVER
Sbjct  63   TICMSVQQTSCSKVTVSPIELEDPNDPPLNLYKPKESYTAKIVSVER  109



>ref|XP_010431466.1| PREDICTED: ferredoxin--NADP reductase, root isozyme 1, chloroplastic 
isoform X1 [Camelina sativa]
Length=377

 Score = 86.3 bits (212),  Expect = 8e-17, Method: Compositional matrix adjust.
 Identities = 52/105 (50%), Positives = 65/105 (62%), Gaps = 1/105 (1%)
 Frame = +3

Query  204  MAAVSQLMQVSVAVALNGDSSLQRSAFKANSITFNNRSPISFQPFDLKTRNGKSRSQYVV  383
            MA  + L Q+SVA+    D S  RS  K  S +F  +S       D K+R+   + +  V
Sbjct  1    MALSTPLSQMSVALPTGIDGS-TRSMIKLQSQSFTEKSWGPRLRLDSKSRSFSVKKRSTV  59

Query  384  CMSVQQANIPKVTVSPLSLEDAKEPPLNLYKPKGPYTATIASVER  518
            CMS+QQA+  KV V+PL LED KE PLNLY+PK PYTATI SVER
Sbjct  60   CMSLQQASKSKVLVTPLELEDPKETPLNLYRPKEPYTATIVSVER  104



>ref|XP_006287956.1| hypothetical protein CARUB_v10001191mg [Capsella rubella]
 gb|EOA20854.1| hypothetical protein CARUB_v10001191mg [Capsella rubella]
Length=377

 Score = 85.9 bits (211),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 53/105 (50%), Positives = 62/105 (59%), Gaps = 1/105 (1%)
 Frame = +3

Query  204  MAAVSQLMQVSVAVALNGDSSLQRSAFKANSITFNNRSPISFQPFDLKTRNGKSRSQYVV  383
            MA  + L Q+SV +    D S  RS  K  SI F   S  S    D K+R+        V
Sbjct  1    MALSTPLSQMSVTLPTGIDGS-SRSMIKLQSINFTETSWGSRLRLDSKSRSLSVNKWSTV  59

Query  384  CMSVQQANIPKVTVSPLSLEDAKEPPLNLYKPKGPYTATIASVER  518
            CMS+QQA+  KV V+PL LED KE PLNLY+PK PYTATI SVER
Sbjct  60   CMSLQQASKSKVLVTPLELEDPKETPLNLYRPKEPYTATIVSVER  104



>gb|KFK44861.1| hypothetical protein AALP_AA1G312100 [Arabis alpina]
Length=384

 Score = 85.1 bits (209),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 50/96 (52%), Positives = 61/96 (64%), Gaps = 4/96 (4%)
 Frame = +3

Query  243  VALNGDSSLQRSAFKAN-SITFNNRSPISFQPFDLKT---RNGKSRSQYVVCMSVQQANI  410
            V+   + SL+RS FK N SI+FN++S  S      +T   R  K  +   +CMSVQQ + 
Sbjct  16   VSSGNERSLKRSIFKQNNSISFNSKSWASSLALSQRTTSLREAKRCTNTTICMSVQQTSS  75

Query  411  PKVTVSPLSLEDAKEPPLNLYKPKGPYTATIASVER  518
             KV V+PL LED KEPPLNLYKPK  YTA I SVER
Sbjct  76   SKVAVTPLELEDPKEPPLNLYKPKSSYTAKIVSVER  111



>ref|XP_002461452.1| hypothetical protein SORBIDRAFT_02g002900 [Sorghum bicolor]
 gb|EER97973.1| hypothetical protein SORBIDRAFT_02g002900 [Sorghum bicolor]
Length=381

 Score = 84.3 bits (207),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 49/107 (46%), Positives = 65/107 (61%), Gaps = 7/107 (7%)
 Frame = +3

Query  210  AVSQLMQVSVAVALNGDSSLQRSAFKANS-ITFNNRSPISFQPFDLKTRNGKSRSQY---  377
            A+   +  + +V +  D   + +A K NS + F N+  I      L  +N   +S++   
Sbjct  5    ALGSQVAAAASVPVGSDCCFKGTALKGNSNLNFRNKPCIGMA---LAWKNKTQQSRHLNK  61

Query  378  VVCMSVQQANIPKVTVSPLSLEDAKEPPLNLYKPKGPYTATIASVER  518
            V CMSVQQA+  KV V P+ LE+AKEPPLNLYKPK PYTATI SVER
Sbjct  62   VFCMSVQQASRSKVAVKPIELENAKEPPLNLYKPKEPYTATIVSVER  108



>ref|XP_010431473.1| PREDICTED: ferredoxin--NADP reductase, root isozyme 1, chloroplastic 
isoform X2 [Camelina sativa]
Length=375

 Score = 84.0 bits (206),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 52/105 (50%), Positives = 65/105 (62%), Gaps = 3/105 (3%)
 Frame = +3

Query  204  MAAVSQLMQVSVAVALNGDSSLQRSAFKANSITFNNRSPISFQPFDLKTRNGKSRSQYVV  383
            MA  + L Q+SVA+    D S  RS  K+ S T  +  P      D K+R+   + +  V
Sbjct  1    MALSTPLSQMSVALPTGIDGS-TRSMIKSQSFTEKSWGPR--LRLDSKSRSFSVKKRSTV  57

Query  384  CMSVQQANIPKVTVSPLSLEDAKEPPLNLYKPKGPYTATIASVER  518
            CMS+QQA+  KV V+PL LED KE PLNLY+PK PYTATI SVER
Sbjct  58   CMSLQQASKSKVLVTPLELEDPKETPLNLYRPKEPYTATIVSVER  102



>ref|NP_849734.1| ferredoxin--NADP reductase, root isozyme 2 [Arabidopsis thaliana]
 sp|Q9S9P8.1|FNRR2_ARATH RecName: Full=Ferredoxin--NADP reductase, root isozyme 2, chloroplastic; 
AltName: Full=Root FNR 2; Short=AtRFNR2; Flags: 
Precursor [Arabidopsis thaliana]
 gb|AAF19753.1|AC009917_12 Strong similarity to gi|3913653 Ferredoxin-NADP Reductase, Embryo 
Isozyme Precurser from Oryza sativa, containing an Oxidoreductase 
FAD/NAD-binding PF|00175 domain. ESTs gb|N38303, 
gb|T21235, gb|AA721819, gb|T44416, gb|AI995147, gb|H76681, gb|N65405, 
gb|F14270 come from this gene [Arabidopsis thaliana]
 gb|AAL11588.1|AF424594_1 At1g30510/F26G16_5 [Arabidopsis thaliana]
 gb|AAM98159.1| ferrodoxin NADP oxidoreductase, putative [Arabidopsis thaliana]
 gb|AAP37827.1| At1g30510 [Arabidopsis thaliana]
 gb|AEE31237.1| ferredoxin--NADP reductase, root isozyme 2 [Arabidopsis thaliana]
Length=382

 Score = 84.0 bits (206),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 58/108 (54%), Positives = 71/108 (66%), Gaps = 6/108 (6%)
 Frame = +3

Query  207  AAVSQLMQVSVAVALNGDSSLQRSAFKAN-SITFNNRSPISFQPFDLKT---RNGKSRSQ  374
            +AVSQ   VSV++      SL+RS FK N SI+FN++S  S    + KT   R+GK    
Sbjct  4    SAVSQAGAVSVSI--ENQRSLRRSVFKQNNSISFNSKSWSSSLALNQKTTSIRDGKRYPS  61

Query  375  YVVCMSVQQANIPKVTVSPLSLEDAKEPPLNLYKPKGPYTATIASVER  518
              +CMSVQQ +  KVTVSP+ LED K+PPLNLYKPK  YTA I SVER
Sbjct  62   TTICMSVQQTSSSKVTVSPIELEDPKDPPLNLYKPKESYTAKIVSVER  109



>ref|XP_010460850.1| PREDICTED: ferredoxin--NADP reductase, root isozyme 2, chloroplastic-like 
isoform X1 [Camelina sativa]
Length=383

 Score = 84.0 bits (206),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 57/108 (53%), Positives = 71/108 (66%), Gaps = 6/108 (6%)
 Frame = +3

Query  207  AAVSQLMQVSVAVALNGDSSLQRSAFKAN-SITFNNRSPISFQPFDLKTRNGKSRSQYV-  380
            A VSQ   VSV++    + SL+RS FK N SI+FN++S  S    + KT N +   +Y  
Sbjct  5    AVVSQAGAVSVSIG--NERSLRRSVFKQNNSISFNSKSWSSSLAMNQKTTNVRDAKRYTN  62

Query  381  --VCMSVQQANIPKVTVSPLSLEDAKEPPLNLYKPKGPYTATIASVER  518
              +CMSVQQ +  KVTVSP+ LED K+PPLNLYKPK  YTA I SVER
Sbjct  63   RTICMSVQQTSSSKVTVSPIELEDPKDPPLNLYKPKESYTAKIVSVER  110



>ref|XP_010422427.1| PREDICTED: ferredoxin--NADP reductase, root isozyme 1, chloroplastic-like 
isoform X2 [Camelina sativa]
Length=375

 Score = 83.6 bits (205),  Expect = 7e-16, Method: Compositional matrix adjust.
 Identities = 53/105 (50%), Positives = 65/105 (62%), Gaps = 3/105 (3%)
 Frame = +3

Query  204  MAAVSQLMQVSVAVALNGDSSLQRSAFKANSITFNNRSPISFQPFDLKTRNGKSRSQYVV  383
            MA  + L Q+SVA+    D S  RS  K  SI+F  +S       D K+R+     +  V
Sbjct  1    MALSTPLSQISVALPTGIDGS-SRSMIK--SISFTEKSWGPRLRLDSKSRSLCVNKRSTV  57

Query  384  CMSVQQANIPKVTVSPLSLEDAKEPPLNLYKPKGPYTATIASVER  518
            CMS+QQA+  KV V+PL LED KE PLNLY+PK PYTATI SVER
Sbjct  58   CMSLQQASKSKVLVTPLELEDPKETPLNLYRPKEPYTATIVSVER  102



>ref|XP_010478464.1| PREDICTED: ferredoxin--NADP reductase, root isozyme 2, chloroplastic 
isoform X1 [Camelina sativa]
Length=383

 Score = 82.8 bits (203),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 56/108 (52%), Positives = 70/108 (65%), Gaps = 6/108 (6%)
 Frame = +3

Query  207  AAVSQLMQVSVAVALNGDSSLQRSAFKAN-SITFNNRSPISFQPFDLKTRNGKSRSQYV-  380
            A VSQ   VSV++    + SL+RS FK N SI+FN++S  S    + KT N +   +Y  
Sbjct  5    AVVSQAGAVSVSIG--NERSLRRSVFKQNNSISFNSKSWSSSLALNQKTTNVRDAKRYTS  62

Query  381  --VCMSVQQANIPKVTVSPLSLEDAKEPPLNLYKPKGPYTATIASVER  518
              +CMSVQQ +  KVTVSP+ LED  +PPLNLYKPK  YTA I SVER
Sbjct  63   RTICMSVQQTSCSKVTVSPIELEDPNDPPLNLYKPKESYTAKIVSVER  110



>emb|CDY46362.1| BnaA09g19760D [Brassica napus]
Length=378

 Score = 82.8 bits (203),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 50/106 (47%), Positives = 65/106 (61%), Gaps = 2/106 (2%)
 Frame = +3

Query  204  MAAVSQLMQVSVAVALNGDSSLQRSAFKANSITFNNRSPISFQPFDLKTRNGKSRSQYVV  383
            MA  + L Q+SVA+ +  D S  RS  K  S++F  +S       D  +R    + +  V
Sbjct  1    MALSTPLSQMSVALPIGIDGS-SRSMIKVQSVSFTEKSCGPLLRLDTVSRKLSLKKRSTV  59

Query  384  CMSVQQ-ANIPKVTVSPLSLEDAKEPPLNLYKPKGPYTATIASVER  518
            CMS+QQ A+  KV+V+PL LED KE PLNLY+PK PYTA I SVER
Sbjct  60   CMSLQQQASRSKVSVTPLELEDPKETPLNLYRPKEPYTAKIVSVER  105



>ref|XP_002874840.1| ATRFNR1 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH51099.1| ATRFNR1 [Arabidopsis lyrata subsp. lyrata]
Length=355

 Score = 82.0 bits (201),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 45/98 (46%), Positives = 60/98 (61%), Gaps = 3/98 (3%)
 Frame = +3

Query  225  MQVSVAVALNGDSSLQRSAFKANSITFNNRSPISFQPFDLKTRNGKSRSQYVVCMSVQQA  404
            M +++   ++G S   RS  K  SI+F  +S       D K+R+     +  +CMS+QQA
Sbjct  1    MSIALPTGIDGSS---RSMIKVQSISFTEKSWSPLLRLDSKSRSLSVNKRSTICMSLQQA  57

Query  405  NIPKVTVSPLSLEDAKEPPLNLYKPKGPYTATIASVER  518
            +  KV V+PL LE  KE PLNLY+PK PYTATI SVER
Sbjct  58   SRSKVAVTPLELEYPKETPLNLYRPKEPYTATIVSVER  95



>gb|ABF99221.1| Ferredoxin-NADP reductase, root isozyme, chloroplast precursor, 
putative, expressed [Oryza sativa Japonica Group]
Length=304

 Score = 81.3 bits (199),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 48/101 (48%), Positives = 63/101 (62%), Gaps = 7/101 (7%)
 Frame = +3

Query  228  QVSVAVALNGDSSLQRSAFKA-NSITFNNRSPISFQPFDLKTRNGKSRSQY---VVCMSV  395
            QV+V+     D  L+ S  +  N+I+F+N+S +      L   +  +R ++   V+CMSV
Sbjct  8    QVAVSAPAGSDRGLRSSGIQGSNNISFSNKSWVGTT---LAWESKATRPRHANKVLCMSV  64

Query  396  QQANIPKVTVSPLSLEDAKEPPLNLYKPKGPYTATIASVER  518
            QQA+  KV V PL LE A EPPLN YKPK PYTATI SVER
Sbjct  65   QQASESKVAVKPLDLESANEPPLNTYKPKEPYTATIVSVER  105



>gb|AAM64825.1| ferredoxin--NADP+ reductase-like protein [Arabidopsis thaliana]
Length=378

 Score = 82.0 bits (201),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 50/109 (46%), Positives = 68/109 (62%), Gaps = 8/109 (7%)
 Frame = +3

Query  204  MAAVSQLMQVSVAVALNGDSSLQRSAFKANSITFNNRSPISFQP----FDLKTRNGKSRS  371
            MA  +   Q+SVA+    D S  RS  K  SI+F ++S   + P     D K+R+   + 
Sbjct  1    MALSTTPSQMSVALPTRIDGS-SRSMIKVQSISFTDKS---WGPPLLRLDSKSRSLGVKK  56

Query  372  QYVVCMSVQQANIPKVTVSPLSLEDAKEPPLNLYKPKGPYTATIASVER  518
            +  +CMS+QQ++  KV V+PL LED KE PLNL++PK PYTATI SVER
Sbjct  57   RSTICMSLQQSSKSKVLVTPLELEDPKETPLNLFRPKEPYTATIVSVER  105



>ref|NP_567293.1| ferredoxin--NADP reductase, root isozyme 1 [Arabidopsis thaliana]
 sp|Q9M0V6.2|FNRR1_ARATH RecName: Full=Ferredoxin--NADP reductase, root isozyme 1, chloroplastic; 
AltName: Full=Root FNR 1; Short=AtRFNR1; Flags: 
Precursor [Arabidopsis thaliana]
 gb|AAL61946.1| ferredoxin-NADP+ reductase-like protein [Arabidopsis thaliana]
 gb|AAM47928.1| ferredoxin-NADP+ reductase-like protein [Arabidopsis thaliana]
 gb|AEE82512.1| ferredoxin--NADP reductase, root isozyme 1 [Arabidopsis thaliana]
Length=378

 Score = 82.0 bits (201),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 50/109 (46%), Positives = 68/109 (62%), Gaps = 8/109 (7%)
 Frame = +3

Query  204  MAAVSQLMQVSVAVALNGDSSLQRSAFKANSITFNNRSPISFQP----FDLKTRNGKSRS  371
            MA  +   Q+SVA+    D S  RS  K  SI+F ++S   + P     D K+R+   + 
Sbjct  1    MALSTTPSQMSVALPTRIDGS-SRSMIKVQSISFTDKS---WGPPLLRLDSKSRSLGVKK  56

Query  372  QYVVCMSVQQANIPKVTVSPLSLEDAKEPPLNLYKPKGPYTATIASVER  518
            +  +CMS+QQ++  KV V+PL LED KE PLNL++PK PYTATI SVER
Sbjct  57   RSTICMSLQQSSKSKVLVTPLELEDPKETPLNLFRPKEPYTATIVSVER  105



>gb|AAM96978.1| ferredoxin--NADP+ reductase-like protein [Arabidopsis thaliana]
Length=378

 Score = 81.6 bits (200),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 50/109 (46%), Positives = 68/109 (62%), Gaps = 8/109 (7%)
 Frame = +3

Query  204  MAAVSQLMQVSVAVALNGDSSLQRSAFKANSITFNNRSPISFQP----FDLKTRNGKSRS  371
            MA  +   Q+SVA+    D S  RS  K  SI+F ++S   + P     D K+R+   + 
Sbjct  1    MALSTTPSQMSVALPTRIDGS-SRSMIKVQSISFTDKS---WGPPLLRLDSKSRSLGVKK  56

Query  372  QYVVCMSVQQANIPKVTVSPLSLEDAKEPPLNLYKPKGPYTATIASVER  518
            +  +CMS+QQ++  KV V+PL LED KE PLNL++PK PYTATI SVER
Sbjct  57   RSTICMSLQQSSKSKVLVTPLELEDPKETPLNLFRPKEPYTATIVSVER  105



>ref|XP_006287955.1| hypothetical protein CARUB_v10001191mg [Capsella rubella]
 gb|EOA20853.1| hypothetical protein CARUB_v10001191mg [Capsella rubella]
Length=375

 Score = 81.6 bits (200),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 53/105 (50%), Positives = 62/105 (59%), Gaps = 3/105 (3%)
 Frame = +3

Query  204  MAAVSQLMQVSVAVALNGDSSLQRSAFKANSITFNNRSPISFQPFDLKTRNGKSRSQYVV  383
            MA  + L Q+SV +    D S  RS  K  SI F   S  S    D K+R+        V
Sbjct  1    MALSTPLSQMSVTLPTGIDGS-SRSMIK--SINFTETSWGSRLRLDSKSRSLSVNKWSTV  57

Query  384  CMSVQQANIPKVTVSPLSLEDAKEPPLNLYKPKGPYTATIASVER  518
            CMS+QQA+  KV V+PL LED KE PLNLY+PK PYTATI SVER
Sbjct  58   CMSLQQASKSKVLVTPLELEDPKETPLNLYRPKEPYTATIVSVER  102



>ref|NP_001051476.1| Os03g0784700 [Oryza sativa Japonica Group]
 sp|P41345.1|FENR2_ORYSJ RecName: Full=Ferredoxin--NADP reductase, root isozyme, chloroplastic; 
Short=FNR; Flags: Precursor [Oryza sativa Japonica 
Group]
 gb|AAK72892.1|AC091123_11 ferredoxin-NADP+ reductase [Oryza sativa Japonica Group]
 dbj|BAA04232.1| ferredoxin-NADP+ reductase [Oryza sativa Japonica Group]
 dbj|BAA07479.1| root ferredoxin-NADP+ reductase [Oryza sativa Japonica Group]
 gb|ABF99220.1| Ferredoxin-NADP reductase, root isozyme, chloroplast precursor, 
putative, expressed [Oryza sativa Japonica Group]
 dbj|BAF13390.1| Os03g0784700 [Oryza sativa Japonica Group]
 gb|EAY92083.1| hypothetical protein OsI_13788 [Oryza sativa Indica Group]
 gb|EAZ28818.1| hypothetical protein OsJ_12850 [Oryza sativa Japonica Group]
 dbj|BAG96344.1| unnamed protein product [Oryza sativa Japonica Group]
 prf||2113196A ferredoxin-NADP oxidoreductase
Length=378

 Score = 81.3 bits (199),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 48/101 (48%), Positives = 63/101 (62%), Gaps = 7/101 (7%)
 Frame = +3

Query  228  QVSVAVALNGDSSLQRSAFKA-NSITFNNRSPISFQPFDLKTRNGKSRSQY---VVCMSV  395
            QV+V+     D  L+ S  +  N+I+F+N+S +      L   +  +R ++   V+CMSV
Sbjct  8    QVAVSAPAGSDRGLRSSGIQGSNNISFSNKSWVGTT---LAWESKATRPRHANKVLCMSV  64

Query  396  QQANIPKVTVSPLSLEDAKEPPLNLYKPKGPYTATIASVER  518
            QQA+  KV V PL LE A EPPLN YKPK PYTATI SVER
Sbjct  65   QQASESKVAVKPLDLESANEPPLNTYKPKEPYTATIVSVER  105



>emb|CDY39167.1| BnaC09g21770D [Brassica napus]
Length=378

 Score = 80.5 bits (197),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 48/106 (45%), Positives = 64/106 (60%), Gaps = 2/106 (2%)
 Frame = +3

Query  204  MAAVSQLMQVSVAVALNGDSSLQRSAFKANSITFNNRSPISFQPFDLKTRNGKSRSQYVV  383
            MA  + L Q+SVA+ +  D S   S  K  S++F  +S +     D  +R    + +  V
Sbjct  1    MALSTPLSQMSVALPIGIDGS-SGSMIKVQSVSFTEKSCVPLLRLDTVSRKLSLKKRSTV  59

Query  384  CMSVQQ-ANIPKVTVSPLSLEDAKEPPLNLYKPKGPYTATIASVER  518
            CMS+QQ A   KV+V+PL LED KE PLNLY+PK PYTA I SV+R
Sbjct  60   CMSLQQQARRSKVSVTPLELEDPKETPLNLYRPKEPYTAKIVSVDR  105



>dbj|BAJ93902.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=376

 Score = 80.1 bits (196),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 49/105 (47%), Positives = 64/105 (61%), Gaps = 5/105 (5%)
 Frame = +3

Query  210  AVSQLMQVSVAVALNG-DSSLQRSAFKA-NSITFNNRSPISFQPFDLKTRNGKSRSQYVV  383
            A +   QV+ +  + G D +++ S  K  NS++F N+S I      L         Q  V
Sbjct  2    ATAAASQVAFSAPVPGSDRAVRSSGIKGTNSLSFGNKSWIGTA---LACDGKAVLQQRHV  58

Query  384  CMSVQQANIPKVTVSPLSLEDAKEPPLNLYKPKGPYTATIASVER  518
            C +VQQ++  KV+V+PL LE AKEPPLN YKPKGPYTATI SVER
Sbjct  59   CRAVQQSSKSKVSVAPLDLESAKEPPLNTYKPKGPYTATIVSVER  103



>ref|XP_009114485.1| PREDICTED: ferredoxin--NADP reductase, root isozyme 1, chloroplastic 
[Brassica rapa]
Length=378

 Score = 80.1 bits (196),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 49/106 (46%), Positives = 65/106 (61%), Gaps = 2/106 (2%)
 Frame = +3

Query  204  MAAVSQLMQVSVAVALNGDSSLQRSAFKANSITFNNRSPISFQPFDLKTRNGKSRSQYVV  383
            MA  + L Q+SVA+ +  D S  RS  K  S++F  +S       D  +R    + +  V
Sbjct  1    MALSTPLSQMSVALPIGIDGS-SRSMIKVQSVSFTEKSCGPLLRLDTVSRKLSLKKRSKV  59

Query  384  CMSVQQ-ANIPKVTVSPLSLEDAKEPPLNLYKPKGPYTATIASVER  518
            CMS+QQ A+  KV+V+PL LE+ KE PLNLY+PK PYTA I SVER
Sbjct  60   CMSLQQQASRSKVSVTPLELEEPKETPLNLYRPKEPYTAKIVSVER  105



>ref|NP_001132762.1| uncharacterized protein LOC100194249 [Zea mays]
 gb|ACF81748.1| unknown [Zea mays]
 tpg|DAA59536.1| TPA: ferredoxin--NADP reductase [Zea mays]
Length=381

 Score = 80.1 bits (196),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 50/105 (48%), Positives = 63/105 (60%), Gaps = 3/105 (3%)
 Frame = +3

Query  210  AVSQLMQVSVAVALNGDSSLQRSAFKANSITFNNRS-PISFQPFDLKTRNGKSRS-QYVV  383
            A+   +  + +V +  DS  + +A K NS T N R+ P        K R  + R    V+
Sbjct  5    ALGSQVAAAASVPVGSDSLAKGAALKGNS-TLNFRTKPCIGMALAWKNRTQQPRRLNKVL  63

Query  384  CMSVQQANIPKVTVSPLSLEDAKEPPLNLYKPKGPYTATIASVER  518
            CMSVQQA+  KV V P+ LE AKEPPL+LYKPK PYTATI SVER
Sbjct  64   CMSVQQASRSKVAVVPIELEKAKEPPLHLYKPKEPYTATIVSVER  108



>ref|XP_008650954.1| PREDICTED: uncharacterized protein LOC100194249 isoform X1 [Zea 
mays]
Length=396

 Score = 80.1 bits (196),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 50/105 (48%), Positives = 63/105 (60%), Gaps = 3/105 (3%)
 Frame = +3

Query  210  AVSQLMQVSVAVALNGDSSLQRSAFKANSITFNNRS-PISFQPFDLKTRNGKSRS-QYVV  383
            A+   +  + +V +  DS  + +A K NS T N R+ P        K R  + R    V+
Sbjct  5    ALGSQVAAAASVPVGSDSLAKGAALKGNS-TLNFRTKPCIGMALAWKNRTQQPRRLNKVL  63

Query  384  CMSVQQANIPKVTVSPLSLEDAKEPPLNLYKPKGPYTATIASVER  518
            CMSVQQA+  KV V P+ LE AKEPPL+LYKPK PYTATI SVER
Sbjct  64   CMSVQQASRSKVAVVPIELEKAKEPPLHLYKPKEPYTATIVSVER  108



>gb|EMT16236.1| Ferredoxin--NADP reductase, root isozyme, chloroplastic [Aegilops 
tauschii]
Length=372

 Score = 78.2 bits (191),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 46/99 (46%), Positives = 62/99 (63%), Gaps = 5/99 (5%)
 Frame = +3

Query  228  QVSVAVALNG-DSSLQRSAFKA-NSITFNNRSPISFQPFDLKTRNGKSRSQYVVCMSVQQ  401
            QV+ +  + G D +++ S  +  NS++F N+S I        ++    R    VC +VQQ
Sbjct  4    QVAFSAPVGGSDRAVRSSGIQGINSLSFGNKSWIG-TALACDSKAAAQRGH--VCRAVQQ  60

Query  402  ANIPKVTVSPLSLEDAKEPPLNLYKPKGPYTATIASVER  518
            ++  KV+V PL LE AKEPPLN YKPKGPYTATI SVER
Sbjct  61   SSKSKVSVVPLDLESAKEPPLNTYKPKGPYTATIVSVER  99



>ref|XP_006658277.1| PREDICTED: ferredoxin--NADP reductase, embryo isozyme, chloroplastic-like 
[Oryza brachyantha]
Length=368

 Score = 78.2 bits (191),  Expect = 6e-14, Method: Compositional matrix adjust.
 Identities = 43/80 (54%), Positives = 54/80 (68%), Gaps = 8/80 (10%)
 Frame = +3

Query  291  NSITFNNRSPI----SFQPFDLKTRNGKSRSQYVVCMSVQQANIPKVTVSPLSLEDAKEP  458
            N++ F N+S I    +++   LK R+       + CMSVQQA+  KV V PL L++AKEP
Sbjct  20   NTVNFCNKSWIGTTLAWESKALKARH----MNKIFCMSVQQASKSKVAVKPLELDNAKEP  75

Query  459  PLNLYKPKGPYTATIASVER  518
            PLNLYKPK PYTATI SVER
Sbjct  76   PLNLYKPKEPYTATIVSVER  95



>ref|NP_001058890.1| Os07g0147900 [Oryza sativa Japonica Group]
 sp|O23877.1|FENR3_ORYSJ RecName: Full=Ferredoxin--NADP reductase, embryo isozyme, chloroplastic; 
Short=FNR; Flags: Precursor [Oryza sativa Japonica 
Group]
 dbj|BAA13417.1| precursor ferredoxin-NADP+ oxidoreductase [Oryza sativa (japonica 
cultivar-group)]
 dbj|BAC83340.1| Ferredoxin--NADP reductase, embryo isozyme, chloroplast precursor 
(FNR) [Oryza sativa Japonica Group]
 dbj|BAF20804.1| Os07g0147900 [Oryza sativa Japonica Group]
 gb|EAZ38695.1| hypothetical protein OsJ_23093 [Oryza sativa Japonica Group]
Length=378

 Score = 77.0 bits (188),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 48/102 (47%), Positives = 63/102 (62%), Gaps = 9/102 (9%)
 Frame = +3

Query  228  QVSVAVALNGDSSLQRSAFKA-NSITFNNRSPI----SFQPFDLKTRNGKSRSQYVVCMS  392
            Q SVA  +      + S+ K  N++ F N+S I    +++   LK+R+       +  MS
Sbjct  8    QASVAAPIGAGGYGRSSSSKGSNTVNFCNKSWIGTTLAWESKALKSRH----MNKIFSMS  63

Query  393  VQQANIPKVTVSPLSLEDAKEPPLNLYKPKGPYTATIASVER  518
            VQQA+  KV V PL L++AKEPPLNLYKPK PYTATI SVER
Sbjct  64   VQQASKSKVAVKPLELDNAKEPPLNLYKPKEPYTATIVSVER  105



>ref|XP_002463784.1| hypothetical protein SORBIDRAFT_01g006100 [Sorghum bicolor]
 gb|EER90782.1| hypothetical protein SORBIDRAFT_01g006100 [Sorghum bicolor]
Length=380

 Score = 77.0 bits (188),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 44/91 (48%), Positives = 58/91 (64%), Gaps = 7/91 (8%)
 Frame = +3

Query  258  DSSLQRSAFKANS-ITFNNRSPISFQPFDLKTRNGKSRSQYV---VCMSVQQANIPKVTV  425
            D   + S  K N+ ++F N+S +      L   +   R ++V   +CMSVQQA+  KV+V
Sbjct  20   DGGARSSGIKGNNNVSFGNKSWVGGT---LAWESSSVRPRHVNKVLCMSVQQASKSKVSV  76

Query  426  SPLSLEDAKEPPLNLYKPKGPYTATIASVER  518
            +PL LE AKEPPLN YKPK P+TATI SVER
Sbjct  77   APLDLESAKEPPLNTYKPKEPFTATIVSVER  107



>ref|XP_006650686.1| PREDICTED: ferredoxin--NADP reductase, root isozyme, chloroplastic-like 
[Oryza brachyantha]
Length=378

 Score = 76.6 bits (187),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 46/99 (46%), Positives = 60/99 (61%), Gaps = 3/99 (3%)
 Frame = +3

Query  228  QVSVAVALNGDSSLQRSAFK-ANSITFNNRSPISFQPFDLKTRNGKSRS-QYVVCMSVQQ  401
            QV V+     D  ++ S  +  NS++F ++S I       +++  + R    V CMSVQQ
Sbjct  8    QVPVSAPAGSDCRVRSSGIQVTNSVSFGSKSWIG-AALAWESKAARPRHVNKVHCMSVQQ  66

Query  402  ANIPKVTVSPLSLEDAKEPPLNLYKPKGPYTATIASVER  518
            A+  KV V PL LE AKEPPLN +KPK PYTATI SVER
Sbjct  67   ASKGKVAVKPLDLESAKEPPLNTFKPKEPYTATIVSVER  105



>gb|EAZ02773.1| hypothetical protein OsI_24896 [Oryza sativa Indica Group]
Length=379

 Score = 75.9 bits (185),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 46/110 (42%), Positives = 65/110 (59%), Gaps = 8/110 (7%)
 Frame = +3

Query  201  IMAAVSQLMQVSVAVALNGDSSLQRSAFKANSITFNNRSPI----SFQPFDLKTRNGKSR  368
            + +A+     V+  +   G      S+  +N++ F N+S I    +++   LK+R+    
Sbjct  1    MASALGAQASVAAPIGAGGYGRRSSSSKGSNTVNFCNKSWIGTTLAWESKALKSRH----  56

Query  369  SQYVVCMSVQQANIPKVTVSPLSLEDAKEPPLNLYKPKGPYTATIASVER  518
               +  MSVQQA+  KV V PL L++AKEPPLNLYKPK PYTATI SVER
Sbjct  57   MNKIFSMSVQQASKSKVAVKPLELDNAKEPPLNLYKPKEPYTATIVSVER  106



>gb|ACG35047.1| ferredoxin--NADP reductase, embryo isozyme [Zea mays]
Length=381

 Score = 75.5 bits (184),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 49/105 (47%), Positives = 62/105 (59%), Gaps = 3/105 (3%)
 Frame = +3

Query  210  AVSQLMQVSVAVALNGDSSLQRSAFKANSITFNNRS-PISFQPFDLKTRNGKSRS-QYVV  383
            A+   +  + +V +  DS  + +A K NS T N R+ P        K R  + R    V+
Sbjct  5    ALGSQVAAAASVPVGSDSLAKGAALKGNS-TLNFRTKPCIGMALAWKNRTQQPRRLNKVL  63

Query  384  CMSVQQANIPKVTVSPLSLEDAKEPPLNLYKPKGPYTATIASVER  518
            CMSVQQA+  KV V P+ LE AKEP L+LYKPK PYTATI SVER
Sbjct  64   CMSVQQASRSKVAVMPVELEKAKEPLLHLYKPKEPYTATIVSVER  108



>gb|EMS61290.1| Ferredoxin--NADP reductase, root isozyme, chloroplastic [Triticum 
urartu]
Length=419

 Score = 75.9 bits (185),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 43/88 (49%), Positives = 58/88 (66%), Gaps = 4/88 (5%)
 Frame = +3

Query  258  DSSLQRSAFKA-NSITFNNRSPISFQPFDLKTRNGKSRSQYVVCMSVQQANIPKVTVSPL  434
            D +++ S  +  NS++F+N+S I            +SR    +C +VQQ++  KV+V+PL
Sbjct  53   DRAVRSSGIQGINSLSFSNKSWIGTALACDSKAAAQSRH---LCRAVQQSSKSKVSVAPL  109

Query  435  SLEDAKEPPLNLYKPKGPYTATIASVER  518
             LE AKEPPLN YKPKGPYTATI SVER
Sbjct  110  DLESAKEPPLNTYKPKGPYTATIVSVER  137



>gb|AGT15976.1| ferredoxin--NADP reductase [Saccharum hybrid cultivar R570]
Length=377

 Score = 75.1 bits (183),  Expect = 8e-13, Method: Compositional matrix adjust.
 Identities = 36/47 (77%), Positives = 39/47 (83%), Gaps = 0/47 (0%)
 Frame = +3

Query  378  VVCMSVQQANIPKVTVSPLSLEDAKEPPLNLYKPKGPYTATIASVER  518
            V CMSVQQA+  KV V P+ LE+AKEPPLNLYKPK PYTATI SVER
Sbjct  58   VFCMSVQQASRSKVAVKPVELENAKEPPLNLYKPKEPYTATIVSVER  104



>ref|XP_004955449.1| PREDICTED: ferredoxin--NADP reductase, embryo isozyme, chloroplastic-like 
[Setaria italica]
Length=380

 Score = 74.7 bits (182),  Expect = 9e-13, Method: Compositional matrix adjust.
 Identities = 46/105 (44%), Positives = 62/105 (59%), Gaps = 2/105 (2%)
 Frame = +3

Query  207  AAVSQLMQVSVAVALNGDSSLQRSAFKANS-ITFNNRSPISFQPFDLKTRNGKSRSQYVV  383
            AA+   +  +    +  D  L  S+ K N+ + F ++  I       KT+  +  ++ V 
Sbjct  4    AALGTQVAATALAPVGSDGFLNGSSLKGNNNLNFRSKPWIRRTLAWEKTQQSRHLNK-VF  62

Query  384  CMSVQQANIPKVTVSPLSLEDAKEPPLNLYKPKGPYTATIASVER  518
            CMSVQ A+  KV V P+ LE+AKEPPLNLYKPK PYTATI SVER
Sbjct  63   CMSVQLASKSKVAVKPVELENAKEPPLNLYKPKEPYTATIVSVER  107



>ref|XP_010537869.1| PREDICTED: ferredoxin--NADP reductase, root isozyme 1, chloroplastic 
[Tarenaya hassleriana]
Length=378

 Score = 74.7 bits (182),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 39/80 (49%), Positives = 53/80 (66%), Gaps = 1/80 (1%)
 Frame = +3

Query  282  FKANSITFNNRSPISFQPFDLKTRNGK-SRSQYVVCMSVQQANIPKVTVSPLSLEDAKEP  458
            F   SI+F  +        + + +N + +R +  +CMSVQQA+  KV+V+PL LEDAK+P
Sbjct  26   FTVQSISFGQKPWTPMLRLESRCKNLRVTRKRGTICMSVQQASKSKVSVNPLELEDAKDP  85

Query  459  PLNLYKPKGPYTATIASVER  518
            PL+LYK K PY ATI SVER
Sbjct  86   PLHLYKTKEPYPATIVSVER  105



>gb|AEZ00858.1| putative ferredoxin NADP+ reductase protein, partial [Elaeis 
guineensis]
Length=217

 Score = 72.4 bits (176),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 36/44 (82%), Positives = 37/44 (84%), Gaps = 0/44 (0%)
 Frame = +3

Query  387  MSVQQANIPKVTVSPLSLEDAKEPPLNLYKPKGPYTATIASVER  518
            MSVQQA+  KV V PL LEDAKEPPLNLYKPK PYTATI SVER
Sbjct  1    MSVQQASKSKVAVKPLELEDAKEPPLNLYKPKEPYTATIVSVER  44



>ref|XP_003558196.1| PREDICTED: ferredoxin--NADP reductase, root isozyme, chloroplastic 
[Brachypodium distachyon]
Length=380

 Score = 73.6 bits (179),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 41/77 (53%), Positives = 48/77 (62%), Gaps = 0/77 (0%)
 Frame = +3

Query  288  ANSITFNNRSPISFQPFDLKTRNGKSRSQYVVCMSVQQANIPKVTVSPLSLEDAKEPPLN  467
             ++++F NRS I            + R    V  SVQQA+  KV V+PL LE AKEPPLN
Sbjct  31   GSNLSFTNRSWIGTTLASESKVAAQRRHVSKVLCSVQQASKSKVAVTPLHLESAKEPPLN  90

Query  468  LYKPKGPYTATIASVER  518
             YKPKGPYTATI SVER
Sbjct  91   TYKPKGPYTATIVSVER  107



>gb|EPS58368.1| hypothetical protein M569_16446, partial [Genlisea aurea]
Length=330

 Score = 72.8 bits (177),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 35/53 (66%), Positives = 42/53 (79%), Gaps = 0/53 (0%)
 Frame = +3

Query  360  KSRSQYVVCMSVQQANIPKVTVSPLSLEDAKEPPLNLYKPKGPYTATIASVER  518
            +SR + VVCMSVQQ +  KV VSPL LE+AKEPPL+++K K PYT TI SVER
Sbjct  3    RSRDRPVVCMSVQQVSTKKVAVSPLVLEEAKEPPLHVFKNKEPYTGTIVSVER  55



>ref|XP_008665551.1| PREDICTED: ferredoxin--NADP reductase, root isozyme, chloroplastic 
[Zea mays]
 gb|ACF87736.1| unknown [Zea mays]
 gb|ACN29024.1| unknown [Zea mays]
 gb|ACR35923.1| unknown [Zea mays]
 gb|ACR36711.1| unknown [Zea mays]
 tpg|DAA51768.1| TPA: ferredoxin-NADP reductase Precursor [Zea mays]
Length=381

 Score = 72.8 bits (177),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 35/50 (70%), Positives = 41/50 (82%), Gaps = 0/50 (0%)
 Frame = +3

Query  366  RSQYVVCMSVQQANIPKVTVSPLSLEDAKEPPLNLYKPKGPYTATIASVE  515
            R+  V+CMSVQQA+  KV+V+PL LE AKEPPLN YKPK P+TATI SVE
Sbjct  58   RASKVLCMSVQQASRSKVSVAPLHLESAKEPPLNTYKPKEPFTATIVSVE  107



>emb|CAB81081.1| ferredoxin--NADP+ reductase-like protein [Arabidopsis thaliana]
Length=360

 Score = 72.4 bits (176),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 39/82 (48%), Positives = 55/82 (67%), Gaps = 7/82 (9%)
 Frame = +3

Query  285  KANSITFNNRSPISFQP----FDLKTRNGKSRSQYVVCMSVQQANIPKVTVSPLSLEDAK  452
            +  SI+F ++S   + P     D K+R+   + +  +CMS+QQ++  KV V+PL LED K
Sbjct  9    QVQSISFTDKS---WGPPLLRLDSKSRSLGVKKRSTICMSLQQSSKSKVLVTPLELEDPK  65

Query  453  EPPLNLYKPKGPYTATIASVER  518
            E PLNL++PK PYTATI SVER
Sbjct  66   ETPLNLFRPKEPYTATIVSVER  87



>gb|EMS52999.1| Ferredoxin--NADP reductase, embryo isozyme, chloroplastic [Triticum 
urartu]
Length=488

 Score = 73.6 bits (179),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 44/99 (44%), Positives = 56/99 (57%), Gaps = 3/99 (3%)
 Frame = +3

Query  228  QVSVAVALNGDSSLQRSAFKANSITFNNRSPISFQPFDLKTRNGKSRSQYVVCMSVQQAN  407
            QV+    +  D    RS          N+S      ++ KT   +  ++ V CMSVQQA+
Sbjct  8    QVAAVAPIGSDGRHYRSCSSLKGNNSRNKSWTGKLAWENKTLQPR-HTKKVFCMSVQQAS  66

Query  408  IPK--VTVSPLSLEDAKEPPLNLYKPKGPYTATIASVER  518
              K  V + PL LE+ KEPPLNLYKPKGPYTA+I SVER
Sbjct  67   KSKCKVAIKPLELENTKEPPLNLYKPKGPYTASIVSVER  105


 Score = 71.6 bits (174),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 35/53 (66%), Positives = 41/53 (77%), Gaps = 2/53 (4%)
 Frame = +3

Query  366  RSQYVVCMSVQQANIPK--VTVSPLSLEDAKEPPLNLYKPKGPYTATIASVER  518
             ++ V CMSVQQA+  K  V + PL LE+ KEPPLNLYKPKGPYTA+I SVER
Sbjct  163  HTKKVFCMSVQQASKSKCKVAIKPLELENTKEPPLNLYKPKGPYTASIVSVER  215



>ref|XP_007022878.1| Ferredoxin--NADP reductase, root-type isozyme, chloroplastic 
isoform 2 [Theobroma cacao]
 gb|EOY25500.1| Ferredoxin--NADP reductase, root-type isozyme, chloroplastic 
isoform 2 [Theobroma cacao]
Length=316

 Score = 71.2 bits (173),  Expect = 9e-12, Method: Compositional matrix adjust.
 Identities = 35/44 (80%), Positives = 38/44 (86%), Gaps = 0/44 (0%)
 Frame = +3

Query  387  MSVQQANIPKVTVSPLSLEDAKEPPLNLYKPKGPYTATIASVER  518
            MSVQQA+  KV VSPL LE+AKEPPLNL+KPK PYTATI SVER
Sbjct  1    MSVQQASKSKVAVSPLELENAKEPPLNLFKPKEPYTATIVSVER  44



>gb|AAB40034.1| ferredoxin-NADP reductase precursor [Zea mays]
Length=327

 Score = 71.2 bits (173),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 34/46 (74%), Positives = 39/46 (85%), Gaps = 0/46 (0%)
 Frame = +3

Query  378  VVCMSVQQANIPKVTVSPLSLEDAKEPPLNLYKPKGPYTATIASVE  515
            V+CMSVQQA+  KV+V+PL LE AKEPPLN YKPK P+TATI SVE
Sbjct  8    VLCMSVQQASRSKVSVAPLHLESAKEPPLNTYKPKEPFTATIVSVE  53



>gb|ACG39703.1| ferredoxin--NADP reductase, root isozyme [Zea mays]
Length=381

 Score = 71.6 bits (174),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 34/46 (74%), Positives = 39/46 (85%), Gaps = 0/46 (0%)
 Frame = +3

Query  378  VVCMSVQQANIPKVTVSPLSLEDAKEPPLNLYKPKGPYTATIASVE  515
            V+CMSVQQA+  KV+V+PL LE AKEPPLN YKPK P+TATI SVE
Sbjct  62   VLCMSVQQASRSKVSVAPLHLESAKEPPLNTYKPKEPFTATIVSVE  107



>gb|EMT31879.1| Ferredoxin--NADP reductase, embryo isozyme, chloroplastic [Aegilops 
tauschii]
Length=378

 Score = 70.9 bits (172),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 43/99 (43%), Positives = 55/99 (56%), Gaps = 3/99 (3%)
 Frame = +3

Query  228  QVSVAVALNGDSSLQRSAFKANSITFNNRSPISFQPFDLKTRNGKSRSQYVVCMSVQQAN  407
            QV+    +  D    RS          N+S      ++ KT   +  ++ V CM VQQA+
Sbjct  8    QVAAVAPIGSDGRHYRSCSSLKGNNSCNKSWTGKLAWENKTLQPR-HTKKVFCMYVQQAS  66

Query  408  IPK--VTVSPLSLEDAKEPPLNLYKPKGPYTATIASVER  518
              K  V + PL LE+ KEPPLNLYKPKGPYTA+I SVER
Sbjct  67   KSKCKVAIKPLELENTKEPPLNLYKPKGPYTASIVSVER  105



>gb|KJB56289.1| hypothetical protein B456_009G115100 [Gossypium raimondii]
Length=316

 Score = 66.6 bits (161),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 33/44 (75%), Positives = 36/44 (82%), Gaps = 0/44 (0%)
 Frame = +3

Query  387  MSVQQANIPKVTVSPLSLEDAKEPPLNLYKPKGPYTATIASVER  518
            MSVQQA+  K+ VSPL LE AKEPPLN +KPK PYTATI SVER
Sbjct  1    MSVQQASKSKIAVSPLELEIAKEPPLNTFKPKEPYTATIVSVER  44



>dbj|BAA02248.1| ferredoxin-NADP+ reductase enzyme [Oryza sativa Japonica Group]
Length=317

 Score = 65.9 bits (159),  Expect = 8e-10, Method: Compositional matrix adjust.
 Identities = 33/44 (75%), Positives = 34/44 (77%), Gaps = 0/44 (0%)
 Frame = +3

Query  387  MSVQQANIPKVTVSPLSLEDAKEPPLNLYKPKGPYTATIASVER  518
            MSVQQA+  KV V PL LE A EPPLN YKPK PYTATI SVER
Sbjct  1    MSVQQASESKVAVKPLDLESANEPPLNTYKPKEPYTATIVSVER  44



>ref|NP_973942.1| ferredoxin--NADP reductase, root isozyme 2 [Arabidopsis thaliana]
 gb|AEE31235.1| ferredoxin--NADP reductase, root isozyme 2 [Arabidopsis thaliana]
Length=317

 Score = 64.7 bits (156),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 32/44 (73%), Positives = 35/44 (80%), Gaps = 0/44 (0%)
 Frame = +3

Query  387  MSVQQANIPKVTVSPLSLEDAKEPPLNLYKPKGPYTATIASVER  518
            MSVQQ +  KVTVSP+ LED K+PPLNLYKPK  YTA I SVER
Sbjct  1    MSVQQTSSSKVTVSPIELEDPKDPPLNLYKPKESYTAKIVSVER  44



>pdb|1JB9|A Chain A, Crystal Structure Of The Ferredoxin:nadp+ Reductase 
From Maize Root At 1.7 Angstroms
Length=316

 Score = 62.8 bits (151),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 31/42 (74%), Positives = 35/42 (83%), Gaps = 0/42 (0%)
 Frame = +3

Query  390  SVQQANIPKVTVSPLSLEDAKEPPLNLYKPKGPYTATIASVE  515
            SVQQA+  KV+V+PL LE AKEPPLN YKPK P+TATI SVE
Sbjct  1    SVQQASRSKVSVAPLHLESAKEPPLNTYKPKEPFTATIVSVE  42



>pdb|3LO8|A Chain A, Crystal Structure Of The Oxidized Form Of Ferredoxin:nadp+ 
Reductase From Maize Root At 1.05 Angstroms
Length=311

 Score = 55.5 bits (132),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 26/34 (76%), Positives = 29/34 (85%), Gaps = 0/34 (0%)
 Frame = +3

Query  414  KVTVSPLSLEDAKEPPLNLYKPKGPYTATIASVE  515
            KV+V+PL LE AKEPPLN YKPK P+TATI SVE
Sbjct  4    KVSVAPLHLESAKEPPLNTYKPKEPFTATIVSVE  37



>pdb|3LVB|A Chain A, Crystal Structure Of The Ferredoxin:nadp+ Reductase 
From Maize Root At 1.7 Angstroms - Test Set Withheld
Length=311

 Score = 55.5 bits (132),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 26/34 (76%), Positives = 29/34 (85%), Gaps = 0/34 (0%)
 Frame = +3

Query  414  KVTVSPLSLEDAKEPPLNLYKPKGPYTATIASVE  515
            KV+V+PL LE AKEPPLN YKPK P+TATI SVE
Sbjct  4    KVSVAPLHLESAKEPPLNTYKPKEPFTATIVSVE  37



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 552470516325