BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFF035B01

Length=524
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009766648.1|  PREDICTED: polyol transporter 5-like               217   4e-64   Nicotiana sylvestris
ref|XP_009596634.1|  PREDICTED: polyol transporter 5-like               216   7e-64   Nicotiana tomentosiformis
ref|XP_008350306.1|  PREDICTED: putative polyol transporter 1           205   3e-62   
gb|KHN39768.1|  Polyol transporter 5                                    211   5e-62   Glycine soja [wild soybean]
gb|KHN25361.1|  Polyol transporter 5                                    210   2e-61   Glycine soja [wild soybean]
ref|XP_003541068.1|  PREDICTED: polyol transporter 5-like               210   2e-61   
ref|XP_009345075.1|  PREDICTED: putative polyol transporter 1           210   2e-61   Pyrus x bretschneideri [bai li]
ref|XP_009344433.1|  PREDICTED: putative polyol transporter 1           208   9e-61   Pyrus x bretschneideri [bai li]
ref|XP_011092774.1|  PREDICTED: polyol transporter 5-like               207   1e-60   Sesamum indicum [beniseed]
ref|XP_008387370.1|  PREDICTED: putative polyol transporter 1           207   2e-60   Malus domestica [apple tree]
gb|AFI61955.1|  polyol transporter                                      207   2e-60   Camellia sinensis [black tea]
gb|ABK29439.1|  sugar transport protein                                 207   3e-60   Coffea canephora [robusta coffee]
emb|CDO97075.1|  unnamed protein product                                207   3e-60   Coffea canephora [robusta coffee]
ref|XP_009375628.1|  PREDICTED: putative polyol transporter 1           207   3e-60   Pyrus x bretschneideri [bai li]
ref|NP_001281033.1|  polyol transporter 5-like                          206   7e-60   Malus domestica [apple tree]
ref|XP_004170410.1|  PREDICTED: LOW QUALITY PROTEIN: polyol trans...    206   8e-60   
ref|XP_004148857.1|  PREDICTED: polyol transporter 5-like               205   1e-59   Cucumis sativus [cucumbers]
ref|XP_004507415.1|  PREDICTED: polyol transporter 5-like               205   1e-59   Cicer arietinum [garbanzo]
gb|EYU42630.1|  hypothetical protein MIMGU_mgv1a0059091mg               195   1e-59   Erythranthe guttata [common monkey flower]
ref|XP_004299107.1|  PREDICTED: polyol transporter 5-like               205   1e-59   Fragaria vesca subsp. vesca
ref|XP_009800568.1|  PREDICTED: polyol transporter 5-like               205   2e-59   Nicotiana sylvestris
gb|KEH30426.1|  polyol/monosaccharide transporter 1                     204   2e-59   Medicago truncatula
emb|CAP58706.1|  putative polyol transporter protein 1                  204   3e-59   Hevea brasiliensis [jebe]
gb|AGG19155.1|  sorbitol transporter                                    204   4e-59   Pyrus pyrifolia [sha li]
ref|XP_009344431.1|  PREDICTED: putative polyol transporter 1           203   5e-59   Pyrus x bretschneideri [bai li]
ref|XP_009375627.1|  PREDICTED: putative polyol transporter 1           203   5e-59   Pyrus x bretschneideri [bai li]
ref|XP_007200585.1|  hypothetical protein PRUPE_ppa007633mg             199   6e-59   
gb|ACB56939.1|  mannitol transporter                                    203   6e-59   Artemisia annua [sweet Annie]
ref|XP_007042744.1|  Polyol/monosaccharide transporter 5                203   9e-59   
ref|XP_008387369.1|  PREDICTED: putative polyol transporter 1 iso...    202   1e-58   
ref|XP_003539021.2|  PREDICTED: polyol transporter 5-like               196   2e-58   
gb|AAT06053.2|  sorbitol transporter                                    201   3e-58   Malus domestica [apple tree]
emb|CAJ29291.1|  putative polyol transporter protein 4                  201   3e-58   Lotus japonicus
gb|ACC61047.1|  mannitol transporter                                    197   6e-58   Gossypium hirsutum [American cotton]
ref|XP_009611551.1|  PREDICTED: polyol transporter 5-like               201   7e-58   Nicotiana tomentosiformis
gb|KDP46230.1|  hypothetical protein JCGZ_10070                         201   7e-58   Jatropha curcas
ref|XP_007208924.1|  hypothetical protein PRUPE_ppb008257mg             193   1e-57   
ref|XP_007131850.1|  hypothetical protein PHAVU_011G046600g             199   1e-57   Phaseolus vulgaris [French bean]
emb|CAP58707.1|  putative polyol transported protein 2                  199   2e-57   Hevea brasiliensis [jebe]
ref|XP_009780685.1|  PREDICTED: polyol transporter 5-like               189   2e-57   Nicotiana sylvestris
gb|KHG20989.1|  Polyol transporter 5 -like protein                      199   2e-57   Gossypium arboreum [tree cotton]
ref|XP_006406559.1|  hypothetical protein EUTSA_v10020495mg             199   3e-57   Eutrema salsugineum [saltwater cress]
gb|AGY96955.1|  polyol transporter 1                                    199   3e-57   Vitis vinifera
ref|XP_002519083.1|  sugar transporter, putative                        199   3e-57   Ricinus communis
ref|NP_001236592.1|  sorbitol-like transporter                          198   3e-57   
ref|XP_003631630.1|  PREDICTED: polyol transporter 5                    198   4e-57   Vitis vinifera
gb|KJB32189.1|  hypothetical protein B456_005G228500                    199   4e-57   Gossypium raimondii
gb|KFK30307.1|  hypothetical protein AALP_AA7G244900                    198   4e-57   Arabis alpina [alpine rockcress]
ref|XP_007131851.1|  hypothetical protein PHAVU_011G046700g             198   5e-57   Phaseolus vulgaris [French bean]
gb|EPS69995.1|  sugar transport protein                                 198   7e-57   Genlisea aurea
gb|AAM44082.1|  putative sorbitol transporter                           197   8e-57   Prunus cerasus [pie cherry]
ref|XP_008236795.1|  PREDICTED: polyol transporter 5-like               197   1e-56   Prunus mume [ume]
ref|XP_008393068.1|  PREDICTED: putative polyol transporter 1           197   1e-56   Malus domestica [apple tree]
emb|CAR82416.1|  polyol transporter                                     187   1e-56   Plantago major [cart-track plant]
gb|AAY86779.1|  putative sugar transporter protein                      189   3e-56   Noccaea caerulescens
ref|XP_004300990.1|  PREDICTED: polyol transporter 5-like               196   4e-56   Fragaria vesca subsp. vesca
ref|XP_006365518.1|  PREDICTED: polyol transporter 5-like               196   7e-56   Solanum tuberosum [potatoes]
ref|NP_001287655.1|  polyol transporter 5-like                          195   8e-56   Solanum lycopersicum
ref|XP_011048787.1|  PREDICTED: polyol transporter 5-like               194   1e-55   Populus euphratica
ref|XP_010096202.1|  Polyol transporter 5                               194   2e-55   Morus notabilis
emb|CDY61985.1|  BnaC03g73840D                                          194   2e-55   Brassica napus [oilseed rape]
ref|XP_009135601.1|  PREDICTED: polyol transporter 5                    194   2e-55   Brassica rapa
gb|KGN44323.1|  Sugar transporter                                       193   3e-55   Cucumis sativus [cucumbers]
ref|XP_008795608.1|  PREDICTED: putative polyol transporter 1           193   3e-55   Phoenix dactylifera
gb|KJB12315.1|  hypothetical protein B456_002G011400                    194   3e-55   Gossypium raimondii
ref|XP_010065409.1|  PREDICTED: polyol transporter 5-like               193   3e-55   Eucalyptus grandis [rose gum]
ref|NP_001280902.1|  putative polyol transporter 1                      193   4e-55   Malus domestica [apple tree]
ref|XP_006487182.1|  PREDICTED: polyol transporter 5-like               193   4e-55   Citrus sinensis [apfelsine]
gb|AAO39267.1|AF482011_1  sorbitol transporter                          192   4e-55   Prunus cerasus [pie cherry]
ref|XP_006423215.1|  hypothetical protein CICLE_v10028170mg             193   4e-55   Citrus clementina [clementine]
ref|XP_002313809.1|  putative sorbitol transporter family protein       193   4e-55   Populus trichocarpa [western balsam poplar]
ref|XP_009112300.1|  PREDICTED: polyol transporter 5                    193   5e-55   Brassica rapa
emb|CDX95491.1|  BnaC01g33830D                                          192   6e-55   
ref|XP_010527590.1|  PREDICTED: polyol transporter 5-like               192   6e-55   Tarenaya hassleriana [spider flower]
ref|XP_007135989.1|  hypothetical protein PHAVU_009G008900g             192   1e-54   Phaseolus vulgaris [French bean]
ref|XP_007199793.1|  hypothetical protein PRUPE_ppa004456mg             191   1e-54   Prunus persica
ref|XP_008387376.1|  PREDICTED: putative polyol transporter 1           192   1e-54   
ref|XP_009375822.1|  PREDICTED: putative polyol transporter 1           192   1e-54   Pyrus x bretschneideri [bai li]
gb|AIU41385.1|  sorbitol transporter 1                                  191   1e-54   Prunus salicina [Japanese plum]
ref|NP_001289249.1|  polyol transporter 5-like                          191   2e-54   Pyrus x bretschneideri [bai li]
ref|XP_008387377.1|  PREDICTED: putative polyol transporter 1           191   2e-54   
ref|XP_004171995.1|  PREDICTED: LOW QUALITY PROTEIN: polyol trans...    191   2e-54   
ref|XP_010065405.1|  PREDICTED: polyol transporter 5-like               191   2e-54   Eucalyptus grandis [rose gum]
gb|ACB86853.1|  mannitol transporter                                    191   2e-54   Citrus sinensis [apfelsine]
ref|XP_008236796.1|  PREDICTED: polyol transporter 5-like               189   7e-54   Prunus mume [ume]
gb|KJB12316.1|  hypothetical protein B456_002G011500                    190   7e-54   Gossypium raimondii
ref|XP_008361285.1|  PREDICTED: putative polyol transporter 1           189   2e-53   
ref|XP_009345071.1|  PREDICTED: putative polyol transporter 1           189   2e-53   Pyrus x bretschneideri [bai li]
ref|XP_009344435.1|  PREDICTED: putative polyol transporter 1           188   2e-53   Pyrus x bretschneideri [bai li]
ref|XP_006577924.1|  PREDICTED: polyol transporter 5-like               188   2e-53   Glycine max [soybeans]
ref|XP_011078883.1|  PREDICTED: polyol transporter 5-like isoform X1    188   3e-53   Sesamum indicum [beniseed]
gb|ACJ85869.1|  unknown                                                 186   3e-53   Medicago truncatula
emb|CDP10064.1|  unnamed protein product                                188   3e-53   Coffea canephora [robusta coffee]
ref|XP_006349565.1|  PREDICTED: polyol transporter 5-like               187   5e-53   Solanum tuberosum [potatoes]
ref|XP_004500821.1|  PREDICTED: polyol transporter 5-like               187   5e-53   Cicer arietinum [garbanzo]
ref|XP_009602627.1|  PREDICTED: polyol transporter 5-like               187   6e-53   Nicotiana tomentosiformis
gb|AFK48916.1|  unknown                                                 177   6e-53   Medicago truncatula
gb|AEX55225.1|  sugar transporter                                       187   6e-53   Allium sativum
ref|XP_009407915.1|  PREDICTED: putative polyol transporter 1           187   8e-53   Musa acuminata subsp. malaccensis [pisang utan]
gb|EMS55536.1|  Polyol transporter 5                                    186   8e-53   Triticum urartu
ref|XP_006423216.1|  hypothetical protein CICLE_v10028174mg             187   1e-52   Citrus clementina [clementine]
ref|XP_011037561.1|  PREDICTED: polyol transporter 5                    187   1e-52   Populus euphratica
ref|XP_003603886.1|  Mannitol transporter                               186   1e-52   Medicago truncatula
ref|XP_006487181.1|  PREDICTED: polyol transporter 5-like               187   1e-52   Citrus sinensis [apfelsine]
ref|XP_008387373.1|  PREDICTED: putative polyol transporter 1           186   1e-52   
ref|XP_010909852.1|  PREDICTED: putative polyol transporter 1           186   2e-52   Elaeis guineensis
ref|XP_009336961.1|  PREDICTED: putative polyol transporter 1           186   2e-52   Pyrus x bretschneideri [bai li]
ref|XP_009344434.1|  PREDICTED: polyol transporter 5-like               185   2e-52   Pyrus x bretschneideri [bai li]
gb|AGG19156.1|  sorbitol transporter                                    185   2e-52   Pyrus pyrifolia [sha li]
emb|CBI32562.3|  unnamed protein product                                182   2e-52   Vitis vinifera
ref|XP_007131852.1|  hypothetical protein PHAVU_011G046800g             186   2e-52   Phaseolus vulgaris [French bean]
ref|XP_009375629.1|  PREDICTED: polyol transporter 5-like               185   2e-52   Pyrus x bretschneideri [bai li]
ref|NP_188513.1|  polyol transporter 5                                  186   2e-52   Arabidopsis thaliana [mouse-ear cress]
ref|NP_001281036.1|  polyol transporter 5-like                          185   2e-52   Malus domestica [apple tree]
gb|AAL85876.2|AF480069_1  mannitol transporter                          186   2e-52   Apium graveolens Dulce Group [celery]
ref|XP_009395604.1|  PREDICTED: putative polyol transporter 1           186   3e-52   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_006349557.1|  PREDICTED: polyol transporter 5-like               185   3e-52   Solanum tuberosum [potatoes]
ref|XP_002305419.2|  hypothetical protein POPTR_0004s15960g             185   3e-52   Populus trichocarpa [western balsam poplar]
ref|XP_008236860.1|  PREDICTED: putative polyol transporter 1           185   4e-52   Prunus mume [ume]
dbj|BAM66296.1|  sorbitol transporter                                   184   4e-52   Pyrus pyrifolia [sha li]
emb|CAD58710.1|  polyol transporter                                     185   4e-52   Plantago major [cart-track plant]
emb|CAD58709.1|  polyol transporter                                     185   5e-52   Plantago major [cart-track plant]
ref|XP_008236773.1|  PREDICTED: putative polyol transporter 1           184   6e-52   Prunus mume [ume]
gb|KCW55335.1|  hypothetical protein EUGRSUZ_I01255                     183   6e-52   Eucalyptus grandis [rose gum]
ref|XP_009121242.1|  PREDICTED: putative polyol transporter 1           177   7e-52   
ref|XP_010497306.1|  PREDICTED: putative polyol transporter 1           175   1e-51   
ref|XP_008345143.1|  PREDICTED: polyol transporter 5-like               184   1e-51   Malus domestica [apple tree]
ref|XP_007199207.1|  hypothetical protein PRUPE_ppa021762mg             184   1e-51   Prunus persica
ref|XP_010690917.1|  PREDICTED: polyol transporter 5 isoform X2         184   1e-51   
ref|XP_009345073.1|  PREDICTED: polyol transporter 5-like               182   2e-51   Pyrus x bretschneideri [bai li]
dbj|BAJ85302.1|  predicted protein                                      184   2e-51   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_010028575.1|  PREDICTED: polyol transporter 5-like               183   2e-51   Eucalyptus grandis [rose gum]
ref|XP_010690916.1|  PREDICTED: polyol transporter 5 isoform X1         184   2e-51   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_010516958.1|  PREDICTED: putative polyol transporter 2           183   2e-51   Camelina sativa [gold-of-pleasure]
gb|EYU37769.1|  hypothetical protein MIMGU_mgv1a005015mg                182   2e-51   Erythranthe guttata [common monkey flower]
ref|XP_007200117.1|  hypothetical protein PRUPE_ppa018884mg             183   2e-51   Prunus persica
emb|CDP17996.1|  unnamed protein product                                183   3e-51   Coffea canephora [robusta coffee]
ref|XP_010507195.1|  PREDICTED: polyol transporter 5                    183   3e-51   Camelina sativa [gold-of-pleasure]
ref|XP_009345072.1|  PREDICTED: putative polyol transporter 1           182   3e-51   
gb|KHG12832.1|  Polyol transporter 5 -like protein                      173   4e-51   Gossypium arboreum [tree cotton]
ref|XP_009396401.1|  PREDICTED: polyol transporter 5-like               182   4e-51   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_006409469.1|  hypothetical protein EUTSA_v10023129mg             182   4e-51   Eutrema salsugineum [saltwater cress]
ref|XP_007200033.1|  hypothetical protein PRUPE_ppa024323mg             182   4e-51   
gb|KHN25431.1|  Polyol transporter 5                                    182   4e-51   Glycine soja [wild soybean]
ref|XP_003607077.1|  Sorbitol-like transporter                          182   5e-51   Medicago truncatula
ref|XP_011088358.1|  PREDICTED: polyol transporter 5-like               182   5e-51   Sesamum indicum [beniseed]
dbj|BAM66295.1|  sorbitol transporter                                   181   5e-51   Pyrus pyrifolia [sha li]
ref|XP_007200254.1|  hypothetical protein PRUPE_ppa015090mg             182   5e-51   Prunus persica
ref|XP_003540961.2|  PREDICTED: polyol transporter 5-like               182   5e-51   Glycine max [soybeans]
ref|XP_008775333.1|  PREDICTED: polyol transporter 5-like               182   5e-51   Phoenix dactylifera
gb|KFK41272.1|  hypothetical protein AALP_AA2G108500                    180   6e-51   Arabis alpina [alpine rockcress]
ref|XP_010468639.1|  PREDICTED: putative polyol transporter 2           181   7e-51   Camelina sativa [gold-of-pleasure]
ref|XP_006299557.1|  hypothetical protein CARUB_v10015731mg             181   7e-51   Capsella rubella
ref|XP_002467638.1|  hypothetical protein SORBIDRAFT_01g031360          182   8e-51   Sorghum bicolor [broomcorn]
ref|XP_008447049.1|  PREDICTED: polyol transporter 5                    181   8e-51   Cucumis melo [Oriental melon]
gb|KDP46229.1|  hypothetical protein JCGZ_10069                         181   9e-51   Jatropha curcas
ref|XP_006384498.1|  hypothetical protein POPTR_0004s15900g             181   9e-51   
ref|XP_010527594.1|  PREDICTED: polyol transporter 5-like isoform X4    181   9e-51   Tarenaya hassleriana [spider flower]
ref|XP_004148312.1|  PREDICTED: polyol transporter 5-like               181   1e-50   
ref|XP_010442448.1|  PREDICTED: putative polyol transporter 2           181   1e-50   Camelina sativa [gold-of-pleasure]
emb|CDP18000.1|  unnamed protein product                                181   1e-50   Coffea canephora [robusta coffee]
ref|XP_010465998.1|  PREDICTED: polyol transporter 5-like               181   1e-50   Camelina sativa [gold-of-pleasure]
ref|XP_010484928.1|  PREDICTED: putative polyol transporter 1           181   1e-50   Camelina sativa [gold-of-pleasure]
ref|XP_010527591.1|  PREDICTED: polyol transporter 5-like isoform X1    181   1e-50   Tarenaya hassleriana [spider flower]
ref|XP_010527593.1|  PREDICTED: polyol transporter 5-like isoform X3    181   1e-50   Tarenaya hassleriana [spider flower]
tpg|DAA45950.1|  TPA: hypothetical protein ZEAMMB73_850316              181   1e-50   
ref|XP_002884156.1|  predicted protein                                  181   1e-50   Arabidopsis lyrata subsp. lyrata
ref|XP_006657888.1|  PREDICTED: polyol transporter 5-like               181   2e-50   Oryza brachyantha
ref|XP_011078884.1|  PREDICTED: polyol transporter 5-like isoform X2    181   2e-50   Sesamum indicum [beniseed]
ref|XP_002886203.1|  hypothetical protein ARALYDRAFT_343514             181   2e-50   Arabidopsis lyrata subsp. lyrata
ref|XP_010527592.1|  PREDICTED: polyol transporter 5-like isoform X2    181   2e-50   Tarenaya hassleriana [spider flower]
ref|XP_007201628.1|  hypothetical protein PRUPE_ppa021469mg             180   2e-50   
ref|XP_010435020.1|  PREDICTED: putative polyol transporter 2           180   2e-50   Camelina sativa [gold-of-pleasure]
ref|XP_008466921.1|  PREDICTED: putative polyol transporter 1           172   3e-50   Cucumis melo [Oriental melon]
gb|KFK40045.1|  hypothetical protein AALP_AA3G322700                    179   3e-50   Arabis alpina [alpine rockcress]
gb|EMT15230.1|  Polyol transporter 5                                    180   4e-50   
ref|NP_179209.1|  polyol/monosaccharide transporter 1                   179   4e-50   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008245258.1|  PREDICTED: polyol transporter 5-like               179   4e-50   Prunus mume [ume]
gb|AAO88964.1|  sorbitol transporter                                    179   4e-50   Malus domestica [apple tree]
ref|XP_008791366.1|  PREDICTED: polyol transporter 5-like               179   4e-50   
ref|XP_010442571.1|  PREDICTED: putative polyol transporter 2           179   4e-50   
ref|XP_006856084.1|  hypothetical protein AMTR_s00059p00122840          179   5e-50   Amborella trichopoda
ref|NP_179210.1|  polyol/monosaccharide transporter 2                   179   5e-50   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010472942.1|  PREDICTED: putative polyol transporter 2           179   5e-50   Camelina sativa [gold-of-pleasure]
ref|XP_010495901.1|  PREDICTED: putative polyol transporter 1           179   5e-50   Camelina sativa [gold-of-pleasure]
ref|XP_010472919.1|  PREDICTED: putative polyol transporter 2           179   5e-50   Camelina sativa [gold-of-pleasure]
ref|XP_004983902.1|  PREDICTED: polyol transporter 5-like isoform X2    179   6e-50   
ref|XP_004983901.1|  PREDICTED: polyol transporter 5-like isoform X1    179   7e-50   Setaria italica
ref|XP_010445995.1|  PREDICTED: putative polyol transporter 2           178   1e-49   Camelina sativa [gold-of-pleasure]
ref|XP_008653287.1|  PREDICTED: polyol transporter 5-like               178   1e-49   Zea mays [maize]
ref|XP_007200584.1|  hypothetical protein PRUPE_ppa007633mg             174   1e-49   
emb|CDY46217.1|  BnaA07g03530D                                          178   1e-49   Brassica napus [oilseed rape]
ref|XP_009121388.1|  PREDICTED: LOW QUALITY PROTEIN: putative pol...    178   1e-49   Brassica rapa
ref|XP_009121227.1|  PREDICTED: putative polyol transporter 1           178   1e-49   Brassica rapa
emb|CDY46218.1|  BnaA07g03520D                                          178   1e-49   Brassica napus [oilseed rape]
ref|XP_002885281.1|  ATPLT5                                             178   2e-49   Arabidopsis lyrata subsp. lyrata
ref|XP_010254894.1|  PREDICTED: polyol transporter 5-like               177   2e-49   Nelumbo nucifera [Indian lotus]
ref|XP_010487804.1|  PREDICTED: polyol transporter 5-like               177   3e-49   Camelina sativa [gold-of-pleasure]
ref|XP_008795606.1|  PREDICTED: polyol transporter 5-like isoform X1    177   3e-49   Phoenix dactylifera
dbj|BAC83310.1|  putative sorbitol transporter                          177   3e-49   Oryza sativa Japonica Group [Japonica rice]
gb|EAZ04480.1|  hypothetical protein OsI_26629                          177   3e-49   Oryza sativa Indica Group [Indian rice]
ref|XP_003562817.1|  PREDICTED: polyol transporter 5-like               177   3e-49   Brachypodium distachyon [annual false brome]
ref|XP_008795604.1|  PREDICTED: putative polyol transporter 1           177   5e-49   Phoenix dactylifera
ref|NP_001147446.1|  sorbitol transporter                               176   6e-49   Zea mays [maize]
ref|XP_002463086.1|  hypothetical protein SORBIDRAFT_02g037590          176   7e-49   Sorghum bicolor [broomcorn]
gb|EMS50618.1|  Polyol transporter 5                                    171   7e-49   Triticum urartu
gb|AAY88181.2|  mannitol transporter 1                                  175   8e-49   Olea europaea
ref|NP_001060108.1|  Os07g0582400                                       177   9e-49   
emb|CDP17999.1|  unnamed protein product                                175   1e-48   Coffea canephora [robusta coffee]
dbj|BAJ86526.1|  predicted protein                                      175   2e-48   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_007042751.1|  Polyol/monosaccharide transporter 5, putative      175   2e-48   
ref|XP_008245305.1|  PREDICTED: polyol transporter 5-like               174   2e-48   Prunus mume [ume]
dbj|BAJ93158.1|  predicted protein                                      174   3e-48   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_008236797.1|  PREDICTED: putative polyol transporter 2           174   3e-48   Prunus mume [ume]
dbj|BAJ86116.1|  predicted protein                                      174   3e-48   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_004985338.1|  PREDICTED: polyol transporter 5-like isoform X2    174   4e-48   
ref|XP_002460923.1|  hypothetical protein SORBIDRAFT_02g037570          174   4e-48   Sorghum bicolor [broomcorn]
ref|XP_004985337.1|  PREDICTED: polyol transporter 5-like isoform X1    174   5e-48   Setaria italica
ref|NP_001281038.1|  polyol transporter 5-like                          173   6e-48   Malus domestica [apple tree]
ref|NP_001049269.1|  Os03g0197100                                       173   1e-47   
ref|XP_011088761.1|  PREDICTED: putative polyol transporter 1           169   1e-47   
ref|XP_003558585.1|  PREDICTED: putative polyol transporter 1           172   2e-47   Brachypodium distachyon [annual false brome]
ref|XP_008800420.1|  PREDICTED: polyol transporter 5-like               172   2e-47   Phoenix dactylifera
ref|XP_010527168.1|  PREDICTED: putative polyol transporter 1           169   2e-47   Tarenaya hassleriana [spider flower]
ref|XP_011088360.1|  PREDICTED: polyol transporter 5-like               172   2e-47   Sesamum indicum [beniseed]
ref|XP_008465477.1|  PREDICTED: polyol transporter 5-like               172   2e-47   Cucumis melo [Oriental melon]
ref|XP_003558586.1|  PREDICTED: polyol transporter 5-like               172   3e-47   Brachypodium distachyon [annual false brome]
gb|KEH30425.1|  polyol/monosaccharide transporter 1                     171   3e-47   Medicago truncatula
ref|XP_007200667.1|  hypothetical protein PRUPE_ppa015294mg             172   3e-47   
ref|XP_008447047.1|  PREDICTED: polyol transporter 5-like               172   3e-47   Cucumis melo [Oriental melon]
ref|XP_006649564.1|  PREDICTED: polyol transporter 5-like               172   3e-47   Oryza brachyantha
ref|XP_010254895.1|  PREDICTED: polyol transporter 5-like               171   4e-47   Nelumbo nucifera [Indian lotus]
ref|XP_006856085.1|  hypothetical protein AMTR_s00059p00123280          171   4e-47   
ref|XP_007131748.1|  hypothetical protein PHAVU_011G038700g             171   5e-47   Phaseolus vulgaris [French bean]
ref|XP_008668471.1|  PREDICTED: hypothetical protein isoform X1         171   5e-47   Zea mays [maize]
gb|KCW62858.1|  hypothetical protein EUGRSUZ_G00452                     171   5e-47   Eucalyptus grandis [rose gum]
gb|EEE58504.1|  hypothetical protein OsJ_09775                          171   6e-47   Oryza sativa Japonica Group [Japonica rice]
gb|EAY88906.1|  hypothetical protein OsI_10385                          171   6e-47   Oryza sativa Indica Group [Indian rice]
gb|AAN07021.1|  putative mannitol transporter                           171   6e-47   Phelipanche ramosa
ref|XP_004958139.1|  PREDICTED: putative polyol transporter 1-like      171   7e-47   Setaria italica
gb|KCW55336.1|  hypothetical protein EUGRSUZ_I01255                     169   8e-47   Eucalyptus grandis [rose gum]
ref|XP_008795607.1|  PREDICTED: polyol transporter 5-like isoform X2    170   9e-47   Phoenix dactylifera
ref|XP_009378956.1|  PREDICTED: putative polyol transporter 1           171   9e-47   Pyrus x bretschneideri [bai li]
ref|XP_009342008.1|  PREDICTED: putative polyol transporter 1           170   1e-46   Pyrus x bretschneideri [bai li]
ref|XP_009342010.1|  PREDICTED: putative polyol transporter 1           170   1e-46   Pyrus x bretschneideri [bai li]
ref|XP_009350912.1|  PREDICTED: putative polyol transporter 1           170   1e-46   Pyrus x bretschneideri [bai li]
ref|XP_010527595.1|  PREDICTED: polyol transporter 5-like               166   2e-46   Tarenaya hassleriana [spider flower]
ref|NP_001150711.1|  LOC100284344                                       170   2e-46   Zea mays [maize]
ref|XP_006649563.1|  PREDICTED: polyol transporter 5-like               170   2e-46   Oryza brachyantha
ref|XP_003562818.1|  PREDICTED: polyol transporter 5-like               169   2e-46   Brachypodium distachyon [annual false brome]
ref|XP_008359575.1|  PREDICTED: LOW QUALITY PROTEIN: polyol trans...    169   2e-46   
emb|CDP02097.1|  unnamed protein product                                169   2e-46   Coffea canephora [robusta coffee]
gb|KGN44327.1|  hypothetical protein Csa_7G253820                       169   3e-46   Cucumis sativus [cucumbers]
ref|XP_010530848.1|  PREDICTED: LOW QUALITY PROTEIN: putative pol...    169   3e-46   Tarenaya hassleriana [spider flower]
ref|XP_009342009.1|  PREDICTED: putative polyol transporter 1           169   3e-46   Pyrus x bretschneideri [bai li]
ref|XP_009407903.1|  PREDICTED: polyol transporter 5-like               169   3e-46   Musa acuminata subsp. malaccensis [pisang utan]
gb|KGN44326.1|  Mannitol transporter                                    169   4e-46   Cucumis sativus [cucumbers]
ref|XP_009350914.1|  PREDICTED: putative polyol transporter 1           169   4e-46   Pyrus x bretschneideri [bai li]
ref|XP_010905473.1|  PREDICTED: putative polyol transporter 1           169   4e-46   
ref|XP_006297395.1|  hypothetical protein CARUB_v10013420mg             169   4e-46   Capsella rubella
ref|XP_010229631.1|  PREDICTED: putative polyol transporter 1           168   7e-46   Brachypodium distachyon [annual false brome]
gb|ABX71752.1|  mannitol transporter                                    168   1e-45   Apium graveolens
gb|KJB12318.1|  hypothetical protein B456_002G011700                    167   1e-45   Gossypium raimondii
ref|XP_010905472.1|  PREDICTED: polyol transporter 5-like               167   1e-45   
ref|XP_009375838.1|  PREDICTED: putative polyol transporter 1           167   1e-45   Pyrus x bretschneideri [bai li]
ref|XP_004985339.1|  PREDICTED: polyol transporter 5-like               167   2e-45   Setaria italica
ref|XP_010680814.1|  PREDICTED: probable polyol transporter 3           165   5e-45   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_010530847.1|  PREDICTED: putative polyol transporter 1           166   6e-45   Tarenaya hassleriana [spider flower]
ref|XP_010068107.1|  PREDICTED: polyol transporter 5-like               165   7e-45   Eucalyptus grandis [rose gum]
gb|EAZ04481.1|  hypothetical protein OsI_26630                          165   9e-45   Oryza sativa Indica Group [Indian rice]
ref|XP_004958138.1|  PREDICTED: polyol transporter 5-like               165   1e-44   Setaria italica
ref|XP_008368694.1|  PREDICTED: polyol transporter 5-like               164   1e-44   
ref|XP_002468337.1|  hypothetical protein SORBIDRAFT_01g044010          164   2e-44   Sorghum bicolor [broomcorn]
ref|XP_004958137.1|  PREDICTED: polyol transporter 5-like               164   2e-44   Setaria italica
dbj|BAK00091.1|  predicted protein                                      164   4e-44   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_006827104.1|  hypothetical protein AMTR_s00010p00243760          163   6e-44   
gb|AAG43998.1|AF215837_1  mannitol transporter                          163   6e-44   Apium graveolens Dulce Group [celery]
ref|XP_007013362.1|  Polyol/monosaccharide transporter 5, putative      162   7e-44   
dbj|BAC83311.1|  putative sorbitol transporter                          162   1e-43   Oryza sativa Japonica Group [Japonica rice]
ref|NP_001060109.2|  Os07g0582500                                       162   1e-43   
ref|XP_008447045.1|  PREDICTED: polyol transporter 5-like               162   2e-43   
ref|XP_002514302.1|  sugar transporter, putative                        162   2e-43   
ref|XP_008800418.1|  PREDICTED: polyol transporter 5-like               161   2e-43   
ref|XP_010688202.1|  PREDICTED: polyol transporter 5-like               161   2e-43   
gb|ABR16466.1|  unknown                                                 161   2e-43   
tpg|DAA43975.1|  TPA: polyol transporter protein 4                      161   3e-43   
ref|XP_004149937.1|  PREDICTED: polyol transporter 5-like               161   3e-43   
ref|XP_004148314.1|  PREDICTED: polyol transporter 5-like               160   3e-43   
gb|EMT15229.1|  Putative polyol transporter 1                           157   3e-43   
gb|ACG47895.1|  polyol transporter protein 4                            160   4e-43   
dbj|BAJ93015.1|  predicted protein                                      160   6e-43   
gb|EMS55537.1|  Putative polyol transporter 1                           158   6e-43   
ref|XP_006658740.1|  PREDICTED: polyol transporter 5-like               159   8e-43   
gb|KJB12317.1|  hypothetical protein B456_002G011600                    159   1e-42   
ref|XP_009112494.1|  PREDICTED: probable polyol transporter 3           159   1e-42   
gb|EYU20732.1|  hypothetical protein MIMGU_mgv1a026176mg                159   1e-42   
ref|XP_008386449.1|  PREDICTED: polyol transporter 5-like               159   2e-42   
ref|XP_009371465.1|  PREDICTED: polyol transporter 5-like               158   2e-42   
ref|XP_009371568.1|  PREDICTED: probable polyol transporter 6           158   2e-42   
ref|XP_006361759.1|  PREDICTED: polyol transporter 5-like               158   2e-42   
ref|XP_008242649.1|  PREDICTED: probable polyol transporter 6           159   2e-42   
ref|XP_008338123.1|  PREDICTED: probable polyol transporter 6           158   3e-42   
ref|XP_004148302.1|  PREDICTED: polyol transporter 5-like               158   3e-42   
gb|EMS52712.1|  Putative polyol transporter 2                           158   3e-42   
ref|XP_004163631.1|  PREDICTED: polyol transporter 5-like               158   4e-42   
ref|XP_004148303.1|  PREDICTED: polyol transporter 5-like               158   4e-42   
ref|XP_010414363.1|  PREDICTED: probable polyol transporter 3           157   4e-42   
gb|KDP33673.1|  hypothetical protein JCGZ_07244                         158   5e-42   
ref|XP_009607069.1|  PREDICTED: polyol transporter 5-like               157   6e-42   
ref|XP_010489553.1|  PREDICTED: probable polyol transporter 3           157   7e-42   
gb|ABF94465.1|  Sugar transporter family protein, expressed             157   7e-42   
ref|XP_008452333.1|  PREDICTED: polyol transporter 5-like isoform X2    157   7e-42   
ref|XP_010467666.1|  PREDICTED: probable polyol transporter 3           157   8e-42   
ref|XP_006409145.1|  hypothetical protein EUTSA_v10022657mg             157   8e-42   
ref|XP_007203539.1|  hypothetical protein PRUPE_ppa1027213mg            157   1e-41   
ref|XP_007203309.1|  hypothetical protein PRUPE_ppa025908mg             156   1e-41   
emb|CDY66291.1|  BnaCnng50240D                                          156   1e-41   
ref|XP_006451145.1|  hypothetical protein CICLE_v10008031mg             156   1e-41   
ref|XP_011458734.1|  PREDICTED: probable polyol transporter 6           157   1e-41   
emb|CDY66868.1|  BnaUnng01720D                                          156   2e-41   
ref|XP_006360474.1|  PREDICTED: polyol transporter 5-like               156   3e-41   
ref|XP_002514303.1|  sugar transporter, putative                        155   3e-41   
ref|XP_008447044.1|  PREDICTED: polyol transporter 5-like               155   3e-41   
ref|XP_002440825.1|  hypothetical protein SORBIDRAFT_09g007450          155   3e-41   
ref|XP_009774532.1|  PREDICTED: polyol transporter 5-like               155   4e-41   
ref|XP_010531021.1|  PREDICTED: probable polyol transporter 3           155   5e-41   
ref|XP_010070046.1|  PREDICTED: probable polyol transporter 6           154   5e-41   
ref|XP_008338588.1|  PREDICTED: probable polyol transporter 6           154   6e-41   
ref|XP_009413615.1|  PREDICTED: probable polyol transporter 3           148   7e-41   
ref|XP_009356716.1|  PREDICTED: probable polyol transporter 6           154   8e-41   
ref|XP_008387375.1|  PREDICTED: polyol transporter 5-like               154   1e-40   
ref|XP_006297471.1|  hypothetical protein CARUB_v10013492mg             154   1e-40   
ref|XP_008651795.1|  PREDICTED: uncharacterized protein LOC100501...    154   1e-40   
ref|XP_010649162.1|  PREDICTED: probable polyol transporter 6 iso...    151   1e-40   
ref|XP_007152832.1|  hypothetical protein PHAVU_004G163600g             154   2e-40   
ref|XP_003616024.1|  hypothetical protein MTR_5g075300                  153   2e-40   
ref|XP_010095276.1|  putative polyol transporter 6                      153   2e-40   
gb|KDP27565.1|  hypothetical protein JCGZ_20028                         153   2e-40   
ref|XP_007013174.1|  Polyol/monosaccharide transporter 5 isoform 1      153   2e-40   
ref|XP_008241649.1|  PREDICTED: probable polyol transporter 6           153   2e-40   
ref|XP_008667512.1|  PREDICTED: hypothetical protein isoform X1         152   3e-40   
ref|XP_010531022.1|  PREDICTED: probable polyol transporter 6           152   3e-40   
gb|KDP33672.1|  hypothetical protein JCGZ_07243                         152   4e-40   
ref|XP_007046983.1|  Major facilitator superfamily protein              152   4e-40   
ref|XP_010026167.1|  PREDICTED: probable polyol transporter 6           152   5e-40   
emb|CBI17542.3|  unnamed protein product                                151   5e-40   
gb|KGN44328.1|  hypothetical protein Csa_7G257320                       152   5e-40   
ref|XP_007203922.1|  hypothetical protein PRUPE_ppa017052mg             152   5e-40   
ref|XP_003529995.1|  PREDICTED: polyol transporter 5-like               152   5e-40   
ref|XP_010548048.1|  PREDICTED: putative polyol transporter 1           152   6e-40   
ref|XP_004159155.1|  PREDICTED: polyol transporter 5-like               151   7e-40   
ref|XP_002267872.1|  PREDICTED: probable polyol transporter 6 iso...    151   1e-39   
ref|NP_179438.1|  putative polyol transporter 3                         151   1e-39   
ref|XP_003533389.1|  PREDICTED: polyol transporter 5-like               151   1e-39   
gb|KJB40206.1|  hypothetical protein B456_007G051000                    150   1e-39   
ref|XP_011458741.1|  PREDICTED: polyol transporter 5-like               150   2e-39   
gb|KGN56185.1|  hypothetical protein Csa_3G095020                       150   2e-39   
ref|XP_008447046.1|  PREDICTED: polyol transporter 5-like               150   2e-39   
gb|EYU23018.1|  hypothetical protein MIMGU_mgv1a005494mg                150   2e-39   
ref|XP_010099586.1|  Polyol transporter 5                               150   2e-39   
ref|XP_010536004.1|  PREDICTED: polyol transporter 5-like               149   3e-39   
emb|CDP03333.1|  unnamed protein product                                149   4e-39   
ref|XP_008440694.1|  PREDICTED: probable polyol transporter 6           149   4e-39   
ref|XP_008463391.1|  PREDICTED: probable polyol transporter 6           149   4e-39   
ref|NP_001168177.1|  uncharacterized protein LOC100381931               149   4e-39   
ref|XP_006346993.1|  PREDICTED: probable polyol transporter 6-like      149   4e-39   
ref|XP_002531429.1|  sugar transporter, putative                        149   4e-39   
ref|XP_004509296.1|  PREDICTED: probable polyol transporter 3-like      149   5e-39   
gb|KGN48817.1|  hypothetical protein Csa_6G502060                       149   5e-39   
ref|XP_004148315.1|  PREDICTED: polyol transporter 5-like               148   7e-39   
ref|XP_010548339.1|  PREDICTED: probable polyol transporter 6           149   8e-39   
ref|XP_006475614.1|  PREDICTED: polyol transporter 5-like isoform X1    149   8e-39   
ref|XP_006827103.1|  hypothetical protein AMTR_s00010p00243630          148   9e-39   
ref|XP_003620669.1|  Myo-inositol transporter                           148   1e-38   
gb|KJB54071.1|  hypothetical protein B456_009G019700                    148   1e-38   
gb|KFK40217.1|  hypothetical protein AALP_AA3G345800                    148   1e-38   
ref|XP_007013177.1|  Polyol/monosaccharide transporter 5 isoform 1      148   2e-38   
ref|XP_006425707.1|  hypothetical protein CICLE_v10027247mg             148   2e-38   
ref|XP_002280978.1|  PREDICTED: polyol transporter 5                    147   2e-38   
ref|XP_007160334.1|  hypothetical protein PHAVU_002G312900g             147   2e-38   
gb|KCW81997.1|  hypothetical protein EUGRSUZ_C03362                     147   2e-38   
ref|XP_004170584.1|  PREDICTED: LOW QUALITY PROTEIN: probable pol...    147   2e-38   
ref|XP_004150056.1|  PREDICTED: probable polyol transporter 6-like      147   2e-38   
ref|XP_010049692.1|  PREDICTED: polyol transporter 5-like               147   2e-38   
gb|AFW56603.1|  hypothetical protein ZEAMMB73_309095                    140   3e-38   
ref|XP_006411974.1|  hypothetical protein EUTSA_v10024974mg             147   3e-38   
gb|KJB64901.1|  hypothetical protein B456_010G071400                    147   3e-38   
ref|XP_004233968.1|  PREDICTED: probable polyol transporter 6           147   3e-38   
ref|XP_006590681.1|  PREDICTED: probable polyol transporter 3-like      147   3e-38   
gb|KHG11695.1|  Polyol transporter 5 -like protein                      147   3e-38   
gb|KFK30287.1|  hypothetical protein AALP_AA7G242000                    147   3e-38   
ref|XP_011025750.1|  PREDICTED: probable polyol transporter 3           147   4e-38   
ref|XP_002310213.2|  mannitol transporter family protein                146   4e-38   
ref|XP_009374073.1|  PREDICTED: probable polyol transporter 6           146   5e-38   
ref|XP_010446763.1|  PREDICTED: probable polyol transporter 6           146   5e-38   
ref|XP_006285274.1|  hypothetical protein CARUB_v10006648mg             146   5e-38   
ref|NP_195385.1|  putative polyol transporter 6                         146   6e-38   
ref|XP_004983249.1|  PREDICTED: probable polyol transporter 3-like      146   7e-38   
ref|XP_010432153.1|  PREDICTED: probable polyol transporter 6           146   7e-38   
ref|XP_002886176.1|  predicted protein                                  146   7e-38   
gb|ACJ85829.1|  unknown                                                 145   9e-38   
ref|XP_004233514.1|  PREDICTED: probable polyol transporter 6           145   9e-38   
emb|CDY35469.1|  BnaC03g61910D                                          145   9e-38   
ref|XP_003629474.1|  hypothetical protein MTR_8g077890                  145   9e-38   
emb|CDX75588.1|  BnaA01g01140D                                          145   1e-37   
emb|CDY67098.1|  BnaCnng53530D                                          145   1e-37   
emb|CBI28072.3|  unnamed protein product                                147   1e-37   
gb|EMT00465.1|  Putative polyol transporter 1                           145   1e-37   
ref|XP_004243120.1|  PREDICTED: polyol transporter 5-like               145   1e-37   
ref|XP_009142783.1|  PREDICTED: LOW QUALITY PROTEIN: probable pol...    145   1e-37   
ref|XP_002866999.1|  hypothetical protein ARALYDRAFT_490969             145   1e-37   
ref|XP_011011702.1|  PREDICTED: LOW QUALITY PROTEIN: probable pol...    148   1e-37   
ref|XP_003561393.1|  PREDICTED: probable polyol transporter 6           145   1e-37   
ref|XP_004143580.1|  PREDICTED: probable polyol transporter 3-like      143   2e-37   
ref|XP_009627595.1|  PREDICTED: probable polyol transporter 6           145   2e-37   
ref|XP_009109331.1|  PREDICTED: probable polyol transporter 6           145   2e-37   
emb|CDY24775.1|  BnaA08g15350D                                          145   2e-37   
ref|XP_004233513.1|  PREDICTED: probable polyol transporter 6 iso...    145   2e-37   
ref|XP_010444944.1|  PREDICTED: probable polyol transporter 6           145   2e-37   
ref|NP_001142160.1|  hypothetical protein                               144   2e-37   
ref|XP_008679503.1|  PREDICTED: carbohydrate transporter/ sugar p...    144   3e-37   
ref|XP_006363185.1|  PREDICTED: probable polyol transporter 6-like      144   3e-37   
gb|KHN00554.1|  Putative polyol transporter 3                           144   3e-37   
ref|XP_008452332.1|  PREDICTED: putative polyol transporter 2 iso...    144   3e-37   
ref|XP_008337386.1|  PREDICTED: polyol transporter 5-like               144   3e-37   
gb|EAY77363.1|  hypothetical protein OsI_05348                          144   3e-37   
dbj|BAO96231.1|  polyol/monosaccharide Transporter 8                    144   3e-37   
ref|NP_001045505.2|  Os01g0966900                                       144   4e-37   
ref|XP_009799010.1|  PREDICTED: probable polyol transporter 6           144   4e-37   
ref|XP_009138439.1|  PREDICTED: probable polyol transporter 6           144   4e-37   
gb|KCW58602.1|  hypothetical protein EUGRSUZ_H01261                     143   5e-37   
ref|XP_002460924.1|  hypothetical protein SORBIDRAFT_02g037580          144   5e-37   
gb|KJB64902.1|  hypothetical protein B456_010G071500                    142   6e-37   
gb|AFK37582.1|  unknown                                                 143   6e-37   
ref|XP_004512978.1|  PREDICTED: polyol transporter 5-like               143   7e-37   
ref|NP_001064429.1|  Os10g0360100                                       143   8e-37   
gb|EAZ15802.1|  hypothetical protein OsJ_31220                          143   8e-37   
gb|AAK13147.1|AC083945_22  Putative sugar transporter                   143   9e-37   
ref|XP_008795662.1|  PREDICTED: probable polyol transporter 6           142   1e-36   
ref|XP_002439891.1|  hypothetical protein SORBIDRAFT_09g022100          143   1e-36   
gb|EYU40145.1|  hypothetical protein MIMGU_mgv1a004984mg                142   1e-36   
ref|XP_002972026.1|  hypothetical protein SELMODRAFT_441647             143   1e-36   
ref|XP_002972566.1|  hypothetical protein SELMODRAFT_148545             142   1e-36   
ref|NP_001132062.1|  proton myo-inositol cotransporter                  142   1e-36   
gb|ACG35144.1|  proton myo-inositol cotransporter                       142   1e-36   
ref|XP_006346943.1|  PREDICTED: probable polyol transporter 6-like      142   2e-36   
ref|XP_010244297.1|  PREDICTED: putative polyol transporter 1           142   2e-36   
gb|EMS56424.1|  putative polyol transporter 6                           134   2e-36   
ref|XP_008670519.1|  PREDICTED: putative polyol transporter 1           142   2e-36   
gb|EEC66802.1|  hypothetical protein OsI_33208                          141   2e-36   
emb|CDX72594.1|  BnaC07g46160D                                          143   2e-36   
ref|XP_007156923.1|  hypothetical protein PHAVU_002G028600g             142   2e-36   
ref|XP_002984640.1|  hypothetical protein SELMODRAFT_120756             134   2e-36   
ref|XP_007156922.1|  hypothetical protein PHAVU_002G028500g             141   2e-36   
dbj|BAK07233.1|  predicted protein                                      141   4e-36   
ref|XP_004301902.2|  PREDICTED: probable polyol transporter 6           141   5e-36   
ref|NP_001146002.1|  uncharacterized protein LOC100279532               140   6e-36   
ref|XP_004983248.1|  PREDICTED: probable polyol transporter 3-like      140   6e-36   
ref|XP_002972029.1|  hypothetical protein SELMODRAFT_96814              140   7e-36   
gb|AFW56602.1|  major myo-inositol transporter iolT                     140   8e-36   
tpg|DAA63328.1|  TPA: hypothetical protein ZEAMMB73_585953              140   9e-36   
ref|NP_001151390.1|  carbohydrate transporter/ sugar porter             140   9e-36   
ref|XP_002978711.1|  hypothetical protein SELMODRAFT_109547             140   1e-35   
ref|XP_010239281.1|  PREDICTED: LOW QUALITY PROTEIN: probable pol...    140   1e-35   
ref|XP_006590682.1|  PREDICTED: probable polyol transporter 6-like      140   1e-35   
ref|XP_002984639.1|  hypothetical protein SELMODRAFT_181215             140   1e-35   
gb|EPS63014.1|  hypothetical protein M569_11773                         139   1e-35   
ref|XP_011100123.1|  PREDICTED: uncharacterized protein LOC105178355    142   2e-35   
gb|EPS67834.1|  hypothetical protein M569_06938                         137   6e-35   
ref|XP_006833286.1|  hypothetical protein AMTR_s00109p00027810          137   7e-35   
ref|XP_010317209.1|  PREDICTED: probable polyol transporter 6 iso...    137   7e-35   
ref|XP_010686555.1|  PREDICTED: probable polyol transporter 4           137   8e-35   
ref|NP_001289849.1|  probable polyol transporter 6                      137   8e-35   
ref|XP_003630795.1|  Polyol transporter                                 137   8e-35   
ref|XP_004503439.1|  PREDICTED: polyol transporter 5-like               137   8e-35   
ref|XP_010317207.1|  PREDICTED: probable polyol transporter 6 iso...    137   8e-35   
gb|AEI98623.1|  hypothetical protein 111O18.10                          137   9e-35   
ref|XP_002521583.1|  sugar transporter, putative                        135   1e-34   
ref|XP_002972359.1|  hypothetical protein SELMODRAFT_97702              137   1e-34   
ref|XP_002443259.1|  hypothetical protein SORBIDRAFT_08g016530          136   2e-34   
ref|XP_003539908.1|  PREDICTED: probable polyol transporter 4-like      136   2e-34   
emb|CAJ29288.1|  putative polyol transporter 1                          136   3e-34   
emb|CDP02044.1|  unnamed protein product                                135   4e-34   
ref|XP_004232637.2|  PREDICTED: LOW QUALITY PROTEIN: probable pol...    132   4e-34   
ref|XP_001755457.1|  predicted protein                                  135   5e-34   
ref|XP_011078372.1|  PREDICTED: polyol transporter 5-like               135   6e-34   
ref|XP_003548895.1|  PREDICTED: probable polyol transporter 3-like      134   8e-34   
ref|XP_009624322.1|  PREDICTED: probable polyol transporter 4 iso...    134   8e-34   
ref|XP_009773455.1|  PREDICTED: probable polyol transporter 4 iso...    134   1e-33   
ref|XP_010049436.1|  PREDICTED: polyol transporter 5-like               134   1e-33   
gb|ACN35873.1|  unknown                                                 134   1e-33   
ref|XP_004232838.1|  PREDICTED: probable polyol transporter 4 iso...    134   1e-33   
ref|XP_009773456.1|  PREDICTED: probable polyol transporter 4 iso...    134   1e-33   
gb|EMS55653.1|  Polyol transporter 5                                    133   1e-33   
ref|XP_004962895.1|  PREDICTED: polyol transporter 5-like               134   1e-33   
gb|KCW58603.1|  hypothetical protein EUGRSUZ_H01262                     134   1e-33   
gb|ACN26310.1|  unknown                                                 134   1e-33   
emb|CCC58382.1|  polyol/monosaccharide transporter 4                    133   2e-33   
ref|XP_007156029.1|  hypothetical protein PHAVU_003G252500g             133   2e-33   
gb|KHN41995.1|  Putative polyol transporter 3                           133   3e-33   



>ref|XP_009766648.1| PREDICTED: polyol transporter 5-like [Nicotiana sylvestris]
Length=526

 Score =   217 bits (552),  Expect = 4e-64, Method: Compositional matrix adjust.
 Identities = 123/152 (81%), Positives = 131/152 (86%), Gaps = 1/152 (1%)
 Frame = +1

Query  70   MGDTRPVRNAGSGHIP-AFDPPKKVKRNKYaiaaaflaslasillGYDIGVMSGAAIYIQ  246
            M D +  RNA  G +  AFDPPKK KRNKYA A +FLASLASILLGYDIGVMSGA IYI+
Sbjct  1    MADKKHGRNAVCGQLQIAFDPPKKPKRNKYATACSFLASLASILLGYDIGVMSGAIIYIK  60

Query  247  KDLKINDTQVEILLGILNLYSLIGSCMAGRTSDWIGRRYTMVVASVVFFVGAILMGFSTN  426
            KDL IND QVEIL GILNLYSLIGS  AGRTSDWIGRR TMVVA+V+FFVGAILMGF+TN
Sbjct  61   KDLNINDVQVEILAGILNLYSLIGSAAAGRTSDWIGRRNTMVVAAVIFFVGAILMGFATN  120

Query  427  YTFLMVGRFVAGIGVGYALMIAPVYTAEVAPA  522
            Y FLM GRFVAGIGVGYALMIAPVYTAEV+PA
Sbjct  121  YAFLMFGRFVAGIGVGYALMIAPVYTAEVSPA  152



>ref|XP_009596634.1| PREDICTED: polyol transporter 5-like [Nicotiana tomentosiformis]
Length=526

 Score =   216 bits (550),  Expect = 7e-64, Method: Compositional matrix adjust.
 Identities = 122/152 (80%), Positives = 132/152 (87%), Gaps = 1/152 (1%)
 Frame = +1

Query  70   MGDTRPVRNAGSGHIP-AFDPPKKVKRNKYaiaaaflaslasillGYDIGVMSGAAIYIQ  246
            M D +  RNA  G +  AFDPPKK KRNKYA+A +FLASLASILLGYDIGVMSGA IYI+
Sbjct  1    MADKKQGRNAVCGQLQIAFDPPKKPKRNKYAVACSFLASLASILLGYDIGVMSGAIIYIK  60

Query  247  KDLKINDTQVEILLGILNLYSLIGSCMAGRTSDWIGRRYTMVVASVVFFVGAILMGFSTN  426
            KDL IND QVEIL GILNLYSLIGS  AGRTSDWIGRR TMVVA+V+FFVGA+LMGF+TN
Sbjct  61   KDLNINDVQVEILAGILNLYSLIGSAAAGRTSDWIGRRNTMVVAAVIFFVGALLMGFATN  120

Query  427  YTFLMVGRFVAGIGVGYALMIAPVYTAEVAPA  522
            Y FLM GRFVAGIGVGYALMIAPVYTAEV+PA
Sbjct  121  YAFLMFGRFVAGIGVGYALMIAPVYTAEVSPA  152



>ref|XP_008350306.1| PREDICTED: putative polyol transporter 1, partial [Malus domestica]
Length=282

 Score =   205 bits (522),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 111/149 (74%), Positives = 125/149 (84%), Gaps = 0/149 (0%)
 Frame = +1

Query  76   DTRPVRNAGSGHIPAFDPPKKVKRNKYaiaaaflaslasillGYDIGVMSGAAIYIQKDL  255
            D   V +     I  FDPP+K KRNKYA A A LAS+ SILLGYDIGVMSGAAIYI+ DL
Sbjct  7    DDNTVSSQPQKTIEDFDPPQKPKRNKYAFACAILASMTSILLGYDIGVMSGAAIYIKDDL  66

Query  256  KINDTQVEILLGILNLYSLIGSCMAGRTSDWIGRRYTMVVASVVFFVGAILMGFSTNYTF  435
            KI+D +VEILLGILNLYSLIGS  AGRTSDW+GRRYT+V+A  +FFVGA+LMGF+TNY F
Sbjct  67   KISDVEVEILLGILNLYSLIGSAAAGRTSDWVGRRYTIVLAGAIFFVGALLMGFATNYAF  126

Query  436  LMVGRFVAGIGVGYALMIAPVYTAEVAPA  522
            LM GRFVAG+GVGYALMIAPVYTAEV+PA
Sbjct  127  LMFGRFVAGVGVGYALMIAPVYTAEVSPA  155



>gb|KHN39768.1| Polyol transporter 5 [Glycine soja]
Length=523

 Score =   211 bits (537),  Expect = 5e-62, Method: Compositional matrix adjust.
 Identities = 111/145 (77%), Positives = 126/145 (87%), Gaps = 2/145 (1%)
 Frame = +1

Query  94   NAGSGH--IPAFDPPKKVKRNKYaiaaaflaslasillGYDIGVMSGAAIYIQKDLKIND  267
             A   H  +  FDPPKK KRNKYA A A LAS+ SILLGYDIGVMSGAAIYI++DLK++D
Sbjct  8    EAAEAHKTLQDFDPPKKRKRNKYAFACAMLASMTSILLGYDIGVMSGAAIYIKRDLKVSD  67

Query  268  TQVEILLGILNLYSLIGSCMAGRTSDWIGRRYTMVVASVVFFVGAILMGFSTNYTFLMVG  447
             Q+EILLGI+NLYSLIGSC+AGRTSDWIGRRYT+V A  +FFVGA+LMGFS NY+FLM G
Sbjct  68   EQIEILLGIINLYSLIGSCLAGRTSDWIGRRYTIVFAGAIFFVGALLMGFSPNYSFLMFG  127

Query  448  RFVAGIGVGYALMIAPVYTAEVAPA  522
            RFVAGIG+GYALMIAPVYTAEV+PA
Sbjct  128  RFVAGIGIGYALMIAPVYTAEVSPA  152



>gb|KHN25361.1| Polyol transporter 5 [Glycine soja]
Length=521

 Score =   210 bits (534),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 110/145 (76%), Positives = 126/145 (87%), Gaps = 2/145 (1%)
 Frame = +1

Query  94   NAGSGH--IPAFDPPKKVKRNKYaiaaaflaslasillGYDIGVMSGAAIYIQKDLKIND  267
             A   H  +  FDPPKK KRNKYA A A LAS+ SILLGYDIGVMSGAA+YI++DLK++D
Sbjct  8    EAAEAHKTLEDFDPPKKRKRNKYAFACAVLASMTSILLGYDIGVMSGAALYIKRDLKVSD  67

Query  268  TQVEILLGILNLYSLIGSCMAGRTSDWIGRRYTMVVASVVFFVGAILMGFSTNYTFLMVG  447
             Q+EILLGI+NLYSLIGSC+AGRTSDWIGRRYT+V A  +FFVGA+LMGFS NY+FLM G
Sbjct  68   VQIEILLGIINLYSLIGSCLAGRTSDWIGRRYTIVFAGAIFFVGALLMGFSPNYSFLMFG  127

Query  448  RFVAGIGVGYALMIAPVYTAEVAPA  522
            RFVAGIG+GYALMIAPVYTAEV+PA
Sbjct  128  RFVAGIGIGYALMIAPVYTAEVSPA  152



>ref|XP_003541068.1| PREDICTED: polyol transporter 5-like [Glycine max]
Length=523

 Score =   210 bits (534),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 110/145 (76%), Positives = 126/145 (87%), Gaps = 2/145 (1%)
 Frame = +1

Query  94   NAGSGH--IPAFDPPKKVKRNKYaiaaaflaslasillGYDIGVMSGAAIYIQKDLKIND  267
             A   H  +  FDPPKK KRNKYA A A LAS+ SILLGYDIGVMSGAA+YI++DLK++D
Sbjct  8    EAAEAHKTLEDFDPPKKRKRNKYAFACAVLASMTSILLGYDIGVMSGAALYIKRDLKVSD  67

Query  268  TQVEILLGILNLYSLIGSCMAGRTSDWIGRRYTMVVASVVFFVGAILMGFSTNYTFLMVG  447
             Q+EILLGI+NLYSLIGSC+AGRTSDWIGRRYT+V A  +FFVGA+LMGFS NY+FLM G
Sbjct  68   VQIEILLGIINLYSLIGSCLAGRTSDWIGRRYTIVFAGAIFFVGALLMGFSPNYSFLMFG  127

Query  448  RFVAGIGVGYALMIAPVYTAEVAPA  522
            RFVAGIG+GYALMIAPVYTAEV+PA
Sbjct  128  RFVAGIGIGYALMIAPVYTAEVSPA  152



>ref|XP_009345075.1| PREDICTED: putative polyol transporter 1 [Pyrus x bretschneideri]
Length=538

 Score =   210 bits (534),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 112/149 (75%), Positives = 128/149 (86%), Gaps = 0/149 (0%)
 Frame = +1

Query  76   DTRPVRNAGSGHIPAFDPPKKVKRNKYaiaaaflaslasillGYDIGVMSGAAIYIQKDL  255
            D    +  GSG +  FDPPKK KRNKYA A A LAS+ SILLGYDIGVMSGAAIYI++DL
Sbjct  8    DNAVSQQPGSGGLSEFDPPKKPKRNKYAFACAILASMTSILLGYDIGVMSGAAIYIKEDL  67

Query  256  KINDTQVEILLGILNLYSLIGSCMAGRTSDWIGRRYTMVVASVVFFVGAILMGFSTNYTF  435
            KI+D ++EILLGI+N+YSLIGS  AGRTSDWIGRRYT+V+A  +FF GAILMGF+TNY F
Sbjct  68   KISDVEIEILLGIINVYSLIGSAAAGRTSDWIGRRYTIVLAGAIFFTGAILMGFATNYVF  127

Query  436  LMVGRFVAGIGVGYALMIAPVYTAEVAPA  522
            LMVGRFVAGIG+GYALMIAPVYTAEV+PA
Sbjct  128  LMVGRFVAGIGIGYALMIAPVYTAEVSPA  156



>ref|XP_009344433.1| PREDICTED: putative polyol transporter 1 [Pyrus x bretschneideri]
Length=537

 Score =   208 bits (529),  Expect = 9e-61, Method: Compositional matrix adjust.
 Identities = 110/134 (82%), Positives = 121/134 (90%), Gaps = 0/134 (0%)
 Frame = +1

Query  121  FDPPKKVKRNKYaiaaaflaslasillGYDIGVMSGAAIYIQKDLKINDTQVEILLGILN  300
            FDPPKK+KRNKYA   A LAS+ SILLGYDIGVMSGAAIYIQKDLKI+D Q+EILLGILN
Sbjct  23   FDPPKKLKRNKYAFGCAILASMTSILLGYDIGVMSGAAIYIQKDLKISDVQIEILLGILN  82

Query  301  LYSLIGSCMAGRTSDWIGRRYTMVVASVVFFVGAILMGFSTNYTFLMVGRFVAGIGVGYA  480
            +YSL GS  AGRTSDWIGRRYT+V+A  +FF GA+LMGF+TNY FLMVGRFVAGIGVGYA
Sbjct  83   VYSLFGSAAAGRTSDWIGRRYTIVLAGAIFFAGALLMGFATNYVFLMVGRFVAGIGVGYA  142

Query  481  LMIAPVYTAEVAPA  522
            LMIAPVYTAEV+PA
Sbjct  143  LMIAPVYTAEVSPA  156



>ref|XP_011092774.1| PREDICTED: polyol transporter 5-like [Sesamum indicum]
Length=519

 Score =   207 bits (528),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 110/137 (80%), Positives = 125/137 (91%), Gaps = 0/137 (0%)
 Frame = +1

Query  112  IPAFDPPKKVKRNKYaiaaaflaslasillGYDIGVMSGAAIYIQKDLKINDTQVEILLG  291
            IPAFDPP+K KRNKYA+A +FLAS+ SILLGYDIGVMSGA IYIQKDL+I+D Q E+++G
Sbjct  9    IPAFDPPQKPKRNKYAMACSFLASMTSILLGYDIGVMSGAIIYIQKDLQISDVQKEVIMG  68

Query  292  ILNLYSLIGSCMAGRTSDWIGRRYTMVVASVVFFVGAILMGFSTNYTFLMVGRFVAGIGV  471
            ILN+YSL+GS  AGRTSDWIGRRYT+V A V+FF GA+LMGF+TNY FLMVGRFVAGIGV
Sbjct  69   ILNVYSLLGSAAAGRTSDWIGRRYTIVFAGVIFFAGALLMGFATNYAFLMVGRFVAGIGV  128

Query  472  GYALMIAPVYTAEVAPA  522
            GYALMIAPVYTAEVAPA
Sbjct  129  GYALMIAPVYTAEVAPA  145



>ref|XP_008387370.1| PREDICTED: putative polyol transporter 1 [Malus domestica]
Length=538

 Score =   207 bits (528),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 110/144 (76%), Positives = 124/144 (86%), Gaps = 0/144 (0%)
 Frame = +1

Query  91   RNAGSGHIPAFDPPKKVKRNKYaiaaaflaslasillGYDIGVMSGAAIYIQKDLKINDT  270
            +  GS  +  FDPPKK KRNKYA   A LAS+ SILLGYDIGVMSGAAIYIQKDLKI+D 
Sbjct  14   QQTGSRGLSDFDPPKKPKRNKYAFGCAILASMTSILLGYDIGVMSGAAIYIQKDLKISDV  73

Query  271  QVEILLGILNLYSLIGSCMAGRTSDWIGRRYTMVVASVVFFVGAILMGFSTNYTFLMVGR  450
            ++EILLGI+N+YSL GS  AGRTSDWIGRRYT+V+A  +FF GA+LMGFSTNY FLMVGR
Sbjct  74   EIEILLGIINVYSLFGSAAAGRTSDWIGRRYTIVLAGAIFFAGALLMGFSTNYAFLMVGR  133

Query  451  FVAGIGVGYALMIAPVYTAEVAPA  522
            FVAGIG+GYALMIAPVYTAEV+PA
Sbjct  134  FVAGIGIGYALMIAPVYTAEVSPA  157



>gb|AFI61955.1| polyol transporter [Camellia sinensis]
Length=532

 Score =   207 bits (527),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 110/155 (71%), Positives = 131/155 (85%), Gaps = 4/155 (3%)
 Frame = +1

Query  70   MGDTRPVRNAGSG----HIPAFDPPKKVKRNKYaiaaaflaslasillGYDIGVMSGAAI  237
            M D +P  N  SG    HIPA DPP+K KRNKYA A A LAS+ SILLGYD GVMSGAA+
Sbjct  1    MADRKPQNNGFSGQTQTHIPALDPPQKPKRNKYAFACAILASMTSILLGYDGGVMSGAAL  60

Query  238  YIQKDLKINDTQVEILLGILNLYSLIGSCMAGRTSDWIGRRYTMVVASVVFFVGAILMGF  417
            +I+ DLKI+D Q+E+L+GI++LYSL+G   AGRTSDW+GRRYT+V+A+ +FFVGAILMGF
Sbjct  61   FIKDDLKISDVQLEVLMGIMSLYSLLGCYAAGRTSDWVGRRYTIVIAAAIFFVGAILMGF  120

Query  418  STNYTFLMVGRFVAGIGVGYALMIAPVYTAEVAPA  522
            +TNY FLMVGRFVAGIGVGYAL+IAPVYTAEV+PA
Sbjct  121  ATNYAFLMVGRFVAGIGVGYALLIAPVYTAEVSPA  155



>gb|ABK29439.1| sugar transport protein [Coffea canephora]
Length=529

 Score =   207 bits (526),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 113/156 (72%), Positives = 130/156 (83%), Gaps = 5/156 (3%)
 Frame = +1

Query  70   MGDTRPVRN-AGSGHIPA----FDPPKKVKRNKYaiaaaflaslasillGYDIGVMSGAA  234
            MG  +P  N   SG  P     FDPPKK KRNKYA+A +FLAS+ S+LLGYDIGVMSGAA
Sbjct  1    MGTRKPAENDVFSGQTPKVIADFDPPKKPKRNKYALACSFLASMTSVLLGYDIGVMSGAA  60

Query  235  IYIQKDLKINDTQVEILLGILNLYSLIGSCMAGRTSDWIGRRYTMVVASVVFFVGAILMG  414
            IYI++D K++D +VEIL+GILNLYSL+GS  AGRTSDWIGRR T+V AS +FF GA+LMG
Sbjct  61   IYIKRDFKLSDVKVEILVGILNLYSLLGSAAAGRTSDWIGRRLTIVFASAIFFAGALLMG  120

Query  415  FSTNYTFLMVGRFVAGIGVGYALMIAPVYTAEVAPA  522
            FSTNY FLMVGRFVAG+GVGYALMIAPVYTAEV+PA
Sbjct  121  FSTNYAFLMVGRFVAGVGVGYALMIAPVYTAEVSPA  156



>emb|CDO97075.1| unnamed protein product [Coffea canephora]
Length=529

 Score =   207 bits (526),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 113/156 (72%), Positives = 130/156 (83%), Gaps = 5/156 (3%)
 Frame = +1

Query  70   MGDTRPVRN-AGSGHIPA----FDPPKKVKRNKYaiaaaflaslasillGYDIGVMSGAA  234
            MG  +P  N   SG  P     FDPPKK KRNKYA+A +FLAS+ S+LLGYDIGVMSGAA
Sbjct  1    MGTRKPAENDVFSGQTPKVIADFDPPKKPKRNKYALACSFLASMTSVLLGYDIGVMSGAA  60

Query  235  IYIQKDLKINDTQVEILLGILNLYSLIGSCMAGRTSDWIGRRYTMVVASVVFFVGAILMG  414
            IYI++D K++D +VEIL+GILNLYSL+GS  AGRTSDWIGRR T+V AS +FF GA+LMG
Sbjct  61   IYIKRDFKLSDVKVEILVGILNLYSLLGSAAAGRTSDWIGRRLTIVFASAIFFAGALLMG  120

Query  415  FSTNYTFLMVGRFVAGIGVGYALMIAPVYTAEVAPA  522
            FSTNY FLMVGRFVAG+GVGYALMIAPVYTAEV+PA
Sbjct  121  FSTNYAFLMVGRFVAGVGVGYALMIAPVYTAEVSPA  156



>ref|XP_009375628.1| PREDICTED: putative polyol transporter 1 [Pyrus x bretschneideri]
Length=537

 Score =   207 bits (526),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 110/134 (82%), Positives = 120/134 (90%), Gaps = 0/134 (0%)
 Frame = +1

Query  121  FDPPKKVKRNKYaiaaaflaslasillGYDIGVMSGAAIYIQKDLKINDTQVEILLGILN  300
            FDPPKK KRNKYA   A LAS+ SILLGYDIGVMSGAAIYIQKDLKI+D Q+EILLGILN
Sbjct  23   FDPPKKPKRNKYAFGCAILASMTSILLGYDIGVMSGAAIYIQKDLKISDVQIEILLGILN  82

Query  301  LYSLIGSCMAGRTSDWIGRRYTMVVASVVFFVGAILMGFSTNYTFLMVGRFVAGIGVGYA  480
            +YSL GS  AGRTSDWIGRRYT+V+A  +FF GA+LMGF+TNY FLMVGRFVAGIGVGYA
Sbjct  83   VYSLFGSAAAGRTSDWIGRRYTIVLAGAIFFAGALLMGFATNYVFLMVGRFVAGIGVGYA  142

Query  481  LMIAPVYTAEVAPA  522
            LMIAPVYTAEV+PA
Sbjct  143  LMIAPVYTAEVSPA  156



>ref|NP_001281033.1| polyol transporter 5-like [Malus domestica]
 dbj|BAD42345.1| sorbitol transporter [Malus domestica]
Length=535

 Score =   206 bits (523),  Expect = 7e-60, Method: Compositional matrix adjust.
 Identities = 111/149 (74%), Positives = 126/149 (85%), Gaps = 0/149 (0%)
 Frame = +1

Query  76   DTRPVRNAGSGHIPAFDPPKKVKRNKYaiaaaflaslasillGYDIGVMSGAAIYIQKDL  255
            D   V +     I  FDPP+K KRNKYA A A LAS+ SILLGYDIGVMSGAAIYI+ DL
Sbjct  7    DDNTVSSQPQKTIADFDPPQKPKRNKYAFACAILASMTSILLGYDIGVMSGAAIYIKDDL  66

Query  256  KINDTQVEILLGILNLYSLIGSCMAGRTSDWIGRRYTMVVASVVFFVGAILMGFSTNYTF  435
            KI+D +VE+LLGILNLYSLIGS  AGRTSDW+GRRYT+V+A  +FFVGA+LMGF+TNY+F
Sbjct  67   KISDVEVEVLLGILNLYSLIGSAAAGRTSDWVGRRYTIVLAGAIFFVGALLMGFATNYSF  126

Query  436  LMVGRFVAGIGVGYALMIAPVYTAEVAPA  522
            LM GRFVAGIGVGYALMIAPVYTAEV+PA
Sbjct  127  LMFGRFVAGIGVGYALMIAPVYTAEVSPA  155



>ref|XP_004170410.1| PREDICTED: LOW QUALITY PROTEIN: polyol transporter 5-like [Cucumis 
sativus]
Length=533

 Score =   206 bits (523),  Expect = 8e-60, Method: Compositional matrix adjust.
 Identities = 103/137 (75%), Positives = 127/137 (93%), Gaps = 0/137 (0%)
 Frame = +1

Query  112  IPAFDPPKKVKRNKYaiaaaflaslasillGYDIGVMSGAAIYIQKDLKINDTQVEILLG  291
            +P FDPPKK KRNK+++A A LAS+ S+LLGYDIGVMSGAA++I++D +++DT++EIL+G
Sbjct  20   LPDFDPPKKNKRNKFSLACATLASMTSVLLGYDIGVMSGAAMFIKEDFRLSDTKIEILVG  79

Query  292  ILNLYSLIGSCMAGRTSDWIGRRYTMVVASVVFFVGAILMGFSTNYTFLMVGRFVAGIGV  471
            ILNLYSLIGS  AGRTSDWIGRRYTMVVA+V+FF GA+LMGF+T+Y+FLM GRFVAG+GV
Sbjct  80   ILNLYSLIGSAAAGRTSDWIGRRYTMVVAAVIFFAGALLMGFATSYSFLMFGRFVAGVGV  139

Query  472  GYALMIAPVYTAEVAPA  522
            GYALMIAPVYTAEV+PA
Sbjct  140  GYALMIAPVYTAEVSPA  156



>ref|XP_004148857.1| PREDICTED: polyol transporter 5-like [Cucumis sativus]
 gb|KGN61777.1| hypothetical protein Csa_2G245410 [Cucumis sativus]
Length=533

 Score =   205 bits (522),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 103/137 (75%), Positives = 127/137 (93%), Gaps = 0/137 (0%)
 Frame = +1

Query  112  IPAFDPPKKVKRNKYaiaaaflaslasillGYDIGVMSGAAIYIQKDLKINDTQVEILLG  291
            +P FDPPKK KRNK+++A A LAS+ S+LLGYDIGVMSGAA++I++D +++DT++EIL+G
Sbjct  20   LPDFDPPKKNKRNKFSLACATLASMTSVLLGYDIGVMSGAAMFIKEDFRLSDTKIEILVG  79

Query  292  ILNLYSLIGSCMAGRTSDWIGRRYTMVVASVVFFVGAILMGFSTNYTFLMVGRFVAGIGV  471
            ILNLYSLIGS  AGRTSDWIGRRYTMVVA+V+FF GA+LMGF+T+Y+FLM GRFVAG+GV
Sbjct  80   ILNLYSLIGSAAAGRTSDWIGRRYTMVVAAVIFFAGALLMGFATSYSFLMFGRFVAGVGV  139

Query  472  GYALMIAPVYTAEVAPA  522
            GYALMIAPVYTAEV+PA
Sbjct  140  GYALMIAPVYTAEVSPA  156



>ref|XP_004507415.1| PREDICTED: polyol transporter 5-like [Cicer arietinum]
Length=526

 Score =   205 bits (522),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 108/151 (72%), Positives = 126/151 (83%), Gaps = 0/151 (0%)
 Frame = +1

Query  70   MGDTRPVRNAGSGHIPAFDPPKKVKRNKYaiaaaflaslasillGYDIGVMSGAAIYIQK  249
            M + + V       +  FDP KK KRN YA A A LAS+ SILLGYDIGVMSGAAIYIQ+
Sbjct  1    MSEGKVVEAKAPQTLHDFDPQKKPKRNMYAFACAMLASMTSILLGYDIGVMSGAAIYIQR  60

Query  250  DLKINDTQVEILLGILNLYSLIGSCMAGRTSDWIGRRYTMVVASVVFFVGAILMGFSTNY  429
            DLK++D Q+EILLGI+N+YSLIGSC+AGRTSDWIGRRYT+V A V+FF GA+LMGFS NY
Sbjct  61   DLKVSDVQIEILLGIINIYSLIGSCLAGRTSDWIGRRYTIVFAGVIFFAGALLMGFSPNY  120

Query  430  TFLMVGRFVAGIGVGYALMIAPVYTAEVAPA  522
            +FLM GRFVAG+G+GYALMIAPVYTAEV+PA
Sbjct  121  SFLMFGRFVAGVGIGYALMIAPVYTAEVSPA  151



>gb|EYU42630.1| hypothetical protein MIMGU_mgv1a0059091mg, partial [Erythranthe 
guttata]
Length=189

 Score =   195 bits (496),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 105/137 (77%), Positives = 120/137 (88%), Gaps = 0/137 (0%)
 Frame = +1

Query  112  IPAFDPPKKVKRNKYaiaaaflaslasillGYDIGVMSGAAIYIQKDLKINDTQVEILLG  291
            IP FDPPKK KRN YA+A +FLAS+ SILLGYDIGVMSGA IYIQ++  I   Q E+++G
Sbjct  18   IPGFDPPKKPKRNMYALACSFLASMTSILLGYDIGVMSGAIIYIQEEFGITSVQKEVVMG  77

Query  292  ILNLYSLIGSCMAGRTSDWIGRRYTMVVASVVFFVGAILMGFSTNYTFLMVGRFVAGIGV  471
            ILN+YSL+GS  AGRTSDWIGRRYT+V+A  +FFVGA+LMGF+TNY FLMVGRFVAGIGV
Sbjct  78   ILNVYSLLGSAAAGRTSDWIGRRYTIVLAGAIFFVGALLMGFATNYAFLMVGRFVAGIGV  137

Query  472  GYALMIAPVYTAEVAPA  522
            GYALMIAPVYTAEVAPA
Sbjct  138  GYALMIAPVYTAEVAPA  154



>ref|XP_004299107.1| PREDICTED: polyol transporter 5-like [Fragaria vesca subsp. vesca]
Length=535

 Score =   205 bits (521),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 114/156 (73%), Positives = 127/156 (81%), Gaps = 5/156 (3%)
 Frame = +1

Query  70   MGDTRPVRNAGSGH-----IPAFDPPKKVKRNKYaiaaaflaslasillGYDIGVMSGAA  234
            M D R   NA SG      I  FDP  K KRNKYA A A LAS+ SILLGYDIGVMSGAA
Sbjct  1    MADRRAEENAVSGQPTQKAIADFDPAPKPKRNKYAFACAMLASMTSILLGYDIGVMSGAA  60

Query  235  IYIQKDLKINDTQVEILLGILNLYSLIGSCMAGRTSDWIGRRYTMVVASVVFFVGAILMG  414
            I+I+ DLKI+D QVE+L+GILNLYSLIGS  AGRTSDWIGRRYT+V+A  +FF GA+LMG
Sbjct  61   IFIKDDLKISDVQVEVLMGILNLYSLIGSAAAGRTSDWIGRRYTIVLAGAIFFAGALLMG  120

Query  415  FSTNYTFLMVGRFVAGIGVGYALMIAPVYTAEVAPA  522
            F+TNY+FLM GRFVAGIGVGYALMIAPVYTAEV+PA
Sbjct  121  FATNYSFLMFGRFVAGIGVGYALMIAPVYTAEVSPA  156



>ref|XP_009800568.1| PREDICTED: polyol transporter 5-like [Nicotiana sylvestris]
Length=534

 Score =   205 bits (521),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 115/155 (74%), Positives = 128/155 (83%), Gaps = 4/155 (3%)
 Frame = +1

Query  70   MGDTRPVRNAGSGHI----PAFDPPKKVKRNKYaiaaaflaslasillGYDIGVMSGAAI  237
            M + +   N G   I      FDPPKK KRNKYAIA +FLASLASILLGYDIGVMSGA I
Sbjct  1    MAEEKLASNNGQPQIVTSIQDFDPPKKPKRNKYAIACSFLASLASILLGYDIGVMSGAII  60

Query  238  YIQKDLKINDTQVEILLGILNLYSLIGSCMAGRTSDWIGRRYTMVVASVVFFVGAILMGF  417
            YI+KDL I DTQVEIL+GILN+YSL GS  AGRTSDWIGRRYTMVVA+ +FF GA+LMGF
Sbjct  61   YIKKDLHITDTQVEILVGILNIYSLFGSAAAGRTSDWIGRRYTMVVAAAIFFAGALLMGF  120

Query  418  STNYTFLMVGRFVAGIGVGYALMIAPVYTAEVAPA  522
            +T Y FLMVGRFVAG+GVGYALM+APVYTAEV+PA
Sbjct  121  ATTYAFLMVGRFVAGVGVGYALMVAPVYTAEVSPA  155



>gb|KEH30426.1| polyol/monosaccharide transporter 1 [Medicago truncatula]
Length=522

 Score =   204 bits (520),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 106/151 (70%), Positives = 127/151 (84%), Gaps = 0/151 (0%)
 Frame = +1

Query  70   MGDTRPVRNAGSGHIPAFDPPKKVKRNKYaiaaaflaslasillGYDIGVMSGAAIYIQK  249
            M + + V      ++  FDP KK KRNKYA A A LAS+ SILLGYDIGVMSGAAIYI++
Sbjct  1    MSEGKIVEAKAQKNLQDFDPQKKPKRNKYAFACAMLASMTSILLGYDIGVMSGAAIYIKR  60

Query  250  DLKINDTQVEILLGILNLYSLIGSCMAGRTSDWIGRRYTMVVASVVFFVGAILMGFSTNY  429
            DLK++D ++E+LLGI+N+YSLIGSC+AGRTSDWIGRRYT+V A  +FFVGA+LMGFS NY
Sbjct  61   DLKVSDGKIEVLLGIINIYSLIGSCLAGRTSDWIGRRYTIVFAGAIFFVGALLMGFSPNY  120

Query  430  TFLMVGRFVAGIGVGYALMIAPVYTAEVAPA  522
             FLM GRFVAG+G+GYALMIAPVYTAEV+PA
Sbjct  121  NFLMFGRFVAGVGIGYALMIAPVYTAEVSPA  151



>emb|CAP58706.1| putative polyol transporter protein 1 [Hevea brasiliensis]
 emb|CAN88842.1| polyols transporter 1 [Hevea brasiliensis]
Length=525

 Score =   204 bits (519),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 109/149 (73%), Positives = 126/149 (85%), Gaps = 0/149 (0%)
 Frame = +1

Query  76   DTRPVRNAGSGHIPAFDPPKKVKRNKYaiaaaflaslasillGYDIGVMSGAAIYIQKDL  255
            D  P        +  FDPPKK KRNK+A+A A LAS+ SILLGYDIGVMSGAAIYI+ DL
Sbjct  9    DVNPSSQPAEKTLADFDPPKKPKRNKFALACAALASMTSILLGYDIGVMSGAAIYIKDDL  68

Query  256  KINDTQVEILLGILNLYSLIGSCMAGRTSDWIGRRYTMVVASVVFFVGAILMGFSTNYTF  435
            KI+DTQVEIL+G LN+YSL+GS  AGRTSDWIGRRYT+VVA  +FFVGA+LMGF+TNY F
Sbjct  69   KISDTQVEILVGTLNIYSLVGSAAAGRTSDWIGRRYTIVVAGGIFFVGALLMGFATNYAF  128

Query  436  LMVGRFVAGIGVGYALMIAPVYTAEVAPA  522
            LMVGRF+AGIGVGYA++IAPVYTAEV+PA
Sbjct  129  LMVGRFIAGIGVGYAVVIAPVYTAEVSPA  157



>gb|AGG19155.1| sorbitol transporter [Pyrus pyrifolia]
Length=535

 Score =   204 bits (518),  Expect = 4e-59, Method: Compositional matrix adjust.
 Identities = 109/137 (80%), Positives = 122/137 (89%), Gaps = 0/137 (0%)
 Frame = +1

Query  112  IPAFDPPKKVKRNKYaiaaaflaslasillGYDIGVMSGAAIYIQKDLKINDTQVEILLG  291
            I  FDPP+K KRNKYA A A LAS+ SILLGYDIGVMSGAAIYI+ DLKI+D +VE+LLG
Sbjct  19   IEDFDPPQKPKRNKYAFACAILASMTSILLGYDIGVMSGAAIYIKDDLKISDVEVEVLLG  78

Query  292  ILNLYSLIGSCMAGRTSDWIGRRYTMVVASVVFFVGAILMGFSTNYTFLMVGRFVAGIGV  471
            ILNLYSLIGS  AGRTSDW+GRRYT+V+A  +FFVGA+LMGF+TNY FLM GRFVAGIGV
Sbjct  79   ILNLYSLIGSAAAGRTSDWVGRRYTIVLAGAIFFVGALLMGFATNYAFLMFGRFVAGIGV  138

Query  472  GYALMIAPVYTAEVAPA  522
            GYALMIAPVYTAEV+PA
Sbjct  139  GYALMIAPVYTAEVSPA  155



>ref|XP_009344431.1| PREDICTED: putative polyol transporter 1 [Pyrus x bretschneideri]
 ref|XP_009344432.1| PREDICTED: putative polyol transporter 1 [Pyrus x bretschneideri]
Length=535

 Score =   203 bits (517),  Expect = 5e-59, Method: Compositional matrix adjust.
 Identities = 109/137 (80%), Positives = 122/137 (89%), Gaps = 0/137 (0%)
 Frame = +1

Query  112  IPAFDPPKKVKRNKYaiaaaflaslasillGYDIGVMSGAAIYIQKDLKINDTQVEILLG  291
            I  FDPP+K KRNKYA A A LAS+ SILLGYDIGVMSGAAIYI+ DLKI+D +VE+LLG
Sbjct  19   IEDFDPPQKPKRNKYAFACAILASMTSILLGYDIGVMSGAAIYIKDDLKISDVEVEVLLG  78

Query  292  ILNLYSLIGSCMAGRTSDWIGRRYTMVVASVVFFVGAILMGFSTNYTFLMVGRFVAGIGV  471
            ILNLYSLIGS  AGRTSDW+GRRYT+V+A  +FFVGA+LMGF+TNY FLM GRFVAGIGV
Sbjct  79   ILNLYSLIGSAAAGRTSDWVGRRYTIVLAGAIFFVGALLMGFATNYAFLMFGRFVAGIGV  138

Query  472  GYALMIAPVYTAEVAPA  522
            GYALMIAPVYTAEV+PA
Sbjct  139  GYALMIAPVYTAEVSPA  155



>ref|XP_009375627.1| PREDICTED: putative polyol transporter 1 [Pyrus x bretschneideri]
Length=535

 Score =   203 bits (517),  Expect = 5e-59, Method: Compositional matrix adjust.
 Identities = 109/137 (80%), Positives = 121/137 (88%), Gaps = 0/137 (0%)
 Frame = +1

Query  112  IPAFDPPKKVKRNKYaiaaaflaslasillGYDIGVMSGAAIYIQKDLKINDTQVEILLG  291
            I  FDPP+K KRNKYA A A LAS+ SILLGYDIGVMSGAAIYI+ DLKI D +VE+LLG
Sbjct  19   IEDFDPPQKPKRNKYAFACAILASMTSILLGYDIGVMSGAAIYIKDDLKITDVEVEVLLG  78

Query  292  ILNLYSLIGSCMAGRTSDWIGRRYTMVVASVVFFVGAILMGFSTNYTFLMVGRFVAGIGV  471
            ILNLYSLIGS  AGRTSDW+GRRYT+V+A  +FFVGA+LMGF+TNY FLM GRFVAGIGV
Sbjct  79   ILNLYSLIGSAAAGRTSDWVGRRYTIVLAGAIFFVGALLMGFATNYAFLMFGRFVAGIGV  138

Query  472  GYALMIAPVYTAEVAPA  522
            GYALMIAPVYTAEV+PA
Sbjct  139  GYALMIAPVYTAEVSPA  155



>ref|XP_007200585.1| hypothetical protein PRUPE_ppa007633mg [Prunus persica]
 gb|EMJ01784.1| hypothetical protein PRUPE_ppa007633mg [Prunus persica]
Length=361

 Score =   199 bits (506),  Expect = 6e-59, Method: Compositional matrix adjust.
 Identities = 112/156 (72%), Positives = 127/156 (81%), Gaps = 5/156 (3%)
 Frame = +1

Query  70   MGDTRPVRNAG-SGH----IPAFDPPKKVKRNKYaiaaaflaslasillGYDIGVMSGAA  234
            M D R   NA  SG     I  FDPP K KRNKYA A A LAS+ SILLGYDIGVMSGAA
Sbjct  1    MADERAEDNAVVSGQPQKTIADFDPPGKPKRNKYAFACAILASMTSILLGYDIGVMSGAA  60

Query  235  IYIQKDLKINDTQVEILLGILNLYSLIGSCMAGRTSDWIGRRYTMVVASVVFFVGAILMG  414
            IYI+KDLK++D ++E+L+GILNLYSLIGS  AGRTSDWIGRRYT+V+A  +FF GA+LMG
Sbjct  61   IYIKKDLKVSDVEIEVLIGILNLYSLIGSAAAGRTSDWIGRRYTIVLAGAIFFAGALLMG  120

Query  415  FSTNYTFLMVGRFVAGIGVGYALMIAPVYTAEVAPA  522
            F+ NY FLM GRF+AGIGVGYALMIAPVYTAEV+PA
Sbjct  121  FAPNYAFLMFGRFIAGIGVGYALMIAPVYTAEVSPA  156



>gb|ACB56939.1| mannitol transporter [Artemisia annua]
Length=522

 Score =   203 bits (516),  Expect = 6e-59, Method: Compositional matrix adjust.
 Identities = 108/154 (70%), Positives = 126/154 (82%), Gaps = 3/154 (2%)
 Frame = +1

Query  70   MGDTRPVRN---AGSGHIPAFDPPKKVKRNKYaiaaaflaslasillGYDIGVMSGAAIY  240
            M D +P  N   + +  +  FDPPK  KRNKYA A A LAS+ S+LLGYDIGVMSGA IY
Sbjct  1    MADQKPEENGVSSKTKELADFDPPKAPKRNKYAFACAMLASMTSVLLGYDIGVMSGAQIY  60

Query  241  IQKDLKINDTQVEILLGILNLYSLIGSCMAGRTSDWIGRRYTMVVASVVFFVGAILMGFS  420
            I++DL  +D Q++IL+GILNLYSL+GS  AGRTSDWIGRRYT+V+A V+FF GAILMGF+
Sbjct  61   IKRDLHCSDNQIQILVGILNLYSLVGSAAAGRTSDWIGRRYTIVLAGVIFFTGAILMGFA  120

Query  421  TNYTFLMVGRFVAGIGVGYALMIAPVYTAEVAPA  522
            TNY FLM GRFVAGIGVGYALMIAPVYTAEV+PA
Sbjct  121  TNYAFLMFGRFVAGIGVGYALMIAPVYTAEVSPA  154



>ref|XP_007042744.1| Polyol/monosaccharide transporter 5 [Theobroma cacao]
 gb|EOX98575.1| Polyol/monosaccharide transporter 5 [Theobroma cacao]
Length=538

 Score =   203 bits (516),  Expect = 9e-59, Method: Compositional matrix adjust.
 Identities = 109/134 (81%), Positives = 119/134 (89%), Gaps = 0/134 (0%)
 Frame = +1

Query  121  FDPPKKVKRNKYaiaaaflaslasillGYDIGVMSGAAIYIQKDLKINDTQVEILLGILN  300
            F+P KK KRNK+A A A LASL SILLGYDIGVMSGA IYI+ DLKIND QVEIL+GILN
Sbjct  25   FEPAKKPKRNKFAFACAILASLTSILLGYDIGVMSGAVIYIKDDLKINDVQVEILVGILN  84

Query  301  LYSLIGSCMAGRTSDWIGRRYTMVVASVVFFVGAILMGFSTNYTFLMVGRFVAGIGVGYA  480
            LY L+GSC AGRTSDWIGRRYT+V A  +FFVGA+LMGF+TNY FLMVGRFVAGIGVGYA
Sbjct  85   LYCLVGSCAAGRTSDWIGRRYTIVFACAIFFVGALLMGFATNYAFLMVGRFVAGIGVGYA  144

Query  481  LMIAPVYTAEVAPA  522
            LMIAPVYTAEV+PA
Sbjct  145  LMIAPVYTAEVSPA  158



>ref|XP_008387369.1| PREDICTED: putative polyol transporter 1 isoform X2 [Malus domestica]
Length=535

 Score =   202 bits (514),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 110/149 (74%), Positives = 124/149 (83%), Gaps = 0/149 (0%)
 Frame = +1

Query  76   DTRPVRNAGSGHIPAFDPPKKVKRNKYaiaaaflaslasillGYDIGVMSGAAIYIQKDL  255
            D   V +     I  FDPP+K KRNKYA A A LAS+ SILLG DIGVMSGAAIYI+ DL
Sbjct  7    DDNTVSSQPQKTIEDFDPPQKPKRNKYAFACAILASMTSILLGLDIGVMSGAAIYIKDDL  66

Query  256  KINDTQVEILLGILNLYSLIGSCMAGRTSDWIGRRYTMVVASVVFFVGAILMGFSTNYTF  435
            KI+D +VEILLGILNLYSLIGS  AGRTSDW+GRRYT+V+A  +FFVGA+LMGF+TNY F
Sbjct  67   KISDVEVEILLGILNLYSLIGSAAAGRTSDWVGRRYTIVLAGAIFFVGALLMGFATNYAF  126

Query  436  LMVGRFVAGIGVGYALMIAPVYTAEVAPA  522
            LM GRFVAG+GVGYALMIAPVYTAEV+PA
Sbjct  127  LMFGRFVAGVGVGYALMIAPVYTAEVSPA  155



>ref|XP_003539021.2| PREDICTED: polyol transporter 5-like [Glycine max]
Length=312

 Score =   196 bits (499),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 105/135 (78%), Positives = 117/135 (87%), Gaps = 1/135 (1%)
 Frame = +1

Query  121  FDPP-KKVKRNKYaiaaaflaslasillGYDIGVMSGAAIYIQKDLKINDTQVEILLGIL  297
            FDPP KK KRN YA A A LA+  SILLGYDIGVMSGAAIYI+KDLK++D Q+EIL+GI 
Sbjct  21   FDPPIKKPKRNTYAFACAMLATTTSILLGYDIGVMSGAAIYIKKDLKVSDVQIEILIGIF  80

Query  298  NLYSLIGSCMAGRTSDWIGRRYTMVVASVVFFVGAILMGFSTNYTFLMVGRFVAGIGVGY  477
            NLYSLIGSC+AGRTSDWIGRRYT+V A  +FF GAILMGFS NY FLM GRFVAGIG+GY
Sbjct  81   NLYSLIGSCLAGRTSDWIGRRYTIVFAGAIFFAGAILMGFSPNYAFLMFGRFVAGIGMGY  140

Query  478  ALMIAPVYTAEVAPA  522
             LMIAPVYT+EV+PA
Sbjct  141  GLMIAPVYTSEVSPA  155



>gb|AAT06053.2| sorbitol transporter [Malus domestica]
Length=533

 Score =   201 bits (512),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 103/148 (70%), Positives = 125/148 (84%), Gaps = 0/148 (0%)
 Frame = +1

Query  76   DTRPVRNAGSGHIPAFDPPKKVKRNKYaiaaaflaslasillGYDIGVMSGAAIYIQKDL  255
            D   V +     I  FDPP+K KRNKYA A A LAS+ SIL+GYDIGVMSGA+IYI+KDL
Sbjct  7    DDNTVSSQPQKTIADFDPPQKPKRNKYAFACAILASMTSILMGYDIGVMSGASIYIEKDL  66

Query  256  KINDTQVEILLGILNLYSLIGSCMAGRTSDWIGRRYTMVVASVVFFVGAILMGFSTNYTF  435
            K+ DTQ+EI++G++ +YSLIGS MAG+TSDW+GRRYT+V++  +FF+GAILMGFSTNYTF
Sbjct  67   KVTDTQIEIMIGVIEIYSLIGSAMAGKTSDWVGRRYTIVISGAIFFIGAILMGFSTNYTF  126

Query  436  LMVGRFVAGIGVGYALMIAPVYTAEVAP  519
            LM GRFVAGIGVGYAL IAPVY+AEV+P
Sbjct  127  LMCGRFVAGIGVGYALTIAPVYSAEVSP  154



>emb|CAJ29291.1| putative polyol transporter protein 4 [Lotus japonicus]
Length=519

 Score =   201 bits (511),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 107/144 (74%), Positives = 124/144 (86%), Gaps = 0/144 (0%)
 Frame = +1

Query  91   RNAGSGHIPAFDPPKKVKRNKYaiaaaflaslasillGYDIGVMSGAAIYIQKDLKINDT  270
             NA   ++  FDP KK KRNKYA A A LAS+ SILLGYDIGVMSGAAIYI++DLK++D 
Sbjct  11   ENANQKNLQDFDPQKKPKRNKYAFACAMLASMTSILLGYDIGVMSGAAIYIKRDLKVSDV  70

Query  271  QVEILLGILNLYSLIGSCMAGRTSDWIGRRYTMVVASVVFFVGAILMGFSTNYTFLMVGR  450
            ++EILLGI+NLYSLIGS +AGRTSDWIGRRYT+V A  +FFVGA+LMGFS NY FLM GR
Sbjct  71   KIEILLGIINLYSLIGSGLAGRTSDWIGRRYTIVFAGAIFFVGALLMGFSPNYWFLMFGR  130

Query  451  FVAGIGVGYALMIAPVYTAEVAPA  522
            F+AGIG+GYALMIAPVYTAEV+PA
Sbjct  131  FIAGIGIGYALMIAPVYTAEVSPA  154



>gb|ACC61047.1| mannitol transporter [Gossypium hirsutum]
Length=392

 Score =   197 bits (501),  Expect = 6e-58, Method: Compositional matrix adjust.
 Identities = 110/150 (73%), Positives = 128/150 (85%), Gaps = 2/150 (1%)
 Frame = +1

Query  76   DTRPVRNAGSGHIPAFDPP-KKVKRNKYaiaaaflaslasillGYDIGVMSGAAIYIQKD  252
             TRPV  A + +   F+P  KK KRNK+A A A LASL SILLGYDIGV+SGA IYIQ+D
Sbjct  12   STRPVM-ADNRNFADFEPAVKKPKRNKFASACAILASLTSILLGYDIGVISGAIIYIQED  70

Query  253  LKINDTQVEILLGILNLYSLIGSCMAGRTSDWIGRRYTMVVASVVFFVGAILMGFSTNYT  432
            LKIND Q EIL+GILN+YSL+GSC AGRTSDW+GRRYT+V+A  +FF+GA+LMGF+T+Y 
Sbjct  71   LKINDVQKEILMGILNVYSLVGSCAAGRTSDWVGRRYTIVLAGAIFFLGALLMGFATSYA  130

Query  433  FLMVGRFVAGIGVGYALMIAPVYTAEVAPA  522
            FLMVGRFVAGIGVGYALMIAPVYTAEV+PA
Sbjct  131  FLMVGRFVAGIGVGYALMIAPVYTAEVSPA  160



>ref|XP_009611551.1| PREDICTED: polyol transporter 5-like [Nicotiana tomentosiformis]
Length=539

 Score =   201 bits (510),  Expect = 7e-58, Method: Compositional matrix adjust.
 Identities = 114/157 (73%), Positives = 126/157 (80%), Gaps = 6/157 (4%)
 Frame = +1

Query  70   MGDTRPVRNAGSGHIPA------FDPPKKVKRNKYaiaaaflaslasillGYDIGVMSGA  231
            M + +   N G    P       FDPPKK K NKYAIA +FLASLASILLGYDIGVMSGA
Sbjct  1    MAEEKLASNNGVHSQPQIASIRDFDPPKKPKTNKYAIACSFLASLASILLGYDIGVMSGA  60

Query  232  AIYIQKDLKINDTQVEILLGILNLYSLIGSCMAGRTSDWIGRRYTMVVASVVFFVGAILM  411
             IYIQKDL I D QVEIL+GILN+YSL GS  AGRTSDWIGRRYTMVVA+ +FF GA+LM
Sbjct  61   IIYIQKDLHITDIQVEILVGILNVYSLFGSAAAGRTSDWIGRRYTMVVAAAIFFAGALLM  120

Query  412  GFSTNYTFLMVGRFVAGIGVGYALMIAPVYTAEVAPA  522
            GF+T Y FLMVGRFVAG+GVGYALM+APVYTAEV+PA
Sbjct  121  GFATTYAFLMVGRFVAGVGVGYALMVAPVYTAEVSPA  157



>gb|KDP46230.1| hypothetical protein JCGZ_10070 [Jatropha curcas]
Length=542

 Score =   201 bits (510),  Expect = 7e-58, Method: Compositional matrix adjust.
 Identities = 107/144 (74%), Positives = 123/144 (85%), Gaps = 0/144 (0%)
 Frame = +1

Query  91   RNAGSGHIPAFDPPKKVKRNKYaiaaaflaslasillGYDIGVMSGAAIYIQKDLKINDT  270
            +N     +  FDPPKK K NK+A+A A LAS+ SILLGYDIGVMSGAAIYI+ DLKI+D 
Sbjct  18   QNQTEKRLADFDPPKKPKSNKFALACAVLASMTSILLGYDIGVMSGAAIYIKDDLKISDL  77

Query  271  QVEILLGILNLYSLIGSCMAGRTSDWIGRRYTMVVASVVFFVGAILMGFSTNYTFLMVGR  450
            QVE+L+G LN+YSL+GS  AGRTSDWIGRRYT+VVA  +FFVGA+LMGF+T Y FLMVGR
Sbjct  78   QVEVLVGTLNIYSLVGSAAAGRTSDWIGRRYTIVVAGAIFFVGALLMGFATTYAFLMVGR  137

Query  451  FVAGIGVGYALMIAPVYTAEVAPA  522
            FVAGIGVGYALMIAPVYTAEV+PA
Sbjct  138  FVAGIGVGYALMIAPVYTAEVSPA  161



>ref|XP_007208924.1| hypothetical protein PRUPE_ppb008257mg [Prunus persica]
 gb|EMJ10123.1| hypothetical protein PRUPE_ppb008257mg [Prunus persica]
Length=270

 Score =   193 bits (490),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 111/151 (74%), Positives = 122/151 (81%), Gaps = 3/151 (2%)
 Frame = +1

Query  70   MGDTRPVRNAGSGHIPAFDPPKKVKRNKYaiaaaflaslasillGYDIGVMSGAAIYIQK  249
            M D R   NA SG  P     KK KRN YAI  A LAS+ SILLGYDIGVMSGA+IYIQ+
Sbjct  1    MTDHRAEANAVSGQ-PLLK--KKPKRNLYAIGCAILASMTSILLGYDIGVMSGASIYIQE  57

Query  250  DLKINDTQVEILLGILNLYSLIGSCMAGRTSDWIGRRYTMVVASVVFFVGAILMGFSTNY  429
            DLKI D +VEIL+GILNLYSLIGS  AGRTSDWIGRRYT+V A  +FF GA+LMGF+TN+
Sbjct  58   DLKITDVEVEILIGILNLYSLIGSAAAGRTSDWIGRRYTIVFAGAIFFTGALLMGFATNF  117

Query  430  TFLMVGRFVAGIGVGYALMIAPVYTAEVAPA  522
             FLMVGRFVAGIGVGYALMIAPVY AEV+PA
Sbjct  118  AFLMVGRFVAGIGVGYALMIAPVYNAEVSPA  148



>ref|XP_007131850.1| hypothetical protein PHAVU_011G046600g [Phaseolus vulgaris]
 gb|ESW03844.1| hypothetical protein PHAVU_011G046600g [Phaseolus vulgaris]
Length=510

 Score =   199 bits (506),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 101/134 (75%), Positives = 117/134 (87%), Gaps = 0/134 (0%)
 Frame = +1

Query  121  FDPPKKVKRNKYaiaaaflaslasillGYDIGVMSGAAIYIQKDLKINDTQVEILLGILN  300
            FDPPKK K NKYA   A LAS   ILLGYDIGVM+GAAIYI++DLK++D Q+EILLGI+N
Sbjct  16   FDPPKKHKTNKYAFGCAILASTTCILLGYDIGVMTGAAIYIKRDLKVSDVQIEILLGIIN  75

Query  301  LYSLIGSCMAGRTSDWIGRRYTMVVASVVFFVGAILMGFSTNYTFLMVGRFVAGIGVGYA  480
            LYSLIGSC+AGRTSDW+GRRYT+V A  +FF GA+LMGFS NY+FLM GRFVAGIG+GYA
Sbjct  76   LYSLIGSCVAGRTSDWLGRRYTIVFAGTIFFAGALLMGFSPNYSFLMFGRFVAGIGIGYA  135

Query  481  LMIAPVYTAEVAPA  522
            LMI PVY+AEV+PA
Sbjct  136  LMIGPVYSAEVSPA  149



>emb|CAP58707.1| putative polyol transported protein 2 [Hevea brasiliensis]
Length=547

 Score =   199 bits (507),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 107/134 (80%), Positives = 121/134 (90%), Gaps = 0/134 (0%)
 Frame = +1

Query  121  FDPPKKVKRNKYaiaaaflaslasillGYDIGVMSGAAIYIQKDLKINDTQVEILLGILN  300
            FDP KK KRNK+A A A LAS+ SILLGYDIGVMSGAAIYI+K+LKI+DTQVEIL G LN
Sbjct  25   FDPQKKPKRNKFAFACAILASMTSILLGYDIGVMSGAAIYIKKNLKISDTQVEILAGTLN  84

Query  301  LYSLIGSCMAGRTSDWIGRRYTMVVASVVFFVGAILMGFSTNYTFLMVGRFVAGIGVGYA  480
            +YSL+GS  AGRTSDWIGRRYT+V+A  +FFVGA+LMGF+TNY FLMVGRFVAG+GVGYA
Sbjct  85   IYSLVGSAAAGRTSDWIGRRYTIVMAGGIFFVGALLMGFATNYAFLMVGRFVAGVGVGYA  144

Query  481  LMIAPVYTAEVAPA  522
            LMIAPVYTAEV+PA
Sbjct  145  LMIAPVYTAEVSPA  158



>ref|XP_009780685.1| PREDICTED: polyol transporter 5-like [Nicotiana sylvestris]
Length=174

 Score =   189 bits (481),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 99/132 (75%), Positives = 116/132 (88%), Gaps = 0/132 (0%)
 Frame = +1

Query  127  PPKKVKRNKYaiaaaflaslasillGYDIGVMSGAAIYIQKDLKINDTQVEILLGILNLY  306
            P KK KRNKYA A + LAS+ S+LLGYD GVMSGA IYI++DLKI+D Q+EIL+G +N+Y
Sbjct  25   PCKKSKRNKYAFACSLLASMTSVLLGYDTGVMSGAVIYIKEDLKISDVQIEILVGTINIY  84

Query  307  SLIGSCMAGRTSDWIGRRYTMVVASVVFFVGAILMGFSTNYTFLMVGRFVAGIGVGYALM  486
            SL+G+ +AGRTSDWIGRRYT++ AS +FF GAILMGF+TNY FLM GRFVAGIGVGYALM
Sbjct  85   SLVGAALAGRTSDWIGRRYTIIFASAIFFAGAILMGFATNYGFLMFGRFVAGIGVGYALM  144

Query  487  IAPVYTAEVAPA  522
            IAPVYTAEVAPA
Sbjct  145  IAPVYTAEVAPA  156



>gb|KHG20989.1| Polyol transporter 5 -like protein [Gossypium arboreum]
Length=539

 Score =   199 bits (507),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 111/150 (74%), Positives = 128/150 (85%), Gaps = 2/150 (1%)
 Frame = +1

Query  76   DTRPVRNAGSGHIPAFDPP-KKVKRNKYaiaaaflaslasillGYDIGVMSGAAIYIQKD  252
             TRPV  A + +   F+P  KK KRNK+A A A LASL SILLGYDIGVMSGA IYIQ+D
Sbjct  12   STRPVM-ADNRNFADFEPAVKKPKRNKFAFACAILASLTSILLGYDIGVMSGAIIYIQED  70

Query  253  LKINDTQVEILLGILNLYSLIGSCMAGRTSDWIGRRYTMVVASVVFFVGAILMGFSTNYT  432
            LKIND Q EIL+GILN+YSL+GSC AGRTSDW+GRRYT+V+A  +FF+GA+LMGF+T+Y 
Sbjct  71   LKINDVQKEILMGILNVYSLVGSCAAGRTSDWVGRRYTIVLAGAIFFLGALLMGFATSYA  130

Query  433  FLMVGRFVAGIGVGYALMIAPVYTAEVAPA  522
            FLMVGRFVAGIGVGYALMIAPVYTAEV+PA
Sbjct  131  FLMVGRFVAGIGVGYALMIAPVYTAEVSPA  160



>ref|XP_006406559.1| hypothetical protein EUTSA_v10020495mg [Eutrema salsugineum]
 gb|ESQ48012.1| hypothetical protein EUTSA_v10020495mg [Eutrema salsugineum]
Length=529

 Score =   199 bits (505),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 105/141 (74%), Positives = 120/141 (85%), Gaps = 0/141 (0%)
 Frame = +1

Query  100  GSGHIPAFDPPKKVKRNKYaiaaaflaslasillGYDIGVMSGAAIYIQKDLKINDTQVE  279
            G+ H+P   PP K KRNKYA A A LAS+ SILLGYDIGVMSGA IYI++DLKI+D Q+ 
Sbjct  17   GTKHVPELGPPAKPKRNKYAFACAILASMTSILLGYDIGVMSGAMIYIKRDLKISDLQIG  76

Query  280  ILLGILNLYSLIGSCMAGRTSDWIGRRYTMVVASVVFFVGAILMGFSTNYTFLMVGRFVA  459
            IL GILN+YSLIGSC AG+TSDWIGRRYT+V+A  +FF GA+LMGF+ NY FLM GRFVA
Sbjct  77   ILAGILNIYSLIGSCAAGKTSDWIGRRYTIVLAGAIFFAGALLMGFAPNYAFLMFGRFVA  136

Query  460  GIGVGYALMIAPVYTAEVAPA  522
            GIGVGYALMIAPVYTAEV+PA
Sbjct  137  GIGVGYALMIAPVYTAEVSPA  157



>gb|AGY96955.1| polyol transporter 1 [Vitis vinifera]
Length=528

 Score =   199 bits (505),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 107/137 (78%), Positives = 121/137 (88%), Gaps = 0/137 (0%)
 Frame = +1

Query  112  IPAFDPPKKVKRNKYaiaaaflaslasillGYDIGVMSGAAIYIQKDLKINDTQVEILLG  291
            +  FD PKK  RNKYAIA   LAS+ SILLGYDIGVMSGAAIYI+KDLKI+D +VEIL+G
Sbjct  19   VTEFDAPKKKGRNKYAIACTILASMTSILLGYDIGVMSGAAIYIKKDLKISDVEVEILVG  78

Query  292  ILNLYSLIGSCMAGRTSDWIGRRYTMVVASVVFFVGAILMGFSTNYTFLMVGRFVAGIGV  471
            ILN+Y L GS  AGRTSDWIGRRYT+V+ASV+FF+GA+LMGF+TNY FLMVGRFVAGIGV
Sbjct  79   ILNVYCLFGSAAAGRTSDWIGRRYTIVLASVIFFLGALLMGFATNYVFLMVGRFVAGIGV  138

Query  472  GYALMIAPVYTAEVAPA  522
            GYALMIAPVY AEV+PA
Sbjct  139  GYALMIAPVYAAEVSPA  155



>ref|XP_002519083.1| sugar transporter, putative [Ricinus communis]
 gb|EEF43294.1| sugar transporter, putative [Ricinus communis]
Length=539

 Score =   199 bits (505),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 110/152 (72%), Positives = 126/152 (83%), Gaps = 9/152 (6%)
 Frame = +1

Query  94   NAGSGHIPA---------FDPPKKVKRNKYaiaaaflaslasillGYDIGVMSGAAIYIQ  246
            NA S   PA         FDPPKK KRNK+A+A A LAS+ SILLGYDIGVMSGAAIYI+
Sbjct  5    NADSSTQPAPISNKTIADFDPPKKPKRNKFALACAILASMTSILLGYDIGVMSGAAIYIK  64

Query  247  KDLKINDTQVEILLGILNLYSLIGSCMAGRTSDWIGRRYTMVVASVVFFVGAILMGFSTN  426
             + +++D QVEIL+G LNLYSL+GS  AGRTSDWIGRRYT+VVA  +FFVGA+LMGF+T+
Sbjct  65   DEFRLSDLQVEILVGTLNLYSLVGSAAAGRTSDWIGRRYTIVVAGAIFFVGALLMGFATS  124

Query  427  YTFLMVGRFVAGIGVGYALMIAPVYTAEVAPA  522
            Y FLMVGRFVAGIGVGYALMIAPVYTAEV+PA
Sbjct  125  YAFLMVGRFVAGIGVGYALMIAPVYTAEVSPA  156



>ref|NP_001236592.1| sorbitol-like transporter [Glycine max]
 emb|CAD91337.1| sorbitol-like transporter [Glycine max]
Length=523

 Score =   198 bits (504),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 105/145 (72%), Positives = 122/145 (84%), Gaps = 2/145 (1%)
 Frame = +1

Query  94   NAGSGH--IPAFDPPKKVKRNKYaiaaaflaslasillGYDIGVMSGAAIYIQKDLKIND  267
             A   H  +  FDPPKK KRNKYA A A LAS+ SILLGYDIGVMSGAAIYI++DLK++D
Sbjct  8    EAAEAHKTLQDFDPPKKRKRNKYAFACAMLASMTSILLGYDIGVMSGAAIYIKRDLKVSD  67

Query  268  TQVEILLGILNLYSLIGSCMAGRTSDWIGRRYTMVVASVVFFVGAILMGFSTNYTFLMVG  447
             Q+EILLGI+NLYSLIGSC+AGRTSDWIGRRYT+ +   +F VG+ LMGF  +Y+FLM G
Sbjct  68   EQIEILLGIINLYSLIGSCLAGRTSDWIGRRYTIGLGGAIFLVGSTLMGFYPHYSFLMCG  127

Query  448  RFVAGIGVGYALMIAPVYTAEVAPA  522
            RFVAGIG+GYALMIAPVYTAEV+PA
Sbjct  128  RFVAGIGIGYALMIAPVYTAEVSPA  152



>ref|XP_003631630.1| PREDICTED: polyol transporter 5 [Vitis vinifera]
 gb|ADP37154.1| putative polyol/monosaccharide transporter [Vitis vinifera]
Length=528

 Score =   198 bits (504),  Expect = 4e-57, Method: Compositional matrix adjust.
 Identities = 107/137 (78%), Positives = 121/137 (88%), Gaps = 0/137 (0%)
 Frame = +1

Query  112  IPAFDPPKKVKRNKYaiaaaflaslasillGYDIGVMSGAAIYIQKDLKINDTQVEILLG  291
            +  FD PKK  RNKYAIA   LAS+ SILLGYDIGVMSGAAIYI+KDLKI+D +VEIL+G
Sbjct  19   VTEFDAPKKNGRNKYAIACTILASMTSILLGYDIGVMSGAAIYIKKDLKISDVEVEILVG  78

Query  292  ILNLYSLIGSCMAGRTSDWIGRRYTMVVASVVFFVGAILMGFSTNYTFLMVGRFVAGIGV  471
            ILN+Y L GS  AGRTSDWIGRRYT+V+ASV+FF+GA+LMGF+TNY FLMVGRFVAGIGV
Sbjct  79   ILNVYCLFGSAAAGRTSDWIGRRYTIVLASVIFFLGALLMGFATNYVFLMVGRFVAGIGV  138

Query  472  GYALMIAPVYTAEVAPA  522
            GYALMIAPVY AEV+PA
Sbjct  139  GYALMIAPVYAAEVSPA  155



>gb|KJB32189.1| hypothetical protein B456_005G228500 [Gossypium raimondii]
Length=539

 Score =   199 bits (505),  Expect = 4e-57, Method: Compositional matrix adjust.
 Identities = 111/150 (74%), Positives = 127/150 (85%), Gaps = 2/150 (1%)
 Frame = +1

Query  76   DTRPVRNAGSGHIPAFDPP-KKVKRNKYaiaaaflaslasillGYDIGVMSGAAIYIQKD  252
             TRPV  A +     F+P  KK KRNK+A A A LASL SILLGYDIGVMSGA IYIQ+D
Sbjct  12   STRPVM-ADNRSFADFEPAVKKPKRNKFAFACAILASLTSILLGYDIGVMSGAIIYIQED  70

Query  253  LKINDTQVEILLGILNLYSLIGSCMAGRTSDWIGRRYTMVVASVVFFVGAILMGFSTNYT  432
            LKIND Q EIL+GILN+YSL+GSC AGRTSDW+GRRYT+V+A  +FF+GA+LMGF+T+Y 
Sbjct  71   LKINDVQKEILMGILNVYSLVGSCAAGRTSDWVGRRYTIVLAGAIFFLGALLMGFATSYA  130

Query  433  FLMVGRFVAGIGVGYALMIAPVYTAEVAPA  522
            FLMVGRFVAGIGVGYALMIAPVYTAEV+PA
Sbjct  131  FLMVGRFVAGIGVGYALMIAPVYTAEVSPA  160



>gb|KFK30307.1| hypothetical protein AALP_AA7G244900 [Arabis alpina]
Length=526

 Score =   198 bits (504),  Expect = 4e-57, Method: Compositional matrix adjust.
 Identities = 107/146 (73%), Positives = 119/146 (82%), Gaps = 0/146 (0%)
 Frame = +1

Query  85   PVRNAGSGHIPAFDPPKKVKRNKYaiaaaflaslasillGYDIGVMSGAAIYIQKDLKIN  264
            P     + H+P   PP K KRNKYA A A LAS+ SILLGYDIGVMSGA IYIQ+DLKI 
Sbjct  12   PPPAPATKHVPELGPPVKPKRNKYAFACAILASMTSILLGYDIGVMSGAMIYIQRDLKIT  71

Query  265  DTQVEILLGILNLYSLIGSCMAGRTSDWIGRRYTMVVASVVFFVGAILMGFSTNYTFLMV  444
            D QV IL GILN+YSLIGSC AG+TSDWIGRRYT+V+A  +FF GA+LMGF+ NY FLM 
Sbjct  72   DIQVGILAGILNIYSLIGSCAAGKTSDWIGRRYTIVLAGAIFFAGALLMGFAPNYAFLMF  131

Query  445  GRFVAGIGVGYALMIAPVYTAEVAPA  522
            GRFVAGIGVGYALMIAPVYTAEV+PA
Sbjct  132  GRFVAGIGVGYALMIAPVYTAEVSPA  157



>ref|XP_007131851.1| hypothetical protein PHAVU_011G046700g [Phaseolus vulgaris]
 gb|ESW03845.1| hypothetical protein PHAVU_011G046700g [Phaseolus vulgaris]
Length=518

 Score =   198 bits (503),  Expect = 5e-57, Method: Compositional matrix adjust.
 Identities = 103/134 (77%), Positives = 118/134 (88%), Gaps = 0/134 (0%)
 Frame = +1

Query  121  FDPPKKVKRNKYaiaaaflaslasillGYDIGVMSGAAIYIQKDLKINDTQVEILLGILN  300
            F+  KK KRNKYA   A LAS+ SILLGYDIGVMSGAAIYI++DLK++D Q+EIL+GI+N
Sbjct  16   FNSSKKPKRNKYAFGCAILASMTSILLGYDIGVMSGAAIYIKRDLKVSDVQIEILMGIIN  75

Query  301  LYSLIGSCMAGRTSDWIGRRYTMVVASVVFFVGAILMGFSTNYTFLMVGRFVAGIGVGYA  480
            LYSLIGSC+AGRTSDWIGRRYT+V A  +FF GA+LMGFS NY FLM GRFVAGIG+GYA
Sbjct  76   LYSLIGSCLAGRTSDWIGRRYTIVFAGTIFFAGALLMGFSPNYLFLMFGRFVAGIGIGYA  135

Query  481  LMIAPVYTAEVAPA  522
            LMIAPVYTAEV+PA
Sbjct  136  LMIAPVYTAEVSPA  149



>gb|EPS69995.1| sugar transport protein [Genlisea aurea]
Length=530

 Score =   198 bits (503),  Expect = 7e-57, Method: Compositional matrix adjust.
 Identities = 104/134 (78%), Positives = 122/134 (91%), Gaps = 0/134 (0%)
 Frame = +1

Query  121  FDPPKKVKRNKYaiaaaflaslasillGYDIGVMSGAAIYIQKDLKINDTQVEILLGILN  300
            FDPPKK KRNKYA+A AFLAS+ SILLGYDIGVMSGA IYI++D+++ D Q E+++GILN
Sbjct  19   FDPPKKPKRNKYALACAFLASMTSILLGYDIGVMSGAIIYIRRDIRMTDVQQEVIMGILN  78

Query  301  LYSLIGSCMAGRTSDWIGRRYTMVVASVVFFVGAILMGFSTNYTFLMVGRFVAGIGVGYA  480
            LYSLIGS +AGRTSDW+GRRYT+++A  +FF GA+LMGF+TNY FLMVGRFVAGIGVGYA
Sbjct  79   LYSLIGSALAGRTSDWLGRRYTIILAGAIFFFGALLMGFATNYAFLMVGRFVAGIGVGYA  138

Query  481  LMIAPVYTAEVAPA  522
            LMIAPVYTAEVAPA
Sbjct  139  LMIAPVYTAEVAPA  152



>gb|AAM44082.1| putative sorbitol transporter [Prunus cerasus]
Length=538

 Score =   197 bits (502),  Expect = 8e-57, Method: Compositional matrix adjust.
 Identities = 110/156 (71%), Positives = 125/156 (80%), Gaps = 5/156 (3%)
 Frame = +1

Query  70   MGDTRPVRNA-----GSGHIPAFDPPKKVKRNKYaiaaaflaslasillGYDIGVMSGAA  234
            M D R   NA        +I  FDPP K KRNKYA A A LAS+ SILLGYDIGVMSGA 
Sbjct  1    MADRRAEYNAVVSGQPQKNIADFDPPGKPKRNKYAFACAILASMTSILLGYDIGVMSGAV  60

Query  235  IYIQKDLKINDTQVEILLGILNLYSLIGSCMAGRTSDWIGRRYTMVVASVVFFVGAILMG  414
            IYI+KDLK++D ++E+L+GILNLYSLIGS  AGRTSDWIGRRYT+V+A  +FF GA+LMG
Sbjct  61   IYIKKDLKVSDVEIEVLVGILNLYSLIGSAAAGRTSDWIGRRYTIVLAGAIFFAGALLMG  120

Query  415  FSTNYTFLMVGRFVAGIGVGYALMIAPVYTAEVAPA  522
            F+ NY FLM GRFVAGIGVGYALMIAPVYTAEV+PA
Sbjct  121  FAPNYAFLMFGRFVAGIGVGYALMIAPVYTAEVSPA  156



>ref|XP_008236795.1| PREDICTED: polyol transporter 5-like [Prunus mume]
Length=538

 Score =   197 bits (501),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 112/156 (72%), Positives = 127/156 (81%), Gaps = 5/156 (3%)
 Frame = +1

Query  70   MGDTRPVRNAG-SGH----IPAFDPPKKVKRNKYaiaaaflaslasillGYDIGVMSGAA  234
            M D R   NA  SG     I  FDPP K KRNKYA A A LAS+ SILLGYDIGVMSGAA
Sbjct  1    MADRRAEDNAVVSGQPQKTIADFDPPGKPKRNKYAFACAILASMTSILLGYDIGVMSGAA  60

Query  235  IYIQKDLKINDTQVEILLGILNLYSLIGSCMAGRTSDWIGRRYTMVVASVVFFVGAILMG  414
            IYI+KDLK++D ++E+L+GILNLYSLIGS  AGRTSDWIGRRYT+V+A  +FF GA+LMG
Sbjct  61   IYIKKDLKVSDVEIEVLIGILNLYSLIGSAAAGRTSDWIGRRYTIVLAGGIFFAGALLMG  120

Query  415  FSTNYTFLMVGRFVAGIGVGYALMIAPVYTAEVAPA  522
            F+ NY FLM GRF+AGIGVGYALMIAPVYTAEV+PA
Sbjct  121  FAPNYAFLMFGRFIAGIGVGYALMIAPVYTAEVSPA  156



>ref|XP_008393068.1| PREDICTED: putative polyol transporter 1 [Malus domestica]
Length=538

 Score =   197 bits (501),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 108/149 (72%), Positives = 125/149 (84%), Gaps = 0/149 (0%)
 Frame = +1

Query  76   DTRPVRNAGSGHIPAFDPPKKVKRNKYaiaaaflaslasillGYDIGVMSGAAIYIQKDL  255
            D    +  GS  +  FD PKK KRNKYA A A LAS+ SILLGYDIGVMSGAAIYI++DL
Sbjct  8    DNAVSQQPGSRGLSEFDSPKKPKRNKYAFACAILASMTSILLGYDIGVMSGAAIYIKEDL  67

Query  256  KINDTQVEILLGILNLYSLIGSCMAGRTSDWIGRRYTMVVASVVFFVGAILMGFSTNYTF  435
            KI+D ++EILLGI+N+YSLIGS  AGRTSD IGRRYT+V+A  +FF GA+LMGF+TNY F
Sbjct  68   KISDVEIEILLGIINVYSLIGSAAAGRTSDRIGRRYTIVLAGAIFFTGALLMGFATNYVF  127

Query  436  LMVGRFVAGIGVGYALMIAPVYTAEVAPA  522
            LMVGRFVAGIG+GYALMIAPVYTAEV+PA
Sbjct  128  LMVGRFVAGIGIGYALMIAPVYTAEVSPA  156



>emb|CAR82416.1| polyol transporter [Plantago major]
Length=181

 Score =   187 bits (475),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 99/132 (75%), Positives = 115/132 (87%), Gaps = 0/132 (0%)
 Frame = +1

Query  127  PPKKVKRNKYaiaaaflaslasillGYDIGVMSGAAIYIQKDLKINDTQVEILLGILNLY  306
            P K V RNKYA+A + LAS+ S+LLGYD GVMSGA +YI+ DLKI+D QVE+L+G +N+Y
Sbjct  34   PKKPVTRNKYALAISILASMTSVLLGYDTGVMSGATLYIKDDLKISDVQVELLVGTINIY  93

Query  307  SLIGSCMAGRTSDWIGRRYTMVVASVVFFVGAILMGFSTNYTFLMVGRFVAGIGVGYALM  486
            SL+GS +AGRTSDW+GRRYT+V ASVVFFVGAILMG +TNY FLM GRFVAGIGVGYALM
Sbjct  94   SLVGSAVAGRTSDWVGRRYTIVFASVVFFVGAILMGIATNYVFLMAGRFVAGIGVGYALM  153

Query  487  IAPVYTAEVAPA  522
            IAPVY AEVAPA
Sbjct  154  IAPVYAAEVAPA  165



>gb|AAY86779.1| putative sugar transporter protein [Noccaea caerulescens]
Length=253

 Score =   189 bits (479),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 103/139 (74%), Positives = 116/139 (83%), Gaps = 1/139 (1%)
 Frame = +1

Query  109  HIP-AFDPPKKVKRNKYaiaaaflaslasillGYDIGVMSGAAIYIQKDLKINDTQVEIL  285
            H+P +  PP K KRNKYA A A LAS+ SILLGYDIGVMSGA IYI++DLK  D Q+ IL
Sbjct  20   HLPESGPPPAKPKRNKYAFACAILASMTSILLGYDIGVMSGAMIYIKRDLKCTDLQIGIL  79

Query  286  LGILNLYSLIGSCMAGRTSDWIGRRYTMVVASVVFFVGAILMGFSTNYTFLMVGRFVAGI  465
             G LN+YSL+GSC AGRTSDWIGRRYT+V+A  +FF GA+LMGFS NY FLM GRFVAG+
Sbjct  80   AGSLNIYSLVGSCAAGRTSDWIGRRYTIVLAGAIFFAGALLMGFSPNYAFLMFGRFVAGV  139

Query  466  GVGYALMIAPVYTAEVAPA  522
            GVGYALMIAPVYTAEVAPA
Sbjct  140  GVGYALMIAPVYTAEVAPA  158



>ref|XP_004300990.1| PREDICTED: polyol transporter 5-like [Fragaria vesca subsp. vesca]
Length=530

 Score =   196 bits (498),  Expect = 4e-56, Method: Compositional matrix adjust.
 Identities = 109/156 (70%), Positives = 124/156 (79%), Gaps = 5/156 (3%)
 Frame = +1

Query  70   MGDTRPVRN-----AGSGHIPAFDPPKKVKRNKYaiaaaflaslasillGYDIGVMSGAA  234
            M D R   N     +    I  FDP  K KRN+YA A A LAS+ SILLGYDIGVMSGAA
Sbjct  1    MADRRAEENGQPTQSTKKAIEDFDPAPKPKRNRYAFACAMLASMTSILLGYDIGVMSGAA  60

Query  235  IYIQKDLKINDTQVEILLGILNLYSLIGSCMAGRTSDWIGRRYTMVVASVVFFVGAILMG  414
            I+I+ DLKI+D QVE+L+GILNLYSLIGS  AGRTSDWIGRRYT+V+A  +FF GA+LMG
Sbjct  61   IFIKDDLKISDVQVEVLVGILNLYSLIGSAAAGRTSDWIGRRYTIVLAGAIFFAGALLMG  120

Query  415  FSTNYTFLMVGRFVAGIGVGYALMIAPVYTAEVAPA  522
            F+TNY+FLM GRFVAGIGVGYALMIAPVYT EV+PA
Sbjct  121  FATNYSFLMFGRFVAGIGVGYALMIAPVYTVEVSPA  156



>ref|XP_006365518.1| PREDICTED: polyol transporter 5-like [Solanum tuberosum]
Length=566

 Score =   196 bits (497),  Expect = 7e-56, Method: Compositional matrix adjust.
 Identities = 108/139 (78%), Positives = 119/139 (86%), Gaps = 0/139 (0%)
 Frame = +1

Query  106  GHIPAFDPPKKVKRNKYaiaaaflaslasillGYDIGVMSGAAIYIQKDLKINDTQVEIL  285
              I  FDPPKK K NKYAIA  FLASL+SILLGYDIGVMSGA IYI+KDL I D QVEIL
Sbjct  36   ARIQDFDPPKKPKTNKYAIACTFLASLSSILLGYDIGVMSGAIIYIKKDLHITDVQVEIL  95

Query  286  LGILNLYSLIGSCMAGRTSDWIGRRYTMVVASVVFFVGAILMGFSTNYTFLMVGRFVAGI  465
            +GILN+YSL GS  AGRTSDWIGRRYTMVVA+ +FF GA+LMGF+T Y FLM GRFVAG+
Sbjct  96   VGILNVYSLFGSAAAGRTSDWIGRRYTMVVAAGIFFAGALLMGFATTYAFLMFGRFVAGV  155

Query  466  GVGYALMIAPVYTAEVAPA  522
            GVGYALM+APVYTAEV+PA
Sbjct  156  GVGYALMVAPVYTAEVSPA  174



>ref|NP_001287655.1| polyol transporter 5-like [Solanum lycopersicum]
 dbj|BAO96229.1| polyol/monosaccharide transporter 4 [Solanum lycopersicum]
Length=541

 Score =   195 bits (496),  Expect = 8e-56, Method: Compositional matrix adjust.
 Identities = 107/139 (77%), Positives = 119/139 (86%), Gaps = 0/139 (0%)
 Frame = +1

Query  106  GHIPAFDPPKKVKRNKYaiaaaflaslasillGYDIGVMSGAAIYIQKDLKINDTQVEIL  285
              I  FDPPKK K NKYAIA  FLASL+SILLGYDIGVMSGA +YI+KDL I D QVEIL
Sbjct  10   ARIQDFDPPKKPKTNKYAIACTFLASLSSILLGYDIGVMSGAILYIKKDLHITDVQVEIL  69

Query  286  LGILNLYSLIGSCMAGRTSDWIGRRYTMVVASVVFFVGAILMGFSTNYTFLMVGRFVAGI  465
            +GILN+YSL GS  AGRTSDWIGRRYTMVVA+ +FF GA+LMGF+T Y FLM GRFVAG+
Sbjct  70   VGILNVYSLFGSAAAGRTSDWIGRRYTMVVAAGIFFAGALLMGFATTYAFLMFGRFVAGV  129

Query  466  GVGYALMIAPVYTAEVAPA  522
            GVGYALM+APVYTAEV+PA
Sbjct  130  GVGYALMVAPVYTAEVSPA  148



>ref|XP_011048787.1| PREDICTED: polyol transporter 5-like [Populus euphratica]
Length=532

 Score =   194 bits (494),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 104/150 (69%), Positives = 123/150 (82%), Gaps = 0/150 (0%)
 Frame = +1

Query  73   GDTRPVRNAGSGHIPAFDPPKKVKRNKYaiaaaflaslasillGYDIGVMSGAAIYIQKD  252
            GD  P + A    +  FDP KK KRNK+A A A +AS+ S+LLGYDIGVMSGA IYIQ D
Sbjct  9    GDANPSQPALDRKLADFDPAKKPKRNKFAFACASIASMTSVLLGYDIGVMSGANIYIQDD  68

Query  253  LKINDTQVEILLGILNLYSLIGSCMAGRTSDWIGRRYTMVVASVVFFVGAILMGFSTNYT  432
            LKIND QV +L+G LN+YSL+GS  AGRTSD IGRRYT+V+A  +FF+G++LMGF+TNY 
Sbjct  69   LKINDLQVALLVGTLNIYSLVGSAAAGRTSDRIGRRYTIVMAGAIFFLGSVLMGFATNYA  128

Query  433  FLMVGRFVAGIGVGYALMIAPVYTAEVAPA  522
            FLMVGRFVAG+GVGYALMIAPVYTAEV+PA
Sbjct  129  FLMVGRFVAGVGVGYALMIAPVYTAEVSPA  158



>ref|XP_010096202.1| Polyol transporter 5 [Morus notabilis]
 gb|EXB63597.1| Polyol transporter 5 [Morus notabilis]
Length=541

 Score =   194 bits (494),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 108/155 (70%), Positives = 126/155 (81%), Gaps = 4/155 (3%)
 Frame = +1

Query  70   MGDTRPVRNAGSGH----IPAFDPPKKVKRNKYaiaaaflaslasillGYDIGVMSGAAI  237
            M D +   N  SG     I  FDPPK+ ++N +AIA A LAS+ SILLGYDIGVMSGA I
Sbjct  1    MADRKAEVNGISGQTQKTIADFDPPKRPRKNIFAIACAVLASMTSILLGYDIGVMSGAVI  60

Query  238  YIQKDLKINDTQVEILLGILNLYSLIGSCMAGRTSDWIGRRYTMVVASVVFFVGAILMGF  417
            +I++DLKI+D +VEIL GILNLYSL+GS  AGRTSDWIGRRYT+V+A  +FF GA+LMGF
Sbjct  61   FIKEDLKISDVKVEILTGILNLYSLLGSAAAGRTSDWIGRRYTIVLAGAIFFAGALLMGF  120

Query  418  STNYTFLMVGRFVAGIGVGYALMIAPVYTAEVAPA  522
            +TNY FLM GRFVAGIGVGYALMIAPVYTAEV+PA
Sbjct  121  ATNYAFLMFGRFVAGIGVGYALMIAPVYTAEVSPA  155



>emb|CDY61985.1| BnaC03g73840D [Brassica napus]
Length=530

 Score =   194 bits (493),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 103/138 (75%), Positives = 117/138 (85%), Gaps = 0/138 (0%)
 Frame = +1

Query  109  HIPAFDPPKKVKRNKYaiaaaflaslasillGYDIGVMSGAAIYIQKDLKINDTQVEILL  288
            H+P   P  K KRNKYA A A LAS+ SILLGYDIGVMSGA IYI++DLKI+D Q+ IL 
Sbjct  26   HVPELGPQAKPKRNKYAFACAILASMTSILLGYDIGVMSGAMIYIKRDLKISDLQIGILA  85

Query  289  GILNLYSLIGSCMAGRTSDWIGRRYTMVVASVVFFVGAILMGFSTNYTFLMVGRFVAGIG  468
            GILN+YSL+GSC AGRTSDWIGRRYT+V+A  +FF GA+LMGF+ NY FLM GRFVAGIG
Sbjct  86   GILNIYSLLGSCAAGRTSDWIGRRYTIVLAGAIFFAGALLMGFAPNYAFLMFGRFVAGIG  145

Query  469  VGYALMIAPVYTAEVAPA  522
            VGYALMIAPVYTAEV+PA
Sbjct  146  VGYALMIAPVYTAEVSPA  163



>ref|XP_009135601.1| PREDICTED: polyol transporter 5 [Brassica rapa]
Length=532

 Score =   194 bits (492),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 103/138 (75%), Positives = 117/138 (85%), Gaps = 0/138 (0%)
 Frame = +1

Query  109  HIPAFDPPKKVKRNKYaiaaaflaslasillGYDIGVMSGAAIYIQKDLKINDTQVEILL  288
            H+P   P  K KRNKYA A A LAS+ SILLGYDIGVMSGA IYI++DLKI+D Q+ IL 
Sbjct  26   HVPELGPQAKPKRNKYAFACAILASMTSILLGYDIGVMSGAMIYIKRDLKISDLQIGILA  85

Query  289  GILNLYSLIGSCMAGRTSDWIGRRYTMVVASVVFFVGAILMGFSTNYTFLMVGRFVAGIG  468
            GILN+YSL+GSC AGRTSDWIGRRYT+V+A  +FF GA+LMGF+ NY FLM GRFVAGIG
Sbjct  86   GILNIYSLLGSCAAGRTSDWIGRRYTIVLAGAIFFAGALLMGFAPNYAFLMFGRFVAGIG  145

Query  469  VGYALMIAPVYTAEVAPA  522
            VGYALMIAPVYTAEV+PA
Sbjct  146  VGYALMIAPVYTAEVSPA  163



>gb|KGN44323.1| Sugar transporter [Cucumis sativus]
Length=516

 Score =   193 bits (491),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 101/131 (77%), Positives = 118/131 (90%), Gaps = 0/131 (0%)
 Frame = +1

Query  130  PKKVKRNKYaiaaaflaslasillGYDIGVMSGAAIYIQKDLKINDTQVEILLGILNLYS  309
            PKK KRNKYA   A LAS+ASILLGYD+GVMSGAAIYI+KD +IND Q E+++G++NLY+
Sbjct  14   PKKPKRNKYAFMCAILASMASILLGYDVGVMSGAAIYIKKDFQINDVQEEVMIGVINLYA  73

Query  310  LIGSCMAGRTSDWIGRRYTMVVASVVFFVGAILMGFSTNYTFLMVGRFVAGIGVGYALMI  489
            LIG+  AGRTSDWIGRRYTMV+A V+FF+GAILMGF+TNY FLM GRFVAGIGVGYALMI
Sbjct  74   LIGAAAAGRTSDWIGRRYTMVLAGVIFFLGAILMGFATNYEFLMFGRFVAGIGVGYALMI  133

Query  490  APVYTAEVAPA  522
            +PVYTAEV+PA
Sbjct  134  SPVYTAEVSPA  144



>ref|XP_008795608.1| PREDICTED: putative polyol transporter 1 [Phoenix dactylifera]
Length=522

 Score =   193 bits (491),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 106/156 (68%), Positives = 123/156 (79%), Gaps = 5/156 (3%)
 Frame = +1

Query  70   MGDTRPVRNAGSGHIPAFDPPKKV-----KRNKYaiaaaflaslasillGYDIGVMSGAA  234
            M D +P     +  +P    P+ V     ++NKYA   A LAS+ SILLGYDIGVMSGAA
Sbjct  1    MTDQKPEATKVASQVPHDSLPEAVAPRPRRKNKYAFGCAMLASMTSILLGYDIGVMSGAA  60

Query  235  IYIQKDLKINDTQVEILLGILNLYSLIGSCMAGRTSDWIGRRYTMVVASVVFFVGAILMG  414
            I+IQ DL + DTQ+EILLGILNLYSL+GS  AGRTSDWIGRRYT+V A+V+FFVGAI+MG
Sbjct  61   IFIQDDLHVTDTQIEILLGILNLYSLVGSLAAGRTSDWIGRRYTIVFAAVIFFVGAIMMG  120

Query  415  FSTNYTFLMVGRFVAGIGVGYALMIAPVYTAEVAPA  522
             + NY FLMVGRFVAG+GVGYALMIAPVYTAEVAPA
Sbjct  121  LAPNYAFLMVGRFVAGVGVGYALMIAPVYTAEVAPA  156



>gb|KJB12315.1| hypothetical protein B456_002G011400 [Gossypium raimondii]
Length=536

 Score =   194 bits (492),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 107/142 (75%), Positives = 124/142 (87%), Gaps = 0/142 (0%)
 Frame = +1

Query  97   AGSGHIPAFDPPKKVKRNKYaiaaaflaslasillGYDIGVMSGAAIYIQKDLKINDTQV  276
            AG+  +  F+  KK KRNK+A A + LASLASILLGYDIGVMSGA IYI+ DLKI+D QV
Sbjct  17   AGNKTVADFEVSKKPKRNKFAFACSILASLASILLGYDIGVMSGAIIYIKDDLKISDVQV  76

Query  277  EILLGILNLYSLIGSCMAGRTSDWIGRRYTMVVASVVFFVGAILMGFSTNYTFLMVGRFV  456
            EIL+GILNLY LIG+  AGRTSDWIGRRYT+VVA+ +FFVGA+LMGF+TNY FLMVGRFV
Sbjct  77   EILVGILNLYCLIGAYAAGRTSDWIGRRYTIVVAAAIFFVGALLMGFATNYAFLMVGRFV  136

Query  457  AGIGVGYALMIAPVYTAEVAPA  522
            AGIGVG+AL+IAPVYTAEV+PA
Sbjct  137  AGIGVGFALLIAPVYTAEVSPA  158



>ref|XP_010065409.1| PREDICTED: polyol transporter 5-like [Eucalyptus grandis]
 gb|KCW62859.1| hypothetical protein EUGRSUZ_G00453 [Eucalyptus grandis]
Length=535

 Score =   193 bits (491),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 104/138 (75%), Positives = 118/138 (86%), Gaps = 0/138 (0%)
 Frame = +1

Query  109  HIPAFDPPKKVKRNKYaiaaaflaslasillGYDIGVMSGAAIYIQKDLKINDTQVEILL  288
             I  FDPP + +RNKYA+A A LAS  SILLGYDIGVMSGA IYI+KDLKI+D +VEIL 
Sbjct  23   SIEDFDPPARPRRNKYAMACATLASTTSILLGYDIGVMSGAIIYIKKDLKISDVEVEILT  82

Query  289  GILNLYSLIGSCMAGRTSDWIGRRYTMVVASVVFFVGAILMGFSTNYTFLMVGRFVAGIG  468
            GIL +YSL+GS MAGRTSDWIGRRYT+V+A  +FF GA+LMGF+ NY FLM GRFVAGIG
Sbjct  83   GILAVYSLLGSAMAGRTSDWIGRRYTIVLAGAIFFAGALLMGFAPNYAFLMFGRFVAGIG  142

Query  469  VGYALMIAPVYTAEVAPA  522
            VGYALMIAPVYTAEV+PA
Sbjct  143  VGYALMIAPVYTAEVSPA  160



>ref|NP_001280902.1| putative polyol transporter 1 [Malus domestica]
 dbj|BAD42343.1| sorbitol transporter [Malus domestica]
Length=526

 Score =   193 bits (490),  Expect = 4e-55, Method: Compositional matrix adjust.
 Identities = 104/156 (67%), Positives = 125/156 (80%), Gaps = 5/156 (3%)
 Frame = +1

Query  70   MGDTRPVRNAGSG-----HIPAFDPPKKVKRNKYaiaaaflaslasillGYDIGVMSGAA  234
            M D R   NA +G      I  FDPP K K +K+AIA A LA   S+LLGYDIGVMSGA+
Sbjct  1    MADRRAEENAVTGGPQNTSIEDFDPPMKPKTSKFAIACALLACTTSVLLGYDIGVMSGAS  60

Query  235  IYIQKDLKINDTQVEILLGILNLYSLIGSCMAGRTSDWIGRRYTMVVASVVFFVGAILMG  414
            +YIQK+LKI+D QVE+L G LN+YSL+GS  AGRTSDWIGR+YT+V+A V+F VGA+LMG
Sbjct  61   LYIQKNLKISDVQVEVLAGTLNIYSLLGSAFAGRTSDWIGRKYTIVLAGVIFLVGALLMG  120

Query  415  FSTNYTFLMVGRFVAGIGVGYALMIAPVYTAEVAPA  522
            F+TNY FLMVGRFVAG+GVGY +MIAPVYTAE++PA
Sbjct  121  FATNYAFLMVGRFVAGVGVGYGMMIAPVYTAEISPA  156



>ref|XP_006487182.1| PREDICTED: polyol transporter 5-like [Citrus sinensis]
Length=535

 Score =   193 bits (491),  Expect = 4e-55, Method: Compositional matrix adjust.
 Identities = 102/134 (76%), Positives = 118/134 (88%), Gaps = 0/134 (0%)
 Frame = +1

Query  121  FDPPKKVKRNKYaiaaaflaslasillGYDIGVMSGAAIYIQKDLKINDTQVEILLGILN  300
            FDP KK KRN YA  AA LAS+ SILLGYDIGVMSGAA+YI+ D K++DTQ+EIL+GILN
Sbjct  24   FDPQKKPKRNLYASGAAILASMTSILLGYDIGVMSGAALYIKDDFKVSDTQIEILIGILN  83

Query  301  LYSLIGSCMAGRTSDWIGRRYTMVVASVVFFVGAILMGFSTNYTFLMVGRFVAGIGVGYA  480
            +YSLIGS  AGRTSDWIGRRYT+V+A  +FF GA+LMGF+TNY FLM GRFVAG+GVGYA
Sbjct  84   IYSLIGSLAAGRTSDWIGRRYTIVLAGAIFFAGALLMGFATNYAFLMGGRFVAGVGVGYA  143

Query  481  LMIAPVYTAEVAPA  522
            LMIAPVYTAE++PA
Sbjct  144  LMIAPVYTAELSPA  157



>gb|AAO39267.1|AF482011_1 sorbitol transporter [Prunus cerasus]
Length=509

 Score =   192 bits (489),  Expect = 4e-55, Method: Compositional matrix adjust.
 Identities = 112/151 (74%), Positives = 122/151 (81%), Gaps = 3/151 (2%)
 Frame = +1

Query  70   MGDTRPVRNAGSGHIPAFDPPKKVKRNKYaiaaaflaslasillGYDIGVMSGAAIYIQK  249
            M D R   NA SG  P     KK KRN YAI  A LAS+ SILLGYDIGVMSGA+IYIQK
Sbjct  1    MTDRRAQDNAVSGQ-PLLK--KKPKRNLYAIGCAILASMTSILLGYDIGVMSGASIYIQK  57

Query  250  DLKINDTQVEILLGILNLYSLIGSCMAGRTSDWIGRRYTMVVASVVFFVGAILMGFSTNY  429
            DLKI+D +VEIL+GILNLYSLIGS  AGRTSDWIGRRYT+V A  +FF GA+LMG +TNY
Sbjct  58   DLKISDVEVEILIGILNLYSLIGSAAAGRTSDWIGRRYTIVFAGAIFFTGALLMGLATNY  117

Query  430  TFLMVGRFVAGIGVGYALMIAPVYTAEVAPA  522
             FLMVGRFVAGIGVGYALMIAPVY AEV+PA
Sbjct  118  AFLMVGRFVAGIGVGYALMIAPVYNAEVSPA  148



>ref|XP_006423215.1| hypothetical protein CICLE_v10028170mg [Citrus clementina]
 gb|ESR36455.1| hypothetical protein CICLE_v10028170mg [Citrus clementina]
Length=535

 Score =   193 bits (490),  Expect = 4e-55, Method: Compositional matrix adjust.
 Identities = 102/134 (76%), Positives = 118/134 (88%), Gaps = 0/134 (0%)
 Frame = +1

Query  121  FDPPKKVKRNKYaiaaaflaslasillGYDIGVMSGAAIYIQKDLKINDTQVEILLGILN  300
            FDP KK KRN YA  AA LAS+ SILLGYDIGVMSGAA+YI+ D K++DTQ+EIL+GILN
Sbjct  24   FDPQKKPKRNLYASGAAILASMTSILLGYDIGVMSGAALYIKDDFKVSDTQIEILIGILN  83

Query  301  LYSLIGSCMAGRTSDWIGRRYTMVVASVVFFVGAILMGFSTNYTFLMVGRFVAGIGVGYA  480
            +YSLIGS  AGRTSDWIGRRYT+V+A  +FF GA+LMGF+TNY FLM GRFVAG+GVGYA
Sbjct  84   IYSLIGSLAAGRTSDWIGRRYTIVLAGAIFFAGALLMGFATNYAFLMGGRFVAGVGVGYA  143

Query  481  LMIAPVYTAEVAPA  522
            LMIAPVYTAE++PA
Sbjct  144  LMIAPVYTAELSPA  157



>ref|XP_002313809.1| putative sorbitol transporter family protein [Populus trichocarpa]
 gb|EEE87764.1| putative sorbitol transporter family protein [Populus trichocarpa]
Length=533

 Score =   193 bits (490),  Expect = 4e-55, Method: Compositional matrix adjust.
 Identities = 106/150 (71%), Positives = 123/150 (82%), Gaps = 0/150 (0%)
 Frame = +1

Query  73   GDTRPVRNAGSGHIPAFDPPKKVKRNKYaiaaaflaslasillGYDIGVMSGAAIYIQKD  252
            GD  P + A    +  FDP KK KRNK+A A A LAS+ S+LLGYDIGVMSGA IYIQ D
Sbjct  9    GDANPSQPALDRTLADFDPVKKPKRNKFAFACAILASMTSVLLGYDIGVMSGANIYIQDD  68

Query  253  LKINDTQVEILLGILNLYSLIGSCMAGRTSDWIGRRYTMVVASVVFFVGAILMGFSTNYT  432
            LKI+D QV +L+G LNLYSL+GS  AGRTSD IGRRYT+V+A  +FF+G+ILMGF+TNY 
Sbjct  69   LKISDLQVALLVGTLNLYSLVGSAAAGRTSDRIGRRYTIVMAGAIFFLGSILMGFATNYA  128

Query  433  FLMVGRFVAGIGVGYALMIAPVYTAEVAPA  522
            FLMVGRFVAG+GVGYALMIAPVYTAEV+PA
Sbjct  129  FLMVGRFVAGVGVGYALMIAPVYTAEVSPA  158



>ref|XP_009112300.1| PREDICTED: polyol transporter 5 [Brassica rapa]
 emb|CDY18552.1| BnaA01g26430D [Brassica napus]
Length=529

 Score =   193 bits (490),  Expect = 5e-55, Method: Compositional matrix adjust.
 Identities = 104/149 (70%), Positives = 116/149 (78%), Gaps = 0/149 (0%)
 Frame = +1

Query  76   DTRPVRNAGSGHIPAFDPPKKVKRNKYaiaaaflaslasillGYDIGVMSGAAIYIQKDL  255
             T P     + H+P   PP K KRNKYA A A LAS+ SILLGYDIGVMSGA IYI++D 
Sbjct  9    QTVPTTAPATKHVPELGPPVKPKRNKYAFACAILASMTSILLGYDIGVMSGALIYIKRDF  68

Query  256  KINDTQVEILLGILNLYSLIGSCMAGRTSDWIGRRYTMVVASVVFFVGAILMGFSTNYTF  435
            KI D QV IL GILN++SLIGSC AG+TSDWIGRR T+V A  +FF GAILMG + NY F
Sbjct  69   KITDLQVSILAGILNIFSLIGSCAAGKTSDWIGRRNTIVFAGAIFFAGAILMGLAPNYAF  128

Query  436  LMVGRFVAGIGVGYALMIAPVYTAEVAPA  522
            LM GRFVAG+GVGYALMIAPVYTAEVAPA
Sbjct  129  LMFGRFVAGVGVGYALMIAPVYTAEVAPA  157



>emb|CDX95491.1| BnaC01g33830D [Brassica napus]
Length=531

 Score =   192 bits (489),  Expect = 6e-55, Method: Compositional matrix adjust.
 Identities = 104/149 (70%), Positives = 116/149 (78%), Gaps = 0/149 (0%)
 Frame = +1

Query  76   DTRPVRNAGSGHIPAFDPPKKVKRNKYaiaaaflaslasillGYDIGVMSGAAIYIQKDL  255
             T P     + H+P   PP K KRNKYA A A LAS+ SILLGYDIGVMSGA IYI++D 
Sbjct  9    QTVPTTAPATKHVPELGPPLKPKRNKYAFACAILASMTSILLGYDIGVMSGALIYIKRDF  68

Query  256  KINDTQVEILLGILNLYSLIGSCMAGRTSDWIGRRYTMVVASVVFFVGAILMGFSTNYTF  435
            KI D QV IL GILN++SLIGSC AG+TSDWIGRR T+V A  +FF GAILMG + NY F
Sbjct  69   KITDLQVSILAGILNIFSLIGSCAAGKTSDWIGRRNTIVFAGAIFFAGAILMGLAPNYDF  128

Query  436  LMVGRFVAGIGVGYALMIAPVYTAEVAPA  522
            LM GRFVAG+GVGYALMIAPVYTAEVAPA
Sbjct  129  LMFGRFVAGVGVGYALMIAPVYTAEVAPA  157



>ref|XP_010527590.1| PREDICTED: polyol transporter 5-like [Tarenaya hassleriana]
Length=519

 Score =   192 bits (488),  Expect = 6e-55, Method: Compositional matrix adjust.
 Identities = 102/137 (74%), Positives = 118/137 (86%), Gaps = 0/137 (0%)
 Frame = +1

Query  112  IPAFDPPKKVKRNKYaiaaaflaslasillGYDIGVMSGAAIYIQKDLKINDTQVEILLG  291
            +P    P K KRNK+A A A LAS+ SILLGYDIGVMSGA IYI++DLKI D ++++L G
Sbjct  19   VPEMSMPAKPKRNKFAFACAILASMTSILLGYDIGVMSGAIIYIKRDLKIGDGKIQVLTG  78

Query  292  ILNLYSLIGSCMAGRTSDWIGRRYTMVVASVVFFVGAILMGFSTNYTFLMVGRFVAGIGV  471
            ILN++SLIGSC AGRTSDWIGRRYT+V+A  +FFVGAILMGF+TNY FLM GRFVAGIGV
Sbjct  79   ILNIFSLIGSCAAGRTSDWIGRRYTIVLAGAIFFVGAILMGFATNYAFLMFGRFVAGIGV  138

Query  472  GYALMIAPVYTAEVAPA  522
            GYALMIAPVYTAEV+PA
Sbjct  139  GYALMIAPVYTAEVSPA  155



>ref|XP_007135989.1| hypothetical protein PHAVU_009G008900g [Phaseolus vulgaris]
 gb|ESW07983.1| hypothetical protein PHAVU_009G008900g [Phaseolus vulgaris]
Length=514

 Score =   192 bits (487),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 100/143 (70%), Positives = 120/143 (84%), Gaps = 0/143 (0%)
 Frame = +1

Query  91   RNAGSGHIPAFDPPKKVKRNKYaiaaaflaslasillGYDIGVMSGAAIYIQKDLKINDT  270
            + A    +  FDP K  KRNK+A A A LAS+ SILLGYD+GVMSGA IYI++DLK+ D 
Sbjct  5    KAAAQKSLEDFDPKKAPKRNKFAFACAILASMTSILLGYDVGVMSGAVIYIKRDLKLTDV  64

Query  271  QVEILLGILNLYSLIGSCMAGRTSDWIGRRYTMVVASVVFFVGAILMGFSTNYTFLMVGR  450
            Q+EI++GI+NLYSLIGSC+AGRTSDWIGRRYT+V+A  +FF+GAILMGFS NY FLM  R
Sbjct  65   QIEIVVGIINLYSLIGSCLAGRTSDWIGRRYTIVLAGGIFFMGAILMGFSPNYPFLMFAR  124

Query  451  FVAGIGVGYALMIAPVYTAEVAP  519
            FVAG+G+GYALMIAPVYTAEV+P
Sbjct  125  FVAGVGIGYALMIAPVYTAEVSP  147



>ref|XP_007199793.1| hypothetical protein PRUPE_ppa004456mg [Prunus persica]
 gb|EMJ00992.1| hypothetical protein PRUPE_ppa004456mg [Prunus persica]
Length=509

 Score =   191 bits (486),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 111/151 (74%), Positives = 122/151 (81%), Gaps = 3/151 (2%)
 Frame = +1

Query  70   MGDTRPVRNAGSGHIPAFDPPKKVKRNKYaiaaaflaslasillGYDIGVMSGAAIYIQK  249
            M D R   NA SG  P     KK KRN YAI  A LAS+ SILLGYDIGVMSGA+IYIQ+
Sbjct  1    MTDHRAEANAVSGQ-PLLK--KKPKRNLYAIGCAILASMTSILLGYDIGVMSGASIYIQE  57

Query  250  DLKINDTQVEILLGILNLYSLIGSCMAGRTSDWIGRRYTMVVASVVFFVGAILMGFSTNY  429
            DLKI D +VEIL+GILNLYSLIGS  AGRTSDWIGRRYT+V A  +FF GA+LMGF+TN+
Sbjct  58   DLKITDVEVEILIGILNLYSLIGSAAAGRTSDWIGRRYTIVFAGAIFFTGALLMGFATNF  117

Query  430  TFLMVGRFVAGIGVGYALMIAPVYTAEVAPA  522
             FLMVGRFVAGIGVGYALMIAPVY AEV+PA
Sbjct  118  AFLMVGRFVAGIGVGYALMIAPVYNAEVSPA  148



>ref|XP_008387376.1| PREDICTED: putative polyol transporter 1 [Malus domestica]
Length=520

 Score =   192 bits (487),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 102/153 (67%), Positives = 123/153 (80%), Gaps = 2/153 (1%)
 Frame = +1

Query  70   MGDTRPVRNAGSGH--IPAFDPPKKVKRNKYaiaaaflaslasillGYDIGVMSGAAIYI  243
            M D +P     SG   I  FDPPK  K  K+AIA A LAS+ SILLGYDIGVMSGA+++I
Sbjct  3    MADRKPQNTEASGQKTIADFDPPKAXKTKKFAIACATLASMTSILLGYDIGVMSGASLFI  62

Query  244  QKDLKINDTQVEILLGILNLYSLIGSCMAGRTSDWIGRRYTMVVASVVFFVGAILMGFST  423
            +++LKI D QVE+L G LNLYSLIGS +AGRTSDWIGRRYT+V++  +FF GA+LMGF+ 
Sbjct  63   KENLKITDVQVEVLNGTLNLYSLIGSALAGRTSDWIGRRYTIVLSGAIFFAGALLMGFAP  122

Query  424  NYTFLMVGRFVAGIGVGYALMIAPVYTAEVAPA  522
            NY FLM GRF+AG+GVGYALMIAPVYTAE++PA
Sbjct  123  NYAFLMFGRFIAGVGVGYALMIAPVYTAEISPA  155



>ref|XP_009375822.1| PREDICTED: putative polyol transporter 1 [Pyrus x bretschneideri]
Length=520

 Score =   192 bits (487),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 101/153 (66%), Positives = 123/153 (80%), Gaps = 2/153 (1%)
 Frame = +1

Query  70   MGDTRPVRNAGSGH--IPAFDPPKKVKRNKYaiaaaflaslasillGYDIGVMSGAAIYI  243
            M D +P     SG   I  FDPPK  K  K+A+A A LAS+ SILLGYDIGVMSGA+++I
Sbjct  3    MADRKPEDTEASGQKTIADFDPPKAAKTKKFAVACAILASMTSILLGYDIGVMSGASLFI  62

Query  244  QKDLKINDTQVEILLGILNLYSLIGSCMAGRTSDWIGRRYTMVVASVVFFVGAILMGFST  423
            +++LKI D QVE+L G LNLYSLIGS +AGRTSDWIGRRYT+V++  +FF GA+LMGF+ 
Sbjct  63   KENLKITDVQVEVLNGTLNLYSLIGSALAGRTSDWIGRRYTIVLSGAIFFAGALLMGFAP  122

Query  424  NYTFLMVGRFVAGIGVGYALMIAPVYTAEVAPA  522
            NY FLM GRF+AG+GVGYALMIAPVYTAE++PA
Sbjct  123  NYAFLMFGRFIAGVGVGYALMIAPVYTAEISPA  155



>gb|AIU41385.1| sorbitol transporter 1 [Prunus salicina]
Length=509

 Score =   191 bits (485),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 111/151 (74%), Positives = 123/151 (81%), Gaps = 3/151 (2%)
 Frame = +1

Query  70   MGDTRPVRNAGSGHIPAFDPPKKVKRNKYaiaaaflaslasillGYDIGVMSGAAIYIQK  249
            M D R   +A SG  P     KK KRN YAI  A LAS+ SILLGYDIGVMSGA+IYIQ+
Sbjct  1    MTDHRAEDSAVSGQ-PLLK--KKPKRNLYAIGCAILASMTSILLGYDIGVMSGASIYIQE  57

Query  250  DLKINDTQVEILLGILNLYSLIGSCMAGRTSDWIGRRYTMVVASVVFFVGAILMGFSTNY  429
            DLKI+D +VEIL+GILNLYSLIGS  AGRTSDWIGRRYT+V A  +FF GA+LMGF+TNY
Sbjct  58   DLKISDVEVEILIGILNLYSLIGSAAAGRTSDWIGRRYTIVFAGAIFFTGALLMGFATNY  117

Query  430  TFLMVGRFVAGIGVGYALMIAPVYTAEVAPA  522
             FLMVGRFVAGIGVGYALMIAPVY AEV+PA
Sbjct  118  AFLMVGRFVAGIGVGYALMIAPVYNAEVSPA  148



>ref|NP_001289249.1| polyol transporter 5-like [Pyrus x bretschneideri]
 ref|XP_009375824.1| PREDICTED: polyol transporter 5-like [Pyrus x bretschneideri]
 gb|AFM91103.1| sorbitol transporter [Pyrus x bretschneideri]
Length=526

 Score =   191 bits (486),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 105/156 (67%), Positives = 125/156 (80%), Gaps = 5/156 (3%)
 Frame = +1

Query  70   MGDTRPVRNAGSGH-----IPAFDPPKKVKRNKYaiaaaflaslasillGYDIGVMSGAA  234
            M D R    A +G      I  FDPPKK K  K+AIA   LAS+ SILLGYDIGVMSGA+
Sbjct  3    MTDRRAEDKAITGQAQNTSIADFDPPKKAKTKKFAIACGVLASMTSILLGYDIGVMSGAS  62

Query  235  IYIQKDLKINDTQVEILLGILNLYSLIGSCMAGRTSDWIGRRYTMVVASVVFFVGAILMG  414
            ++I+++LKI+D QVEIL G LNLYSLIGS +AGRTSDWIGRRYT+V+A  +FF+GA+LMG
Sbjct  63   LFIKENLKISDVQVEILNGTLNLYSLIGSALAGRTSDWIGRRYTIVLAGTIFFIGALLMG  122

Query  415  FSTNYTFLMVGRFVAGIGVGYALMIAPVYTAEVAPA  522
            F+ NY FLM GRFVAG+GVGYALMIAPVYTAE++PA
Sbjct  123  FAPNYAFLMFGRFVAGVGVGYALMIAPVYTAEISPA  158



>ref|XP_008387377.1| PREDICTED: putative polyol transporter 1 [Malus domestica]
Length=520

 Score =   191 bits (485),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 102/153 (67%), Positives = 123/153 (80%), Gaps = 2/153 (1%)
 Frame = +1

Query  70   MGDTRPVRNAGSGH--IPAFDPPKKVKRNKYaiaaaflaslasillGYDIGVMSGAAIYI  243
            M D +P     SG   I  FDPPK  K  K+AIA A LAS+ SILLGYDIGVMSGA+++I
Sbjct  3    MADRKPQNTEASGQKTIADFDPPKAPKTKKFAIACATLASMTSILLGYDIGVMSGASLFI  62

Query  244  QKDLKINDTQVEILLGILNLYSLIGSCMAGRTSDWIGRRYTMVVASVVFFVGAILMGFST  423
            +++LKI D QVE+L G LNLYSLIGS +AGRTSDWIGRRYT+V++  +FF GA+LMGF+ 
Sbjct  63   KENLKITDVQVEVLNGTLNLYSLIGSALAGRTSDWIGRRYTIVLSGAIFFAGALLMGFAP  122

Query  424  NYTFLMVGRFVAGIGVGYALMIAPVYTAEVAPA  522
            NY FLM GRF+AG+GVGYALMIAPVYTAE++PA
Sbjct  123  NYAFLMFGRFIAGVGVGYALMIAPVYTAEISPA  155



>ref|XP_004171995.1| PREDICTED: LOW QUALITY PROTEIN: polyol transporter 5-like [Cucumis 
sativus]
Length=516

 Score =   191 bits (485),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 100/131 (76%), Positives = 117/131 (89%), Gaps = 0/131 (0%)
 Frame = +1

Query  130  PKKVKRNKYaiaaaflaslasillGYDIGVMSGAAIYIQKDLKINDTQVEILLGILNLYS  309
            PKK KRNKYA   A LAS+ASILLGYD+GVMSGAAIYI+ D +IND Q E+++G++NLY+
Sbjct  14   PKKPKRNKYAFMCAILASMASILLGYDVGVMSGAAIYIKXDFQINDVQEEVMIGVINLYA  73

Query  310  LIGSCMAGRTSDWIGRRYTMVVASVVFFVGAILMGFSTNYTFLMVGRFVAGIGVGYALMI  489
            LIG+  AGRTSDWIGRRYTMV+A V+FF+GAILMGF+TNY FLM GRFVAGIGVGYALMI
Sbjct  74   LIGAAAAGRTSDWIGRRYTMVLAGVIFFLGAILMGFATNYEFLMFGRFVAGIGVGYALMI  133

Query  490  APVYTAEVAPA  522
            +PVYTAEV+PA
Sbjct  134  SPVYTAEVSPA  144



>ref|XP_010065405.1| PREDICTED: polyol transporter 5-like [Eucalyptus grandis]
 gb|KCW62856.1| hypothetical protein EUGRSUZ_G00450 [Eucalyptus grandis]
Length=535

 Score =   191 bits (485),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 103/138 (75%), Positives = 118/138 (86%), Gaps = 0/138 (0%)
 Frame = +1

Query  109  HIPAFDPPKKVKRNKYaiaaaflaslasillGYDIGVMSGAAIYIQKDLKINDTQVEILL  288
             I  FDPP + +RNKYA+A A LAS  SILLGYDIGVMSGA IYI++DLKI+D +VEIL 
Sbjct  23   SIEDFDPPARPRRNKYAMACATLASTTSILLGYDIGVMSGAIIYIKEDLKISDVEVEILT  82

Query  289  GILNLYSLIGSCMAGRTSDWIGRRYTMVVASVVFFVGAILMGFSTNYTFLMVGRFVAGIG  468
            GIL +YSL+GS MAGRTSDWIGRRYT+V+A  +FF GA+LMGF+ NY FLM GRFVAGIG
Sbjct  83   GILAVYSLLGSPMAGRTSDWIGRRYTIVLAGAIFFAGALLMGFAPNYAFLMFGRFVAGIG  142

Query  469  VGYALMIAPVYTAEVAPA  522
            VGYALMIAPVYTAEV+PA
Sbjct  143  VGYALMIAPVYTAEVSPA  160



>gb|ACB86853.1| mannitol transporter [Citrus sinensis]
Length=535

 Score =   191 bits (485),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 102/134 (76%), Positives = 118/134 (88%), Gaps = 0/134 (0%)
 Frame = +1

Query  121  FDPPKKVKRNKYaiaaaflaslasillGYDIGVMSGAAIYIQKDLKINDTQVEILLGILN  300
            FDP KK KRN YA  AA LAS+ SILLGYDIGVMSGAA+YI+ DLK++DT++EIL+GILN
Sbjct  24   FDPQKKPKRNLYASGAAILASMTSILLGYDIGVMSGAALYIKDDLKVSDTKIEILMGILN  83

Query  301  LYSLIGSCMAGRTSDWIGRRYTMVVASVVFFVGAILMGFSTNYTFLMVGRFVAGIGVGYA  480
            +YSLIGS  AGRTSDWIGRRYT+V+A  +FF GA+LMGF+TNY FLM GRF AGIGVGYA
Sbjct  84   IYSLIGSLAAGRTSDWIGRRYTIVLAGAIFFAGALLMGFATNYAFLMGGRFGAGIGVGYA  143

Query  481  LMIAPVYTAEVAPA  522
            LMIAPVYTAE++PA
Sbjct  144  LMIAPVYTAELSPA  157



>ref|XP_008236796.1| PREDICTED: polyol transporter 5-like [Prunus mume]
Length=509

 Score =   189 bits (481),  Expect = 7e-54, Method: Compositional matrix adjust.
 Identities = 110/151 (73%), Positives = 122/151 (81%), Gaps = 3/151 (2%)
 Frame = +1

Query  70   MGDTRPVRNAGSGHIPAFDPPKKVKRNKYaiaaaflaslasillGYDIGVMSGAAIYIQK  249
            M D R   +A SG  P     KK KRN YAI  A LAS+ SILLGYDIGVMSGA+IYIQ+
Sbjct  1    MTDRRAEDSAVSGQ-PLLK--KKPKRNLYAIGCAILASMTSILLGYDIGVMSGASIYIQE  57

Query  250  DLKINDTQVEILLGILNLYSLIGSCMAGRTSDWIGRRYTMVVASVVFFVGAILMGFSTNY  429
            DLKI D +VEIL+GILNLYSLIGS  AGRTSDWIGRRYT+V A  +FF GA+LMGF+TN+
Sbjct  58   DLKITDVEVEILIGILNLYSLIGSAAAGRTSDWIGRRYTIVFAGAIFFTGALLMGFATNF  117

Query  430  TFLMVGRFVAGIGVGYALMIAPVYTAEVAPA  522
             FLMVGRFVAGIGVGYALMIAPVY AEV+PA
Sbjct  118  AFLMVGRFVAGIGVGYALMIAPVYNAEVSPA  148



>gb|KJB12316.1| hypothetical protein B456_002G011500 [Gossypium raimondii]
Length=533

 Score =   190 bits (482),  Expect = 7e-54, Method: Compositional matrix adjust.
 Identities = 105/134 (78%), Positives = 121/134 (90%), Gaps = 0/134 (0%)
 Frame = +1

Query  121  FDPPKKVKRNKYaiaaaflaslasillGYDIGVMSGAAIYIQKDLKINDTQVEILLGILN  300
            F+  KK KRNK+A A A LASLASILLGYDIGVMSGA +YI+ DLKI+D QVEIL+GILN
Sbjct  25   FEVLKKPKRNKFAFACAILASLASILLGYDIGVMSGAILYIKDDLKISDVQVEILVGILN  84

Query  301  LYSLIGSCMAGRTSDWIGRRYTMVVASVVFFVGAILMGFSTNYTFLMVGRFVAGIGVGYA  480
            LY LIG+ +AGRTSDWIGRRYT+VVA+ +FFVGA+LMGF+TNYTFLMVGRFV GIGVG+A
Sbjct  85   LYCLIGAYVAGRTSDWIGRRYTIVVAASIFFVGALLMGFATNYTFLMVGRFVTGIGVGFA  144

Query  481  LMIAPVYTAEVAPA  522
            L+IAPVYTAEV+PA
Sbjct  145  LLIAPVYTAEVSPA  158



>ref|XP_008361285.1| PREDICTED: putative polyol transporter 1 [Malus domestica]
Length=527

 Score =   189 bits (479),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 101/143 (71%), Positives = 120/143 (84%), Gaps = 0/143 (0%)
 Frame = +1

Query  94   NAGSGHIPAFDPPKKVKRNKYaiaaaflaslasillGYDIGVMSGAAIYIQKDLKINDTQ  273
             A +  I  FDPPKK K  K+AIA   LAS+ SILLGYDIGVMSGA+++I+++LKI+D Q
Sbjct  16   EAQNTCIADFDPPKKAKTKKFAIACGILASMTSILLGYDIGVMSGASLFIKENLKISDVQ  75

Query  274  VEILLGILNLYSLIGSCMAGRTSDWIGRRYTMVVASVVFFVGAILMGFSTNYTFLMVGRF  453
            VEIL G LNLYSLIGS +AGRTSDWIGRRYT+V+A  +FF+GAILMG + NY FLM GRF
Sbjct  76   VEILNGTLNLYSLIGSALAGRTSDWIGRRYTIVLAGTIFFIGAILMGLAPNYAFLMFGRF  135

Query  454  VAGIGVGYALMIAPVYTAEVAPA  522
            VAG+GVGYALMIAPVYTAE++PA
Sbjct  136  VAGVGVGYALMIAPVYTAEISPA  158



>ref|XP_009345071.1| PREDICTED: putative polyol transporter 1 [Pyrus x bretschneideri]
Length=527

 Score =   189 bits (479),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 101/143 (71%), Positives = 120/143 (84%), Gaps = 0/143 (0%)
 Frame = +1

Query  94   NAGSGHIPAFDPPKKVKRNKYaiaaaflaslasillGYDIGVMSGAAIYIQKDLKINDTQ  273
             A +  I  FDPPKK K  K+AIA   LAS+ SILLGYDIGVMSGA+++I+++LKI+D Q
Sbjct  16   EAQNTCIADFDPPKKAKTKKFAIACGILASMTSILLGYDIGVMSGASLFIKENLKISDVQ  75

Query  274  VEILLGILNLYSLIGSCMAGRTSDWIGRRYTMVVASVVFFVGAILMGFSTNYTFLMVGRF  453
            VEIL G LNLYSLIGS +AGRTSDWIGRRYT+V+A  +FF+GAILMG + NY FLM GRF
Sbjct  76   VEILNGTLNLYSLIGSALAGRTSDWIGRRYTIVLAGTIFFIGAILMGLAPNYAFLMFGRF  135

Query  454  VAGIGVGYALMIAPVYTAEVAPA  522
            VAG+GVGYALMIAPVYTAE++PA
Sbjct  136  VAGVGVGYALMIAPVYTAEISPA  158



>ref|XP_009344435.1| PREDICTED: putative polyol transporter 1 [Pyrus x bretschneideri]
Length=526

 Score =   188 bits (478),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 102/156 (65%), Positives = 125/156 (80%), Gaps = 5/156 (3%)
 Frame = +1

Query  70   MGDTRPVRNAGSG-----HIPAFDPPKKVKRNKYaiaaaflaslasillGYDIGVMSGAA  234
            M D R   NA +G      I  FDPPKK K +K+AIA A LA   S+LLGYDIGVMSGA+
Sbjct  1    MADQRVNDNAVTGGPQNTSIEDFDPPKKPKTSKFAIACALLACTTSVLLGYDIGVMSGAS  60

Query  235  IYIQKDLKINDTQVEILLGILNLYSLIGSCMAGRTSDWIGRRYTMVVASVVFFVGAILMG  414
            ++I+++LKI+D QVEIL G LN+YSL+GS  AGRTSDWIGR+YT+V+A V+F VGA+LMG
Sbjct  61   LFIKENLKISDVQVEILAGTLNIYSLLGSAFAGRTSDWIGRKYTIVLAGVIFLVGALLMG  120

Query  415  FSTNYTFLMVGRFVAGIGVGYALMIAPVYTAEVAPA  522
            F+TNY FLM GRFVAG+GVGY +MIAPVYTAE++PA
Sbjct  121  FATNYAFLMFGRFVAGVGVGYGMMIAPVYTAEISPA  156



>ref|XP_006577924.1| PREDICTED: polyol transporter 5-like [Glycine max]
Length=509

 Score =   188 bits (477),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 98/143 (69%), Positives = 117/143 (82%), Gaps = 0/143 (0%)
 Frame = +1

Query  91   RNAGSGHIPAFDPPKKVKRNKYaiaaaflaslasillGYDIGVMSGAAIYIQKDLKINDT  270
            + A    +  FDP K  +RNKYA A A LAS+ SILLGYD+GVMSGA IYI++DLK+ D 
Sbjct  5    KTATQKSLQDFDPQKTPRRNKYAFACAILASMTSILLGYDVGVMSGAIIYIKRDLKLTDV  64

Query  271  QVEILLGILNLYSLIGSCMAGRTSDWIGRRYTMVVASVVFFVGAILMGFSTNYTFLMVGR  450
            Q+EIL+GI+NLYSLIGSC+AGRTSDWIGRRYT+V+A  +FF GAILMG S NY FLM  R
Sbjct  65   QIEILVGIINLYSLIGSCLAGRTSDWIGRRYTIVLAGSIFFAGAILMGISPNYPFLMFAR  124

Query  451  FVAGIGVGYALMIAPVYTAEVAP  519
            F+AG+G+GYALMIAPVYT EV+P
Sbjct  125  FIAGVGIGYALMIAPVYTTEVSP  147



>ref|XP_011078883.1| PREDICTED: polyol transporter 5-like isoform X1 [Sesamum indicum]
Length=526

 Score =   188 bits (478),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 99/131 (76%), Positives = 115/131 (88%), Gaps = 0/131 (0%)
 Frame = +1

Query  130  PKKVKRNKYaiaaaflaslasillGYDIGVMSGAAIYIQKDLKINDTQVEILLGILNLYS  309
            P K KRNKYA+A + LAS+ S+LLGYD GVMSGA IYI++DLKI+D Q+EIL+G +N+YS
Sbjct  31   PTKHKRNKYALAISVLASMTSVLLGYDTGVMSGATIYIKRDLKISDVQIEILVGTINIYS  90

Query  310  LIGSCMAGRTSDWIGRRYTMVVASVVFFVGAILMGFSTNYTFLMVGRFVAGIGVGYALMI  489
            L+GS +AGRTSDWIGRRYT+V AS +FF GAILMGF+ NY FLMVGRFVAGIGVGYALMI
Sbjct  91   LLGSAVAGRTSDWIGRRYTIVFASAIFFAGAILMGFAANYAFLMVGRFVAGIGVGYALMI  150

Query  490  APVYTAEVAPA  522
            APVY AEVAPA
Sbjct  151  APVYAAEVAPA  161



>gb|ACJ85869.1| unknown [Medicago truncatula]
 gb|AFK48997.1| unknown [Medicago truncatula]
Length=434

 Score =   186 bits (472),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 96/134 (72%), Positives = 117/134 (87%), Gaps = 0/134 (0%)
 Frame = +1

Query  121  FDPPKKVKRNKYaiaaaflaslasillGYDIGVMSGAAIYIQKDLKINDTQVEILLGILN  300
            FD  KK + NK+A A A LAS+ SILLGYDIGVMSGA IYI++DLK+++ Q+EIL+GI+N
Sbjct  16   FDSQKKPESNKFAFACAILASMTSILLGYDIGVMSGAVIYIKRDLKLSNVQIEILVGIIN  75

Query  301  LYSLIGSCMAGRTSDWIGRRYTMVVASVVFFVGAILMGFSTNYTFLMVGRFVAGIGVGYA  480
            L+SLIGSC+AGRTSDWIGRRYT+V+A  +FF GA+LMGFS N+ FLM  RF+AGIG+GYA
Sbjct  76   LFSLIGSCLAGRTSDWIGRRYTIVLAGSIFFAGALLMGFSPNFAFLMFARFIAGIGIGYA  135

Query  481  LMIAPVYTAEVAPA  522
            LMIAPVYTAEV+PA
Sbjct  136  LMIAPVYTAEVSPA  149



>emb|CDP10064.1| unnamed protein product [Coffea canephora]
Length=521

 Score =   188 bits (477),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 98/137 (72%), Positives = 120/137 (88%), Gaps = 0/137 (0%)
 Frame = +1

Query  112  IPAFDPPKKVKRNKYaiaaaflaslasillGYDIGVMSGAAIYIQKDLKINDTQVEILLG  291
            IP F PP + KRNKY++A A LAS+ SILLGYD GVMSGA +YI++DL ++D Q+EIL+G
Sbjct  17   IPDFGPPPRPKRNKYSLACALLASMTSILLGYDTGVMSGATLYIKQDLHVSDVQIEILVG  76

Query  292  ILNLYSLIGSCMAGRTSDWIGRRYTMVVASVVFFVGAILMGFSTNYTFLMVGRFVAGIGV  471
             +N+YSL+GS +AG+TSD +GRRYT+V+A+VVFFVGA LMGF+TNY FLM GRFVAGIGV
Sbjct  77   TINIYSLVGSAIAGKTSDMVGRRYTIVIAAVVFFVGAFLMGFATNYAFLMFGRFVAGIGV  136

Query  472  GYALMIAPVYTAEVAPA  522
            GYALMIAPVYTAEVAP+
Sbjct  137  GYALMIAPVYTAEVAPS  153



>ref|XP_006349565.1| PREDICTED: polyol transporter 5-like [Solanum tuberosum]
Length=518

 Score =   187 bits (475),  Expect = 5e-53, Method: Compositional matrix adjust.
 Identities = 99/140 (71%), Positives = 119/140 (85%), Gaps = 0/140 (0%)
 Frame = +1

Query  103  SGHIPAFDPPKKVKRNKYaiaaaflaslasillGYDIGVMSGAAIYIQKDLKINDTQVEI  282
            S  IP F P KK KRNKYA A + LAS+ S+LLGYD GVMSGA IYI++DLKI+D  +E+
Sbjct  13   SNKIPEFVPLKKPKRNKYAFACSLLASMTSVLLGYDTGVMSGAVIYIKEDLKISDVAIEV  72

Query  283  LLGILNLYSLIGSCMAGRTSDWIGRRYTMVVASVVFFVGAILMGFSTNYTFLMVGRFVAG  462
            L+G +N+YSL+G+ +AGRTSDWIGRRYT+++AS +F VGA+LMGF+ NY FLM GRFVAG
Sbjct  73   LVGTINIYSLVGAAIAGRTSDWIGRRYTIILASGIFLVGALLMGFAPNYWFLMFGRFVAG  132

Query  463  IGVGYALMIAPVYTAEVAPA  522
            IGVGYALMIAPVYTAEVAPA
Sbjct  133  IGVGYALMIAPVYTAEVAPA  152



>ref|XP_004500821.1| PREDICTED: polyol transporter 5-like [Cicer arietinum]
Length=517

 Score =   187 bits (475),  Expect = 5e-53, Method: Compositional matrix adjust.
 Identities = 99/135 (73%), Positives = 118/135 (87%), Gaps = 1/135 (1%)
 Frame = +1

Query  121  FDPPKKV-KRNKYaiaaaflaslasillGYDIGVMSGAAIYIQKDLKINDTQVEILLGIL  297
            FDP KK  + NK+A A A LAS+ SILLGYDIGVMSGA IYI++DLK++D Q+EIL+GI+
Sbjct  19   FDPQKKKPESNKFAFACAILASMTSILLGYDIGVMSGAVIYIRRDLKLSDVQIEILVGII  78

Query  298  NLYSLIGSCMAGRTSDWIGRRYTMVVASVVFFVGAILMGFSTNYTFLMVGRFVAGIGVGY  477
            NL+SLIGSC+AGRTSDWIGRRYT+V+A  +FF GAILMGFS N+ FLM  RF+AGIG+GY
Sbjct  79   NLFSLIGSCLAGRTSDWIGRRYTIVLAGAIFFAGAILMGFSPNFPFLMFARFIAGIGIGY  138

Query  478  ALMIAPVYTAEVAPA  522
            ALMIAPVYTAEV+PA
Sbjct  139  ALMIAPVYTAEVSPA  153



>ref|XP_009602627.1| PREDICTED: polyol transporter 5-like [Nicotiana tomentosiformis]
Length=531

 Score =   187 bits (475),  Expect = 6e-53, Method: Compositional matrix adjust.
 Identities = 98/132 (74%), Positives = 115/132 (87%), Gaps = 0/132 (0%)
 Frame = +1

Query  127  PPKKVKRNKYaiaaaflaslasillGYDIGVMSGAAIYIQKDLKINDTQVEILLGILNLY  306
            P K  KRNKYA A + LAS+ S+LLGYD GVMSGA IYI++DLKI+D Q+EIL+G +N+Y
Sbjct  25   PCKNPKRNKYAFACSLLASMTSVLLGYDTGVMSGAVIYIKEDLKISDVQIEILVGTINIY  84

Query  307  SLIGSCMAGRTSDWIGRRYTMVVASVVFFVGAILMGFSTNYTFLMVGRFVAGIGVGYALM  486
            SL+G+ +AGRTSDWIGRRYT++ AS +FF GAILMGF+TNY FLM GRFVAGIGVGYALM
Sbjct  85   SLVGAALAGRTSDWIGRRYTIIFASAIFFAGAILMGFATNYGFLMFGRFVAGIGVGYALM  144

Query  487  IAPVYTAEVAPA  522
            IAPVYTAEVAPA
Sbjct  145  IAPVYTAEVAPA  156



>gb|AFK48916.1| unknown [Medicago truncatula]
Length=153

 Score =   177 bits (449),  Expect = 6e-53, Method: Compositional matrix adjust.
 Identities = 82/105 (78%), Positives = 98/105 (93%), Gaps = 0/105 (0%)
 Frame = +1

Query  208  DIGVMSGAAIYIQKDLKINDTQVEILLGILNLYSLIGSCMAGRTSDWIGRRYTMVVASVV  387
            DIGVMSGAAIYI++DLK++D ++E+LLGI+N+YSLIGSC+AGRTSDWIGRRYT+V A  +
Sbjct  12   DIGVMSGAAIYIKRDLKVSDGKIEVLLGIINIYSLIGSCLAGRTSDWIGRRYTIVFAGAI  71

Query  388  FFVGAILMGFSTNYTFLMVGRFVAGIGVGYALMIAPVYTAEVAPA  522
            FFVGA+LMGFS NY FLM GRFVAG+G+GYALMIAPVYTAEV+PA
Sbjct  72   FFVGALLMGFSPNYNFLMFGRFVAGVGIGYALMIAPVYTAEVSPA  116



>gb|AEX55225.1| sugar transporter [Allium sativum]
Length=522

 Score =   187 bits (475),  Expect = 6e-53, Method: Compositional matrix adjust.
 Identities = 105/146 (72%), Positives = 121/146 (83%), Gaps = 3/146 (2%)
 Frame = +1

Query  94   NAGSGHIP---AFDPPKKVKRNKYaiaaaflaslasillGYDIGVMSGAAIYIQKDLKIN  264
            N  S  IP   A  PP+  K  ++A A A LAS+ SILLGYDIGVMSGAA++I+ DL ++
Sbjct  5    NLDSNIIPNEKADGPPRTKKNTRFASACALLASMTSILLGYDIGVMSGAALFIKDDLNVS  64

Query  265  DTQVEILLGILNLYSLIGSCMAGRTSDWIGRRYTMVVASVVFFVGAILMGFSTNYTFLMV  444
            DTQ+EILLGILNLYSL+GS  AGRTSDWIGRRYT+V A+V+FFVGAI+MG S NY FLMV
Sbjct  65   DTQIEILLGILNLYSLLGSFAAGRTSDWIGRRYTIVFAAVIFFVGAIMMGLSPNYAFLMV  124

Query  445  GRFVAGIGVGYALMIAPVYTAEVAPA  522
            GRFVAGIGVGYALMIAPVYTAEV+PA
Sbjct  125  GRFVAGIGVGYALMIAPVYTAEVSPA  150



>ref|XP_009407915.1| PREDICTED: putative polyol transporter 1 [Musa acuminata subsp. 
malaccensis]
Length=520

 Score =   187 bits (474),  Expect = 8e-53, Method: Compositional matrix adjust.
 Identities = 102/132 (77%), Positives = 114/132 (86%), Gaps = 0/132 (0%)
 Frame = +1

Query  127  PPKKVKRNKYaiaaaflaslasillGYDIGVMSGAAIYIQKDLKINDTQVEILLGILNLY  306
            PP K   NKYA   A LASLASILLGYDIGVMSGA ++I+ DLK+NDTQ+EILLG+LNLY
Sbjct  19   PPPKRGYNKYATGCAMLASLASILLGYDIGVMSGAELFIKDDLKLNDTQIEILLGVLNLY  78

Query  307  SLIGSCMAGRTSDWIGRRYTMVVASVVFFVGAILMGFSTNYTFLMVGRFVAGIGVGYALM  486
            SL+GS  AG TSDWIGRRYT+V A+ +FF GA+LMGF+TNY FLMVGRFVAGIGVGYALM
Sbjct  79   SLVGSFAAGFTSDWIGRRYTIVFAATIFFTGALLMGFATNYAFLMVGRFVAGIGVGYALM  138

Query  487  IAPVYTAEVAPA  522
            IAP YTAEVAPA
Sbjct  139  IAPTYTAEVAPA  150



>gb|EMS55536.1| Polyol transporter 5 [Triticum urartu]
Length=515

 Score =   186 bits (473),  Expect = 8e-53, Method: Compositional matrix adjust.
 Identities = 101/137 (74%), Positives = 118/137 (86%), Gaps = 0/137 (0%)
 Frame = +1

Query  112  IPAFDPPKKVKRNKYaiaaaflaslasillGYDIGVMSGAAIYIQKDLKINDTQVEILLG  291
            +PA   PKK    ++A A A LAS+ SILLGYDIGVMSGA++YIQKDLKINDTQ+E+L+G
Sbjct  6    LPAAVEPKKKGNVRFAFACAILASMTSILLGYDIGVMSGASLYIQKDLKINDTQLEVLMG  65

Query  292  ILNLYSLIGSCMAGRTSDWIGRRYTMVVASVVFFVGAILMGFSTNYTFLMVGRFVAGIGV  471
            ILN+YSLIGS  AGRTSDWIGRR+T+V A+V+FF GA++MGFS NY  LM GRFVAGIGV
Sbjct  66   ILNVYSLIGSFAAGRTSDWIGRRFTIVFAAVIFFAGALIMGFSVNYAMLMFGRFVAGIGV  125

Query  472  GYALMIAPVYTAEVAPA  522
            GYALMIAPVYTAEV+PA
Sbjct  126  GYALMIAPVYTAEVSPA  142



>ref|XP_006423216.1| hypothetical protein CICLE_v10028174mg [Citrus clementina]
 gb|ESR36456.1| hypothetical protein CICLE_v10028174mg [Citrus clementina]
Length=535

 Score =   187 bits (474),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 98/134 (73%), Positives = 117/134 (87%), Gaps = 0/134 (0%)
 Frame = +1

Query  121  FDPPKKVKRNKYaiaaaflaslasillGYDIGVMSGAAIYIQKDLKINDTQVEILLGILN  300
            FDP KK KRN YA  AA LAS+ SILLGYDIGVMSGAA+YI+ D K++DT++EIL+GILN
Sbjct  24   FDPQKKPKRNLYASGAAILASMTSILLGYDIGVMSGAALYIKDDFKVSDTKIEILIGILN  83

Query  301  LYSLIGSCMAGRTSDWIGRRYTMVVASVVFFVGAILMGFSTNYTFLMVGRFVAGIGVGYA  480
            ++SLIGS  AGRTSDWIGRRYT+V+A  +FF GA+LMGF+TNY FLM GRFVAG+GVGYA
Sbjct  84   IFSLIGSLAAGRTSDWIGRRYTIVLAGAIFFAGALLMGFATNYAFLMGGRFVAGVGVGYA  143

Query  481  LMIAPVYTAEVAPA  522
             +IAPVYTAE++PA
Sbjct  144  ALIAPVYTAELSPA  157



>ref|XP_011037561.1| PREDICTED: polyol transporter 5 [Populus euphratica]
 ref|XP_011037562.1| PREDICTED: polyol transporter 5 [Populus euphratica]
 ref|XP_011037564.1| PREDICTED: polyol transporter 5 [Populus euphratica]
 ref|XP_011037565.1| PREDICTED: polyol transporter 5 [Populus euphratica]
 ref|XP_011037566.1| PREDICTED: polyol transporter 5 [Populus euphratica]
 ref|XP_011037567.1| PREDICTED: polyol transporter 5 [Populus euphratica]
Length=531

 Score =   187 bits (474),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 105/149 (70%), Positives = 117/149 (79%), Gaps = 0/149 (0%)
 Frame = +1

Query  76   DTRPVRNAGSGHIPAFDPPKKVKRNKYaiaaaflaslasillGYDIGVMSGAAIYIQKDL  255
            D  P +      +  FDP KK KRNKYA A A LAS+ASILLGYDIGVMSGA  YIQ DL
Sbjct  10   DVNPSQPTTEKTLADFDPVKKPKRNKYAFACAILASVASILLGYDIGVMSGAKDYIQTDL  69

Query  256  KINDTQVEILLGILNLYSLIGSCMAGRTSDWIGRRYTMVVASVVFFVGAILMGFSTNYTF  435
            K++D QV +L+G LN YSL+GS  AG TSDWIGRRYT+VVA  VFF GA+LMGFSTNY F
Sbjct  70   KLSDVQVGLLVGTLNWYSLVGSAAAGVTSDWIGRRYTIVVAGAVFFTGALLMGFSTNYAF  129

Query  436  LMVGRFVAGIGVGYALMIAPVYTAEVAPA  522
            LMV RFVAGIGVG+ALMIAPVYT EV+PA
Sbjct  130  LMVARFVAGIGVGFALMIAPVYTTEVSPA  158



>ref|XP_003603886.1| Mannitol transporter [Medicago truncatula]
 gb|AES74137.1| polyol/monosaccharide transporter 1 [Medicago truncatula]
Length=514

 Score =   186 bits (473),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 96/134 (72%), Positives = 117/134 (87%), Gaps = 0/134 (0%)
 Frame = +1

Query  121  FDPPKKVKRNKYaiaaaflaslasillGYDIGVMSGAAIYIQKDLKINDTQVEILLGILN  300
            FD  KK + NK+A A A LAS+ SILLGYDIGVMSGA IYI++DLK+++ Q+EIL+GI+N
Sbjct  16   FDSQKKPESNKFAFACAILASMTSILLGYDIGVMSGAVIYIKRDLKLSNVQIEILVGIIN  75

Query  301  LYSLIGSCMAGRTSDWIGRRYTMVVASVVFFVGAILMGFSTNYTFLMVGRFVAGIGVGYA  480
            L+SLIGSC+AGRTSDWIGRRYT+V+A  +FF GA+LMGFS N+ FLM  RF+AGIG+GYA
Sbjct  76   LFSLIGSCLAGRTSDWIGRRYTIVLAGSIFFAGALLMGFSPNFAFLMFARFIAGIGIGYA  135

Query  481  LMIAPVYTAEVAPA  522
            LMIAPVYTAEV+PA
Sbjct  136  LMIAPVYTAEVSPA  149



>ref|XP_006487181.1| PREDICTED: polyol transporter 5-like [Citrus sinensis]
Length=539

 Score =   187 bits (474),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 98/134 (73%), Positives = 117/134 (87%), Gaps = 0/134 (0%)
 Frame = +1

Query  121  FDPPKKVKRNKYaiaaaflaslasillGYDIGVMSGAAIYIQKDLKINDTQVEILLGILN  300
            FDP KK KRN YA  AA LAS+ SILLGYDIGVMSGAA+YI+ D K++DT++EIL+GILN
Sbjct  24   FDPQKKPKRNLYASGAAILASMTSILLGYDIGVMSGAALYIKDDFKVSDTKIEILIGILN  83

Query  301  LYSLIGSCMAGRTSDWIGRRYTMVVASVVFFVGAILMGFSTNYTFLMVGRFVAGIGVGYA  480
            ++SLIGS  AGRTSDWIGRRYT+V+A  +FF GA+LMGF+TNY FLM GRFVAG+GVGYA
Sbjct  84   IFSLIGSLAAGRTSDWIGRRYTIVLAGAIFFAGALLMGFATNYAFLMGGRFVAGVGVGYA  143

Query  481  LMIAPVYTAEVAPA  522
             +IAPVYTAE++PA
Sbjct  144  ALIAPVYTAELSPA  157



>ref|XP_008387373.1| PREDICTED: putative polyol transporter 1 [Malus domestica]
Length=526

 Score =   186 bits (472),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 100/156 (64%), Positives = 124/156 (79%), Gaps = 5/156 (3%)
 Frame = +1

Query  70   MGDTRPVRNA-----GSGHIPAFDPPKKVKRNKYaiaaaflaslasillGYDIGVMSGAA  234
            M D R   NA      +  I   DPPKK K +K+AIA A LA   S+LLGYDIGVMSGA+
Sbjct  1    MADQRANENAVTSGPQNTSIEDIDPPKKPKTSKFAIACALLACTTSVLLGYDIGVMSGAS  60

Query  235  IYIQKDLKINDTQVEILLGILNLYSLIGSCMAGRTSDWIGRRYTMVVASVVFFVGAILMG  414
            ++I+++LKI+D QVE+L G LN+YSL+GS  AGRTSDWIGR+YT+V+A V+F VGA+LMG
Sbjct  61   LFIKENLKISDVQVEVLAGTLNIYSLLGSAFAGRTSDWIGRKYTIVLAGVIFLVGALLMG  120

Query  415  FSTNYTFLMVGRFVAGIGVGYALMIAPVYTAEVAPA  522
            F+TNY FLMVGRFVAG+GVGY +MIAPVYTAE++PA
Sbjct  121  FATNYAFLMVGRFVAGVGVGYGMMIAPVYTAEISPA  156



>ref|XP_010909852.1| PREDICTED: putative polyol transporter 1 [Elaeis guineensis]
Length=520

 Score =   186 bits (472),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 104/156 (67%), Positives = 125/156 (80%), Gaps = 5/156 (3%)
 Frame = +1

Query  70   MGDTRPVRNAGSGHIPAFDPP----KKVKRNK-YaiaaaflaslasillGYDIGVMSGAA  234
            M D +P     +   P+   P     +++RNK +A A A LAS+ SILLGYDIGVMSGAA
Sbjct  1    MSDRKPEATKVASQGPSVSLPYAVTPRLRRNKRFAFACAMLASMTSILLGYDIGVMSGAA  60

Query  235  IYIQKDLKINDTQVEILLGILNLYSLIGSCMAGRTSDWIGRRYTMVVASVVFFVGAILMG  414
            I+I+ DL ++DTQ+EILLGILNLYSL+GS  AGRTSDWIGRRYT+V A+V+FF+GAI+MG
Sbjct  61   IFIKDDLHVSDTQIEILLGILNLYSLVGSLAAGRTSDWIGRRYTIVFAAVIFFIGAIMMG  120

Query  415  FSTNYTFLMVGRFVAGIGVGYALMIAPVYTAEVAPA  522
             + NY FLMVGRFVAG+GVGYALMIAPVYTAEVAPA
Sbjct  121  LAPNYAFLMVGRFVAGVGVGYALMIAPVYTAEVAPA  156



>ref|XP_009336961.1| PREDICTED: putative polyol transporter 1 [Pyrus x bretschneideri]
Length=526

 Score =   186 bits (472),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 100/156 (64%), Positives = 125/156 (80%), Gaps = 5/156 (3%)
 Frame = +1

Query  70   MGDTRPVRNAGSG-----HIPAFDPPKKVKRNKYaiaaaflaslasillGYDIGVMSGAA  234
            M D R   NA +G      I  FD P K K +K+AIA A LA   S+LLGYDIGVMSGA+
Sbjct  1    MADRRAEENAVTGGPQNTSIEDFDRPMKPKTSKFAIACALLACTTSVLLGYDIGVMSGAS  60

Query  235  IYIQKDLKINDTQVEILLGILNLYSLIGSCMAGRTSDWIGRRYTMVVASVVFFVGAILMG  414
            ++I+++LKI+D QVE+L G LN+YSL+GS  AGRTSDWIGR+YT+V+A V+FFVGA+LMG
Sbjct  61   LFIKENLKISDVQVEVLAGTLNIYSLLGSAFAGRTSDWIGRKYTIVLAGVIFFVGALLMG  120

Query  415  FSTNYTFLMVGRFVAGIGVGYALMIAPVYTAEVAPA  522
            F+TNY FLMVGRFVAG+GVG+ +MIAPVYTAE++PA
Sbjct  121  FATNYAFLMVGRFVAGVGVGFGMMIAPVYTAEISPA  156



>ref|XP_009344434.1| PREDICTED: polyol transporter 5-like [Pyrus x bretschneideri]
Length=491

 Score =   185 bits (470),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 88/107 (82%), Positives = 98/107 (92%), Gaps = 0/107 (0%)
 Frame = +1

Query  202  GYDIGVMSGAAIYIQKDLKINDTQVEILLGILNLYSLIGSCMAGRTSDWIGRRYTMVVAS  381
            GYDIGVMSGAAIYI+KDLK+ DTQ+EILLGILNLYSLIGS MAGRTSDW+GRRYT+V++ 
Sbjct  7    GYDIGVMSGAAIYIEKDLKVTDTQIEILLGILNLYSLIGSAMAGRTSDWVGRRYTIVISR  66

Query  382  VVFFVGAILMGFSTNYTFLMVGRFVAGIGVGYALMIAPVYTAEVAPA  522
             +FF GAILMG STNYTFLM GRFVAG+GVGYAL IAPVY AEV+PA
Sbjct  67   AIFFTGAILMGLSTNYTFLMCGRFVAGLGVGYALTIAPVYAAEVSPA  113



>gb|AGG19156.1| sorbitol transporter [Pyrus pyrifolia]
Length=491

 Score =   185 bits (470),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 88/107 (82%), Positives = 98/107 (92%), Gaps = 0/107 (0%)
 Frame = +1

Query  202  GYDIGVMSGAAIYIQKDLKINDTQVEILLGILNLYSLIGSCMAGRTSDWIGRRYTMVVAS  381
            GYDIGVMSGAAIYI+KDLK+ DTQ+EILLGILNLYSLIGS MAGRTSDW+GRRYT+V++ 
Sbjct  7    GYDIGVMSGAAIYIEKDLKVTDTQIEILLGILNLYSLIGSAMAGRTSDWVGRRYTIVISG  66

Query  382  VVFFVGAILMGFSTNYTFLMVGRFVAGIGVGYALMIAPVYTAEVAPA  522
             +FF GAILMG STNYTFLM GRFVAG+GVGYAL IAPVY AEV+PA
Sbjct  67   AIFFTGAILMGLSTNYTFLMCGRFVAGLGVGYALTIAPVYAAEVSPA  113



>emb|CBI32562.3| unnamed protein product [Vitis vinifera]
Length=351

 Score =   182 bits (462),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 88/107 (82%), Positives = 100/107 (93%), Gaps = 0/107 (0%)
 Frame = +1

Query  202  GYDIGVMSGAAIYIQKDLKINDTQVEILLGILNLYSLIGSCMAGRTSDWIGRRYTMVVAS  381
            GYDIGVMSGAAIYI+KDLKI+D +VEIL+GILN+Y L GS  AGRTSDWIGRRYT+V+AS
Sbjct  7    GYDIGVMSGAAIYIKKDLKISDVEVEILVGILNVYCLFGSAAAGRTSDWIGRRYTIVLAS  66

Query  382  VVFFVGAILMGFSTNYTFLMVGRFVAGIGVGYALMIAPVYTAEVAPA  522
            V+FF+GA+LMGF+TNY FLMVGRFVAGIGVGYALMIAPVY AEV+PA
Sbjct  67   VIFFLGALLMGFATNYVFLMVGRFVAGIGVGYALMIAPVYAAEVSPA  113



>ref|XP_007131852.1| hypothetical protein PHAVU_011G046800g [Phaseolus vulgaris]
 gb|ESW03846.1| hypothetical protein PHAVU_011G046800g [Phaseolus vulgaris]
Length=519

 Score =   186 bits (471),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 97/134 (72%), Positives = 114/134 (85%), Gaps = 0/134 (0%)
 Frame = +1

Query  118  AFDPPKKVKRNKYaiaaaflaslasillGYDIGVMSGAAIYIQKDLKINDTQVEILLGIL  297
            A    K +K N Y  A A LAS+ SILLGYDIGVMSGAAIYI++DLK++D ++EIL+GI 
Sbjct  13   AHQTRKNLKLNNYTFACAILASITSILLGYDIGVMSGAAIYIKRDLKLSDVKIEILVGIF  72

Query  298  NLYSLIGSCMAGRTSDWIGRRYTMVVASVVFFVGAILMGFSTNYTFLMVGRFVAGIGVGY  477
            NLYSL+GSC+AGRTSDWIGRRYT+V A  +FFVGAILMGFS NY FLM GRFVAG+G+GY
Sbjct  73   NLYSLVGSCLAGRTSDWIGRRYTIVFAGAIFFVGAILMGFSPNYAFLMFGRFVAGVGMGY  132

Query  478  ALMIAPVYTAEVAP  519
            ALMIAPVYTAE++P
Sbjct  133  ALMIAPVYTAELSP  146



>ref|XP_009375629.1| PREDICTED: polyol transporter 5-like [Pyrus x bretschneideri]
Length=491

 Score =   185 bits (470),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 88/107 (82%), Positives = 98/107 (92%), Gaps = 0/107 (0%)
 Frame = +1

Query  202  GYDIGVMSGAAIYIQKDLKINDTQVEILLGILNLYSLIGSCMAGRTSDWIGRRYTMVVAS  381
            GYDIGVMSGAAIYI+KDLK+ DTQ+EILLGILNLYSLIGS MAGRTSDW+GRRYT+V++ 
Sbjct  7    GYDIGVMSGAAIYIEKDLKVTDTQIEILLGILNLYSLIGSAMAGRTSDWVGRRYTIVISG  66

Query  382  VVFFVGAILMGFSTNYTFLMVGRFVAGIGVGYALMIAPVYTAEVAPA  522
             +FF GAILMG STNYTFLM GRFVAG+GVGYAL IAPVY AEV+PA
Sbjct  67   AIFFTGAILMGLSTNYTFLMCGRFVAGLGVGYALTIAPVYAAEVSPA  113



>ref|NP_188513.1| polyol transporter 5 [Arabidopsis thaliana]
 sp|Q8VZ80.2|PLT5_ARATH RecName: Full=Polyol transporter 5; AltName: Full=Protein POLYOL 
TRANSPORTER 5; Short=AtPLT5; AltName: Full=Sugar-proton 
symporter PLT5 [Arabidopsis thaliana]
 dbj|BAB01812.1| sugar transporter protein [Arabidopsis thaliana]
 gb|AEE76153.1| polyol transporter 5 [Arabidopsis thaliana]
Length=539

 Score =   186 bits (472),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 103/139 (74%), Positives = 115/139 (83%), Gaps = 1/139 (1%)
 Frame = +1

Query  109  HIP-AFDPPKKVKRNKYaiaaaflaslasillGYDIGVMSGAAIYIQKDLKINDTQVEIL  285
            H+P +  P K  KRN YA A A LAS+ SILLGYDIGVMSGA IYI++DLKIND Q+ IL
Sbjct  19   HVPESVLPAKPPKRNNYAFACAILASMTSILLGYDIGVMSGAMIYIKRDLKINDLQIGIL  78

Query  286  LGILNLYSLIGSCMAGRTSDWIGRRYTMVVASVVFFVGAILMGFSTNYTFLMVGRFVAGI  465
             G LN+YSLIGSC AGRTSDWIGRRYT+V+A  +FF GAILMG S NY FLM GRF+AGI
Sbjct  79   AGSLNIYSLIGSCAAGRTSDWIGRRYTIVLAGAIFFAGAILMGLSPNYAFLMFGRFIAGI  138

Query  466  GVGYALMIAPVYTAEVAPA  522
            GVGYALMIAPVYTAEV+PA
Sbjct  139  GVGYALMIAPVYTAEVSPA  157



>ref|NP_001281036.1| polyol transporter 5-like [Malus domestica]
 dbj|BAD42344.1| sorbitol transporter [Malus domestica]
Length=491

 Score =   185 bits (470),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 88/107 (82%), Positives = 98/107 (92%), Gaps = 0/107 (0%)
 Frame = +1

Query  202  GYDIGVMSGAAIYIQKDLKINDTQVEILLGILNLYSLIGSCMAGRTSDWIGRRYTMVVAS  381
            GYDIGVMSGAAIYI+KDLK+ DTQ+EILLGILNLYSLIGS MAGRTSDW+GRRYT+V++ 
Sbjct  7    GYDIGVMSGAAIYIEKDLKVTDTQIEILLGILNLYSLIGSAMAGRTSDWVGRRYTIVISG  66

Query  382  VVFFVGAILMGFSTNYTFLMVGRFVAGIGVGYALMIAPVYTAEVAPA  522
             +FF GAILMG STNYTFLM GRFVAG+GVGYAL IAPVY AEV+PA
Sbjct  67   AIFFTGAILMGLSTNYTFLMCGRFVAGLGVGYALTIAPVYAAEVSPA  113



>gb|AAL85876.2|AF480069_1 mannitol transporter [Apium graveolens Dulce Group]
 gb|ABH03025.1| mannitol transporter MaT2 [Apium graveolens]
Length=524

 Score =   186 bits (471),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 98/134 (73%), Positives = 116/134 (87%), Gaps = 0/134 (0%)
 Frame = +1

Query  121  FDPPKKVKRNKYaiaaaflaslasillGYDIGVMSGAAIYIQKDLKINDTQVEILLGILN  300
            FD  KK KRNKYA   A LAS+ S+LLGYDIGVMSGAAIYI+  L ++D ++EI++GI+N
Sbjct  24   FDAVKKPKRNKYAFGCAILASMTSVLLGYDIGVMSGAAIYIKDQLHVSDVKLEIVVGIIN  83

Query  301  LYSLIGSCMAGRTSDWIGRRYTMVVASVVFFVGAILMGFSTNYTFLMVGRFVAGIGVGYA  480
             +SL+GS +AGRTSDWIGRRYTMV+A  +FFVGAILMGF+TNY+FLM GRFVAGIGVGYA
Sbjct  84   FFSLVGSALAGRTSDWIGRRYTMVLAGAIFFVGAILMGFATNYSFLMFGRFVAGIGVGYA  143

Query  481  LMIAPVYTAEVAPA  522
            LMIAPVYTAEV+ A
Sbjct  144  LMIAPVYTAEVSSA  157



>ref|XP_009395604.1| PREDICTED: putative polyol transporter 1 [Musa acuminata subsp. 
malaccensis]
Length=561

 Score =   186 bits (472),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 108/152 (71%), Positives = 122/152 (80%), Gaps = 5/152 (3%)
 Frame = +1

Query  67   IMGDTRPVRNAGSGHIPAFDPPKKVKRNKYaiaaaflaslasillGYDIGVMSGAAIYIQ  246
            +MGD +P  N      PA     K +   +A A A LAS+ASILLGYDIGVMSGAAI+I+
Sbjct  49   VMGDQKPEANIMEAVAPA-----KSRNKMFAFACAVLASMASILLGYDIGVMSGAAIFIK  103

Query  247  KDLKINDTQVEILLGILNLYSLIGSCMAGRTSDWIGRRYTMVVASVVFFVGAILMGFSTN  426
             DLKI+D QVEILLGILNLYSL+GS  AG TSDWIGRRYT+V A+ +FFVGAILMGF+TN
Sbjct  104  DDLKISDVQVEILLGILNLYSLVGSYAAGFTSDWIGRRYTIVFAAGIFFVGAILMGFATN  163

Query  427  YTFLMVGRFVAGIGVGYALMIAPVYTAEVAPA  522
            Y FLM GRFVAGIGVGYALMIAPVYTAE+APA
Sbjct  164  YAFLMAGRFVAGIGVGYALMIAPVYTAEIAPA  195



>ref|XP_006349557.1| PREDICTED: polyol transporter 5-like [Solanum tuberosum]
Length=519

 Score =   185 bits (470),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 98/130 (75%), Positives = 117/130 (90%), Gaps = 0/130 (0%)
 Frame = +1

Query  133  KKVKRNKYaiaaaflaslasillGYDIGVMSGAAIYIQKDLKINDTQVEILLGILNLYSL  312
            K  KRNKYA+A + LAS+ SILLGYD GVMSGA IYI++DLKI+D Q+EIL+G +N+YSL
Sbjct  10   KSPKRNKYALACSLLASMTSILLGYDTGVMSGAVIYIKEDLKISDVQIEILVGTINIYSL  69

Query  313  IGSCMAGRTSDWIGRRYTMVVASVVFFVGAILMGFSTNYTFLMVGRFVAGIGVGYALMIA  492
            +G+ +AGRTSDWIGRRYT+++AS++FFVGAILMGF+ NY FLM GRFVAGIGVGYALMIA
Sbjct  70   VGAAIAGRTSDWIGRRYTIILASLIFFVGAILMGFAPNYWFLMFGRFVAGIGVGYALMIA  129

Query  493  PVYTAEVAPA  522
            PVYTAEVAPA
Sbjct  130  PVYTAEVAPA  139



>ref|XP_002305419.2| hypothetical protein POPTR_0004s15960g [Populus trichocarpa]
 gb|EEE85930.2| hypothetical protein POPTR_0004s15960g [Populus trichocarpa]
Length=531

 Score =   185 bits (470),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 103/149 (69%), Positives = 116/149 (78%), Gaps = 0/149 (0%)
 Frame = +1

Query  76   DTRPVRNAGSGHIPAFDPPKKVKRNKYaiaaaflaslasillGYDIGVMSGAAIYIQKDL  255
            D  P +      +  FDP KK KRNK+A A A  AS+ASILLGYDIGVMSGA  YIQ DL
Sbjct  10   DVNPSQPTTEKTLADFDPVKKPKRNKFAFACAITASVASILLGYDIGVMSGAKDYIQTDL  69

Query  256  KINDTQVEILLGILNLYSLIGSCMAGRTSDWIGRRYTMVVASVVFFVGAILMGFSTNYTF  435
            K++D QV +L+G LN YSL+GS  AG TSDWIGRRYT+VVA  VFF GA+LMGFSTNY F
Sbjct  70   KLSDVQVGLLVGTLNWYSLVGSAAAGVTSDWIGRRYTIVVAGAVFFAGALLMGFSTNYAF  129

Query  436  LMVGRFVAGIGVGYALMIAPVYTAEVAPA  522
            LMV RFVAGIGVG+ALMIAPVYT EV+PA
Sbjct  130  LMVARFVAGIGVGFALMIAPVYTTEVSPA  158



>ref|XP_008236860.1| PREDICTED: putative polyol transporter 1 [Prunus mume]
Length=525

 Score =   185 bits (469),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 98/136 (72%), Positives = 115/136 (85%), Gaps = 0/136 (0%)
 Frame = +1

Query  112  IPAFDPPKKVKRNKYaiaaaflaslasillGYDIGVMSGAAIYIQKDLKINDTQVEILLG  291
            I  FDPP+K KRNK+AIA + LA + SILLGYDIGVMSGA ++IQ DLKIND Q++IL G
Sbjct  20   IADFDPPQKPKRNKFAIACSILACMTSILLGYDIGVMSGANLFIQDDLKINDVQIQILTG  79

Query  292  ILNLYSLIGSCMAGRTSDWIGRRYTMVVASVVFFVGAILMGFSTNYTFLMVGRFVAGIGV  471
             LN+YSLIGS +AGRTSDWIGRRYT+V++  +FFVGAILMG +  Y FLM GRFVAGIGV
Sbjct  80   TLNIYSLIGSALAGRTSDWIGRRYTVVLSGAIFFVGAILMGVAPGYGFLMFGRFVAGIGV  139

Query  472  GYALMIAPVYTAEVAP  519
            GY LMI+PVYTAE+AP
Sbjct  140  GYGLMISPVYTAEIAP  155



>dbj|BAM66296.1| sorbitol transporter, partial [Pyrus pyrifolia]
 dbj|BAM66297.1| sorbitol transporter, partial [Pyrus pyrifolia]
Length=454

 Score =   184 bits (466),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 89/106 (84%), Positives = 98/106 (92%), Gaps = 0/106 (0%)
 Frame = +1

Query  205  YDIGVMSGAAIYIQKDLKINDTQVEILLGILNLYSLIGSCMAGRTSDWIGRRYTMVVASV  384
            YDIGVMSGAAIYIQKDLKI+D Q+EILLGILN+YSL GS  AGRTSDWIGRRYT+V+A  
Sbjct  1    YDIGVMSGAAIYIQKDLKISDVQIEILLGILNVYSLFGSAAAGRTSDWIGRRYTIVLAGA  60

Query  385  VFFVGAILMGFSTNYTFLMVGRFVAGIGVGYALMIAPVYTAEVAPA  522
            +FF GA+LMGF+TNY FLMVGRFVAGIGVGYALMIAPVYTAEV+PA
Sbjct  61   IFFAGALLMGFATNYVFLMVGRFVAGIGVGYALMIAPVYTAEVSPA  106



>emb|CAD58710.1| polyol transporter [Plantago major]
Length=530

 Score =   185 bits (469),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 99/132 (75%), Positives = 114/132 (86%), Gaps = 0/132 (0%)
 Frame = +1

Query  127  PPKKVKRNKYaiaaaflaslasillGYDIGVMSGAAIYIQKDLKINDTQVEILLGILNLY  306
            P K V RNKYA+A + LAS+ S+LLGYD GVMSGA +YI+ DLKI+D QVE+L+G +N+Y
Sbjct  34   PKKPVTRNKYALAISILASMTSVLLGYDTGVMSGATLYIKDDLKISDVQVELLVGTINIY  93

Query  307  SLIGSCMAGRTSDWIGRRYTMVVASVVFFVGAILMGFSTNYTFLMVGRFVAGIGVGYALM  486
            SL+GS +AGRTSDW+GRRYT V ASVVFFVGAILMG +TNY FLM GRFVAGIGVGYALM
Sbjct  94   SLVGSAVAGRTSDWVGRRYTTVFASVVFFVGAILMGIATNYVFLMAGRFVAGIGVGYALM  153

Query  487  IAPVYTAEVAPA  522
            IAPVY AEVAPA
Sbjct  154  IAPVYAAEVAPA  165



>emb|CAD58709.1| polyol transporter [Plantago major]
 emb|CAR82415.1| polyol transporter [Plantago major]
Length=529

 Score =   185 bits (469),  Expect = 5e-52, Method: Compositional matrix adjust.
 Identities = 97/132 (73%), Positives = 115/132 (87%), Gaps = 0/132 (0%)
 Frame = +1

Query  127  PPKKVKRNKYaiaaaflaslasillGYDIGVMSGAAIYIQKDLKINDTQVEILLGILNLY  306
            P K +KRNKYA+A + LAS+ S+LLGYD GVMSGA  +IQ+DL I D QVE+L+G +N+Y
Sbjct  33   PKKPLKRNKYALAISILASMTSVLLGYDCGVMSGATQFIQEDLIITDVQVELLVGTINIY  92

Query  307  SLIGSCMAGRTSDWIGRRYTMVVASVVFFVGAILMGFSTNYTFLMVGRFVAGIGVGYALM  486
            SL+GS +AGRTSDW+GRRYT+V AS +FF+GAILMGF+TNY FLMVGRFVAGIGVGYALM
Sbjct  93   SLVGSAVAGRTSDWVGRRYTIVFASTIFFLGAILMGFATNYAFLMVGRFVAGIGVGYALM  152

Query  487  IAPVYTAEVAPA  522
            IAPVY AEVAPA
Sbjct  153  IAPVYAAEVAPA  164



>ref|XP_008236773.1| PREDICTED: putative polyol transporter 1 [Prunus mume]
 ref|XP_008236774.1| PREDICTED: putative polyol transporter 1 [Prunus mume]
Length=528

 Score =   184 bits (468),  Expect = 6e-52, Method: Compositional matrix adjust.
 Identities = 102/156 (65%), Positives = 120/156 (77%), Gaps = 6/156 (4%)
 Frame = +1

Query  70   MGDTRPVRNAGSGH------IPAFDPPKKVKRNKYaiaaaflaslasillGYDIGVMSGA  231
            M D R   NA SG       I  FDPP+K K NK+AIA A LA   SILLGYDIGVMSGA
Sbjct  1    MADRRVEDNAVSGQLQNDHRIADFDPPQKPKTNKFAIACAILACTTSILLGYDIGVMSGA  60

Query  232  AIYIQKDLKINDTQVEILLGILNLYSLIGSCMAGRTSDWIGRRYTMVVASVVFFVGAILM  411
             I+IQ DLK++DT++ +L G LN+YSLIGS +AGRTSDWIGRRYT+V++ V+FFVGA+LM
Sbjct  61   NIFIQNDLKLSDTEIAVLAGTLNIYSLIGSALAGRTSDWIGRRYTVVLSGVIFFVGALLM  120

Query  412  GFSTNYTFLMVGRFVAGIGVGYALMIAPVYTAEVAP  519
            G +  Y FLM GRFVAGIGVGY LMIAPVYT E++P
Sbjct  121  GLAPGYAFLMFGRFVAGIGVGYGLMIAPVYTVEISP  156



>gb|KCW55335.1| hypothetical protein EUGRSUZ_I01255 [Eucalyptus grandis]
Length=467

 Score =   183 bits (465),  Expect = 6e-52, Method: Compositional matrix adjust.
 Identities = 99/132 (75%), Positives = 114/132 (86%), Gaps = 0/132 (0%)
 Frame = +1

Query  127  PPKKVKRNKYaiaaaflaslasillGYDIGVMSGAAIYIQKDLKINDTQVEILLGILNLY  306
            P K+  RNKYA A A LAS+ SILLGYDIGVMSGAAI I+K L +ND +VE+L+GI+NLY
Sbjct  28   PKKRPPRNKYAFACAILASMTSILLGYDIGVMSGAAIPIKKQLHLNDVEVEVLVGIINLY  87

Query  307  SLIGSCMAGRTSDWIGRRYTMVVASVVFFVGAILMGFSTNYTFLMVGRFVAGIGVGYALM  486
            SL+GS +AGRTSDW+GRRYTMV+A  +FFVGAILM F+ NY FLM GRFVAGIGVGYALM
Sbjct  88   SLLGSAVAGRTSDWVGRRYTMVIAGAIFFVGAILMAFAFNYAFLMFGRFVAGIGVGYALM  147

Query  487  IAPVYTAEVAPA  522
            IAPVYTAEV+PA
Sbjct  148  IAPVYTAEVSPA  159



>ref|XP_009121242.1| PREDICTED: putative polyol transporter 1, partial [Brassica rapa]
Length=247

 Score =   177 bits (450),  Expect = 7e-52, Method: Compositional matrix adjust.
 Identities = 96/139 (69%), Positives = 118/139 (85%), Gaps = 0/139 (0%)
 Frame = +1

Query  106  GHIPAFDPPKKVKRNKYaiaaaflaslasillGYDIGVMSGAAIYIQKDLKINDTQVEIL  285
            G + A     +  R+++A A A LAS+ SI+LGYDIGVMSGAAI+I++DLK++D Q+EIL
Sbjct  9    GVVTAEAEAPRGNRSRFAFACAILASMTSIILGYDIGVMSGAAIFIKEDLKLSDVQLEIL  68

Query  286  LGILNLYSLIGSCMAGRTSDWIGRRYTMVVASVVFFVGAILMGFSTNYTFLMVGRFVAGI  465
            +GILN+YSL+GS  AGRTSDWIGRRYT+V+A   FF GA+LMGF+TNY F+MVGRFVAGI
Sbjct  69   MGILNIYSLVGSGAAGRTSDWIGRRYTIVLAGAFFFCGALLMGFATNYPFIMVGRFVAGI  128

Query  466  GVGYALMIAPVYTAEVAPA  522
            GVGYA+MIAPVYTAEVAPA
Sbjct  129  GVGYAMMIAPVYTAEVAPA  147



>ref|XP_010497306.1| PREDICTED: putative polyol transporter 1, partial [Camelina sativa]
Length=182

 Score =   175 bits (443),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 84/107 (79%), Positives = 98/107 (92%), Gaps = 0/107 (0%)
 Frame = +1

Query  202  GYDIGVMSGAAIYIQKDLKINDTQVEILLGILNLYSLIGSCMAGRTSDWIGRRYTMVVAS  381
            GYDIGVMSGAAI+I+ DLK++D Q+EIL+GILN+YSLIGS  AGRTSDWIGRRYT+V+A 
Sbjct  7    GYDIGVMSGAAIFIKDDLKLSDVQLEILMGILNIYSLIGSGAAGRTSDWIGRRYTIVLAG  66

Query  382  VVFFVGAILMGFSTNYTFLMVGRFVAGIGVGYALMIAPVYTAEVAPA  522
              FF GA+LMGF+TNY F+MVGRF+AGIGVGYA+MIAPVYTAEVAPA
Sbjct  67   SFFFCGALLMGFATNYPFIMVGRFIAGIGVGYAMMIAPVYTAEVAPA  113



>ref|XP_008345143.1| PREDICTED: polyol transporter 5-like [Malus domestica]
Length=527

 Score =   184 bits (466),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 99/155 (64%), Positives = 123/155 (79%), Gaps = 4/155 (3%)
 Frame = +1

Query  70   MGDTRPVRNAGSGH----IPAFDPPKKVKRNKYaiaaaflaslasillGYDIGVMSGAAI  237
            M D     N  SG     I  FDPP K K  K+A+A A LAS+ SILLGYDIGVMSGA++
Sbjct  1    MADQAADNNVVSGQPQNSIADFDPPTKPKTKKFAVACAVLASMTSILLGYDIGVMSGASL  60

Query  238  YIQKDLKINDTQVEILLGILNLYSLIGSCMAGRTSDWIGRRYTMVVASVVFFVGAILMGF  417
            +I+++L I+D QVE+L G LN+YSLIGS +AG+TSDWIGRRYT+V+A  +FF+GA+LMGF
Sbjct  61   FIKENLNISDVQVEVLNGTLNIYSLIGSALAGKTSDWIGRRYTIVLAGTIFFIGALLMGF  120

Query  418  STNYTFLMVGRFVAGIGVGYALMIAPVYTAEVAPA  522
            + NY FLM GRF+AG+GVGYALMIAPVYTAE++PA
Sbjct  121  APNYAFLMFGRFIAGVGVGYALMIAPVYTAEISPA  155



>ref|XP_007199207.1| hypothetical protein PRUPE_ppa021762mg [Prunus persica]
 gb|EMJ00406.1| hypothetical protein PRUPE_ppa021762mg [Prunus persica]
Length=528

 Score =   184 bits (466),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 97/136 (71%), Positives = 115/136 (85%), Gaps = 0/136 (0%)
 Frame = +1

Query  112  IPAFDPPKKVKRNKYaiaaaflaslasillGYDIGVMSGAAIYIQKDLKINDTQVEILLG  291
            I  FDPP+K KRNK+AIA + LA + SILLGYDIGVMSGA ++IQ DLKIND Q++IL G
Sbjct  20   IADFDPPQKPKRNKFAIACSILACMTSILLGYDIGVMSGANLFIQDDLKINDVQIQILTG  79

Query  292  ILNLYSLIGSCMAGRTSDWIGRRYTMVVASVVFFVGAILMGFSTNYTFLMVGRFVAGIGV  471
             LN+YSL+GS +AGRTSDWIGRRYT+V++  +FFVGAILMG +  Y FLM GRFVAGIGV
Sbjct  80   TLNIYSLVGSGLAGRTSDWIGRRYTVVLSGAIFFVGAILMGVAPGYGFLMFGRFVAGIGV  139

Query  472  GYALMIAPVYTAEVAP  519
            GY LMI+PVYTAE+AP
Sbjct  140  GYGLMISPVYTAEIAP  155



>ref|XP_010690917.1| PREDICTED: polyol transporter 5 isoform X2 [Beta vulgaris subsp. 
vulgaris]
 gb|AAB68029.1| putative sugar transporter; member of major facilitative superfamily; 
integral membrane protein [Beta vulgaris]
Length=545

 Score =   184 bits (466),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 104/152 (68%), Positives = 121/152 (80%), Gaps = 3/152 (2%)
 Frame = +1

Query  70   MGDTRPVRNAGSGHIPAFDPPKKV-KRNKYaiaaaflaslasillGYDIGVMSGAAIYIQ  246
            M D  P     S  I  FDP KK  KRNK+A A A LAS+ S+LLGYDIGVMSGA IY++
Sbjct  9    MSDPPP--TTASKVIADFDPLKKPPKRNKFAFACATLASMTSVLLGYDIGVMSGAIIYLK  66

Query  247  KDLKINDTQVEILLGILNLYSLIGSCMAGRTSDWIGRRYTMVVASVVFFVGAILMGFSTN  426
            +D  I+DTQ+ +L+GILN+Y L GS  AGRTSDWIGRRYT+V+A  +FFVGA+LMGF+TN
Sbjct  67   EDWHISDTQIGVLVGILNIYCLFGSFAAGRTSDWIGRRYTIVLAGAIFFVGALLMGFATN  126

Query  427  YTFLMVGRFVAGIGVGYALMIAPVYTAEVAPA  522
            Y FLMVGRFV GIGVGYALMIAPVYTAEV+PA
Sbjct  127  YAFLMVGRFVTGIGVGYALMIAPVYTAEVSPA  158



>ref|XP_009345073.1| PREDICTED: polyol transporter 5-like [Pyrus x bretschneideri]
Length=491

 Score =   182 bits (463),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 86/107 (80%), Positives = 99/107 (93%), Gaps = 0/107 (0%)
 Frame = +1

Query  202  GYDIGVMSGAAIYIQKDLKINDTQVEILLGILNLYSLIGSCMAGRTSDWIGRRYTMVVAS  381
            GYDIGVMSGA++YI+KDLK+ DTQ+EILLGIL +YSLIGS MAG+TSDW+GRRYT+V++ 
Sbjct  7    GYDIGVMSGASLYIEKDLKVTDTQIEILLGILEIYSLIGSAMAGKTSDWVGRRYTIVISG  66

Query  382  VVFFVGAILMGFSTNYTFLMVGRFVAGIGVGYALMIAPVYTAEVAPA  522
             +FFVGAILMG STNYTFLM GRFVAGIGVGYAL IAPVY+AEVAPA
Sbjct  67   AIFFVGAILMGLSTNYTFLMCGRFVAGIGVGYALTIAPVYSAEVAPA  113



>dbj|BAJ85302.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=546

 Score =   184 bits (466),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 99/137 (72%), Positives = 117/137 (85%), Gaps = 0/137 (0%)
 Frame = +1

Query  112  IPAFDPPKKVKRNKYaiaaaflaslasillGYDIGVMSGAAIYIQKDLKINDTQVEILLG  291
            +PA   PKK    ++A A A LAS+ SILLGYDIGVMSGA++YIQKDLKINDTQ+E+L+G
Sbjct  37   LPAAVEPKKKGNVRFAFACAILASMTSILLGYDIGVMSGASLYIQKDLKINDTQLEVLMG  96

Query  292  ILNLYSLIGSCMAGRTSDWIGRRYTMVVASVVFFVGAILMGFSTNYTFLMVGRFVAGIGV  471
            ILN+YSL+GS  AGRTSDWIGRR+T+V A+V+FF GA++MG S NY  LM GRFVAGIGV
Sbjct  97   ILNVYSLVGSFAAGRTSDWIGRRFTIVFAAVIFFAGALIMGLSVNYAMLMFGRFVAGIGV  156

Query  472  GYALMIAPVYTAEVAPA  522
            GYALMIAPVYTAEV+PA
Sbjct  157  GYALMIAPVYTAEVSPA  173



>ref|XP_010028575.1| PREDICTED: polyol transporter 5-like [Eucalyptus grandis]
Length=544

 Score =   183 bits (465),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 99/132 (75%), Positives = 114/132 (86%), Gaps = 0/132 (0%)
 Frame = +1

Query  127  PPKKVKRNKYaiaaaflaslasillGYDIGVMSGAAIYIQKDLKINDTQVEILLGILNLY  306
            P K+  RNKYA A A LAS+ SILLGYDIGVMSGAAI I+K L +ND +VE+L+GI+NLY
Sbjct  28   PKKRPPRNKYAFACAILASMTSILLGYDIGVMSGAAIPIKKQLHLNDVEVEVLVGIINLY  87

Query  307  SLIGSCMAGRTSDWIGRRYTMVVASVVFFVGAILMGFSTNYTFLMVGRFVAGIGVGYALM  486
            SL+GS +AGRTSDW+GRRYTMV+A  +FFVGAILM F+ NY FLM GRFVAGIGVGYALM
Sbjct  88   SLLGSAVAGRTSDWVGRRYTMVIAGAIFFVGAILMAFAFNYAFLMFGRFVAGIGVGYALM  147

Query  487  IAPVYTAEVAPA  522
            IAPVYTAEV+PA
Sbjct  148  IAPVYTAEVSPA  159



>ref|XP_010690916.1| PREDICTED: polyol transporter 5 isoform X1 [Beta vulgaris subsp. 
vulgaris]
 gb|AAB68028.1| putative sugar transporter; member of major facilitative superfamily; 
integral membrane protein [Beta vulgaris]
Length=549

 Score =   184 bits (466),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 104/152 (68%), Positives = 121/152 (80%), Gaps = 3/152 (2%)
 Frame = +1

Query  70   MGDTRPVRNAGSGHIPAFDPPKKV-KRNKYaiaaaflaslasillGYDIGVMSGAAIYIQ  246
            M D  P     S  I  FDP KK  KRNK+A A A LAS+ S+LLGYDIGVMSGA IY++
Sbjct  9    MSDPPP--TTASKVIADFDPLKKPPKRNKFAFACATLASMTSVLLGYDIGVMSGAIIYLK  66

Query  247  KDLKINDTQVEILLGILNLYSLIGSCMAGRTSDWIGRRYTMVVASVVFFVGAILMGFSTN  426
            +D  I+DTQ+ +L+GILN+Y L GS  AGRTSDWIGRRYT+V+A  +FFVGA+LMGF+TN
Sbjct  67   EDWHISDTQIGVLVGILNIYCLFGSFAAGRTSDWIGRRYTIVLAGAIFFVGALLMGFATN  126

Query  427  YTFLMVGRFVAGIGVGYALMIAPVYTAEVAPA  522
            Y FLMVGRFV GIGVGYALMIAPVYTAEV+PA
Sbjct  127  YAFLMVGRFVTGIGVGYALMIAPVYTAEVSPA  158



>ref|XP_010516958.1| PREDICTED: putative polyol transporter 2 [Camelina sativa]
Length=511

 Score =   183 bits (464),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 99/133 (74%), Positives = 117/133 (88%), Gaps = 1/133 (1%)
 Frame = +1

Query  124  DPPKKVKRNKYaiaaaflaslasillGYDIGVMSGAAIYIQKDLKINDTQVEILLGILNL  303
            +PP+   R +YA A A LAS+ SI+LGYDIGVMSGAAI+I+ DLK++D Q+EIL+GILN+
Sbjct  16   EPPRG-NRTQYAFACAILASMTSIILGYDIGVMSGAAIFIKDDLKLSDVQLEILMGILNI  74

Query  304  YSLIGSCMAGRTSDWIGRRYTMVVASVVFFVGAILMGFSTNYTFLMVGRFVAGIGVGYAL  483
            YSLIGS  AGRTSDWIGRRYT+V+A V FF GA+LMGF+TNY F+MVGRFVAGIGVGYA+
Sbjct  75   YSLIGSGAAGRTSDWIGRRYTIVLAGVFFFCGALLMGFATNYPFIMVGRFVAGIGVGYAM  134

Query  484  MIAPVYTAEVAPA  522
            MIAPVYTAEVAPA
Sbjct  135  MIAPVYTAEVAPA  147



>gb|EYU37769.1| hypothetical protein MIMGU_mgv1a005015mg [Erythranthe guttata]
Length=500

 Score =   182 bits (463),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 97/129 (75%), Positives = 111/129 (86%), Gaps = 0/129 (0%)
 Frame = +1

Query  133  KKVKRNKYaiaaaflaslasillGYDIGVMSGAAIYIQKDLKINDTQVEILLGILNLYSL  312
             K K NKYA+A + LAS+ SILLGYDIGVMSGA IYIQKDLKI D Q E+++GILNLYSL
Sbjct  4    SKAKTNKYALACSILASMTSILLGYDIGVMSGAIIYIQKDLKITDVQTEVVMGILNLYSL  63

Query  313  IGSCMAGRTSDWIGRRYTMVVASVVFFVGAILMGFSTNYTFLMVGRFVAGIGVGYALMIA  492
            IGS  AGRTSDWIGRRYT+V A V+FF GA+LMGF+TNY FLM GRFVAG+GVG+A+MIA
Sbjct  64   IGSAAAGRTSDWIGRRYTIVFAGVIFFAGALLMGFATNYAFLMAGRFVAGVGVGFAMMIA  123

Query  493  PVYTAEVAP  519
            PVY AEV+P
Sbjct  124  PVYAAEVSP  132



>ref|XP_007200117.1| hypothetical protein PRUPE_ppa018884mg [Prunus persica]
 gb|EMJ01316.1| hypothetical protein PRUPE_ppa018884mg [Prunus persica]
Length=527

 Score =   183 bits (464),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 101/156 (65%), Positives = 120/156 (77%), Gaps = 6/156 (4%)
 Frame = +1

Query  70   MGDTRPVRNAGSGH------IPAFDPPKKVKRNKYaiaaaflaslasillGYDIGVMSGA  231
            M D R   +A SG       I  FDPP+K K NK+AIA A LA   SILLGYDIGVMSGA
Sbjct  1    MADRRVEESAVSGQLQNDHRIADFDPPQKPKTNKFAIACAILACTTSILLGYDIGVMSGA  60

Query  232  AIYIQKDLKINDTQVEILLGILNLYSLIGSCMAGRTSDWIGRRYTMVVASVVFFVGAILM  411
             I+IQ DLK++DT++ +L G LN+YSLIGS +AGRTSDWIGRRYT+V++ V+FFVGA+LM
Sbjct  61   NIFIQNDLKLSDTEIAVLAGTLNIYSLIGSALAGRTSDWIGRRYTVVLSGVIFFVGALLM  120

Query  412  GFSTNYTFLMVGRFVAGIGVGYALMIAPVYTAEVAP  519
            G +  Y FLM GRFVAGIGVGY LMIAPVYT E++P
Sbjct  121  GLAPGYAFLMFGRFVAGIGVGYGLMIAPVYTVEISP  156



>emb|CDP17996.1| unnamed protein product [Coffea canephora]
Length=525

 Score =   183 bits (464),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 94/148 (64%), Positives = 117/148 (79%), Gaps = 0/148 (0%)
 Frame = +1

Query  76   DTRPVRNAGSGHIPAFDPPKKVKRNKYaiaaaflaslasillGYDIGVMSGAAIYIQKDL  255
             +R V        P F PP K  +NKYA+A A LA ++S+LLGYD GVMSG  IYIQ+DL
Sbjct  5    QSRAVTRGVESSNPDFGPPPKATKNKYALACALLACMSSVLLGYDTGVMSGGMIYIQRDL  64

Query  256  KINDTQVEILLGILNLYSLIGSCMAGRTSDWIGRRYTMVVASVVFFVGAILMGFSTNYTF  435
            KI+D Q E+L+G +N+YSL+GS +AGRT DW+GRRYT+ +A V+FFVGA LM F+TNY F
Sbjct  65   KISDVQKEVLVGTINVYSLLGSAIAGRTCDWVGRRYTIAMAGVIFFVGAFLMAFATNYAF  124

Query  436  LMVGRFVAGIGVGYALMIAPVYTAEVAP  519
            LMVGRFVAGIGVGYA+MIAPVY+AE++P
Sbjct  125  LMVGRFVAGIGVGYAMMIAPVYSAEISP  152



>ref|XP_010507195.1| PREDICTED: polyol transporter 5 [Camelina sativa]
Length=534

 Score =   183 bits (464),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 99/132 (75%), Positives = 112/132 (85%), Gaps = 0/132 (0%)
 Frame = +1

Query  127  PPKKVKRNKYaiaaaflaslasillGYDIGVMSGAAIYIQKDLKINDTQVEILLGILNLY  306
            P K  K+N+YA A A LAS+ SILLGYDIGVMSGA IYI++DLKI DTQ+ IL G LN+Y
Sbjct  27   PAKPPKKNRYAFACAILASMTSILLGYDIGVMSGAMIYIKRDLKITDTQIGILAGSLNIY  86

Query  307  SLIGSCMAGRTSDWIGRRYTMVVASVVFFVGAILMGFSTNYTFLMVGRFVAGIGVGYALM  486
            SLIGSC AG+TSDWIGRRYT+V+A  +FF GAILMG + NY FLM GRF+AGIGVGYALM
Sbjct  87   SLIGSCAAGKTSDWIGRRYTIVLAGAIFFAGAILMGLAPNYAFLMFGRFIAGIGVGYALM  146

Query  487  IAPVYTAEVAPA  522
            IAPVYTAEVAPA
Sbjct  147  IAPVYTAEVAPA  158



>ref|XP_009345072.1| PREDICTED: putative polyol transporter 1 [Pyrus x bretschneideri]
Length=523

 Score =   182 bits (463),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 95/137 (69%), Positives = 119/137 (87%), Gaps = 0/137 (0%)
 Frame = +1

Query  112  IPAFDPPKKVKRNKYaiaaaflaslasillGYDIGVMSGAAIYIQKDLKINDTQVEILLG  291
            I  FD PKK K +K+AIA A LA   SILLG+DIGVMSGA+++I+++LKI+D QVE+L G
Sbjct  20   IEDFDHPKKPKTSKFAIACALLACTTSILLGFDIGVMSGASLFIKENLKISDVQVEVLAG  79

Query  292  ILNLYSLIGSCMAGRTSDWIGRRYTMVVASVVFFVGAILMGFSTNYTFLMVGRFVAGIGV  471
             LN+YSL+GS +AGRTSDWIGR+YT+V+A V+F VGA+LMGF+TNY FLMVGRFVAG+GV
Sbjct  80   TLNIYSLLGSALAGRTSDWIGRKYTIVLAGVIFLVGALLMGFATNYAFLMVGRFVAGVGV  139

Query  472  GYALMIAPVYTAEVAPA  522
            GY +MIAPVYTAE++PA
Sbjct  140  GYGMMIAPVYTAEISPA  156



>gb|KHG12832.1| Polyol transporter 5 -like protein [Gossypium arboreum]
Length=169

 Score =   173 bits (438),  Expect = 4e-51, Method: Compositional matrix adjust.
 Identities = 94/154 (61%), Positives = 120/154 (78%), Gaps = 12/154 (8%)
 Frame = +1

Query  97   AGSGH------------IPAFDPPKKVKRNKYaiaaaflaslasillGYDIGVMSGAAIY  240
            AGSGH            +  F+  KK K+NK+A+  A LASL S+LLGYDIGVMSGA I+
Sbjct  2    AGSGHENGAISIRPADNLAVFEVSKKPKKNKFALGCAMLASLTSMLLGYDIGVMSGAIIF  61

Query  241  IQKDLKINDTQVEILLGILNLYSLIGSCMAGRTSDWIGRRYTMVVASVVFFVGAILMGFS  420
            I+KDLKIND Q+EIL+G+LNLY L+GS +AG  +DWIGRRYT+V+A+V+ FVG++ MGFS
Sbjct  62   IKKDLKINDVQIEILVGVLNLYCLVGSIIAGNIADWIGRRYTIVLANVIIFVGSLFMGFS  121

Query  421  TNYTFLMVGRFVAGIGVGYALMIAPVYTAEVAPA  522
             NY FLMVGRF+AGIGVG+A+M A +Y AE++PA
Sbjct  122  VNYAFLMVGRFIAGIGVGFAIMGAILYNAEISPA  155



>ref|XP_009396401.1| PREDICTED: polyol transporter 5-like [Musa acuminata subsp. malaccensis]
Length=513

 Score =   182 bits (462),  Expect = 4e-51, Method: Compositional matrix adjust.
 Identities = 102/131 (78%), Positives = 114/131 (87%), Gaps = 0/131 (0%)
 Frame = +1

Query  130  PKKVKRNKYaiaaaflaslasillGYDIGVMSGAAIYIQKDLKINDTQVEILLGILNLYS  309
            P K K  ++A A A LAS+ SILLGYDIGVMSGAAI+I+ DLKI+DTQVEILLGILNLYS
Sbjct  17   PAKRKSKRFAFACAMLASMTSILLGYDIGVMSGAAIFIKDDLKISDTQVEILLGILNLYS  76

Query  310  LIGSCMAGRTSDWIGRRYTMVVASVVFFVGAILMGFSTNYTFLMVGRFVAGIGVGYALMI  489
            L+GS  AG TSDWIGRRYT+V A+ +FFVGA+LMGF+ NY FLM GRFVAGIGVGYALMI
Sbjct  77   LVGSYAAGFTSDWIGRRYTIVFAAGIFFVGALLMGFAVNYAFLMFGRFVAGIGVGYALMI  136

Query  490  APVYTAEVAPA  522
            APVYTAEVAPA
Sbjct  137  APVYTAEVAPA  147



>ref|XP_006409469.1| hypothetical protein EUTSA_v10023129mg [Eutrema salsugineum]
 gb|ESQ50922.1| hypothetical protein EUTSA_v10023129mg [Eutrema salsugineum]
Length=511

 Score =   182 bits (462),  Expect = 4e-51, Method: Compositional matrix adjust.
 Identities = 98/133 (74%), Positives = 117/133 (88%), Gaps = 1/133 (1%)
 Frame = +1

Query  124  DPPKKVKRNKYaiaaaflaslasillGYDIGVMSGAAIYIQKDLKINDTQVEILLGILNL  303
            +PP+   R+++A A A LAS+ SI+LGYDIGVMSGAAI+I+ DLK++D Q EIL+GILN+
Sbjct  16   EPPRG-NRSRFAFACAILASMTSIILGYDIGVMSGAAIFIKDDLKLSDVQFEILMGILNI  74

Query  304  YSLIGSCMAGRTSDWIGRRYTMVVASVVFFVGAILMGFSTNYTFLMVGRFVAGIGVGYAL  483
            YSLIGS MAGRTSDWIGRRYT+V+A   FF GA+LMGF+TNY F+MVGRFVAGIGVGYA+
Sbjct  75   YSLIGSGMAGRTSDWIGRRYTIVLAGAFFFCGALLMGFATNYPFIMVGRFVAGIGVGYAM  134

Query  484  MIAPVYTAEVAPA  522
            MIAPVYTAEVAPA
Sbjct  135  MIAPVYTAEVAPA  147



>ref|XP_007200033.1| hypothetical protein PRUPE_ppa024323mg [Prunus persica]
 gb|EMJ01232.1| hypothetical protein PRUPE_ppa024323mg [Prunus persica]
Length=534

 Score =   182 bits (463),  Expect = 4e-51, Method: Compositional matrix adjust.
 Identities = 101/156 (65%), Positives = 120/156 (77%), Gaps = 6/156 (4%)
 Frame = +1

Query  70   MGDTRPVRNAGSGH------IPAFDPPKKVKRNKYaiaaaflaslasillGYDIGVMSGA  231
            M D R   +A SG       I  FDPP+K K NK+AIA A LA   SILLGYDIGVMSGA
Sbjct  1    MADRRVEDSAVSGQLQNDHRIADFDPPQKPKTNKFAIACAILACTTSILLGYDIGVMSGA  60

Query  232  AIYIQKDLKINDTQVEILLGILNLYSLIGSCMAGRTSDWIGRRYTMVVASVVFFVGAILM  411
             I+IQ DLK++DT++ +L G LN+YSLIGS +AGRTSDWIGRRYT+V++ V+FFVGA+LM
Sbjct  61   NIFIQNDLKLSDTEIAVLAGTLNIYSLIGSALAGRTSDWIGRRYTVVLSGVIFFVGALLM  120

Query  412  GFSTNYTFLMVGRFVAGIGVGYALMIAPVYTAEVAP  519
            G +  Y FLM GRFVAGIGVGY LMIAPVYT E++P
Sbjct  121  GLAPGYAFLMFGRFVAGIGVGYGLMIAPVYTVEISP  156



>gb|KHN25431.1| Polyol transporter 5 [Glycine soja]
Length=518

 Score =   182 bits (462),  Expect = 4e-51, Method: Compositional matrix adjust.
 Identities = 94/133 (71%), Positives = 116/133 (87%), Gaps = 0/133 (0%)
 Frame = +1

Query  124  DPPKKVKRNKYaiaaaflaslasillGYDIGVMSGAAIYIQKDLKINDTQVEILLGILNL  303
            +P KK +RNKYA A A LAS+ SILLGYDIGVMSGAA+YIQ+DLK++D Q+EIL GI+NL
Sbjct  14   NPEKKPRRNKYAFACAILASMTSILLGYDIGVMSGAALYIQRDLKVSDVQIEILNGIINL  73

Query  304  YSLIGSCMAGRTSDWIGRRYTMVVASVVFFVGAILMGFSTNYTFLMVGRFVAGIGVGYAL  483
            YS +GS +AGRTSDWIGRRYT+V+A  +FFVGAILMGFS NY FLM GRF AG+G+G+A 
Sbjct  74   YSPVGSFIAGRTSDWIGRRYTIVLAGAIFFVGAILMGFSPNYAFLMFGRFFAGVGIGFAF  133

Query  484  MIAPVYTAEVAPA  522
            +IAPVYT+E++P+
Sbjct  134  LIAPVYTSEISPS  146



>ref|XP_003607077.1| Sorbitol-like transporter [Medicago truncatula]
 gb|AES89274.1| polyol/monosaccharide transporter 1 [Medicago truncatula]
Length=520

 Score =   182 bits (462),  Expect = 5e-51, Method: Compositional matrix adjust.
 Identities = 95/133 (71%), Positives = 115/133 (86%), Gaps = 0/133 (0%)
 Frame = +1

Query  121  FDPPKKVKRNKYaiaaaflaslasillGYDIGVMSGAAIYIQKDLKINDTQVEILLGILN  300
            F P KK+KRNK+A A A LAS+ SILLGYDIGVMSGAAIYI++DLK+ D Q+EILLGI+N
Sbjct  15   FGPQKKLKRNKFACACAILASMTSILLGYDIGVMSGAAIYIKRDLKVTDVQIEILLGIIN  74

Query  301  LYSLIGSCMAGRTSDWIGRRYTMVVASVVFFVGAILMGFSTNYTFLMVGRFVAGIGVGYA  480
            LYS IGS +AGR SDWIGRRYT+V+A ++FFVGA+LMG S NY FLM GRF AG+G+G+A
Sbjct  75   LYSPIGSYIAGRLSDWIGRRYTIVLAGLIFFVGAVLMGLSPNYAFLMFGRFFAGVGIGFA  134

Query  481  LMIAPVYTAEVAP  519
             +IAPVYT+EV+P
Sbjct  135  FLIAPVYTSEVSP  147



>ref|XP_011088358.1| PREDICTED: polyol transporter 5-like [Sesamum indicum]
Length=532

 Score =   182 bits (462),  Expect = 5e-51, Method: Compositional matrix adjust.
 Identities = 105/156 (67%), Positives = 123/156 (79%), Gaps = 8/156 (5%)
 Frame = +1

Query  70   MGDTRPVRNAGSGH-----IPAFDPPKKVKRNKYaiaaaflaslasillGYDIGVMSGAA  234
            M D    RN  S       IPAFDPP+K KRNKYA+A +FLAS+ SILLGYDIGVMSGA 
Sbjct  1    MADGMSARNGVSSAPSHLPIPAFDPPRKPKRNKYALACSFLASMTSILLGYDIGVMSGAI  60

Query  235  IYIQKDLKINDTQVEILLGILNLYSLIGSCMAGRTSDWIGRRYTMVVASVVFFVGAILMG  414
            IYI+K++ + D Q E+++GILNLYSL+GS  AGRTSD    RYT++ A  +FF GA+LMG
Sbjct  61   IYIRKNIHMTDVQKEVIMGILNLYSLLGSAAAGRTSDC---RYTIIFAGAIFFAGALLMG  117

Query  415  FSTNYTFLMVGRFVAGIGVGYALMIAPVYTAEVAPA  522
            F+T+Y FLMVGRFVAGIGVGYALMIAPVYTAEVAPA
Sbjct  118  FATSYAFLMVGRFVAGIGVGYALMIAPVYTAEVAPA  153



>dbj|BAM66295.1| sorbitol transporter, partial [Pyrus pyrifolia]
Length=454

 Score =   181 bits (458),  Expect = 5e-51, Method: Compositional matrix adjust.
 Identities = 87/106 (82%), Positives = 98/106 (92%), Gaps = 0/106 (0%)
 Frame = +1

Query  205  YDIGVMSGAAIYIQKDLKINDTQVEILLGILNLYSLIGSCMAGRTSDWIGRRYTMVVASV  384
            YDIGVMSGAAIYI+ DLKI+D +VE+LLGILNLYSLIGS  AGRTSDW+GRRYT+V+A  
Sbjct  1    YDIGVMSGAAIYIKDDLKISDVEVEVLLGILNLYSLIGSAAAGRTSDWVGRRYTIVLAGA  60

Query  385  VFFVGAILMGFSTNYTFLMVGRFVAGIGVGYALMIAPVYTAEVAPA  522
            +FFVGA+LMGF+TNY FLM GRFVAGIGVGYALMIAPVYTAEV+PA
Sbjct  61   IFFVGALLMGFATNYAFLMFGRFVAGIGVGYALMIAPVYTAEVSPA  106



>ref|XP_007200254.1| hypothetical protein PRUPE_ppa015090mg [Prunus persica]
 ref|XP_007200263.1| hypothetical protein PRUPE_ppa014975mg [Prunus persica]
 gb|EMJ01453.1| hypothetical protein PRUPE_ppa015090mg [Prunus persica]
 gb|EMJ01462.1| hypothetical protein PRUPE_ppa014975mg [Prunus persica]
Length=527

 Score =   182 bits (462),  Expect = 5e-51, Method: Compositional matrix adjust.
 Identities = 101/156 (65%), Positives = 120/156 (77%), Gaps = 6/156 (4%)
 Frame = +1

Query  70   MGDTRPVRNAGSGH------IPAFDPPKKVKRNKYaiaaaflaslasillGYDIGVMSGA  231
            M D R   +A SG       I  FDPP+K K NK+AIA A LA   SILLGYDIGVMSGA
Sbjct  1    MADRRVEDSAVSGQLQNDHRIADFDPPQKPKTNKFAIACAILACTTSILLGYDIGVMSGA  60

Query  232  AIYIQKDLKINDTQVEILLGILNLYSLIGSCMAGRTSDWIGRRYTMVVASVVFFVGAILM  411
             I+IQ DLK++DT++ +L G LN+YSLIGS +AGRTSDWIGRRYT+V++ V+FFVGA+LM
Sbjct  61   NIFIQNDLKLSDTEIAVLAGTLNIYSLIGSALAGRTSDWIGRRYTVVLSGVIFFVGALLM  120

Query  412  GFSTNYTFLMVGRFVAGIGVGYALMIAPVYTAEVAP  519
            G +  Y FLM GRFVAGIGVGY LMIAPVYT E++P
Sbjct  121  GLAPGYAFLMFGRFVAGIGVGYGLMIAPVYTVEISP  156



>ref|XP_003540961.2| PREDICTED: polyol transporter 5-like [Glycine max]
Length=531

 Score =   182 bits (462),  Expect = 5e-51, Method: Compositional matrix adjust.
 Identities = 94/133 (71%), Positives = 116/133 (87%), Gaps = 0/133 (0%)
 Frame = +1

Query  124  DPPKKVKRNKYaiaaaflaslasillGYDIGVMSGAAIYIQKDLKINDTQVEILLGILNL  303
            +P KK +RNKYA A A LAS+ SILLGYDIGVMSGAA+YIQ+DLK++D Q+EIL GI+NL
Sbjct  27   NPEKKPRRNKYAFACAILASMTSILLGYDIGVMSGAALYIQRDLKVSDVQIEILNGIINL  86

Query  304  YSLIGSCMAGRTSDWIGRRYTMVVASVVFFVGAILMGFSTNYTFLMVGRFVAGIGVGYAL  483
            YS +GS +AGRTSDWIGRRYT+V+A  +FFVGAILMGFS NY FLM GRF AG+G+G+A 
Sbjct  87   YSPVGSFIAGRTSDWIGRRYTIVLAGAIFFVGAILMGFSPNYAFLMFGRFFAGVGIGFAF  146

Query  484  MIAPVYTAEVAPA  522
            +IAPVYT+E++P+
Sbjct  147  LIAPVYTSEISPS  159



>ref|XP_008775333.1| PREDICTED: polyol transporter 5-like [Phoenix dactylifera]
Length=528

 Score =   182 bits (462),  Expect = 5e-51, Method: Compositional matrix adjust.
 Identities = 103/154 (67%), Positives = 124/154 (81%), Gaps = 4/154 (3%)
 Frame = +1

Query  70   MGDTRPVRNAGSGHIP----AFDPPKKVKRNKYaiaaaflaslasillGYDIGVMSGAAI  237
            M D +P   A S   P    A + PKK  RNKYA+A A LAS+ SIL GYD+ VMSGA++
Sbjct  1    MDDQKPRAPAISDPPPNQTLALEKPKKPPRNKYALACATLASMTSILSGYDVAVMSGASV  60

Query  238  YIQKDLKINDTQVEILLGILNLYSLIGSCMAGRTSDWIGRRYTMVVASVVFFVGAILMGF  417
            +IQKDL+INDTQ+EIL GI+N++SL+GS  AGRTSDWIGRRYT++ A+ +FF GA+LMG 
Sbjct  61   FIQKDLEINDTQIEILAGIINIFSLVGSVAAGRTSDWIGRRYTIIFAAAIFFAGALLMGL  120

Query  418  STNYTFLMVGRFVAGIGVGYALMIAPVYTAEVAP  519
            +TNY FLMVGRFVAG+GVGYALMIAPVYTAEVAP
Sbjct  121  ATNYAFLMVGRFVAGVGVGYALMIAPVYTAEVAP  154



>gb|KFK41272.1| hypothetical protein AALP_AA2G108500 [Arabis alpina]
Length=444

 Score =   180 bits (457),  Expect = 6e-51, Method: Compositional matrix adjust.
 Identities = 96/133 (72%), Positives = 117/133 (88%), Gaps = 1/133 (1%)
 Frame = +1

Query  124  DPPKKVKRNKYaiaaaflaslasillGYDIGVMSGAAIYIQKDLKINDTQVEILLGILNL  303
            +PP+   R+++A A A LAS+ SI+LGYDIGVMSGAAI+I+ DLK++D Q+EIL+GILN+
Sbjct  16   EPPRG-NRSRFAFACAILASMTSIILGYDIGVMSGAAIFIKDDLKLSDVQLEILMGILNI  74

Query  304  YSLIGSCMAGRTSDWIGRRYTMVVASVVFFVGAILMGFSTNYTFLMVGRFVAGIGVGYAL  483
            YSL+GS  AGRTSDWIGRRYT+V+A   FF GA+LMGF+TNY F+MVGRFVAGIGVGYA+
Sbjct  75   YSLVGSGAAGRTSDWIGRRYTIVLAGAFFFCGALLMGFATNYPFIMVGRFVAGIGVGYAM  134

Query  484  MIAPVYTAEVAPA  522
            MIAPVYTAEVAPA
Sbjct  135  MIAPVYTAEVAPA  147



>ref|XP_010468639.1| PREDICTED: putative polyol transporter 2 [Camelina sativa]
Length=511

 Score =   181 bits (460),  Expect = 7e-51, Method: Compositional matrix adjust.
 Identities = 98/133 (74%), Positives = 117/133 (88%), Gaps = 1/133 (1%)
 Frame = +1

Query  124  DPPKKVKRNKYaiaaaflaslasillGYDIGVMSGAAIYIQKDLKINDTQVEILLGILNL  303
            +PP+   R++YA A A LAS+ SI+LGYDIGVMSGAAI+I+ DLK++D Q+EIL+GILN+
Sbjct  16   EPPRG-NRSQYAFACAILASMTSIILGYDIGVMSGAAIFIKDDLKLSDVQLEILMGILNI  74

Query  304  YSLIGSCMAGRTSDWIGRRYTMVVASVVFFVGAILMGFSTNYTFLMVGRFVAGIGVGYAL  483
            YSLIGS  AGRTSDWIGRRYT+V+A   FF GA+LMGF+TNY F+MVGRFVAGIGVGYA+
Sbjct  75   YSLIGSGAAGRTSDWIGRRYTIVLAGAFFFCGALLMGFATNYPFIMVGRFVAGIGVGYAM  134

Query  484  MIAPVYTAEVAPA  522
            MIAPVYTAEVAPA
Sbjct  135  MIAPVYTAEVAPA  147



>ref|XP_006299557.1| hypothetical protein CARUB_v10015731mg [Capsella rubella]
 gb|EOA32455.1| hypothetical protein CARUB_v10015731mg [Capsella rubella]
Length=511

 Score =   181 bits (460),  Expect = 7e-51, Method: Compositional matrix adjust.
 Identities = 98/140 (70%), Positives = 118/140 (84%), Gaps = 0/140 (0%)
 Frame = +1

Query  103  SGHIPAFDPPKKVKRNKYaiaaaflaslasillGYDIGVMSGAAIYIQKDLKINDTQVEI  282
             G + A   P +  R++YA A A LAS+ SI+LGYDIGVMSGAAI+I+ DLK++D Q+EI
Sbjct  8    QGVVVAVPEPPRGNRSRYAFACAILASMTSIILGYDIGVMSGAAIFIKDDLKLSDVQLEI  67

Query  283  LLGILNLYSLIGSCMAGRTSDWIGRRYTMVVASVVFFVGAILMGFSTNYTFLMVGRFVAG  462
            L+GILN+YSLIGS  AGRTSDW+GRRYT+V+A   FF GA+LMGF+TNY F+MVGRFVAG
Sbjct  68   LMGILNIYSLIGSGAAGRTSDWLGRRYTIVLAGAFFFCGALLMGFATNYPFIMVGRFVAG  127

Query  463  IGVGYALMIAPVYTAEVAPA  522
            IGVGYA+MIAPVYTAEVAPA
Sbjct  128  IGVGYAMMIAPVYTAEVAPA  147



>ref|XP_002467638.1| hypothetical protein SORBIDRAFT_01g031360 [Sorghum bicolor]
 gb|EER94636.1| hypothetical protein SORBIDRAFT_01g031360 [Sorghum bicolor]
Length=535

 Score =   182 bits (461),  Expect = 8e-51, Method: Compositional matrix adjust.
 Identities = 100/147 (68%), Positives = 120/147 (82%), Gaps = 1/147 (1%)
 Frame = +1

Query  85   PVRNAGSGHIP-AFDPPKKVKRNKYaiaaaflaslasillGYDIGVMSGAAIYIQKDLKI  261
            P   A S  +P    PP+K    ++A A A LAS+ SILLGYDIGVMSGAA++I++DLKI
Sbjct  8    PTNRAASDGLPDGVAPPRKKTNVRFAFACAILASMTSILLGYDIGVMSGAALFIKEDLKI  67

Query  262  NDTQVEILLGILNLYSLIGSCMAGRTSDWIGRRYTMVVASVVFFVGAILMGFSTNYTFLM  441
            +D +VE+LLGILNLYSL+GS  AGRTSDWIGRR T+++A+V+FFVGA +MGFS NY  LM
Sbjct  68   SDVEVEVLLGILNLYSLLGSFAAGRTSDWIGRRLTIILAAVIFFVGAFMMGFSVNYPMLM  127

Query  442  VGRFVAGIGVGYALMIAPVYTAEVAPA  522
             GRFVAGIGVGYALMIAPVYTAEV+PA
Sbjct  128  AGRFVAGIGVGYALMIAPVYTAEVSPA  154



>ref|XP_008447049.1| PREDICTED: polyol transporter 5 [Cucumis melo]
Length=516

 Score =   181 bits (460),  Expect = 8e-51, Method: Compositional matrix adjust.
 Identities = 95/126 (75%), Positives = 113/126 (90%), Gaps = 0/126 (0%)
 Frame = +1

Query  145  RNKYaiaaaflaslasillGYDIGVMSGAAIYIQKDLKINDTQVEILLGILNLYSLIGSC  324
            RNKYA   A LAS+ASILLGYD+GVMSGAAIYI+KD +I D Q E+++G++NLY+LIG+ 
Sbjct  19   RNKYAFMCAILASMASILLGYDVGVMSGAAIYIKKDFEITDVQEEVMIGVINLYALIGAA  78

Query  325  MAGRTSDWIGRRYTMVVASVVFFVGAILMGFSTNYTFLMVGRFVAGIGVGYALMIAPVYT  504
             AGRTSDWIGRRYTMV+A V+FF+GA+LMGF+TNY FLM GRFVAGIGVGYALMI+PVYT
Sbjct  79   AAGRTSDWIGRRYTMVLAGVIFFLGAVLMGFATNYGFLMFGRFVAGIGVGYALMISPVYT  138

Query  505  AEVAPA  522
            AEV+PA
Sbjct  139  AEVSPA  144



>gb|KDP46229.1| hypothetical protein JCGZ_10069 [Jatropha curcas]
Length=514

 Score =   181 bits (459),  Expect = 9e-51, Method: Compositional matrix adjust.
 Identities = 87/107 (81%), Positives = 98/107 (92%), Gaps = 0/107 (0%)
 Frame = +1

Query  202  GYDIGVMSGAAIYIQKDLKINDTQVEILLGILNLYSLIGSCMAGRTSDWIGRRYTMVVAS  381
            GYDIGVMSGAAIYI+ DLKI+D QVE+L+G LN+YSL+GS  AGRTSDWIGRRYT+VVA 
Sbjct  27   GYDIGVMSGAAIYIKDDLKISDLQVEVLVGTLNIYSLVGSAAAGRTSDWIGRRYTIVVAG  86

Query  382  VVFFVGAILMGFSTNYTFLMVGRFVAGIGVGYALMIAPVYTAEVAPA  522
             +FFVGA+LMGF+T Y FLMVGRFVAGIGVGYALMIAPVYTAEV+PA
Sbjct  87   AIFFVGALLMGFATTYAFLMVGRFVAGIGVGYALMIAPVYTAEVSPA  133



>ref|XP_006384498.1| hypothetical protein POPTR_0004s15900g [Populus trichocarpa]
 gb|ERP62295.1| hypothetical protein POPTR_0004s15900g [Populus trichocarpa]
Length=503

 Score =   181 bits (459),  Expect = 9e-51, Method: Compositional matrix adjust.
 Identities = 103/149 (69%), Positives = 117/149 (79%), Gaps = 0/149 (0%)
 Frame = +1

Query  76   DTRPVRNAGSGHIPAFDPPKKVKRNKYaiaaaflaslasillGYDIGVMSGAAIYIQKDL  255
            D  P +      +  FDP KK K NK+A A A LAS+ASILLGYDIGVMSGA  YI+ DL
Sbjct  10   DVNPSQPTTEKTLADFDPVKKPKGNKFAFACAILASMASILLGYDIGVMSGAKDYIKIDL  69

Query  256  KINDTQVEILLGILNLYSLIGSCMAGRTSDWIGRRYTMVVASVVFFVGAILMGFSTNYTF  435
            K++DTQV +L+G LN YSL+GS  AG TSDWIGRRYT+VVA  VFF GA+LMGFSTNY F
Sbjct  70   KLSDTQVGLLVGTLNWYSLVGSAAAGVTSDWIGRRYTIVVAGAVFFAGALLMGFSTNYAF  129

Query  436  LMVGRFVAGIGVGYALMIAPVYTAEVAPA  522
            LMV RFV GIGVG+ALMIAPVYTAEV+PA
Sbjct  130  LMVARFVTGIGVGFALMIAPVYTAEVSPA  158



>ref|XP_010527594.1| PREDICTED: polyol transporter 5-like isoform X4 [Tarenaya hassleriana]
Length=526

 Score =   181 bits (460),  Expect = 9e-51, Method: Compositional matrix adjust.
 Identities = 94/132 (71%), Positives = 113/132 (86%), Gaps = 0/132 (0%)
 Frame = +1

Query  127  PPKKVKRNKYaiaaaflaslasillGYDIGVMSGAAIYIQKDLKINDTQVEILLGILNLY  306
            PP+K KRNK+A   A L S+  ILLGYDIGVMSGA IYI++DLKI+D Q+EIL+GILN+Y
Sbjct  17   PPEKPKRNKFAFVCAILVSMTLILLGYDIGVMSGAIIYIKRDLKISDGQIEILVGILNIY  76

Query  307  SLIGSCMAGRTSDWIGRRYTMVVASVVFFVGAILMGFSTNYTFLMVGRFVAGIGVGYALM  486
            S++G+C AGRTSD IGRRYT+V+A  +FF GAILMGF+TNY FLM GRFVAG GVG+A M
Sbjct  77   SVVGACFAGRTSDLIGRRYTIVLAGGIFFAGAILMGFATNYAFLMFGRFVAGFGVGFAGM  136

Query  487  IAPVYTAEVAPA  522
            IAPVYTAE++PA
Sbjct  137  IAPVYTAEISPA  148



>ref|XP_004148312.1| PREDICTED: polyol transporter 5-like [Cucumis sativus]
Length=492

 Score =   181 bits (458),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 83/107 (78%), Positives = 99/107 (93%), Gaps = 0/107 (0%)
 Frame = +1

Query  202  GYDIGVMSGAAIYIQKDLKINDTQVEILLGILNLYSLIGSCMAGRTSDWIGRRYTMVVAS  381
            GYD+GVMSGAAIYI+KD +IND Q E+++G++NLY+LIG+  AGRTSDWIGRRYTMV+A 
Sbjct  14   GYDVGVMSGAAIYIKKDFQINDVQEEVMIGVINLYALIGAAAAGRTSDWIGRRYTMVLAG  73

Query  382  VVFFVGAILMGFSTNYTFLMVGRFVAGIGVGYALMIAPVYTAEVAPA  522
            V+FF+GAILMGF+TNY FLM GRFVAGIGVGYALMI+PVYTAEV+PA
Sbjct  74   VIFFLGAILMGFATNYEFLMFGRFVAGIGVGYALMISPVYTAEVSPA  120



>ref|XP_010442448.1| PREDICTED: putative polyol transporter 2 [Camelina sativa]
Length=511

 Score =   181 bits (459),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 97/133 (73%), Positives = 118/133 (89%), Gaps = 1/133 (1%)
 Frame = +1

Query  124  DPPKKVKRNKYaiaaaflaslasillGYDIGVMSGAAIYIQKDLKINDTQVEILLGILNL  303
            +PP+   RN++A A A LAS+ SI+LGYDIGV+SGAAI+I+ DLK++D Q+EIL+GILN+
Sbjct  16   EPPRG-NRNRFAFACAILASMTSIILGYDIGVISGAAIFIKDDLKLSDVQLEILMGILNI  74

Query  304  YSLIGSCMAGRTSDWIGRRYTMVVASVVFFVGAILMGFSTNYTFLMVGRFVAGIGVGYAL  483
            YS+IGS +AGRTSDWIGRRYT+V+A   FF GAILMGF+TNY F+MVGRFVAGIGVGYA+
Sbjct  75   YSIIGSGVAGRTSDWIGRRYTIVLAGAFFFCGAILMGFATNYPFIMVGRFVAGIGVGYAM  134

Query  484  MIAPVYTAEVAPA  522
            MIAPVYTAEVAPA
Sbjct  135  MIAPVYTAEVAPA  147



>emb|CDP18000.1| unnamed protein product [Coffea canephora]
Length=507

 Score =   181 bits (458),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 95/135 (70%), Positives = 113/135 (84%), Gaps = 0/135 (0%)
 Frame = +1

Query  115  PAFDPPKKVKRNKYaiaaaflaslasillGYDIGVMSGAAIYIQKDLKINDTQVEILLGI  294
            P   PP K KRNKYA+A A LA ++S+LLGYD GVMSGA IYIQ+DLKIND Q EIL+G 
Sbjct  18   PDSVPPPKPKRNKYALACALLACMSSVLLGYDTGVMSGAMIYIQRDLKINDVQKEILVGT  77

Query  295  LNLYSLIGSCMAGRTSDWIGRRYTMVVASVVFFVGAILMGFSTNYTFLMVGRFVAGIGVG  474
            +N+YSL+GS +AGRT DWIGRRYT+ +A V+FF GAILM  +TNY FLM GRFVAG+GVG
Sbjct  78   INVYSLLGSAIAGRTCDWIGRRYTIAMAGVIFFAGAILMACATNYAFLMFGRFVAGLGVG  137

Query  475  YALMIAPVYTAEVAP  519
            YALMIAPVY+AE++P
Sbjct  138  YALMIAPVYSAEISP  152



>ref|XP_010465998.1| PREDICTED: polyol transporter 5-like [Camelina sativa]
Length=534

 Score =   181 bits (459),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 100/140 (71%), Positives = 115/140 (82%), Gaps = 2/140 (1%)
 Frame = +1

Query  109  HIPAF--DPPKKVKRNKYaiaaaflaslasillGYDIGVMSGAAIYIQKDLKINDTQVEI  282
            H+P+    P K  K+N+YA A A LAS+ SILLGYDIGVMSGA IYI++DL I DTQ+ I
Sbjct  19   HVPSELGVPAKPPKKNRYAFACAILASMTSILLGYDIGVMSGAMIYIKRDLDITDTQIGI  78

Query  283  LLGILNLYSLIGSCMAGRTSDWIGRRYTMVVASVVFFVGAILMGFSTNYTFLMVGRFVAG  462
            L G LN+YSLIGSC AG+TSDWIGRRYT+V+A  +FF GAILMG + NY FLM GRF+AG
Sbjct  79   LAGSLNIYSLIGSCAAGKTSDWIGRRYTIVLAGAIFFAGAILMGLAPNYAFLMFGRFIAG  138

Query  463  IGVGYALMIAPVYTAEVAPA  522
            IGVGYALMIAPVYTAEVAPA
Sbjct  139  IGVGYALMIAPVYTAEVAPA  158



>ref|XP_010484928.1| PREDICTED: putative polyol transporter 1 [Camelina sativa]
Length=512

 Score =   181 bits (458),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 97/137 (71%), Positives = 118/137 (86%), Gaps = 1/137 (1%)
 Frame = +1

Query  112  IPAFDPPKKVKRNKYaiaaaflaslasillGYDIGVMSGAAIYIQKDLKINDTQVEILLG  291
            +   +PP+   R+++A A A LAS+ SI+LGYDIGVMSGAAI+I+ DLK++D Q+EIL+G
Sbjct  12   VTELEPPRG-NRSRFAFACAILASMTSIILGYDIGVMSGAAIFIKDDLKLSDIQLEILMG  70

Query  292  ILNLYSLIGSCMAGRTSDWIGRRYTMVVASVVFFVGAILMGFSTNYTFLMVGRFVAGIGV  471
            ILN+YSLIGS  AGRTSDWIGRRYT+V+A   FF GA+LMGF+TNY F+MVGRFVAGIGV
Sbjct  71   ILNIYSLIGSGAAGRTSDWIGRRYTIVLAGAFFFCGALLMGFATNYPFIMVGRFVAGIGV  130

Query  472  GYALMIAPVYTAEVAPA  522
            GYA+MIAPVYTAEVAPA
Sbjct  131  GYAMMIAPVYTAEVAPA  147



>ref|XP_010527591.1| PREDICTED: polyol transporter 5-like isoform X1 [Tarenaya hassleriana]
Length=537

 Score =   181 bits (459),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 94/132 (71%), Positives = 113/132 (86%), Gaps = 0/132 (0%)
 Frame = +1

Query  127  PPKKVKRNKYaiaaaflaslasillGYDIGVMSGAAIYIQKDLKINDTQVEILLGILNLY  306
            PP+K KRNK+A   A L S+  ILLGYDIGVMSGA IYI++DLKI+D Q+EIL+GILN+Y
Sbjct  17   PPEKPKRNKFAFVCAILVSMTLILLGYDIGVMSGAIIYIKRDLKISDGQIEILVGILNIY  76

Query  307  SLIGSCMAGRTSDWIGRRYTMVVASVVFFVGAILMGFSTNYTFLMVGRFVAGIGVGYALM  486
            S++G+C AGRTSD IGRRYT+V+A  +FF GAILMGF+TNY FLM GRFVAG GVG+A M
Sbjct  77   SVVGACFAGRTSDLIGRRYTIVLAGGIFFAGAILMGFATNYAFLMFGRFVAGFGVGFAGM  136

Query  487  IAPVYTAEVAPA  522
            IAPVYTAE++PA
Sbjct  137  IAPVYTAEISPA  148



>ref|XP_010527593.1| PREDICTED: polyol transporter 5-like isoform X3 [Tarenaya hassleriana]
Length=528

 Score =   181 bits (459),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 94/132 (71%), Positives = 113/132 (86%), Gaps = 0/132 (0%)
 Frame = +1

Query  127  PPKKVKRNKYaiaaaflaslasillGYDIGVMSGAAIYIQKDLKINDTQVEILLGILNLY  306
            PP+K KRNK+A   A L S+  ILLGYDIGVMSGA IYI++DLKI+D Q+EIL+GILN+Y
Sbjct  17   PPEKPKRNKFAFVCAILVSMTLILLGYDIGVMSGAIIYIKRDLKISDGQIEILVGILNIY  76

Query  307  SLIGSCMAGRTSDWIGRRYTMVVASVVFFVGAILMGFSTNYTFLMVGRFVAGIGVGYALM  486
            S++G+C AGRTSD IGRRYT+V+A  +FF GAILMGF+TNY FLM GRFVAG GVG+A M
Sbjct  77   SVVGACFAGRTSDLIGRRYTIVLAGGIFFAGAILMGFATNYAFLMFGRFVAGFGVGFAGM  136

Query  487  IAPVYTAEVAPA  522
            IAPVYTAE++PA
Sbjct  137  IAPVYTAEISPA  148



>tpg|DAA45950.1| TPA: hypothetical protein ZEAMMB73_850316 [Zea mays]
Length=519

 Score =   181 bits (458),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 100/144 (69%), Positives = 118/144 (82%), Gaps = 0/144 (0%)
 Frame = +1

Query  91   RNAGSGHIPAFDPPKKVKRNKYaiaaaflaslasillGYDIGVMSGAAIYIQKDLKINDT  270
            R A  G      PP+K    ++A A A LAS+ SILLGYDIGVMSGAA++I++DLKI+D 
Sbjct  11   RVASDGLPDGVAPPRKKSNVRFAFACAILASMTSILLGYDIGVMSGAALFIKEDLKISDV  70

Query  271  QVEILLGILNLYSLIGSCMAGRTSDWIGRRYTMVVASVVFFVGAILMGFSTNYTFLMVGR  450
            +VE+LLGILNLYSLIGS  AGRTSDWIGRR T+++A+V+FFVGA +MGFS NY  LM GR
Sbjct  71   EVEVLLGILNLYSLIGSFAAGRTSDWIGRRLTIILAAVIFFVGAFMMGFSVNYPMLMAGR  130

Query  451  FVAGIGVGYALMIAPVYTAEVAPA  522
            FVAGIGVGYALMIAPVYTAEV+PA
Sbjct  131  FVAGIGVGYALMIAPVYTAEVSPA  154



>ref|XP_002884156.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH60415.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
Length=511

 Score =   181 bits (458),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 98/139 (71%), Positives = 118/139 (85%), Gaps = 0/139 (0%)
 Frame = +1

Query  106  GHIPAFDPPKKVKRNKYaiaaaflaslasillGYDIGVMSGAAIYIQKDLKINDTQVEIL  285
            G + A   P +  R+++A A A LAS+ SI+LGYDIGVMSGAAI+I+ DLK++D Q+EIL
Sbjct  9    GVVVADSEPPRGNRSRFAFACAILASMTSIILGYDIGVMSGAAIFIKDDLKLSDVQLEIL  68

Query  286  LGILNLYSLIGSCMAGRTSDWIGRRYTMVVASVVFFVGAILMGFSTNYTFLMVGRFVAGI  465
            +GILN+YSLIGS  AGRTSDWIGRRYT+V+A   FF GA+LMGF+TNY F+MVGRFVAGI
Sbjct  69   MGILNIYSLIGSGAAGRTSDWIGRRYTIVLAGAFFFCGALLMGFATNYPFIMVGRFVAGI  128

Query  466  GVGYALMIAPVYTAEVAPA  522
            GVGYA+MIAPVYTAEVAPA
Sbjct  129  GVGYAMMIAPVYTAEVAPA  147



>ref|XP_006657888.1| PREDICTED: polyol transporter 5-like [Oryza brachyantha]
Length=510

 Score =   181 bits (458),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 99/140 (71%), Positives = 117/140 (84%), Gaps = 0/140 (0%)
 Frame = +1

Query  103  SGHIPAFDPPKKVKRNKYaiaaaflaslasillGYDIGVMSGAAIYIQKDLKINDTQVEI  282
            S  +P    PKK    K+A A A L+S+ SILLGYDIGVMSGA++YI+KDLK++D +VE+
Sbjct  3    SAALPEAVAPKKKGNFKFAFACAILSSMTSILLGYDIGVMSGASLYIKKDLKLSDGKVEV  62

Query  283  LLGILNLYSLIGSCMAGRTSDWIGRRYTMVVASVVFFVGAILMGFSTNYTFLMVGRFVAG  462
            L+GILNLYSLIGS  AGRTSDWIGRRYT+V A+V+FF GA+LMGFS N+  LM GRFVAG
Sbjct  63   LMGILNLYSLIGSFAAGRTSDWIGRRYTIVFAAVIFFAGALLMGFSVNFGMLMFGRFVAG  122

Query  463  IGVGYALMIAPVYTAEVAPA  522
            IGVGYALMIAPVYTAEV+PA
Sbjct  123  IGVGYALMIAPVYTAEVSPA  142



>ref|XP_011078884.1| PREDICTED: polyol transporter 5-like isoform X2 [Sesamum indicum]
Length=524

 Score =   181 bits (458),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 98/131 (75%), Positives = 114/131 (87%), Gaps = 2/131 (2%)
 Frame = +1

Query  130  PKKVKRNKYaiaaaflaslasillGYDIGVMSGAAIYIQKDLKINDTQVEILLGILNLYS  309
            P K KRNKYA+A + LAS+ S+LLGY  GVMSGA IYI++DLKI+D Q+EIL+G +N+YS
Sbjct  31   PTKHKRNKYALAISVLASMTSVLLGY--GVMSGATIYIKRDLKISDVQIEILVGTINIYS  88

Query  310  LIGSCMAGRTSDWIGRRYTMVVASVVFFVGAILMGFSTNYTFLMVGRFVAGIGVGYALMI  489
            L+GS +AGRTSDWIGRRYT+V AS +FF GAILMGF+ NY FLMVGRFVAGIGVGYALMI
Sbjct  89   LLGSAVAGRTSDWIGRRYTIVFASAIFFAGAILMGFAANYAFLMVGRFVAGIGVGYALMI  148

Query  490  APVYTAEVAPA  522
            APVY AEVAPA
Sbjct  149  APVYAAEVAPA  159



>ref|XP_002886203.1| hypothetical protein ARALYDRAFT_343514 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH62462.1| hypothetical protein ARALYDRAFT_343514 [Arabidopsis lyrata subsp. 
lyrata]
Length=511

 Score =   181 bits (458),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 98/140 (70%), Positives = 118/140 (84%), Gaps = 0/140 (0%)
 Frame = +1

Query  103  SGHIPAFDPPKKVKRNKYaiaaaflaslasillGYDIGVMSGAAIYIQKDLKINDTQVEI  282
             G + A   P +  R++YA A A LAS+ SI+LGYDIGVMSGAAI+I+ DLK++D Q+EI
Sbjct  8    QGVVIADSEPPRGNRSRYAFACAILASMTSIILGYDIGVMSGAAIFIKDDLKLSDVQLEI  67

Query  283  LLGILNLYSLIGSCMAGRTSDWIGRRYTMVVASVVFFVGAILMGFSTNYTFLMVGRFVAG  462
            L+GILN+YSLIGS  AGRTSDWIGRR+T+V+A   FF GA+LMGF+TNY F+MVGRFVAG
Sbjct  68   LMGILNIYSLIGSGAAGRTSDWIGRRFTIVLAGAFFFCGALLMGFATNYPFIMVGRFVAG  127

Query  463  IGVGYALMIAPVYTAEVAPA  522
            IGVGYA+MIAPVYTAEVAPA
Sbjct  128  IGVGYAMMIAPVYTAEVAPA  147



>ref|XP_010527592.1| PREDICTED: polyol transporter 5-like isoform X2 [Tarenaya hassleriana]
Length=532

 Score =   181 bits (458),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 94/132 (71%), Positives = 113/132 (86%), Gaps = 0/132 (0%)
 Frame = +1

Query  127  PPKKVKRNKYaiaaaflaslasillGYDIGVMSGAAIYIQKDLKINDTQVEILLGILNLY  306
            PP+K KRNK+A   A L S+  ILLGYDIGVMSGA IYI++DLKI+D Q+EIL+GILN+Y
Sbjct  17   PPEKPKRNKFAFVCAILVSMTLILLGYDIGVMSGAIIYIKRDLKISDGQIEILVGILNIY  76

Query  307  SLIGSCMAGRTSDWIGRRYTMVVASVVFFVGAILMGFSTNYTFLMVGRFVAGIGVGYALM  486
            S++G+C AGRTSD IGRRYT+V+A  +FF GAILMGF+TNY FLM GRFVAG GVG+A M
Sbjct  77   SVVGACFAGRTSDLIGRRYTIVLAGGIFFAGAILMGFATNYAFLMFGRFVAGFGVGFAGM  136

Query  487  IAPVYTAEVAPA  522
            IAPVYTAE++PA
Sbjct  137  IAPVYTAEISPA  148



>ref|XP_007201628.1| hypothetical protein PRUPE_ppa021469mg [Prunus persica]
 gb|EMJ02827.1| hypothetical protein PRUPE_ppa021469mg [Prunus persica]
Length=490

 Score =   180 bits (456),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 93/133 (70%), Positives = 111/133 (83%), Gaps = 0/133 (0%)
 Frame = +1

Query  121  FDPPKKVKRNKYaiaaaflaslasillGYDIGVMSGAAIYIQKDLKINDTQVEILLGILN  300
            FDPP+K KRNK+AIA + +A   SILLGYDIGVMSGA ++IQ DLKIND Q++IL G LN
Sbjct  9    FDPPQKPKRNKFAIACSLMACTTSILLGYDIGVMSGANLFIQDDLKINDVQIQILTGTLN  68

Query  301  LYSLIGSCMAGRTSDWIGRRYTMVVASVVFFVGAILMGFSTNYTFLMVGRFVAGIGVGYA  480
            +YS++GS +AGRTSDWIGRRYT  ++  +F VGAILMG +  YTFLM GRFVAGIGVGY 
Sbjct  69   IYSVLGSALAGRTSDWIGRRYTAFLSGAIFSVGAILMGVAQGYTFLMFGRFVAGIGVGYG  128

Query  481  LMIAPVYTAEVAP  519
            LMI+PVYTAE+AP
Sbjct  129  LMISPVYTAEIAP  141



>ref|XP_010435020.1| PREDICTED: putative polyol transporter 2 [Camelina sativa]
Length=511

 Score =   180 bits (457),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 97/134 (72%), Positives = 117/134 (87%), Gaps = 1/134 (1%)
 Frame = +1

Query  121  FDPPKKVKRNKYaiaaaflaslasillGYDIGVMSGAAIYIQKDLKINDTQVEILLGILN  300
             +PP+   R+++A A A LAS+ SI+LGYDIGVMSGAAI+I+ DLK++D Q+EIL+GILN
Sbjct  15   LEPPRG-NRSRFAFACAILASMTSIILGYDIGVMSGAAIFIKDDLKLSDIQLEILMGILN  73

Query  301  LYSLIGSCMAGRTSDWIGRRYTMVVASVVFFVGAILMGFSTNYTFLMVGRFVAGIGVGYA  480
            +YSLIGS  AGRTSDWIGRRYT+V+A   FF GA+LMGF+TNY F+MVGRFVAGIGVGYA
Sbjct  74   IYSLIGSGAAGRTSDWIGRRYTIVLAGAFFFCGALLMGFATNYPFIMVGRFVAGIGVGYA  133

Query  481  LMIAPVYTAEVAPA  522
            +MIAPVYTAEVAPA
Sbjct  134  MMIAPVYTAEVAPA  147



>ref|XP_008466921.1| PREDICTED: putative polyol transporter 1, partial [Cucumis melo]
Length=200

 Score =   172 bits (435),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 81/101 (80%), Positives = 95/101 (94%), Gaps = 0/101 (0%)
 Frame = +1

Query  220  MSGAAIYIQKDLKINDTQVEILLGILNLYSLIGSCMAGRTSDWIGRRYTMVVASVVFFVG  399
            MSGAAI+I+ D K++DT++EIL+GILNLYSLIGS  AGRTSDWIGRRYTMVVA+V+FF G
Sbjct  1    MSGAAIFIKDDFKLSDTKIEILVGILNLYSLIGSAAAGRTSDWIGRRYTMVVAAVIFFAG  60

Query  400  AILMGFSTNYTFLMVGRFVAGIGVGYALMIAPVYTAEVAPA  522
            A+LMGF+TNY+FLM GRFVAG+GVGYALMIAPVYTAEV+PA
Sbjct  61   ALLMGFATNYSFLMFGRFVAGVGVGYALMIAPVYTAEVSPA  101



>gb|KFK40045.1| hypothetical protein AALP_AA3G322700 [Arabis alpina]
Length=487

 Score =   179 bits (455),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 95/133 (71%), Positives = 117/133 (88%), Gaps = 1/133 (1%)
 Frame = +1

Query  124  DPPKKVKRNKYaiaaaflaslasillGYDIGVMSGAAIYIQKDLKINDTQVEILLGILNL  303
            +PP+   R+++A A A LAS+ SI+LGYDIGVMSGAAI+I+ DLK++D Q+EIL+GILN+
Sbjct  16   EPPRG-NRSRFAFACAILASMTSIILGYDIGVMSGAAIFIKDDLKLSDVQLEILMGILNI  74

Query  304  YSLIGSCMAGRTSDWIGRRYTMVVASVVFFVGAILMGFSTNYTFLMVGRFVAGIGVGYAL  483
            YSL+GS  AGRTSDWIGRRYT+V+A   FF GA+LMGF+TNY F+MVGRF+AGIGVGYA+
Sbjct  75   YSLVGSGAAGRTSDWIGRRYTIVLAGAFFFCGALLMGFATNYPFIMVGRFIAGIGVGYAM  134

Query  484  MIAPVYTAEVAPA  522
            MIAPVYTAEVAPA
Sbjct  135  MIAPVYTAEVAPA  147



>gb|EMT15230.1| Polyol transporter 5 [Aegilops tauschii]
Length=524

 Score =   180 bits (456),  Expect = 4e-50, Method: Compositional matrix adjust.
 Identities = 85/106 (80%), Positives = 98/106 (92%), Gaps = 0/106 (0%)
 Frame = +1

Query  205  YDIGVMSGAAIYIQKDLKINDTQVEILLGILNLYSLIGSCMAGRTSDWIGRRYTMVVASV  384
            YDIGVMSGA++YIQKDLKINDTQ+E+L+GILN+YSLIGS  AGRTSDWIGRR+T+V A+V
Sbjct  46   YDIGVMSGASLYIQKDLKINDTQLEVLMGILNVYSLIGSFAAGRTSDWIGRRFTIVFAAV  105

Query  385  VFFVGAILMGFSTNYTFLMVGRFVAGIGVGYALMIAPVYTAEVAPA  522
            +FF GA++MGFS NY  LM GRFVAGIGVGYALMIAPVYTAEV+PA
Sbjct  106  IFFAGALIMGFSVNYAMLMFGRFVAGIGVGYALMIAPVYTAEVSPA  151



>ref|NP_179209.1| polyol/monosaccharide transporter 1 [Arabidopsis thaliana]
 sp|Q9XIH7.1|PLT1_ARATH RecName: Full=Putative polyol transporter 1 [Arabidopsis thaliana]
 gb|AAD26954.1| putative sugar transporter [Arabidopsis thaliana]
 gb|AEC06467.1| polyol/monosaccharide transporter 1 [Arabidopsis thaliana]
Length=511

 Score =   179 bits (455),  Expect = 4e-50, Method: Compositional matrix adjust.
 Identities = 96/140 (69%), Positives = 118/140 (84%), Gaps = 0/140 (0%)
 Frame = +1

Query  103  SGHIPAFDPPKKVKRNKYaiaaaflaslasillGYDIGVMSGAAIYIQKDLKINDTQVEI  282
             G + A   P +  R++YA A A LAS+ SI+LGYDIGVMSGA+I+I+ DLK++D Q+EI
Sbjct  8    QGVVIAESEPPRGNRSRYAFACAILASMTSIILGYDIGVMSGASIFIKDDLKLSDVQLEI  67

Query  283  LLGILNLYSLIGSCMAGRTSDWIGRRYTMVVASVVFFVGAILMGFSTNYTFLMVGRFVAG  462
            L+GILN+YSL+GS  AGRTSDW+GRRYT+V+A   FF GA+LMGF+TNY F+MVGRFVAG
Sbjct  68   LMGILNIYSLVGSGAAGRTSDWLGRRYTIVLAGAFFFCGALLMGFATNYPFIMVGRFVAG  127

Query  463  IGVGYALMIAPVYTAEVAPA  522
            IGVGYA+MIAPVYTAEVAPA
Sbjct  128  IGVGYAMMIAPVYTAEVAPA  147



>ref|XP_008245258.1| PREDICTED: polyol transporter 5-like [Prunus mume]
Length=511

 Score =   179 bits (455),  Expect = 4e-50, Method: Compositional matrix adjust.
 Identities = 96/133 (72%), Positives = 110/133 (83%), Gaps = 0/133 (0%)
 Frame = +1

Query  121  FDPPKKVKRNKYaiaaaflaslasillGYDIGVMSGAAIYIQKDLKINDTQVEILLGILN  300
            FDP  K KRNK+AIA + LA   SILLGYDIGVMSGA + IQ DLKIND Q++IL G LN
Sbjct  9    FDPSLKPKRNKFAIACSLLACTPSILLGYDIGVMSGANLSIQDDLKINDVQIQILTGTLN  68

Query  301  LYSLIGSCMAGRTSDWIGRRYTMVVASVVFFVGAILMGFSTNYTFLMVGRFVAGIGVGYA  480
            +YS+IGS +AGRTSDWIGRRYT V++  +FFVGAILMGF+  Y FLM GRFVAGIGVGY 
Sbjct  69   IYSVIGSALAGRTSDWIGRRYTAVLSGAIFFVGAILMGFAPGYAFLMFGRFVAGIGVGYG  128

Query  481  LMIAPVYTAEVAP  519
            LMI+PVYTAE+AP
Sbjct  129  LMISPVYTAEIAP  141



>gb|AAO88964.1| sorbitol transporter [Malus domestica]
Length=491

 Score =   179 bits (454),  Expect = 4e-50, Method: Compositional matrix adjust.
 Identities = 81/106 (76%), Positives = 99/106 (93%), Gaps = 0/106 (0%)
 Frame = +1

Query  202  GYDIGVMSGAAIYIQKDLKINDTQVEILLGILNLYSLIGSCMAGRTSDWIGRRYTMVVAS  381
            GYDIGVMSGA+IYI+KDLK+ DTQ+EI++G++ +YSLIGS MAG+TSDW+GRRYT+V++ 
Sbjct  7    GYDIGVMSGASIYIEKDLKVTDTQIEIMIGVIEIYSLIGSAMAGKTSDWVGRRYTIVISG  66

Query  382  VVFFVGAILMGFSTNYTFLMVGRFVAGIGVGYALMIAPVYTAEVAP  519
             +FF+GAILMGFSTNYTFLM GRFVAGIGVGYAL IAPVY+AEV+P
Sbjct  67   AIFFIGAILMGFSTNYTFLMCGRFVAGIGVGYALTIAPVYSAEVSP  112



>ref|XP_008791366.1| PREDICTED: polyol transporter 5-like [Phoenix dactylifera]
Length=507

 Score =   179 bits (454),  Expect = 4e-50, Method: Compositional matrix adjust.
 Identities = 98/132 (74%), Positives = 118/132 (89%), Gaps = 0/132 (0%)
 Frame = +1

Query  124  DPPKKVKRNKYaiaaaflaslasillGYDIGVMSGAAIYIQKDLKINDTQVEILLGILNL  303
            + PKK  RNKYA+A A LAS+ SILLGYDI VMSGA+++I+KDLKINDTQ+EIL GI+N+
Sbjct  2    EKPKKPPRNKYALACATLASMTSILLGYDIAVMSGASVFIKKDLKINDTQIEILAGIINI  61

Query  304  YSLIGSCMAGRTSDWIGRRYTMVVASVVFFVGAILMGFSTNYTFLMVGRFVAGIGVGYAL  483
            +SL+GS  AGRTSDWIGRRYT++ A+ +FF GA+LMGF+TNY FLMVGRF+AG+GVGYAL
Sbjct  62   FSLVGSIAAGRTSDWIGRRYTIIFAAAIFFAGALLMGFATNYAFLMVGRFIAGVGVGYAL  121

Query  484  MIAPVYTAEVAP  519
            MIAPVYTAEVAP
Sbjct  122  MIAPVYTAEVAP  133



>ref|XP_010442571.1| PREDICTED: putative polyol transporter 2 [Camelina sativa]
Length=518

 Score =   179 bits (455),  Expect = 4e-50, Method: Compositional matrix adjust.
 Identities = 96/133 (72%), Positives = 117/133 (88%), Gaps = 1/133 (1%)
 Frame = +1

Query  124  DPPKKVKRNKYaiaaaflaslasillGYDIGVMSGAAIYIQKDLKINDTQVEILLGILNL  303
            +PP+   R+++A A A LAS+ SI+LGYDIGVMSGAAI+I+ DLK++D Q+EIL+GILN+
Sbjct  16   EPPRG-NRSRFAFACAILASMTSIILGYDIGVMSGAAIFIKDDLKLSDVQLEILMGILNI  74

Query  304  YSLIGSCMAGRTSDWIGRRYTMVVASVVFFVGAILMGFSTNYTFLMVGRFVAGIGVGYAL  483
            YS+IGS  AGRTSDWIGRRYT+V+A   FF GA+LMGF+TNY F+MVGRFVAGIGVGYA+
Sbjct  75   YSIIGSGAAGRTSDWIGRRYTIVLAGAFFFCGALLMGFATNYPFIMVGRFVAGIGVGYAM  134

Query  484  MIAPVYTAEVAPA  522
            MIAPVYTAEVAPA
Sbjct  135  MIAPVYTAEVAPA  147



>ref|XP_006856084.1| hypothetical protein AMTR_s00059p00122840 [Amborella trichopoda]
 gb|ERN17551.1| hypothetical protein AMTR_s00059p00122840 [Amborella trichopoda]
Length=518

 Score =   179 bits (454),  Expect = 5e-50, Method: Compositional matrix adjust.
 Identities = 99/130 (76%), Positives = 115/130 (88%), Gaps = 0/130 (0%)
 Frame = +1

Query  133  KKVKRNKYaiaaaflaslasillGYDIGVMSGAAIYIQKDLKINDTQVEILLGILNLYSL  312
            +K KRNKYA+A AFLAS+ SILLGYDIGVMSGA I+I++DL+I+D +VEIL+G LN+Y L
Sbjct  17   EKPKRNKYALACAFLASMTSILLGYDIGVMSGAVIFIKEDLRISDVEVEILVGSLNIYCL  76

Query  313  IGSCMAGRTSDWIGRRYTMVVASVVFFVGAILMGFSTNYTFLMVGRFVAGIGVGYALMIA  492
            IGS  AGRTSDWIGRRYT+V AS +FFVGA++MGF+ NY FLM GR VAGIGVGYALMIA
Sbjct  77   IGSFAAGRTSDWIGRRYTIVFASAIFFVGALMMGFAPNYAFLMAGRVVAGIGVGYALMIA  136

Query  493  PVYTAEVAPA  522
            PVYTAEVAPA
Sbjct  137  PVYTAEVAPA  146



>ref|NP_179210.1| polyol/monosaccharide transporter 2 [Arabidopsis thaliana]
 sp|Q9XIH6.1|PLT2_ARATH RecName: Full=Putative polyol transporter 2 [Arabidopsis thaliana]
 gb|AAD26955.1| putative sugar transporter [Arabidopsis thaliana]
 gb|AEC06468.1| polyol/monosaccharide transporter 2 [Arabidopsis thaliana]
Length=511

 Score =   179 bits (454),  Expect = 5e-50, Method: Compositional matrix adjust.
 Identities = 97/139 (70%), Positives = 117/139 (84%), Gaps = 0/139 (0%)
 Frame = +1

Query  106  GHIPAFDPPKKVKRNKYaiaaaflaslasillGYDIGVMSGAAIYIQKDLKINDTQVEIL  285
            G + A   P +  R+++A A A LAS+ SI+LGYDIGVMSGAAI+I+ DLK++D Q+EIL
Sbjct  9    GVVVAESEPPRGNRSRFAFACAILASMTSIILGYDIGVMSGAAIFIKDDLKLSDVQLEIL  68

Query  286  LGILNLYSLIGSCMAGRTSDWIGRRYTMVVASVVFFVGAILMGFSTNYTFLMVGRFVAGI  465
            +GILN+YSLIGS  AGRTSDWIGRRYT+V+A   FF GA+LMGF+TNY F+MVGRFVAGI
Sbjct  69   MGILNIYSLIGSGAAGRTSDWIGRRYTIVLAGFFFFCGALLMGFATNYPFIMVGRFVAGI  128

Query  466  GVGYALMIAPVYTAEVAPA  522
            GVGYA+MIAPVYT EVAPA
Sbjct  129  GVGYAMMIAPVYTTEVAPA  147



>ref|XP_010472942.1| PREDICTED: putative polyol transporter 2 [Camelina sativa]
Length=511

 Score =   179 bits (454),  Expect = 5e-50, Method: Compositional matrix adjust.
 Identities = 96/133 (72%), Positives = 117/133 (88%), Gaps = 1/133 (1%)
 Frame = +1

Query  124  DPPKKVKRNKYaiaaaflaslasillGYDIGVMSGAAIYIQKDLKINDTQVEILLGILNL  303
            +PP+   R+++A A A LAS+ SI+LGYDIGVMSGAAI+I+ DLK++D Q+EIL+GILN+
Sbjct  16   EPPRG-NRSRFAFACAILASMTSIILGYDIGVMSGAAIFIKDDLKLSDIQLEILMGILNI  74

Query  304  YSLIGSCMAGRTSDWIGRRYTMVVASVVFFVGAILMGFSTNYTFLMVGRFVAGIGVGYAL  483
            YSLIGS  AGRTSDWIGRRYT+V+A   FF GA+LMGF+TNY F+MVGRF+AGIGVGYA+
Sbjct  75   YSLIGSGAAGRTSDWIGRRYTIVLAGSFFFCGALLMGFATNYPFIMVGRFIAGIGVGYAM  134

Query  484  MIAPVYTAEVAPA  522
            MIAPVYTAEVAPA
Sbjct  135  MIAPVYTAEVAPA  147



>ref|XP_010495901.1| PREDICTED: putative polyol transporter 1 [Camelina sativa]
Length=511

 Score =   179 bits (454),  Expect = 5e-50, Method: Compositional matrix adjust.
 Identities = 96/133 (72%), Positives = 117/133 (88%), Gaps = 1/133 (1%)
 Frame = +1

Query  124  DPPKKVKRNKYaiaaaflaslasillGYDIGVMSGAAIYIQKDLKINDTQVEILLGILNL  303
            +PP+   R+++A A A LAS+ SI+LGYDIGVMSGAAI+I+ DLK++D Q+EIL+GILN+
Sbjct  16   EPPRG-NRSRFAFACAILASMTSIILGYDIGVMSGAAIFIKDDLKLSDIQLEILMGILNI  74

Query  304  YSLIGSCMAGRTSDWIGRRYTMVVASVVFFVGAILMGFSTNYTFLMVGRFVAGIGVGYAL  483
            YSLIGS  AGRTSDW+GRRYT+V+A   FF GA+LMGF+TNY F+MVGRFVAGIGVGYA+
Sbjct  75   YSLIGSGAAGRTSDWMGRRYTIVLAGAFFFCGALLMGFATNYPFIMVGRFVAGIGVGYAM  134

Query  484  MIAPVYTAEVAPA  522
            MIAPVYTAEVAPA
Sbjct  135  MIAPVYTAEVAPA  147



>ref|XP_010472919.1| PREDICTED: putative polyol transporter 2 [Camelina sativa]
Length=511

 Score =   179 bits (454),  Expect = 5e-50, Method: Compositional matrix adjust.
 Identities = 96/133 (72%), Positives = 117/133 (88%), Gaps = 1/133 (1%)
 Frame = +1

Query  124  DPPKKVKRNKYaiaaaflaslasillGYDIGVMSGAAIYIQKDLKINDTQVEILLGILNL  303
            +PP+   R+++A A A LAS+ SI+LGYDIGVMSGAAI+I+ DLK++D Q+EIL+GILN+
Sbjct  16   EPPRG-NRSRFAFACAILASMTSIILGYDIGVMSGAAIFIKDDLKLSDIQLEILMGILNI  74

Query  304  YSLIGSCMAGRTSDWIGRRYTMVVASVVFFVGAILMGFSTNYTFLMVGRFVAGIGVGYAL  483
            YSLIGS  AGRTSDWIGRRYT+V+A   FF GA+LMGF+TNY F+MVGRF+AGIGVGYA+
Sbjct  75   YSLIGSGAAGRTSDWIGRRYTIVLAGSFFFCGALLMGFATNYPFIMVGRFIAGIGVGYAM  134

Query  484  MIAPVYTAEVAPA  522
            MIAPVYTAEVAPA
Sbjct  135  MIAPVYTAEVAPA  147



>ref|XP_004983902.1| PREDICTED: polyol transporter 5-like isoform X2 [Setaria italica]
Length=523

 Score =   179 bits (454),  Expect = 6e-50, Method: Compositional matrix adjust.
 Identities = 99/142 (70%), Positives = 117/142 (82%), Gaps = 0/142 (0%)
 Frame = +1

Query  97   AGSGHIPAFDPPKKVKRNKYaiaaaflaslasillGYDIGVMSGAAIYIQKDLKINDTQV  276
            A  G +P    PKK    ++A A A LAS+ SILLGYDIGVMSGAA++I++DL+I+D +V
Sbjct  13   ASDGRLPDGVAPKKKTNVRFAFACAILASMTSILLGYDIGVMSGAALFIKEDLEISDVEV  72

Query  277  EILLGILNLYSLIGSCMAGRTSDWIGRRYTMVVASVVFFVGAILMGFSTNYTFLMVGRFV  456
            EILLGILNLYSLIGS  AGRTSDWIGRR T+++A+ +FFVGA +MGFS NY  LM GRFV
Sbjct  73   EILLGILNLYSLIGSFAAGRTSDWIGRRLTIILAAAIFFVGAFIMGFSVNYPMLMAGRFV  132

Query  457  AGIGVGYALMIAPVYTAEVAPA  522
            AGIGVGYALMIAPVYTAEV+PA
Sbjct  133  AGIGVGYALMIAPVYTAEVSPA  154



>ref|XP_004983901.1| PREDICTED: polyol transporter 5-like isoform X1 [Setaria italica]
Length=535

 Score =   179 bits (454),  Expect = 7e-50, Method: Compositional matrix adjust.
 Identities = 99/142 (70%), Positives = 117/142 (82%), Gaps = 0/142 (0%)
 Frame = +1

Query  97   AGSGHIPAFDPPKKVKRNKYaiaaaflaslasillGYDIGVMSGAAIYIQKDLKINDTQV  276
            A  G +P    PKK    ++A A A LAS+ SILLGYDIGVMSGAA++I++DL+I+D +V
Sbjct  13   ASDGRLPDGVAPKKKTNVRFAFACAILASMTSILLGYDIGVMSGAALFIKEDLEISDVEV  72

Query  277  EILLGILNLYSLIGSCMAGRTSDWIGRRYTMVVASVVFFVGAILMGFSTNYTFLMVGRFV  456
            EILLGILNLYSLIGS  AGRTSDWIGRR T+++A+ +FFVGA +MGFS NY  LM GRFV
Sbjct  73   EILLGILNLYSLIGSFAAGRTSDWIGRRLTIILAAAIFFVGAFIMGFSVNYPMLMAGRFV  132

Query  457  AGIGVGYALMIAPVYTAEVAPA  522
            AGIGVGYALMIAPVYTAEV+PA
Sbjct  133  AGIGVGYALMIAPVYTAEVSPA  154



>ref|XP_010445995.1| PREDICTED: putative polyol transporter 2 [Camelina sativa]
Length=511

 Score =   178 bits (452),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 96/139 (69%), Positives = 118/139 (85%), Gaps = 0/139 (0%)
 Frame = +1

Query  106  GHIPAFDPPKKVKRNKYaiaaaflaslasillGYDIGVMSGAAIYIQKDLKINDTQVEIL  285
            G + A   P +  R+++A A A LAS+ SI+LGYDIGVMSGAAI+I+ DLK++D Q+E+L
Sbjct  9    GVVVAEPKPPRGNRSRFAFACAILASMTSIILGYDIGVMSGAAIFIKDDLKLSDVQLEVL  68

Query  286  LGILNLYSLIGSCMAGRTSDWIGRRYTMVVASVVFFVGAILMGFSTNYTFLMVGRFVAGI  465
            +GILN+YS+IGS  AGRTSDWIGRRYT+V+A   FF GA+LMGF+TNY F+MVGRFVAGI
Sbjct  69   MGILNIYSIIGSGAAGRTSDWIGRRYTIVLAGAFFFCGALLMGFATNYPFIMVGRFVAGI  128

Query  466  GVGYALMIAPVYTAEVAPA  522
            GVGYA+MIAPVYTAEVAPA
Sbjct  129  GVGYAMMIAPVYTAEVAPA  147



>ref|XP_008653287.1| PREDICTED: polyol transporter 5-like [Zea mays]
 tpg|DAA63325.1| TPA: hypothetical protein ZEAMMB73_442702 [Zea mays]
Length=513

 Score =   178 bits (452),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 100/140 (71%), Positives = 116/140 (83%), Gaps = 0/140 (0%)
 Frame = +1

Query  103  SGHIPAFDPPKKVKRNKYaiaaaflaslasillGYDIGVMSGAAIYIQKDLKINDTQVEI  282
            S  +PA   P K    K+A A A LAS+ SILLGYDIGVMSGA++YI+KDLKI+D ++EI
Sbjct  3    SAPLPAAIEPGKKGNVKFAFACAILASMTSILLGYDIGVMSGASLYIKKDLKISDVKLEI  62

Query  283  LLGILNLYSLIGSCMAGRTSDWIGRRYTMVVASVVFFVGAILMGFSTNYTFLMVGRFVAG  462
            L+GILN+YSLIGS  AGRTSDWIGRRYT+V A+V+FF GA LMGF+ NY  LM GRFVAG
Sbjct  63   LMGILNVYSLIGSFAAGRTSDWIGRRYTIVFAAVIFFAGAFLMGFAVNYWMLMFGRFVAG  122

Query  463  IGVGYALMIAPVYTAEVAPA  522
            IGVGYALMIAPVYTAEV+PA
Sbjct  123  IGVGYALMIAPVYTAEVSPA  142



>ref|XP_007200584.1| hypothetical protein PRUPE_ppa007633mg [Prunus persica]
 gb|EMJ01783.1| hypothetical protein PRUPE_ppa007633mg [Prunus persica]
Length=335

 Score =   174 bits (441),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 82/105 (78%), Positives = 96/105 (91%), Gaps = 0/105 (0%)
 Frame = +1

Query  208  DIGVMSGAAIYIQKDLKINDTQVEILLGILNLYSLIGSCMAGRTSDWIGRRYTMVVASVV  387
            DIGVMSGAAIYI+KDLK++D ++E+L+GILNLYSLIGS  AGRTSDWIGRRYT+V+A  +
Sbjct  26   DIGVMSGAAIYIKKDLKVSDVEIEVLIGILNLYSLIGSAAAGRTSDWIGRRYTIVLAGAI  85

Query  388  FFVGAILMGFSTNYTFLMVGRFVAGIGVGYALMIAPVYTAEVAPA  522
            FF GA+LMGF+ NY FLM GRF+AGIGVGYALMIAPVYTAEV+PA
Sbjct  86   FFAGALLMGFAPNYAFLMFGRFIAGIGVGYALMIAPVYTAEVSPA  130



>emb|CDY46217.1| BnaA07g03530D [Brassica napus]
Length=512

 Score =   178 bits (451),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 94/127 (74%), Positives = 114/127 (90%), Gaps = 0/127 (0%)
 Frame = +1

Query  142  KRNKYaiaaaflaslasillGYDIGVMSGAAIYIQKDLKINDTQVEILLGILNLYSLIGS  321
             R+++A A A LAS+ SI+LGYDIGVMSGAAI+I++DLK++D Q+EIL+GILN+YSL+GS
Sbjct  22   NRSRFAFACAILASMTSIILGYDIGVMSGAAIFIKEDLKLSDVQLEILMGILNIYSLVGS  81

Query  322  CMAGRTSDWIGRRYTMVVASVVFFVGAILMGFSTNYTFLMVGRFVAGIGVGYALMIAPVY  501
              AGRTSDWIGRRYT+V+A   FF GA+LMGF+TNY F+MVGRFVAGIGVGYA+MIAPVY
Sbjct  82   GAAGRTSDWIGRRYTIVLAGAFFFCGALLMGFATNYPFIMVGRFVAGIGVGYAMMIAPVY  141

Query  502  TAEVAPA  522
            TAEVAPA
Sbjct  142  TAEVAPA  148



>ref|XP_009121388.1| PREDICTED: LOW QUALITY PROTEIN: putative polyol transporter 1 
[Brassica rapa]
Length=511

 Score =   178 bits (451),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 94/127 (74%), Positives = 114/127 (90%), Gaps = 0/127 (0%)
 Frame = +1

Query  142  KRNKYaiaaaflaslasillGYDIGVMSGAAIYIQKDLKINDTQVEILLGILNLYSLIGS  321
             R+++A A A LAS+ SI+LGYDIGVMSGAAI+I++DLK++D Q+EIL+GILN+YSL+GS
Sbjct  21   NRSRFAFACAILASMTSIILGYDIGVMSGAAIFIKEDLKLSDVQLEILMGILNIYSLVGS  80

Query  322  CMAGRTSDWIGRRYTMVVASVVFFVGAILMGFSTNYTFLMVGRFVAGIGVGYALMIAPVY  501
              AGRTSDWIGRRYT+V+A   FF GA+LMGF+TNY F+MVGRFVAGIGVGYA+MIAPVY
Sbjct  81   GAAGRTSDWIGRRYTIVLAGAFFFCGALLMGFATNYPFIMVGRFVAGIGVGYAMMIAPVY  140

Query  502  TAEVAPA  522
            TAEVAPA
Sbjct  141  TAEVAPA  147



>ref|XP_009121227.1| PREDICTED: putative polyol transporter 1 [Brassica rapa]
Length=511

 Score =   178 bits (451),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 94/127 (74%), Positives = 114/127 (90%), Gaps = 0/127 (0%)
 Frame = +1

Query  142  KRNKYaiaaaflaslasillGYDIGVMSGAAIYIQKDLKINDTQVEILLGILNLYSLIGS  321
             R+++A A A LAS+ SI+LGYDIGVMSGAAI+I++DLK++D Q+EIL+GILN+YSL+GS
Sbjct  21   NRSRFAFACAILASMTSIILGYDIGVMSGAAIFIKEDLKLSDVQLEILMGILNIYSLVGS  80

Query  322  CMAGRTSDWIGRRYTMVVASVVFFVGAILMGFSTNYTFLMVGRFVAGIGVGYALMIAPVY  501
              AGRTSDWIGRRYT+V+A   FF GA+LMGF+TNY F+MVGRFVAGIGVGYA+MIAPVY
Sbjct  81   GAAGRTSDWIGRRYTIVLAGAFFFCGALLMGFATNYPFIMVGRFVAGIGVGYAMMIAPVY  140

Query  502  TAEVAPA  522
            TAEVAPA
Sbjct  141  TAEVAPA  147



>emb|CDY46218.1| BnaA07g03520D [Brassica napus]
Length=511

 Score =   178 bits (451),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 94/127 (74%), Positives = 114/127 (90%), Gaps = 0/127 (0%)
 Frame = +1

Query  142  KRNKYaiaaaflaslasillGYDIGVMSGAAIYIQKDLKINDTQVEILLGILNLYSLIGS  321
             R+++A A A LAS+ SI+LGYDIGVMSGAAI+I++DLK++D Q+EIL+GILN+YSL+GS
Sbjct  21   NRSRFAFACAILASMTSIILGYDIGVMSGAAIFIKEDLKLSDVQLEILMGILNIYSLVGS  80

Query  322  CMAGRTSDWIGRRYTMVVASVVFFVGAILMGFSTNYTFLMVGRFVAGIGVGYALMIAPVY  501
              AGRTSDWIGRRYT+V+A   FF GA+LMGF+TNY F+MVGRFVAGIGVGYA+MIAPVY
Sbjct  81   GAAGRTSDWIGRRYTIVLAGAFFFCGALLMGFATNYPFIMVGRFVAGIGVGYAMMIAPVY  140

Query  502  TAEVAPA  522
            TAEVAPA
Sbjct  141  TAEVAPA  147



>ref|XP_002885281.1| ATPLT5 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH61540.1| ATPLT5 [Arabidopsis lyrata subsp. lyrata]
Length=538

 Score =   178 bits (451),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 100/139 (72%), Positives = 115/139 (83%), Gaps = 1/139 (1%)
 Frame = +1

Query  109  HIP-AFDPPKKVKRNKYaiaaaflaslasillGYDIGVMSGAAIYIQKDLKINDTQVEIL  285
            H+P +  P K  KRNKYA A A LAS+ SILLGYDIGVMSGA IYI++DLKI+D ++ IL
Sbjct  19   HVPESVLPAKPPKRNKYAFACAILASMTSILLGYDIGVMSGAMIYIKRDLKISDLEIGIL  78

Query  286  LGILNLYSLIGSCMAGRTSDWIGRRYTMVVASVVFFVGAILMGFSTNYTFLMVGRFVAGI  465
             G LN+YSLIGSC AG+TSD IGRRYT+V+A  +FF GAILMG + NY FLM GRFVAGI
Sbjct  79   AGSLNIYSLIGSCAAGKTSDLIGRRYTIVLAGAIFFAGAILMGLAPNYAFLMFGRFVAGI  138

Query  466  GVGYALMIAPVYTAEVAPA  522
            GVGYALMIAPVYTAEV+PA
Sbjct  139  GVGYALMIAPVYTAEVSPA  157



>ref|XP_010254894.1| PREDICTED: polyol transporter 5-like [Nelumbo nucifera]
Length=504

 Score =   177 bits (449),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 94/147 (64%), Positives = 115/147 (78%), Gaps = 0/147 (0%)
 Frame = +1

Query  82   RPVRNAGSGHIPAFDPPKKVKRNKYaiaaaflaslasillGYDIGVMSGAAIYIQKDLKI  261
            + +  +    I   + P K +R K+A+  A LAS+ SILLGYD GVMSGA I+I+ DLKI
Sbjct  6    QKIETSAVHEILEIESPNKYRRKKFALTCATLASMISILLGYDTGVMSGAIIFIKDDLKI  65

Query  262  NDTQVEILLGILNLYSLIGSCMAGRTSDWIGRRYTMVVASVVFFVGAILMGFSTNYTFLM  441
            NDTQ+E+L+GI+NL SL+GS  AGRTSDWIGRRYT+V A+V+FFVGA+LMG + NY  LM
Sbjct  66   NDTQIEVLVGIINLCSLVGSVAAGRTSDWIGRRYTIVFAAVIFFVGALLMGLAPNYAVLM  125

Query  442  VGRFVAGIGVGYALMIAPVYTAEVAPA  522
             GR VAG GVGYALMIAPVYTAE+APA
Sbjct  126  AGRIVAGFGVGYALMIAPVYTAELAPA  152



>ref|XP_010487804.1| PREDICTED: polyol transporter 5-like [Camelina sativa]
Length=535

 Score =   177 bits (450),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 96/132 (73%), Positives = 112/132 (85%), Gaps = 0/132 (0%)
 Frame = +1

Query  127  PPKKVKRNKYaiaaaflaslasillGYDIGVMSGAAIYIQKDLKINDTQVEILLGILNLY  306
            P K  K+N+YA A A LAS+ SILLGYDIGVMSGA IYI++DLKI+D ++ +L G LN+Y
Sbjct  27   PGKPPKKNRYAFACAILASMTSILLGYDIGVMSGAMIYIKRDLKISDFEIGVLAGSLNIY  86

Query  307  SLIGSCMAGRTSDWIGRRYTMVVASVVFFVGAILMGFSTNYTFLMVGRFVAGIGVGYALM  486
            SLIGSC AG+TSDWIGRRYT+V+A  +FF GAILMG + NY FLM GRF+AGIGVGYALM
Sbjct  87   SLIGSCAAGKTSDWIGRRYTIVLAGAIFFAGAILMGLAPNYAFLMFGRFIAGIGVGYALM  146

Query  487  IAPVYTAEVAPA  522
            IAPVYTAEVAPA
Sbjct  147  IAPVYTAEVAPA  158



>ref|XP_008795606.1| PREDICTED: polyol transporter 5-like isoform X1 [Phoenix dactylifera]
Length=522

 Score =   177 bits (449),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 97/156 (62%), Positives = 120/156 (77%), Gaps = 5/156 (3%)
 Frame = +1

Query  70   MGDTRPVRNAGSGHIPAFD-----PPKKVKRNKYaiaaaflaslasillGYDIGVMSGAA  234
            M D +P     +  +P         P+     +YA A A LAS+ SILLGYDIGVMSGAA
Sbjct  1    MTDQKPEATKVAPQVPHDSLLEAVAPRPRHNKRYAFACAMLASMTSILLGYDIGVMSGAA  60

Query  235  IYIQKDLKINDTQVEILLGILNLYSLIGSCMAGRTSDWIGRRYTMVVASVVFFVGAILMG  414
            ++++ DL +NDTQ+EILLGILNL+S++GS  AGRTSDWIGRRYT+V A+V+FFVGAI+MG
Sbjct  61   LFMKDDLHVNDTQIEILLGILNLFSIVGSLAAGRTSDWIGRRYTIVFAAVIFFVGAIMMG  120

Query  415  FSTNYTFLMVGRFVAGIGVGYALMIAPVYTAEVAPA  522
             + NY FLMVGRFVAG+GVGYAL+IAPVYT E+APA
Sbjct  121  LAPNYAFLMVGRFVAGVGVGYALVIAPVYTTELAPA  156



>dbj|BAC83310.1| putative sorbitol transporter [Oryza sativa Japonica Group]
 gb|EAZ40438.1| hypothetical protein OsJ_24893 [Oryza sativa Japonica Group]
Length=510

 Score =   177 bits (449),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 98/140 (70%), Positives = 114/140 (81%), Gaps = 0/140 (0%)
 Frame = +1

Query  103  SGHIPAFDPPKKVKRNKYaiaaaflaslasillGYDIGVMSGAAIYIQKDLKINDTQVEI  282
            S  +P    PKK    ++A A A LAS+ SILLGYDIGVMSGA++YI+KD  I+D +VE+
Sbjct  3    SAALPEAVAPKKKGNVRFAFACAILASMTSILLGYDIGVMSGASLYIKKDFNISDGKVEV  62

Query  283  LLGILNLYSLIGSCMAGRTSDWIGRRYTMVVASVVFFVGAILMGFSTNYTFLMVGRFVAG  462
            L+GILNLYSLIGS  AGRTSDWIGRRYT+V A+V+FF GA LMGF+ NY  LM GRFVAG
Sbjct  63   LMGILNLYSLIGSFAAGRTSDWIGRRYTIVFAAVIFFAGAFLMGFAVNYAMLMFGRFVAG  122

Query  463  IGVGYALMIAPVYTAEVAPA  522
            IGVGYALMIAPVYTAEV+PA
Sbjct  123  IGVGYALMIAPVYTAEVSPA  142



>gb|EAZ04480.1| hypothetical protein OsI_26629 [Oryza sativa Indica Group]
Length=510

 Score =   177 bits (449),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 98/140 (70%), Positives = 114/140 (81%), Gaps = 0/140 (0%)
 Frame = +1

Query  103  SGHIPAFDPPKKVKRNKYaiaaaflaslasillGYDIGVMSGAAIYIQKDLKINDTQVEI  282
            S  +P    PKK    ++A A A LAS+ SILLGYDIGVMSGA++YI+KD  I+D +VE+
Sbjct  3    SAALPEAVAPKKKGNVRFAFACAILASMTSILLGYDIGVMSGASLYIKKDFNISDGKVEV  62

Query  283  LLGILNLYSLIGSCMAGRTSDWIGRRYTMVVASVVFFVGAILMGFSTNYTFLMVGRFVAG  462
            L+GILNLYSLIGS  AGRTSDWIGRRYT+V A+V+FF GA LMGF+ NY  LM GRFVAG
Sbjct  63   LMGILNLYSLIGSFAAGRTSDWIGRRYTIVFAAVIFFAGAFLMGFAVNYAMLMFGRFVAG  122

Query  463  IGVGYALMIAPVYTAEVAPA  522
            IGVGYALMIAPVYTAEV+PA
Sbjct  123  IGVGYALMIAPVYTAEVSPA  142



>ref|XP_003562817.1| PREDICTED: polyol transporter 5-like [Brachypodium distachyon]
Length=513

 Score =   177 bits (448),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 96/131 (73%), Positives = 114/131 (87%), Gaps = 0/131 (0%)
 Frame = +1

Query  130  PKKVKRNKYaiaaaflaslasillGYDIGVMSGAAIYIQKDLKINDTQVEILLGILNLYS  309
            PKK    ++A A A LAS+ SILLGYDIGVMSGA+++I+KDL+I+D QVE+L+GILN+YS
Sbjct  12   PKKKGNVRFAFACAILASMTSILLGYDIGVMSGASLFIKKDLQISDVQVEVLMGILNVYS  71

Query  310  LIGSCMAGRTSDWIGRRYTMVVASVVFFVGAILMGFSTNYTFLMVGRFVAGIGVGYALMI  489
            LIGS  AGRTSDWIGRRYT+V A+V+FF GA++MGFS NY  LM GRFVAGIGVGYALMI
Sbjct  72   LIGSFAAGRTSDWIGRRYTIVFAAVIFFAGALVMGFSVNYLMLMFGRFVAGIGVGYALMI  131

Query  490  APVYTAEVAPA  522
            APVYTAEV+PA
Sbjct  132  APVYTAEVSPA  142



>ref|XP_008795604.1| PREDICTED: putative polyol transporter 1 [Phoenix dactylifera]
Length=522

 Score =   177 bits (448),  Expect = 5e-49, Method: Compositional matrix adjust.
 Identities = 94/131 (72%), Positives = 112/131 (85%), Gaps = 0/131 (0%)
 Frame = +1

Query  130  PKKVKRNKYaiaaaflaslasillGYDIGVMSGAAIYIQKDLKINDTQVEILLGILNLYS  309
            P+     +YA A A LAS+ SI+LGYDIGVMSGAA++I+ DL +NDTQ+EILLGILNLYS
Sbjct  26   PRPRHNKRYACACAMLASMTSIILGYDIGVMSGAALFIEDDLHVNDTQIEILLGILNLYS  85

Query  310  LIGSCMAGRTSDWIGRRYTMVVASVVFFVGAILMGFSTNYTFLMVGRFVAGIGVGYALMI  489
            ++GS  AGRTSDWIGRRYT+V A+V+FFVGAI+MG + NY FLMVGRFVAG+GVGYA +I
Sbjct  86   IVGSLAAGRTSDWIGRRYTIVFAAVIFFVGAIMMGLAPNYAFLMVGRFVAGVGVGYAAVI  145

Query  490  APVYTAEVAPA  522
            A VYTAEVAPA
Sbjct  146  AAVYTAEVAPA  156



>ref|NP_001147446.1| sorbitol transporter [Zea mays]
 gb|ACF84429.1| unknown [Zea mays]
 gb|ACG27557.1| sorbitol transporter [Zea mays]
 tpg|DAA43973.1| TPA: Sorbitol transporter [Zea mays]
Length=525

 Score =   176 bits (447),  Expect = 6e-49, Method: Compositional matrix adjust.
 Identities = 95/151 (63%), Positives = 123/151 (81%), Gaps = 1/151 (1%)
 Frame = +1

Query  70   MGDTRPVRNAGSGHIPAFDPP-KKVKRNKYaiaaaflaslasillGYDIGVMSGAAIYIQ  246
            M +++    A  G IPA + P K+   NKYA+A A LAS+ SILLGYD+ VMSGA ++++
Sbjct  1    MSNSKQHDAADDGGIPAPEAPAKRPPLNKYALACAVLASMNSILLGYDVSVMSGAQLFMK  60

Query  247  KDLKINDTQVEILLGILNLYSLIGSCMAGRTSDWIGRRYTMVVASVVFFVGAILMGFSTN  426
            +DLKI DTQ+EIL GI+N+YSL+GS  AGRTSDW+GRRYTMV+A+ +FF GA++MG + +
Sbjct  61   QDLKITDTQIEILAGIINIYSLVGSLAAGRTSDWLGRRYTMVLAAAIFFAGALIMGLAPS  120

Query  427  YTFLMVGRFVAGIGVGYALMIAPVYTAEVAP  519
            YT LM+GRFVAG+GVGYALMIAPVYTAEV+P
Sbjct  121  YTILMLGRFVAGVGVGYALMIAPVYTAEVSP  151



>ref|XP_002463086.1| hypothetical protein SORBIDRAFT_02g037590 [Sorghum bicolor]
 gb|EER99607.1| hypothetical protein SORBIDRAFT_02g037590 [Sorghum bicolor]
Length=505

 Score =   176 bits (446),  Expect = 7e-49, Method: Compositional matrix adjust.
 Identities = 91/131 (69%), Positives = 111/131 (85%), Gaps = 0/131 (0%)
 Frame = +1

Query  130  PKKVKRNKYaiaaaflaslasillGYDIGVMSGAAIYIQKDLKINDTQVEILLGILNLYS  309
            P+K    KYA   A LAS+A I++GYDIGVMSGAAIYI+KDL I D Q+EI++GILN+YS
Sbjct  7    PRKKSNVKYASMCAILASMAVIIVGYDIGVMSGAAIYIKKDLNITDVQLEIVMGILNIYS  66

Query  310  LIGSCMAGRTSDWIGRRYTMVVASVVFFVGAILMGFSTNYTFLMVGRFVAGIGVGYALMI  489
            LIGS  AGRTSDWIGRR+T+V A+V+FF G++LMGF+ NY  LM GRFVAG+GVGYA+MI
Sbjct  67   LIGSFAAGRTSDWIGRRFTVVFAAVIFFAGSLLMGFAVNYAMLMAGRFVAGVGVGYAIMI  126

Query  490  APVYTAEVAPA  522
            APVYTAE++PA
Sbjct  127  APVYTAEISPA  137



>gb|EMS50618.1| Polyol transporter 5 [Triticum urartu]
Length=311

 Score =   171 bits (434),  Expect = 7e-49, Method: Compositional matrix adjust.
 Identities = 93/137 (68%), Positives = 115/137 (84%), Gaps = 1/137 (1%)
 Frame = +1

Query  112  IPAFDPP-KKVKRNKYaiaaaflaslasillGYDIGVMSGAAIYIQKDLKINDTQVEILL  288
            IPA + P K+   NKYA+A A LAS+ SILLGYD+ VMSGA I++++DL I DTQ+E+L 
Sbjct  9    IPAGEAPAKRAPLNKYALACAILASMNSILLGYDVSVMSGAQIFMKRDLHITDTQIEVLA  68

Query  289  GILNLYSLIGSCMAGRTSDWIGRRYTMVVASVVFFVGAILMGFSTNYTFLMVGRFVAGIG  468
            GI+N++SL+GS  AGRTSDWIGRRYTMV+ASV+FF GA++MG +  Y  LM+GRFVAG+G
Sbjct  69   GIINIFSLVGSLAAGRTSDWIGRRYTMVLASVIFFAGALIMGLAPGYAVLMLGRFVAGVG  128

Query  469  VGYALMIAPVYTAEVAP  519
            VGYALMIAPVYTAEVAP
Sbjct  129  VGYALMIAPVYTAEVAP  145



>gb|AAY88181.2| mannitol transporter 1 [Olea europaea]
Length=480

 Score =   175 bits (444),  Expect = 8e-49, Method: Compositional matrix adjust.
 Identities = 82/107 (77%), Positives = 98/107 (92%), Gaps = 0/107 (0%)
 Frame = +1

Query  202  GYDIGVMSGAAIYIQKDLKINDTQVEILLGILNLYSLIGSCMAGRTSDWIGRRYTMVVAS  381
            GYDIGVMSGAAIYI+  L ++D ++EI++GI+N +SL+GS +AGRTSDWIGRRYTMV+A 
Sbjct  7    GYDIGVMSGAAIYIKDQLHVSDVKLEIVVGIINFFSLVGSALAGRTSDWIGRRYTMVLAG  66

Query  382  VVFFVGAILMGFSTNYTFLMVGRFVAGIGVGYALMIAPVYTAEVAPA  522
             +FFVGAILMGF+TNY+FLM GRFVAGIGVGYALMIAPVYTAEV+PA
Sbjct  67   AIFFVGAILMGFATNYSFLMFGRFVAGIGVGYALMIAPVYTAEVSPA  113



>ref|NP_001060108.1| Os07g0582400 [Oryza sativa Japonica Group]
 gb|AAL14615.1|AF416867_1 putative sugar transporter [Oryza sativa]
 dbj|BAF22022.1| Os07g0582400 [Oryza sativa Japonica Group]
Length=577

 Score =   177 bits (448),  Expect = 9e-49, Method: Compositional matrix adjust.
 Identities = 98/140 (70%), Positives = 114/140 (81%), Gaps = 0/140 (0%)
 Frame = +1

Query  103  SGHIPAFDPPKKVKRNKYaiaaaflaslasillGYDIGVMSGAAIYIQKDLKINDTQVEI  282
            S  +P    PKK    ++A A A LAS+ SILLGYDIGVMSGA++YI+KD  I+D +VE+
Sbjct  70   SAALPEAVAPKKKGNVRFAFACAILASMTSILLGYDIGVMSGASLYIKKDFNISDGKVEV  129

Query  283  LLGILNLYSLIGSCMAGRTSDWIGRRYTMVVASVVFFVGAILMGFSTNYTFLMVGRFVAG  462
            L+GILNLYSLIGS  AGRTSDWIGRRYT+V A+V+FF GA LMGF+ NY  LM GRFVAG
Sbjct  130  LMGILNLYSLIGSFAAGRTSDWIGRRYTIVFAAVIFFAGAFLMGFAVNYAMLMFGRFVAG  189

Query  463  IGVGYALMIAPVYTAEVAPA  522
            IGVGYALMIAPVYTAEV+PA
Sbjct  190  IGVGYALMIAPVYTAEVSPA  209



>emb|CDP17999.1| unnamed protein product [Coffea canephora]
Length=503

 Score =   175 bits (444),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 91/135 (67%), Positives = 112/135 (83%), Gaps = 0/135 (0%)
 Frame = +1

Query  115  PAFDPPKKVKRNKYaiaaaflaslasillGYDIGVMSGAAIYIQKDLKINDTQVEILLGI  294
            P F PP K  +NKYA+  AFLA ++S+LLGY+ GVMSGA IYIQ+DLKI+D Q E+L GI
Sbjct  18   PDFGPPPKATKNKYALGCAFLACMSSVLLGYNAGVMSGAMIYIQRDLKISDVQKEVLGGI  77

Query  295  LNLYSLIGSCMAGRTSDWIGRRYTMVVASVVFFVGAILMGFSTNYTFLMVGRFVAGIGVG  474
            +N+YSL+GS +AGRT DW+GRRYT+ +A V+FF GA LM F+TNY FLMVG FVAGIGVG
Sbjct  78   INVYSLLGSAIAGRTCDWVGRRYTIAMAGVIFFAGAFLMAFATNYAFLMVGLFVAGIGVG  137

Query  475  YALMIAPVYTAEVAP  519
            Y LMIAPVY+AE++P
Sbjct  138  YGLMIAPVYSAEISP  152



>dbj|BAJ86526.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=520

 Score =   175 bits (444),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 93/134 (69%), Positives = 112/134 (84%), Gaps = 0/134 (0%)
 Frame = +1

Query  118  AFDPPKKVKRNKYaiaaaflaslasillGYDIGVMSGAAIYIQKDLKINDTQVEILLGIL  297
            A  P K+   NKYA A A LAS+ S+LLGYDI VMSGA +++++DLKI DTQ+EIL GI+
Sbjct  11   AMAPAKRPPINKYAFACALLASMNSVLLGYDISVMSGAQLFMKEDLKITDTQIEILAGII  70

Query  298  NLYSLIGSCMAGRTSDWIGRRYTMVVASVVFFVGAILMGFSTNYTFLMVGRFVAGIGVGY  477
            ++YSL+GS MAG TSDW+GRRYTMV+A+ +FF GA+LMG + NY FLM GRFVAGIGVGY
Sbjct  71   SIYSLLGSLMAGLTSDWLGRRYTMVLAAAIFFTGALLMGLAPNYAFLMAGRFVAGIGVGY  130

Query  478  ALMIAPVYTAEVAP  519
            ALMIAPVYTAEVAP
Sbjct  131  ALMIAPVYTAEVAP  144



>ref|XP_007042751.1| Polyol/monosaccharide transporter 5, putative [Theobroma cacao]
 gb|EOX98582.1| Polyol/monosaccharide transporter 5, putative [Theobroma cacao]
Length=532

 Score =   175 bits (443),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 94/134 (70%), Positives = 112/134 (84%), Gaps = 0/134 (0%)
 Frame = +1

Query  121  FDPPKKVKRNKYaiaaaflaslasillGYDIGVMSGAAIYIQKDLKINDTQVEILLGILN  300
            F+P  K KRN +A A A LASL +ILLGYDIGVMSGA I+I+KDLKIND QVEIL+GILN
Sbjct  24   FEPANKPKRNLFAFACAVLASLTTILLGYDIGVMSGAIIFIKKDLKINDVQVEILVGILN  83

Query  301  LYSLIGSCMAGRTSDWIGRRYTMVVASVVFFVGAILMGFSTNYTFLMVGRFVAGIGVGYA  480
            L  L+GS  AGRTSDWIGRRYT+V+A+ +FFVGA+LM F+TNY  LM GRF+ GIG G+A
Sbjct  84   LCCLVGSFAAGRTSDWIGRRYTIVLANAIFFVGALLMAFATNYALLMFGRFIGGIGAGFA  143

Query  481  LMIAPVYTAEVAPA  522
            +MIA VYTAE++PA
Sbjct  144  IMIALVYTAELSPA  157



>ref|XP_008245305.1| PREDICTED: polyol transporter 5-like [Prunus mume]
Length=511

 Score =   174 bits (442),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 90/133 (68%), Positives = 109/133 (82%), Gaps = 0/133 (0%)
 Frame = +1

Query  121  FDPPKKVKRNKYaiaaaflaslasillGYDIGVMSGAAIYIQKDLKINDTQVEILLGILN  300
            FDPP+K K NK+AIA + +A   SIL GYDIGVMSGA ++I+ DLKIND Q++I  G LN
Sbjct  9    FDPPQKPKINKFAIACSLMACTTSILHGYDIGVMSGAYLFIKDDLKINDLQIQIFTGTLN  68

Query  301  LYSLIGSCMAGRTSDWIGRRYTMVVASVVFFVGAILMGFSTNYTFLMVGRFVAGIGVGYA  480
            +YS+IGS +AGRTSDWIGR+YT V++  +FFVGAILMG +  Y FLM GRFVAGIGVGY 
Sbjct  69   IYSVIGSALAGRTSDWIGRQYTAVLSGAIFFVGAILMGVAPGYAFLMFGRFVAGIGVGYG  128

Query  481  LMIAPVYTAEVAP  519
            LMI+PVYTAE+AP
Sbjct  129  LMISPVYTAEIAP  141



>dbj|BAJ93158.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=520

 Score =   174 bits (442),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 94/140 (67%), Positives = 117/140 (84%), Gaps = 1/140 (1%)
 Frame = +1

Query  103  SGHIPAFDPP-KKVKRNKYaiaaaflaslasillGYDIGVMSGAAIYIQKDLKINDTQVE  279
            +  IPA + P K+   NKYA+A A LAS+ SILLGYD+ VMSGA I++++DL I DTQ+E
Sbjct  6    AADIPAAEAPAKRPPLNKYALACAILASMNSILLGYDVSVMSGAQIFMKRDLNITDTQIE  65

Query  280  ILLGILNLYSLIGSCMAGRTSDWIGRRYTMVVASVVFFVGAILMGFSTNYTFLMVGRFVA  459
            IL GI+N++SL+GS  AGRTSDWIGRRYTMV+ASV+FF GA++MG + +Y  LM+GRFVA
Sbjct  66   ILAGIINIFSLVGSLAAGRTSDWIGRRYTMVLASVIFFAGALIMGLAPSYAVLMLGRFVA  125

Query  460  GIGVGYALMIAPVYTAEVAP  519
            G+GVGYALMIAPVYTAEVAP
Sbjct  126  GVGVGYALMIAPVYTAEVAP  145



>ref|XP_008236797.1| PREDICTED: putative polyol transporter 2 [Prunus mume]
Length=531

 Score =   174 bits (442),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 101/156 (65%), Positives = 117/156 (75%), Gaps = 5/156 (3%)
 Frame = +1

Query  70   MGDTRPVRNAGSGH-----IPAFDPPKKVKRNKYaiaaaflaslasillGYDIGVMSGAA  234
            M D +   NA SG      I  FDPP+K   NK+AIA A LA + SILLGYDIGVMSGA 
Sbjct  4    MTDQKVEDNAVSGEPQNKRIADFDPPEKPNANKFAIACATLACMTSILLGYDIGVMSGAN  63

Query  235  IYIQKDLKINDTQVEILLGILNLYSLIGSCMAGRTSDWIGRRYTMVVASVVFFVGAILMG  414
            I+I+ DLKI D QVEIL G LN+YSLIGS +AG TSDWIGRRYT+V++  +FFVGAILMG
Sbjct  64   IFIKDDLKITDVQVEILAGTLNIYSLIGSGLAGVTSDWIGRRYTIVLSGTIFFVGAILMG  123

Query  415  FSTNYTFLMVGRFVAGIGVGYALMIAPVYTAEVAPA  522
             +  Y  LM GRFVAG+GVGY LMIAPVYT E++PA
Sbjct  124  VAPGYGLLMFGRFVAGVGVGYGLMIAPVYTVEISPA  159



>dbj|BAJ86116.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ97918.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=520

 Score =   174 bits (442),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 94/140 (67%), Positives = 117/140 (84%), Gaps = 1/140 (1%)
 Frame = +1

Query  103  SGHIPAFDPP-KKVKRNKYaiaaaflaslasillGYDIGVMSGAAIYIQKDLKINDTQVE  279
            +  IPA + P K+   NKYA+A A LAS+ SILLGYD+ VMSGA I++++DL I DTQ+E
Sbjct  6    AADIPAAEAPAKRPPLNKYALACAILASMNSILLGYDVSVMSGAQIFMKRDLNITDTQIE  65

Query  280  ILLGILNLYSLIGSCMAGRTSDWIGRRYTMVVASVVFFVGAILMGFSTNYTFLMVGRFVA  459
            IL GI+N++SL+GS  AGRTSDWIGRRYTMV+ASV+FF GA++MG + +Y  LM+GRFVA
Sbjct  66   ILAGIINIFSLVGSLAAGRTSDWIGRRYTMVLASVIFFAGALIMGLAPSYAVLMLGRFVA  125

Query  460  GIGVGYALMIAPVYTAEVAP  519
            G+GVGYALMIAPVYTAEVAP
Sbjct  126  GVGVGYALMIAPVYTAEVAP  145



>ref|XP_004985338.1| PREDICTED: polyol transporter 5-like isoform X2 [Setaria italica]
Length=504

 Score =   174 bits (441),  Expect = 4e-48, Method: Compositional matrix adjust.
 Identities = 94/144 (65%), Positives = 118/144 (82%), Gaps = 1/144 (1%)
 Frame = +1

Query  91   RNAGSGHIPAFDPPKKVKR-NKYaiaaaflaslasillGYDIGVMSGAAIYIQKDLKIND  267
            +   S  IPA + P K +  NKYA+A A LAS+ SILLGYD+ VMSGA +++++DLKI D
Sbjct  3    KQDASDGIPAAEAPAKRRPLNKYALACAILASMNSILLGYDVSVMSGAQLFMKQDLKITD  62

Query  268  TQVEILLGILNLYSLIGSCMAGRTSDWIGRRYTMVVASVVFFVGAILMGFSTNYTFLMVG  447
            TQ+EIL GI+N+YSL+GS  AGRTSDWIGRRYTMV+A+ +FF GA++MG + +Y  LM+G
Sbjct  63   TQIEILAGIINIYSLVGSLAAGRTSDWIGRRYTMVLAAAIFFAGALIMGLAPSYAILMLG  122

Query  448  RFVAGIGVGYALMIAPVYTAEVAP  519
            RFVAG+GVGYALMIAPVYTAEVAP
Sbjct  123  RFVAGVGVGYALMIAPVYTAEVAP  146



>ref|XP_002460923.1| hypothetical protein SORBIDRAFT_02g037570 [Sorghum bicolor]
 gb|EER97444.1| hypothetical protein SORBIDRAFT_02g037570 [Sorghum bicolor]
Length=510

 Score =   174 bits (441),  Expect = 4e-48, Method: Compositional matrix adjust.
 Identities = 97/140 (69%), Positives = 113/140 (81%), Gaps = 0/140 (0%)
 Frame = +1

Query  103  SGHIPAFDPPKKVKRNKYaiaaaflaslasillGYDIGVMSGAAIYIQKDLKINDTQVEI  282
            S  +P    P K    ++A A A LAS+ SILLGYDIGVMSGA++YI+KDL I D Q+EI
Sbjct  3    SAALPEAVEPGKKGNVRFAFACAILASMTSILLGYDIGVMSGASLYIKKDLGITDVQLEI  62

Query  283  LLGILNLYSLIGSCMAGRTSDWIGRRYTMVVASVVFFVGAILMGFSTNYTFLMVGRFVAG  462
            L+GILN+YSLIGS  AGRTSDWIGRRYT+V A+V+FF GA LMGF+ NY  LM GRFVAG
Sbjct  63   LMGILNVYSLIGSFAAGRTSDWIGRRYTIVFAAVIFFAGAFLMGFAVNYGMLMFGRFVAG  122

Query  463  IGVGYALMIAPVYTAEVAPA  522
            +GVGYALMIAPVYTAEV+PA
Sbjct  123  VGVGYALMIAPVYTAEVSPA  142



>ref|XP_004985337.1| PREDICTED: polyol transporter 5-like isoform X1 [Setaria italica]
Length=517

 Score =   174 bits (440),  Expect = 5e-48, Method: Compositional matrix adjust.
 Identities = 94/144 (65%), Positives = 118/144 (82%), Gaps = 1/144 (1%)
 Frame = +1

Query  91   RNAGSGHIPAFDPPKKVKR-NKYaiaaaflaslasillGYDIGVMSGAAIYIQKDLKIND  267
            +   S  IPA + P K +  NKYA+A A LAS+ SILLGYD+ VMSGA +++++DLKI D
Sbjct  3    KQDASDGIPAAEAPAKRRPLNKYALACAILASMNSILLGYDVSVMSGAQLFMKQDLKITD  62

Query  268  TQVEILLGILNLYSLIGSCMAGRTSDWIGRRYTMVVASVVFFVGAILMGFSTNYTFLMVG  447
            TQ+EIL GI+N+YSL+GS  AGRTSDWIGRRYTMV+A+ +FF GA++MG + +Y  LM+G
Sbjct  63   TQIEILAGIINIYSLVGSLAAGRTSDWIGRRYTMVLAAAIFFAGALIMGLAPSYAILMLG  122

Query  448  RFVAGIGVGYALMIAPVYTAEVAP  519
            RFVAG+GVGYALMIAPVYTAEVAP
Sbjct  123  RFVAGVGVGYALMIAPVYTAEVAP  146



>ref|NP_001281038.1| polyol transporter 5-like [Malus domestica]
 gb|AAO88965.1| sorbitol transporter [Malus domestica]
Length=481

 Score =   173 bits (438),  Expect = 6e-48, Method: Compositional matrix adjust.
 Identities = 80/107 (75%), Positives = 98/107 (92%), Gaps = 0/107 (0%)
 Frame = +1

Query  202  GYDIGVMSGAAIYIQKDLKINDTQVEILLGILNLYSLIGSCMAGRTSDWIGRRYTMVVAS  381
            GYDIGVMSGA+++I+++LKI+D QVEI+ G LNLYSLIGS +AGRTSDWIGRRYT+V+A 
Sbjct  7    GYDIGVMSGASLFIKENLKISDVQVEIMNGTLNLYSLIGSALAGRTSDWIGRRYTIVLAG  66

Query  382  VVFFVGAILMGFSTNYTFLMVGRFVAGIGVGYALMIAPVYTAEVAPA  522
             +FF+GA+LMGF+ NY FLM GRFVAG+GVGYALMIAPVYTAE++PA
Sbjct  67   TIFFIGALLMGFAPNYAFLMFGRFVAGVGVGYALMIAPVYTAEISPA  113



>ref|NP_001049269.1| Os03g0197100 [Oryza sativa Japonica Group]
 gb|ABF94464.1| mannitol transporter, putative, expressed [Oryza sativa Japonica 
Group]
 dbj|BAF11183.1| Os03g0197100 [Oryza sativa Japonica Group]
 gb|EAY88905.1| hypothetical protein OsI_10384 [Oryza sativa Indica Group]
 gb|EAZ25930.1| hypothetical protein OsJ_09774 [Oryza sativa Japonica Group]
 dbj|BAG91937.1| unnamed protein product [Oryza sativa Japonica Group]
Length=517

 Score =   173 bits (438),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 92/134 (69%), Positives = 109/134 (81%), Gaps = 0/134 (0%)
 Frame = +1

Query  118  AFDPPKKVKRNKYaiaaaflaslasillGYDIGVMSGAAIYIQKDLKINDTQVEILLGIL  297
            A  P K+   NKYA   A LAS+ S+LLGYDI VMSGA I++++DLKI DTQ+EIL G++
Sbjct  10   AVAPAKRPPINKYAFGCALLASMNSVLLGYDISVMSGAQIFMKEDLKITDTQIEILAGVI  69

Query  298  NLYSLIGSCMAGRTSDWIGRRYTMVVASVVFFVGAILMGFSTNYTFLMVGRFVAGIGVGY  477
            N+YSL GS  AG TSDW+GRRYTMV+A+ +FF GA+LMG + NY FLM GRFVAGIGVGY
Sbjct  70   NIYSLFGSLAAGMTSDWLGRRYTMVLAAAIFFTGALLMGLAPNYAFLMAGRFVAGIGVGY  129

Query  478  ALMIAPVYTAEVAP  519
            ALMIAPVYTAEVAP
Sbjct  130  ALMIAPVYTAEVAP  143



>ref|XP_011088761.1| PREDICTED: putative polyol transporter 1 [Sesamum indicum]
Length=336

 Score =   169 bits (428),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 83/107 (78%), Positives = 93/107 (87%), Gaps = 0/107 (0%)
 Frame = +1

Query  202  GYDIGVMSGAAIYIQKDLKINDTQVEILLGILNLYSLIGSCMAGRTSDWIGRRYTMVVAS  381
            GYDIGVMSGA IYIQKDL I D Q E+++GI +LYSLIGS +AG TSDWIGRR T+V+A 
Sbjct  15   GYDIGVMSGAIIYIQKDLHITDVQKEVIMGIFSLYSLIGSAVAGPTSDWIGRRLTIVLAG  74

Query  382  VVFFVGAILMGFSTNYTFLMVGRFVAGIGVGYALMIAPVYTAEVAPA  522
            V+FF GA+ MG +TNY FLMVGRFVAGIGVGYALMIAPVYTAEVAPA
Sbjct  75   VIFFFGALFMGLATNYAFLMVGRFVAGIGVGYALMIAPVYTAEVAPA  121



>ref|XP_003558585.1| PREDICTED: putative polyol transporter 1 [Brachypodium distachyon]
Length=526

 Score =   172 bits (437),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 92/134 (69%), Positives = 110/134 (82%), Gaps = 0/134 (0%)
 Frame = +1

Query  118  AFDPPKKVKRNKYaiaaaflaslasillGYDIGVMSGAAIYIQKDLKINDTQVEILLGIL  297
            A  P K+   NKYA A A LAS+ S+LLGYDI VMSGA +++++DLKI DTQ+EIL G++
Sbjct  16   AVAPAKRPPINKYAFACALLASMNSVLLGYDISVMSGAQLFMKEDLKITDTQIEILAGVI  75

Query  298  NLYSLIGSCMAGRTSDWIGRRYTMVVASVVFFVGAILMGFSTNYTFLMVGRFVAGIGVGY  477
            N+YSL GS  AG TSDW+GRRYTMV+A+ +FF GA+LMG + NY FLM GRFVAGIGVGY
Sbjct  76   NIYSLFGSLAAGLTSDWLGRRYTMVLAAAIFFTGALLMGLAPNYAFLMAGRFVAGIGVGY  135

Query  478  ALMIAPVYTAEVAP  519
            ALMIAPVYTAEVAP
Sbjct  136  ALMIAPVYTAEVAP  149



>ref|XP_008800420.1| PREDICTED: polyol transporter 5-like [Phoenix dactylifera]
Length=526

 Score =   172 bits (436),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 91/134 (68%), Positives = 110/134 (82%), Gaps = 0/134 (0%)
 Frame = +1

Query  118  AFDPPKKVKRNKYaiaaaflaslasillGYDIGVMSGAAIYIQKDLKINDTQVEILLGIL  297
            A + PKK  RNKYA+A A LAS+ SIL GYD  VMSGA+++IQK LKINDTQVEIL GI+
Sbjct  21   ALEKPKKPPRNKYALACATLASMISILSGYDGAVMSGASVFIQKYLKINDTQVEILAGII  80

Query  298  NLYSLIGSCMAGRTSDWIGRRYTMVVASVVFFVGAILMGFSTNYTFLMVGRFVAGIGVGY  477
            N ++L+GS  AGRTSDWIGRRYT++ A+ +F  GA+LMG + NY  LMVGR VAG+G+GY
Sbjct  81   NPFALVGSIAAGRTSDWIGRRYTIIFAAAIFLAGALLMGLAPNYAILMVGRLVAGVGIGY  140

Query  478  ALMIAPVYTAEVAP  519
            ALMIAPVYTAE+AP
Sbjct  141  ALMIAPVYTAEIAP  154



>ref|XP_010527168.1| PREDICTED: putative polyol transporter 1 [Tarenaya hassleriana]
Length=362

 Score =   169 bits (428),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 92/140 (66%), Positives = 115/140 (82%), Gaps = 2/140 (1%)
 Frame = +1

Query  103  SGHIPAFDPPKKVKRNKYaiaaaflaslasillGYDIGVMSGAAIYIQKDLKINDTQVEI  282
            +G + +  P +   R  YA A A LAS++SI+LGYDIGV+SGA+I+IQ DLK++D Q+EI
Sbjct  8    AGTVTSQQPDRS--RRLYATACAVLASMSSIVLGYDIGVVSGASIFIQDDLKLSDLQLEI  65

Query  283  LLGILNLYSLIGSCMAGRTSDWIGRRYTMVVASVVFFVGAILMGFSTNYTFLMVGRFVAG  462
             +GILNLYS++GS +AGRTSDWIGRRYT+V+A   F  GA+LMGF+TNY F+MVGRFVAG
Sbjct  66   FMGILNLYSIVGSGLAGRTSDWIGRRYTIVLAGCFFIAGALLMGFATNYPFIMVGRFVAG  125

Query  463  IGVGYALMIAPVYTAEVAPA  522
            IGVGY +MIAPVYT EVAPA
Sbjct  126  IGVGYGMMIAPVYTTEVAPA  145



>ref|XP_011088360.1| PREDICTED: polyol transporter 5-like [Sesamum indicum]
Length=522

 Score =   172 bits (436),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 97/153 (63%), Positives = 117/153 (76%), Gaps = 7/153 (5%)
 Frame = +1

Query  70   MGDTRPVRNAGSGHIPAFDP--PKKVKRNKYaiaaaflaslasillGYDIGVMSGAAIYI  243
            M + +P  NA       FDP  P K  RNK+A A +FLAS+ S+LLGYD+GVMSGA IYI
Sbjct  1    MAEEKPENNAAF-----FDPAAPPKPTRNKFATACSFLASMTSVLLGYDVGVMSGAIIYI  55

Query  244  QKDLKINDTQVEILLGILNLYSLIGSCMAGRTSDWIGRRYTMVVASVVFFVGAILMGFST  423
            Q+DL+I D Q E+++GI  LY+LIGS +AGR SD +GRR T+V A  +FF GA+ MG +T
Sbjct  56   QRDLQITDVQKEVIMGIFGLYALIGSAIAGRISDRVGRRLTIVFAGAIFFFGALFMGLAT  115

Query  424  NYTFLMVGRFVAGIGVGYALMIAPVYTAEVAPA  522
            NY FLMVGRFVAGIGVG+ALMIAPVYTAEVAPA
Sbjct  116  NYAFLMVGRFVAGIGVGHALMIAPVYTAEVAPA  148



>ref|XP_008465477.1| PREDICTED: polyol transporter 5-like [Cucumis melo]
Length=517

 Score =   172 bits (436),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 94/151 (62%), Positives = 120/151 (79%), Gaps = 1/151 (1%)
 Frame = +1

Query  70   MGDTRPVRNAGSGHIPAFDPPKKVKRNKYaiaaaflaslasillGYDIGVMSGAAIYIQK  249
            M D +   ++ S H  A  P  K KRN YA A + +AS+AS+LLGYDIGVMSGA I+IQK
Sbjct  1    MSDRQHETSSISYH-SAPPPATKPKRNYYAFACSTMASMASVLLGYDIGVMSGAVIFIQK  59

Query  250  DLKINDTQVEILLGILNLYSLIGSCMAGRTSDWIGRRYTMVVASVVFFVGAILMGFSTNY  429
            D KI+D ++EIL+GI++LY+++G+  AGRTSDWIGRRYTM +A+  FFVGAILMG STNY
Sbjct  60   DFKISDVKLEILVGIISLYAILGTAAAGRTSDWIGRRYTMGLAAAFFFVGAILMGLSTNY  119

Query  430  TFLMVGRFVAGIGVGYALMIAPVYTAEVAPA  522
            +FLM GRF AGIG+G+A +IAPVYT E++PA
Sbjct  120  SFLMFGRFFAGIGIGFASLIAPVYTTEISPA  150



>ref|XP_003558586.1| PREDICTED: polyol transporter 5-like [Brachypodium distachyon]
Length=521

 Score =   172 bits (436),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 91/129 (71%), Positives = 111/129 (86%), Gaps = 0/129 (0%)
 Frame = +1

Query  133  KKVKRNKYaiaaaflaslasillGYDIGVMSGAAIYIQKDLKINDTQVEILLGILNLYSL  312
            K+   NKYA+A A LAS+ SILLGYD+ VMSGA I+I+KDLK+ DT +EIL GI+N++SL
Sbjct  19   KRAPLNKYALACAVLASMNSILLGYDVSVMSGAQIFIKKDLKVTDTDIEILAGIINIFSL  78

Query  313  IGSCMAGRTSDWIGRRYTMVVASVVFFVGAILMGFSTNYTFLMVGRFVAGIGVGYALMIA  492
            +GS  AGRTSDWIGRRYTMV+A+V+FF GA++MG + +Y  LMVGRFVAG+GVGYALMIA
Sbjct  79   VGSLAAGRTSDWIGRRYTMVLAAVIFFAGALIMGLAPSYAVLMVGRFVAGVGVGYALMIA  138

Query  493  PVYTAEVAP  519
            PVYTAEVAP
Sbjct  139  PVYTAEVAP  147



>gb|KEH30425.1| polyol/monosaccharide transporter 1 [Medicago truncatula]
Length=472

 Score =   171 bits (433),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 78/101 (77%), Positives = 94/101 (93%), Gaps = 0/101 (0%)
 Frame = +1

Query  220  MSGAAIYIQKDLKINDTQVEILLGILNLYSLIGSCMAGRTSDWIGRRYTMVVASVVFFVG  399
            MSGAAIYI++DLK++D ++E+LLGI+N+YSLIGSC+AGRTSDWIGRRYT+V A  +FFVG
Sbjct  1    MSGAAIYIKRDLKVSDGKIEVLLGIINIYSLIGSCLAGRTSDWIGRRYTIVFAGAIFFVG  60

Query  400  AILMGFSTNYTFLMVGRFVAGIGVGYALMIAPVYTAEVAPA  522
            A+LMGFS NY FLM GRFVAG+G+GYALMIAPVYTAEV+PA
Sbjct  61   ALLMGFSPNYNFLMFGRFVAGVGIGYALMIAPVYTAEVSPA  101



>ref|XP_007200667.1| hypothetical protein PRUPE_ppa015294mg [Prunus persica]
 gb|EMJ01866.1| hypothetical protein PRUPE_ppa015294mg [Prunus persica]
Length=538

 Score =   172 bits (436),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 99/156 (63%), Positives = 117/156 (75%), Gaps = 5/156 (3%)
 Frame = +1

Query  70   MGDTRPVRNAGSGH-----IPAFDPPKKVKRNKYaiaaaflaslasillGYDIGVMSGAA  234
            M D +   NA SG      I  FDPP+K   +K+AIA A LA + SILLGYDIGVMSGA 
Sbjct  1    MTDRKVEDNAVSGEPQNKRIADFDPPEKPNASKFAIACATLACMTSILLGYDIGVMSGAN  60

Query  235  IYIQKDLKINDTQVEILLGILNLYSLIGSCMAGRTSDWIGRRYTMVVASVVFFVGAILMG  414
            I+I+ DLKI D QVE+L G LN+YSLIGS +AG TSDWIGRRYT+V++  +FF+GAILMG
Sbjct  61   IFIKDDLKITDVQVEVLAGTLNIYSLIGSGLAGVTSDWIGRRYTIVLSGTIFFIGAILMG  120

Query  415  FSTNYTFLMVGRFVAGIGVGYALMIAPVYTAEVAPA  522
             +  Y  LM GRFVAGIGVGY LMIAPVYT E++PA
Sbjct  121  VAPGYGLLMFGRFVAGIGVGYGLMIAPVYTVEISPA  156



>ref|XP_008447047.1| PREDICTED: polyol transporter 5-like [Cucumis melo]
Length=519

 Score =   172 bits (435),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 88/140 (63%), Positives = 112/140 (80%), Gaps = 0/140 (0%)
 Frame = +1

Query  103  SGHIPAFDPPKKVKRNKYaiaaaflaslasillGYDIGVMSGAAIYIQKDLKINDTQVEI  282
            +  I    PP   KRN YA   + +AS+AS+LLGYDIGVMSGAAI+IQ+D +I+D +VEI
Sbjct  20   TSSISDHSPPPAAKRNNYAFVCSTMASMASVLLGYDIGVMSGAAIFIQEDFRISDLEVEI  79

Query  283  LLGILNLYSLIGSCMAGRTSDWIGRRYTMVVASVVFFVGAILMGFSTNYTFLMVGRFVAG  462
            L+GI++LYS++GS  AGRTSDWIGRRYTM +A+  F VGA+LMG +TNY FLM GRF AG
Sbjct  80   LVGIISLYSILGSVAAGRTSDWIGRRYTMGIAAAFFLVGAVLMGLATNYAFLMFGRFFAG  139

Query  463  IGVGYALMIAPVYTAEVAPA  522
            +G G+A +IAPVYTAE++PA
Sbjct  140  VGTGFAGLIAPVYTAEISPA  159



>ref|XP_006649564.1| PREDICTED: polyol transporter 5-like [Oryza brachyantha]
Length=518

 Score =   172 bits (435),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 94/141 (67%), Positives = 117/141 (83%), Gaps = 1/141 (1%)
 Frame = +1

Query  103  SGHIPAFDPP-KKVKRNKYaiaaaflaslasillGYDIGVMSGAAIYIQKDLKINDTQVE  279
            S  IPA + P K+   NKYA+A A LAS+ SILLGYDI VMSGA  ++++DL I+DT++ 
Sbjct  6    SDEIPAAEAPAKRAPLNKYALACAVLASMNSILLGYDISVMSGAQKFMKEDLNISDTKIA  65

Query  280  ILLGILNLYSLIGSCMAGRTSDWIGRRYTMVVASVVFFVGAILMGFSTNYTFLMVGRFVA  459
            IL GI+N+YSL+GS  AGRTSDWIGRRYTMV+A+V+FF GA++MG + +Y  LM+GRFVA
Sbjct  66   ILAGIINIYSLVGSLAAGRTSDWIGRRYTMVLAAVIFFAGALIMGLAPSYAILMLGRFVA  125

Query  460  GIGVGYALMIAPVYTAEVAPA  522
            G+GVGYALMIAPVYTAEVAPA
Sbjct  126  GVGVGYALMIAPVYTAEVAPA  146



>ref|XP_010254895.1| PREDICTED: polyol transporter 5-like [Nelumbo nucifera]
Length=531

 Score =   171 bits (434),  Expect = 4e-47, Method: Compositional matrix adjust.
 Identities = 92/130 (71%), Positives = 111/130 (85%), Gaps = 0/130 (0%)
 Frame = +1

Query  130  PKKVKRNKYaiaaaflaslasillGYDIGVMSGAAIYIQKDLKINDTQVEILLGILNLYS  309
            P K +  ++A+A A +AS+ SILLGYDIGVMSGA I+I+ +L I DTQVEIL+G+ +LYS
Sbjct  18   PAKRQNKRFAMACATIASMVSILLGYDIGVMSGAVIFIKDNLHITDTQVEILVGVFHLYS  77

Query  310  LIGSCMAGRTSDWIGRRYTMVVASVVFFVGAILMGFSTNYTFLMVGRFVAGIGVGYALMI  489
            LIGS  AGRTSDWIGRR T++ A+V+FFVGA++MG + NY FLMVGRFVAGIGVGYALMI
Sbjct  78   LIGSTAAGRTSDWIGRRCTIIFAAVIFFVGALMMGLAPNYAFLMVGRFVAGIGVGYALMI  137

Query  490  APVYTAEVAP  519
            APVYTAEVAP
Sbjct  138  APVYTAEVAP  147



>ref|XP_006856085.1| hypothetical protein AMTR_s00059p00123280 [Amborella trichopoda]
 gb|ERN17552.1| hypothetical protein AMTR_s00059p00123280 [Amborella trichopoda]
Length=513

 Score =   171 bits (434),  Expect = 4e-47, Method: Compositional matrix adjust.
 Identities = 95/130 (73%), Positives = 112/130 (86%), Gaps = 0/130 (0%)
 Frame = +1

Query  133  KKVKRNKYaiaaaflaslasillGYDIGVMSGAAIYIQKDLKINDTQVEILLGILNLYSL  312
            +K +RNKYA+A A LAS+ SILLGYDIGVMSGA ++I+ DL IND +VEIL+G LN++SL
Sbjct  14   EKPQRNKYALACATLASMTSILLGYDIGVMSGAILFIKDDLHINDVEVEILVGSLNIFSL  73

Query  313  IGSCMAGRTSDWIGRRYTMVVASVVFFVGAILMGFSTNYTFLMVGRFVAGIGVGYALMIA  492
            IGS  AGRTSD+IGRRYT+V A  +FFVGA++MGF+ NY FLM GR VAGIGVGYALMIA
Sbjct  74   IGSAAAGRTSDYIGRRYTIVFAGGIFFVGALMMGFAPNYAFLMAGRVVAGIGVGYALMIA  133

Query  493  PVYTAEVAPA  522
            PVYTAEVAPA
Sbjct  134  PVYTAEVAPA  143



>ref|XP_007131748.1| hypothetical protein PHAVU_011G038700g [Phaseolus vulgaris]
 gb|ESW03742.1| hypothetical protein PHAVU_011G038700g [Phaseolus vulgaris]
Length=495

 Score =   171 bits (433),  Expect = 5e-47, Method: Compositional matrix adjust.
 Identities = 89/126 (71%), Positives = 109/126 (87%), Gaps = 0/126 (0%)
 Frame = +1

Query  124  DPPKKVKRNKYaiaaaflaslasillGYDIGVMSGAAIYIQKDLKINDTQVEILLGILNL  303
            DP  K KRNK+A+A A LAS+ SILLGYDIGVMSGAA+YIQ+DLK++D Q+EIL GI+NL
Sbjct  11   DPKNKPKRNKFALACAILASMTSILLGYDIGVMSGAALYIQRDLKVSDVQIEILSGIINL  70

Query  304  YSLIGSCMAGRTSDWIGRRYTMVVASVVFFVGAILMGFSTNYTFLMVGRFVAGIGVGYAL  483
            YS +GS +AGRTSDWIGRRYT+ +A V+FFVGAILMGFS NY FLM GRF AG+G+G+A 
Sbjct  71   YSPVGSFIAGRTSDWIGRRYTIALAGVIFFVGAILMGFSPNYAFLMFGRFFAGVGIGFAF  130

Query  484  MIAPVY  501
            +IAP++
Sbjct  131  LIAPIF  136



>ref|XP_008668471.1| PREDICTED: hypothetical protein isoform X1 [Zea mays]
 tpg|DAA43976.1| TPA: hypothetical protein ZEAMMB73_311171 [Zea mays]
Length=524

 Score =   171 bits (434),  Expect = 5e-47, Method: Compositional matrix adjust.
 Identities = 92/134 (69%), Positives = 111/134 (83%), Gaps = 0/134 (0%)
 Frame = +1

Query  118  AFDPPKKVKRNKYaiaaaflaslasillGYDIGVMSGAAIYIQKDLKINDTQVEILLGIL  297
            A  P K+   NKYA A A LAS+ S+LLGYDI VMSGA +++++DLKI DTQ+EIL G++
Sbjct  11   AVAPAKRPPINKYAFACALLASMNSVLLGYDISVMSGAQLFMKEDLKITDTQIEILAGVI  70

Query  298  NLYSLIGSCMAGRTSDWIGRRYTMVVASVVFFVGAILMGFSTNYTFLMVGRFVAGIGVGY  477
            N+YSL GS  AG TSDW+GRRYTMV+A+ +FF GA+LMGF+  Y FLMVGRFVAGIGVG+
Sbjct  71   NIYSLFGSLAAGLTSDWLGRRYTMVLAAAIFFTGALLMGFAPGYGFLMVGRFVAGIGVGF  130

Query  478  ALMIAPVYTAEVAP  519
            ALMIAPVYTAEVAP
Sbjct  131  ALMIAPVYTAEVAP  144



>gb|KCW62858.1| hypothetical protein EUGRSUZ_G00452 [Eucalyptus grandis]
Length=529

 Score =   171 bits (434),  Expect = 5e-47, Method: Compositional matrix adjust.
 Identities = 94/150 (63%), Positives = 117/150 (78%), Gaps = 2/150 (1%)
 Frame = +1

Query  70   MGDTRPVRNAGSGHIPAFDPPKKVKRNKYaiaaaflaslasillGYDIGVMSGAAIYIQK  249
            M D   V  A  G   A +  K  ++NKYA A A LAS+ S+LLGYD+GVMSGA I++ +
Sbjct  1    MADRNTV--AKDGISDAGNQRKSPRKNKYAFACAILASMTSVLLGYDVGVMSGAIIFVVE  58

Query  250  DLKINDTQVEILLGILNLYSLIGSCMAGRTSDWIGRRYTMVVASVVFFVGAILMGFSTNY  429
            +LKIN  +VE+L+G++NLYSL+GS MAGRTSDWIGRRYT+V++  +FF GA+LMG + NY
Sbjct  59   ELKINHVEVEVLMGVINLYSLVGSAMAGRTSDWIGRRYTIVLSGAIFFAGALLMGLAPNY  118

Query  430  TFLMVGRFVAGIGVGYALMIAPVYTAEVAP  519
             FLM GRFVAGIGVGY LMIAPVYTAEV+P
Sbjct  119  AFLMFGRFVAGIGVGYGLMIAPVYTAEVSP  148



>gb|EEE58504.1| hypothetical protein OsJ_09775 [Oryza sativa Japonica Group]
Length=521

 Score =   171 bits (433),  Expect = 6e-47, Method: Compositional matrix adjust.
 Identities = 93/140 (66%), Positives = 116/140 (83%), Gaps = 1/140 (1%)
 Frame = +1

Query  103  SGHIPAFDPP-KKVKRNKYaiaaaflaslasillGYDIGVMSGAAIYIQKDLKINDTQVE  279
            S  +PA + P K+   NKYA+A A LAS+ SILLGYDI VMSGA  +++KDL I+D +VE
Sbjct  6    SSDVPAAEAPAKRAPLNKYALACAILASMNSILLGYDISVMSGAQKFMKKDLNISDAKVE  65

Query  280  ILLGILNLYSLIGSCMAGRTSDWIGRRYTMVVASVVFFVGAILMGFSTNYTFLMVGRFVA  459
            +L GI+N+YSL+GS  AGRTSDWIGRRYTMV+ASV+FF GA++MG + +Y  +M+GRFVA
Sbjct  66   VLAGIINIYSLVGSLAAGRTSDWIGRRYTMVLASVIFFAGALIMGLAPSYAIVMLGRFVA  125

Query  460  GIGVGYALMIAPVYTAEVAP  519
            G+GVGYALMIAPVYTAEVAP
Sbjct  126  GVGVGYALMIAPVYTAEVAP  145



>gb|EAY88906.1| hypothetical protein OsI_10385 [Oryza sativa Indica Group]
Length=521

 Score =   171 bits (433),  Expect = 6e-47, Method: Compositional matrix adjust.
 Identities = 93/140 (66%), Positives = 116/140 (83%), Gaps = 1/140 (1%)
 Frame = +1

Query  103  SGHIPAFDPP-KKVKRNKYaiaaaflaslasillGYDIGVMSGAAIYIQKDLKINDTQVE  279
            S  +PA + P K+   NKYA+A A LAS+ SILLGYDI VMSGA  +++KDL I+D +VE
Sbjct  6    SSDVPAAEAPAKRAPLNKYALACAILASMNSILLGYDISVMSGAQKFMKKDLNISDAKVE  65

Query  280  ILLGILNLYSLIGSCMAGRTSDWIGRRYTMVVASVVFFVGAILMGFSTNYTFLMVGRFVA  459
            +L GI+N+YSL+GS  AGRTSDWIGRRYTMV+ASV+FF GA++MG + +Y  +M+GRFVA
Sbjct  66   VLAGIINIYSLVGSLAAGRTSDWIGRRYTMVLASVIFFAGALIMGLAPSYAIVMLGRFVA  125

Query  460  GIGVGYALMIAPVYTAEVAP  519
            G+GVGYALMIAPVYTAEVAP
Sbjct  126  GVGVGYALMIAPVYTAEVAP  145



>gb|AAN07021.1| putative mannitol transporter [Orobanche ramosa]
Length=519

 Score =   171 bits (433),  Expect = 6e-47, Method: Compositional matrix adjust.
 Identities = 95/144 (66%), Positives = 116/144 (81%), Gaps = 3/144 (2%)
 Frame = +1

Query  91   RNAGSGHIPAFDPPKKVKRNKYaiaaaflaslasillGYDIGVMSGAAIYIQKDLKINDT  270
            R+ GS      + PKK   N YA+  + +AS+ SILLGYD GVMSGA +YI+KDLKI D 
Sbjct  13   RSGGSPTKALINKPKK---NMYALLISVMASMTSILLGYDTGVMSGATLYIKKDLKITDV  69

Query  271  QVEILLGILNLYSLIGSCMAGRTSDWIGRRYTMVVASVVFFVGAILMGFSTNYTFLMVGR  450
            QVEIL+G++N+YSLIGS +AGRTSD++GRR T+V+ASV+FFVGA +MG + NY  LMVGR
Sbjct  70   QVEILVGLINIYSLIGSAVAGRTSDYLGRRITIVIASVIFFVGAAVMGLANNYAVLMVGR  129

Query  451  FVAGIGVGYALMIAPVYTAEVAPA  522
            FVAG+GVGYALMIAPVY AEVAPA
Sbjct  130  FVAGLGVGYALMIAPVYAAEVAPA  153



>ref|XP_004958139.1| PREDICTED: putative polyol transporter 1-like [Setaria italica]
Length=508

 Score =   171 bits (432),  Expect = 7e-47, Method: Compositional matrix adjust.
 Identities = 93/131 (71%), Positives = 108/131 (82%), Gaps = 0/131 (0%)
 Frame = +1

Query  130  PKKVKRNKYaiaaaflaslasillGYDIGVMSGAAIYIQKDLKINDTQVEILLGILNLYS  309
            PKK     YA   + LAS+ASI+LGYDIGVMSGAA+YI+KDLKI D Q+EIL+GILN YS
Sbjct  7    PKKKSNVTYAFICSILASMASIILGYDIGVMSGAALYIKKDLKITDVQLEILMGILNFYS  66

Query  310  LIGSCMAGRTSDWIGRRYTMVVASVVFFVGAILMGFSTNYTFLMVGRFVAGIGVGYALMI  489
            LIGS  AGRTSDWIGRR+T+VVA+  FF GA+LMG + +Y  LM GRFVAG+GVGY LMI
Sbjct  67   LIGSFAAGRTSDWIGRRFTVVVAAAFFFSGALLMGLAGDYATLMFGRFVAGVGVGYGLMI  126

Query  490  APVYTAEVAPA  522
            APVYTAEV+PA
Sbjct  127  APVYTAEVSPA  137



>gb|KCW55336.1| hypothetical protein EUGRSUZ_I01255 [Eucalyptus grandis]
Length=425

 Score =   169 bits (428),  Expect = 8e-47, Method: Compositional matrix adjust.
 Identities = 81/107 (76%), Positives = 95/107 (89%), Gaps = 0/107 (0%)
 Frame = +1

Query  202  GYDIGVMSGAAIYIQKDLKINDTQVEILLGILNLYSLIGSCMAGRTSDWIGRRYTMVVAS  381
            G +IGVMSGAAI I+K L +ND +VE+L+GI+NLYSL+GS +AGRTSDW+GRRYTMV+A 
Sbjct  11   GTNIGVMSGAAIPIKKQLHLNDVEVEVLVGIINLYSLLGSAVAGRTSDWVGRRYTMVIAG  70

Query  382  VVFFVGAILMGFSTNYTFLMVGRFVAGIGVGYALMIAPVYTAEVAPA  522
             +FFVGAILM F+ NY FLM GRFVAGIGVGYALMIAPVYTAEV+PA
Sbjct  71   AIFFVGAILMAFAFNYAFLMFGRFVAGIGVGYALMIAPVYTAEVSPA  117



>ref|XP_008795607.1| PREDICTED: polyol transporter 5-like isoform X2 [Phoenix dactylifera]
Length=487

 Score =   170 bits (430),  Expect = 9e-47, Method: Compositional matrix adjust.
 Identities = 79/105 (75%), Positives = 96/105 (91%), Gaps = 0/105 (0%)
 Frame = +1

Query  208  DIGVMSGAAIYIQKDLKINDTQVEILLGILNLYSLIGSCMAGRTSDWIGRRYTMVVASVV  387
            DIGVMSGAA++++ DL +NDTQ+EILLGILNL+S++GS  AGRTSDWIGRRYT+V A+V+
Sbjct  17   DIGVMSGAALFMKDDLHVNDTQIEILLGILNLFSIVGSLAAGRTSDWIGRRYTIVFAAVI  76

Query  388  FFVGAILMGFSTNYTFLMVGRFVAGIGVGYALMIAPVYTAEVAPA  522
            FFVGAI+MG + NY FLMVGRFVAG+GVGYAL+IAPVYT E+APA
Sbjct  77   FFVGAIMMGLAPNYAFLMVGRFVAGVGVGYALVIAPVYTTELAPA  121



>ref|XP_009378956.1| PREDICTED: putative polyol transporter 1 [Pyrus x bretschneideri]
Length=530

 Score =   171 bits (432),  Expect = 9e-47, Method: Compositional matrix adjust.
 Identities = 101/155 (65%), Positives = 125/155 (81%), Gaps = 4/155 (3%)
 Frame = +1

Query  70   MGDTRPVRNA--GSGH--IPAFDPPKKVKRNKYaiaaaflaslasillGYDIGVMSGAAI  237
            M D R   N   G  H  I  FDPPKK K  K+A+A A LAS+ SILLGYDIGVMSGA++
Sbjct  3    MADQRAENNVVFGQPHNSIADFDPPKKPKTKKFAVACAVLASMTSILLGYDIGVMSGASL  62

Query  238  YIQKDLKINDTQVEILLGILNLYSLIGSCMAGRTSDWIGRRYTMVVASVVFFVGAILMGF  417
            +I+++L I+D QVE+L G LN+YSLIGS +AG+TSDWIGRRYT+V+A  +FF+GA+LMGF
Sbjct  63   FIKENLNISDVQVEVLNGTLNIYSLIGSALAGKTSDWIGRRYTIVLAGTIFFIGALLMGF  122

Query  418  STNYTFLMVGRFVAGIGVGYALMIAPVYTAEVAPA  522
            + NY FLM GRF+AG+GVGYALMIAPVYTAE++PA
Sbjct  123  APNYAFLMFGRFIAGVGVGYALMIAPVYTAEISPA  157



>ref|XP_009342008.1| PREDICTED: putative polyol transporter 1 [Pyrus x bretschneideri]
Length=527

 Score =   170 bits (431),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 100/155 (65%), Positives = 124/155 (80%), Gaps = 4/155 (3%)
 Frame = +1

Query  70   MGDTRPVRNAGSGH----IPAFDPPKKVKRNKYaiaaaflaslasillGYDIGVMSGAAI  237
            M D R   N   G     I  FDPPKK K  K+A+A A LAS+ SILLGYDIGVMSGA++
Sbjct  1    MADQRAENNVVFGQPQNSIADFDPPKKPKTKKFAVACAVLASMTSILLGYDIGVMSGASL  60

Query  238  YIQKDLKINDTQVEILLGILNLYSLIGSCMAGRTSDWIGRRYTMVVASVVFFVGAILMGF  417
            +I+++L I+D QVE+L G LN+YSLIGS +AG+TSDWIGRRYT+V+A  +FF+GA+LMGF
Sbjct  61   FIKENLNISDVQVEVLNGTLNIYSLIGSALAGKTSDWIGRRYTIVLAGTIFFIGALLMGF  120

Query  418  STNYTFLMVGRFVAGIGVGYALMIAPVYTAEVAPA  522
            + NY FLM GRF+AG+GVGYALMIAPVYTAE++PA
Sbjct  121  APNYAFLMFGRFIAGVGVGYALMIAPVYTAEISPA  155



>ref|XP_009342010.1| PREDICTED: putative polyol transporter 1 [Pyrus x bretschneideri]
Length=529

 Score =   170 bits (431),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 101/155 (65%), Positives = 124/155 (80%), Gaps = 4/155 (3%)
 Frame = +1

Query  70   MGDTRPVRNAGSGH----IPAFDPPKKVKRNKYaiaaaflaslasillGYDIGVMSGAAI  237
            M D R   N   G     I  FDPPKK K  K+AIA A LAS+ SILLGYDIGVMSGA++
Sbjct  3    MADQRAENNVVFGQHQNSIADFDPPKKPKTKKFAIACAVLASMTSILLGYDIGVMSGASL  62

Query  238  YIQKDLKINDTQVEILLGILNLYSLIGSCMAGRTSDWIGRRYTMVVASVVFFVGAILMGF  417
            +I+++L I+D QVE+L G LN+YSLIGS +AG+TSDWIGRRYT+V+A  +FF+GA+LMGF
Sbjct  63   FIKENLNISDVQVEVLNGTLNIYSLIGSALAGKTSDWIGRRYTIVLAGTIFFIGALLMGF  122

Query  418  STNYTFLMVGRFVAGIGVGYALMIAPVYTAEVAPA  522
            + NY FLM GRF+AG+GVGYALMIAPVYTAE++PA
Sbjct  123  APNYAFLMFGRFIAGVGVGYALMIAPVYTAEISPA  157



>ref|XP_009350912.1| PREDICTED: putative polyol transporter 1 [Pyrus x bretschneideri]
Length=527

 Score =   170 bits (431),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 100/155 (65%), Positives = 124/155 (80%), Gaps = 4/155 (3%)
 Frame = +1

Query  70   MGDTRPVRNAGSGH----IPAFDPPKKVKRNKYaiaaaflaslasillGYDIGVMSGAAI  237
            M D R   N   G     I  FDPPKK K  K+A+A A LAS+ SILLGYDIGVMSGA++
Sbjct  1    MADQRAENNVVFGQPQNSIADFDPPKKPKTKKFAVACAVLASMTSILLGYDIGVMSGASL  60

Query  238  YIQKDLKINDTQVEILLGILNLYSLIGSCMAGRTSDWIGRRYTMVVASVVFFVGAILMGF  417
            +I+++L I+D QVE+L G LN+YSLIGS +AG+TSDWIGRRYT+V+A  +FF+GA+LMGF
Sbjct  61   FIKENLNISDVQVEVLNGTLNIYSLIGSALAGKTSDWIGRRYTIVLAGTIFFIGALLMGF  120

Query  418  STNYTFLMVGRFVAGIGVGYALMIAPVYTAEVAPA  522
            + NY FLM GRF+AG+GVGYALMIAPVYTAE++PA
Sbjct  121  APNYAFLMFGRFIAGVGVGYALMIAPVYTAEISPA  155



>ref|XP_010527595.1| PREDICTED: polyol transporter 5-like [Tarenaya hassleriana]
Length=334

 Score =   166 bits (420),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 83/130 (64%), Positives = 109/130 (84%), Gaps = 0/130 (0%)
 Frame = +1

Query  133  KKVKRNKYaiaaaflaslasillGYDIGVMSGAAIYIQKDLKINDTQVEILLGILNLYSL  312
            ++ KRN++    A L S+  ILLGYDIGVMSGA IYI++D+K++D Q+EIL+GIL++YSL
Sbjct  8    ERPKRNRFPFVCAILVSMILILLGYDIGVMSGAIIYIKRDMKLSDVQIEILVGILSIYSL  67

Query  313  IGSCMAGRTSDWIGRRYTMVVASVVFFVGAILMGFSTNYTFLMVGRFVAGIGVGYALMIA  492
            +GS +AGRTSDWIGRRYT+V+A  +FF GA+LMGF+T+Y FLM GRFVAG  +G+A MIA
Sbjct  68   VGSSLAGRTSDWIGRRYTIVLAGGIFFAGALLMGFATDYAFLMFGRFVAGFSIGFAGMIA  127

Query  493  PVYTAEVAPA  522
            PVY AE++PA
Sbjct  128  PVYIAEISPA  137



>ref|NP_001150711.1| LOC100284344 [Zea mays]
 gb|ACG40102.1| polyol transporter protein 4 [Zea mays]
 gb|AFW89354.1| polyol transporter protein 4 [Zea mays]
Length=531

 Score =   170 bits (430),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 92/143 (64%), Positives = 115/143 (80%), Gaps = 1/143 (1%)
 Frame = +1

Query  94   NAGSGHIP-AFDPPKKVKRNKYaiaaaflaslasillGYDIGVMSGAAIYIQKDLKINDT  270
            + G+  +P A  P K+   NKYA A A LAS+ S+LLGYDI VMSGA +++++DLKI DT
Sbjct  2    STGTDAVPVAVAPAKRPPINKYAFACALLASMNSVLLGYDISVMSGAQLFMKEDLKITDT  61

Query  271  QVEILLGILNLYSLIGSCMAGRTSDWIGRRYTMVVASVVFFVGAILMGFSTNYTFLMVGR  450
            Q+EIL G++N+YSL GS  AG TSDW+GRRYTMV+A+ +FF GA+LMG + +Y FLM GR
Sbjct  62   QIEILAGVINIYSLFGSLAAGLTSDWLGRRYTMVLAAAIFFTGALLMGLAPDYGFLMAGR  121

Query  451  FVAGIGVGYALMIAPVYTAEVAP  519
            FVAGIGVG+ALMIAPVYTAEVAP
Sbjct  122  FVAGIGVGFALMIAPVYTAEVAP  144



>ref|XP_006649563.1| PREDICTED: polyol transporter 5-like [Oryza brachyantha]
Length=521

 Score =   170 bits (430),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 90/129 (70%), Positives = 107/129 (83%), Gaps = 0/129 (0%)
 Frame = +1

Query  133  KKVKRNKYaiaaaflaslasillGYDIGVMSGAAIYIQKDLKINDTQVEILLGILNLYSL  312
            K+   NKYA   A LAS+ S+LLGYDI VMSGA I++++DLKI DTQ+EIL G++N+YSL
Sbjct  16   KRPPINKYAFGCALLASMNSVLLGYDISVMSGAQIFMKEDLKITDTQIEILAGVINIYSL  75

Query  313  IGSCMAGRTSDWIGRRYTMVVASVVFFVGAILMGFSTNYTFLMVGRFVAGIGVGYALMIA  492
             GS  AG TSDW+GRRYTMV+A+ +FF GA+LMG + NY FLM GRFVAGIGVGYALMIA
Sbjct  76   FGSLAAGLTSDWLGRRYTMVLAAAIFFTGALLMGLAPNYAFLMAGRFVAGIGVGYALMIA  135

Query  493  PVYTAEVAP  519
            PVYTAEVAP
Sbjct  136  PVYTAEVAP  144



>ref|XP_003562818.1| PREDICTED: polyol transporter 5-like [Brachypodium distachyon]
Length=514

 Score =   169 bits (429),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 90/141 (64%), Positives = 113/141 (80%), Gaps = 1/141 (1%)
 Frame = +1

Query  100  GSGHIPAFDPPKKVKRNKYaiaaaflaslasillGYDIGVMSGAAIYIQKDLKINDTQVE  279
             S  +P    PKK    KYA   + LAS+A+I+LGYD+GVMSGA++YI+KDL+I D QVE
Sbjct  7    ASASLPEAVEPKK-SNFKYAFTCSILASMATIVLGYDVGVMSGASLYIKKDLQITDVQVE  65

Query  280  ILLGILNLYSLIGSCMAGRTSDWIGRRYTMVVASVVFFVGAILMGFSTNYTFLMVGRFVA  459
            IL+GIL+LY+L+GS  A RTSDWIGRR T+V A+ +FF G++LMGF+ NY  LMVGRFV 
Sbjct  66   ILIGILSLYALVGSFAASRTSDWIGRRVTVVFAATIFFTGSLLMGFAVNYAMLMVGRFVT  125

Query  460  GIGVGYALMIAPVYTAEVAPA  522
            GIGVGYA+M+APVYTAEV+PA
Sbjct  126  GIGVGYAIMVAPVYTAEVSPA  146



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 564104274800