BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFF035A23

Length=571
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_004247828.1|  PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxi...    292   2e-93   
ref|XP_009619812.1|  PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxi...    291   2e-93   Nicotiana tomentosiformis
ref|XP_006360332.1|  PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxi...    291   5e-93   Solanum tuberosum [potatoes]
ref|XP_009784398.1|  PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxi...    290   8e-93   Nicotiana sylvestris
gb|ACV70033.1|  3-ketoacyl CoA thiolase 2                               286   3e-91   Petunia x hybrida [garden petunia]
gb|EYU32624.1|  hypothetical protein MIMGU_mgv1a005944mg                286   4e-91   Erythranthe guttata [common monkey flower]
gb|AGC59769.1|  3-ketoacyl-CoA thiolase 1                               285   1e-90   Rehmannia glutinosa [Chinese foxglove]
gb|AGC24176.1|  3-ketoacyl-CoA thiolase 2                               284   1e-90   Rehmannia glutinosa [Chinese foxglove]
gb|AAL25590.1|  At2g33150/F25I18.11                                     277   1e-88   Arabidopsis thaliana [mouse-ear cress]
ref|XP_011073762.1|  PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxi...    279   2e-88   Sesamum indicum [beniseed]
gb|KDO43603.1|  hypothetical protein CISIN_1g012506mg                   277   3e-88   Citrus sinensis [apfelsine]
ref|XP_008457258.1|  PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxi...    278   4e-88   Cucumis melo [Oriental melon]
gb|KDO43602.1|  hypothetical protein CISIN_1g012506mg                   275   7e-88   Citrus sinensis [apfelsine]
gb|KCW57292.1|  hypothetical protein EUGRSUZ_H00090                     274   1e-87   Eucalyptus grandis [rose gum]
gb|KDO43601.1|  hypothetical protein CISIN_1g012506mg                   275   3e-87   Citrus sinensis [apfelsine]
ref|NP_180873.1|  3-ketoacyl-CoA thiolase 2                             276   3e-87   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002881265.1|  hypothetical protein ARALYDRAFT_482251             275   4e-87   
ref|XP_010522426.1|  PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxi...    275   4e-87   Tarenaya hassleriana [spider flower]
ref|XP_006420604.1|  hypothetical protein CICLE_v10004931mg             275   4e-87   Citrus clementina [clementine]
ref|NP_001267690.1|  3-ketoacyl-CoA thiolase 2, peroxisomal-like        275   5e-87   Cucumis sativus [cucumbers]
ref|XP_010069076.1|  PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxi...    274   2e-86   Eucalyptus grandis [rose gum]
ref|XP_006294172.1|  hypothetical protein CARUB_v10023167mg             273   3e-86   Capsella rubella
emb|CAA53078.1|  3-ketoacyl-CoA thiolase B                              271   5e-86   Mangifera indica
gb|AAQ77242.1|  acetoacetyl CoA thiolase                                270   2e-85   Helianthus annuus
ref|XP_010556945.1|  PREDICTED: LOW QUALITY PROTEIN: 3-ketoacyl-C...    271   3e-85   Tarenaya hassleriana [spider flower]
emb|CDO99410.1|  unnamed protein product                                270   3e-85   Coffea canephora [robusta coffee]
ref|XP_007034449.1|  Peroxisomal 3-ketoacyl-CoA thiolase 3 isoform 1    270   4e-85   
ref|XP_009132912.1|  PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxi...    270   7e-85   Brassica rapa
ref|XP_011091395.1|  PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxi...    268   2e-84   Sesamum indicum [beniseed]
emb|CDY19452.1|  BnaC04g11470D                                          268   3e-84   Brassica napus [oilseed rape]
ref|XP_009143894.1|  PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxi...    268   3e-84   Brassica rapa
ref|XP_010413914.1|  PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxi...    268   4e-84   Camelina sativa [gold-of-pleasure]
ref|XP_010509924.1|  PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxi...    268   5e-84   Camelina sativa [gold-of-pleasure]
emb|CAN81585.1|  hypothetical protein VITISV_023191                     267   5e-84   Vitis vinifera
ref|XP_010243983.1|  PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxi...    267   6e-84   Nelumbo nucifera [Indian lotus]
ref|XP_002299284.2|  hypothetical protein POPTR_0001s14280g             267   8e-84   Populus trichocarpa [western balsam poplar]
ref|XP_011002175.1|  PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxi...    266   1e-83   Populus euphratica
gb|KJB72151.1|  hypothetical protein B456_011G161700                    265   1e-83   Gossypium raimondii
ref|XP_002285653.1|  PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxi...    266   1e-83   Vitis vinifera
ref|XP_006410451.1|  hypothetical protein EUTSA_v10016622mg             266   1e-83   Eutrema salsugineum [saltwater cress]
gb|KHG05724.1|  3-ketoacyl-CoA thiolase 2, peroxisomal -like protein    266   1e-83   Gossypium arboreum [tree cotton]
emb|CDY37750.1|  BnaA04g19180D                                          266   2e-83   Brassica napus [oilseed rape]
emb|CAA63598.1|  glyoxysomal beta-ketoacyl-thiolase                     265   4e-83   Brassica napus [oilseed rape]
gb|KJB72150.1|  hypothetical protein B456_011G161700                    265   4e-83   Gossypium raimondii
gb|KJB72152.1|  hypothetical protein B456_011G161700                    264   6e-83   Gossypium raimondii
emb|CDY23766.1|  BnaC04g43560D                                          265   7e-83   Brassica napus [oilseed rape]
ref|XP_008224585.1|  PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxi...    265   7e-83   Prunus mume [ume]
gb|EPS68937.1|  hypothetical protein M569_05826                         264   7e-83   Genlisea aurea
ref|XP_009141289.1|  PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxi...    264   7e-83   Brassica rapa
emb|CDX84701.1|  BnaA03g15290D                                          264   8e-83   
emb|CDX79511.1|  BnaC03g18470D                                          264   8e-83   
ref|XP_007225742.1|  hypothetical protein PRUPE_ppa005421mg             264   9e-83   Prunus persica
ref|XP_010935683.1|  PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxi...    264   9e-83   Elaeis guineensis
pir||S72532  acetyl-CoA C-acyltransferase (EC 2.3.1.16) precursor...    264   1e-82   
gb|ACU21519.1|  unknown                                                 260   1e-82   Glycine max [soybeans]
ref|XP_008438387.1|  PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxi...    264   1e-82   Cucumis melo [Oriental melon]
ref|XP_008372446.1|  PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxi...    263   2e-82   
gb|KDP20330.1|  hypothetical protein JCGZ_06416                         263   3e-82   Jatropha curcas
ref|XP_011020687.1|  PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxi...    261   1e-81   Populus euphratica
ref|XP_009371217.1|  PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxi...    261   1e-81   Pyrus x bretschneideri [bai li]
ref|XP_011020688.1|  PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxi...    261   2e-81   Populus euphratica
ref|XP_009385864.1|  PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxi...    260   4e-81   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_011083116.1|  PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxi...    259   1e-80   Sesamum indicum [beniseed]
ref|NP_001238475.1|  peroxisomal 3-ketoacyl-CoA thiolase                258   2e-80   Glycine max [soybeans]
ref|XP_010469514.1|  PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxi...    258   2e-80   Camelina sativa [gold-of-pleasure]
ref|XP_008800565.1|  PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxi...    258   2e-80   Phoenix dactylifera
gb|ACV70032.1|  3-ketoacyl CoA thiolase 1                               258   3e-80   Petunia x hybrida [garden petunia]
ref|XP_004138952.1|  PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxi...    257   4e-80   Cucumis sativus [cucumbers]
ref|XP_004164123.1|  PREDICTED: LOW QUALITY PROTEIN: 3-ketoacyl-C...    257   4e-80   
ref|XP_010696158.1|  PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxi...    257   4e-80   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_004296638.1|  PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxi...    257   5e-80   Fragaria vesca subsp. vesca
ref|XP_008804745.1|  PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxi...    255   2e-79   Phoenix dactylifera
gb|KDP26413.1|  hypothetical protein JCGZ_17571                         254   4e-79   Jatropha curcas
gb|KDO43599.1|  hypothetical protein CISIN_1g012506mg                   254   5e-79   Citrus sinensis [apfelsine]
ref|XP_006605730.1|  PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxi...    253   6e-79   
ref|XP_009336051.1|  PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxi...    254   7e-79   
ref|XP_004247103.1|  PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxi...    253   2e-78   
ref|XP_008235516.1|  PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxi...    252   4e-78   Prunus mume [ume]
ref|XP_003555712.1|  PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxi...    252   4e-78   Glycine max [soybeans]
gb|ACJ84483.1|  unknown                                                 246   4e-78   Medicago truncatula
ref|XP_009796304.1|  PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxi...    252   6e-78   Nicotiana sylvestris
ref|XP_006350308.1|  PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxi...    251   6e-78   Solanum tuberosum [potatoes]
ref|XP_009629663.1|  PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxi...    252   7e-78   Nicotiana tomentosiformis
gb|KDO65878.1|  hypothetical protein CISIN_1g0125222mg                  247   9e-78   Citrus sinensis [apfelsine]
gb|KDO65876.1|  hypothetical protein CISIN_1g0125222mg                  247   3e-77   Citrus sinensis [apfelsine]
ref|XP_004290230.1|  PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxi...    249   5e-77   Fragaria vesca subsp. vesca
ref|XP_007201004.1|  hypothetical protein PRUPE_ppa005303mg             249   5e-77   Prunus persica
ref|XP_009411367.1|  PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxi...    249   9e-77   Musa acuminata subsp. malaccensis [pisang utan]
gb|AFW74040.1|  hypothetical protein ZEAMMB73_080325                    246   9e-77   
ref|XP_009400955.1|  PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxi...    248   9e-77   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_006649171.1|  PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxi...    248   1e-76   Oryza brachyantha
gb|KDO65875.1|  hypothetical protein CISIN_1g0125222mg                  246   2e-76   Citrus sinensis [apfelsine]
ref|XP_010940650.1|  PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxi...    248   2e-76   Elaeis guineensis
ref|XP_006854408.1|  hypothetical protein AMTR_s00039p00196630          248   2e-76   Amborella trichopoda
gb|AFW74041.1|  hypothetical protein ZEAMMB73_080325                    245   5e-76   
ref|XP_010099126.1|  3-ketoacyl-CoA thiolase 2                          246   6e-76   
pdb|2WUA|A  Chain A, Structure Of The Peroxisomal 3-Ketoacyl-Coa ...    246   6e-76   Helianthus annuus
ref|NP_001131193.1|  acetyl-CoA C-acyltransferase-like protein          246   1e-75   Zea mays [maize]
gb|ACN39947.1|  unknown                                                 246   1e-75   Picea sitchensis
ref|NP_001241698.1|  3-ketoacyl-CoA thiolase 2, peroxisomal precu...    246   1e-75   
gb|KEH41248.1|  3-ketoacyl-CoA thiolase 2, peroxisomal-like protein     246   1e-75   Medicago truncatula
emb|CDP03848.1|  unnamed protein product                                246   1e-75   Coffea canephora [robusta coffee]
ref|XP_006443651.1|  hypothetical protein CICLE_v10020068mg             245   2e-75   Citrus clementina [clementine]
ref|XP_002974835.1|  hypothetical protein SELMODRAFT_101898             245   2e-75   
ref|XP_002963753.1|  hypothetical protein SELMODRAFT_450889             245   2e-75   Selaginella moellendorffii
gb|ABR16781.1|  unknown                                                 245   2e-75   Picea sitchensis
ref|XP_011006998.1|  PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxi...    244   5e-75   Populus euphratica
ref|XP_010933143.1|  PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxi...    244   6e-75   Elaeis guineensis
ref|XP_003570403.1|  PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxi...    244   7e-75   Brachypodium distachyon [annual false brome]
ref|XP_009376354.1|  PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxi...    243   8e-75   Pyrus x bretschneideri [bai li]
ref|XP_008804452.1|  PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxi...    243   9e-75   Phoenix dactylifera
ref|XP_002301570.1|  hypothetical protein POPTR_0002s22410g             243   1e-74   Populus trichocarpa [western balsam poplar]
ref|XP_010457531.1|  PREDICTED: 3-ketoacyl-CoA thiolase 1, peroxi...    243   1e-74   Camelina sativa [gold-of-pleasure]
gb|KHG13200.1|  3-ketoacyl-CoA thiolase 2, peroxisomal -like protein    243   1e-74   Gossypium arboreum [tree cotton]
ref|XP_002518136.1|  3-ketoacyl-CoA thiolase B, putative                243   2e-74   
dbj|BAJ87577.1|  predicted protein                                      242   2e-74   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|EYU17978.1|  hypothetical protein MIMGU_mgv1a005895mg                243   2e-74   Erythranthe guttata [common monkey flower]
ref|XP_010109695.1|  3-ketoacyl-CoA thiolase 2                          242   3e-74   Morus notabilis
ref|XP_008380600.1|  PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxi...    242   3e-74   Malus domestica [apple tree]
ref|XP_010475137.1|  PREDICTED: 3-ketoacyl-CoA thiolase 1, peroxi...    241   5e-74   Camelina sativa [gold-of-pleasure]
ref|XP_004497755.1|  PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxi...    241   6e-74   Cicer arietinum [garbanzo]
dbj|BAJ85217.1|  predicted protein                                      239   8e-74   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_010684942.1|  PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxi...    240   2e-73   Beta vulgaris subsp. vulgaris [field beet]
gb|ABR17647.1|  unknown                                                 240   2e-73   Picea sitchensis
ref|XP_002521123.1|  3-ketoacyl-CoA thiolase B, putative                240   3e-73   Ricinus communis
ref|XP_007145410.1|  hypothetical protein PHAVU_007G236600g             239   6e-73   Phaseolus vulgaris [French bean]
gb|EMT31542.1|  3-ketoacyl-CoA thiolase 2, peroxisomal                  238   7e-73   
dbj|BAI66423.1|  3-ketoacyl-CoA thiolase-like protein                   238   7e-73   Triticum aestivum [Canadian hard winter wheat]
pdb|2WU9|A  Chain A, Crystal Structure Of Peroxisomal Kat2 From A...    238   1e-72   Arabidopsis thaliana [mouse-ear cress]
ref|XP_004954382.1|  PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxi...    238   1e-72   Setaria italica
gb|KJB10129.1|  hypothetical protein B456_001G185200                    236   1e-72   Gossypium raimondii
ref|XP_010484150.1|  PREDICTED: 3-ketoacyl-CoA thiolase 1, peroxi...    237   2e-72   Camelina sativa [gold-of-pleasure]
ref|XP_010484155.1|  PREDICTED: 3-ketoacyl-CoA thiolase 1, peroxi...    237   2e-72   Camelina sativa [gold-of-pleasure]
ref|XP_001764272.1|  predicted protein                                  236   9e-72   
pdb|2C7Y|A  Chain A, Plant Enzyme                                       234   1e-71   Arabidopsis thaliana [mouse-ear cress]
gb|KJB10128.1|  hypothetical protein B456_001G185200                    235   2e-71   Gossypium raimondii
gb|AAM61609.1|  putative acetyl-CoA acyltransferase                     234   4e-71   Arabidopsis thaliana [mouse-ear cress]
ref|NP_171965.1|  3-ketoacyl-CoA thiolase 1                             233   4e-71   Arabidopsis thaliana [mouse-ear cress]
emb|CDX86611.1|  BnaC08g00920D                                          233   6e-71   
ref|XP_003604976.1|  3-ketoacyl-CoA thiolase 2, peroxisomal             233   6e-71   Medicago truncatula
ref|XP_006368897.1|  hypothetical protein POPTR_0001s14290g             233   1e-70   
gb|KCW50169.1|  hypothetical protein EUGRSUZ_K03601                     231   1e-70   Eucalyptus grandis [rose gum]
ref|XP_009384048.1|  PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxi...    232   2e-70   Musa acuminata subsp. malaccensis [pisang utan]
gb|KCW50170.1|  hypothetical protein EUGRSUZ_K03601                     231   2e-70   Eucalyptus grandis [rose gum]
ref|XP_011034453.1|  PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxi...    232   2e-70   Populus euphratica
ref|XP_011002176.1|  PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxi...    231   3e-70   Populus euphratica
gb|AFK40880.1|  unknown                                                 231   3e-70   Medicago truncatula
ref|XP_009111084.1|  PREDICTED: 3-ketoacyl-CoA thiolase 1, peroxi...    231   4e-70   Brassica rapa
ref|XP_006307516.1|  hypothetical protein CARUB_v10009140mg             226   6e-70   
gb|AEQ94132.1|  putative 3-ketoacyl CoA thiolase                        227   7e-70   Elaeis guineensis
gb|ACN29136.1|  unknown                                                 230   1e-69   Zea mays [maize]
ref|XP_010038353.1|  PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxi...    230   1e-69   Eucalyptus grandis [rose gum]
gb|KHG11493.1|  3-ketoacyl-CoA thiolase 2, peroxisomal -like protein    230   1e-69   Gossypium arboreum [tree cotton]
gb|KCW50166.1|  hypothetical protein EUGRSUZ_K03601                     230   2e-69   Eucalyptus grandis [rose gum]
ref|NP_001048523.1|  Os02g0817700                                       229   2e-69   
gb|KFK42814.1|  hypothetical protein AALP_AA1G042000                    229   2e-69   Arabis alpina [alpine rockcress]
ref|XP_007153157.1|  hypothetical protein PHAVU_003G011600g             229   3e-69   Phaseolus vulgaris [French bean]
ref|XP_003632434.2|  PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxi...    228   3e-69   
gb|KHN15993.1|  3-ketoacyl-CoA thiolase 2, peroxisomal                  228   4e-69   Glycine soja [wild soybean]
gb|KJB42404.1|  hypothetical protein B456_007G152600                    228   8e-69   Gossypium raimondii
gb|KJB42405.1|  hypothetical protein B456_007G152600                    228   8e-69   Gossypium raimondii
ref|XP_002467133.1|  hypothetical protein SORBIDRAFT_01g020150          228   8e-69   Sorghum bicolor [broomcorn]
ref|NP_001242568.1|  uncharacterized protein LOC100789930               227   1e-68   
ref|XP_004506590.1|  PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxi...    227   1e-68   Cicer arietinum [garbanzo]
ref|XP_010918893.1|  PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxi...    227   2e-68   Elaeis guineensis
ref|XP_004506669.1|  PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxi...    226   2e-68   Cicer arietinum [garbanzo]
ref|XP_009796305.1|  PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxi...    226   4e-68   Nicotiana sylvestris
ref|XP_006307517.1|  hypothetical protein CARUB_v10009140mg             226   5e-68   Capsella rubella
ref|XP_004982961.1|  PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxi...    226   5e-68   Setaria italica
emb|CDY15520.1|  BnaA08g28040D                                          226   6e-68   Brassica napus [oilseed rape]
ref|XP_001762605.1|  predicted protein                                  225   8e-68   
ref|NP_001237076.1|  3-ketoacyl-CoA thiolase                            224   2e-67   Glycine max [soybeans]
ref|XP_006662414.1|  PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxi...    224   2e-67   Oryza brachyantha
ref|NP_001064764.1|  Os10g0457600                                       223   1e-66   
gb|EEC67095.1|  hypothetical protein OsI_33888                          222   1e-66   Oryza sativa Indica Group [Indian rice]
ref|XP_002889522.1|  hypothetical protein ARALYDRAFT_470458             221   2e-66   
ref|XP_009336047.1|  PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxi...    221   2e-66   
ref|XP_010547051.1|  PREDICTED: 3-ketoacyl-CoA thiolase 5, peroxi...    222   2e-66   Tarenaya hassleriana [spider flower]
ref|XP_010547050.1|  PREDICTED: 3-ketoacyl-CoA thiolase 5, peroxi...    222   2e-66   Tarenaya hassleriana [spider flower]
gb|AAB80634.1|  Strong similarity to Cucumis acetyl-CoA acyltrans...    221   5e-66   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008454505.1|  PREDICTED: 3-ketoacyl-CoA thiolase 1, peroxi...    221   5e-66   
gb|EMS48058.1|  3-ketoacyl-CoA thiolase 2, peroxisomal                  220   9e-66   Triticum urartu
ref|XP_008454504.1|  PREDICTED: 3-ketoacyl-CoA thiolase 1, peroxi...    220   2e-65   
ref|XP_007049827.1|  Peroxisomal 3-ketoacyl-CoA thiolase 3 isoform 3    216   3e-65   
ref|XP_007049828.1|  Peroxisomal 3-ketoacyl-CoA thiolase 3 isoform 4    216   3e-65   
gb|AFW74043.1|  hypothetical protein ZEAMMB73_080325                    208   6e-65   
ref|XP_004152018.1|  PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxi...    218   6e-65   Cucumis sativus [cucumbers]
ref|XP_006280441.1|  hypothetical protein CARUB_v10026373mg             217   2e-64   Capsella rubella
ref|XP_007049826.1|  Peroxisomal 3-ketoacyl-CoA thiolase 3 isoform 2    216   4e-64   
ref|XP_007049825.1|  Peroxisomal 3-ketoacyl-CoA thiolase 3 isoform 1    216   5e-64   
ref|XP_006395129.1|  hypothetical protein EUTSA_v10004174mg             215   6e-64   Eutrema salsugineum [saltwater cress]
gb|KDO43600.1|  hypothetical protein CISIN_1g012506mg                   214   7e-64   Citrus sinensis [apfelsine]
ref|XP_002865685.1|  KAT5/PKT1/PKT2 peroxisomal 3-keto-acyl-CoA t...    214   1e-63   Arabidopsis lyrata subsp. lyrata
gb|EMS60447.1|  3-ketoacyl-CoA thiolase 2, peroxisomal                  212   5e-63   Triticum urartu
ref|NP_568704.2|  3-keto-acyl-CoA thiolase 2                            212   8e-63   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010439766.1|  PREDICTED: 3-ketoacyl-CoA thiolase 5, peroxi...    211   2e-62   Camelina sativa [gold-of-pleasure]
emb|CDY33940.1|  BnaA02g30470D                                          209   8e-62   Brassica napus [oilseed rape]
ref|XP_009129750.1|  PREDICTED: 3-ketoacyl-CoA thiolase 5, peroxi...    207   5e-61   Brassica rapa
ref|XP_007049829.1|  Peroxisomal 3-ketoacyl-CoA thiolase 3 isoform 5    203   2e-60   
ref|XP_003574006.1|  PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxi...    206   2e-60   Brachypodium distachyon [annual false brome]
emb|CDY05657.1|  BnaC02g38800D                                          205   5e-60   
ref|XP_010442336.1|  PREDICTED: 3-ketoacyl-CoA thiolase 5, peroxi...    205   5e-60   Camelina sativa [gold-of-pleasure]
ref|XP_007225741.1|  hypothetical protein PRUPE_ppa005421mg             204   8e-60   
ref|XP_010482154.1|  PREDICTED: 3-ketoacyl-CoA thiolase 5, peroxi...    204   1e-59   Camelina sativa [gold-of-pleasure]
gb|ADE77908.1|  unknown                                                 200   2e-58   Picea sitchensis
ref|XP_010439770.1|  PREDICTED: 3-ketoacyl-CoA thiolase 5, peroxi...    198   1e-57   Camelina sativa [gold-of-pleasure]
ref|XP_010482155.1|  PREDICTED: 3-ketoacyl-CoA thiolase 5, peroxi...    198   1e-57   Camelina sativa [gold-of-pleasure]
ref|XP_010442338.1|  PREDICTED: 3-ketoacyl-CoA thiolase 5, peroxi...    197   1e-57   Camelina sativa [gold-of-pleasure]
ref|XP_008349049.1|  PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxi...    187   3e-57   
ref|XP_006395130.1|  hypothetical protein EUTSA_v10004174mg             196   7e-57   Eutrema salsugineum [saltwater cress]
ref|XP_009129751.1|  PREDICTED: 3-ketoacyl-CoA thiolase 5, peroxi...    195   1e-56   Brassica rapa
dbj|BAF02017.1|  peroxisomal-3-keto-acyl-CoA thiolase 1                 194   2e-56   Arabidopsis thaliana [mouse-ear cress]
ref|NP_851157.1|  3-keto-acyl-CoA thiolase 2                            194   2e-56   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010547052.1|  PREDICTED: 3-ketoacyl-CoA thiolase 5, peroxi...    189   2e-54   Tarenaya hassleriana [spider flower]
ref|XP_005646163.1|  thiolase                                           185   3e-52   Coccomyxa subellipsoidea C-169
gb|AIB06952.1|  3-ketoacyl-CoA thiolase                                 180   2e-50   Vanda hybrid cultivar
ref|XP_002989683.1|  hypothetical protein SELMODRAFT_447769             179   2e-50   
ref|XP_002991797.1|  hypothetical protein SELMODRAFT_236388             177   4e-50   
ref|XP_002946078.1|  hypothetical protein VOLCADRAFT_102696             178   8e-50   Volvox carteri f. nagariensis
ref|XP_001697225.1|  acetyl-CoA acyltransferase                         173   7e-48   Chlamydomonas reinhardtii
dbj|BAA25250.1|  mutated 3-ketoacyl-CoA thiolase                        161   4e-47   Arabidopsis thaliana [mouse-ear cress]
ref|XP_005845320.1|  hypothetical protein CHLNCDRAFT_25846              167   1e-46   Chlorella variabilis
gb|KIY92728.1|  acetyl-CoA acyltransferase 1                            162   6e-45   Monoraphidium neglectum
gb|ACJ84675.1|  unknown                                                 154   6e-43   Medicago truncatula
ref|XP_011400620.1|  3-ketoacyl-CoA thiolase 2, peroxisomal             153   2e-40   Auxenochlorella protothecoides
gb|KDO43604.1|  hypothetical protein CISIN_1g012506mg                   150   6e-40   Citrus sinensis [apfelsine]
emb|CEF98532.1|  Thiolase-like, subgroup                                150   1e-39   Ostreococcus tauri
gb|KDO65879.1|  hypothetical protein CISIN_1g0125222mg                  144   8e-38   Citrus sinensis [apfelsine]
ref|XP_003080093.1|  Dynein 1-alpha heavy chain, flagellar inner ...    149   3e-37   
gb|KJB42403.1|  hypothetical protein B456_007G152600                    142   4e-37   Gossypium raimondii
ref|XP_001418570.1|  predicted protein                                  142   8e-37   Ostreococcus lucimarinus CCE9901
ref|XP_643924.1|  acetyl-CoA C-acyltransferase                          142   1e-36   Dictyostelium discoideum AX4
ref|XP_007513169.1|  unknown                                            142   1e-36   Bathycoccus prasinos
ref|XP_011328216.1|  3-ketoacyl-CoA thiolase                            141   3e-36   Fusarium graminearum PH-1
ref|XP_009262137.1|  hypothetical protein FPSE_10745                    141   3e-36   Fusarium pseudograminearum CS3096
gb|EIE80258.1|  hypothetical protein RO3G_04963                         140   4e-36   Rhizopus delemar RA 99-880
ref|XP_002591918.1|  hypothetical protein BRAFLDRAFT_284464             140   4e-36   Branchiostoma floridae
emb|CEF85217.1|  unnamed protein product                                140   5e-36   
gb|KIL93411.1|  hypothetical protein FAVG1_03392                        140   1e-35   Fusarium avenaceum
emb|CCF32753.1|  acetyl-CoA acetyltransferase                           139   1e-35   Colletotrichum higginsianum
ref|XP_960422.1|  3-ketoacyl-CoA thiolase                               139   2e-35   Neurospora crassa OR74A
gb|KDD73648.1|  beta-ketoacyl-ACP synthase                              139   2e-35   Helicosporidium sp. ATCC 50920
gb|EGU82326.1|  hypothetical protein FOXB_07155                         138   4e-35   Fusarium oxysporum Fo5176
gb|EWG42127.1|  acetyl-CoA acyltransferase                              138   4e-35   Fusarium verticillioides 7600
ref|XP_004349337.1|  peroxisomal 3-ketoacyl-CoA thiolase B              138   4e-35   Capsaspora owczarzaki ATCC 30864
ref|XP_003353115.1|  hypothetical protein SMAC_03432                    137   5e-35   Sordaria macrospora k-hell
emb|CDO68177.1|  hypothetical protein BN946_scf184938.g29               137   6e-35   Trametes cinnabarina
ref|XP_003001876.1|  3-ketoacyl-CoA thiolase                            137   1e-34   Verticillium alfalfae VaMs.102
ref|XP_005082434.1|  PREDICTED: 3-ketoacyl-CoA thiolase B, peroxi...    134   1e-34   
ref|NP_001072686.1|  3-ketoacyl-CoA thiolase, peroxisomal               136   2e-34   Xenopus tropicalis [western clawed frog]
gb|KDN71907.1|  putative acetyl-CoA acetyltransferase                   136   2e-34   Colletotrichum sublineola
gb|EFQ33554.1|  acetyl-CoA acetyltransferase                            136   2e-34   Colletotrichum graminicola M1.001
ref|XP_007595974.1|  acetyl-CoA acetyltransferase                       136   2e-34   
gb|EPZ32623.1|  3-ketoacyl-CoA thiolase A, peroxisomal                  135   3e-34   Rozella allomycis CSF55
ref|XP_009648812.1|  3-ketoacyl-CoA thiolase                            135   4e-34   Verticillium dahliae VdLs.17
gb|KGG50758.1|  hypothetical protein DI09_57p130                        135   5e-34   Mitosporidium daphniae
gb|KFA63582.1|  hypothetical protein S40285_04144                       135   6e-34   Stachybotrys chlorohalonata IBT 40285
gb|KEY69142.1|  hypothetical protein S7711_04925                        135   6e-34   Stachybotrys chartarum IBT 7711
ref|XP_003664280.1|  3-ketoacyl-CoA thiolase                            134   9e-34   Thermothelomyces thermophila ATCC 42464
ref|XP_005348137.1|  PREDICTED: 3-ketoacyl-CoA thiolase B, peroxi...    134   1e-33   Microtus ochrogaster [prairie voles]
gb|ENH73947.1|  3-ketoacyl-CoA thiolase, peroxisomal                    137   1e-33   Fusarium oxysporum f. sp. cubense race 1
emb|CCA76233.1|  probable POT1-acetyl-CoA C-acyltransferase, pero...    134   1e-33   Serendipita indica DSM 11827
ref|XP_002904159.1|  3-ketoacyl-CoA thiolase A                          134   1e-33   Phytophthora infestans T30-4
ref|XP_004339798.1|  acetylCoA acyltransferase, putative                134   1e-33   Acanthamoeba castellanii str. Neff
gb|ETI53494.1|  hypothetical protein F443_03599                         134   1e-33   Phytophthora parasitica P1569
ref|XP_003724378.1|  PREDICTED: 3-ketoacyl-CoA thiolase B, peroxi...    134   2e-33   
ref|XP_007366726.1|  thiolase                                           134   2e-33   Dichomitus squalens LYAD-421 SS1
gb|ETK93319.1|  hypothetical protein L915_03492                         133   2e-33   Phytophthora parasitica
ref|XP_008844714.1|  PREDICTED: 3-ketoacyl-CoA thiolase B, peroxi...    133   2e-33   
gb|EHK49858.1|  putative 3-ketoacyl-CoA thiolase                        133   2e-33   Trichoderma atroviride IMI 206040
gb|ENH84024.1|  3-ketoacyl-thiolase                                     133   2e-33   
gb|ERZ96342.1|  hypothetical protein GLOINDRAFT_71751                   133   2e-33   
ref|XP_005852686.1|  3-ketoacyl- thiolase peroxisomal                   132   3e-33   Nannochloropsis gaditana CCMP526
emb|CEG63739.1|  Putative Acetyl-CoA acyltransferase                    133   3e-33   Rhizopus microsporus
emb|CEI96344.1|  Putative Acetyl-CoA acyltransferase                    133   3e-33   Rhizopus microsporus
gb|EFA76209.1|  acetyl-CoA C-acyltransferase                            133   3e-33   Heterostelium album PN500
ref|XP_001226866.1|  conserved hypothetical protein                     132   3e-33   Chaetomium globosum CBS 148.51
gb|EDL76922.1|  rCG25918, isoform CRA_a                                 129   4e-33   Rattus norvegicus [brown rat]
gb|KHN99131.1|  3-ketoacyl-CoA thiolase                                 132   4e-33   Metarhizium album ARSEF 1941
ref|XP_002500295.1|  acetyl-coa acyltransferase                         132   4e-33   
ref|XP_005348140.1|  PREDICTED: 3-ketoacyl-CoA thiolase B, peroxi...    132   4e-33   
ref|XP_009537056.1|  hypothetical protein PHYSODRAFT_340572             132   4e-33   
gb|EWM24705.1|  3-ketoacyl- thiolase peroxisomal                        132   4e-33   
gb|KIM26928.1|  hypothetical protein M408DRAFT_72087                    132   5e-33   
ref|XP_005854303.1|  beta-ketoacyl-CoA thiolase                         132   5e-33   
ref|NP_001080604.1|  3-ketoacyl-CoA thiolase, peroxisomal               132   5e-33   
ref|XP_002742159.1|  PREDICTED: 3-ketoacyl-CoA thiolase A, peroxi...    132   5e-33   
dbj|GAM22408.1|  hypothetical protein SAMD00019534_055830               132   5e-33   
ref|XP_006512179.1|  PREDICTED: 3-ketoacyl-CoA thiolase B, peroxi...    129   6e-33   
ref|XP_007818295.1|  3-ketoacyl-CoA thiolase                            132   6e-33   
gb|KID67493.1|  3-ketoacyl-CoA thiolase                                 132   6e-33   
ref|XP_007913467.1|  putative 3-ketoacyl- thiolase protein              132   7e-33   
gb|KID77958.1|  3-ketoacyl-CoA thiolase                                 132   8e-33   
ref|XP_007276712.1|  3-ketoacyl- thiolase                               131   8e-33   
ref|XP_005297192.1|  PREDICTED: 3-ketoacyl-CoA thiolase, peroxiso...    131   1e-32   
ref|XP_007000547.1|  hypothetical protein TREMEDRAFT_24802              131   1e-32   
ref|XP_008853327.1|  PREDICTED: LOW QUALITY PROTEIN: 3-ketoacyl-C...    131   1e-32   
ref|XP_006986814.1|  PREDICTED: 3-ketoacyl-CoA thiolase B, peroxi...    127   1e-32   
gb|ACF24566.1|  acetyl-CoA acyltransferase                              129   1e-32   
gb|EQB52382.1|  acetyl-CoA acetyltransferase                            131   1e-32   
ref|XP_010865004.1|  PREDICTED: 3-ketoacyl-CoA thiolase, peroxisomal    131   2e-32   
emb|CEJ90926.1|  Putative 3-ketoacyl-coA thiolase peroxisomal A         130   2e-32   
ref|XP_009216548.1|  3-ketoacyl-CoA thiolase                            130   2e-32   
ref|XP_006910841.1|  PREDICTED: 3-ketoacyl-CoA thiolase, peroxisomal    130   2e-32   
ref|XP_009833032.1|  hypothetical protein, variant 3                    129   3e-32   
ref|XP_005150078.1|  PREDICTED: 3-ketoacyl-CoA thiolase A, peroxi...    130   3e-32   
ref|XP_002759778.2|  PREDICTED: 3-ketoacyl-CoA thiolase, peroxisomal    130   3e-32   
ref|XP_002564709.1|  Pc22g06820                                         130   3e-32   
ref|XP_003712230.1|  3-ketoacyl-CoA thiolase                            130   3e-32   
ref|XP_002626309.1|  3-ketoacyl-coA thiolase peroxisomal A              130   3e-32   
ref|XP_009833030.1|  hypothetical protein, variant 1                    129   3e-32   
ref|XP_011121603.1|  hypothetical protein AOL_s00078g38                 130   3e-32   
ref|XP_001247762.1|  hypothetical protein CIMG_01533                    129   4e-32   
gb|EFX04324.1|  3-ketoacyl-CoA thiolase peroxisomal a precursor         130   4e-32   
ref|XP_005096572.1|  PREDICTED: 3-ketoacyl-CoA thiolase B, peroxi...    130   4e-32   
gb|EWC45293.1|  peroxisomal 3-ketoacyl-CoA thiolase                     130   4e-32   
gb|ERS99148.1|  hypothetical protein HMPREF1624_04344                   130   4e-32   
gb|KIH94193.1|  acetyl-CoA acyltransferase                              129   4e-32   
gb|KFH68616.1|  acetyl-CoA acyltransferase                              129   5e-32   
emb|CCE27342.1|  uncharacterized protein CPUR_00816                     129   5e-32   
dbj|BAA14107.1|  peroxisomal 3-ketoacyl-CoA thiolase B                  129   5e-32   
ref|XP_009549597.1|  hypothetical protein HETIRDRAFT_441328             129   5e-32   
sp|P07871.2|THIKB_RAT  RecName: Full=3-ketoacyl-CoA thiolase B, p...    129   5e-32   
ref|XP_566859.1|  acetyl-CoA C-acyltransferase                          129   5e-32   
ref|XP_002111185.1|  expressed hypothetical protein                     129   6e-32   
ref|XP_006680802.1|  hypothetical protein BATDEDRAFT_37225              129   6e-32   
dbj|GAA82972.1|  3-ketoacyl-coA thiolase peroxisomal A precursor        129   6e-32   
ref|XP_007836703.1|  3-ketoacyl-CoA thiolase                            129   6e-32   
ref|XP_003046188.1|  predicted protein                                  129   7e-32   
gb|EKV04734.1|  hypothetical protein PDIG_87260                         129   7e-32   
ref|XP_009833029.1|  hypothetical protein H257_08703                    129   7e-32   
gb|KFH47479.1|  3-ketoacyl-CoA thiolase, peroxisomal-like protein       129   7e-32   
ref|XP_003650647.1|  hypothetical protein THITE_2110329                 129   7e-32   
gb|ELK13640.1|  3-ketoacyl-CoA thiolase, peroxisomal                    129   7e-32   
ref|XP_003065696.1|  3-ketoacyl-CoA thiolase, peroxisomal precurs...    129   7e-32   
ref|XP_005348136.1|  PREDICTED: 3-ketoacyl-CoA thiolase B, peroxi...    128   7e-32   
emb|CCI45800.1|  unnamed protein product                                129   8e-32   
ref|XP_008900800.1|  hypothetical protein PPTG_08457                    129   8e-32   
ref|XP_003283381.1|  acetyl-CoA C-acyltransferase                       129   8e-32   
ref|XP_005348141.1|  PREDICTED: 3-ketoacyl-CoA thiolase B, peroxi...    127   9e-32   
ref|XP_001544549.1|  hypothetical protein HCAG_01596                    129   9e-32   
ref|NP_666342.1|  3-ketoacyl-CoA thiolase B, peroxisomal precursor      129   9e-32   
gb|KIJ47990.1|  hypothetical protein M422DRAFT_28531                    129   1e-31   
gb|EEH08158.1|  3-ketoacyl-coA thiolase peroxisomal A                   129   1e-31   
ref|XP_004635291.1|  PREDICTED: 3-ketoacyl-CoA thiolase A, peroxi...    129   1e-31   
gb|EPB86339.1|  acetyl-CoA acyltransferase                              129   1e-31   
ref|XP_003221941.1|  PREDICTED: 3-ketoacyl-CoA thiolase, peroxisomal    129   1e-31   
ref|XP_010355558.1|  PREDICTED: 3-ketoacyl-CoA thiolase, peroxisomal    129   1e-31   
gb|AFR92621.1|  acetyl-CoA acyltransferase                              128   1e-31   
dbj|GAN10585.1|  3-ketoacyl-CoA thiolase, peroxisomal precursor         128   1e-31   
gb|EHK18224.1|  hypothetical protein TRIVIDRAFT_80821                   128   1e-31   
gb|KDO30583.1|  hypothetical protein SPRG_04484                         128   1e-31   
gb|KGO78426.1|  Thiolase-like, subgroup                                 128   2e-31   
ref|XP_004471222.1|  PREDICTED: 3-ketoacyl-CoA thiolase, peroxisomal    123   2e-31   
gb|EGC43203.1|  3-ketoacyl-CoA thiolase                                 128   2e-31   
gb|KIR48491.1|  acetyl-CoA acyltransferase                              128   2e-31   
ref|XP_003894723.1|  PREDICTED: 3-ketoacyl-CoA thiolase, peroxisomal    128   2e-31   
gb|KIY37061.1|  acetyl-CoA acyltransferase                              128   2e-31   
ref|XP_005546711.1|  PREDICTED: 3-ketoacyl-CoA thiolase, peroxiso...    128   2e-31   
dbj|BAK06976.1|  predicted protein                                      127   2e-31   
gb|KGO37526.1|  Thiolase-like, subgroup                                 127   2e-31   
dbj|GAM87832.1|  hypothetical protein ANO11243_058600                   127   2e-31   
ref|XP_001088834.2|  PREDICTED: 3-ketoacyl-CoA thiolase, peroxiso...    128   2e-31   
ref|XP_007969955.1|  PREDICTED: 3-ketoacyl-CoA thiolase, peroxisomal    128   2e-31   
ref|NP_570934.1|  3-ketoacyl-CoA thiolase A, peroxisomal precursor      127   2e-31   
gb|AAH89821.1|  Acaa1 protein                                           127   2e-31   
emb|CEG73130.1|  Putative Acetyl-CoA acyltransferase                    127   3e-31   
dbj|BAE25296.1|  unnamed protein product                                127   3e-31   
gb|KEY75796.1|  3 ketoacyl coA thiolase peroxisomal A                   127   3e-31   
ref|XP_751733.1|  3-ketoacyl-coA thiolase peroxisomal A precursor       127   3e-31   
dbj|GAN09045.1|  3-ketoacyl-CoA thiolase, peroxisomal precursor         127   3e-31   
gb|KDB18023.1|  3-ketoacyl-CoA thiolase                                 127   3e-31   
ref|XP_003191423.1|  acetyl-CoA C-acyltransferase                       127   3e-31   
gb|EPE04951.1|  3-ketoacyl- thiolase                                    127   3e-31   
gb|KFG85036.1|  3-ketoacyl-CoA thiolase                                 127   3e-31   
gb|KEQ93783.1|  hypothetical protein AUEXF2481DRAFT_90094               127   3e-31   
gb|KIR50795.1|  acetyl-CoA acyltransferase                              127   3e-31   
ref|XP_001401936.1|  acetyl-CoA C-acyltransferase                       127   4e-31   
gb|EDL76915.1|  rCG25819, isoform CRA_a                                 127   4e-31   
ref|XP_001905889.1|  hypothetical protein                               127   4e-31   
gb|ELR08725.1|  hypothetical protein GMDG_03407                         127   4e-31   
ref|NP_001035108.1|  3-ketoacyl-CoA thiolase B, peroxisomal precu...    127   4e-31   
gb|KDQ50409.1|  hypothetical protein JAAARDRAFT_584417                  127   4e-31   
ref|XP_006713185.1|  PREDICTED: 3-ketoacyl-CoA thiolase, peroxiso...    126   5e-31   
dbj|BAE72965.1|  hypothetical protein                                   127   5e-31   
ref|XP_007517129.1|  PREDICTED: 3-ketoacyl-CoA thiolase, peroxiso...    127   5e-31   
ref|XP_006986793.1|  PREDICTED: 3-ketoacyl-CoA thiolase B, peroxi...    127   5e-31   
ref|XP_006694648.1|  3-ketoacyl-CoA thiolase-like protein               127   5e-31   
gb|KFY51958.1|  hypothetical protein V497_08728                         127   5e-31   
ref|NP_036621.1|  3-ketoacyl-CoA thiolase A, peroxisomal                127   5e-31   
ref|XP_003170852.1|  3-ketoacyl-CoA thiolase                            127   6e-31   
dbj|BAA14106.1|  peroxisomal 3-ketoacyl-CoA thiolase A                  127   6e-31   
ref|XP_009066824.1|  hypothetical protein LOTGIDRAFT_134529             127   6e-31   
ref|NP_001598.1|  3-ketoacyl-CoA thiolase, peroxisomal isoform a        126   6e-31   
ref|XP_009443455.1|  PREDICTED: 3-ketoacyl-CoA thiolase, peroxiso...    126   7e-31   
ref|XP_006962930.1|  3-ketoacyl-CoA thiolase                            126   7e-31   
ref|XP_005386652.1|  PREDICTED: 3-ketoacyl-CoA thiolase B, peroxi...    126   7e-31   
ref|XP_002813979.1|  PREDICTED: 3-ketoacyl-CoA thiolase, peroxisomal    126   8e-31   
ref|XP_003464147.2|  PREDICTED: 3-ketoacyl-CoA thiolase B, peroxi...    126   8e-31   
ref|XP_008877314.1|  hypothetical protein H310_12126                    126   8e-31   
gb|EPS33443.1|  hypothetical protein PDE_08405                          126   9e-31   
ref|XP_007943890.1|  PREDICTED: 3-ketoacyl-CoA thiolase, peroxiso...    126   9e-31   
ref|XP_006634258.1|  PREDICTED: 3-ketoacyl-CoA thiolase B, peroxi...    126   9e-31   
ref|XP_001271962.1|  3-ketoacyl-coA thiolase peroxisomal A precursor    126   9e-31   
gb|EZF34509.1|  hypothetical protein H101_01942                         126   1e-30   
gb|KIM88443.1|  hypothetical protein PILCRDRAFT_85575                   126   1e-30   
gb|KDB27199.1|  hypothetical protein H109_01068                         126   1e-30   
ref|XP_007582372.1|  putative 3-ketoacyl-coa thiolase peroxisomal...    126   1e-30   
gb|KFH69993.1|  acetyl-CoA acyltransferase                              126   1e-30   
gb|KFY75484.1|  hypothetical protein V499_04526                         126   1e-30   
ref|XP_011110053.1|  hypothetical protein H072_4093                     126   1e-30   
gb|KFZ13138.1|  hypothetical protein V501_03843                         126   1e-30   
ref|XP_001213158.1|  3-ketoacyl-CoA thiolase                            126   1e-30   
ref|XP_003232365.1|  3-ketoacyl-CoA thiolase peroxisomal A              126   1e-30   
ref|XP_003020839.1|  3-ketoacyl-CoA thiolase (POT1), putative           126   1e-30   
dbj|GAD94451.1|  acetyl-CoA C-acyltransferase                           125   1e-30   
gb|ACJ02108.1|  3-ketoacyl-coenzyme A thiolase                          122   1e-30   
ref|XP_003011454.1|  3-ketoacyl-CoA thiolase (POT1), putative           126   1e-30   
ref|XP_010559421.1|  PREDICTED: 3-ketoacyl-CoA thiolase, peroxisomal    125   1e-30   
ref|XP_004033892.1|  PREDICTED: 3-ketoacyl-CoA thiolase, peroxiso...    125   1e-30   
gb|KDQ18816.1|  hypothetical protein BOTBODRAFT_103597                  125   1e-30   
ref|XP_006462290.1|  hypothetical protein AGABI2DRAFT_193507            125   1e-30   
gb|KIO21034.1|  hypothetical protein M407DRAFT_131995                   125   1e-30   
ref|XP_663250.1|  hypothetical protein AN5646.2                         125   1e-30   
ref|XP_003256905.2|  PREDICTED: LOW QUALITY PROTEIN: 3-ketoacyl-C...    125   2e-30   
ref|XP_007925002.1|  hypothetical protein MYCFIDRAFT_210863             125   2e-30   
ref|XP_008161239.1|  PREDICTED: 3-ketoacyl-CoA thiolase, peroxiso...    125   2e-30   
ref|XP_004635292.1|  PREDICTED: 3-ketoacyl-CoA thiolase A, peroxi...    124   2e-30   
gb|EKC24920.1|  3-ketoacyl-CoA thiolase A, peroxisomal                  122   2e-30   
ref|XP_007770641.1|  acetyl-CoA acetyl transferase                      125   2e-30   
sp|P21775.2|THIKA_RAT  RecName: Full=3-ketoacyl-CoA thiolase A, p...    125   2e-30   
dbj|BAE35878.1|  unnamed protein product                                125   2e-30   
gb|ELU09588.1|  hypothetical protein CAPTEDRAFT_229355                  125   2e-30   
ref|XP_001932756.1|  3-ketoacyl-CoA thiolase B                          125   2e-30   
ref|XP_001266900.1|  3-ketoacyl-coA thiolase peroxisomal A precursor    125   2e-30   
emb|CEP14254.1|  hypothetical protein                                   125   2e-30   
gb|EJU03448.1|  thiolase                                                125   2e-30   
gb|EPB90768.1|  acetyl-CoA acyltransferase                              125   2e-30   
gb|EYE99809.1|  thiolase                                                125   2e-30   
gb|KEQ81585.1|  3-ketoacyl-CoA thiolase-like protein                    125   2e-30   
pdb|2IIK|A  Chain A, Crystal Structure Of Human Peroxisomal Acety...    125   2e-30   
gb|EIE78703.1|  hypothetical protein RO3G_03407                         125   2e-30   
ref|XP_007382657.1|  thiolase                                           125   3e-30   
ref|XP_003930949.1|  PREDICTED: 3-ketoacyl-CoA thiolase, peroxisomal    125   3e-30   
ref|XP_008616222.1|  acetyl-CoA acyltransferase 1                       124   3e-30   
ref|XP_001820215.1|  acetyl-CoA C-acyltransferase                       125   3e-30   
emb|CDM36619.1|  3-ketoacyl-CoA thiolase, peroxisomal                   125   3e-30   
ref|XP_004676369.1|  PREDICTED: 3-ketoacyl-CoA thiolase A, peroxi...    125   3e-30   
gb|KDQ28695.1|  hypothetical protein PLEOSDRAFT_1054697                 124   3e-30   
ref|XP_011363629.1|  PREDICTED: 3-ketoacyl-CoA thiolase, peroxisomal    125   3e-30   
ref|XP_002844427.1|  3-ketoacyl-CoA thiolase                            124   3e-30   
emb|CCX07864.1|  Similar to 3-ketoacyl-CoA thiolase B, peroxisoma...    124   3e-30   
gb|KIR86712.1|  acetyl-CoA acyltransferase                              124   3e-30   
ref|XP_007253620.1|  PREDICTED: 3-ketoacyl-CoA thiolase A, peroxi...    124   4e-30   
gb|KIK43764.1|  hypothetical protein CY34DRAFT_803509                   124   4e-30   
ref|XP_002584604.1|  3-ketoacyl-CoA thiolase                            124   4e-30   
ref|XP_003132151.1|  PREDICTED: 3-ketoacyl-CoA thiolase A, peroxi...    124   4e-30   
gb|KEZ40268.1|  3-ketoacyl-CoA thiolase, peroxisomal                    124   4e-30   
ref|XP_002374205.1|  3-ketoacyl-coA thiolase peroxisomal A precursor    124   4e-30   
gb|EIT80840.1|  3-oxoacyl CoA thiolase                                  124   4e-30   
gb|KFY83038.1|  hypothetical protein V500_10206                         124   4e-30   
gb|EGD97916.1|  3-ketoacyl-CoA thiolase peroxisomal A                   124   4e-30   
gb|KFY22787.1|  hypothetical protein V493_06318                         124   5e-30   
ref|XP_007674965.1|  hypothetical protein BAUCODRAFT_146808             124   5e-30   
ref|XP_004377453.1|  PREDICTED: 3-ketoacyl-CoA thiolase, peroxisomal    124   5e-30   
gb|KEQ67540.1|  3-ketoacyl-CoA thiolase-like protein                    124   5e-30   
gb|KFZ04546.1|  hypothetical protein V502_10068                         124   6e-30   
ref|NP_001002207.1|  3-ketoacyl-CoA thiolase, peroxisomal               124   6e-30   
gb|KIY48859.1|  thiolase                                                124   6e-30   
ref|XP_003306063.1|  hypothetical protein PTT_19080                     124   6e-30   
gb|KIN95402.1|  hypothetical protein M404DRAFT_1007539                  124   7e-30   
ref|XP_005546712.1|  PREDICTED: 3-ketoacyl-CoA thiolase, peroxiso...    123   7e-30   
emb|CCO31845.1|  hypothetical protein BN14_05895                        123   7e-30   
ref|XP_003992303.1|  PREDICTED: 3-ketoacyl-CoA thiolase, peroxisomal    124   7e-30   
ref|XP_004360305.1|  acetyl-CoA C-acyltransferase                       127   8e-30   
ref|XP_005317422.1|  PREDICTED: 3-ketoacyl-CoA thiolase A, peroxi...    123   8e-30   
ref|XP_008522879.1|  PREDICTED: 3-ketoacyl-CoA thiolase, peroxisomal    123   8e-30   
ref|XP_001488609.1|  PREDICTED: 3-ketoacyl-CoA thiolase, peroxiso...    123   9e-30   
ref|XP_004704131.1|  PREDICTED: 3-ketoacyl-CoA thiolase, peroxiso...    123   9e-30   
gb|KEQ77684.1|  3-ketoacyl-CoA thiolase-like protein                    123   9e-30   
ref|XP_006869210.1|  PREDICTED: 3-ketoacyl-CoA thiolase, peroxiso...    123   1e-29   
gb|EPQ67799.1|  3-ketoacyl-CoA thiolase                                 123   1e-29   
emb|CCU81710.1|  3-ketoacyl-coA thiolase/POT1                           123   1e-29   
ref|XP_007517130.1|  PREDICTED: 3-ketoacyl-CoA thiolase, peroxiso...    122   1e-29   
ref|XP_007191535.1|  PREDICTED: 3-ketoacyl-CoA thiolase, peroxisomal    123   1e-29   
ref|XP_004419563.1|  PREDICTED: 3-ketoacyl-CoA thiolase, peroxiso...    123   1e-29   
ref|XP_005491482.1|  PREDICTED: 3-ketoacyl-CoA thiolase B, peroxi...    123   1e-29   
gb|KDN40444.1|  thiolase                                                122   1e-29   
ref|XP_010393120.1|  PREDICTED: 3-ketoacyl-CoA thiolase, peroxisomal    123   1e-29   
ref|XP_004642271.1|  PREDICTED: 3-ketoacyl-CoA thiolase A, peroxi...    123   1e-29   
ref|XP_010785602.1|  PREDICTED: 3-ketoacyl-CoA thiolase, peroxisomal    122   1e-29   
gb|KGL84935.1|  3-ketoacyl-CoA thiolase B, peroxisomal                  122   1e-29   
gb|EQK99353.1|  3-ketoacyl-CoA thiolase                                 122   1e-29   
ref|XP_003456538.2|  PREDICTED: 3-ketoacyl-CoA thiolase B, peroxi...    123   2e-29   
ref|XP_010739674.1|  PREDICTED: 3-ketoacyl-CoA thiolase, peroxisomal    122   2e-29   
ref|XP_005040595.1|  PREDICTED: 3-ketoacyl-CoA thiolase, peroxiso...    122   2e-29   
ref|XP_002766693.1|  Acetyl-CoA acetyltransferase, putative             117   2e-29   
ref|XP_005386653.1|  PREDICTED: 3-ketoacyl-CoA thiolase B, peroxi...    122   2e-29   
dbj|GAA95537.1|  hypothetical protein E5Q_02192                         122   2e-29   
ref|XP_005994280.1|  PREDICTED: 3-ketoacyl-CoA thiolase B, peroxi...    122   2e-29   



>ref|XP_004247828.1| PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxisomal [Solanum lycopersicum]
Length=465

 Score =   292 bits (747),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 148/170 (87%), Positives = 164/170 (96%), Gaps = 0/170 (0%)
 Frame = +3

Query  60   AIERQRVLLQHLRPTNAASSHDSIESSVSASVCAAGDSAAYQRNSVYGDDIVIVAAYRTP  239
            AIERQRVLLQHLRP+  +SS ++IESS+SASVC+AGDSAAYQR SV+GDD+VIVAAYRTP
Sbjct  4    AIERQRVLLQHLRPSQTSSSLENIESSISASVCSAGDSAAYQRTSVFGDDVVIVAAYRTP  63

Query  240  LCKSKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTVLAPGSIRASECRMAAF  419
            LCK+KRGGFKDTYPDD+LA+VLKA+IEKTN+NPSEVGDI+VG+VLAPGS RASECRMAAF
Sbjct  64   LCKAKRGGFKDTYPDDILAAVLKAVIEKTNVNPSEVGDIVVGSVLAPGSQRASECRMAAF  123

Query  420  YAGFPETVPVRTVNRQCSSGLQavadvaaaikaGFYDIGIGAGLESMTVN  569
            YAGFPETVP+RTVNRQCSSGLQAVADVAAAIKAGFYDIGIGAGLESMT N
Sbjct  124  YAGFPETVPIRTVNRQCSSGLQAVADVAAAIKAGFYDIGIGAGLESMTTN  173



>ref|XP_009619812.1| PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxisomal [Nicotiana 
tomentosiformis]
Length=464

 Score =   291 bits (746),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 150/170 (88%), Positives = 163/170 (96%), Gaps = 0/170 (0%)
 Frame = +3

Query  60   AIERQRVLLQHLRPTNAASSHDSIESSVSASVCAAGDSAAYQRNSVYGDDIVIVAAYRTP  239
            AIERQRVLLQHLRP+  +SS ++IESS++ASVC+AGDSAAYQR SV+GDD+VIVAAYRTP
Sbjct  4    AIERQRVLLQHLRPSQTSSSLENIESSIAASVCSAGDSAAYQRTSVFGDDVVIVAAYRTP  63

Query  240  LCKSKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTVLAPGSIRASECRMAAF  419
            LCK+KRGGFKDTYPDDLLA VLKAL+EKTNL+PSEVGDI+VGTVLAPGS RASECRMAAF
Sbjct  64   LCKAKRGGFKDTYPDDLLAPVLKALMEKTNLSPSEVGDIVVGTVLAPGSQRASECRMAAF  123

Query  420  YAGFPETVPVRTVNRQCSSGLQavadvaaaikaGFYDIGIGAGLESMTVN  569
            YAGFPETVPVRTVNRQCSSGLQAVADVAAAIKAGFYDIGIGAGLESMT N
Sbjct  124  YAGFPETVPVRTVNRQCSSGLQAVADVAAAIKAGFYDIGIGAGLESMTAN  173



>ref|XP_006360332.1| PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxisomal-like [Solanum 
tuberosum]
Length=465

 Score =   291 bits (744),  Expect = 5e-93, Method: Compositional matrix adjust.
 Identities = 147/170 (86%), Positives = 164/170 (96%), Gaps = 0/170 (0%)
 Frame = +3

Query  60   AIERQRVLLQHLRPTNAASSHDSIESSVSASVCAAGDSAAYQRNSVYGDDIVIVAAYRTP  239
            AIERQRVLLQHLRP+  +SS ++IESS+SASVC+AGDSAAYQR SV+GDD+VIVAAYRTP
Sbjct  4    AIERQRVLLQHLRPSQTSSSLENIESSISASVCSAGDSAAYQRTSVFGDDVVIVAAYRTP  63

Query  240  LCKSKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTVLAPGSIRASECRMAAF  419
            LCK+K+GGFKDTYPDD+LA+VLKA+IEKTN+NPSEVGDI+VG+VLAPGS RASECRMAAF
Sbjct  64   LCKAKKGGFKDTYPDDILAAVLKAVIEKTNVNPSEVGDIVVGSVLAPGSQRASECRMAAF  123

Query  420  YAGFPETVPVRTVNRQCSSGLQavadvaaaikaGFYDIGIGAGLESMTVN  569
            YAGFPETVP+RTVNRQCSSGLQAVADVAAAIKAGFYDIGIGAGLESMT N
Sbjct  124  YAGFPETVPIRTVNRQCSSGLQAVADVAAAIKAGFYDIGIGAGLESMTTN  173



>ref|XP_009784398.1| PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxisomal [Nicotiana 
sylvestris]
Length=464

 Score =   290 bits (742),  Expect = 8e-93, Method: Compositional matrix adjust.
 Identities = 148/170 (87%), Positives = 163/170 (96%), Gaps = 0/170 (0%)
 Frame = +3

Query  60   AIERQRVLLQHLRPTNAASSHDSIESSVSASVCAAGDSAAYQRNSVYGDDIVIVAAYRTP  239
            AIERQRVLLQHLRP+  +SS ++IESS++ASVC+AGDSAAYQR SV+GDD+VIVAAYRTP
Sbjct  4    AIERQRVLLQHLRPSQTSSSLENIESSIAASVCSAGDSAAYQRTSVFGDDVVIVAAYRTP  63

Query  240  LCKSKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTVLAPGSIRASECRMAAF  419
            LCK+KRGGFKDTYPDDLLA VLKAL+EKTN++PSE+GDI+VGTVLAPGS RASECRMAAF
Sbjct  64   LCKAKRGGFKDTYPDDLLAPVLKALMEKTNVSPSEIGDIVVGTVLAPGSQRASECRMAAF  123

Query  420  YAGFPETVPVRTVNRQCSSGLQavadvaaaikaGFYDIGIGAGLESMTVN  569
            YAGFPETVPVRTVNRQCSSGLQAVADVAAAIKAGFYDIGIGAGLESMT N
Sbjct  124  YAGFPETVPVRTVNRQCSSGLQAVADVAAAIKAGFYDIGIGAGLESMTTN  173



>gb|ACV70033.1| 3-ketoacyl CoA thiolase 2 [Petunia x hybrida]
Length=463

 Score =   286 bits (732),  Expect = 3e-91, Method: Compositional matrix adjust.
 Identities = 146/170 (86%), Positives = 162/170 (95%), Gaps = 0/170 (0%)
 Frame = +3

Query  60   AIERQRVLLQHLRPTNAASSHDSIESSVSASVCAAGDSAAYQRNSVYGDDIVIVAAYRTP  239
            +IERQRVLLQHLRP+  +SS ++++SS+SASVC+AGDSAAYQR SV+GDD+VIVAAYRTP
Sbjct  4    SIERQRVLLQHLRPSQTSSSLENLDSSISASVCSAGDSAAYQRTSVFGDDVVIVAAYRTP  63

Query  240  LCKSKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTVLAPGSIRASECRMAAF  419
            LCK+KRG FKDTYPDDLLA VLKAL+EKTN++PSEVGDI+VGTVLAPGS RASECRMAAF
Sbjct  64   LCKAKRGSFKDTYPDDLLAPVLKALMEKTNVSPSEVGDIVVGTVLAPGSQRASECRMAAF  123

Query  420  YAGFPETVPVRTVNRQCSSGLQavadvaaaikaGFYDIGIGAGLESMTVN  569
            YAGFPETVPVRTVNRQCSSGLQAVADVAAAIKAGFYDIGIGAGLESMT N
Sbjct  124  YAGFPETVPVRTVNRQCSSGLQAVADVAAAIKAGFYDIGIGAGLESMTTN  173



>gb|EYU32624.1| hypothetical protein MIMGU_mgv1a005944mg [Erythranthe guttata]
Length=464

 Score =   286 bits (731),  Expect = 4e-91, Method: Compositional matrix adjust.
 Identities = 147/170 (86%), Positives = 162/170 (95%), Gaps = 0/170 (0%)
 Frame = +3

Query  60   AIERQRVLLQHLRPTNAASSHDSIESSVSASVCAAGDSAAYQRNSVYGDDIVIVAAYRTP  239
            A+ERQRVLLQHLRP+  +SS + IESS+SAS+C+AGDSAAY R+SV+GDD+VIVAAYRT 
Sbjct  4    AVERQRVLLQHLRPSFTSSSLEDIESSLSASICSAGDSAAYHRSSVFGDDVVIVAAYRTA  63

Query  240  LCKSKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTVLAPGSIRASECRMAAF  419
            LCKSKRGGFKDTYPDDLLA VL+A++EKTN+NPSEVGDI+VGTVLAPGS RASECRMAAF
Sbjct  64   LCKSKRGGFKDTYPDDLLAPVLRAVMEKTNVNPSEVGDIVVGTVLAPGSQRASECRMAAF  123

Query  420  YAGFPETVPVRTVNRQCSSGLQavadvaaaikaGFYDIGIGAGLESMTVN  569
            YAGFPETVPVRTVNRQCSSGLQAVADVAAAIKAGFYDIGIGAGLESMTVN
Sbjct  124  YAGFPETVPVRTVNRQCSSGLQAVADVAAAIKAGFYDIGIGAGLESMTVN  173



>gb|AGC59769.1| 3-ketoacyl-CoA thiolase 1 [Rehmannia glutinosa]
Length=464

 Score =   285 bits (728),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 147/170 (86%), Positives = 161/170 (95%), Gaps = 0/170 (0%)
 Frame = +3

Query  60   AIERQRVLLQHLRPTNAASSHDSIESSVSASVCAAGDSAAYQRNSVYGDDIVIVAAYRTP  239
            A ERQRVLLQHLRP+  +SS + IESSVSAS+C+AGDSAAY R+SV+GDD+VIVAAYRT 
Sbjct  4    ATERQRVLLQHLRPSFTSSSLEDIESSVSASICSAGDSAAYHRSSVFGDDVVIVAAYRTA  63

Query  240  LCKSKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTVLAPGSIRASECRMAAF  419
            LCKSKRGGFKDTYPDDLLA VL+A++EKTN+NP+EVGDI+VGTVLAPGS RASECRMAAF
Sbjct  64   LCKSKRGGFKDTYPDDLLAPVLRAVVEKTNVNPNEVGDIVVGTVLAPGSQRASECRMAAF  123

Query  420  YAGFPETVPVRTVNRQCSSGLQavadvaaaikaGFYDIGIGAGLESMTVN  569
            YAGFPETVPVRTVNRQCSSGLQAVADVAAAIKAGFYDIGIGAGLESMTVN
Sbjct  124  YAGFPETVPVRTVNRQCSSGLQAVADVAAAIKAGFYDIGIGAGLESMTVN  173



>gb|AGC24176.1| 3-ketoacyl-CoA thiolase 2 [Rehmannia glutinosa]
Length=464

 Score =   284 bits (727),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 147/170 (86%), Positives = 161/170 (95%), Gaps = 0/170 (0%)
 Frame = +3

Query  60   AIERQRVLLQHLRPTNAASSHDSIESSVSASVCAAGDSAAYQRNSVYGDDIVIVAAYRTP  239
            A ERQRVLLQHLRP+  +SS + IESSVSAS+C+AGDSAAY R+SV+GDD+VIVAAYRT 
Sbjct  4    ATERQRVLLQHLRPSFTSSSLEDIESSVSASICSAGDSAAYHRSSVFGDDVVIVAAYRTA  63

Query  240  LCKSKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTVLAPGSIRASECRMAAF  419
            LCKSKRGGFKDTYPDDLLA VL+A++EKTN+NP+EVGDI+VGTVLAPGS RASECRMAAF
Sbjct  64   LCKSKRGGFKDTYPDDLLAPVLRAVVEKTNVNPNEVGDIVVGTVLAPGSQRASECRMAAF  123

Query  420  YAGFPETVPVRTVNRQCSSGLQavadvaaaikaGFYDIGIGAGLESMTVN  569
            YAGFPETVPVRTVNRQCSSGLQAVADVAAAIKAGFYDIGIGAGLESMTVN
Sbjct  124  YAGFPETVPVRTVNRQCSSGLQAVADVAAAIKAGFYDIGIGAGLESMTVN  173



>gb|AAL25590.1| At2g33150/F25I18.11 [Arabidopsis thaliana]
Length=390

 Score =   277 bits (708),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 147/170 (86%), Positives = 159/170 (94%), Gaps = 2/170 (1%)
 Frame = +3

Query  60   AIERQRVLLQHLRPTNAASSHDSIESSVSASVCAAGDSAAYQRNSVYGDDIVIVAAYRTP  239
            AIERQRVLL+HLRP+++ SSH+  E+S+SAS C AGDSAAYQR S+YGDD+VIVAA+RTP
Sbjct  4    AIERQRVLLEHLRPSSS-SSHN-YEASLSASACLAGDSAAYQRTSLYGDDVVIVAAHRTP  61

Query  240  LCKSKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTVLAPGSIRASECRMAAF  419
            LCKSKRG FKDTYPDDLLA VL+ALIEKTNLNPSEVGDI+VGTVLAPGS RASECRMAAF
Sbjct  62   LCKSKRGNFKDTYPDDLLAPVLRALIEKTNLNPSEVGDIVVGTVLAPGSQRASECRMAAF  121

Query  420  YAGFPETVPVRTVNRQCSSGLQavadvaaaikaGFYDIGIGAGLESMTVN  569
            YAGFPETV VRTVNRQCSSGLQAVADVAAAIKAGFYDIGIGAGLESMT N
Sbjct  122  YAGFPETVAVRTVNRQCSSGLQAVADVAAAIKAGFYDIGIGAGLESMTTN  171



>ref|XP_011073762.1| PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxisomal-like [Sesamum 
indicum]
Length=464

 Score =   279 bits (713),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 144/170 (85%), Positives = 160/170 (94%), Gaps = 0/170 (0%)
 Frame = +3

Query  60   AIERQRVLLQHLRPTNAASSHDSIESSVSASVCAAGDSAAYQRNSVYGDDIVIVAAYRTP  239
            AI+RQRVLLQHLRP+  +S+ + I SSVSAS+C AGDSAAY R+SV+GDD+VIVAA+RT 
Sbjct  4    AIDRQRVLLQHLRPSFTSSTLEDIGSSVSASICLAGDSAAYHRSSVFGDDVVIVAAHRTA  63

Query  240  LCKSKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTVLAPGSIRASECRMAAF  419
            LCKSKRGGFKDTYPDDLLA VL+AL+EKTN+NP+EVGDI+VGTVLAPGS RASECRMAAF
Sbjct  64   LCKSKRGGFKDTYPDDLLAPVLRALLEKTNVNPNEVGDIVVGTVLAPGSQRASECRMAAF  123

Query  420  YAGFPETVPVRTVNRQCSSGLQavadvaaaikaGFYDIGIGAGLESMTVN  569
            YAGFPETVPVRTVNRQCSSGLQAVADVAAAIKAGFYDIGIGAGLESMT+N
Sbjct  124  YAGFPETVPVRTVNRQCSSGLQAVADVAAAIKAGFYDIGIGAGLESMTIN  173



>gb|KDO43603.1| hypothetical protein CISIN_1g012506mg [Citrus sinensis]
Length=415

 Score =   277 bits (708),  Expect = 3e-88, Method: Compositional matrix adjust.
 Identities = 148/170 (87%), Positives = 159/170 (94%), Gaps = 2/170 (1%)
 Frame = +3

Query  60   AIERQRVLLQHLRPTNAASSHDSIESSVSASVCAAGDSAAYQRNSVYGDDIVIVAAYRTP  239
            AI RQ+VLL+HLRP+N+ SSH+  ES +SAS CAAGDSAAY R SVYGDD+VIVAAYRT 
Sbjct  4    AINRQQVLLEHLRPSNS-SSHN-YESILSASACAAGDSAAYHRTSVYGDDVVIVAAYRTA  61

Query  240  LCKSKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTVLAPGSIRASECRMAAF  419
            LCKSKRGGFKDTYPDDLLA VLKA+IEKTN++PSEVGDI+VGTVLAPGS RASECRMAAF
Sbjct  62   LCKSKRGGFKDTYPDDLLAPVLKAVIEKTNVDPSEVGDIVVGTVLAPGSQRASECRMAAF  121

Query  420  YAGFPETVPVRTVNRQCSSGLQavadvaaaikaGFYDIGIGAGLESMTVN  569
            YAGFPETVPVRTVNRQCSSGLQAVADVAAAIKAGFYDIGIGAGLESMTVN
Sbjct  122  YAGFPETVPVRTVNRQCSSGLQAVADVAAAIKAGFYDIGIGAGLESMTVN  171



>ref|XP_008457258.1| PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxisomal-like [Cucumis 
melo]
Length=461

 Score =   278 bits (711),  Expect = 4e-88, Method: Compositional matrix adjust.
 Identities = 146/170 (86%), Positives = 156/170 (92%), Gaps = 3/170 (2%)
 Frame = +3

Query  60   AIERQRVLLQHLRPTNAASSHDSIESSVSASVCAAGDSAAYQRNSVYGDDIVIVAAYRTP  239
            AI RQ+VLL HLRP+++  SHDS    +SAS C AGDSAAYQRNSV+GDD+VIVAAYRT 
Sbjct  4    AINRQKVLLHHLRPSSSLHSHDS---PLSASACLAGDSAAYQRNSVFGDDVVIVAAYRTA  60

Query  240  LCKSKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTVLAPGSIRASECRMAAF  419
            LCKSKRGGFKDT+PDDLLA VLKALIEKTNLNPSEVGDI+VG+VL PGS RASECRMAAF
Sbjct  61   LCKSKRGGFKDTHPDDLLAPVLKALIEKTNLNPSEVGDIVVGSVLGPGSQRASECRMAAF  120

Query  420  YAGFPETVPVRTVNRQCSSGLQavadvaaaikaGFYDIGIGAGLESMTVN  569
            YAGFPETVPVRTVNRQCSSGLQAVADVAAAIKAGFYDIGIGAGLESMTVN
Sbjct  121  YAGFPETVPVRTVNRQCSSGLQAVADVAAAIKAGFYDIGIGAGLESMTVN  170



>gb|KDO43602.1| hypothetical protein CISIN_1g012506mg [Citrus sinensis]
Length=406

 Score =   275 bits (704),  Expect = 7e-88, Method: Compositional matrix adjust.
 Identities = 148/170 (87%), Positives = 159/170 (94%), Gaps = 2/170 (1%)
 Frame = +3

Query  60   AIERQRVLLQHLRPTNAASSHDSIESSVSASVCAAGDSAAYQRNSVYGDDIVIVAAYRTP  239
            AI RQ+VLL+HLRP+N+ SSH+  ES +SAS CAAGDSAAY R SVYGDD+VIVAAYRT 
Sbjct  4    AINRQQVLLEHLRPSNS-SSHN-YESILSASACAAGDSAAYHRTSVYGDDVVIVAAYRTA  61

Query  240  LCKSKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTVLAPGSIRASECRMAAF  419
            LCKSKRGGFKDTYPDDLLA VLKA+IEKTN++PSEVGDI+VGTVLAPGS RASECRMAAF
Sbjct  62   LCKSKRGGFKDTYPDDLLAPVLKAVIEKTNVDPSEVGDIVVGTVLAPGSQRASECRMAAF  121

Query  420  YAGFPETVPVRTVNRQCSSGLQavadvaaaikaGFYDIGIGAGLESMTVN  569
            YAGFPETVPVRTVNRQCSSGLQAVADVAAAIKAGFYDIGIGAGLESMTVN
Sbjct  122  YAGFPETVPVRTVNRQCSSGLQAVADVAAAIKAGFYDIGIGAGLESMTVN  171



>gb|KCW57292.1| hypothetical protein EUGRSUZ_H00090 [Eucalyptus grandis]
Length=380

 Score =   274 bits (700),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 146/170 (86%), Positives = 159/170 (94%), Gaps = 0/170 (0%)
 Frame = +3

Query  60   AIERQRVLLQHLRPTNAASSHDSIESSVSASVCAAGDSAAYQRNSVYGDDIVIVAAYRTP  239
            AIERQRVLLQHLRP++++SS     SS+SAS+CAAGDSAAYQR+  +GDDIVIVAAYRT 
Sbjct  4    AIERQRVLLQHLRPSSSSSSVHGDASSLSASICAAGDSAAYQRSGSFGDDIVIVAAYRTA  63

Query  240  LCKSKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTVLAPGSIRASECRMAAF  419
            LCKSKRGGFKDTYPDDLLA VL+ALI+KT +NPSEVGDI+VGTVLAPGS RASECRMAAF
Sbjct  64   LCKSKRGGFKDTYPDDLLAPVLRALIDKTKINPSEVGDIVVGTVLAPGSQRASECRMAAF  123

Query  420  YAGFPETVPVRTVNRQCSSGLQavadvaaaikaGFYDIGIGAGLESMTVN  569
            YAGFPETVP+RTVNRQCSSGLQAVADVAAAIKAGFYDIGIGAGLESMTVN
Sbjct  124  YAGFPETVPIRTVNRQCSSGLQAVADVAAAIKAGFYDIGIGAGLESMTVN  173



>gb|KDO43601.1| hypothetical protein CISIN_1g012506mg [Citrus sinensis]
Length=437

 Score =   275 bits (703),  Expect = 3e-87, Method: Compositional matrix adjust.
 Identities = 148/170 (87%), Positives = 159/170 (94%), Gaps = 2/170 (1%)
 Frame = +3

Query  60   AIERQRVLLQHLRPTNAASSHDSIESSVSASVCAAGDSAAYQRNSVYGDDIVIVAAYRTP  239
            AI RQ+VLL+HLRP+N+ SSH+  ES +SAS CAAGDSAAY R SVYGDD+VIVAAYRT 
Sbjct  4    AINRQQVLLEHLRPSNS-SSHN-YESILSASACAAGDSAAYHRTSVYGDDVVIVAAYRTA  61

Query  240  LCKSKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTVLAPGSIRASECRMAAF  419
            LCKSKRGGFKDTYPDDLLA VLKA+IEKTN++PSEVGDI+VGTVLAPGS RASECRMAAF
Sbjct  62   LCKSKRGGFKDTYPDDLLAPVLKAVIEKTNVDPSEVGDIVVGTVLAPGSQRASECRMAAF  121

Query  420  YAGFPETVPVRTVNRQCSSGLQavadvaaaikaGFYDIGIGAGLESMTVN  569
            YAGFPETVPVRTVNRQCSSGLQAVADVAAAIKAGFYDIGIGAGLESMTVN
Sbjct  122  YAGFPETVPVRTVNRQCSSGLQAVADVAAAIKAGFYDIGIGAGLESMTVN  171



>ref|NP_180873.1| 3-ketoacyl-CoA thiolase 2 [Arabidopsis thaliana]
 sp|Q56WD9.2|THIK2_ARATH RecName: Full=3-ketoacyl-CoA thiolase 2, peroxisomal; AltName: 
Full=Acetyl-CoA acyltransferase 2; AltName: Full=Beta-ketothiolase 
2; AltName: Full=Peroxisomal 3-oxoacyl-CoA thiolase 
2; AltName: Full=Peroxisome defective protein 1; Flags: Precursor 
[Arabidopsis thaliana]
 gb|AAG42910.1|AF327529_1 putative 3-ketoacyl-CoA thiolase [Arabidopsis thaliana]
 gb|AAK15577.1|AF349530_1 putative 3-ketoacyl-CoA thiolase [Arabidopsis thaliana]
 gb|AAC04908.1| 3-ketoacyl-CoA thiolase [Arabidopsis thaliana]
 dbj|BAA25248.1| 3-ketoacyl-CoA thiolase [Arabidopsis thaliana]
 dbj|BAA25249.1| 3-ketoacyl-CoA thiolase [Arabidopsis thaliana]
 gb|AAK96606.1| At2g33150/F25I18.11 [Arabidopsis thaliana]
 gb|AAL36070.1| At2g33150/F25I18.11 [Arabidopsis thaliana]
 gb|AAM65085.1| 3-ketoacyl-CoA thiolase [Arabidopsis thaliana]
 gb|AEC08791.1| 3-ketoacyl-CoA thiolase 2 [Arabidopsis thaliana]
Length=462

 Score =   276 bits (705),  Expect = 3e-87, Method: Compositional matrix adjust.
 Identities = 147/170 (86%), Positives = 159/170 (94%), Gaps = 2/170 (1%)
 Frame = +3

Query  60   AIERQRVLLQHLRPTNAASSHDSIESSVSASVCAAGDSAAYQRNSVYGDDIVIVAAYRTP  239
            AIERQRVLL+HLRP+++ SSH+  E+S+SAS C AGDSAAYQR S+YGDD+VIVAA+RTP
Sbjct  4    AIERQRVLLEHLRPSSS-SSHN-YEASLSASACLAGDSAAYQRTSLYGDDVVIVAAHRTP  61

Query  240  LCKSKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTVLAPGSIRASECRMAAF  419
            LCKSKRG FKDTYPDDLLA VL+ALIEKTNLNPSEVGDI+VGTVLAPGS RASECRMAAF
Sbjct  62   LCKSKRGNFKDTYPDDLLAPVLRALIEKTNLNPSEVGDIVVGTVLAPGSQRASECRMAAF  121

Query  420  YAGFPETVPVRTVNRQCSSGLQavadvaaaikaGFYDIGIGAGLESMTVN  569
            YAGFPETV VRTVNRQCSSGLQAVADVAAAIKAGFYDIGIGAGLESMT N
Sbjct  122  YAGFPETVAVRTVNRQCSSGLQAVADVAAAIKAGFYDIGIGAGLESMTTN  171



>ref|XP_002881265.1| hypothetical protein ARALYDRAFT_482251 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH57524.1| hypothetical protein ARALYDRAFT_482251 [Arabidopsis lyrata subsp. 
lyrata]
Length=462

 Score =   275 bits (704),  Expect = 4e-87, Method: Compositional matrix adjust.
 Identities = 146/170 (86%), Positives = 159/170 (94%), Gaps = 2/170 (1%)
 Frame = +3

Query  60   AIERQRVLLQHLRPTNAASSHDSIESSVSASVCAAGDSAAYQRNSVYGDDIVIVAAYRTP  239
            AIERQRVLL+HLRP+ ++SSH+  E+S+SAS C AGDSAAYQR S+YGDD+VIVAA+RTP
Sbjct  4    AIERQRVLLEHLRPS-SSSSHN-FEASLSASACLAGDSAAYQRTSLYGDDVVIVAAHRTP  61

Query  240  LCKSKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTVLAPGSIRASECRMAAF  419
            LCKSKRG FKDTYPDDLLA VL+ALIEKTNLNPSEVGDI+VGTVLAPGS RASECRM+AF
Sbjct  62   LCKSKRGNFKDTYPDDLLAPVLRALIEKTNLNPSEVGDIVVGTVLAPGSQRASECRMSAF  121

Query  420  YAGFPETVPVRTVNRQCSSGLQavadvaaaikaGFYDIGIGAGLESMTVN  569
            YAGFPETV VRTVNRQCSSGLQAVADVAAAIKAGFYDIGIGAGLESMT N
Sbjct  122  YAGFPETVAVRTVNRQCSSGLQAVADVAAAIKAGFYDIGIGAGLESMTTN  171



>ref|XP_010522426.1| PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxisomal [Tarenaya hassleriana]
Length=464

 Score =   275 bits (704),  Expect = 4e-87, Method: Compositional matrix adjust.
 Identities = 144/170 (85%), Positives = 158/170 (93%), Gaps = 2/170 (1%)
 Frame = +3

Query  60   AIERQRVLLQHLRPTNAASSHDSIESSVSASVCAAGDSAAYQRNSVYGDDIVIVAAYRTP  239
            AIERQRVLL+HLRP+++ S +   E+S+SAS C AGDSAAYQR S+YGDD+VIVAA+RT 
Sbjct  4    AIERQRVLLEHLRPSSSPSHN--FEASLSASACLAGDSAAYQRTSLYGDDVVIVAAHRTA  61

Query  240  LCKSKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTVLAPGSIRASECRMAAF  419
            LCKSKRGGFKDTYPDDLLA VL+ALIEKTN+NP+EVGDI+VGTVLAPGS RASECRMAAF
Sbjct  62   LCKSKRGGFKDTYPDDLLAPVLRALIEKTNVNPNEVGDIVVGTVLAPGSQRASECRMAAF  121

Query  420  YAGFPETVPVRTVNRQCSSGLQavadvaaaikaGFYDIGIGAGLESMTVN  569
            YAGFPETVPVRTVNRQCSSGLQAVADVAAAIKAGFYDIGIGAGLESMT N
Sbjct  122  YAGFPETVPVRTVNRQCSSGLQAVADVAAAIKAGFYDIGIGAGLESMTTN  171



>ref|XP_006420604.1| hypothetical protein CICLE_v10004931mg [Citrus clementina]
 ref|XP_006489799.1| PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxisomal-like [Citrus 
sinensis]
 gb|ESR33844.1| hypothetical protein CICLE_v10004931mg [Citrus clementina]
 gb|KDO43598.1| hypothetical protein CISIN_1g012506mg [Citrus sinensis]
Length=462

 Score =   275 bits (704),  Expect = 4e-87, Method: Compositional matrix adjust.
 Identities = 148/170 (87%), Positives = 159/170 (94%), Gaps = 2/170 (1%)
 Frame = +3

Query  60   AIERQRVLLQHLRPTNAASSHDSIESSVSASVCAAGDSAAYQRNSVYGDDIVIVAAYRTP  239
            AI RQ+VLL+HLRP+N+ SSH+  ES +SAS CAAGDSAAY R SVYGDD+VIVAAYRT 
Sbjct  4    AINRQQVLLEHLRPSNS-SSHN-YESILSASACAAGDSAAYHRTSVYGDDVVIVAAYRTA  61

Query  240  LCKSKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTVLAPGSIRASECRMAAF  419
            LCKSKRGGFKDTYPDDLLA VLKA+IEKTN++PSEVGDI+VGTVLAPGS RASECRMAAF
Sbjct  62   LCKSKRGGFKDTYPDDLLAPVLKAVIEKTNVDPSEVGDIVVGTVLAPGSQRASECRMAAF  121

Query  420  YAGFPETVPVRTVNRQCSSGLQavadvaaaikaGFYDIGIGAGLESMTVN  569
            YAGFPETVPVRTVNRQCSSGLQAVADVAAAIKAGFYDIGIGAGLESMTVN
Sbjct  122  YAGFPETVPVRTVNRQCSSGLQAVADVAAAIKAGFYDIGIGAGLESMTVN  171



>ref|NP_001267690.1| 3-ketoacyl-CoA thiolase 2, peroxisomal-like [Cucumis sativus]
 emb|CAA47926.1| 3-ketoacyl-CoA thiolase [Cucumis sativus]
 gb|KGN56763.1| hypothetical protein Csa_3G133140 [Cucumis sativus]
Length=462

 Score =   275 bits (703),  Expect = 5e-87, Method: Compositional matrix adjust.
 Identities = 144/170 (85%), Positives = 158/170 (93%), Gaps = 3/170 (2%)
 Frame = +3

Query  60   AIERQRVLLQHLRPTNAASSHDSIESSVSASVCAAGDSAAYQRNSVYGDDIVIVAAYRTP  239
            AI RQ +LL HLRP+++A ++   ESS+SASVCAAGDSA+YQR SV+GDD+VIVAAYRT 
Sbjct  4    AINRQSILLHHLRPSSSAYTN---ESSLSASVCAAGDSASYQRTSVFGDDVVIVAAYRTA  60

Query  240  LCKSKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTVLAPGSIRASECRMAAF  419
            +CKSKRGGFKDTYPDDLLA VLKALIEKTNLNPSEVGDI+VG+VLAPGS RASECRMAAF
Sbjct  61   ICKSKRGGFKDTYPDDLLAPVLKALIEKTNLNPSEVGDIVVGSVLAPGSQRASECRMAAF  120

Query  420  YAGFPETVPVRTVNRQCSSGLQavadvaaaikaGFYDIGIGAGLESMTVN  569
            YAGFPETVPVRTVNRQCSSGLQAVADVAAAI+AGFYDIGIGAGLESMT N
Sbjct  121  YAGFPETVPVRTVNRQCSSGLQAVADVAAAIRAGFYDIGIGAGLESMTTN  170



>ref|XP_010069076.1| PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxisomal [Eucalyptus 
grandis]
 gb|KCW57291.1| hypothetical protein EUGRSUZ_H00090 [Eucalyptus grandis]
Length=464

 Score =   274 bits (700),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 146/170 (86%), Positives = 159/170 (94%), Gaps = 0/170 (0%)
 Frame = +3

Query  60   AIERQRVLLQHLRPTNAASSHDSIESSVSASVCAAGDSAAYQRNSVYGDDIVIVAAYRTP  239
            AIERQRVLLQHLRP++++SS     SS+SAS+CAAGDSAAYQR+  +GDDIVIVAAYRT 
Sbjct  4    AIERQRVLLQHLRPSSSSSSVHGDASSLSASICAAGDSAAYQRSGSFGDDIVIVAAYRTA  63

Query  240  LCKSKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTVLAPGSIRASECRMAAF  419
            LCKSKRGGFKDTYPDDLLA VL+ALI+KT +NPSEVGDI+VGTVLAPGS RASECRMAAF
Sbjct  64   LCKSKRGGFKDTYPDDLLAPVLRALIDKTKINPSEVGDIVVGTVLAPGSQRASECRMAAF  123

Query  420  YAGFPETVPVRTVNRQCSSGLQavadvaaaikaGFYDIGIGAGLESMTVN  569
            YAGFPETVP+RTVNRQCSSGLQAVADVAAAIKAGFYDIGIGAGLESMTVN
Sbjct  124  YAGFPETVPIRTVNRQCSSGLQAVADVAAAIKAGFYDIGIGAGLESMTVN  173



>ref|XP_006294172.1| hypothetical protein CARUB_v10023167mg [Capsella rubella]
 gb|EOA27070.1| hypothetical protein CARUB_v10023167mg [Capsella rubella]
Length=462

 Score =   273 bits (698),  Expect = 3e-86, Method: Compositional matrix adjust.
 Identities = 146/170 (86%), Positives = 157/170 (92%), Gaps = 2/170 (1%)
 Frame = +3

Query  60   AIERQRVLLQHLRPTNAASSHDSIESSVSASVCAAGDSAAYQRNSVYGDDIVIVAAYRTP  239
            AIERQRVLL+HLRP  A+SSH+  E+S+SAS C AGDSAAYQR S+YGDD+VIVAA+RTP
Sbjct  4    AIERQRVLLEHLRPC-ASSSHN-FEASLSASACLAGDSAAYQRTSLYGDDVVIVAAHRTP  61

Query  240  LCKSKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTVLAPGSIRASECRMAAF  419
            LCKSKRG  KDTYPDDLLA VL+ALIEKTNLNPSEVGDI+VGTVLAPGS RASECRM+AF
Sbjct  62   LCKSKRGNLKDTYPDDLLAPVLRALIEKTNLNPSEVGDIVVGTVLAPGSQRASECRMSAF  121

Query  420  YAGFPETVPVRTVNRQCSSGLQavadvaaaikaGFYDIGIGAGLESMTVN  569
            YAGFPETV VRTVNRQCSSGLQAVADVAAAIKAGFYDIGIGAGLESMT N
Sbjct  122  YAGFPETVAVRTVNRQCSSGLQAVADVAAAIKAGFYDIGIGAGLESMTTN  171



>emb|CAA53078.1| 3-ketoacyl-CoA thiolase B [Mangifera indica]
Length=430

 Score =   271 bits (694),  Expect = 5e-86, Method: Compositional matrix adjust.
 Identities = 146/170 (86%), Positives = 159/170 (94%), Gaps = 2/170 (1%)
 Frame = +3

Query  60   AIERQRVLLQHLRPTNAASSHDSIESSVSASVCAAGDSAAYQRNSVYGDDIVIVAAYRTP  239
            AI RQ+VLLQHLRP+N+ SSH+  ES+++ASVCAAGDSAAY R SVYGDD+VIVAA+RT 
Sbjct  4    AINRQQVLLQHLRPSNS-SSHN-YESALAASVCAAGDSAAYHRASVYGDDVVIVAAHRTA  61

Query  240  LCKSKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTVLAPGSIRASECRMAAF  419
            LCKSKRGGFKDTYPDDLLA VLKALIEKTNL+PSEVGDI+VGTVLA GS RASECRMAAF
Sbjct  62   LCKSKRGGFKDTYPDDLLAPVLKALIEKTNLDPSEVGDIVVGTVLAAGSQRASECRMAAF  121

Query  420  YAGFPETVPVRTVNRQCSSGLQavadvaaaikaGFYDIGIGAGLESMTVN  569
            YAGFP+TVP+RTVNRQCSSGLQAVADVAAAIKAGFYDIGIGAGLESMT N
Sbjct  122  YAGFPDTVPLRTVNRQCSSGLQAVADVAAAIKAGFYDIGIGAGLESMTAN  171



>gb|AAQ77242.1| acetoacetyl CoA thiolase [Helianthus annuus]
Length=449

 Score =   270 bits (691),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 141/170 (83%), Positives = 157/170 (92%), Gaps = 4/170 (2%)
 Frame = +3

Query  60   AIERQRVLLQHLRPTNAASSHDSIESSVSASVCAAGDSAAYQRNSVYGDDIVIVAAYRTP  239
            AIERQRVLL+HLRP++ +SS +++    S SVCAAGDSAAYQRNSV+GDD+VIVAAYR+P
Sbjct  4    AIERQRVLLEHLRPSSTSSSLENL----SVSVCAAGDSAAYQRNSVFGDDVVIVAAYRSP  59

Query  240  LCKSKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTVLAPGSIRASECRMAAF  419
            LCK+KRGG KDTYPDD+LA VLKALIEKTN+NP+EVGDI+VG+VL  GS RASECRMAAF
Sbjct  60   LCKAKRGGLKDTYPDDILAPVLKALIEKTNINPAEVGDIVVGSVLGAGSQRASECRMAAF  119

Query  420  YAGFPETVPVRTVNRQCSSGLQavadvaaaikaGFYDIGIGAGLESMTVN  569
            YAGFPETVPVRTVNRQCSSGLQAVADVAAAIKAGFYDIGIGAGLESMT N
Sbjct  120  YAGFPETVPVRTVNRQCSSGLQAVADVAAAIKAGFYDIGIGAGLESMTAN  169



>ref|XP_010556945.1| PREDICTED: LOW QUALITY PROTEIN: 3-ketoacyl-CoA thiolase 2, peroxisomal-like 
[Tarenaya hassleriana]
Length=463

 Score =   271 bits (692),  Expect = 3e-85, Method: Compositional matrix adjust.
 Identities = 144/170 (85%), Positives = 158/170 (93%), Gaps = 2/170 (1%)
 Frame = +3

Query  60   AIERQRVLLQHLRPTNAASSHDSIESSVSASVCAAGDSAAYQRNSVYGDDIVIVAAYRTP  239
            AIERQRVLL+HLRP+++ SSH+  E+S+SAS C AGDSA+YQR S+YGDD+VIVAAYRT 
Sbjct  4    AIERQRVLLEHLRPSSS-SSHN-FEASLSASACLAGDSASYQRASLYGDDVVIVAAYRTA  61

Query  240  LCKSKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTVLAPGSIRASECRMAAF  419
            LCKSKRGGFKDTYPDDLLA VL+ALIEK N+NP+EVGDI+VGTVLA GS RASECRMAAF
Sbjct  62   LCKSKRGGFKDTYPDDLLAPVLRALIEKKNVNPAEVGDIVVGTVLAAGSQRASECRMAAF  121

Query  420  YAGFPETVPVRTVNRQCSSGLQavadvaaaikaGFYDIGIGAGLESMTVN  569
            YAGFPETVPVRTVNRQCSSGLQAVADVAAAIKAGFYDIGIGAGLESMT N
Sbjct  122  YAGFPETVPVRTVNRQCSSGLQAVADVAAAIKAGFYDIGIGAGLESMTAN  171



>emb|CDO99410.1| unnamed protein product [Coffea canephora]
Length=461

 Score =   270 bits (691),  Expect = 3e-85, Method: Compositional matrix adjust.
 Identities = 144/170 (85%), Positives = 157/170 (92%), Gaps = 3/170 (2%)
 Frame = +3

Query  60   AIERQRVLLQHLRPTNAASSHDSIESSVSASVCAAGDSAAYQRNSVYGDDIVIVAAYRTP  239
            AIERQRV+LQHL+P+  +SS ++++SS+SASVCAAGDSAAY R S +GDD+VIVAAYRT 
Sbjct  4    AIERQRVVLQHLKPSFTSSSLENLDSSLSASVCAAGDSAAYHRTSAFGDDVVIVAAYRTA  63

Query  240  LCKSKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTVLAPGSIRASECRMAAF  419
            LCKSKRGGFKDTYPDDLLA VL+ALIEKTNLNPSEVGDI+VGTVLAPGS RASECRMAAF
Sbjct  64   LCKSKRGGFKDTYPDDLLAPVLRALIEKTNLNPSEVGDIVVGTVLAPGSQRASECRMAAF  123

Query  420  YAGFPETVPVRTVNRQCSSGLQavadvaaaikaGFYDIGIGAGLESMTVN  569
            YA   ETVPVRTVNRQCSSGLQAVADVAAAIKAGFYDIGIGAGLESMT N
Sbjct  124  YA---ETVPVRTVNRQCSSGLQAVADVAAAIKAGFYDIGIGAGLESMTTN  170



>ref|XP_007034449.1| Peroxisomal 3-ketoacyl-CoA thiolase 3 isoform 1 [Theobroma cacao]
 gb|EOY05375.1| Peroxisomal 3-ketoacyl-CoA thiolase 3 isoform 1 [Theobroma cacao]
Length=464

 Score =   270 bits (690),  Expect = 4e-85, Method: Compositional matrix adjust.
 Identities = 140/170 (82%), Positives = 153/170 (90%), Gaps = 0/170 (0%)
 Frame = +3

Query  60   AIERQRVLLQHLRPTNAASSHDSIESSVSASVCAAGDSAAYQRNSVYGDDIVIVAAYRTP  239
            AI RQ++LLQHL P+  +S+  +  S++SAS C AGDSAAYQR + +GDD+VIVAAYRT 
Sbjct  4    AINRQQILLQHLNPSAPSSADQNYNSALSASACLAGDSAAYQRTNAFGDDVVIVAAYRTA  63

Query  240  LCKSKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTVLAPGSIRASECRMAAF  419
            LCKSKRGGFKDTYPDDLLA VL+ALIEKTNLNP EVGDI+VGTVLAPGS RASECRMAAF
Sbjct  64   LCKSKRGGFKDTYPDDLLAPVLRALIEKTNLNPGEVGDIVVGTVLAPGSQRASECRMAAF  123

Query  420  YAGFPETVPVRTVNRQCSSGLQavadvaaaikaGFYDIGIGAGLESMTVN  569
            YAGFPETVPVRTVNRQCSSGLQAVADVAAAIKAGFYDIGIGAGLESMT N
Sbjct  124  YAGFPETVPVRTVNRQCSSGLQAVADVAAAIKAGFYDIGIGAGLESMTTN  173



>ref|XP_009132912.1| PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxisomal-like [Brassica 
rapa]
Length=460

 Score =   270 bits (689),  Expect = 7e-85, Method: Compositional matrix adjust.
 Identities = 145/170 (85%), Positives = 155/170 (91%), Gaps = 4/170 (2%)
 Frame = +3

Query  60   AIERQRVLLQHLRPTNAASSHDSIESSVSASVCAAGDSAAYQRNSVYGDDIVIVAAYRTP  239
            AIERQRVLL+HLRP+   SSH S E S+SAS C AGDSAAYQR S+YGDD+VIVAA+RT 
Sbjct  4    AIERQRVLLEHLRPS---SSH-SFEGSLSASACLAGDSAAYQRTSLYGDDVVIVAAHRTA  59

Query  240  LCKSKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTVLAPGSIRASECRMAAF  419
            LCKSKRG FKDTYPDDLLA VL+ALIEKTNL+PSEVGDI+VGTVLAPGS RASECRM+AF
Sbjct  60   LCKSKRGNFKDTYPDDLLAPVLRALIEKTNLDPSEVGDIVVGTVLAPGSQRASECRMSAF  119

Query  420  YAGFPETVPVRTVNRQCSSGLQavadvaaaikaGFYDIGIGAGLESMTVN  569
            YAGFPETV VRTVNRQCSSGLQAVADVAAAIKAGFYDIGIGAGLESMT N
Sbjct  120  YAGFPETVAVRTVNRQCSSGLQAVADVAAAIKAGFYDIGIGAGLESMTTN  169



>ref|XP_011091395.1| PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxisomal [Sesamum indicum]
Length=464

 Score =   268 bits (685),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 147/170 (86%), Positives = 163/170 (96%), Gaps = 0/170 (0%)
 Frame = +3

Query  60   AIERQRVLLQHLRPTNAASSHDSIESSVSASVCAAGDSAAYQRNSVYGDDIVIVAAYRTP  239
            A+ERQRVLLQHLRP+  +SS + I+SS+SAS+C+AGDS+AY R++V+GDD+VIVAAYRTP
Sbjct  4    AVERQRVLLQHLRPSFTSSSLEDIDSSISASICSAGDSSAYHRSTVFGDDVVIVAAYRTP  63

Query  240  LCKSKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTVLAPGSIRASECRMAAF  419
            LCKSKRGGFKDTYPDDLLA VL+ALIEKTN+NPSEVGDI+VGTVLAPGS RASECRMAAF
Sbjct  64   LCKSKRGGFKDTYPDDLLAPVLRALIEKTNVNPSEVGDIVVGTVLAPGSQRASECRMAAF  123

Query  420  YAGFPETVPVRTVNRQCSSGLQavadvaaaikaGFYDIGIGAGLESMTVN  569
            YAGFPETVPVRTVNRQCSSGLQAVADVAAAIKAGFYDIGIGAGLESMTVN
Sbjct  124  YAGFPETVPVRTVNRQCSSGLQAVADVAAAIKAGFYDIGIGAGLESMTVN  173



>emb|CDY19452.1| BnaC04g11470D [Brassica napus]
Length=463

 Score =   268 bits (685),  Expect = 3e-84, Method: Compositional matrix adjust.
 Identities = 146/170 (86%), Positives = 159/170 (94%), Gaps = 1/170 (1%)
 Frame = +3

Query  60   AIERQRVLLQHLRPTNAASSHDSIESSVSASVCAAGDSAAYQRNSVYGDDIVIVAAYRTP  239
            AIERQRVLL+HLRP++++SSH S E S+SAS C AGDSAAYQR S+YGDD+VIVAA+RT 
Sbjct  4    AIERQRVLLEHLRPSSSSSSH-SFEGSLSASACLAGDSAAYQRTSLYGDDVVIVAAHRTA  62

Query  240  LCKSKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTVLAPGSIRASECRMAAF  419
            LCKSKRG FKDTYPDDLLA VL+ALIEKTNLNPS+VGDI+VGTVLAPGS RASECRM+AF
Sbjct  63   LCKSKRGNFKDTYPDDLLAPVLRALIEKTNLNPSDVGDIVVGTVLAPGSQRASECRMSAF  122

Query  420  YAGFPETVPVRTVNRQCSSGLQavadvaaaikaGFYDIGIGAGLESMTVN  569
            YAGFPETVPVRTVNRQCSSGLQAVADVAAAIKAGFYDIGIGAGLESMT N
Sbjct  123  YAGFPETVPVRTVNRQCSSGLQAVADVAAAIKAGFYDIGIGAGLESMTTN  172



>ref|XP_009143894.1| PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxisomal [Brassica rapa]
 emb|CDY17140.1| BnaA05g10480D [Brassica napus]
Length=462

 Score =   268 bits (684),  Expect = 3e-84, Method: Compositional matrix adjust.
 Identities = 144/170 (85%), Positives = 157/170 (92%), Gaps = 2/170 (1%)
 Frame = +3

Query  60   AIERQRVLLQHLRPTNAASSHDSIESSVSASVCAAGDSAAYQRNSVYGDDIVIVAAYRTP  239
            AIERQRVLL+HLRP++++S   S E S+SAS C AGDSAAYQR S+YGDD+VIVAA+RT 
Sbjct  4    AIERQRVLLEHLRPSSSSSH--SFEGSLSASACLAGDSAAYQRTSLYGDDVVIVAAHRTA  61

Query  240  LCKSKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTVLAPGSIRASECRMAAF  419
            LCKSKRG FKDTYPDDLLA VL+ALIEKTNLNPS+VGDI+VGTVLAPGS RASECRM+AF
Sbjct  62   LCKSKRGNFKDTYPDDLLAPVLRALIEKTNLNPSDVGDIVVGTVLAPGSQRASECRMSAF  121

Query  420  YAGFPETVPVRTVNRQCSSGLQavadvaaaikaGFYDIGIGAGLESMTVN  569
            YAGFPETVPVRTVNRQCSSGLQAVADVAAAIKAGFYDIGIGAGLESMT N
Sbjct  122  YAGFPETVPVRTVNRQCSSGLQAVADVAAAIKAGFYDIGIGAGLESMTTN  171



>ref|XP_010413914.1| PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxisomal [Camelina sativa]
Length=462

 Score =   268 bits (684),  Expect = 4e-84, Method: Compositional matrix adjust.
 Identities = 143/170 (84%), Positives = 157/170 (92%), Gaps = 2/170 (1%)
 Frame = +3

Query  60   AIERQRVLLQHLRPTNAASSHDSIESSVSASVCAAGDSAAYQRNSVYGDDIVIVAAYRTP  239
            AIERQRVLL+HLRP +++S   S E+S+SAS C AGDSAAYQR S+YGDD+VIVAA+RTP
Sbjct  4    AIERQRVLLEHLRPCSSSSH--SFEASLSASACLAGDSAAYQRTSLYGDDVVIVAAHRTP  61

Query  240  LCKSKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTVLAPGSIRASECRMAAF  419
            LCK+KRG FKDTYPDDLLA VL+ALIEKTN+NPSEVGDI+VGTVLAPGS RASECRM+AF
Sbjct  62   LCKAKRGNFKDTYPDDLLAPVLRALIEKTNINPSEVGDIVVGTVLAPGSQRASECRMSAF  121

Query  420  YAGFPETVPVRTVNRQCSSGLQavadvaaaikaGFYDIGIGAGLESMTVN  569
            YAGFPETV VRTVNRQCSSGLQAVADVAAAIKAGFYDIGIGAGLESMT N
Sbjct  122  YAGFPETVAVRTVNRQCSSGLQAVADVAAAIKAGFYDIGIGAGLESMTTN  171



>ref|XP_010509924.1| PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxisomal-like [Camelina 
sativa]
Length=462

 Score =   268 bits (684),  Expect = 5e-84, Method: Compositional matrix adjust.
 Identities = 143/170 (84%), Positives = 157/170 (92%), Gaps = 2/170 (1%)
 Frame = +3

Query  60   AIERQRVLLQHLRPTNAASSHDSIESSVSASVCAAGDSAAYQRNSVYGDDIVIVAAYRTP  239
            AIERQRVLL+HLRP +++S   S E+S+SAS C AGDSAAYQR S+YGDD+VIVAA+RTP
Sbjct  4    AIERQRVLLEHLRPCSSSSH--SFEASLSASACLAGDSAAYQRTSLYGDDVVIVAAHRTP  61

Query  240  LCKSKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTVLAPGSIRASECRMAAF  419
            LCK+KRG FKDTYPDDLLA VL+ALIEKTN+NPSEVGDI+VGTVLAPGS RASECRM+AF
Sbjct  62   LCKAKRGNFKDTYPDDLLAPVLRALIEKTNINPSEVGDIVVGTVLAPGSQRASECRMSAF  121

Query  420  YAGFPETVPVRTVNRQCSSGLQavadvaaaikaGFYDIGIGAGLESMTVN  569
            YAGFPETV VRTVNRQCSSGLQAVADVAAAIKAGFYDIGIGAGLESMT N
Sbjct  122  YAGFPETVAVRTVNRQCSSGLQAVADVAAAIKAGFYDIGIGAGLESMTTN  171



>emb|CAN81585.1| hypothetical protein VITISV_023191 [Vitis vinifera]
Length=461

 Score =   267 bits (683),  Expect = 5e-84, Method: Compositional matrix adjust.
 Identities = 147/170 (86%), Positives = 157/170 (92%), Gaps = 3/170 (2%)
 Frame = +3

Query  60   AIERQRVLLQHLRPTNAASSHDSIESSVSASVCAAGDSAAYQRNSVYGDDIVIVAAYRTP  239
            AI RQRVLLQHL P+++A+     ESS+SASVC AGDSAAYQR SV+GDD+VIVAAYRT 
Sbjct  4    AINRQRVLLQHLSPSSSAAED---ESSLSASVCVAGDSAAYQRTSVFGDDVVIVAAYRTA  60

Query  240  LCKSKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTVLAPGSIRASECRMAAF  419
            LCKSKRGGFKDTYPDDLLA VL+ALIEKTNLNP+EVGDI+VGTVLAPGS RASECRMAAF
Sbjct  61   LCKSKRGGFKDTYPDDLLAPVLRALIEKTNLNPNEVGDIVVGTVLAPGSQRASECRMAAF  120

Query  420  YAGFPETVPVRTVNRQCSSGLQavadvaaaikaGFYDIGIGAGLESMTVN  569
            YAGFPETVPVRTVNRQCSSGLQAVADVAAAIKAGFYDIGIGAGLESMT N
Sbjct  121  YAGFPETVPVRTVNRQCSSGLQAVADVAAAIKAGFYDIGIGAGLESMTAN  170



>ref|XP_010243983.1| PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxisomal [Nelumbo nucifera]
Length=460

 Score =   267 bits (683),  Expect = 6e-84, Method: Compositional matrix adjust.
 Identities = 142/170 (84%), Positives = 153/170 (90%), Gaps = 4/170 (2%)
 Frame = +3

Query  60   AIERQRVLLQHLRPTNAASSHDSIESSVSASVCAAGDSAAYQRNSVYGDDIVIVAAYRTP  239
            AI RQRVLL HLRP    SS    +SS+SASVC AGDSAAY R + +GDD+VIVAAYRT 
Sbjct  4    AINRQRVLLDHLRP----SSQTHHQSSLSASVCLAGDSAAYHRTAAFGDDVVIVAAYRTA  59

Query  240  LCKSKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTVLAPGSIRASECRMAAF  419
            LCKSKRGG+KDT+PDDLLA VLKALIEKTNLNP+EVGDIIVGTVLAPGS RA+ECRMAAF
Sbjct  60   LCKSKRGGYKDTHPDDLLAPVLKALIEKTNLNPNEVGDIIVGTVLAPGSQRATECRMAAF  119

Query  420  YAGFPETVPVRTVNRQCSSGLQavadvaaaikaGFYDIGIGAGLESMTVN  569
            YAGFPETVP+RTVNRQCSSGLQAVADVAAAIKAGFYDIGIGAGLESMT+N
Sbjct  120  YAGFPETVPIRTVNRQCSSGLQAVADVAAAIKAGFYDIGIGAGLESMTIN  169



>ref|XP_002299284.2| hypothetical protein POPTR_0001s14280g [Populus trichocarpa]
 gb|EEE84089.2| hypothetical protein POPTR_0001s14280g [Populus trichocarpa]
Length=461

 Score =   267 bits (682),  Expect = 8e-84, Method: Compositional matrix adjust.
 Identities = 141/170 (83%), Positives = 155/170 (91%), Gaps = 4/170 (2%)
 Frame = +3

Query  60   AIERQRVLLQHLRPTNAASSHDSIESSVSASVCAAGDSAAYQRNSVYGDDIVIVAAYRTP  239
            AI RQRVLL+HLRP+   SSH+  ES++SAS C AGDSAAYQR S YGDD+VIVAAYRTP
Sbjct  4    AINRQRVLLEHLRPS---SSHN-FESTLSASACLAGDSAAYQRTSAYGDDVVIVAAYRTP  59

Query  240  LCKSKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTVLAPGSIRASECRMAAF  419
             CKSKRGGFKDT+ DDLLA VLKALIEKTNL+P EVGDI+VG+VLAPGS RASECRMAAF
Sbjct  60   QCKSKRGGFKDTHADDLLAPVLKALIEKTNLDPREVGDIVVGSVLAPGSQRASECRMAAF  119

Query  420  YAGFPETVPVRTVNRQCSSGLQavadvaaaikaGFYDIGIGAGLESMTVN  569
            YAGFPETVP+RTVNRQCSSGLQAVADVAA+IKAGFY+IGIGAGLESMT+N
Sbjct  120  YAGFPETVPIRTVNRQCSSGLQAVADVAASIKAGFYEIGIGAGLESMTIN  169



>ref|XP_011002175.1| PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxisomal [Populus euphratica]
Length=462

 Score =   266 bits (681),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 142/170 (84%), Positives = 155/170 (91%), Gaps = 3/170 (2%)
 Frame = +3

Query  60   AIERQRVLLQHLRPTNAASSHDSIESSVSASVCAAGDSAAYQRNSVYGDDIVIVAAYRTP  239
            AI RQRVLL HLRP+  +SSH+  ES++SAS C AGDSAAYQR S YGDD+VIVAAYRTP
Sbjct  4    AINRQRVLLDHLRPS--SSSHN-FESTLSASACLAGDSAAYQRTSAYGDDVVIVAAYRTP  60

Query  240  LCKSKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTVLAPGSIRASECRMAAF  419
             CKSKRGGFKDT+ DDLLA VLKALIEKTNL+P EVGDI+VG+VLAPGS RASECRMAAF
Sbjct  61   QCKSKRGGFKDTHADDLLAPVLKALIEKTNLDPREVGDIVVGSVLAPGSQRASECRMAAF  120

Query  420  YAGFPETVPVRTVNRQCSSGLQavadvaaaikaGFYDIGIGAGLESMTVN  569
            YAGFPETVPVRTVNRQCSSGLQAVADVAA+IKAGFY+IGIGAGLESMT+N
Sbjct  121  YAGFPETVPVRTVNRQCSSGLQAVADVAASIKAGFYEIGIGAGLESMTIN  170



>gb|KJB72151.1| hypothetical protein B456_011G161700 [Gossypium raimondii]
Length=415

 Score =   265 bits (677),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 139/170 (82%), Positives = 153/170 (90%), Gaps = 0/170 (0%)
 Frame = +3

Query  60   AIERQRVLLQHLRPTNAASSHDSIESSVSASVCAAGDSAAYQRNSVYGDDIVIVAAYRTP  239
            AI RQ+VLLQHL P+ ++       S++SAS C AGDSAAY+R +V+GDD+VIVAAYRT 
Sbjct  4    AINRQQVLLQHLNPSASSFLSHQNNSALSASACLAGDSAAYRRTNVFGDDVVIVAAYRTA  63

Query  240  LCKSKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTVLAPGSIRASECRMAAF  419
            LCKSKRGGFKDTYPDDLLA VL+A+IEKTNLNPSEVGDI+VGTVLAPGS RASECRMAAF
Sbjct  64   LCKSKRGGFKDTYPDDLLAPVLRAVIEKTNLNPSEVGDIVVGTVLAPGSQRASECRMAAF  123

Query  420  YAGFPETVPVRTVNRQCSSGLQavadvaaaikaGFYDIGIGAGLESMTVN  569
            YAGFPETVPVRTVNRQCSSGLQAVADVAAAIKAGFY+IGIGAGLESMT N
Sbjct  124  YAGFPETVPVRTVNRQCSSGLQAVADVAAAIKAGFYEIGIGAGLESMTTN  173



>ref|XP_002285653.1| PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxisomal [Vitis vinifera]
 emb|CBI33354.3| unnamed protein product [Vitis vinifera]
Length=461

 Score =   266 bits (681),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 146/170 (86%), Positives = 157/170 (92%), Gaps = 3/170 (2%)
 Frame = +3

Query  60   AIERQRVLLQHLRPTNAASSHDSIESSVSASVCAAGDSAAYQRNSVYGDDIVIVAAYRTP  239
            AI RQRVLLQHL P+++A+     ESS+SASVC AGDSAAYQR SV+GDD+VIVAAYRT 
Sbjct  4    AINRQRVLLQHLSPSSSAAED---ESSLSASVCVAGDSAAYQRTSVFGDDVVIVAAYRTA  60

Query  240  LCKSKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTVLAPGSIRASECRMAAF  419
            LCKSKRGGFKDTYPDDLLA VL+AL+EKTNLNP+EVGDI+VGTVLAPGS RASECRMAAF
Sbjct  61   LCKSKRGGFKDTYPDDLLAPVLRALLEKTNLNPNEVGDIVVGTVLAPGSQRASECRMAAF  120

Query  420  YAGFPETVPVRTVNRQCSSGLQavadvaaaikaGFYDIGIGAGLESMTVN  569
            YAGFPETVPVRTVNRQCSSGLQAVADVAAAIKAGFYDIGIGAGLESMT N
Sbjct  121  YAGFPETVPVRTVNRQCSSGLQAVADVAAAIKAGFYDIGIGAGLESMTAN  170



>ref|XP_006410451.1| hypothetical protein EUTSA_v10016622mg [Eutrema salsugineum]
 dbj|BAJ34444.1| unnamed protein product [Thellungiella halophila]
 gb|ESQ51904.1| hypothetical protein EUTSA_v10016622mg [Eutrema salsugineum]
Length=462

 Score =   266 bits (680),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 144/170 (85%), Positives = 156/170 (92%), Gaps = 2/170 (1%)
 Frame = +3

Query  60   AIERQRVLLQHLRPTNAASSHDSIESSVSASVCAAGDSAAYQRNSVYGDDIVIVAAYRTP  239
            AIERQRVLL+HLRP++++S   S E S+SAS C AGDSAAYQR S+YGDD+VIVAA+RT 
Sbjct  4    AIERQRVLLEHLRPSSSSSH--SFEGSLSASACLAGDSAAYQRTSLYGDDVVIVAAHRTA  61

Query  240  LCKSKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTVLAPGSIRASECRMAAF  419
            LCKSKRG FKDTYPDDLLA VL+ALIEKTNLNPSEVGDI+VGTVLAPGS RASECRM+AF
Sbjct  62   LCKSKRGNFKDTYPDDLLAPVLRALIEKTNLNPSEVGDIVVGTVLAPGSQRASECRMSAF  121

Query  420  YAGFPETVPVRTVNRQCSSGLQavadvaaaikaGFYDIGIGAGLESMTVN  569
            YAGFPETV VRTVNRQCSSGLQAVADVAAAIKAGFYDIGIGAGLESMT N
Sbjct  122  YAGFPETVAVRTVNRQCSSGLQAVADVAAAIKAGFYDIGIGAGLESMTTN  171



>gb|KHG05724.1| 3-ketoacyl-CoA thiolase 2, peroxisomal -like protein [Gossypium 
arboreum]
Length=464

 Score =   266 bits (680),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 140/170 (82%), Positives = 153/170 (90%), Gaps = 0/170 (0%)
 Frame = +3

Query  60   AIERQRVLLQHLRPTNAASSHDSIESSVSASVCAAGDSAAYQRNSVYGDDIVIVAAYRTP  239
            AI RQ+VLLQHL P+ ++ S     S++SAS C AGDSAAY R +V+GDD+VIVAAYRT 
Sbjct  4    AINRQQVLLQHLNPSASSFSSHQNNSALSASACLAGDSAAYLRTNVFGDDVVIVAAYRTA  63

Query  240  LCKSKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTVLAPGSIRASECRMAAF  419
            LCKSKRGGFKDTYPDDLLA VL+A+IEKTNLNPSEVGDI+VGTVLAPGS RASECRMAAF
Sbjct  64   LCKSKRGGFKDTYPDDLLAPVLRAVIEKTNLNPSEVGDIVVGTVLAPGSQRASECRMAAF  123

Query  420  YAGFPETVPVRTVNRQCSSGLQavadvaaaikaGFYDIGIGAGLESMTVN  569
            YAGFPETVPVRTVNRQCSSGLQAVADVAAAIKAGFY+IGIGAGLESMT N
Sbjct  124  YAGFPETVPVRTVNRQCSSGLQAVADVAAAIKAGFYEIGIGAGLESMTTN  173



>emb|CDY37750.1| BnaA04g19180D [Brassica napus]
Length=462

 Score =   266 bits (679),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 144/170 (85%), Positives = 156/170 (92%), Gaps = 2/170 (1%)
 Frame = +3

Query  60   AIERQRVLLQHLRPTNAASSHDSIESSVSASVCAAGDSAAYQRNSVYGDDIVIVAAYRTP  239
            AIERQRVLLQHLRP++++S   S E S+SAS C AGDSAAYQR S+YGDD+VIVAA+RT 
Sbjct  4    AIERQRVLLQHLRPSSSSSH--SFEGSLSASACLAGDSAAYQRTSLYGDDVVIVAAHRTA  61

Query  240  LCKSKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTVLAPGSIRASECRMAAF  419
            LCKSKRG FKDTYPDDLLA VL+ALIEKTNL+PSEVGDI+VGTVLAPGS RASECRM+AF
Sbjct  62   LCKSKRGNFKDTYPDDLLAPVLRALIEKTNLDPSEVGDIVVGTVLAPGSQRASECRMSAF  121

Query  420  YAGFPETVPVRTVNRQCSSGLQavadvaaaikaGFYDIGIGAGLESMTVN  569
            YAGFPETV VRTVNRQCSSGLQAVADVAAAIKAGFYDIGIGAGLESMT N
Sbjct  122  YAGFPETVAVRTVNRQCSSGLQAVADVAAAIKAGFYDIGIGAGLESMTTN  171



>emb|CAA63598.1| glyoxysomal beta-ketoacyl-thiolase [Brassica napus]
Length=462

 Score =   265 bits (677),  Expect = 4e-83, Method: Compositional matrix adjust.
 Identities = 142/170 (84%), Positives = 156/170 (92%), Gaps = 2/170 (1%)
 Frame = +3

Query  60   AIERQRVLLQHLRPTNAASSHDSIESSVSASVCAAGDSAAYQRNSVYGDDIVIVAAYRTP  239
            A+ERQRVLL+HLRP++++S   S E S+SAS C AGDSAAYQR S+YGDD+VIVAA+RT 
Sbjct  4    AMERQRVLLEHLRPSSSSSH--SFEGSLSASACLAGDSAAYQRTSLYGDDVVIVAAHRTA  61

Query  240  LCKSKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTVLAPGSIRASECRMAAF  419
            LCKSKRG FKDTYPDDLLA VL+ALIEKTNLNPS+VGDI+VGTV APGS RASECRM+AF
Sbjct  62   LCKSKRGNFKDTYPDDLLAPVLRALIEKTNLNPSDVGDIVVGTVWAPGSQRASECRMSAF  121

Query  420  YAGFPETVPVRTVNRQCSSGLQavadvaaaikaGFYDIGIGAGLESMTVN  569
            YAGFPETVPVRTVNRQCSSGLQAVADVAAAIKAGFYDIGIGAGLESMT N
Sbjct  122  YAGFPETVPVRTVNRQCSSGLQAVADVAAAIKAGFYDIGIGAGLESMTTN  171



>gb|KJB72150.1| hypothetical protein B456_011G161700 [Gossypium raimondii]
Length=464

 Score =   265 bits (677),  Expect = 4e-83, Method: Compositional matrix adjust.
 Identities = 139/170 (82%), Positives = 153/170 (90%), Gaps = 0/170 (0%)
 Frame = +3

Query  60   AIERQRVLLQHLRPTNAASSHDSIESSVSASVCAAGDSAAYQRNSVYGDDIVIVAAYRTP  239
            AI RQ+VLLQHL P+ ++       S++SAS C AGDSAAY+R +V+GDD+VIVAAYRT 
Sbjct  4    AINRQQVLLQHLNPSASSFLSHQNNSALSASACLAGDSAAYRRTNVFGDDVVIVAAYRTA  63

Query  240  LCKSKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTVLAPGSIRASECRMAAF  419
            LCKSKRGGFKDTYPDDLLA VL+A+IEKTNLNPSEVGDI+VGTVLAPGS RASECRMAAF
Sbjct  64   LCKSKRGGFKDTYPDDLLAPVLRAVIEKTNLNPSEVGDIVVGTVLAPGSQRASECRMAAF  123

Query  420  YAGFPETVPVRTVNRQCSSGLQavadvaaaikaGFYDIGIGAGLESMTVN  569
            YAGFPETVPVRTVNRQCSSGLQAVADVAAAIKAGFY+IGIGAGLESMT N
Sbjct  124  YAGFPETVPVRTVNRQCSSGLQAVADVAAAIKAGFYEIGIGAGLESMTTN  173



>gb|KJB72152.1| hypothetical protein B456_011G161700 [Gossypium raimondii]
Length=453

 Score =   264 bits (675),  Expect = 6e-83, Method: Compositional matrix adjust.
 Identities = 139/170 (82%), Positives = 153/170 (90%), Gaps = 0/170 (0%)
 Frame = +3

Query  60   AIERQRVLLQHLRPTNAASSHDSIESSVSASVCAAGDSAAYQRNSVYGDDIVIVAAYRTP  239
            AI RQ+VLLQHL P+ ++       S++SAS C AGDSAAY+R +V+GDD+VIVAAYRT 
Sbjct  4    AINRQQVLLQHLNPSASSFLSHQNNSALSASACLAGDSAAYRRTNVFGDDVVIVAAYRTA  63

Query  240  LCKSKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTVLAPGSIRASECRMAAF  419
            LCKSKRGGFKDTYPDDLLA VL+A+IEKTNLNPSEVGDI+VGTVLAPGS RASECRMAAF
Sbjct  64   LCKSKRGGFKDTYPDDLLAPVLRAVIEKTNLNPSEVGDIVVGTVLAPGSQRASECRMAAF  123

Query  420  YAGFPETVPVRTVNRQCSSGLQavadvaaaikaGFYDIGIGAGLESMTVN  569
            YAGFPETVPVRTVNRQCSSGLQAVADVAAAIKAGFY+IGIGAGLESMT N
Sbjct  124  YAGFPETVPVRTVNRQCSSGLQAVADVAAAIKAGFYEIGIGAGLESMTTN  173



>emb|CDY23766.1| BnaC04g43560D [Brassica napus]
Length=462

 Score =   265 bits (676),  Expect = 7e-83, Method: Compositional matrix adjust.
 Identities = 143/170 (84%), Positives = 156/170 (92%), Gaps = 2/170 (1%)
 Frame = +3

Query  60   AIERQRVLLQHLRPTNAASSHDSIESSVSASVCAAGDSAAYQRNSVYGDDIVIVAAYRTP  239
            AIERQRVLL+HLRP++++S   S E S+SAS C AGDSAAYQR S+YGDD+VIVAA+RT 
Sbjct  4    AIERQRVLLEHLRPSSSSSH--SFEGSLSASACLAGDSAAYQRTSLYGDDVVIVAAHRTA  61

Query  240  LCKSKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTVLAPGSIRASECRMAAF  419
            LCKSKRG FKDTYPDDLLA VL+ALIEKTNL+PSEVGDI+VGTVLAPGS RASECRM+AF
Sbjct  62   LCKSKRGNFKDTYPDDLLAPVLRALIEKTNLDPSEVGDIVVGTVLAPGSQRASECRMSAF  121

Query  420  YAGFPETVPVRTVNRQCSSGLQavadvaaaikaGFYDIGIGAGLESMTVN  569
            YAGFPETV VRTVNRQCSSGLQAVADVAAAIKAGFYDIGIGAGLESMT N
Sbjct  122  YAGFPETVAVRTVNRQCSSGLQAVADVAAAIKAGFYDIGIGAGLESMTTN  171



>ref|XP_008224585.1| PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxisomal [Prunus mume]
Length=462

 Score =   265 bits (676),  Expect = 7e-83, Method: Compositional matrix adjust.
 Identities = 137/170 (81%), Positives = 154/170 (91%), Gaps = 1/170 (1%)
 Frame = +3

Query  60   AIERQRVLLQHLRPTNAASSHDSIESSVSASVCAAGDSAAYQRNSVYGDDIVIVAAYRTP  239
            A  RQRVLL HLRP+ ++S H +  SS+SAS C AGDSAAY R +V+GDD+VIVAAYRTP
Sbjct  4    AFNRQRVLLDHLRPS-SSSLHGTDSSSLSASACVAGDSAAYARTNVFGDDVVIVAAYRTP  62

Query  240  LCKSKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTVLAPGSIRASECRMAAF  419
            +CK+KRGGFKDT+ DDLLA VLKA+IEK+NLNPSEVGDI+VGTVLAPGS RASECRMAAF
Sbjct  63   ICKAKRGGFKDTHADDLLAPVLKAVIEKSNLNPSEVGDIVVGTVLAPGSQRASECRMAAF  122

Query  420  YAGFPETVPVRTVNRQCSSGLQavadvaaaikaGFYDIGIGAGLESMTVN  569
            YAGFPETVP+RTVNRQCSSGLQAVADVAA+I+AGFYDIGIGAGLESMT N
Sbjct  123  YAGFPETVPIRTVNRQCSSGLQAVADVAASIRAGFYDIGIGAGLESMTAN  172



>gb|EPS68937.1| hypothetical protein M569_05826, partial [Genlisea aurea]
Length=457

 Score =   264 bits (675),  Expect = 7e-83, Method: Compositional matrix adjust.
 Identities = 137/170 (81%), Positives = 155/170 (91%), Gaps = 6/170 (4%)
 Frame = +3

Query  60   AIERQRVLLQHLRPTNAASSHDSIESSVSASVCAAGDSAAYQRNSVYGDDIVIVAAYRTP  239
            A++RQRVLL+HLRP       ++ ESS+SAS+CAAGDSA Y R+SV+GDD+VIVAAYR+ 
Sbjct  4    AVDRQRVLLRHLRPI------ENTESSISASICAAGDSAPYHRSSVFGDDVVIVAAYRSA  57

Query  240  LCKSKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTVLAPGSIRASECRMAAF  419
            LCKSKRG FKDTYP+D+LA VL+ALI+KTNLNP+EVGDI+VGTVLAPGS RASECRMAAF
Sbjct  58   LCKSKRGSFKDTYPEDILAPVLRALIDKTNLNPNEVGDIVVGTVLAPGSQRASECRMAAF  117

Query  420  YAGFPETVPVRTVNRQCSSGLQavadvaaaikaGFYDIGIGAGLESMTVN  569
            YAGFPETVP+RTVNRQCSSGLQAVADVAAAIKAGFYDIGIGAGLESMT N
Sbjct  118  YAGFPETVPIRTVNRQCSSGLQAVADVAAAIKAGFYDIGIGAGLESMTAN  167



>ref|XP_009141289.1| PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxisomal [Brassica rapa]
Length=462

 Score =   264 bits (675),  Expect = 7e-83, Method: Compositional matrix adjust.
 Identities = 143/170 (84%), Positives = 156/170 (92%), Gaps = 2/170 (1%)
 Frame = +3

Query  60   AIERQRVLLQHLRPTNAASSHDSIESSVSASVCAAGDSAAYQRNSVYGDDIVIVAAYRTP  239
            AIERQRVLL+HLRP++++S   S E S+SAS C AGDSAAYQR S+YGDD+VIVAA+RT 
Sbjct  4    AIERQRVLLEHLRPSSSSSH--SFEGSLSASACLAGDSAAYQRTSLYGDDVVIVAAHRTA  61

Query  240  LCKSKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTVLAPGSIRASECRMAAF  419
            LCKSKRG FKDTYPDDLLA VL+ALIEKTNL+PSEVGDI+VGTVLAPGS RASECRM+AF
Sbjct  62   LCKSKRGNFKDTYPDDLLAPVLRALIEKTNLDPSEVGDIVVGTVLAPGSQRASECRMSAF  121

Query  420  YAGFPETVPVRTVNRQCSSGLQavadvaaaikaGFYDIGIGAGLESMTVN  569
            YAGFPETV VRTVNRQCSSGLQAVADVAAAIKAGFYDIGIGAGLESMT N
Sbjct  122  YAGFPETVAVRTVNRQCSSGLQAVADVAAAIKAGFYDIGIGAGLESMTTN  171



>emb|CDX84701.1| BnaA03g15290D [Brassica napus]
Length=462

 Score =   264 bits (675),  Expect = 8e-83, Method: Compositional matrix adjust.
 Identities = 143/170 (84%), Positives = 156/170 (92%), Gaps = 2/170 (1%)
 Frame = +3

Query  60   AIERQRVLLQHLRPTNAASSHDSIESSVSASVCAAGDSAAYQRNSVYGDDIVIVAAYRTP  239
            AIERQRVLL+HLRP++++S   S E S+SAS C AGDSAAYQR S+YGDD+VIVAA+RT 
Sbjct  4    AIERQRVLLEHLRPSSSSSH--SFEGSLSASACLAGDSAAYQRTSLYGDDVVIVAAHRTA  61

Query  240  LCKSKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTVLAPGSIRASECRMAAF  419
            LCKSKRG FKDTYPDDLLA VL+ALIEKTNL+PSEVGDI+VGTVLAPGS RASECRM+AF
Sbjct  62   LCKSKRGNFKDTYPDDLLAPVLRALIEKTNLDPSEVGDIVVGTVLAPGSQRASECRMSAF  121

Query  420  YAGFPETVPVRTVNRQCSSGLQavadvaaaikaGFYDIGIGAGLESMTVN  569
            YAGFPETV VRTVNRQCSSGLQAVADVAAAIKAGFYDIGIGAGLESMT N
Sbjct  122  YAGFPETVAVRTVNRQCSSGLQAVADVAAAIKAGFYDIGIGAGLESMTTN  171



>emb|CDX79511.1| BnaC03g18470D [Brassica napus]
Length=462

 Score =   264 bits (675),  Expect = 8e-83, Method: Compositional matrix adjust.
 Identities = 143/170 (84%), Positives = 156/170 (92%), Gaps = 2/170 (1%)
 Frame = +3

Query  60   AIERQRVLLQHLRPTNAASSHDSIESSVSASVCAAGDSAAYQRNSVYGDDIVIVAAYRTP  239
            AIERQRVLL+HLRP++++S   S E S+SAS C AGDSAAYQR S+YGDD+VIVAA+RT 
Sbjct  4    AIERQRVLLEHLRPSSSSSH--SFEGSLSASACLAGDSAAYQRTSLYGDDVVIVAAHRTA  61

Query  240  LCKSKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTVLAPGSIRASECRMAAF  419
            LCKSKRG FKDTYPDDLLA VL+ALIEKTNL+PSEVGDI+VGTVLAPGS RASECRM+AF
Sbjct  62   LCKSKRGNFKDTYPDDLLAPVLRALIEKTNLDPSEVGDIVVGTVLAPGSQRASECRMSAF  121

Query  420  YAGFPETVPVRTVNRQCSSGLQavadvaaaikaGFYDIGIGAGLESMTVN  569
            YAGFPETV VRTVNRQCSSGLQAVADVAAAIKAGFYDIGIGAGLESMT N
Sbjct  122  YAGFPETVAVRTVNRQCSSGLQAVADVAAAIKAGFYDIGIGAGLESMTTN  171



>ref|XP_007225742.1| hypothetical protein PRUPE_ppa005421mg [Prunus persica]
 gb|EMJ26941.1| hypothetical protein PRUPE_ppa005421mg [Prunus persica]
Length=462

 Score =   264 bits (675),  Expect = 9e-83, Method: Compositional matrix adjust.
 Identities = 137/170 (81%), Positives = 154/170 (91%), Gaps = 1/170 (1%)
 Frame = +3

Query  60   AIERQRVLLQHLRPTNAASSHDSIESSVSASVCAAGDSAAYQRNSVYGDDIVIVAAYRTP  239
            A  RQRVLL HLRP+ ++S H +  SS+SAS C AGDSAAY R +V+GDD+VIVAAYRTP
Sbjct  4    AFNRQRVLLDHLRPS-SSSLHGTDPSSLSASACVAGDSAAYARKNVFGDDVVIVAAYRTP  62

Query  240  LCKSKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTVLAPGSIRASECRMAAF  419
            +CK+KRGGFKDT+ DDLLA VLKA+IEK+NLNPSEVGDI+VGTVLAPGS RASECRMAAF
Sbjct  63   ICKAKRGGFKDTHADDLLAPVLKAVIEKSNLNPSEVGDIVVGTVLAPGSQRASECRMAAF  122

Query  420  YAGFPETVPVRTVNRQCSSGLQavadvaaaikaGFYDIGIGAGLESMTVN  569
            YAGFPETVP+RTVNRQCSSGLQAVADVAA+I+AGFYDIGIGAGLESMT N
Sbjct  123  YAGFPETVPIRTVNRQCSSGLQAVADVAASIRAGFYDIGIGAGLESMTAN  172



>ref|XP_010935683.1| PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxisomal-like [Elaeis 
guineensis]
Length=461

 Score =   264 bits (675),  Expect = 9e-83, Method: Compositional matrix adjust.
 Identities = 135/170 (79%), Positives = 154/170 (91%), Gaps = 3/170 (2%)
 Frame = +3

Query  60   AIERQRVLLQHLRPTNAASSHDSIESSVSASVCAAGDSAAYQRNSVYGDDIVIVAAYRTP  239
            AI RQRVLLQHL+P+  +    S+   +SAS+CAAGDS AYQR+S +GDD+V+VAAYRTP
Sbjct  4    AINRQRVLLQHLQPSTPSLDESSM---LSASICAAGDSTAYQRSSCFGDDVVVVAAYRTP  60

Query  240  LCKSKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTVLAPGSIRASECRMAAF  419
            +CKSKRGGFKDTYP+DLLA+VLK L++KT LNP+EVGDI+VGTVLAPGS RA+ECRMAAF
Sbjct  61   ICKSKRGGFKDTYPEDLLATVLKGLLDKTKLNPNEVGDIVVGTVLAPGSQRATECRMAAF  120

Query  420  YAGFPETVPVRTVNRQCSSGLQavadvaaaikaGFYDIGIGAGLESMTVN  569
            YAGFPETVPVRTVNRQCSSGLQAVADVAA+IKAGFYDIGIGAGLESMT N
Sbjct  121  YAGFPETVPVRTVNRQCSSGLQAVADVAASIKAGFYDIGIGAGLESMTAN  170



>pir||S72532 acetyl-CoA C-acyltransferase (EC 2.3.1.16) precursor - cucurbit
 dbj|BAA11117.1| 3-ketoacyl-CoA thiolase [Cucurbita cv. Kurokawa Amakuri]
Length=461

 Score =   264 bits (674),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 146/170 (86%), Positives = 157/170 (92%), Gaps = 3/170 (2%)
 Frame = +3

Query  60   AIERQRVLLQHLRPTNAASSHDSIESSVSASVCAAGDSAAYQRNSVYGDDIVIVAAYRTP  239
            AI RQ +LL HLRP+++A SH   ESS+SASVCAAGDSA+YQR SV+GDD+VIVAAYRT 
Sbjct  4    AINRQSILLHHLRPSSSAYSH---ESSLSASVCAAGDSASYQRTSVFGDDVVIVAAYRTA  60

Query  240  LCKSKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTVLAPGSIRASECRMAAF  419
            LCKSKRGGFKDTYPDDLLA VLKALIEKTNLNPSEVGDI+VG+VLAPGS RASECRMA F
Sbjct  61   LCKSKRGGFKDTYPDDLLAPVLKALIEKTNLNPSEVGDIVVGSVLAPGSQRASECRMATF  120

Query  420  YAGFPETVPVRTVNRQCSSGLQavadvaaaikaGFYDIGIGAGLESMTVN  569
            Y GFPETVPVRTVNRQCSSGLQAVADVAAAI+AGFYDIGIGAGLESMTVN
Sbjct  121  YPGFPETVPVRTVNRQCSSGLQAVADVAAAIRAGFYDIGIGAGLESMTVN  170



>gb|ACU21519.1| unknown [Glycine max]
Length=349

 Score =   260 bits (665),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 135/170 (79%), Positives = 151/170 (89%), Gaps = 2/170 (1%)
 Frame = +3

Query  60   AIERQRVLLQHLRPTNAASSHDSIESSVSASVCAAGDSAAYQRNSVYGDDIVIVAAYRTP  239
            AI RQ++LL HL P++  S+H +  SS+ AS C AGDSAAYQR S +GDD+VIVAAYRT 
Sbjct  4    AINRQKILLHHLNPSS--STHPNESSSLHASACVAGDSAAYQRTSTFGDDVVIVAAYRTA  61

Query  240  LCKSKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTVLAPGSIRASECRMAAF  419
             CK+KRGGFKDT PDDLLA VLKA+IEKTN+NPSEVGDI+VG+VLAPG+ RASECRMAAF
Sbjct  62   HCKAKRGGFKDTLPDDLLAPVLKAVIEKTNVNPSEVGDIVVGSVLAPGAQRASECRMAAF  121

Query  420  YAGFPETVPVRTVNRQCSSGLQavadvaaaikaGFYDIGIGAGLESMTVN  569
            YAGFPETVPVRTVNRQCSSGLQAVADVAAAI+AGFYDIGIGAGLESMT N
Sbjct  122  YAGFPETVPVRTVNRQCSSGLQAVADVAAAIRAGFYDIGIGAGLESMTTN  171



>ref|XP_008438387.1| PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxisomal [Cucumis melo]
Length=462

 Score =   264 bits (674),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 146/170 (86%), Positives = 158/170 (93%), Gaps = 3/170 (2%)
 Frame = +3

Query  60   AIERQRVLLQHLRPTNAASSHDSIESSVSASVCAAGDSAAYQRNSVYGDDIVIVAAYRTP  239
            AI RQ +LL HLRP+++A SH   ESS+SASVCAAGDSA+YQR SV+GDD+VIVAAYRT 
Sbjct  4    AINRQNILLHHLRPSSSAYSH---ESSLSASVCAAGDSASYQRTSVFGDDVVIVAAYRTA  60

Query  240  LCKSKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTVLAPGSIRASECRMAAF  419
            LCKSKRGGFKDTY DDLLA VLKALIEKTNLNPSEVGDI+VG+VLAPGS RASECRMAAF
Sbjct  61   LCKSKRGGFKDTYADDLLAPVLKALIEKTNLNPSEVGDIVVGSVLAPGSQRASECRMAAF  120

Query  420  YAGFPETVPVRTVNRQCSSGLQavadvaaaikaGFYDIGIGAGLESMTVN  569
            YAGFPETVPVRTVNRQCSSGLQAVADVAAAI+AGFYDIGIGAGLESMT+N
Sbjct  121  YAGFPETVPVRTVNRQCSSGLQAVADVAAAIRAGFYDIGIGAGLESMTIN  170



>ref|XP_008372446.1| PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxisomal [Malus domestica]
Length=453

 Score =   263 bits (672),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 135/170 (79%), Positives = 154/170 (91%), Gaps = 0/170 (0%)
 Frame = +3

Query  60   AIERQRVLLQHLRPTNAASSHDSIESSVSASVCAAGDSAAYQRNSVYGDDIVIVAAYRTP  239
            A+ RQ+VLLQHLRP+++ SS D   +++SAS CAAGDSAAY R S +GDDIVIVAAYRT 
Sbjct  4    ALNRQKVLLQHLRPSSSVSSPDYESAALSASTCAAGDSAAYHRTSAFGDDIVIVAAYRTA  63

Query  240  LCKSKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTVLAPGSIRASECRMAAF  419
            +CK+KRGGFKDT PDDLLA VLKA+IE+TNLNP EVGDI+VGTVLAPGS+RA ECRMAAF
Sbjct  64   ICKAKRGGFKDTLPDDLLAPVLKAVIERTNLNPKEVGDIVVGTVLAPGSLRAMECRMAAF  123

Query  420  YAGFPETVPVRTVNRQCSSGLQavadvaaaikaGFYDIGIGAGLESMTVN  569
            YAGFP+TVP+RTVNRQCSSGLQAVADVAAAIKAG+YDIGI AGLESMTV+
Sbjct  124  YAGFPDTVPIRTVNRQCSSGLQAVADVAAAIKAGYYDIGIAAGLESMTVD  173



>gb|KDP20330.1| hypothetical protein JCGZ_06416 [Jatropha curcas]
Length=462

 Score =   263 bits (671),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 145/170 (85%), Positives = 157/170 (92%), Gaps = 2/170 (1%)
 Frame = +3

Query  60   AIERQRVLLQHLRPTNAASSHDSIESSVSASVCAAGDSAAYQRNSVYGDDIVIVAAYRTP  239
            AI RQRVLL HLRP++++S   + ESS+SAS C AGDSAAYQR +V+GDD+VIVAAYRTP
Sbjct  4    AINRQRVLLDHLRPSSSSSH--NYESSLSASACLAGDSAAYQRTAVFGDDVVIVAAYRTP  61

Query  240  LCKSKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTVLAPGSIRASECRMAAF  419
            LCKSKRGGFKDT+ DDLLA VLKALIEKTNLN SEVGDI+VGTVLAPGS RASECRMAAF
Sbjct  62   LCKSKRGGFKDTHADDLLAPVLKALIEKTNLNASEVGDIVVGTVLAPGSQRASECRMAAF  121

Query  420  YAGFPETVPVRTVNRQCSSGLQavadvaaaikaGFYDIGIGAGLESMTVN  569
            YAGFPETVPVRTVNRQCSSGLQAVADVAAAIKAGFYDIGIGAGLESMT+N
Sbjct  122  YAGFPETVPVRTVNRQCSSGLQAVADVAAAIKAGFYDIGIGAGLESMTIN  171



>ref|XP_011020687.1| PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxisomal-like isoform 
X1 [Populus euphratica]
Length=460

 Score =   261 bits (667),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 135/170 (79%), Positives = 152/170 (89%), Gaps = 2/170 (1%)
 Frame = +3

Query  60   AIERQRVLLQHLRPTNAASSHDSIESSVSASVCAAGDSAAYQRNSVYGDDIVIVAAYRTP  239
            AI+RQRVLL HLRP+  + SH + ES++SAS C AGDS AYQR S +GDD+VIVAAYRTP
Sbjct  4    AIDRQRVLLDHLRPS--SPSHHNFESTLSASACLAGDSTAYQRTSAFGDDVVIVAAYRTP  61

Query  240  LCKSKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTVLAPGSIRASECRMAAF  419
            LCKSK G FKDT+ DDLLA VLKALIEKTN++P EVGDI+VG+VLAPGS RASECRMAAF
Sbjct  62   LCKSKGGSFKDTHADDLLAPVLKALIEKTNVDPREVGDIVVGSVLAPGSQRASECRMAAF  121

Query  420  YAGFPETVPVRTVNRQCSSGLQavadvaaaikaGFYDIGIGAGLESMTVN  569
            YAGFPETVP+RTVNRQCSSGLQAVADV A+IKAGFY+IGIGAGLESMT+N
Sbjct  122  YAGFPETVPIRTVNRQCSSGLQAVADVVASIKAGFYEIGIGAGLESMTIN  171



>ref|XP_009371217.1| PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxisomal [Pyrus x bretschneideri]
Length=453

 Score =   261 bits (666),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 133/170 (78%), Positives = 154/170 (91%), Gaps = 0/170 (0%)
 Frame = +3

Query  60   AIERQRVLLQHLRPTNAASSHDSIESSVSASVCAAGDSAAYQRNSVYGDDIVIVAAYRTP  239
            A+ RQ+VLLQHLRP+++ SS D   +++SAS CAAGDSAAY R S +GDDIVIVAAYRT 
Sbjct  4    ALNRQKVLLQHLRPSSSVSSPDYESAALSASTCAAGDSAAYHRTSAFGDDIVIVAAYRTA  63

Query  240  LCKSKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTVLAPGSIRASECRMAAF  419
            +CK+KRGGFKDT PDDLLA VLKA+IE+TNLNP+EVGDI+VGTVLAPGS+RA ECRMAAF
Sbjct  64   ICKAKRGGFKDTLPDDLLAPVLKAVIERTNLNPNEVGDIVVGTVLAPGSLRAIECRMAAF  123

Query  420  YAGFPETVPVRTVNRQCSSGLQavadvaaaikaGFYDIGIGAGLESMTVN  569
            YAGFP+TVP+RTVNRQCSSGLQAVAD+AAAIKAG+YDIGI AGLE MTV+
Sbjct  124  YAGFPDTVPIRTVNRQCSSGLQAVADIAAAIKAGYYDIGIAAGLECMTVD  173



>ref|XP_011020688.1| PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxisomal-like isoform 
X2 [Populus euphratica]
Length=458

 Score =   261 bits (666),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 135/170 (79%), Positives = 152/170 (89%), Gaps = 2/170 (1%)
 Frame = +3

Query  60   AIERQRVLLQHLRPTNAASSHDSIESSVSASVCAAGDSAAYQRNSVYGDDIVIVAAYRTP  239
            AI+RQRVLL HLRP+  + SH + ES++SAS C AGDS AYQR S +GDD+VIVAAYRTP
Sbjct  4    AIDRQRVLLDHLRPS--SPSHHNFESTLSASACLAGDSTAYQRTSAFGDDVVIVAAYRTP  61

Query  240  LCKSKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTVLAPGSIRASECRMAAF  419
            LCKSK G FKDT+ DDLLA VLKALIEKTN++P EVGDI+VG+VLAPGS RASECRMAAF
Sbjct  62   LCKSKGGSFKDTHADDLLAPVLKALIEKTNVDPREVGDIVVGSVLAPGSQRASECRMAAF  121

Query  420  YAGFPETVPVRTVNRQCSSGLQavadvaaaikaGFYDIGIGAGLESMTVN  569
            YAGFPETVP+RTVNRQCSSGLQAVADV A+IKAGFY+IGIGAGLESMT+N
Sbjct  122  YAGFPETVPIRTVNRQCSSGLQAVADVVASIKAGFYEIGIGAGLESMTIN  171



>ref|XP_009385864.1| PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxisomal-like [Musa 
acuminata subsp. malaccensis]
Length=463

 Score =   260 bits (664),  Expect = 4e-81, Method: Compositional matrix adjust.
 Identities = 137/170 (81%), Positives = 157/170 (92%), Gaps = 2/170 (1%)
 Frame = +3

Query  60   AIERQRVLLQHLRPTNAASSHDSIESSVSASVCAAGDSAAYQRNSVYGDDIVIVAAYRTP  239
            AI+RQRVLL+HLRP+ ++S + S    +SASVCAAGDSAAYQRNS +GDD+V+VAAYRT 
Sbjct  4    AIDRQRVLLRHLRPSPSSSPNGS--HLISASVCAAGDSAAYQRNSCFGDDVVVVAAYRTA  61

Query  240  LCKSKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTVLAPGSIRASECRMAAF  419
            +CKSKRGGFKDTYP++LL  VLKAL++KTNLNP+EVGDI+VGTVLAPG+ RA+ECRMAAF
Sbjct  62   ICKSKRGGFKDTYPEELLTVVLKALLDKTNLNPNEVGDIVVGTVLAPGAQRATECRMAAF  121

Query  420  YAGFPETVPVRTVNRQCSSGLQavadvaaaikaGFYDIGIGAGLESMTVN  569
            YAGFPETVPVRTVNRQCSSGLQAVADVAAAIK+GFYDIGIGAGLESMT N
Sbjct  122  YAGFPETVPVRTVNRQCSSGLQAVADVAAAIKSGFYDIGIGAGLESMTTN  171



>ref|XP_011083116.1| PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxisomal [Sesamum indicum]
Length=463

 Score =   259 bits (661),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 133/170 (78%), Positives = 153/170 (90%), Gaps = 1/170 (1%)
 Frame = +3

Query  60   AIERQRVLLQHLRPTNAASSHDSIESSVSASVCAAGDSAAYQRNSVYGDDIVIVAAYRTP  239
            A  RQR+LLQHLRPT++ S H + +SS+S S+C AGDSAAY R + +GDDIVIVAAYRT 
Sbjct  4    ATNRQRILLQHLRPTSSVS-HQTSDSSLSPSICLAGDSAAYHRTAAFGDDIVIVAAYRTA  62

Query  240  LCKSKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTVLAPGSIRASECRMAAF  419
            +CKSKRGGFKDT PDDLLA+VLKALI++TNLNP+EVGDIIVGTVLAPGS+RA ECRMAA 
Sbjct  63   ICKSKRGGFKDTLPDDLLAAVLKALIDRTNLNPAEVGDIIVGTVLAPGSLRAIECRMAAL  122

Query  420  YAGFPETVPVRTVNRQCSSGLQavadvaaaikaGFYDIGIGAGLESMTVN  569
            YAGFP++VPVRTVNRQCSSGLQAVADVAA I+AG+YDIGI AGLESMTV+
Sbjct  123  YAGFPDSVPVRTVNRQCSSGLQAVADVAAFIQAGYYDIGIAAGLESMTVD  172



>ref|NP_001238475.1| peroxisomal 3-ketoacyl-CoA thiolase [Glycine max]
 dbj|BAG09380.1| peroxisomal 3-ketoacyl-CoA thiolase precursor [Glycine max]
 gb|KHN21671.1| 3-ketoacyl-CoA thiolase 2, peroxisomal [Glycine soja]
Length=463

 Score =   258 bits (660),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 135/170 (79%), Positives = 151/170 (89%), Gaps = 2/170 (1%)
 Frame = +3

Query  60   AIERQRVLLQHLRPTNAASSHDSIESSVSASVCAAGDSAAYQRNSVYGDDIVIVAAYRTP  239
            AI RQ++LL HL P+  +S+H +  SS+ AS C AGDSAAYQR S +GDD+VIVAAYRT 
Sbjct  4    AINRQKILLHHLNPS--SSTHPNESSSLHASACVAGDSAAYQRTSTFGDDVVIVAAYRTA  61

Query  240  LCKSKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTVLAPGSIRASECRMAAF  419
             CK+KRGGFKDT PDDLLA VLKA+IEKTN+NPSEVGDI+VG+VLAPG+ RASECRMAAF
Sbjct  62   HCKAKRGGFKDTLPDDLLAPVLKAVIEKTNVNPSEVGDIVVGSVLAPGAQRASECRMAAF  121

Query  420  YAGFPETVPVRTVNRQCSSGLQavadvaaaikaGFYDIGIGAGLESMTVN  569
            YAGFPETVPVRTVNRQCSSGLQAVADVAAAI+AGFYDIGIGAGLESMT N
Sbjct  122  YAGFPETVPVRTVNRQCSSGLQAVADVAAAIRAGFYDIGIGAGLESMTTN  171



>ref|XP_010469514.1| PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxisomal-like [Camelina 
sativa]
Length=462

 Score =   258 bits (660),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 143/170 (84%), Positives = 157/170 (92%), Gaps = 2/170 (1%)
 Frame = +3

Query  60   AIERQRVLLQHLRPTNAASSHDSIESSVSASVCAAGDSAAYQRNSVYGDDIVIVAAYRTP  239
            AIERQRVLL+HLRP +++S   S ESS+SAS C AGDSAAYQR S+YGDD+VIVAA+RTP
Sbjct  4    AIERQRVLLEHLRPCSSSSH--SFESSLSASACLAGDSAAYQRTSLYGDDVVIVAAHRTP  61

Query  240  LCKSKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTVLAPGSIRASECRMAAF  419
            LCK+KRG FKDTYPDDLLA VL+ALI+KTN+NPSEVGDI+VGTVLAPGS RASECRM+AF
Sbjct  62   LCKAKRGNFKDTYPDDLLAPVLRALIDKTNINPSEVGDIVVGTVLAPGSQRASECRMSAF  121

Query  420  YAGFPETVPVRTVNRQCSSGLQavadvaaaikaGFYDIGIGAGLESMTVN  569
            YAGFPETV VRTVNRQCSSGLQAVADVAAAIKAGFYDIGIGAGLESMT N
Sbjct  122  YAGFPETVAVRTVNRQCSSGLQAVADVAAAIKAGFYDIGIGAGLESMTTN  171



>ref|XP_008800565.1| PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxisomal-like [Phoenix 
dactylifera]
Length=461

 Score =   258 bits (659),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 134/170 (79%), Positives = 155/170 (91%), Gaps = 3/170 (2%)
 Frame = +3

Query  60   AIERQRVLLQHLRPTNAASSHDSIESSVSASVCAAGDSAAYQRNSVYGDDIVIVAAYRTP  239
            AI RQRVLLQHL+P++ + +   +   +SAS+CAAGDSAAYQR+S +GDD+V+VAAYRTP
Sbjct  4    AINRQRVLLQHLQPSSPSPNESPM---LSASICAAGDSAAYQRSSCFGDDVVVVAAYRTP  60

Query  240  LCKSKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTVLAPGSIRASECRMAAF  419
            +CKSKRGGFKDTYP+DLLA+VLK L++KT LNP+EVGDI+VGTVLAPGS RA+ECRMAAF
Sbjct  61   ICKSKRGGFKDTYPEDLLATVLKGLLDKTKLNPNEVGDIVVGTVLAPGSQRATECRMAAF  120

Query  420  YAGFPETVPVRTVNRQCSSGLQavadvaaaikaGFYDIGIGAGLESMTVN  569
            YAGFPE VPVRTVNRQCSSGLQAVADVAA+IKAGFYDIGIGAGLESMT N
Sbjct  121  YAGFPENVPVRTVNRQCSSGLQAVADVAASIKAGFYDIGIGAGLESMTAN  170



>gb|ACV70032.1| 3-ketoacyl CoA thiolase 1 [Petunia x hybrida]
Length=462

 Score =   258 bits (658),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 135/170 (79%), Positives = 152/170 (89%), Gaps = 2/170 (1%)
 Frame = +3

Query  60   AIERQRVLLQHLRPTNAASSHDSIESSVSASVCAAGDSAAYQRNSVYGDDIVIVAAYRTP  239
            AI+RQRVLL+HL+P     +HD   SS++ S+CAAGDSAAYQR + +GDD+VIVAAYRT 
Sbjct  4    AIQRQRVLLEHLQPIRH-HTHDH-SSSLTTSICAAGDSAAYQRTAAFGDDVVIVAAYRTA  61

Query  240  LCKSKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTVLAPGSIRASECRMAAF  419
            +CKSKRGGFKDT  DDLLA VLKA+IEKTNL+P EVGDI+VGTVLAPGSIRA ECRMAAF
Sbjct  62   ICKSKRGGFKDTLSDDLLAPVLKAVIEKTNLDPKEVGDIVVGTVLAPGSIRAMECRMAAF  121

Query  420  YAGFPETVPVRTVNRQCSSGLQavadvaaaikaGFYDIGIGAGLESMTVN  569
            YAGFPETVP+RTVNRQCSSGLQAVADVAA+IKAGFYDIGIGAGLE MTV+
Sbjct  122  YAGFPETVPIRTVNRQCSSGLQAVADVAASIKAGFYDIGIGAGLELMTVD  171



>ref|XP_004138952.1| PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxisomal-like [Cucumis 
sativus]
 gb|KGN61456.1| hypothetical protein Csa_2G129150 [Cucumis sativus]
Length=461

 Score =   257 bits (657),  Expect = 4e-80, Method: Compositional matrix adjust.
 Identities = 144/170 (85%), Positives = 155/170 (91%), Gaps = 3/170 (2%)
 Frame = +3

Query  60   AIERQRVLLQHLRPTNAASSHDSIESSVSASVCAAGDSAAYQRNSVYGDDIVIVAAYRTP  239
            AI RQ+VLL HLRP+++  S    +SS+SAS C AGDSAAYQR+SV+GDD+VIVAAYRT 
Sbjct  4    AINRQKVLLHHLRPSSSLPS---HDSSLSASACLAGDSAAYQRSSVFGDDVVIVAAYRTA  60

Query  240  LCKSKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTVLAPGSIRASECRMAAF  419
            LCKSKRGGFKDT+PDDLLA VLKALIEKTNLNPSEVGDIIVG+VL PGS RASECRMAAF
Sbjct  61   LCKSKRGGFKDTHPDDLLAPVLKALIEKTNLNPSEVGDIIVGSVLGPGSQRASECRMAAF  120

Query  420  YAGFPETVPVRTVNRQCSSGLQavadvaaaikaGFYDIGIGAGLESMTVN  569
            YAGFPETVPVRTVNRQCSSGLQAVADVAAAIKAGFYDIGIGAGLESMT N
Sbjct  121  YAGFPETVPVRTVNRQCSSGLQAVADVAAAIKAGFYDIGIGAGLESMTAN  170



>ref|XP_004164123.1| PREDICTED: LOW QUALITY PROTEIN: 3-ketoacyl-CoA thiolase 2, peroxisomal-like 
[Cucumis sativus]
Length=461

 Score =   257 bits (657),  Expect = 4e-80, Method: Compositional matrix adjust.
 Identities = 144/170 (85%), Positives = 155/170 (91%), Gaps = 3/170 (2%)
 Frame = +3

Query  60   AIERQRVLLQHLRPTNAASSHDSIESSVSASVCAAGDSAAYQRNSVYGDDIVIVAAYRTP  239
            AI RQ+VLL HLRP+++  S    +SS+SAS C AGDSAAYQR+SV+GDD+VIVAAYRT 
Sbjct  4    AINRQKVLLHHLRPSSSLPS---HDSSLSASACLAGDSAAYQRSSVFGDDVVIVAAYRTA  60

Query  240  LCKSKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTVLAPGSIRASECRMAAF  419
            LCKSKRGGFKDT+PDDLLA VLKALIEKTNLNPSEVGDIIVG+VL PGS RASECRMAAF
Sbjct  61   LCKSKRGGFKDTHPDDLLAPVLKALIEKTNLNPSEVGDIIVGSVLGPGSQRASECRMAAF  120

Query  420  YAGFPETVPVRTVNRQCSSGLQavadvaaaikaGFYDIGIGAGLESMTVN  569
            YAGFPETVPVRTVNRQCSSGLQAVADVAAAIKAGFYDIGIGAGLESMT N
Sbjct  121  YAGFPETVPVRTVNRQCSSGLQAVADVAAAIKAGFYDIGIGAGLESMTAN  170



>ref|XP_010696158.1| PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxisomal [Beta vulgaris 
subsp. vulgaris]
Length=462

 Score =   257 bits (657),  Expect = 4e-80, Method: Compositional matrix adjust.
 Identities = 136/170 (80%), Positives = 151/170 (89%), Gaps = 2/170 (1%)
 Frame = +3

Query  60   AIERQRVLLQHLRPTNAASSHDSIESSVSASVCAAGDSAAYQRNSVYGDDIVIVAAYRTP  239
            AI RQ++LL HLRP +  SS  + E+ +SAS CAAGDS+AY R + +GDD+VIVAA+RT 
Sbjct  4    AINRQKILLDHLRPPS--SSDHNYEAFLSASNCAAGDSSAYHRTTAFGDDVVIVAAHRTA  61

Query  240  LCKSKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTVLAPGSIRASECRMAAF  419
            LCK+KRG FKDTYPDDLLA VLKALIEKTN+NP+EVGDI+VGTVLAPGS RASECRMAAF
Sbjct  62   LCKAKRGSFKDTYPDDLLAPVLKALIEKTNVNPAEVGDIVVGTVLAPGSQRASECRMAAF  121

Query  420  YAGFPETVPVRTVNRQCSSGLQavadvaaaikaGFYDIGIGAGLESMTVN  569
            YAGFPE VPVRTVNRQCSSGLQAVADVAAAIKAGFYDIGIGAGLESMT N
Sbjct  122  YAGFPEIVPVRTVNRQCSSGLQAVADVAAAIKAGFYDIGIGAGLESMTTN  171



>ref|XP_004296638.1| PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxisomal [Fragaria vesca 
subsp. vesca]
Length=458

 Score =   257 bits (656),  Expect = 5e-80, Method: Compositional matrix adjust.
 Identities = 141/170 (83%), Positives = 154/170 (91%), Gaps = 5/170 (3%)
 Frame = +3

Query  60   AIERQRVLLQHLRPTNAASSHDSIESSVSASVCAAGDSAAYQRNSVYGDDIVIVAAYRTP  239
            AI RQ+VLL HLRP++++       SS+SASVCAAGDSAAY RN V+GDD+VIVAAYRTP
Sbjct  4    AINRQKVLLDHLRPSSSSDD-----SSLSASVCAAGDSAAYARNHVFGDDVVIVAAYRTP  58

Query  240  LCKSKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTVLAPGSIRASECRMAAF  419
            LCK+KRGGFKDTY DDLLA VLKA++EKTNLNP EVGDI+VGTVLAPGS RASECRMAAF
Sbjct  59   LCKAKRGGFKDTYADDLLAPVLKAVVEKTNLNPKEVGDIVVGTVLAPGSQRASECRMAAF  118

Query  420  YAGFPETVPVRTVNRQCSSGLQavadvaaaikaGFYDIGIGAGLESMTVN  569
            YAGFPETVPVRTVNRQCSSGLQAVADVAAAI+AGFYDIGIGAGLESMT N
Sbjct  119  YAGFPETVPVRTVNRQCSSGLQAVADVAAAIRAGFYDIGIGAGLESMTAN  168



>ref|XP_008804745.1| PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxisomal [Phoenix dactylifera]
Length=460

 Score =   255 bits (652),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 132/170 (78%), Positives = 151/170 (89%), Gaps = 4/170 (2%)
 Frame = +3

Query  60   AIERQRVLLQHLRPTNAASSHDSIESSVSASVCAAGDSAAYQRNSVYGDDIVIVAAYRTP  239
            AI RQRVLLQHL P++ +  H ++    S S+CAAGDSAAYQR+S +GDD+VIVAA RT 
Sbjct  4    AIGRQRVLLQHLHPSSGSDDHPTL----STSICAAGDSAAYQRSSCFGDDVVIVAACRTA  59

Query  240  LCKSKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTVLAPGSIRASECRMAAF  419
            +CKSKRGGFKDT+P+DLLA VLKAL++KT LNPSEVGDI+VGTVLAPGS RA ECRMAAF
Sbjct  60   ICKSKRGGFKDTHPEDLLAPVLKALLDKTKLNPSEVGDIVVGTVLAPGSQRAIECRMAAF  119

Query  420  YAGFPETVPVRTVNRQCSSGLQavadvaaaikaGFYDIGIGAGLESMTVN  569
            YAGFPETVP+RTVNRQCSSGLQAVAD+AA+IKAGFYDIGI AG+ESMTVN
Sbjct  120  YAGFPETVPLRTVNRQCSSGLQAVADIAASIKAGFYDIGIAAGMESMTVN  169



>gb|KDP26413.1| hypothetical protein JCGZ_17571 [Jatropha curcas]
Length=452

 Score =   254 bits (650),  Expect = 4e-79, Method: Compositional matrix adjust.
 Identities = 131/169 (78%), Positives = 152/169 (90%), Gaps = 2/169 (1%)
 Frame = +3

Query  69   RQRVLLQHLRPTNAAS--SHDSIESSVSASVCAAGDSAAYQRNSVYGDDIVIVAAYRTPL  242
            RQ+VLL HL+P +++S  SH    SS+S S+CAAG+ AAY+R +V GDD+VIVAAYRT +
Sbjct  7    RQKVLLGHLQPNSSSSFLSHTQKSSSLSTSICAAGNGAAYRRTAVSGDDVVIVAAYRTAI  66

Query  243  CKSKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTVLAPGSIRASECRMAAFY  422
            CK+K+GGFKDT PDDL+ SVLKALIEKTN+NPSEVGDI+VGTVLAPGS+RA ECRM AFY
Sbjct  67   CKAKKGGFKDTLPDDLIGSVLKALIEKTNVNPSEVGDIVVGTVLAPGSLRAIECRMGAFY  126

Query  423  AGFPETVPVRTVNRQCSSGLQavadvaaaikaGFYDIGIGAGLESMTVN  569
            AGFPETVP+RTVNRQCSSGLQAVADVAA+IKAGFYDIGIGAGLESMTV+
Sbjct  127  AGFPETVPIRTVNRQCSSGLQAVADVAASIKAGFYDIGIGAGLESMTVD  175



>gb|KDO43599.1| hypothetical protein CISIN_1g012506mg [Citrus sinensis]
Length=445

 Score =   254 bits (648),  Expect = 5e-79, Method: Compositional matrix adjust.
 Identities = 137/159 (86%), Positives = 148/159 (93%), Gaps = 2/159 (1%)
 Frame = +3

Query  60   AIERQRVLLQHLRPTNAASSHDSIESSVSASVCAAGDSAAYQRNSVYGDDIVIVAAYRTP  239
            AI RQ+VLL+HLRP+N+ SSH+  ES +SAS CAAGDSAAY R SVYGDD+VIVAAYRT 
Sbjct  4    AINRQQVLLEHLRPSNS-SSHN-YESILSASACAAGDSAAYHRTSVYGDDVVIVAAYRTA  61

Query  240  LCKSKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTVLAPGSIRASECRMAAF  419
            LCKSKRGGFKDTYPDDLLA VLKA+IEKTN++PSEVGDI+VGTVLAPGS RASECRMAAF
Sbjct  62   LCKSKRGGFKDTYPDDLLAPVLKAVIEKTNVDPSEVGDIVVGTVLAPGSQRASECRMAAF  121

Query  420  YAGFPETVPVRTVNRQCSSGLQavadvaaaikaGFYDIG  536
            YAGFPETVPVRTVNRQCSSGLQAVADVAAAIKAGFYDIG
Sbjct  122  YAGFPETVPVRTVNRQCSSGLQAVADVAAAIKAGFYDIG  160



>ref|XP_006605730.1| PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxisomal-like isoform 
X2 [Glycine max]
Length=410

 Score =   253 bits (645),  Expect = 6e-79, Method: Compositional matrix adjust.
 Identities = 133/170 (78%), Positives = 149/170 (88%), Gaps = 2/170 (1%)
 Frame = +3

Query  60   AIERQRVLLQHLRPTNAASSHDSIESSVSASVCAAGDSAAYQRNSVYGDDIVIVAAYRTP  239
            AI RQ++LL HL P+  +S+H +  SS+ AS C AGDSAAYQR S + DD+VIVAAYRT 
Sbjct  4    AISRQKILLHHLNPS--SSTHVNESSSLYASACVAGDSAAYQRTSTFRDDVVIVAAYRTA  61

Query  240  LCKSKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTVLAPGSIRASECRMAAF  419
             CK KRGGFKDT PDDLLA VLKA+IE+TN+NPSEVGDI+VG+VLAPG+ RASECRMAAF
Sbjct  62   HCKGKRGGFKDTLPDDLLAPVLKAVIERTNVNPSEVGDIVVGSVLAPGAQRASECRMAAF  121

Query  420  YAGFPETVPVRTVNRQCSSGLQavadvaaaikaGFYDIGIGAGLESMTVN  569
            YAGFPETVPVRTVNRQCSSGLQAVADVAAAI+AGFYDIGIGAGLESMT N
Sbjct  122  YAGFPETVPVRTVNRQCSSGLQAVADVAAAIRAGFYDIGIGAGLESMTTN  171



>ref|XP_009336051.1| PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxisomal-like [Pyrus 
x bretschneideri]
Length=453

 Score =   254 bits (648),  Expect = 7e-79, Method: Compositional matrix adjust.
 Identities = 130/170 (76%), Positives = 153/170 (90%), Gaps = 0/170 (0%)
 Frame = +3

Query  60   AIERQRVLLQHLRPTNAASSHDSIESSVSASVCAAGDSAAYQRNSVYGDDIVIVAAYRTP  239
            A+ RQRVLLQHLRP ++ SS +     +SAS+CAAGDSAAY R + +GDD+VIVAAYRT 
Sbjct  4    AMNRQRVLLQHLRPNSSVSSSNYESDPLSASICAAGDSAAYHRTAAFGDDVVIVAAYRTA  63

Query  240  LCKSKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTVLAPGSIRASECRMAAF  419
            +CK+KRGGFKDT PDDLLA VLK +IE+TNLNPSEVGDI+VGTV+APGS+RA+ECRMAAF
Sbjct  64   ICKAKRGGFKDTLPDDLLAPVLKEVIERTNLNPSEVGDIVVGTVMAPGSLRATECRMAAF  123

Query  420  YAGFPETVPVRTVNRQCSSGLQavadvaaaikaGFYDIGIGAGLESMTVN  569
            YAGFP+TVP+RTVNRQCSSGLQAVADVAA+IKAG+YDIGI AGLES+TV+
Sbjct  124  YAGFPDTVPIRTVNRQCSSGLQAVADVAASIKAGYYDIGIAAGLESLTVD  173



>ref|XP_004247103.1| PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxisomal [Solanum lycopersicum]
Length=456

 Score =   253 bits (646),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 133/170 (78%), Positives = 149/170 (88%), Gaps = 8/170 (5%)
 Frame = +3

Query  60   AIERQRVLLQHLRPTNAASSHDSIESSVSASVCAAGDSAAYQRNSVYGDDIVIVAAYRTP  239
            AIERQRVLL+HL+P  +        SS++ SVC AGDS+AY R S +GDD+VIVAAYRT 
Sbjct  4    AIERQRVLLEHLQPIRS--------SSITPSVCLAGDSSAYHRTSAFGDDVVIVAAYRTA  55

Query  240  LCKSKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTVLAPGSIRASECRMAAF  419
            +CK+KRGGFKDT  DDLLA VLKA++EKTNLNPSEVGDI+VGTVLAPGSIRA ECRMAAF
Sbjct  56   ICKAKRGGFKDTLSDDLLAPVLKAVVEKTNLNPSEVGDIVVGTVLAPGSIRAMECRMAAF  115

Query  420  YAGFPETVPVRTVNRQCSSGLQavadvaaaikaGFYDIGIGAGLESMTVN  569
            YAGFP+TVP+RTVNRQCSSGLQAVADVAAAIKAGFYDIGIGAGLE MTV+
Sbjct  116  YAGFPDTVPIRTVNRQCSSGLQAVADVAAAIKAGFYDIGIGAGLEFMTVD  165



>ref|XP_008235516.1| PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxisomal [Prunus mume]
Length=467

 Score =   252 bits (644),  Expect = 4e-78, Method: Compositional matrix adjust.
 Identities = 132/175 (75%), Positives = 155/175 (89%), Gaps = 7/175 (4%)
 Frame = +3

Query  60   AIERQRVLLQHLRPTNAASS-----HDSIESSVSASVCAAGDSAAYQRNSVYGDDIVIVA  224
            A  RQRVLLQHL P ++ SS     H S  +++SAS+CAAGDSAAY R + +GDD+VIVA
Sbjct  4    AHNRQRVLLQHLLPNSSFSSAPPETHQS--AALSASICAAGDSAAYHRTAAFGDDVVIVA  61

Query  225  AYRTPLCKSKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTVLAPGSIRASEC  404
            AYRT +CK+KRGGFKDT PDDLLA VLKALIE+TNLNPSEVGDI+VGTV+APGS+RA+EC
Sbjct  62   AYRTAICKAKRGGFKDTSPDDLLAPVLKALIERTNLNPSEVGDIVVGTVMAPGSLRATEC  121

Query  405  RMAAFYAGFPETVPVRTVNRQCSSGLQavadvaaaikaGFYDIGIGAGLESMTVN  569
            RMAAFYAGFP+TVP+RTVNRQCSSGLQAVADVAA+IKAGFY+IG+ AGLESM+V+
Sbjct  122  RMAAFYAGFPDTVPIRTVNRQCSSGLQAVADVAASIKAGFYEIGVAAGLESMSVD  176



>ref|XP_003555712.1| PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxisomal-like isoform 
X1 [Glycine max]
 gb|KHN18010.1| 3-ketoacyl-CoA thiolase 2, peroxisomal [Glycine soja]
Length=461

 Score =   252 bits (644),  Expect = 4e-78, Method: Compositional matrix adjust.
 Identities = 133/170 (78%), Positives = 149/170 (88%), Gaps = 2/170 (1%)
 Frame = +3

Query  60   AIERQRVLLQHLRPTNAASSHDSIESSVSASVCAAGDSAAYQRNSVYGDDIVIVAAYRTP  239
            AI RQ++LL HL P++  S+H +  SS+ AS C AGDSAAYQR S + DD+VIVAAYRT 
Sbjct  4    AISRQKILLHHLNPSS--STHVNESSSLYASACVAGDSAAYQRTSTFRDDVVIVAAYRTA  61

Query  240  LCKSKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTVLAPGSIRASECRMAAF  419
             CK KRGGFKDT PDDLLA VLKA+IE+TN+NPSEVGDI+VG+VLAPG+ RASECRMAAF
Sbjct  62   HCKGKRGGFKDTLPDDLLAPVLKAVIERTNVNPSEVGDIVVGSVLAPGAQRASECRMAAF  121

Query  420  YAGFPETVPVRTVNRQCSSGLQavadvaaaikaGFYDIGIGAGLESMTVN  569
            YAGFPETVPVRTVNRQCSSGLQAVADVAAAI+AGFYDIGIGAGLESMT N
Sbjct  122  YAGFPETVPVRTVNRQCSSGLQAVADVAAAIRAGFYDIGIGAGLESMTTN  171



>gb|ACJ84483.1| unknown [Medicago truncatula]
Length=259

 Score =   246 bits (627),  Expect = 4e-78, Method: Compositional matrix adjust.
 Identities = 133/170 (78%), Positives = 151/170 (89%), Gaps = 1/170 (1%)
 Frame = +3

Query  60   AIERQRVLLQHLRPTNAASSHDSIESSVSASVCAAGDSAAYQRNSVYGDDIVIVAAYRTP  239
            AI RQ+VLLQHL P++ +S+  S  +S++AS C AGDSAAY R + +GDD+VIVAAYRT 
Sbjct  4    AINRQKVLLQHLNPSSFSSND-SSSTSLNASACLAGDSAAYHRTAAFGDDVVIVAAYRTA  62

Query  240  LCKSKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTVLAPGSIRASECRMAAF  419
            LCK+KRGGFKDT+ DD+LA VLKA+IEKTNLNPSEVGDI+VG+VL  GS RASECRMAAF
Sbjct  63   LCKAKRGGFKDTHADDILAPVLKAVIEKTNLNPSEVGDIVVGSVLGAGSQRASECRMAAF  122

Query  420  YAGFPETVPVRTVNRQCSSGLQavadvaaaikaGFYDIGIGAGLESMTVN  569
            YAGFPETVPVRTVNRQCSSGLQAVADVAAAI+AGFYDIGIGAGLESMT N
Sbjct  123  YAGFPETVPVRTVNRQCSSGLQAVADVAAAIRAGFYDIGIGAGLESMTTN  172



>ref|XP_009796304.1| PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxisomal-like isoform 
X1 [Nicotiana sylvestris]
Length=486

 Score =   252 bits (644),  Expect = 6e-78, Method: Compositional matrix adjust.
 Identities = 132/170 (78%), Positives = 153/170 (90%), Gaps = 3/170 (2%)
 Frame = +3

Query  60   AIERQRVLLQHLRPTNAASSHDSIESSVSASVCAAGDSAAYQRNSVYGDDIVIVAAYRTP  239
            AIERQRVLL+HL+P  + SSH    SS++ S+C AGDSAAYQR + +GDD+VIVAAYRT 
Sbjct  29   AIERQRVLLEHLQPIRS-SSHQF--SSLTPSICLAGDSAAYQRTAAFGDDVVIVAAYRTA  85

Query  240  LCKSKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTVLAPGSIRASECRMAAF  419
            +CK+KRGGFK+T  DDLLA VLKA++EKTNL+P+EVGDI+VGTVLAPGS+RA ECRMAAF
Sbjct  86   ICKAKRGGFKNTLADDLLAPVLKAVVEKTNLSPNEVGDIVVGTVLAPGSLRAMECRMAAF  145

Query  420  YAGFPETVPVRTVNRQCSSGLQavadvaaaikaGFYDIGIGAGLESMTVN  569
            YAGFPETVP+RTVNRQCSSGLQAVADVAA+IKAGFYDIGIGAGLE MTV+
Sbjct  146  YAGFPETVPIRTVNRQCSSGLQAVADVAASIKAGFYDIGIGAGLELMTVD  195



>ref|XP_006350308.1| PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxisomal-like [Solanum 
tuberosum]
Length=456

 Score =   251 bits (642),  Expect = 6e-78, Method: Compositional matrix adjust.
 Identities = 132/170 (78%), Positives = 149/170 (88%), Gaps = 8/170 (5%)
 Frame = +3

Query  60   AIERQRVLLQHLRPTNAASSHDSIESSVSASVCAAGDSAAYQRNSVYGDDIVIVAAYRTP  239
            AIERQRVLL+HL+P  +        SS++ SVC AGDS+AY R S +GDD+VIVAAYRT 
Sbjct  4    AIERQRVLLEHLQPIRS--------SSITPSVCLAGDSSAYHRTSAFGDDVVIVAAYRTA  55

Query  240  LCKSKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTVLAPGSIRASECRMAAF  419
            +CK+KRGGFKDT  DDLLA VLKA++EKTNLNP+EVGDI+VGTVLAPGSIRA ECRMAAF
Sbjct  56   ICKAKRGGFKDTLSDDLLAPVLKAVVEKTNLNPNEVGDIVVGTVLAPGSIRAMECRMAAF  115

Query  420  YAGFPETVPVRTVNRQCSSGLQavadvaaaikaGFYDIGIGAGLESMTVN  569
            YAGFP+TVP+RTVNRQCSSGLQAVADVAAAIKAGFYDIGIGAGLE MTV+
Sbjct  116  YAGFPDTVPIRTVNRQCSSGLQAVADVAAAIKAGFYDIGIGAGLELMTVD  165



>ref|XP_009629663.1| PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxisomal-like [Nicotiana 
tomentosiformis]
Length=494

 Score =   252 bits (644),  Expect = 7e-78, Method: Compositional matrix adjust.
 Identities = 130/171 (76%), Positives = 153/171 (89%), Gaps = 1/171 (1%)
 Frame = +3

Query  60   AIERQRVLLQHLRPTNAASSHDSIESS-VSASVCAAGDSAAYQRNSVYGDDIVIVAAYRT  236
            AIERQRVLL+HL+P  ++S H   +SS ++ S+C AGDSAAY+R + + DD+VIVAAYRT
Sbjct  33   AIERQRVLLEHLQPIRSSSHHTHDQSSSLTPSICLAGDSAAYRRTAAFDDDVVIVAAYRT  92

Query  237  PLCKSKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTVLAPGSIRASECRMAA  416
             +CK+KRGGFKDT  DDLLA VLKA++EKTNL+P+EVGDI+VGTVLAPGS+RA ECRMAA
Sbjct  93   AICKAKRGGFKDTLADDLLAPVLKAVVEKTNLSPNEVGDIVVGTVLAPGSLRAMECRMAA  152

Query  417  FYAGFPETVPVRTVNRQCSSGLQavadvaaaikaGFYDIGIGAGLESMTVN  569
            FYAGFPETVP+RTVNRQCSSGLQAVADVAA+IKAGFYDIGIGAGLE MTV+
Sbjct  153  FYAGFPETVPIRTVNRQCSSGLQAVADVAASIKAGFYDIGIGAGLELMTVD  203



>gb|KDO65878.1| hypothetical protein CISIN_1g0125222mg [Citrus sinensis]
Length=320

 Score =   247 bits (630),  Expect = 9e-78, Method: Compositional matrix adjust.
 Identities = 128/170 (75%), Positives = 145/170 (85%), Gaps = 3/170 (2%)
 Frame = +3

Query  60   AIERQRVLLQHLRPTNAASSHDSIESSVSASVCAAGDSAAYQRNSVYGDDIVIVAAYRTP  239
            A+ RQR+LLQHL+P+   SS  S   ++SAS+C+AG++A Y R   + DD+VIVAAYRT 
Sbjct  4    ALHRQRILLQHLQPS---SSQTSDSPAISASICSAGEAAGYHRKPAFDDDVVIVAAYRTA  60

Query  240  LCKSKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTVLAPGSIRASECRMAAF  419
            +CK+KRGGFKDT  DDLLA VLKA+IEKT LNPSEVGDI+VGTVLAPGS RA ECRMAAF
Sbjct  61   ICKAKRGGFKDTLADDLLAPVLKAVIEKTRLNPSEVGDIVVGTVLAPGSTRAMECRMAAF  120

Query  420  YAGFPETVPVRTVNRQCSSGLQavadvaaaikaGFYDIGIGAGLESMTVN  569
            YAGFPETVP+RTVNRQCSSGLQAVADVA AIKAG YDIGI AGLESMTVN
Sbjct  121  YAGFPETVPLRTVNRQCSSGLQAVADVATAIKAGLYDIGIAAGLESMTVN  170



>gb|KDO65876.1| hypothetical protein CISIN_1g0125222mg [Citrus sinensis]
 gb|KDO65877.1| hypothetical protein CISIN_1g0125222mg [Citrus sinensis]
Length=374

 Score =   247 bits (631),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 128/170 (75%), Positives = 145/170 (85%), Gaps = 3/170 (2%)
 Frame = +3

Query  60   AIERQRVLLQHLRPTNAASSHDSIESSVSASVCAAGDSAAYQRNSVYGDDIVIVAAYRTP  239
            A+ RQR+LLQHL+P+   SS  S   ++SAS+C+AG++A Y R   + DD+VIVAAYRT 
Sbjct  4    ALHRQRILLQHLQPS---SSQTSDSPAISASICSAGEAAGYHRKPAFDDDVVIVAAYRTA  60

Query  240  LCKSKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTVLAPGSIRASECRMAAF  419
            +CK+KRGGFKDT  DDLLA VLKA+IEKT LNPSEVGDI+VGTVLAPGS RA ECRMAAF
Sbjct  61   ICKAKRGGFKDTLADDLLAPVLKAVIEKTRLNPSEVGDIVVGTVLAPGSTRAMECRMAAF  120

Query  420  YAGFPETVPVRTVNRQCSSGLQavadvaaaikaGFYDIGIGAGLESMTVN  569
            YAGFPETVP+RTVNRQCSSGLQAVADVA AIKAG YDIGI AGLESMTVN
Sbjct  121  YAGFPETVPLRTVNRQCSSGLQAVADVATAIKAGLYDIGIAAGLESMTVN  170



>ref|XP_004290230.1| PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxisomal-like [Fragaria 
vesca subsp. vesca]
Length=456

 Score =   249 bits (636),  Expect = 5e-77, Method: Compositional matrix adjust.
 Identities = 131/174 (75%), Positives = 151/174 (87%), Gaps = 6/174 (3%)
 Frame = +3

Query  60   AIERQRVLLQHLRPTNAASS----HDSIESSVSASVCAAGDSAAYQRNSVYGDDIVIVAA  227
            A+ RQ+VLLQHLRP ++ SS    H+S  S +SA +CAAGDSAAY R   +GDDIVIVAA
Sbjct  4    ALNRQKVLLQHLRPNSSLSSAIQTHES--SVLSAEICAAGDSAAYHRTGAFGDDIVIVAA  61

Query  228  YRTPLCKSKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTVLAPGSIRASECR  407
            YRT +CK+KRGGFKDT  DDLLA VLKA+IE+TNLNPSEVGDI+VGTVLAPGS+RA ECR
Sbjct  62   YRTAVCKAKRGGFKDTLADDLLAPVLKAVIERTNLNPSEVGDIVVGTVLAPGSLRAIECR  121

Query  408  MAAFYAGFPETVPVRTVNRQCSSGLQavadvaaaikaGFYDIGIGAGLESMTVN  569
            MAAFYAGFP+TVP+RTVNRQCSSGLQAVADVAA IKAG+YDIGI AG+E MT++
Sbjct  122  MAAFYAGFPDTVPIRTVNRQCSSGLQAVADVAAFIKAGYYDIGIAAGVECMTID  175



>ref|XP_007201004.1| hypothetical protein PRUPE_ppa005303mg [Prunus persica]
 gb|EMJ02203.1| hypothetical protein PRUPE_ppa005303mg [Prunus persica]
Length=467

 Score =   249 bits (637),  Expect = 5e-77, Method: Compositional matrix adjust.
 Identities = 129/173 (75%), Positives = 151/173 (87%), Gaps = 3/173 (2%)
 Frame = +3

Query  60   AIERQRVLLQHLRPT---NAASSHDSIESSVSASVCAAGDSAAYQRNSVYGDDIVIVAAY  230
            A  RQRVLLQHL P    +AA       +++SAS+CAAGDSAAY R + +GDD+VIVAAY
Sbjct  4    AHNRQRVLLQHLLPNCSFSAAPPETHQSAALSASICAAGDSAAYHRTAAFGDDVVIVAAY  63

Query  231  RTPLCKSKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTVLAPGSIRASECRM  410
            RT +CK+KRGGFKDT PDDLLA VLKALIE+TNLNP EVGDI+VGTV+APGS+RA+ECRM
Sbjct  64   RTAICKAKRGGFKDTSPDDLLAPVLKALIERTNLNPGEVGDIVVGTVMAPGSLRATECRM  123

Query  411  AAFYAGFPETVPVRTVNRQCSSGLQavadvaaaikaGFYDIGIGAGLESMTVN  569
            AAFYAGFP+TVP+RTVNRQCSSGLQAVADVAA+IKAGFY+IG+ AGLESM+V+
Sbjct  124  AAFYAGFPDTVPIRTVNRQCSSGLQAVADVAASIKAGFYEIGVAAGLESMSVD  176



>ref|XP_009411367.1| PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxisomal-like [Musa 
acuminata subsp. malaccensis]
Length=459

 Score =   249 bits (635),  Expect = 9e-77, Method: Compositional matrix adjust.
 Identities = 134/170 (79%), Positives = 148/170 (87%), Gaps = 5/170 (3%)
 Frame = +3

Query  60   AIERQRVLLQHLRPTNAASSHDSIESSVSASVCAAGDSAAYQRNSVYGDDIVIVAAYRTP  239
            AIERQRVLL HL+P+    S       +S  VCAAGDSA YQR+S +GDD+VIVAA RT 
Sbjct  4    AIERQRVLLHHLQPSPPLRS-----PILSTEVCAAGDSAKYQRSSCFGDDVVIVAACRTA  58

Query  240  LCKSKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTVLAPGSIRASECRMAAF  419
            +CKSKRGGFKDT+P+DLLA VLKAL++KT LNPSEVGDI+VGTVLAPGS RA ECRMAAF
Sbjct  59   ICKSKRGGFKDTHPEDLLAPVLKALLDKTQLNPSEVGDIVVGTVLAPGSQRAIECRMAAF  118

Query  420  YAGFPETVPVRTVNRQCSSGLQavadvaaaikaGFYDIGIGAGLESMTVN  569
            YAGFP+TVP+RTVNRQCSSGLQAVADVAAAIKAGFYDIGIGAGLESMTVN
Sbjct  119  YAGFPDTVPLRTVNRQCSSGLQAVADVAAAIKAGFYDIGIGAGLESMTVN  168



>gb|AFW74040.1| hypothetical protein ZEAMMB73_080325 [Zea mays]
Length=378

 Score =   246 bits (628),  Expect = 9e-77, Method: Compositional matrix adjust.
 Identities = 125/170 (74%), Positives = 152/170 (89%), Gaps = 3/170 (2%)
 Frame = +3

Query  60   AIERQRVLLQHLRPTNAASSHDSIESSVSASVCAAGDSAAYQRNSVYGDDIVIVAAYRTP  239
            AI+RQRVLL HL P+ +A+S    +  ++AS CAAGDSAAYQR+S +GDD+V+VAAYRTP
Sbjct  4    AIDRQRVLLAHLLPSPSAASS---QPQLAASACAAGDSAAYQRSSSFGDDVVVVAAYRTP  60

Query  240  LCKSKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTVLAPGSIRASECRMAAF  419
            +CK+KRGGFKDTYP+DLL  VLKA+++ T +NP+++GDI+VGTVL PGS RA+ECRMAA 
Sbjct  61   ICKAKRGGFKDTYPEDLLTVVLKAVLDNTRINPADIGDIVVGTVLGPGSQRANECRMAAL  120

Query  420  YAGFPETVPVRTVNRQCSSGLQavadvaaaikaGFYDIGIGAGLESMTVN  569
            +AGFPETVPVRTVNRQCSSGLQAVADVAAAIKAG+YDIGIGAGLESM++N
Sbjct  121  FAGFPETVPVRTVNRQCSSGLQAVADVAAAIKAGYYDIGIGAGLESMSIN  170



>ref|XP_009400955.1| PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxisomal-like [Musa 
acuminata subsp. malaccensis]
 ref|XP_009400962.1| PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxisomal-like [Musa 
acuminata subsp. malaccensis]
Length=459

 Score =   248 bits (634),  Expect = 9e-77, Method: Compositional matrix adjust.
 Identities = 138/170 (81%), Positives = 155/170 (91%), Gaps = 5/170 (3%)
 Frame = +3

Query  60   AIERQRVLLQHLRPTNAASSHDSIESSVSASVCAAGDSAAYQRNSVYGDDIVIVAAYRTP  239
            AI RQRVLLQHL+P  ++SS     S VSASVCAAGDSAAYQRNS +GDD+V+VAAYRT 
Sbjct  4    AINRQRVLLQHLQPFPSSSS-----SLVSASVCAAGDSAAYQRNSSFGDDVVVVAAYRTA  58

Query  240  LCKSKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTVLAPGSIRASECRMAAF  419
            + KSKRGGFKDTYP++LL +VLKAL++KTNLNP+EVGDI+VGTVLAPGS RA+ECRMAAF
Sbjct  59   ISKSKRGGFKDTYPEELLTAVLKALLDKTNLNPNEVGDIVVGTVLAPGSQRATECRMAAF  118

Query  420  YAGFPETVPVRTVNRQCSSGLQavadvaaaikaGFYDIGIGAGLESMTVN  569
            YAGFPETVP+RTVNRQCSSGLQAVADVAA+IKAGFYDIGIGAGLESMT N
Sbjct  119  YAGFPETVPIRTVNRQCSSGLQAVADVAASIKAGFYDIGIGAGLESMTAN  168



>ref|XP_006649171.1| PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxisomal-like [Oryza 
brachyantha]
Length=449

 Score =   248 bits (633),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 128/170 (75%), Positives = 151/170 (89%), Gaps = 4/170 (2%)
 Frame = +3

Query  60   AIERQRVLLQHLRPTNAASSHDSIESSVSASVCAAGDSAAYQRNSVYGDDIVIVAAYRTP  239
            AI+RQRVLL HL P++++S+    +  +SAS CAAGDSAAYQR S YGDD+V+VAAYRTP
Sbjct  4    AIDRQRVLLAHLLPSSSSSN----QPLLSASACAAGDSAAYQRTSAYGDDVVVVAAYRTP  59

Query  240  LCKSKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTVLAPGSIRASECRMAAF  419
            +C++KRGGFKDTYP+DLL +VLKA+++ T +NP E+GDI+VG+VL PGS RA ECR AAF
Sbjct  60   ICRAKRGGFKDTYPEDLLTTVLKAVLDNTRINPGEIGDIVVGSVLGPGSQRAVECRAAAF  119

Query  420  YAGFPETVPVRTVNRQCSSGLQavadvaaaikaGFYDIGIGAGLESMTVN  569
            YAGFPETVPVRTVNRQCSSGLQAVADVAAAIKAGFYDIGIGAGLESM+VN
Sbjct  120  YAGFPETVPVRTVNRQCSSGLQAVADVAAAIKAGFYDIGIGAGLESMSVN  169



>gb|KDO65875.1| hypothetical protein CISIN_1g0125222mg, partial [Citrus sinensis]
Length=397

 Score =   246 bits (628),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 128/170 (75%), Positives = 145/170 (85%), Gaps = 3/170 (2%)
 Frame = +3

Query  60   AIERQRVLLQHLRPTNAASSHDSIESSVSASVCAAGDSAAYQRNSVYGDDIVIVAAYRTP  239
            A+ RQR+LLQHL+P+   SS  S   ++SAS+C+AG++A Y R   + DD+VIVAAYRT 
Sbjct  4    ALHRQRILLQHLQPS---SSQTSDSPAISASICSAGEAAGYHRKPAFDDDVVIVAAYRTA  60

Query  240  LCKSKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTVLAPGSIRASECRMAAF  419
            +CK+KRGGFKDT  DDLLA VLKA+IEKT LNPSEVGDI+VGTVLAPGS RA ECRMAAF
Sbjct  61   ICKAKRGGFKDTLADDLLAPVLKAVIEKTRLNPSEVGDIVVGTVLAPGSTRAMECRMAAF  120

Query  420  YAGFPETVPVRTVNRQCSSGLQavadvaaaikaGFYDIGIGAGLESMTVN  569
            YAGFPETVP+RTVNRQCSSGLQAVADVA AIKAG YDIGI AGLESMTVN
Sbjct  121  YAGFPETVPLRTVNRQCSSGLQAVADVATAIKAGLYDIGIAAGLESMTVN  170



>ref|XP_010940650.1| PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxisomal-like [Elaeis 
guineensis]
Length=461

 Score =   248 bits (633),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 137/170 (81%), Positives = 157/170 (92%), Gaps = 3/170 (2%)
 Frame = +3

Query  60   AIERQRVLLQHLRPTNAASSHDSIESSVSASVCAAGDSAAYQRNSVYGDDIVIVAAYRTP  239
            AI RQRVLLQHL+P +++S+   +   +SAS+CAAGDSAAYQR+S +GDD+V+VAAYRTP
Sbjct  4    AINRQRVLLQHLQPPSSSSNDAPM---LSASICAAGDSAAYQRSSSFGDDVVVVAAYRTP  60

Query  240  LCKSKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTVLAPGSIRASECRMAAF  419
            +CKSKRGGFKDTYP+DLLA+VLKAL++KT LNP EVGDI+VGTVLAPGS RA+ECRMAAF
Sbjct  61   ICKSKRGGFKDTYPEDLLAAVLKALLDKTKLNPREVGDIVVGTVLAPGSQRANECRMAAF  120

Query  420  YAGFPETVPVRTVNRQCSSGLQavadvaaaikaGFYDIGIGAGLESMTVN  569
            YAGFPETVPVRTVNRQCSSGLQAVADVAA+IKAGFYDIGIGAGLESMT N
Sbjct  121  YAGFPETVPVRTVNRQCSSGLQAVADVAASIKAGFYDIGIGAGLESMTTN  170



>ref|XP_006854408.1| hypothetical protein AMTR_s00039p00196630 [Amborella trichopoda]
 gb|ERN15875.1| hypothetical protein AMTR_s00039p00196630 [Amborella trichopoda]
Length=460

 Score =   248 bits (633),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 133/167 (80%), Positives = 150/167 (90%), Gaps = 4/167 (2%)
 Frame = +3

Query  69   RQRVLLQHLRPTNAASSHDSIESSVSASVCAAGDSAAYQRNSVYGDDIVIVAAYRTPLCK  248
            RQ++LL HLRP+  ASS ++  S++ ASVC AGDSAAY R++ +GDD+VIVAAYRT  CK
Sbjct  7    RQKILLDHLRPS--ASSQEN--SNLQASVCLAGDSAAYARSAPFGDDVVIVAAYRTAQCK  62

Query  249  SKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTVLAPGSIRASECRMAAFYAG  428
            SKRGGFKDT+P+DLLA VLKALI+KT L+P EVGDI+VGTVLAPGS RASECRMAAFYAG
Sbjct  63   SKRGGFKDTFPEDLLAPVLKALIDKTKLDPREVGDIVVGTVLAPGSQRASECRMAAFYAG  122

Query  429  FPETVPVRTVNRQCSSGLQavadvaaaikaGFYDIGIGAGLESMTVN  569
            +PETVPVRTVNRQCSSGLQAVADVAAAIKAGFYDIGIGAGLESMT N
Sbjct  123  YPETVPVRTVNRQCSSGLQAVADVAAAIKAGFYDIGIGAGLESMTAN  169



>gb|AFW74041.1| hypothetical protein ZEAMMB73_080325 [Zea mays]
Length=407

 Score =   245 bits (626),  Expect = 5e-76, Method: Compositional matrix adjust.
 Identities = 125/170 (74%), Positives = 152/170 (89%), Gaps = 3/170 (2%)
 Frame = +3

Query  60   AIERQRVLLQHLRPTNAASSHDSIESSVSASVCAAGDSAAYQRNSVYGDDIVIVAAYRTP  239
            AI+RQRVLL HL P+ +A+S    +  ++AS CAAGDSAAYQR+S +GDD+V+VAAYRTP
Sbjct  4    AIDRQRVLLAHLLPSPSAASS---QPQLAASACAAGDSAAYQRSSSFGDDVVVVAAYRTP  60

Query  240  LCKSKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTVLAPGSIRASECRMAAF  419
            +CK+KRGGFKDTYP+DLL  VLKA+++ T +NP+++GDI+VGTVL PGS RA+ECRMAA 
Sbjct  61   ICKAKRGGFKDTYPEDLLTVVLKAVLDNTRINPADIGDIVVGTVLGPGSQRANECRMAAL  120

Query  420  YAGFPETVPVRTVNRQCSSGLQavadvaaaikaGFYDIGIGAGLESMTVN  569
            +AGFPETVPVRTVNRQCSSGLQAVADVAAAIKAG+YDIGIGAGLESM++N
Sbjct  121  FAGFPETVPVRTVNRQCSSGLQAVADVAAAIKAGYYDIGIGAGLESMSIN  170



>ref|XP_010099126.1| 3-ketoacyl-CoA thiolase 2 [Morus notabilis]
 gb|EXB76920.1| 3-ketoacyl-CoA thiolase 2 [Morus notabilis]
Length=464

 Score =   246 bits (629),  Expect = 6e-76, Method: Compositional matrix adjust.
 Identities = 128/141 (91%), Positives = 136/141 (96%), Gaps = 0/141 (0%)
 Frame = +3

Query  147  ASVCAAGDSAAYQRNSVYGDDIVIVAAYRTPLCKSKRGGFKDTYPDDLLASVLKALIEKT  326
            ASVC AGDSAAYQR +V+GDD+VIVAAYRTPLCKSKRGGFKDT+ DDLLA VLKALIEKT
Sbjct  33   ASVCLAGDSAAYQRTNVFGDDVVIVAAYRTPLCKSKRGGFKDTHADDLLAPVLKALIEKT  92

Query  327  NLNPSEVGDIIVGTVLAPGSIRASECRMAAFYAGFPETVPVRTVNRQCSSGLQavadvaa  506
            NLNPSEVGDI+VGTVLAPGS RASECRMAAFYAGFPETVP+RTVNRQCSSGLQAVADVAA
Sbjct  93   NLNPSEVGDIVVGTVLAPGSQRASECRMAAFYAGFPETVPIRTVNRQCSSGLQAVADVAA  152

Query  507  aikaGFYDIGIGAGLESMTVN  569
            AI+AGFYDIGIGAGLESMT+N
Sbjct  153  AIRAGFYDIGIGAGLESMTMN  173



>pdb|2WUA|A Chain A, Structure Of The Peroxisomal 3-Ketoacyl-Coa Thiolase 
From Sunflower
 pdb|2WUA|B Chain B, Structure Of The Peroxisomal 3-Ketoacyl-Coa Thiolase 
From Sunflower
Length=440

 Score =   246 bits (627),  Expect = 6e-76, Method: Compositional matrix adjust.
 Identities = 129/152 (85%), Positives = 140/152 (92%), Gaps = 0/152 (0%)
 Frame = +3

Query  114  SSHDSIESSVSASVCAAGDSAAYQRNSVYGDDIVIVAAYRTPLCKSKRGGFKDTYPDDLL  293
            SS  S   ++S SVCAAGDSAAYQRNSV+GDD+VIVAAYR+PLCK+KRGG KDTYPDD+L
Sbjct  3    SSTSSSLENLSVSVCAAGDSAAYQRNSVFGDDVVIVAAYRSPLCKAKRGGLKDTYPDDIL  62

Query  294  ASVLKALIEKTNLNPSEVGDIIVGTVLAPGSIRASECRMAAFYAGFPETVPVRTVNRQCS  473
            A VLKALIEKTN+NP+EVGDI+VG+VL  GS RASECRMAAFYAGFPETVPVRTVNRQCS
Sbjct  63   APVLKALIEKTNINPAEVGDIVVGSVLGAGSQRASECRMAAFYAGFPETVPVRTVNRQCS  122

Query  474  SGLQavadvaaaikaGFYDIGIGAGLESMTVN  569
            SGLQAVADVAAAIKAGFYDIGIGAGLESMT N
Sbjct  123  SGLQAVADVAAAIKAGFYDIGIGAGLESMTAN  154



>ref|NP_001131193.1| acetyl-CoA C-acyltransferase-like protein [Zea mays]
 gb|ACF79501.1| unknown [Zea mays]
 gb|AFW74042.1| LOW QUALITY PROTEIN: acetyl-CoA C-acyltransferase-like protein 
[Zea mays]
Length=461

 Score =   246 bits (627),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 125/170 (74%), Positives = 152/170 (89%), Gaps = 3/170 (2%)
 Frame = +3

Query  60   AIERQRVLLQHLRPTNAASSHDSIESSVSASVCAAGDSAAYQRNSVYGDDIVIVAAYRTP  239
            AI+RQRVLL HL P+ +A+S    +  ++AS CAAGDSAAYQR+S +GDD+V+VAAYRTP
Sbjct  4    AIDRQRVLLAHLLPSPSAASS---QPQLAASACAAGDSAAYQRSSSFGDDVVVVAAYRTP  60

Query  240  LCKSKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTVLAPGSIRASECRMAAF  419
            +CK+KRGGFKDTYP+DLL  VLKA+++ T +NP+++GDI+VGTVL PGS RA+ECRMAA 
Sbjct  61   ICKAKRGGFKDTYPEDLLTVVLKAVLDNTRINPADIGDIVVGTVLGPGSQRANECRMAAL  120

Query  420  YAGFPETVPVRTVNRQCSSGLQavadvaaaikaGFYDIGIGAGLESMTVN  569
            +AGFPETVPVRTVNRQCSSGLQAVADVAAAIKAG+YDIGIGAGLESM++N
Sbjct  121  FAGFPETVPVRTVNRQCSSGLQAVADVAAAIKAGYYDIGIGAGLESMSIN  170



>gb|ACN39947.1| unknown [Picea sitchensis]
 gb|ACN40646.1| unknown [Picea sitchensis]
Length=462

 Score =   246 bits (627),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 130/167 (78%), Positives = 146/167 (87%), Gaps = 4/167 (2%)
 Frame = +3

Query  69   RQRVLLQHLRPTNAASSHDSIESSVSASVCAAGDSAAYQRNSVYGDDIVIVAAYRTPLCK  248
            RQ+VLL HLRP     +     + + ASVC+AGDSAAY+R + +GDD+VIVAAYRTP+CK
Sbjct  9    RQQVLLDHLRPARFPKAS----TDLVASVCSAGDSAAYERAAEFGDDVVIVAAYRTPICK  64

Query  249  SKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTVLAPGSIRASECRMAAFYAG  428
            +KRGGFKDT PDDLLA VLKALI+KT +NP+EV DI+VGTVLAPGS RASECRMA+FYAG
Sbjct  65   AKRGGFKDTLPDDLLAPVLKALIDKTGINPNEVRDIVVGTVLAPGSQRASECRMASFYAG  124

Query  429  FPETVPVRTVNRQCSSGLQavadvaaaikaGFYDIGIGAGLESMTVN  569
            FPETVPVRTVNRQCSSGLQAVADVAAAIKAGFYDIGIGAGLESMT N
Sbjct  125  FPETVPVRTVNRQCSSGLQAVADVAAAIKAGFYDIGIGAGLESMTAN  171



>ref|NP_001241698.1| 3-ketoacyl-CoA thiolase 2, peroxisomal precursor [Zea mays]
 gb|ACG36949.1| 3-ketoacyl-CoA thiolase 2, peroxisomal precursor [Zea mays]
Length=461

 Score =   246 bits (627),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 125/170 (74%), Positives = 152/170 (89%), Gaps = 3/170 (2%)
 Frame = +3

Query  60   AIERQRVLLQHLRPTNAASSHDSIESSVSASVCAAGDSAAYQRNSVYGDDIVIVAAYRTP  239
            AI+RQRVLL HL P+ +A+S    +  ++AS CAAGDSAAYQR+S +GDD+V+VAAYRTP
Sbjct  4    AIDRQRVLLAHLLPSPSAASS---QPHLAASACAAGDSAAYQRSSSFGDDVVVVAAYRTP  60

Query  240  LCKSKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTVLAPGSIRASECRMAAF  419
            +CK+KRGGFKDTYP+DLL  VLKA+++ T +NP+++GDI+VGTVL PGS RA+ECRMAA 
Sbjct  61   ICKAKRGGFKDTYPEDLLTVVLKAVLDNTRINPADIGDIVVGTVLGPGSQRANECRMAAL  120

Query  420  YAGFPETVPVRTVNRQCSSGLQavadvaaaikaGFYDIGIGAGLESMTVN  569
            +AGFPETVPVRTVNRQCSSGLQAVADVAAAIKAG+YDIGIGAGLESM++N
Sbjct  121  FAGFPETVPVRTVNRQCSSGLQAVADVAAAIKAGYYDIGIGAGLESMSIN  170



>gb|KEH41248.1| 3-ketoacyl-CoA thiolase 2, peroxisomal-like protein [Medicago 
truncatula]
Length=462

 Score =   246 bits (627),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 133/170 (78%), Positives = 151/170 (89%), Gaps = 1/170 (1%)
 Frame = +3

Query  60   AIERQRVLLQHLRPTNAASSHDSIESSVSASVCAAGDSAAYQRNSVYGDDIVIVAAYRTP  239
            AI RQ+VLLQHL P++ +S+  S  +S++AS C AGDSAAY R + +GDD+VIVAAYRT 
Sbjct  4    AINRQKVLLQHLNPSSFSSND-SSSTSLNASACLAGDSAAYHRTAAFGDDVVIVAAYRTA  62

Query  240  LCKSKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTVLAPGSIRASECRMAAF  419
            LCK+KRGGFKDT+ DD+LA VLKA+IEKTNLNPSEVGDI+VG+VL  GS RASECRMAAF
Sbjct  63   LCKAKRGGFKDTHADDILAPVLKAVIEKTNLNPSEVGDIVVGSVLGAGSQRASECRMAAF  122

Query  420  YAGFPETVPVRTVNRQCSSGLQavadvaaaikaGFYDIGIGAGLESMTVN  569
            YAGFPETVPVRTVNRQCSSGLQAVADVAAAI+AGFYDIGIGAGLESMT N
Sbjct  123  YAGFPETVPVRTVNRQCSSGLQAVADVAAAIRAGFYDIGIGAGLESMTTN  172



>emb|CDP03848.1| unnamed protein product [Coffea canephora]
Length=466

 Score =   246 bits (627),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 134/172 (78%), Positives = 150/172 (87%), Gaps = 2/172 (1%)
 Frame = +3

Query  60   AIERQRVLLQHLRPTNAASSH--DSIESSVSASVCAAGDSAAYQRNSVYGDDIVIVAAYR  233
            AI RQ+VLL+HL+PT+  S        SS+S S+C AGDSAAYQR + +GDD+VIVAAYR
Sbjct  4    AIFRQKVLLEHLQPTSCFSHQLTHEESSSISPSICLAGDSAAYQRTAAFGDDVVIVAAYR  63

Query  234  TPLCKSKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTVLAPGSIRASECRMA  413
            T +CKSKRGGFKDT  DDLLA VLKALI+KTN+NPSEVGDI+VGTV+APGS RA+ECRMA
Sbjct  64   TAICKSKRGGFKDTLADDLLAPVLKALIDKTNINPSEVGDIVVGTVVAPGSQRATECRMA  123

Query  414  AFYAGFPETVPVRTVNRQCSSGLQavadvaaaikaGFYDIGIGAGLESMTVN  569
            AFYAGFPETVP+RTVNRQCSSGLQAVADVAA IKAGFYDIGIGAGLESMT N
Sbjct  124  AFYAGFPETVPIRTVNRQCSSGLQAVADVAACIKAGFYDIGIGAGLESMTTN  175



>ref|XP_006443651.1| hypothetical protein CICLE_v10020068mg [Citrus clementina]
 ref|XP_006480201.1| PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxisomal-like [Citrus 
sinensis]
 gb|ESR56891.1| hypothetical protein CICLE_v10020068mg [Citrus clementina]
Length=461

 Score =   245 bits (626),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 128/170 (75%), Positives = 145/170 (85%), Gaps = 3/170 (2%)
 Frame = +3

Query  60   AIERQRVLLQHLRPTNAASSHDSIESSVSASVCAAGDSAAYQRNSVYGDDIVIVAAYRTP  239
            A+ RQR+LLQHL+P+   SS  S   ++SAS+C+AG++A Y R   + DD+VIVAAYRT 
Sbjct  4    ALHRQRILLQHLQPS---SSQTSDSPAISASICSAGEAAGYHRKPAFDDDVVIVAAYRTA  60

Query  240  LCKSKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTVLAPGSIRASECRMAAF  419
            +CK+KRGGFKDT  DDLLA VLKA+IEKT LNPSEVGDI+VGTVLAPGS RA ECRMAAF
Sbjct  61   ICKAKRGGFKDTLADDLLAPVLKAVIEKTRLNPSEVGDIVVGTVLAPGSTRAMECRMAAF  120

Query  420  YAGFPETVPVRTVNRQCSSGLQavadvaaaikaGFYDIGIGAGLESMTVN  569
            YAGFPETVP+RTVNRQCSSGLQAVADVA AIKAG YDIGI AGLESMTVN
Sbjct  121  YAGFPETVPLRTVNRQCSSGLQAVADVATAIKAGLYDIGIAAGLESMTVN  170



>ref|XP_002974835.1| hypothetical protein SELMODRAFT_101898 [Selaginella moellendorffii]
 gb|EFJ24355.1| hypothetical protein SELMODRAFT_101898 [Selaginella moellendorffii]
Length=454

 Score =   245 bits (625),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 126/167 (75%), Positives = 144/167 (86%), Gaps = 5/167 (3%)
 Frame = +3

Query  69   RQRVLLQHLRPTNAASSHDSIESSVSASVCAAGDSAAYQRNSVYGDDIVIVAAYRTPLCK  248
            RQ++LL HLRP++A    + +      S+C+AGDSAAY R + Y DD+V+VAAYRTP+CK
Sbjct  2    RQQILLDHLRPSSAPRPVNLV-----TSICSAGDSAAYHRTTDYSDDVVVVAAYRTPICK  56

Query  249  SKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTVLAPGSIRASECRMAAFYAG  428
            SKRGGFKDTYP+DLL  VLKA++EK  LNP+EVGDI+VGTVLAPGS RA+ECRMAAFYAG
Sbjct  57   SKRGGFKDTYPEDLLTPVLKAVVEKVGLNPAEVGDIVVGTVLAPGSQRANECRMAAFYAG  116

Query  429  FPETVPVRTVNRQCSSGLQavadvaaaikaGFYDIGIGAGLESMTVN  569
            FPETVPVRTVNRQCSSGLQAVADV AAIKAGFYDIGIGAGLESMT N
Sbjct  117  FPETVPVRTVNRQCSSGLQAVADVVAAIKAGFYDIGIGAGLESMTAN  163



>ref|XP_002963753.1| hypothetical protein SELMODRAFT_450889 [Selaginella moellendorffii]
 gb|EFJ35624.1| hypothetical protein SELMODRAFT_450889 [Selaginella moellendorffii]
Length=462

 Score =   245 bits (625),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 126/167 (75%), Positives = 144/167 (86%), Gaps = 5/167 (3%)
 Frame = +3

Query  69   RQRVLLQHLRPTNAASSHDSIESSVSASVCAAGDSAAYQRNSVYGDDIVIVAAYRTPLCK  248
            RQ++LL HLRP++A    + +      S+C+AGDSAAY R + Y DD+V+VAAYRTP+CK
Sbjct  10   RQQILLDHLRPSSAPRPVNLV-----TSICSAGDSAAYHRTTDYSDDVVVVAAYRTPICK  64

Query  249  SKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTVLAPGSIRASECRMAAFYAG  428
            SKRGGFKDTYP+DLL  VLKA++EK  LNP+EVGDI+VGTVLAPGS RA+ECRMAAFYAG
Sbjct  65   SKRGGFKDTYPEDLLTPVLKAVVEKVGLNPAEVGDIVVGTVLAPGSQRANECRMAAFYAG  124

Query  429  FPETVPVRTVNRQCSSGLQavadvaaaikaGFYDIGIGAGLESMTVN  569
            FPETVPVRTVNRQCSSGLQAVADV AAIKAGFYDIGIGAGLESMT N
Sbjct  125  FPETVPVRTVNRQCSSGLQAVADVVAAIKAGFYDIGIGAGLESMTAN  171



>gb|ABR16781.1| unknown [Picea sitchensis]
Length=462

 Score =   245 bits (625),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 133/167 (80%), Positives = 147/167 (88%), Gaps = 6/167 (4%)
 Frame = +3

Query  69   RQRVLLQHLRPTN-AASSHDSIESSVSASVCAAGDSAAYQRNSVYGDDIVIVAAYRTPLC  245
            RQ+VLL HLRP +   +S D +     ASVCAAGDSAAY+R + +GDD+VIVAAYRTP+C
Sbjct  9    RQQVLLDHLRPAHFPKASKDLV-----ASVCAAGDSAAYERAAEFGDDVVIVAAYRTPIC  63

Query  246  KSKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTVLAPGSIRASECRMAAFYA  425
            K+KRGGFKDT  DDLLA VLKALI+KT LNP EVGDI+VGTVLAPGS RASECRMAAFYA
Sbjct  64   KAKRGGFKDTLADDLLAPVLKALIDKTGLNPVEVGDIVVGTVLAPGSQRASECRMAAFYA  123

Query  426  GFPETVPVRTVNRQCSSGLQavadvaaaikaGFYDIGIGAGLESMTV  566
            GFPETVPVRTVNRQCSSGLQAVADVAAAIKAGFYDIGIGAG+ESM+V
Sbjct  124  GFPETVPVRTVNRQCSSGLQAVADVAAAIKAGFYDIGIGAGVESMSV  170



>ref|XP_011006998.1| PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxisomal-like [Populus 
euphratica]
Length=457

 Score =   244 bits (622),  Expect = 5e-75, Method: Compositional matrix adjust.
 Identities = 128/170 (75%), Positives = 146/170 (86%), Gaps = 7/170 (4%)
 Frame = +3

Query  60   AIERQRVLLQHLRPTNAASSHDSIESSVSASVCAAGDSAAYQRNSVYGDDIVIVAAYRTP  239
            A  RQ+VLL HL+PT       S    +SAS+CAAGDSAAY R + +GDDIVIVAAYRT 
Sbjct  4    AFNRQKVLLAHLQPT-------SPSPLLSASICAAGDSAAYHRTAAFGDDIVIVAAYRTA  56

Query  240  LCKSKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTVLAPGSIRASECRMAAF  419
            +CK++RGGFKDT+PDDLL  VLKA++EKTN+NPSEVGDI+VGTVLAPGS RA ECRMAAF
Sbjct  57   ICKARRGGFKDTFPDDLLGFVLKAVVEKTNVNPSEVGDIVVGTVLAPGSERAIECRMAAF  116

Query  420  YAGFPETVPVRTVNRQCSSGLQavadvaaaikaGFYDIGIGAGLESMTVN  569
            YAGFP+TVP+RTVNRQCSSGLQAVADVAA+IKAG+YDIGI AGLE MTVN
Sbjct  117  YAGFPDTVPLRTVNRQCSSGLQAVADVAASIKAGYYDIGIAAGLECMTVN  166



>ref|XP_010933143.1| PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxisomal-like [Elaeis 
guineensis]
Length=460

 Score =   244 bits (622),  Expect = 6e-75, Method: Compositional matrix adjust.
 Identities = 128/170 (75%), Positives = 147/170 (86%), Gaps = 4/170 (2%)
 Frame = +3

Query  60   AIERQRVLLQHLRPTNAASSHDSIESSVSASVCAAGDSAAYQRNSVYGDDIVIVAAYRTP  239
            AI RQRVLLQH  P++A+  H ++    S S+CAAGDSAAYQR+S +GDD+VIVAA RT 
Sbjct  4    AISRQRVLLQHFHPSSASDDHPTL----STSICAAGDSAAYQRSSCFGDDVVIVAACRTA  59

Query  240  LCKSKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTVLAPGSIRASECRMAAF  419
            +CKSKRGGFKDT+P+DLLA VLK L++KT LNPSEVGDI+VGTVLA GS RA ECRMAAF
Sbjct  60   ICKSKRGGFKDTHPEDLLAPVLKELLDKTKLNPSEVGDIVVGTVLASGSQRAIECRMAAF  119

Query  420  YAGFPETVPVRTVNRQCSSGLQavadvaaaikaGFYDIGIGAGLESMTVN  569
            YAGFPETV ++TVNRQCSSGLQAVAD+AAAIKAG YDIGI AG+ESMTVN
Sbjct  120  YAGFPETVSLKTVNRQCSSGLQAVADIAAAIKAGLYDIGIAAGMESMTVN  169



>ref|XP_003570403.1| PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxisomal [Brachypodium 
distachyon]
Length=461

 Score =   244 bits (622),  Expect = 7e-75, Method: Compositional matrix adjust.
 Identities = 127/170 (75%), Positives = 147/170 (86%), Gaps = 3/170 (2%)
 Frame = +3

Query  60   AIERQRVLLQHLRPTNAASSHDSIESSVSASVCAAGDSAAYQRNSVYGDDIVIVAAYRTP  239
            AI+RQRVLL HL P+ ++S+       +SAS CAAGDSAAYQR+S +GDD+VIVAAYRTP
Sbjct  4    AIDRQRVLLAHLAPSASSSAQGQ---QLSASACAAGDSAAYQRSSCFGDDVVIVAAYRTP  60

Query  240  LCKSKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTVLAPGSIRASECRMAAF  419
            +CK+KRGGFKDTYP+DLL  VLKA+++ T +NP E+GDI+VGTVL PGS RA ECR A+ 
Sbjct  61   ICKAKRGGFKDTYPEDLLTPVLKAVLDNTGINPGEIGDIVVGTVLGPGSQRAIECRTASL  120

Query  420  YAGFPETVPVRTVNRQCSSGLQavadvaaaikaGFYDIGIGAGLESMTVN  569
             AGFPETVPVRTVNRQCSSGLQAVADVAAAIKAGFYDIGIGAGLESM+VN
Sbjct  121  LAGFPETVPVRTVNRQCSSGLQAVADVAAAIKAGFYDIGIGAGLESMSVN  170



>ref|XP_009376354.1| PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxisomal [Pyrus x bretschneideri]
Length=459

 Score =   243 bits (621),  Expect = 8e-75, Method: Compositional matrix adjust.
 Identities = 138/170 (81%), Positives = 154/170 (91%), Gaps = 5/170 (3%)
 Frame = +3

Query  60   AIERQRVLLQHLRPTNAASSHDSIESSVSASVCAAGDSAAYQRNSVYGDDIVIVAAYRTP  239
            AI RQRVLL HLRP +A SS     SS+SAS CAAGDSAAY R +V+GDD+VIVAAYRTP
Sbjct  4    AINRQRVLLDHLRPPSADSS-----SSLSASACAAGDSAAYARTNVFGDDVVIVAAYRTP  58

Query  240  LCKSKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTVLAPGSIRASECRMAAF  419
            +CK+KRGGFKDT+ DDLLA VLKA++EKTN+NPSE+GDI+VGTVLAPGS RASECRMAAF
Sbjct  59   ICKAKRGGFKDTHADDLLAPVLKAVVEKTNVNPSEIGDIVVGTVLAPGSQRASECRMAAF  118

Query  420  YAGFPETVPVRTVNRQCSSGLQavadvaaaikaGFYDIGIGAGLESMTVN  569
            YAGFPETVP+RTVNRQCSSGLQAVADVAA+I+AGFYDIGIGAGLESMT N
Sbjct  119  YAGFPETVPIRTVNRQCSSGLQAVADVAASIRAGFYDIGIGAGLESMTAN  168



>ref|XP_008804452.1| PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxisomal-like [Phoenix 
dactylifera]
Length=460

 Score =   243 bits (621),  Expect = 9e-75, Method: Compositional matrix adjust.
 Identities = 129/170 (76%), Positives = 149/170 (88%), Gaps = 4/170 (2%)
 Frame = +3

Query  60   AIERQRVLLQHLRPTNAASSHDSIESSVSASVCAAGDSAAYQRNSVYGDDIVIVAAYRTP  239
            AI RQ VLLQHLRP    SS      ++SAS+CAAGDSAAYQR+S +GDD+VIVAA RT 
Sbjct  4    AINRQSVLLQHLRP----SSDFGDRPALSASICAAGDSAAYQRSSCFGDDVVIVAACRTA  59

Query  240  LCKSKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTVLAPGSIRASECRMAAF  419
            +CKS RGGF++T+P+DLLA VLKAL++KT LNPSEVGDI+VGTVLAPGS RA ECRMAAF
Sbjct  60   ICKSSRGGFRNTHPEDLLAPVLKALLDKTKLNPSEVGDIVVGTVLAPGSQRAIECRMAAF  119

Query  420  YAGFPETVPVRTVNRQCSSGLQavadvaaaikaGFYDIGIGAGLESMTVN  569
            YAGFPETVP+RTVNRQCSSGLQAVAD+AAAIK+GFY+IGI AG+ESMTV+
Sbjct  120  YAGFPETVPLRTVNRQCSSGLQAVADIAAAIKSGFYEIGIAAGMESMTVD  169



>ref|XP_002301570.1| hypothetical protein POPTR_0002s22410g [Populus trichocarpa]
 gb|EEE80843.1| hypothetical protein POPTR_0002s22410g [Populus trichocarpa]
Length=457

 Score =   243 bits (620),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 128/170 (75%), Positives = 146/170 (86%), Gaps = 7/170 (4%)
 Frame = +3

Query  60   AIERQRVLLQHLRPTNAASSHDSIESSVSASVCAAGDSAAYQRNSVYGDDIVIVAAYRTP  239
            A  RQ+VLL HL+PT       S    +SAS+CAAGDSAAY R + +GDDIVIVAAYRT 
Sbjct  4    AFNRQKVLLAHLQPT-------SPSPLLSASICAAGDSAAYHRTAAFGDDIVIVAAYRTA  56

Query  240  LCKSKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTVLAPGSIRASECRMAAF  419
            +CK++RGGFKDT+PDDLL  VLKA++EKTN+NPSEVGDI+VGTVLAPGS RA ECRMAAF
Sbjct  57   ICKARRGGFKDTFPDDLLGFVLKAVVEKTNVNPSEVGDIVVGTVLAPGSERAIECRMAAF  116

Query  420  YAGFPETVPVRTVNRQCSSGLQavadvaaaikaGFYDIGIGAGLESMTVN  569
            YAGFP+TVP+RTVNRQCSSGLQAVADVAA+IKAG+YDIGI AGLE MTVN
Sbjct  117  YAGFPDTVPLRTVNRQCSSGLQAVADVAASIKAGYYDIGIAAGLECMTVN  166



>ref|XP_010457531.1| PREDICTED: 3-ketoacyl-CoA thiolase 1, peroxisomal [Camelina sativa]
Length=439

 Score =   243 bits (619),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 130/169 (77%), Positives = 146/169 (86%), Gaps = 13/169 (8%)
 Frame = +3

Query  63   IERQRVLLQHLRPTNAASSHDSIESSVSASVCAAGDSAAYQRNSVYGDDIVIVAAYRTPL  242
            +ERQRVLLQHL+P++A         S+S S C A    +Y+R S+YGDD+VIVAA RT L
Sbjct  5    MERQRVLLQHLQPSDA---------SLSPSACLA----SYERTSLYGDDVVIVAAQRTAL  51

Query  243  CKSKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTVLAPGSIRASECRMAAFY  422
            CK+KRG FKDTYPDDLLASVL+ALIEKTN+NP+EVGDI+VGTVL PGS RASECRMAAFY
Sbjct  52   CKAKRGSFKDTYPDDLLASVLRALIEKTNVNPTEVGDIVVGTVLGPGSQRASECRMAAFY  111

Query  423  AGFPETVPVRTVNRQCSSGLQavadvaaaikaGFYDIGIGAGLESMTVN  569
            AGFP+TVP+RTVNRQCSSGLQAVADVAAAIKAGFYDIGIGAGLESMT N
Sbjct  112  AGFPQTVPIRTVNRQCSSGLQAVADVAAAIKAGFYDIGIGAGLESMTTN  160



>gb|KHG13200.1| 3-ketoacyl-CoA thiolase 2, peroxisomal -like protein [Gossypium 
arboreum]
 gb|KHG18802.1| 3-ketoacyl-CoA thiolase 2, peroxisomal -like protein [Gossypium 
arboreum]
Length=454

 Score =   243 bits (620),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 129/170 (76%), Positives = 146/170 (86%), Gaps = 2/170 (1%)
 Frame = +3

Query  60   AIERQRVLLQHLRPTNAASSHDSIESSVSASVCAAGDSAAYQRNSVYGDDIVIVAAYRTP  239
            AI RQ+VLL HL+P++   SH S  + +  S CAAGDSAAY R + +GDD+VIVAA RT 
Sbjct  4    AINRQQVLLNHLQPSS--QSHQSPAAILFPSNCAAGDSAAYHRTAAFGDDVVIVAACRTA  61

Query  240  LCKSKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTVLAPGSIRASECRMAAF  419
            +CK+KRGGFKDT  DDLLA VLKA+I++T LNPSEVGDI+VGTVLAPGS RASECRMAAF
Sbjct  62   ICKAKRGGFKDTLADDLLAPVLKAVIDRTKLNPSEVGDIVVGTVLAPGSQRASECRMAAF  121

Query  420  YAGFPETVPVRTVNRQCSSGLQavadvaaaikaGFYDIGIGAGLESMTVN  569
            YAGFP+TVP+RTVNRQCSSGLQAVADVAA IKAGFYDIGIGAGLESMT N
Sbjct  122  YAGFPDTVPIRTVNRQCSSGLQAVADVAACIKAGFYDIGIGAGLESMTTN  171



>ref|XP_002518136.1| 3-ketoacyl-CoA thiolase B, putative [Ricinus communis]
 gb|EEF44269.1| 3-ketoacyl-CoA thiolase B, putative [Ricinus communis]
Length=460

 Score =   243 bits (619),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 138/170 (81%), Positives = 155/170 (91%), Gaps = 4/170 (2%)
 Frame = +3

Query  60   AIERQRVLLQHLRPTNAASSHDSIESSVSASVCAAGDSAAYQRNSVYGDDIVIVAAYRTP  239
            AI RQ++LL HLRP++++S H+  +SS+SAS C+AGDSAAYQR SVYGDD+VIVAA+RT 
Sbjct  4    AINRQKILLDHLRPSSSSSLHN-YDSSLSASACSAGDSAAYQRTSVYGDDVVIVAAHRTA  62

Query  240  LCKSKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTVLAPGSIRASECRMAAF  419
            LCKSKRGGFKDT+ DDLLA VLKALIEKT LNPSEVGDI+VGTVLAPGS RASECRMAAF
Sbjct  63   LCKSKRGGFKDTFADDLLAPVLKALIEKTKLNPSEVGDIVVGTVLAPGSQRASECRMAAF  122

Query  420  YAGFPETVPVRTVNRQCSSGLQavadvaaaikaGFYDIGIGAGLESMTVN  569
            YAGFPETVP+RTVNRQCSSGLQAVADVAAAIKAGFYDI   AG+ESMT+N
Sbjct  123  YAGFPETVPIRTVNRQCSSGLQAVADVAAAIKAGFYDI---AGVESMTIN  169



>dbj|BAJ87577.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=460

 Score =   242 bits (618),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 127/170 (75%), Positives = 147/170 (86%), Gaps = 5/170 (3%)
 Frame = +3

Query  60   AIERQRVLLQHLRPTNAASSHDSIESSVSASVCAAGDSAAYQRNSVYGDDIVIVAAYRTP  239
            AI+RQRVLL HL P+ A++      S +SAS CAAGDSAAYQR S +GDD+VIVAAYRTP
Sbjct  4    AIDRQRVLLAHLLPSPASAG-----SQLSASACAAGDSAAYQRTSCFGDDVVIVAAYRTP  58

Query  240  LCKSKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTVLAPGSIRASECRMAAF  419
            +CK+KRGGFKDTYP+DLL  VLKA+++KT +NP+E+GD++VGTVL PGS RA ECR A+ 
Sbjct  59   ICKAKRGGFKDTYPEDLLTPVLKAVLDKTGINPAEIGDVVVGTVLGPGSQRAIECRTASL  118

Query  420  YAGFPETVPVRTVNRQCSSGLQavadvaaaikaGFYDIGIGAGLESMTVN  569
             AG PETVPVRTVNRQCSSGLQAVADVAAAIKAGFYDIGIGAGLESM+VN
Sbjct  119  LAGIPETVPVRTVNRQCSSGLQAVADVAAAIKAGFYDIGIGAGLESMSVN  168



>gb|EYU17978.1| hypothetical protein MIMGU_mgv1a005895mg [Erythranthe guttata]
Length=466

 Score =   243 bits (619),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 127/170 (75%), Positives = 145/170 (85%), Gaps = 1/170 (1%)
 Frame = +3

Query  60   AIERQRVLLQHLRPTNAASSHDSIESSVSASVCAAGDSAAYQRNSVYGDDIVIVAAYRTP  239
            A  RQ++LL HLRPT++   H   + S+S +VC AGDSAAY R   +GDDIVIVAAYRT 
Sbjct  4    AANRQKILLDHLRPTSSVP-HLISQPSLSRAVCLAGDSAAYHRTPAFGDDIVIVAAYRTA  62

Query  240  LCKSKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTVLAPGSIRASECRMAAF  419
            LCKS RGGFKDT PDDLLA+VLKALI++TNLNP+EVGDI+VGTVLAPGS+RA ECRMAA 
Sbjct  63   LCKSTRGGFKDTLPDDLLAAVLKALIDRTNLNPAEVGDIVVGTVLAPGSLRAIECRMAAL  122

Query  420  YAGFPETVPVRTVNRQCSSGLQavadvaaaikaGFYDIGIGAGLESMTVN  569
            YAGFP+ VP+RTVNRQCSSGLQAVADVAA IKAG+YDIGI AGLESMT +
Sbjct  123  YAGFPDKVPIRTVNRQCSSGLQAVADVAAFIKAGYYDIGIAAGLESMTAD  172



>ref|XP_010109695.1| 3-ketoacyl-CoA thiolase 2 [Morus notabilis]
 gb|EXC24165.1| 3-ketoacyl-CoA thiolase 2 [Morus notabilis]
Length=452

 Score =   242 bits (617),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 127/170 (75%), Positives = 149/170 (88%), Gaps = 3/170 (2%)
 Frame = +3

Query  60   AIERQRVLLQHLRPTNAASSHDSIESSVSASVCAAGDSAAYQRNSVYGDDIVIVAAYRTP  239
            A ERQRVLLQHL PT   SS  +  +S+SAS+CAAG S AYQR + +GDDIVIVAA RT 
Sbjct  4    AAERQRVLLQHLSPT---SSQTNDTASLSASICAAGQSGAYQRTAAFGDDIVIVAACRTA  60

Query  240  LCKSKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTVLAPGSIRASECRMAAF  419
            +CK+KRGGFKDT  DDLLA+VLKA+IE+TNL+PSE+GDI+VGTVLAPGS+RA ECRMAA 
Sbjct  61   ICKAKRGGFKDTPVDDLLAAVLKAVIERTNLDPSEIGDIVVGTVLAPGSVRAIECRMAAI  120

Query  420  YAGFPETVPVRTVNRQCSSGLQavadvaaaikaGFYDIGIGAGLESMTVN  569
            YAG P+TVPVRTVNRQCSSGLQAVAD+AA+IKAG+YDIGIGAG+E MT++
Sbjct  121  YAGIPDTVPVRTVNRQCSSGLQAVADIAASIKAGYYDIGIGAGVECMTID  170



>ref|XP_008380600.1| PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxisomal [Malus domestica]
Length=459

 Score =   242 bits (617),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 137/170 (81%), Positives = 153/170 (90%), Gaps = 5/170 (3%)
 Frame = +3

Query  60   AIERQRVLLQHLRPTNAASSHDSIESSVSASVCAAGDSAAYQRNSVYGDDIVIVAAYRTP  239
            AI RQRVLL HLRP +A SS     SS+SAS CAAGDSAAY R  V+GDD+VIVAAYRTP
Sbjct  4    AINRQRVLLDHLRPPSADSS-----SSLSASACAAGDSAAYARTHVFGDDVVIVAAYRTP  58

Query  240  LCKSKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTVLAPGSIRASECRMAAF  419
            +CK+KRGGFKDT+ DDLLA VLKA++E+TN+NPSE+GDI+VGTVLAPGS RASECRMAAF
Sbjct  59   ICKAKRGGFKDTHADDLLAPVLKAVVERTNVNPSEIGDIVVGTVLAPGSQRASECRMAAF  118

Query  420  YAGFPETVPVRTVNRQCSSGLQavadvaaaikaGFYDIGIGAGLESMTVN  569
            YAGFPETVP+RTVNRQCSSGLQAVADVAA+I+AGFYDIGIGAGLESMT N
Sbjct  119  YAGFPETVPIRTVNRQCSSGLQAVADVAASIRAGFYDIGIGAGLESMTAN  168



>ref|XP_010475137.1| PREDICTED: 3-ketoacyl-CoA thiolase 1, peroxisomal-like [Camelina 
sativa]
Length=446

 Score =   241 bits (615),  Expect = 5e-74, Method: Compositional matrix adjust.
 Identities = 129/169 (76%), Positives = 146/169 (86%), Gaps = 13/169 (8%)
 Frame = +3

Query  63   IERQRVLLQHLRPTNAASSHDSIESSVSASVCAAGDSAAYQRNSVYGDDIVIVAAYRTPL  242
            +ERQRVLLQHL+P++A         S+S S C A    +Y+R S+YGDD+VIVAA RT L
Sbjct  5    MERQRVLLQHLQPSDA---------SLSPSACLA----SYERTSLYGDDVVIVAAQRTAL  51

Query  243  CKSKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTVLAPGSIRASECRMAAFY  422
            CK+KRG FKDTYP+DLLASVL+ALIEKTN+NPSEVGDI+VGTVL PGS RA+ECRMAAFY
Sbjct  52   CKAKRGSFKDTYPEDLLASVLRALIEKTNVNPSEVGDIVVGTVLGPGSQRATECRMAAFY  111

Query  423  AGFPETVPVRTVNRQCSSGLQavadvaaaikaGFYDIGIGAGLESMTVN  569
            AGFP+TVP+RTVNRQCSSGLQAVADVAAAIKAGFYDIGIGAGLESMT N
Sbjct  112  AGFPQTVPIRTVNRQCSSGLQAVADVAAAIKAGFYDIGIGAGLESMTTN  160



>ref|XP_004497755.1| PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxisomal-like [Cicer 
arietinum]
Length=458

 Score =   241 bits (615),  Expect = 6e-74, Method: Compositional matrix adjust.
 Identities = 135/170 (79%), Positives = 150/170 (88%), Gaps = 5/170 (3%)
 Frame = +3

Query  60   AIERQRVLLQHLRPTNAASSHDSIESSVSASVCAAGDSAAYQRNSVYGDDIVIVAAYRTP  239
            AI RQ+VLLQHL P+ ++SS     +S+SAS C AGDSAAY R + +GDD+VIVAAYRT 
Sbjct  4    AINRQKVLLQHLNPSQSSSS-----TSLSASACLAGDSAAYHRTASFGDDVVIVAAYRTA  58

Query  240  LCKSKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTVLAPGSIRASECRMAAF  419
            LCK+KRGGFKDT+ DDLLA VLKA+IEKTNLNPSEVGDI+VG+VL  GS RASECRMAAF
Sbjct  59   LCKAKRGGFKDTHADDLLAPVLKAVIEKTNLNPSEVGDIVVGSVLGGGSQRASECRMAAF  118

Query  420  YAGFPETVPVRTVNRQCSSGLQavadvaaaikaGFYDIGIGAGLESMTVN  569
            YAGFPETVPVRTVNRQCSSGLQAVADVAAAI+AGFYDIGIGAGLESMT N
Sbjct  119  YAGFPETVPVRTVNRQCSSGLQAVADVAAAIRAGFYDIGIGAGLESMTTN  168



>dbj|BAJ85217.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ87964.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=401

 Score =   239 bits (610),  Expect = 8e-74, Method: Compositional matrix adjust.
 Identities = 127/170 (75%), Positives = 144/170 (85%), Gaps = 3/170 (2%)
 Frame = +3

Query  60   AIERQRVLLQHLRPTNAASSHDSIESSVSASVCAAGDSAAYQRNSVYGDDIVIVAAYRTP  239
            A++RQR+LL+HL P   A+  +   S+VSASVCAAGDSAAY R   + DDIVIVAAYRT 
Sbjct  4    ALDRQRILLRHLEP---AAGANPTASAVSASVCAAGDSAAYHRGPCFADDIVIVAAYRTA  60

Query  240  LCKSKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTVLAPGSIRASECRMAAF  419
            +CK+KRG FKDT P+DLL  V KAL+EKT LNPSEVGDI+VGTVLAPGS RA ECRMAA 
Sbjct  61   ICKAKRGSFKDTLPEDLLVPVFKALVEKTKLNPSEVGDIVVGTVLAPGSQRAIECRMAAL  120

Query  420  YAGFPETVPVRTVNRQCSSGLQavadvaaaikaGFYDIGIGAGLESMTVN  569
            YAGFP+TVP++TVNRQCSSGLQAVADVAAAIKAG YDIGI AG+ESMTVN
Sbjct  121  YAGFPDTVPLKTVNRQCSSGLQAVADVAAAIKAGMYDIGIAAGVESMTVN  170



>ref|XP_010684942.1| PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxisomal [Beta vulgaris 
subsp. vulgaris]
Length=453

 Score =   240 bits (612),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 125/170 (74%), Positives = 145/170 (85%), Gaps = 4/170 (2%)
 Frame = +3

Query  60   AIERQRVLLQHLRPTNAASSHDSIESSVSASVCAAGDSAAYQRNSVYGDDIVIVAAYRTP  239
            A+ RQ+VLLQHL PT +   H+    + S SVC++GD   Y RN+ +GDD+VIVAA RTP
Sbjct  4    ALNRQKVLLQHLNPT-STRPHNV---TFSTSVCSSGDDGTYHRNAAFGDDVVIVAACRTP  59

Query  240  LCKSKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTVLAPGSIRASECRMAAF  419
            +CK+KRGGFKDT  DDLLA VLKALI+KTN+ PSEVGDI+VGTVLAPGS RA ECRMAAF
Sbjct  60   ICKAKRGGFKDTLADDLLAPVLKALIQKTNVKPSEVGDIVVGTVLAPGSARAMECRMAAF  119

Query  420  YAGFPETVPVRTVNRQCSSGLQavadvaaaikaGFYDIGIGAGLESMTVN  569
            YAGFP+TVP+RTVNRQCSSGLQAVADVAA IKAGFYDIGIGAG+ESMT++
Sbjct  120  YAGFPDTVPIRTVNRQCSSGLQAVADVAACIKAGFYDIGIGAGVESMTID  169



>gb|ABR17647.1| unknown [Picea sitchensis]
Length=462

 Score =   240 bits (612),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 131/168 (78%), Positives = 145/168 (86%), Gaps = 6/168 (4%)
 Frame = +3

Query  69   RQRVLLQHLRPTN-AASSHDSIESSVSASVCAAGDSAAYQRNSVYGDDIVIVAAYRTPLC  245
            RQ+V L HLRP +   +S D +     ASVCAAGDSAAY+R + +GDD+VIVAAYRTP+C
Sbjct  9    RQQVSLDHLRPAHFPKASKDLV-----ASVCAAGDSAAYERAAEFGDDVVIVAAYRTPIC  63

Query  246  KSKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTVLAPGSIRASECRMAAFYA  425
            K+KRGGFKDT  DDLLA VLKALI+KT LNP EVGDI+VGTVLAPGS RA ECRMAAFYA
Sbjct  64   KAKRGGFKDTLADDLLAPVLKALIDKTGLNPVEVGDIVVGTVLAPGSQRAIECRMAAFYA  123

Query  426  GFPETVPVRTVNRQCSSGLQavadvaaaikaGFYDIGIGAGLESMTVN  569
            GFPETVPVRTVNRQCSSGLQAVADVAAAIKAGFYDIGIGAG+ESM+V 
Sbjct  124  GFPETVPVRTVNRQCSSGLQAVADVAAAIKAGFYDIGIGAGVESMSVT  171



>ref|XP_002521123.1| 3-ketoacyl-CoA thiolase B, putative [Ricinus communis]
 gb|EEF41274.1| 3-ketoacyl-CoA thiolase B, putative [Ricinus communis]
Length=467

 Score =   240 bits (612),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 128/172 (74%), Positives = 151/172 (88%), Gaps = 2/172 (1%)
 Frame = +3

Query  60   AIERQRVLLQHLRPTNAASSHDSIESSV--SASVCAAGDSAAYQRNSVYGDDIVIVAAYR  233
            A+ RQ++LL HL+P++  SS    + SV  S S+CAAGDS AY R + + DD+VIVAAYR
Sbjct  4    AVNRQKILLGHLQPSSPLSSLSQTQESVRLSTSICAAGDSTAYHRTAAFNDDVVIVAAYR  63

Query  234  TPLCKSKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTVLAPGSIRASECRMA  413
            T +CKSKR GFKDT+PDDLL SVLKALIEKTN+NP+EVGDI+VGTVLAPGS+RA+ECRMA
Sbjct  64   TAICKSKRRGFKDTHPDDLLGSVLKALIEKTNVNPNEVGDIVVGTVLAPGSVRATECRMA  123

Query  414  AFYAGFPETVPVRTVNRQCSSGLQavadvaaaikaGFYDIGIGAGLESMTVN  569
            AF+AGFPETVP+RTVNRQCSSGLQAVADVAA+IKAGFYDIGIGAGLE MT++
Sbjct  124  AFFAGFPETVPIRTVNRQCSSGLQAVADVAASIKAGFYDIGIGAGLECMTLD  175



>ref|XP_007145410.1| hypothetical protein PHAVU_007G236600g [Phaseolus vulgaris]
 gb|ESW17404.1| hypothetical protein PHAVU_007G236600g [Phaseolus vulgaris]
Length=458

 Score =   239 bits (609),  Expect = 6e-73, Method: Compositional matrix adjust.
 Identities = 136/170 (80%), Positives = 151/170 (89%), Gaps = 5/170 (3%)
 Frame = +3

Query  60   AIERQRVLLQHLRPTNAASSHDSIESSVSASVCAAGDSAAYQRNSVYGDDIVIVAAYRTP  239
            AI RQ++LL HL P+++  S     SS+SAS CAAGDSAAY R S +GDD+VIVAAYRT 
Sbjct  4    AINRQKILLHHLNPSSSNHS-----SSLSASACAAGDSAAYHRTSTFGDDVVIVAAYRTA  58

Query  240  LCKSKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTVLAPGSIRASECRMAAF  419
            LCKSKRGGFKDT+ DDLLA VLKA+IE+TN+NPSEVGDIIVGTVLAPGS RASECRM+AF
Sbjct  59   LCKSKRGGFKDTHADDLLAPVLKAVIERTNVNPSEVGDIIVGTVLAPGSQRASECRMSAF  118

Query  420  YAGFPETVPVRTVNRQCSSGLQavadvaaaikaGFYDIGIGAGLESMTVN  569
            YAGFPETVP+RTVNRQCSSGLQAVADVAAAI+AGFYDIGIGAGLESMT N
Sbjct  119  YAGFPETVPIRTVNRQCSSGLQAVADVAAAIRAGFYDIGIGAGLESMTAN  168



>gb|EMT31542.1| 3-ketoacyl-CoA thiolase 2, peroxisomal [Aegilops tauschii]
Length=459

 Score =   238 bits (608),  Expect = 7e-73, Method: Compositional matrix adjust.
 Identities = 127/170 (75%), Positives = 149/170 (88%), Gaps = 6/170 (4%)
 Frame = +3

Query  60   AIERQRVLLQHLRPTNAASSHDSIESSVSASVCAAGDSAAYQRNSVYGDDIVIVAAYRTP  239
            AI+RQRVLL HL P+  ASS    ++ +SAS CAAGDSAAYQR+S +GDD+VIVAAYRTP
Sbjct  4    AIDRQRVLLAHLLPS--ASS----QTQLSASPCAAGDSAAYQRSSCFGDDVVIVAAYRTP  57

Query  240  LCKSKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTVLAPGSIRASECRMAAF  419
            +CK+KRGGFKDTYP+DLL  VLKA+++KT +NP+E+GD++VGTVL PGS RA ECR A+ 
Sbjct  58   ICKAKRGGFKDTYPEDLLTPVLKAVLDKTGINPAEIGDVVVGTVLGPGSQRAIECRTASL  117

Query  420  YAGFPETVPVRTVNRQCSSGLQavadvaaaikaGFYDIGIGAGLESMTVN  569
             AG PETVPVRTVNRQCSSGLQAVADVAAAIKAGFY+IGIGAGLESM+VN
Sbjct  118  LAGIPETVPVRTVNRQCSSGLQAVADVAAAIKAGFYEIGIGAGLESMSVN  167



>dbj|BAI66423.1| 3-ketoacyl-CoA thiolase-like protein [Triticum aestivum]
Length=459

 Score =   238 bits (608),  Expect = 7e-73, Method: Compositional matrix adjust.
 Identities = 127/170 (75%), Positives = 149/170 (88%), Gaps = 6/170 (4%)
 Frame = +3

Query  60   AIERQRVLLQHLRPTNAASSHDSIESSVSASVCAAGDSAAYQRNSVYGDDIVIVAAYRTP  239
            AI+RQRVLL HL P+  ASS    ++ +SAS CAAGDSAAYQR+S +GDD+VIVAAYRTP
Sbjct  4    AIDRQRVLLAHLLPS--ASS----QTQLSASPCAAGDSAAYQRSSCFGDDVVIVAAYRTP  57

Query  240  LCKSKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTVLAPGSIRASECRMAAF  419
            +CK+KRGGFKDTYP+DLL  VLKA+++KT +NP+E+GD++VGTVL PGS RA ECR A+ 
Sbjct  58   ICKAKRGGFKDTYPEDLLTPVLKAVLDKTGINPAEIGDVVVGTVLGPGSQRAIECRTASL  117

Query  420  YAGFPETVPVRTVNRQCSSGLQavadvaaaikaGFYDIGIGAGLESMTVN  569
             AG PETVPVRTVNRQCSSGLQAVADVAAAIKAGFY+IGIGAGLESM+VN
Sbjct  118  LAGIPETVPVRTVNRQCSSGLQAVADVAAAIKAGFYEIGIGAGLESMSVN  167



>pdb|2WU9|A Chain A, Crystal Structure Of Peroxisomal Kat2 From Arabidopsis 
Thaliana
 pdb|2WU9|B Chain B, Crystal Structure Of Peroxisomal Kat2 From Arabidopsis 
Thaliana
Length=442

 Score =   238 bits (606),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 125/136 (92%), Positives = 130/136 (96%), Gaps = 0/136 (0%)
 Frame = +3

Query  162  AGDSAAYQRNSVYGDDIVIVAAYRTPLCKSKRGGFKDTYPDDLLASVLKALIEKTNLNPS  341
            AGDSAAYQR S+YGDD+VIVAA+RTPLCKSKRG FKDTYPDDLLA VL+ALIEKTNLNPS
Sbjct  16   AGDSAAYQRTSLYGDDVVIVAAHRTPLCKSKRGNFKDTYPDDLLAPVLRALIEKTNLNPS  75

Query  342  EVGDIIVGTVLAPGSIRASECRMAAFYAGFPETVPVRTVNRQCSSGLQavadvaaaikaG  521
            EVGDI+VGTVLAPGS RASECRMAAFYAGFPETV VRTVNRQCSSGLQAVADVAAAIKAG
Sbjct  76   EVGDIVVGTVLAPGSQRASECRMAAFYAGFPETVAVRTVNRQCSSGLQAVADVAAAIKAG  135

Query  522  FYDIGIGAGLESMTVN  569
            FYDIGIGAGLESMT N
Sbjct  136  FYDIGIGAGLESMTTN  151



>ref|XP_004954382.1| PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxisomal-like [Setaria 
italica]
Length=461

 Score =   238 bits (607),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 127/170 (75%), Positives = 148/170 (87%), Gaps = 3/170 (2%)
 Frame = +3

Query  60   AIERQRVLLQHLRPTNAASSHDSIESSVSASVCAAGDSAAYQRNSVYGDDIVIVAAYRTP  239
            AI+RQRVLL H      +SS  S +  ++AS CAAGDSAAYQR S +GDD+V+VAAYRTP
Sbjct  4    AIDRQRVLLAH---LLPSSSSPSSQPQLAASECAAGDSAAYQRTSSFGDDVVVVAAYRTP  60

Query  240  LCKSKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTVLAPGSIRASECRMAAF  419
            +CK+KRGGFKDTYP+DLL  VLKA+++ T +NP ++GDI+VGTVL PGS RA+ECRMAAF
Sbjct  61   ICKAKRGGFKDTYPEDLLTVVLKAVLDNTKINPGDIGDIVVGTVLGPGSQRANECRMAAF  120

Query  420  YAGFPETVPVRTVNRQCSSGLQavadvaaaikaGFYDIGIGAGLESMTVN  569
            YAGFPETVPVRTVNRQCSSGLQAVADVAAAIKAGFYDIGIGAGLESM++N
Sbjct  121  YAGFPETVPVRTVNRQCSSGLQAVADVAAAIKAGFYDIGIGAGLESMSIN  170



>gb|KJB10129.1| hypothetical protein B456_001G185200 [Gossypium raimondii]
Length=371

 Score =   236 bits (601),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 125/170 (74%), Positives = 146/170 (86%), Gaps = 0/170 (0%)
 Frame = +3

Query  60   AIERQRVLLQHLRPTNAASSHDSIESSVSASVCAAGDSAAYQRNSVYGDDIVIVAAYRTP  239
            A+ RQRVLL HLRP++++SS     +++  S CAAGDSAAY R + +GDD+VIVAA RT 
Sbjct  4    ALNRQRVLLHHLRPSSSSSSSHESAATLFPSNCAAGDSAAYHRTAAFGDDVVIVAACRTA  63

Query  240  LCKSKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTVLAPGSIRASECRMAAF  419
            +CK+KRGGFKDT  DDLLA VLKALI++T L+PSEV DI+VGTVLAPGS R  ECRMAAF
Sbjct  64   ICKAKRGGFKDTLADDLLAPVLKALIDRTKLDPSEVSDIVVGTVLAPGSQRGIECRMAAF  123

Query  420  YAGFPETVPVRTVNRQCSSGLQavadvaaaikaGFYDIGIGAGLESMTVN  569
            YAGFP+TVP+RTVNRQCSSGLQAVADVAA+IKAGFYDIGIGAGLESMT +
Sbjct  124  YAGFPDTVPIRTVNRQCSSGLQAVADVAASIKAGFYDIGIGAGLESMTTD  173



>ref|XP_010484150.1| PREDICTED: 3-ketoacyl-CoA thiolase 1, peroxisomal-like isoform 
X1 [Camelina sativa]
Length=446

 Score =   237 bits (604),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 128/170 (75%), Positives = 145/170 (85%), Gaps = 13/170 (8%)
 Frame = +3

Query  60   AIERQRVLLQHLRPTNAASSHDSIESSVSASVCAAGDSAAYQRNSVYGDDIVIVAAYRTP  239
            A+ERQRVLLQHL+P++A         S+S S C A    +Y+R S+YGDD+VIVAA RT 
Sbjct  4    AMERQRVLLQHLQPSDA---------SLSPSACLA----SYERTSLYGDDVVIVAAQRTA  50

Query  240  LCKSKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTVLAPGSIRASECRMAAF  419
            LCK+KRG FKDTYPDDLLASVL+A+I KTN+NPSEVGDI+VGTVL  GS RA+ECRMAAF
Sbjct  51   LCKAKRGSFKDTYPDDLLASVLRAMIVKTNVNPSEVGDIVVGTVLGTGSQRATECRMAAF  110

Query  420  YAGFPETVPVRTVNRQCSSGLQavadvaaaikaGFYDIGIGAGLESMTVN  569
            YAGFP+TVP+RTVNRQCSSGLQAVADVAAAIKAGFYDIGIGAGLESMT N
Sbjct  111  YAGFPQTVPIRTVNRQCSSGLQAVADVAAAIKAGFYDIGIGAGLESMTTN  160



>ref|XP_010484155.1| PREDICTED: 3-ketoacyl-CoA thiolase 1, peroxisomal-like isoform 
X2 [Camelina sativa]
Length=440

 Score =   237 bits (604),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 128/170 (75%), Positives = 145/170 (85%), Gaps = 13/170 (8%)
 Frame = +3

Query  60   AIERQRVLLQHLRPTNAASSHDSIESSVSASVCAAGDSAAYQRNSVYGDDIVIVAAYRTP  239
            A+ERQRVLLQHL+P++A         S+S S C A    +Y+R S+YGDD+VIVAA RT 
Sbjct  4    AMERQRVLLQHLQPSDA---------SLSPSACLA----SYERTSLYGDDVVIVAAQRTA  50

Query  240  LCKSKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTVLAPGSIRASECRMAAF  419
            LCK+KRG FKDTYPDDLLASVL+A+I KTN+NPSEVGDI+VGTVL  GS RA+ECRMAAF
Sbjct  51   LCKAKRGSFKDTYPDDLLASVLRAMIVKTNVNPSEVGDIVVGTVLGTGSQRATECRMAAF  110

Query  420  YAGFPETVPVRTVNRQCSSGLQavadvaaaikaGFYDIGIGAGLESMTVN  569
            YAGFP+TVP+RTVNRQCSSGLQAVADVAAAIKAGFYDIGIGAGLESMT N
Sbjct  111  YAGFPQTVPIRTVNRQCSSGLQAVADVAAAIKAGFYDIGIGAGLESMTTN  160



>ref|XP_001764272.1| predicted protein [Physcomitrella patens]
 gb|EDQ70826.1| predicted protein [Physcomitrella patens]
Length=460

 Score =   236 bits (601),  Expect = 9e-72, Method: Compositional matrix adjust.
 Identities = 119/167 (71%), Positives = 143/167 (86%), Gaps = 4/167 (2%)
 Frame = +3

Query  69   RQRVLLQHLRPTNAASSHDSIESSVSASVCAAGDSAAYQRNSVYGDDIVIVAAYRTPLCK  248
            RQ++LL HL+P     +     ++V  S+C+A DSA Y R + + DD+VIVAAYRTP+CK
Sbjct  7    RQQLLLDHLKPETGRRAA----ANVVTSICSANDSAPYARTTDFLDDVVIVAAYRTPICK  62

Query  249  SKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTVLAPGSIRASECRMAAFYAG  428
            +KRGGFKDTYPDDLLA VL+A++EKT +NP+E+GDI++GTVLAPG+ RA+ECRMAAFYAG
Sbjct  63   AKRGGFKDTYPDDLLAPVLRAVVEKTGVNPAEIGDIVIGTVLAPGAQRANECRMAAFYAG  122

Query  429  FPETVPVRTVNRQCSSGLQavadvaaaikaGFYDIGIGAGLESMTVN  569
            FPETVP+RTVNRQCSSGLQAVADV AAIKAGFYDIGIG GLESMTVN
Sbjct  123  FPETVPIRTVNRQCSSGLQAVADVVAAIKAGFYDIGIGGGLESMTVN  169



>pdb|2C7Y|A Chain A, Plant Enzyme
 pdb|2C7Y|B Chain B, Plant Enzyme
 pdb|2C7Z|A Chain A, Plant Enzyme Crystal Form Ii
Length=404

 Score =   234 bits (596),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 123/134 (92%), Positives = 128/134 (96%), Gaps = 0/134 (0%)
 Frame = +3

Query  168  DSAAYQRNSVYGDDIVIVAAYRTPLCKSKRGGFKDTYPDDLLASVLKALIEKTNLNPSEV  347
            DSAAYQR S+YGDD+VIVAA+RTPLCKSKRG FKDTYPDDLLA VL+ALIEKTNLNPSEV
Sbjct  1    DSAAYQRTSLYGDDVVIVAAHRTPLCKSKRGNFKDTYPDDLLAPVLRALIEKTNLNPSEV  60

Query  348  GDIIVGTVLAPGSIRASECRMAAFYAGFPETVPVRTVNRQCSSGLQavadvaaaikaGFY  527
            GDI+VGTVLAPGS RASECRMAAFYAGFPETV VRTVNRQCSSGLQAVADVAAAIKAGFY
Sbjct  61   GDIVVGTVLAPGSQRASECRMAAFYAGFPETVAVRTVNRQCSSGLQAVADVAAAIKAGFY  120

Query  528  DIGIGAGLESMTVN  569
            DIGIGAGLESMT N
Sbjct  121  DIGIGAGLESMTTN  134



>gb|KJB10128.1| hypothetical protein B456_001G185200 [Gossypium raimondii]
Length=465

 Score =   235 bits (599),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 125/170 (74%), Positives = 146/170 (86%), Gaps = 0/170 (0%)
 Frame = +3

Query  60   AIERQRVLLQHLRPTNAASSHDSIESSVSASVCAAGDSAAYQRNSVYGDDIVIVAAYRTP  239
            A+ RQRVLL HLRP++++SS     +++  S CAAGDSAAY R + +GDD+VIVAA RT 
Sbjct  4    ALNRQRVLLHHLRPSSSSSSSHESAATLFPSNCAAGDSAAYHRTAAFGDDVVIVAACRTA  63

Query  240  LCKSKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTVLAPGSIRASECRMAAF  419
            +CK+KRGGFKDT  DDLLA VLKALI++T L+PSEV DI+VGTVLAPGS R  ECRMAAF
Sbjct  64   ICKAKRGGFKDTLADDLLAPVLKALIDRTKLDPSEVSDIVVGTVLAPGSQRGIECRMAAF  123

Query  420  YAGFPETVPVRTVNRQCSSGLQavadvaaaikaGFYDIGIGAGLESMTVN  569
            YAGFP+TVP+RTVNRQCSSGLQAVADVAA+IKAGFYDIGIGAGLESMT +
Sbjct  124  YAGFPDTVPIRTVNRQCSSGLQAVADVAASIKAGFYDIGIGAGLESMTTD  173



>gb|AAM61609.1| putative acetyl-CoA acyltransferase [Arabidopsis thaliana]
Length=443

 Score =   234 bits (596),  Expect = 4e-71, Method: Compositional matrix adjust.
 Identities = 131/170 (77%), Positives = 149/170 (88%), Gaps = 10/170 (6%)
 Frame = +3

Query  60   AIERQRVLLQHLRPTNAASSHDSIESSVSASVCAAGDSAAYQRNSVYGDDIVIVAAYRTP  239
            A ERQR+LL+HL+P++++ +      S+SAS C + DSAAYQ    YGDD+VIVAA RT 
Sbjct  4    ATERQRILLRHLQPSSSSDA------SLSASACLSKDSAAYQ----YGDDVVIVAAQRTA  53

Query  240  LCKSKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTVLAPGSIRASECRMAAF  419
            LCK+KRG FKDT+PD+LLASVL+ALIEKTN+NPSEVGDI+VGTVL PGS RASECRMAAF
Sbjct  54   LCKAKRGSFKDTFPDELLASVLRALIEKTNVNPSEVGDIVVGTVLGPGSQRASECRMAAF  113

Query  420  YAGFPETVPVRTVNRQCSSGLQavadvaaaikaGFYDIGIGAGLESMTVN  569
            YAGFPETVP+RTVNRQCSSGLQAVADVAAAIKAGFYDIGIGAGLESMT N
Sbjct  114  YAGFPETVPIRTVNRQCSSGLQAVADVAAAIKAGFYDIGIGAGLESMTTN  163



>ref|NP_171965.1| 3-ketoacyl-CoA thiolase 1 [Arabidopsis thaliana]
 sp|Q8LF48.2|THIK1_ARATH RecName: Full=3-ketoacyl-CoA thiolase 1, peroxisomal; AltName: 
Full=Acetyl-CoA acyltransferase 1; AltName: Full=Beta-ketothiolase 
1; AltName: Full=Peroxisomal 3-oxoacyl-CoA thiolase 
1; Flags: Precursor [Arabidopsis thaliana]
 gb|AAM20592.1| putative acetyl-CoA acyltransferase [Arabidopsis thaliana]
 gb|AAO30078.1| putative acetyl-CoA acyltransferase [Arabidopsis thaliana]
 gb|AEE27736.1| 3-ketoacyl-CoA thiolase 1 [Arabidopsis thaliana]
Length=443

 Score =   233 bits (595),  Expect = 4e-71, Method: Compositional matrix adjust.
 Identities = 131/170 (77%), Positives = 149/170 (88%), Gaps = 10/170 (6%)
 Frame = +3

Query  60   AIERQRVLLQHLRPTNAASSHDSIESSVSASVCAAGDSAAYQRNSVYGDDIVIVAAYRTP  239
            A ERQR+LL+HL+P++++ +      S+SAS C + DSAAYQ    YGDD+VIVAA RT 
Sbjct  4    ATERQRILLRHLQPSSSSDA------SLSASACLSKDSAAYQ----YGDDVVIVAAQRTA  53

Query  240  LCKSKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTVLAPGSIRASECRMAAF  419
            LCK+KRG FKDT+PD+LLASVL+ALIEKTN+NPSEVGDI+VGTVL PGS RASECRMAAF
Sbjct  54   LCKAKRGSFKDTFPDELLASVLRALIEKTNVNPSEVGDIVVGTVLGPGSQRASECRMAAF  113

Query  420  YAGFPETVPVRTVNRQCSSGLQavadvaaaikaGFYDIGIGAGLESMTVN  569
            YAGFPETVP+RTVNRQCSSGLQAVADVAAAIKAGFYDIGIGAGLESMT N
Sbjct  114  YAGFPETVPIRTVNRQCSSGLQAVADVAAAIKAGFYDIGIGAGLESMTTN  163



>emb|CDX86611.1| BnaC08g00920D [Brassica napus]
Length=451

 Score =   233 bits (595),  Expect = 6e-71, Method: Compositional matrix adjust.
 Identities = 134/170 (79%), Positives = 147/170 (86%), Gaps = 3/170 (2%)
 Frame = +3

Query  60   AIERQRVLLQHLRPTNAASSHDSIESSVSASVCAAGDSAAYQRNSVYGDDIVIVAAYRTP  239
            AIERQRVLL HLRP   +SS     SS+S S C AGDSAAYQR S+YGDD+VIVAA RT 
Sbjct  4    AIERQRVLLHHLRPPPPSSSQ---ASSLSVSACLAGDSAAYQRTSLYGDDVVIVAAQRTA  60

Query  240  LCKSKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTVLAPGSIRASECRMAAF  419
            LCK+KRG FKDTYPD+LLA VL+A+IEKT LNPSEVGDI+VGTVL  GS +A+E RMAAF
Sbjct  61   LCKAKRGSFKDTYPDELLAPVLRAVIEKTKLNPSEVGDIVVGTVLGSGSQKATEFRMAAF  120

Query  420  YAGFPETVPVRTVNRQCSSGLQavadvaaaikaGFYDIGIGAGLESMTVN  569
            YAGFPETVP+RTVNRQCSSGLQAVADVAAAIKAGFYDIGIGAGLESMT +
Sbjct  121  YAGFPETVPIRTVNRQCSSGLQAVADVAAAIKAGFYDIGIGAGLESMTTS  170



>ref|XP_003604976.1| 3-ketoacyl-CoA thiolase 2, peroxisomal [Medicago truncatula]
 gb|AES87173.1| 3-ketoacyl-CoA thiolase 2, peroxisomal-like protein [Medicago 
truncatula]
Length=435

 Score =   233 bits (593),  Expect = 6e-71, Method: Compositional matrix adjust.
 Identities = 125/168 (74%), Positives = 142/168 (85%), Gaps = 8/168 (5%)
 Frame = +3

Query  60   AIERQRVLLQHLRPTNAASSHDSIESSVSASVCAAGDSAAYQRNSVYGDDIVIVAAYRTP  239
            A+ERQRVLLQHL P +  SSH S  + +SAS+C+AG +   +      +D+VIVAAYRT 
Sbjct  4    AVERQRVLLQHLNPNSVTSSHHS--THLSASLCSAGQTGGSE------NDVVIVAAYRTA  55

Query  240  LCKSKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTVLAPGSIRASECRMAAF  419
            +CK+KRGGFKDT PDDLLASVLKA+IEKTN+ PSEVGDI+VGTVL PGS RA ECRMAAF
Sbjct  56   ICKAKRGGFKDTLPDDLLASVLKAVIEKTNVEPSEVGDIVVGTVLGPGSERAIECRMAAF  115

Query  420  YAGFPETVPVRTVNRQCSSGLQavadvaaaikaGFYDIGIGAGLESMT  563
            YAGFP+TVP+RTVNRQCSSGLQAVADVAA IKAGFYDIGIGAGLE MT
Sbjct  116  YAGFPDTVPLRTVNRQCSSGLQAVADVAAYIKAGFYDIGIGAGLECMT  163



>ref|XP_006368897.1| hypothetical protein POPTR_0001s14290g [Populus trichocarpa]
 gb|ERP65466.1| hypothetical protein POPTR_0001s14290g [Populus trichocarpa]
Length=455

 Score =   233 bits (593),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 130/170 (76%), Positives = 146/170 (86%), Gaps = 9/170 (5%)
 Frame = +3

Query  60   AIERQRVLLQHLRPTNAASSHDSIESSVSASVCAAGDSAAYQRNSVYGDDIVIVAAYRTP  239
            A  RQRVLL HLR   ++SS+++ ESS+SAS C AG SAA       GDD+V+VAAYRTP
Sbjct  4    ASNRQRVLLGHLR---SSSSYNNHESSLSASACLAGGSAAC------GDDVVVVAAYRTP  54

Query  240  LCKSKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTVLAPGSIRASECRMAAF  419
            LCKSKRGGFKDT+ DDLLA VLKALIEKTNL+  EVGDI+VG+ LAPGS RASECRMAA 
Sbjct  55   LCKSKRGGFKDTHADDLLAPVLKALIEKTNLDAREVGDIVVGSSLAPGSQRASECRMAAL  114

Query  420  YAGFPETVPVRTVNRQCSSGLQavadvaaaikaGFYDIGIGAGLESMTVN  569
            YAGFPETVP+RTVNR+CSSGLQAVADVAA+IKAGFY+IGIGAGLESMTVN
Sbjct  115  YAGFPETVPIRTVNRKCSSGLQAVADVAASIKAGFYEIGIGAGLESMTVN  164



>gb|KCW50169.1| hypothetical protein EUGRSUZ_K03601 [Eucalyptus grandis]
Length=406

 Score =   231 bits (589),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 131/172 (76%), Positives = 153/172 (89%), Gaps = 2/172 (1%)
 Frame = +3

Query  60   AIERQRVLLQHLRPTNAASS--HDSIESSVSASVCAAGDSAAYQRNSVYGDDIVIVAAYR  233
            A++RQRVLL+HL+P+ ++ S  H    + VSAS CAAGD AAYQR + +GDD+VIVAAYR
Sbjct  4    ALDRQRVLLRHLQPSPSSGSPSHTPQSACVSASACAAGDLAAYQRTASFGDDVVIVAAYR  63

Query  234  TPLCKSKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTVLAPGSIRASECRMA  413
            T +CKS+RGGFKDT P+DLLA VL+A++EKTNLNP+EVGDI+VGTVLAPGS R  ECRMA
Sbjct  64   TAICKSRRGGFKDTLPEDLLAPVLRAVVEKTNLNPAEVGDIVVGTVLAPGSQRGIECRMA  123

Query  414  AFYAGFPETVPVRTVNRQCSSGLQavadvaaaikaGFYDIGIGAGLESMTVN  569
            AFYAGFPETVP+RTVNRQCSSGLQAVADVAA+IKAGFYDIGIGAGLESMTV+
Sbjct  124  AFYAGFPETVPLRTVNRQCSSGLQAVADVAASIKAGFYDIGIGAGLESMTVD  175



>ref|XP_009384048.1| PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxisomal-like [Musa 
acuminata subsp. malaccensis]
Length=451

 Score =   232 bits (592),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 126/170 (74%), Positives = 145/170 (85%), Gaps = 6/170 (4%)
 Frame = +3

Query  60   AIERQRVLLQHLRPTNAASSHDSIESSVSASVCAAGDSAAYQRNSVYGDDIVIVAAYRTP  239
            AIERQR+LL HLRP+ +A        S+S +VC+A  SA   R+S +GDD+VIVAA RT 
Sbjct  4    AIERQRILLHHLRPSPSADP-----PSISTAVCSASGSAK-DRSSCFGDDVVIVAACRTA  57

Query  240  LCKSKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTVLAPGSIRASECRMAAF  419
            LCK+++GGFKDTYPDDLLA VLKAL++KT LNPSEVGDIIVGTVLAPGS RA ECRM AF
Sbjct  58   LCKARKGGFKDTYPDDLLAPVLKALLDKTRLNPSEVGDIIVGTVLAPGSQRAIECRMGAF  117

Query  420  YAGFPETVPVRTVNRQCSSGLQavadvaaaikaGFYDIGIGAGLESMTVN  569
            YAGFP+TVP+RTVNRQCSSGLQAVAD+AAAIKAGFYD GIGAG+ESMTV+
Sbjct  118  YAGFPDTVPLRTVNRQCSSGLQAVADIAAAIKAGFYDFGIGAGVESMTVD  167



>gb|KCW50170.1| hypothetical protein EUGRSUZ_K03601 [Eucalyptus grandis]
Length=406

 Score =   231 bits (588),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 131/172 (76%), Positives = 153/172 (89%), Gaps = 2/172 (1%)
 Frame = +3

Query  60   AIERQRVLLQHLRPTNAASS--HDSIESSVSASVCAAGDSAAYQRNSVYGDDIVIVAAYR  233
            A++RQRVLL+HL+P+ ++ S  H    + VSAS CAAGD AAYQR + +GDD+VIVAAYR
Sbjct  4    ALDRQRVLLRHLQPSPSSGSPSHTPQSACVSASACAAGDLAAYQRTASFGDDVVIVAAYR  63

Query  234  TPLCKSKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTVLAPGSIRASECRMA  413
            T +CKS+RGGFKDT P+DLLA VL+A++EKTNLNP+EVGDI+VGTVLAPGS R  ECRMA
Sbjct  64   TAICKSRRGGFKDTLPEDLLAPVLRAVVEKTNLNPAEVGDIVVGTVLAPGSQRGIECRMA  123

Query  414  AFYAGFPETVPVRTVNRQCSSGLQavadvaaaikaGFYDIGIGAGLESMTVN  569
            AFYAGFPETVP+RTVNRQCSSGLQAVADVAA+IKAGFYDIGIGAGLESMTV+
Sbjct  124  AFYAGFPETVPLRTVNRQCSSGLQAVADVAASIKAGFYDIGIGAGLESMTVD  175



>ref|XP_011034453.1| PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxisomal-like [Populus 
euphratica]
Length=455

 Score =   232 bits (591),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 130/170 (76%), Positives = 146/170 (86%), Gaps = 9/170 (5%)
 Frame = +3

Query  60   AIERQRVLLQHLRPTNAASSHDSIESSVSASVCAAGDSAAYQRNSVYGDDIVIVAAYRTP  239
            A  RQRVLL HL   + +SS+++ ESS+SAS C AG SAA       GDD+V+VAAYRTP
Sbjct  4    ASNRQRVLLGHL---HYSSSYNNHESSLSASACLAGGSAAC------GDDVVVVAAYRTP  54

Query  240  LCKSKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTVLAPGSIRASECRMAAF  419
            LCKSKRGGFKDT+ DDLLASVLKALIEKTNL+  EVGDI+VG+ LAPGS RASECRMAA 
Sbjct  55   LCKSKRGGFKDTHADDLLASVLKALIEKTNLDAREVGDIVVGSSLAPGSQRASECRMAAL  114

Query  420  YAGFPETVPVRTVNRQCSSGLQavadvaaaikaGFYDIGIGAGLESMTVN  569
            YAGFPETVP+RTVNR+CSSGLQAVADVAA+IKAGFY+IGIGAGLESMTVN
Sbjct  115  YAGFPETVPIRTVNRKCSSGLQAVADVAASIKAGFYEIGIGAGLESMTVN  164



>ref|XP_011002176.1| PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxisomal-like [Populus 
euphratica]
Length=455

 Score =   231 bits (590),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 130/170 (76%), Positives = 146/170 (86%), Gaps = 9/170 (5%)
 Frame = +3

Query  60   AIERQRVLLQHLRPTNAASSHDSIESSVSASVCAAGDSAAYQRNSVYGDDIVIVAAYRTP  239
            A  RQRVLL HL   + +SS+++ ESS+SAS C AG SAA       GDD+V+VAAYRTP
Sbjct  4    ASNRQRVLLGHL---HYSSSYNNHESSLSASACLAGGSAAC------GDDVVVVAAYRTP  54

Query  240  LCKSKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTVLAPGSIRASECRMAAF  419
            LCKSKRGGFKDT+ DDLLASVLKALIEKTNL+  EVGDI+VG+ LAPGS RASECRMAA 
Sbjct  55   LCKSKRGGFKDTHADDLLASVLKALIEKTNLDAREVGDIVVGSSLAPGSQRASECRMAAL  114

Query  420  YAGFPETVPVRTVNRQCSSGLQavadvaaaikaGFYDIGIGAGLESMTVN  569
            YAGFPETVP+RTVNR+CSSGLQAVADVAA+IKAGFY+IGIGAGLESMTVN
Sbjct  115  YAGFPETVPIRTVNRKCSSGLQAVADVAASIKAGFYEIGIGAGLESMTVN  164



>gb|AFK40880.1| unknown [Medicago truncatula]
Length=435

 Score =   231 bits (588),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 124/168 (74%), Positives = 141/168 (84%), Gaps = 8/168 (5%)
 Frame = +3

Query  60   AIERQRVLLQHLRPTNAASSHDSIESSVSASVCAAGDSAAYQRNSVYGDDIVIVAAYRTP  239
            A+ERQRVLLQHL P +  SSH S  + +SAS+C+AG +   +      +D+VIVAAYRT 
Sbjct  4    AVERQRVLLQHLNPNSVTSSHHS--THLSASLCSAGQTGGSE------NDVVIVAAYRTA  55

Query  240  LCKSKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTVLAPGSIRASECRMAAF  419
            +CK+KRGGFKDT PDDLLASVLKA+IEKTN+ PSEVGDI+VGTVL PGS RA ECRMAAF
Sbjct  56   ICKAKRGGFKDTLPDDLLASVLKAVIEKTNVEPSEVGDIVVGTVLGPGSERAIECRMAAF  115

Query  420  YAGFPETVPVRTVNRQCSSGLQavadvaaaikaGFYDIGIGAGLESMT  563
            YAGFP+T P+RTVNRQCSSGLQAVADVAA IKAGFYDIGIGAGLE MT
Sbjct  116  YAGFPDTAPLRTVNRQCSSGLQAVADVAAYIKAGFYDIGIGAGLECMT  163



>ref|XP_009111084.1| PREDICTED: 3-ketoacyl-CoA thiolase 1, peroxisomal [Brassica rapa]
Length=451

 Score =   231 bits (589),  Expect = 4e-70, Method: Compositional matrix adjust.
 Identities = 131/170 (77%), Positives = 148/170 (87%), Gaps = 3/170 (2%)
 Frame = +3

Query  60   AIERQRVLLQHLRPTNAASSHDSIESSVSASVCAAGDSAAYQRNSVYGDDIVIVAAYRTP  239
            A+ERQRVLL HL+P  ++SS     SS+S S C AGDS AYQR S+YGDD+VIVAA RT 
Sbjct  4    AMERQRVLLHHLQPLPSSSSQ---ASSLSVSACLAGDSNAYQRTSLYGDDVVIVAAQRTA  60

Query  240  LCKSKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTVLAPGSIRASECRMAAF  419
            LCK+KRG FKDTYPD+LLASVL+A+IEKT L+PSEVGDI+VGTVL  GS +A+E RMAAF
Sbjct  61   LCKAKRGSFKDTYPDELLASVLRAVIEKTKLDPSEVGDIVVGTVLGSGSQKATEFRMAAF  120

Query  420  YAGFPETVPVRTVNRQCSSGLQavadvaaaikaGFYDIGIGAGLESMTVN  569
            YAGFPETVP+RTVNRQCSSGLQAVADVAAAIKAGFYDIGIGAGLESMT +
Sbjct  121  YAGFPETVPIRTVNRQCSSGLQAVADVAAAIKAGFYDIGIGAGLESMTTS  170



>ref|XP_006307516.1| hypothetical protein CARUB_v10009140mg [Capsella rubella]
 gb|EOA40414.1| hypothetical protein CARUB_v10009140mg [Capsella rubella]
Length=315

 Score =   226 bits (577),  Expect = 6e-70, Method: Compositional matrix adjust.
 Identities = 126/170 (74%), Positives = 144/170 (85%), Gaps = 10/170 (6%)
 Frame = +3

Query  60   AIERQRVLLQHLRPTNAASSHDSIESSVSASVCAAGDSAAYQRNSVYGDDIVIVAAYRTP  239
            A+ERQRVLLQHL+P++++ S  S  + +          AAYQ  S YGDD+VIVAA RT 
Sbjct  4    AMERQRVLLQHLQPSSSSDSALSPSACL----------AAYQNTSKYGDDVVIVAAQRTA  53

Query  240  LCKSKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTVLAPGSIRASECRMAAF  419
            +CK+KRG FKDTYPD+LLASVL+ALIEKTN+NPSEVGDI+VGTVL PGS RASECRMA+F
Sbjct  54   ICKAKRGSFKDTYPDELLASVLRALIEKTNVNPSEVGDIVVGTVLGPGSQRASECRMASF  113

Query  420  YAGFPETVPVRTVNRQCSSGLQavadvaaaikaGFYDIGIGAGLESMTVN  569
            YAGFP TVP+RTVNRQC+SGLQAVADVAAAIKAGFYDIGIGAGLESMT N
Sbjct  114  YAGFPLTVPIRTVNRQCASGLQAVADVAAAIKAGFYDIGIGAGLESMTTN  163



>gb|AEQ94132.1| putative 3-ketoacyl CoA thiolase [Elaeis guineensis]
Length=324

 Score =   227 bits (578),  Expect = 7e-70, Method: Compositional matrix adjust.
 Identities = 114/134 (85%), Positives = 128/134 (96%), Gaps = 0/134 (0%)
 Frame = +3

Query  168  DSAAYQRNSVYGDDIVIVAAYRTPLCKSKRGGFKDTYPDDLLASVLKALIEKTNLNPSEV  347
            DSAAYQR+S +GDD+V+VAAYRTP+CKSKRGGFKDT+P+DLLA+VLK L++KT LNP+EV
Sbjct  1    DSAAYQRSSSFGDDVVVVAAYRTPICKSKRGGFKDTHPEDLLATVLKGLLDKTKLNPNEV  60

Query  348  GDIIVGTVLAPGSIRASECRMAAFYAGFPETVPVRTVNRQCSSGLQavadvaaaikaGFY  527
             DI+VGTVLAPGS RA+ECRMAAFYAGFPETVPVRTVNRQCSSGLQAVADVAA+IKAGFY
Sbjct  61   SDIVVGTVLAPGSQRATECRMAAFYAGFPETVPVRTVNRQCSSGLQAVADVAASIKAGFY  120

Query  528  DIGIGAGLESMTVN  569
            DIGIGAGLESMT N
Sbjct  121  DIGIGAGLESMTAN  134



>gb|ACN29136.1| unknown [Zea mays]
 gb|AFW68658.1| hypothetical protein ZEAMMB73_512974 [Zea mays]
Length=461

 Score =   230 bits (587),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 122/170 (72%), Positives = 142/170 (84%), Gaps = 3/170 (2%)
 Frame = +3

Query  60   AIERQRVLLQHLRPTNAASSHDSIESSVSASVCAAGDSAAYQRNSVYGDDIVIVAAYRTP  239
            A++RQRVLL+HL   N A++      ++SAS CAAGDSAAY R   + DD+VIVAAYRT 
Sbjct  4    AVDRQRVLLRHL---NPAAAGSPAPPAISASACAAGDSAAYHRRPAFADDVVIVAAYRTA  60

Query  240  LCKSKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTVLAPGSIRASECRMAAF  419
            +CK+KRGGFKDT+ +DLL  V KAL++KT L+PSEVGDI+VGTVLAPGS RA ECRMAA 
Sbjct  61   ICKAKRGGFKDTFAEDLLVPVFKALVDKTKLDPSEVGDIVVGTVLAPGSQRAIECRMAAL  120

Query  420  YAGFPETVPVRTVNRQCSSGLQavadvaaaikaGFYDIGIGAGLESMTVN  569
            YAGFP+TVP++TVNRQCSSGLQAVADVA AIKAG YDIGI AGLESMTVN
Sbjct  121  YAGFPDTVPLKTVNRQCSSGLQAVADVATAIKAGLYDIGIAAGLESMTVN  170



>ref|XP_010038353.1| PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxisomal [Eucalyptus 
grandis]
 ref|XP_010038354.1| PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxisomal [Eucalyptus 
grandis]
 gb|KCW50167.1| hypothetical protein EUGRSUZ_K03601 [Eucalyptus grandis]
 gb|KCW50168.1| hypothetical protein EUGRSUZ_K03601 [Eucalyptus grandis]
Length=466

 Score =   230 bits (587),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 131/172 (76%), Positives = 153/172 (89%), Gaps = 2/172 (1%)
 Frame = +3

Query  60   AIERQRVLLQHLRPTNAASS--HDSIESSVSASVCAAGDSAAYQRNSVYGDDIVIVAAYR  233
            A++RQRVLL+HL+P+ ++ S  H    + VSAS CAAGD AAYQR + +GDD+VIVAAYR
Sbjct  4    ALDRQRVLLRHLQPSPSSGSPSHTPQSACVSASACAAGDLAAYQRTASFGDDVVIVAAYR  63

Query  234  TPLCKSKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTVLAPGSIRASECRMA  413
            T +CKS+RGGFKDT P+DLLA VL+A++EKTNLNP+EVGDI+VGTVLAPGS R  ECRMA
Sbjct  64   TAICKSRRGGFKDTLPEDLLAPVLRAVVEKTNLNPAEVGDIVVGTVLAPGSQRGIECRMA  123

Query  414  AFYAGFPETVPVRTVNRQCSSGLQavadvaaaikaGFYDIGIGAGLESMTVN  569
            AFYAGFPETVP+RTVNRQCSSGLQAVADVAA+IKAGFYDIGIGAGLESMTV+
Sbjct  124  AFYAGFPETVPLRTVNRQCSSGLQAVADVAASIKAGFYDIGIGAGLESMTVD  175



>gb|KHG11493.1| 3-ketoacyl-CoA thiolase 2, peroxisomal -like protein [Gossypium 
arboreum]
Length=463

 Score =   230 bits (587),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 126/170 (74%), Positives = 147/170 (86%), Gaps = 1/170 (1%)
 Frame = +3

Query  60   AIERQRVLLQHLRPTNAASSHDSIESSVSASVCAAGDSAAYQRNSVYGDDIVIVAAYRTP  239
            A+ RQRVLL HLRP++++SSH    +++  S CAAGDSAAY R + +GDD+VIVAA RT 
Sbjct  4    ALNRQRVLLHHLRPSSSSSSH-ESAAALFPSNCAAGDSAAYHRTAAFGDDVVIVAACRTA  62

Query  240  LCKSKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTVLAPGSIRASECRMAAF  419
            +CK+KRGGFKDT  DDLLA VLKALI++T L+PSEV DI+VGTVLAPGS R  ECRMAAF
Sbjct  63   ICKAKRGGFKDTLADDLLAPVLKALIDRTKLDPSEVSDIVVGTVLAPGSQRGIECRMAAF  122

Query  420  YAGFPETVPVRTVNRQCSSGLQavadvaaaikaGFYDIGIGAGLESMTVN  569
            YAGFP+TVP+RTVNRQCSSGLQAVADVAA+IKAGFYDIGIGAGLESMT +
Sbjct  123  YAGFPDTVPIRTVNRQCSSGLQAVADVAASIKAGFYDIGIGAGLESMTTD  172



>gb|KCW50166.1| hypothetical protein EUGRSUZ_K03601 [Eucalyptus grandis]
Length=474

 Score =   230 bits (587),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 131/172 (76%), Positives = 153/172 (89%), Gaps = 2/172 (1%)
 Frame = +3

Query  60   AIERQRVLLQHLRPTNAASS--HDSIESSVSASVCAAGDSAAYQRNSVYGDDIVIVAAYR  233
            A++RQRVLL+HL+P+ ++ S  H    + VSAS CAAGD AAYQR + +GDD+VIVAAYR
Sbjct  4    ALDRQRVLLRHLQPSPSSGSPSHTPQSACVSASACAAGDLAAYQRTASFGDDVVIVAAYR  63

Query  234  TPLCKSKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTVLAPGSIRASECRMA  413
            T +CKS+RGGFKDT P+DLLA VL+A++EKTNLNP+EVGDI+VGTVLAPGS R  ECRMA
Sbjct  64   TAICKSRRGGFKDTLPEDLLAPVLRAVVEKTNLNPAEVGDIVVGTVLAPGSQRGIECRMA  123

Query  414  AFYAGFPETVPVRTVNRQCSSGLQavadvaaaikaGFYDIGIGAGLESMTVN  569
            AFYAGFPETVP+RTVNRQCSSGLQAVADVAA+IKAGFYDIGIGAGLESMTV+
Sbjct  124  AFYAGFPETVPLRTVNRQCSSGLQAVADVAASIKAGFYDIGIGAGLESMTVD  175



>ref|NP_001048523.1| Os02g0817700 [Oryza sativa Japonica Group]
 gb|AAO72588.1| 3-ketoacyl-CoA thiolase-like protein [Oryza sativa Japonica Group]
 dbj|BAD21525.1| putative 3-ketoacyl-CoA thiolase; acetyl-CoA acyltransferase 
[Oryza sativa Japonica Group]
 dbj|BAF10437.1| Os02g0817700 [Oryza sativa Japonica Group]
 gb|EAY88029.1| hypothetical protein OsI_09452 [Oryza sativa Indica Group]
Length=448

 Score =   229 bits (584),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 128/170 (75%), Positives = 143/170 (84%), Gaps = 5/170 (3%)
 Frame = +3

Query  60   AIERQRVLLQHLRPTNAASSHDSIESSVSASVCAAGDSAAYQRNSVYGDDIVIVAAYRTP  239
            AI+RQRVLL H        S  S +S +SAS CAAGDSAAYQR S YGDD+V+VAAYRTP
Sbjct  4    AIDRQRVLLAH-----LLPSSSSDQSLLSASACAAGDSAAYQRTSAYGDDVVVVAAYRTP  58

Query  240  LCKSKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTVLAPGSIRASECRMAAF  419
            +CK+KRGGFKDTYP+DLL  VLKA+++ T +NP E+GDI+VGTVL PGS RA ECR AAF
Sbjct  59   ICKAKRGGFKDTYPEDLLTVVLKAVLDNTKINPGEIGDIVVGTVLGPGSQRAIECRAAAF  118

Query  420  YAGFPETVPVRTVNRQCSSGLQavadvaaaikaGFYDIGIGAGLESMTVN  569
            YAG PE VPVRTVNRQCSSGLQAVADVAAAIKAGFYDIGIGAGLESM+VN
Sbjct  119  YAGVPENVPVRTVNRQCSSGLQAVADVAAAIKAGFYDIGIGAGLESMSVN  168



>gb|KFK42814.1| hypothetical protein AALP_AA1G042000 [Arabis alpina]
Length=439

 Score =   229 bits (583),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 131/170 (77%), Positives = 147/170 (86%), Gaps = 7/170 (4%)
 Frame = +3

Query  60   AIERQRVLLQHLRPTNAASSHDSIESSVSASVCAAGDSAAYQRNSVYGDDIVIVAAYRTP  239
            AIERQRVLL HL+P +++S+     +S+S S C AG++   QR S Y DD+VIVAA RT 
Sbjct  4    AIERQRVLLHHLQPLSSSSN----AASLSVSACFAGEN---QRTSQYEDDVVIVAAQRTA  56

Query  240  LCKSKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTVLAPGSIRASECRMAAF  419
            LCK+KRG FKDTYPD+LLA VL+ALIEKT+LNPSEVGDI+VGTVL PGS RASECRMAAF
Sbjct  57   LCKAKRGSFKDTYPDELLAPVLRALIEKTHLNPSEVGDIVVGTVLGPGSQRASECRMAAF  116

Query  420  YAGFPETVPVRTVNRQCSSGLQavadvaaaikaGFYDIGIGAGLESMTVN  569
            YAGFPETVP+RTVNRQCSSGLQAVADVAAAIKAGFYDIGIGAGLESMT N
Sbjct  117  YAGFPETVPIRTVNRQCSSGLQAVADVAAAIKAGFYDIGIGAGLESMTTN  166



>ref|XP_007153157.1| hypothetical protein PHAVU_003G011600g [Phaseolus vulgaris]
 gb|ESW25151.1| hypothetical protein PHAVU_003G011600g [Phaseolus vulgaris]
Length=445

 Score =   229 bits (583),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 127/171 (74%), Positives = 151/171 (88%), Gaps = 4/171 (2%)
 Frame = +3

Query  60   AIERQRVLLQHLRPTNAAS--SHDSIESS-VSASVCAAGDSAAYQRNSVYGDDIVIVAAY  230
            AI+RQRVLL+HL+P++++S  SH + +S+ +SAS C AG+S+  QR     DD+VIVAAY
Sbjct  4    AIQRQRVLLEHLQPSSSSSNFSHQTHQSTDLSASSCFAGNSSHGQRGGSE-DDVVIVAAY  62

Query  231  RTPLCKSKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTVLAPGSIRASECRM  410
            RT +CK+KRGGFKDT PDDLLA+VLKA+IEKTN++P+EVGDI+VGTVLAPGS R  ECRM
Sbjct  63   RTAICKAKRGGFKDTLPDDLLATVLKAVIEKTNVDPAEVGDIVVGTVLAPGSDRGIECRM  122

Query  411  AAFYAGFPETVPVRTVNRQCSSGLQavadvaaaikaGFYDIGIGAGLESMT  563
            AAFYAGFPETVP+RTVNRQCSSGLQAVADVAA IKAGFYDIGIGAGLESM+
Sbjct  123  AAFYAGFPETVPLRTVNRQCSSGLQAVADVAAYIKAGFYDIGIGAGLESMS  173



>ref|XP_003632434.2| PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxisomal-like [Vitis 
vinifera]
 emb|CBI37268.3| unnamed protein product [Vitis vinifera]
Length=443

 Score =   228 bits (582),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 127/171 (74%), Positives = 147/171 (86%), Gaps = 3/171 (2%)
 Frame = +3

Query  60   AIERQRVLLQHLRPTNAASSHDSI-ESSVSASVCAAGDSAAYQRNSVYGDDIVIVAAYRT  236
            AI RQRVLL+HLRP++++ S   I ESS+SAS+C AG+ A    +S  GDDIV+VAA RT
Sbjct  4    AINRQRVLLEHLRPSSSSPSPSPINESSLSASICLAGNRATNPVDS--GDDIVVVAACRT  61

Query  237  PLCKSKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTVLAPGSIRASECRMAA  416
             +CK+KRGGFKDT PDD+LA VLKALIEKTN++PSEVGDI+VGTVLAPGS RA ECRMAA
Sbjct  62   AICKAKRGGFKDTLPDDILAPVLKALIEKTNVDPSEVGDIVVGTVLAPGSQRAIECRMAA  121

Query  417  FYAGFPETVPVRTVNRQCSSGLQavadvaaaikaGFYDIGIGAGLESMTVN  569
            FYAGFP+TVP+RTVNRQCSSGLQAV DV AAI+AG YDIGIGAGLESMT +
Sbjct  122  FYAGFPDTVPIRTVNRQCSSGLQAVVDVVAAIRAGLYDIGIGAGLESMTTD  172



>gb|KHN15993.1| 3-ketoacyl-CoA thiolase 2, peroxisomal [Glycine soja]
Length=445

 Score =   228 bits (582),  Expect = 4e-69, Method: Compositional matrix adjust.
 Identities = 125/175 (71%), Positives = 148/175 (85%), Gaps = 8/175 (5%)
 Frame = +3

Query  60   AIERQRVLLQHLRP-----TNAASSHDSIESSVSASVCAAGDSAAYQRNSVYGDDIVIVA  224
            AI+RQRVLL+HL+P       ++ +H S  + +SAS+C AG+S+  Q      DD+VIVA
Sbjct  4    AIQRQRVLLEHLQPISSSSNFSSQTHQS--TDLSASLCFAGNSSHGQTGG-SDDDVVIVA  60

Query  225  AYRTPLCKSKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTVLAPGSIRASEC  404
            AYRT +CK+KRGGFKDT PDDLLA+VLKA+IEKTN++P+EVGDI+VGTVLAPGS R  EC
Sbjct  61   AYRTAICKAKRGGFKDTLPDDLLATVLKAVIEKTNVDPAEVGDIVVGTVLAPGSDRGIEC  120

Query  405  RMAAFYAGFPETVPVRTVNRQCSSGLQavadvaaaikaGFYDIGIGAGLESMTVN  569
            RMAAFYAGFPETVP+RTVNRQCSSGLQAV+DVAA IKAGFYDIGIGAGLESMTV+
Sbjct  121  RMAAFYAGFPETVPLRTVNRQCSSGLQAVSDVAAYIKAGFYDIGIGAGLESMTVD  175



>gb|KJB42404.1| hypothetical protein B456_007G152600 [Gossypium raimondii]
Length=453

 Score =   228 bits (581),  Expect = 8e-69, Method: Compositional matrix adjust.
 Identities = 124/170 (73%), Positives = 144/170 (85%), Gaps = 2/170 (1%)
 Frame = +3

Query  60   AIERQRVLLQHLRPTNAASSHDSIESSVSASVCAAGDSAAYQRNSVYGDDIVIVAAYRTP  239
            AI RQ+VLL HL+P++ +    +  + +  S CAAGDSAAY R + +GDD+VIVAA RT 
Sbjct  4    AINRQQVLLNHLQPSSQSHQSSA--AILFPSNCAAGDSAAYHRTAAFGDDVVIVAACRTA  61

Query  240  LCKSKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTVLAPGSIRASECRMAAF  419
            +CK+KRGGFKDT  DDLLA VL+A+I++T LNPSEVGDI+VGTVLAPGS RA ECRMAAF
Sbjct  62   ICKAKRGGFKDTLADDLLAPVLRAVIDRTKLNPSEVGDIVVGTVLAPGSQRAMECRMAAF  121

Query  420  YAGFPETVPVRTVNRQCSSGLQavadvaaaikaGFYDIGIGAGLESMTVN  569
            YAGFP+TVP+RTVNRQCSSGLQAVADVAA IKAGFYDIGIGAGLESMT N
Sbjct  122  YAGFPDTVPIRTVNRQCSSGLQAVADVAACIKAGFYDIGIGAGLESMTTN  171



>gb|KJB42405.1| hypothetical protein B456_007G152600 [Gossypium raimondii]
Length=454

 Score =   228 bits (581),  Expect = 8e-69, Method: Compositional matrix adjust.
 Identities = 124/170 (73%), Positives = 144/170 (85%), Gaps = 2/170 (1%)
 Frame = +3

Query  60   AIERQRVLLQHLRPTNAASSHDSIESSVSASVCAAGDSAAYQRNSVYGDDIVIVAAYRTP  239
            AI RQ+VLL HL+P++ +    +  + +  S CAAGDSAAY R + +GDD+VIVAA RT 
Sbjct  4    AINRQQVLLNHLQPSSQSHQSSA--AILFPSNCAAGDSAAYHRTAAFGDDVVIVAACRTA  61

Query  240  LCKSKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTVLAPGSIRASECRMAAF  419
            +CK+KRGGFKDT  DDLLA VL+A+I++T LNPSEVGDI+VGTVLAPGS RA ECRMAAF
Sbjct  62   ICKAKRGGFKDTLADDLLAPVLRAVIDRTKLNPSEVGDIVVGTVLAPGSQRAMECRMAAF  121

Query  420  YAGFPETVPVRTVNRQCSSGLQavadvaaaikaGFYDIGIGAGLESMTVN  569
            YAGFP+TVP+RTVNRQCSSGLQAVADVAA IKAGFYDIGIGAGLESMT N
Sbjct  122  YAGFPDTVPIRTVNRQCSSGLQAVADVAACIKAGFYDIGIGAGLESMTTN  171



>ref|XP_002467133.1| hypothetical protein SORBIDRAFT_01g020150 [Sorghum bicolor]
 gb|EER94131.1| hypothetical protein SORBIDRAFT_01g020150 [Sorghum bicolor]
Length=462

 Score =   228 bits (581),  Expect = 8e-69, Method: Compositional matrix adjust.
 Identities = 123/170 (72%), Positives = 143/170 (84%), Gaps = 2/170 (1%)
 Frame = +3

Query  60   AIERQRVLLQHLRPTNAASSHDSIESSVSASVCAAGDSAAYQRNSVYGDDIVIVAAYRTP  239
            AI+RQRVLL+HL  + AA++      ++SAS CAAGDSAAY R   + DD+VIVAAYRT 
Sbjct  4    AIDRQRVLLRHL--SPAAAAESPAPPAISASACAAGDSAAYHRTPAFADDVVIVAAYRTA  61

Query  240  LCKSKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTVLAPGSIRASECRMAAF  419
            +CK+KRGGFKDT+ +DLL  V KAL++KT L+PSEVGDI+VGTVLAPGS RA ECRMAA 
Sbjct  62   ICKAKRGGFKDTFAEDLLVPVFKALVDKTKLDPSEVGDIVVGTVLAPGSQRAIECRMAAL  121

Query  420  YAGFPETVPVRTVNRQCSSGLQavadvaaaikaGFYDIGIGAGLESMTVN  569
            YAGFP+TVP++TVNRQCSSGLQAVADVA AIKAG YDIGI AGLESMTVN
Sbjct  122  YAGFPDTVPLKTVNRQCSSGLQAVADVATAIKAGLYDIGIAAGLESMTVN  171



>ref|NP_001242568.1| uncharacterized protein LOC100789930 [Glycine max]
 gb|ACU23006.1| unknown [Glycine max]
Length=445

 Score =   227 bits (579),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 125/175 (71%), Positives = 148/175 (85%), Gaps = 8/175 (5%)
 Frame = +3

Query  60   AIERQRVLLQHLRP-----TNAASSHDSIESSVSASVCAAGDSAAYQRNSVYGDDIVIVA  224
            AI+RQRVLL+HL+P       ++ +H S  + +SAS+C AG+S+  Q      DD+VIVA
Sbjct  4    AIQRQRVLLEHLQPISSSSNFSSQTHQS--TDLSASLCFAGNSSHGQTGG-SDDDVVIVA  60

Query  225  AYRTPLCKSKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTVLAPGSIRASEC  404
            AYRT +CK+KRGGFKDT PDDLLA+VLKA+IEKTN++P+EVGDI+VGTVLAPGS R  EC
Sbjct  61   AYRTAICKAKRGGFKDTPPDDLLATVLKAVIEKTNVDPAEVGDIVVGTVLAPGSDRGIEC  120

Query  405  RMAAFYAGFPETVPVRTVNRQCSSGLQavadvaaaikaGFYDIGIGAGLESMTVN  569
            RMAAFYAGFPETVP+RTVNRQCSSGLQAV+DVAA IKAGFYDIGIGAGLESMTV+
Sbjct  121  RMAAFYAGFPETVPLRTVNRQCSSGLQAVSDVAAYIKAGFYDIGIGAGLESMTVD  175



>ref|XP_004506590.1| PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxisomal-like [Cicer 
arietinum]
Length=440

 Score =   227 bits (579),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 123/171 (72%), Positives = 142/171 (83%), Gaps = 9/171 (5%)
 Frame = +3

Query  60   AIERQRVLLQHLRPTNAAS---SHDSIESSVSASVCAAGDSAAYQRNSVYGDDIVIVAAY  230
            AIERQRVLL+HL+P ++ S   SH    + +SAS C+AG +   +      +D+VIVAAY
Sbjct  4    AIERQRVLLEHLQPNSSNSAFLSHTHQSTDLSASFCSAGQTGGSE------NDVVIVAAY  57

Query  231  RTPLCKSKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTVLAPGSIRASECRM  410
            RT +CK+KRGGFKDT PDDLLA VLKA+IEKTN+ PSEVGDIIVGTVL PGS +A+ECRM
Sbjct  58   RTAICKAKRGGFKDTLPDDLLAPVLKAVIEKTNVEPSEVGDIIVGTVLGPGSEKATECRM  117

Query  411  AAFYAGFPETVPVRTVNRQCSSGLQavadvaaaikaGFYDIGIGAGLESMT  563
            AAFYAGFPETVP+RTVNRQCSSGLQAVADVAA IKAGFYDIGIGAGLE M+
Sbjct  118  AAFYAGFPETVPLRTVNRQCSSGLQAVADVAAYIKAGFYDIGIGAGLECMS  168



>ref|XP_010918893.1| PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxisomal-like [Elaeis 
guineensis]
Length=460

 Score =   227 bits (579),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 125/170 (74%), Positives = 150/170 (88%), Gaps = 4/170 (2%)
 Frame = +3

Query  60   AIERQRVLLQHLRPTNAASSHDSIESSVSASVCAAGDSAAYQRNSVYGDDIVIVAAYRTP  239
            AI RQRVLLQHLRP++ +    ++    + S+CAAGDSAAYQR+S +GDD+VIVAA RT 
Sbjct  4    AINRQRVLLQHLRPSSGSDDRPAL----TTSICAAGDSAAYQRSSCFGDDVVIVAACRTA  59

Query  240  LCKSKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTVLAPGSIRASECRMAAF  419
            +CKS RGGFK+T+P+DLLA +LKAL++KT +NPSEVGDI+VGTVLAPGS RA ECRMAAF
Sbjct  60   ICKSNRGGFKNTHPEDLLAPLLKALLDKTKVNPSEVGDIVVGTVLAPGSQRAIECRMAAF  119

Query  420  YAGFPETVPVRTVNRQCSSGLQavadvaaaikaGFYDIGIGAGLESMTVN  569
            YAGFPETVP+RTVNRQCSSGLQAVAD+AAAIK+GFY+IGI AG+ESMTV+
Sbjct  120  YAGFPETVPLRTVNRQCSSGLQAVADIAAAIKSGFYEIGIAAGMESMTVD  169



>ref|XP_004506669.1| PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxisomal-like [Cicer 
arietinum]
Length=440

 Score =   226 bits (577),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 122/171 (71%), Positives = 142/171 (83%), Gaps = 9/171 (5%)
 Frame = +3

Query  60   AIERQRVLLQHLRPTNAAS---SHDSIESSVSASVCAAGDSAAYQRNSVYGDDIVIVAAY  230
            AIERQRVLL+HL+P ++ S   SH    + +SAS C+AG +   +      +D+VIVAAY
Sbjct  4    AIERQRVLLEHLQPNSSNSVFLSHTHQSTDLSASFCSAGQTGGSE------NDVVIVAAY  57

Query  231  RTPLCKSKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTVLAPGSIRASECRM  410
            RT +CK+KRGGFKDT PDDLLA VLKA+IEKTN+ PSEVGDI+VGTVL PGS +A+ECRM
Sbjct  58   RTAICKAKRGGFKDTLPDDLLAPVLKAVIEKTNVEPSEVGDIVVGTVLGPGSEKATECRM  117

Query  411  AAFYAGFPETVPVRTVNRQCSSGLQavadvaaaikaGFYDIGIGAGLESMT  563
            AAFYAGFPETVP+RTVNRQCSSGLQAVADVAA IKAGFYDIGIGAGLE M+
Sbjct  118  AAFYAGFPETVPLRTVNRQCSSGLQAVADVAACIKAGFYDIGIGAGLECMS  168



>ref|XP_009796305.1| PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxisomal-like isoform 
X2 [Nicotiana sylvestris]
Length=462

 Score =   226 bits (577),  Expect = 4e-68, Method: Compositional matrix adjust.
 Identities = 115/140 (82%), Positives = 131/140 (94%), Gaps = 0/140 (0%)
 Frame = +3

Query  150  SVCAAGDSAAYQRNSVYGDDIVIVAAYRTPLCKSKRGGFKDTYPDDLLASVLKALIEKTN  329
            S+C AGDSAAYQR + +GDD+VIVAAYRT +CK+KRGGFK+T  DDLLA VLKA++EKTN
Sbjct  32   SICLAGDSAAYQRTAAFGDDVVIVAAYRTAICKAKRGGFKNTLADDLLAPVLKAVVEKTN  91

Query  330  LNPSEVGDIIVGTVLAPGSIRASECRMAAFYAGFPETVPVRTVNRQCSSGLQavadvaaa  509
            L+P+EVGDI+VGTVLAPGS+RA ECRMAAFYAGFPETVP+RTVNRQCSSGLQAVADVAA+
Sbjct  92   LSPNEVGDIVVGTVLAPGSLRAMECRMAAFYAGFPETVPIRTVNRQCSSGLQAVADVAAS  151

Query  510  ikaGFYDIGIGAGLESMTVN  569
            IKAGFYDIGIGAGLE MTV+
Sbjct  152  IKAGFYDIGIGAGLELMTVD  171



>ref|XP_006307517.1| hypothetical protein CARUB_v10009140mg [Capsella rubella]
 gb|EOA40415.1| hypothetical protein CARUB_v10009140mg [Capsella rubella]
Length=444

 Score =   226 bits (575),  Expect = 5e-68, Method: Compositional matrix adjust.
 Identities = 126/170 (74%), Positives = 144/170 (85%), Gaps = 10/170 (6%)
 Frame = +3

Query  60   AIERQRVLLQHLRPTNAASSHDSIESSVSASVCAAGDSAAYQRNSVYGDDIVIVAAYRTP  239
            A+ERQRVLLQHL+P++++ S  S  + +          AAYQ  S YGDD+VIVAA RT 
Sbjct  4    AMERQRVLLQHLQPSSSSDSALSPSACL----------AAYQNTSKYGDDVVIVAAQRTA  53

Query  240  LCKSKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTVLAPGSIRASECRMAAF  419
            +CK+KRG FKDTYPD+LLASVL+ALIEKTN+NPSEVGDI+VGTVL PGS RASECRMA+F
Sbjct  54   ICKAKRGSFKDTYPDELLASVLRALIEKTNVNPSEVGDIVVGTVLGPGSQRASECRMASF  113

Query  420  YAGFPETVPVRTVNRQCSSGLQavadvaaaikaGFYDIGIGAGLESMTVN  569
            YAGFP TVP+RTVNRQC+SGLQAVADVAAAIKAGFYDIGIGAGLESMT N
Sbjct  114  YAGFPLTVPIRTVNRQCASGLQAVADVAAAIKAGFYDIGIGAGLESMTTN  163



>ref|XP_004982961.1| PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxisomal-like [Setaria 
italica]
Length=461

 Score =   226 bits (576),  Expect = 5e-68, Method: Compositional matrix adjust.
 Identities = 124/170 (73%), Positives = 145/170 (85%), Gaps = 3/170 (2%)
 Frame = +3

Query  60   AIERQRVLLQHLRPTNAASSHDSIESSVSASVCAAGDSAAYQRNSVYGDDIVIVAAYRTP  239
            AI+RQR+LL+HL   + A++      ++SAS CAAGDSAAY R + + DD+VIVAAYRT 
Sbjct  4    AIDRQRILLRHL---DPAAAPSPAPPAISASACAAGDSAAYHRRAAFADDVVIVAAYRTA  60

Query  240  LCKSKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTVLAPGSIRASECRMAAF  419
            +CK+KRGGFKDT+ +DLL  VLKAL++KT LNPSEVGDI+VGTVLAPGS RA ECRMAA 
Sbjct  61   ICKAKRGGFKDTFAEDLLVPVLKALVDKTKLNPSEVGDIVVGTVLAPGSQRAIECRMAAL  120

Query  420  YAGFPETVPVRTVNRQCSSGLQavadvaaaikaGFYDIGIGAGLESMTVN  569
            YAGFP+TVP++TVNRQCSSGLQAVADVAAAIKAG YDIGI AGLESMTVN
Sbjct  121  YAGFPDTVPLKTVNRQCSSGLQAVADVAAAIKAGLYDIGIAAGLESMTVN  170



>emb|CDY15520.1| BnaA08g28040D [Brassica napus]
Length=451

 Score =   226 bits (575),  Expect = 6e-68, Method: Compositional matrix adjust.
 Identities = 128/170 (75%), Positives = 143/170 (84%), Gaps = 3/170 (2%)
 Frame = +3

Query  60   AIERQRVLLQHLRPTNAASSHDSIESSVSASVCAAGDSAAYQRNSVYGDDIVIVAAYRTP  239
            A+ERQRVLL H           S ++S+S S C AG SAAYQR S+YGDD+VIVAA RT 
Sbjct  4    AMERQRVLLHH---LQPPLPSSSSQASLSVSACLAGGSAAYQRTSLYGDDVVIVAAQRTA  60

Query  240  LCKSKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTVLAPGSIRASECRMAAF  419
            LCK+KRG FKDTYPD+LLASVL+A+IEKT L+PSEVGDI+VGTVL  GS +A+E RMAAF
Sbjct  61   LCKAKRGSFKDTYPDELLASVLRAVIEKTKLDPSEVGDIVVGTVLGSGSQKATEFRMAAF  120

Query  420  YAGFPETVPVRTVNRQCSSGLQavadvaaaikaGFYDIGIGAGLESMTVN  569
            YAGFPETVPVRTVNRQCSSGLQAVADVAAAIKAGFYDIGIGAGLESMT +
Sbjct  121  YAGFPETVPVRTVNRQCSSGLQAVADVAAAIKAGFYDIGIGAGLESMTTS  170



>ref|XP_001762605.1| predicted protein [Physcomitrella patens]
 gb|EDQ72728.1| predicted protein [Physcomitrella patens]
Length=455

 Score =   225 bits (574),  Expect = 8e-68, Method: Compositional matrix adjust.
 Identities = 116/167 (69%), Positives = 141/167 (84%), Gaps = 9/167 (5%)
 Frame = +3

Query  69   RQRVLLQHLRPTNAASSHDSIESSVSASVCAAGDSAAYQRNSVYGDDIVIVAAYRTPLCK  248
            RQ+VLL HL+P     +         +S+C+A DSA Y R + + DD+VIVAAYRT +C+
Sbjct  7    RQQVLLDHLKPETGRRA---------SSICSANDSAPYARTTDFLDDVVIVAAYRTAICR  57

Query  249  SKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTVLAPGSIRASECRMAAFYAG  428
            +KRGGFKDTYPDDLLA VL+A++EKT ++P+E+GDI++G+VLAPG+ RA+ECRMAAF+AG
Sbjct  58   AKRGGFKDTYPDDLLAPVLRAVVEKTGVSPAEIGDIVIGSVLAPGAQRANECRMAAFFAG  117

Query  429  FPETVPVRTVNRQCSSGLQavadvaaaikaGFYDIGIGAGLESMTVN  569
            FPETVPVRTVNRQCSSGLQAVADVAAAIKAGFYDIGIG GLESMTVN
Sbjct  118  FPETVPVRTVNRQCSSGLQAVADVAAAIKAGFYDIGIGGGLESMTVN  164



>ref|NP_001237076.1| 3-ketoacyl-CoA thiolase [Glycine max]
 ref|XP_006605407.1| PREDICTED: 3-ketoacyl-CoA thiolase isoform X1 [Glycine max]
 gb|AAQ93070.1| 3-ketoacyl-CoA thiolase [Glycine max]
 gb|KHM99006.1| 3-ketoacyl-CoA thiolase 2, peroxisomal [Glycine soja]
Length=445

 Score =   224 bits (570),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 124/175 (71%), Positives = 146/175 (83%), Gaps = 8/175 (5%)
 Frame = +3

Query  60   AIERQRVLLQHLRP-----TNAASSHDSIESSVSASVCAAGDSAAYQRNSVYGDDIVIVA  224
            AI+RQRVLL HL+P       ++ +H S  + +SAS+C A +S+  Q      DD+VIVA
Sbjct  4    AIQRQRVLLDHLQPISSSSNFSSQTHQS--TDLSASLCFAKNSSHGQIGG-SDDDVVIVA  60

Query  225  AYRTPLCKSKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTVLAPGSIRASEC  404
            AYRT +CK+KRGGFKDT PDDLLA+VLKA+IEKTN+NP+EVGDI+VGTVLAPGS R  EC
Sbjct  61   AYRTAICKAKRGGFKDTLPDDLLATVLKAVIEKTNVNPAEVGDIVVGTVLAPGSDRGIEC  120

Query  405  RMAAFYAGFPETVPVRTVNRQCSSGLQavadvaaaikaGFYDIGIGAGLESMTVN  569
            RMAAFYAGFPETVP+RTVNRQCSSGLQAV+DVAA IKAGFY+IGIGAGLESMTV+
Sbjct  121  RMAAFYAGFPETVPLRTVNRQCSSGLQAVSDVAAYIKAGFYEIGIGAGLESMTVD  175



>ref|XP_006662414.1| PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxisomal-like [Oryza 
brachyantha]
Length=460

 Score =   224 bits (571),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 122/170 (72%), Positives = 138/170 (81%), Gaps = 5/170 (3%)
 Frame = +3

Query  60   AIERQRVLLQHLRPTNAASSHDSIESSVSASVCAAGDSAAYQRNSVYGDDIVIVAAYRTP  239
            AI RQRVLL HL P    ++      + +AS CAAGDSAAY R + + DD+VIVAAYRT 
Sbjct  4    AINRQRVLLAHLEPAATPAA-----PAFTASACAAGDSAAYHRGACFADDVVIVAAYRTA  58

Query  240  LCKSKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTVLAPGSIRASECRMAAF  419
            +CKSKRGGFKDT  +DLL  V KALI+KT LNPSEVGDI+VGTVLAPGS RA ECRMAAF
Sbjct  59   ICKSKRGGFKDTPAEDLLVPVFKALIDKTKLNPSEVGDIVVGTVLAPGSQRAIECRMAAF  118

Query  420  YAGFPETVPVRTVNRQCSSGLQavadvaaaikaGFYDIGIGAGLESMTVN  569
            YAGFP+TVP+ TVNRQCSSGLQAV++VA+ IKAG YDIGI AGLESMTVN
Sbjct  119  YAGFPDTVPLMTVNRQCSSGLQAVSNVASNIKAGLYDIGIAAGLESMTVN  168



>ref|NP_001064764.1| Os10g0457600 [Oryza sativa Japonica Group]
 gb|AAK54299.1|AC034258_17 putative thiolase [Oryza sativa Japonica Group]
 gb|AAP54100.1| 3-ketoacyl-CoA thiolase 2, peroxisomal precursor, putative, expressed 
[Oryza sativa Japonica Group]
 dbj|BAF26678.1| Os10g0457600 [Oryza sativa Japonica Group]
 gb|EAZ16317.1| hypothetical protein OsJ_31778 [Oryza sativa Japonica Group]
 dbj|BAG92981.1| unnamed protein product [Oryza sativa Japonica Group]
Length=461

 Score =   223 bits (567),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 123/170 (72%), Positives = 140/170 (82%), Gaps = 3/170 (2%)
 Frame = +3

Query  60   AIERQRVLLQHLRPTNAASSHDSIESSVSASVCAAGDSAAYQRNSVYGDDIVIVAAYRTP  239
            AI RQRVLL HL P  + ++      +++AS CAAGDSAAY R + + DD+VIVAAYRT 
Sbjct  4    AINRQRVLLAHLEPAASPAAA---APAITASACAAGDSAAYHRGACFADDVVIVAAYRTA  60

Query  240  LCKSKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTVLAPGSIRASECRMAAF  419
            +CKSKRGGFKDT  +DLL  V KALI+KT LNPSEVGDI+VGTVLAPGS RA ECRMAAF
Sbjct  61   ICKSKRGGFKDTPAEDLLVPVFKALIDKTKLNPSEVGDIVVGTVLAPGSQRAIECRMAAF  120

Query  420  YAGFPETVPVRTVNRQCSSGLQavadvaaaikaGFYDIGIGAGLESMTVN  569
            YAGFP+TVP+ TVNRQCSSGLQAVA+VA+ IKAG YDIGI AGLESMTVN
Sbjct  121  YAGFPDTVPLMTVNRQCSSGLQAVANVASNIKAGLYDIGIAAGLESMTVN  170



>gb|EEC67095.1| hypothetical protein OsI_33888 [Oryza sativa Indica Group]
Length=461

 Score =   222 bits (566),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 123/170 (72%), Positives = 140/170 (82%), Gaps = 3/170 (2%)
 Frame = +3

Query  60   AIERQRVLLQHLRPTNAASSHDSIESSVSASVCAAGDSAAYQRNSVYGDDIVIVAAYRTP  239
            AI RQRVLL HL P  + ++      +++AS CAAGDSAAY R + + DD+VIVAAYRT 
Sbjct  4    AINRQRVLLAHLEPAASPAAA---APAITASACAAGDSAAYHRGACFADDVVIVAAYRTA  60

Query  240  LCKSKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTVLAPGSIRASECRMAAF  419
            +CKSKRGGFKDT  +DLL  V KALI+KT LNPSEVGDI+VGTVLAPGS RA ECRMAAF
Sbjct  61   ICKSKRGGFKDTPAEDLLVPVFKALIDKTKLNPSEVGDIVVGTVLAPGSQRAIECRMAAF  120

Query  420  YAGFPETVPVRTVNRQCSSGLQavadvaaaikaGFYDIGIGAGLESMTVN  569
            YAGFP+TVP+ TVNRQCSSGLQAVA+VA+ IKAG YDIGI AGLESMTVN
Sbjct  121  YAGFPDTVPLMTVNRQCSSGLQAVANVASNIKAGLYDIGIAAGLESMTVN  170



>ref|XP_002889522.1| hypothetical protein ARALYDRAFT_470458 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH65781.1| hypothetical protein ARALYDRAFT_470458 [Arabidopsis lyrata subsp. 
lyrata]
Length=419

 Score =   221 bits (562),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 118/141 (84%), Positives = 127/141 (90%), Gaps = 4/141 (3%)
 Frame = +3

Query  147  ASVCAAGDSAAYQRNSVYGDDIVIVAAYRTPLCKSKRGGFKDTYPDDLLASVLKALIEKT  326
            AS C A +SAAYQ    YGDD+VIVAA RTPLCK+KRG FKDTYPD+LLASVL+ LIEKT
Sbjct  1    ASPCLAKESAAYQ----YGDDVVIVAAQRTPLCKAKRGSFKDTYPDELLASVLRGLIEKT  56

Query  327  NLNPSEVGDIIVGTVLAPGSIRASECRMAAFYAGFPETVPVRTVNRQCSSGLQavadvaa  506
            N+NPSEVGDI+VGTVL PGS RASECRMAAFYAGFPETVP+R VNRQCSSGLQAVADVAA
Sbjct  57   NVNPSEVGDIVVGTVLGPGSQRASECRMAAFYAGFPETVPIRIVNRQCSSGLQAVADVAA  116

Query  507  aikaGFYDIGIGAGLESMTVN  569
            AI+AGFYDIGIGAGLESMT N
Sbjct  117  AIRAGFYDIGIGAGLESMTTN  137



>ref|XP_009336047.1| PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxisomal-like [Pyrus 
x bretschneideri]
Length=443

 Score =   221 bits (564),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 114/170 (67%), Positives = 143/170 (84%), Gaps = 0/170 (0%)
 Frame = +3

Query  60   AIERQRVLLQHLRPTNAASSHDSIESSVSASVCAAGDSAAYQRNSVYGDDIVIVAAYRTP  239
            A+ +Q+VLLQHLRP ++ SS +   + +SAS+CAAGDSAAY R + +   I++  AYRT 
Sbjct  4    AMNKQKVLLQHLRPNSSVSSSNYESAPLSASICAAGDSAAYHRTAAFAVKIMLNRAYRTA  63

Query  240  LCKSKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTVLAPGSIRASECRMAAF  419
            +CK+KRGGFKDT PDDLL  VLKA+IE+TNLNPS V D++VGTV+APGS+RA+E RM AF
Sbjct  64   ICKAKRGGFKDTLPDDLLPPVLKAVIERTNLNPSAVADVVVGTVMAPGSLRATESRMVAF  123

Query  420  YAGFPETVPVRTVNRQCSSGLQavadvaaaikaGFYDIGIGAGLESMTVN  569
            YA FP+TVP+RTVNRQCSSGLQAV DVAA+IKAG+YDIGI AG+ES+TV+
Sbjct  124  YASFPDTVPIRTVNRQCSSGLQAVFDVAASIKAGYYDIGIAAGVESLTVD  173



>ref|XP_010547051.1| PREDICTED: 3-ketoacyl-CoA thiolase 5, peroxisomal isoform X2 
[Tarenaya hassleriana]
Length=468

 Score =   222 bits (565),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 116/172 (67%), Positives = 148/172 (86%), Gaps = 2/172 (1%)
 Frame = +3

Query  60   AIERQRVLLQHLRPTNAASSH--DSIESSVSASVCAAGDSAAYQRNSVYGDDIVIVAAYR  233
            AI+RQR+LL+HL P +++ S   D   + +SA  CAAGD +AY   + +GDDIVIVAA+R
Sbjct  4    AIDRQRILLRHLNPVSSSLSSRIDHDPAILSAVNCAAGDFSAYSPMAAFGDDIVIVAAHR  63

Query  234  TPLCKSKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTVLAPGSIRASECRMA  413
            T +CK++RGGFKDT  DDLLA+VLKA++E+T+L+PSEVGDI+VGTV+APGS RA ECR+A
Sbjct  64   TAICKARRGGFKDTLADDLLATVLKAMVERTSLDPSEVGDIVVGTVIAPGSQRAMECRVA  123

Query  414  AFYAGFPETVPVRTVNRQCSSGLQavadvaaaikaGFYDIGIGAGLESMTVN  569
            A+YAGFP++VP+RTVNRQCSSGLQAVADVAA+IKAGFYDIGI AG+ESM+ +
Sbjct  124  AYYAGFPDSVPIRTVNRQCSSGLQAVADVAASIKAGFYDIGIAAGVESMSTD  175



>ref|XP_010547050.1| PREDICTED: 3-ketoacyl-CoA thiolase 5, peroxisomal isoform X1 
[Tarenaya hassleriana]
Length=474

 Score =   222 bits (565),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 116/172 (67%), Positives = 148/172 (86%), Gaps = 2/172 (1%)
 Frame = +3

Query  60   AIERQRVLLQHLRPTNAASSH--DSIESSVSASVCAAGDSAAYQRNSVYGDDIVIVAAYR  233
            AI+RQR+LL+HL P +++ S   D   + +SA  CAAGD +AY   + +GDDIVIVAA+R
Sbjct  4    AIDRQRILLRHLNPVSSSLSSRIDHDPAILSAVNCAAGDFSAYSPMAAFGDDIVIVAAHR  63

Query  234  TPLCKSKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTVLAPGSIRASECRMA  413
            T +CK++RGGFKDT  DDLLA+VLKA++E+T+L+PSEVGDI+VGTV+APGS RA ECR+A
Sbjct  64   TAICKARRGGFKDTLADDLLATVLKAMVERTSLDPSEVGDIVVGTVIAPGSQRAMECRVA  123

Query  414  AFYAGFPETVPVRTVNRQCSSGLQavadvaaaikaGFYDIGIGAGLESMTVN  569
            A+YAGFP++VP+RTVNRQCSSGLQAVADVAA+IKAGFYDIGI AG+ESM+ +
Sbjct  124  AYYAGFPDSVPIRTVNRQCSSGLQAVADVAASIKAGFYDIGIAAGVESMSTD  175



>gb|AAB80634.1| Strong similarity to Cucumis acetyl-CoA acyltransferase (gb|D70895) 
[Arabidopsis thaliana]
Length=460

 Score =   221 bits (562),  Expect = 5e-66, Method: Compositional matrix adjust.
 Identities = 131/180 (73%), Positives = 149/180 (83%), Gaps = 20/180 (11%)
 Frame = +3

Query  60   AIERQRVLLQHLRPTNAASSHDSIESSVSASVCAAGDSAAYQRNSVYGDDIVIVAAYRTP  239
            A ERQR+LL+HL+P++++ +      S+SAS C + DSAAYQ    YGDD+VIVAA RT 
Sbjct  4    ATERQRILLRHLQPSSSSDA------SLSASACLSKDSAAYQ----YGDDVVIVAAQRTA  53

Query  240  LCKSKRGGFKDTYPDDLLASVLK---ALIEKTNLNPSEVGDIIVGTVLAPGSIRASECRM  410
            LCK+KRG FKDT+PD+LLASVL+   ALIEKTN+NPSEVGDI+VGTVL PGS RASECRM
Sbjct  54   LCKAKRGSFKDTFPDELLASVLRVCLALIEKTNVNPSEVGDIVVGTVLGPGSQRASECRM  113

Query  411  AAFYAGFPETVPVRTVNRQCSSGLQavadvaaaikaGFYDI-------GIGAGLESMTVN  569
            AAFYAGFPETVP+RTVNRQCSSGLQAVADVAAAIKAGFYDI       GIGAGLESMT N
Sbjct  114  AAFYAGFPETVPIRTVNRQCSSGLQAVADVAAAIKAGFYDIGKIVTIFGIGAGLESMTTN  173



>ref|XP_008454505.1| PREDICTED: 3-ketoacyl-CoA thiolase 1, peroxisomal-like isoform 
X2 [Cucumis melo]
Length=461

 Score =   221 bits (562),  Expect = 5e-66, Method: Compositional matrix adjust.
 Identities = 124/172 (72%), Positives = 149/172 (87%), Gaps = 7/172 (4%)
 Frame = +3

Query  60   AIERQRVLLQHLRPTNAASSHDSIESSVSASVCAAGDSAA--YQRNSVYGDDIVIVAAYR  233
            A+ RQ+VLLQHL+P++++ S     +S+S SVCAAG+SA+  Y R + +GDDIVIVAA R
Sbjct  13   ALNRQKVLLQHLQPSSSSGS-----ASLSTSVCAAGESASNSYHRTAAFGDDIVIVAANR  67

Query  234  TPLCKSKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTVLAPGSIRASECRMA  413
            T +C++K+GGFKDT  +DLLASVLKA+IEKT LNP EVGDI+VGTVLAPGSIRASECRMA
Sbjct  68   TAICRAKKGGFKDTPAEDLLASVLKAVIEKTKLNPIEVGDIVVGTVLAPGSIRASECRMA  127

Query  414  AFYAGFPETVPVRTVNRQCSSGLQavadvaaaikaGFYDIGIGAGLESMTVN  569
            AF AGFP+TV +RTVNRQCSSGLQAVADVAAAIK G+YDIGIGAGLE M++N
Sbjct  128  AFCAGFPDTVSIRTVNRQCSSGLQAVADVAAAIKVGYYDIGIGAGLECMSIN  179



>gb|EMS48058.1| 3-ketoacyl-CoA thiolase 2, peroxisomal [Triticum urartu]
Length=453

 Score =   220 bits (560),  Expect = 9e-66, Method: Compositional matrix adjust.
 Identities = 112/141 (79%), Positives = 129/141 (91%), Gaps = 0/141 (0%)
 Frame = +3

Query  147  ASVCAAGDSAAYQRNSVYGDDIVIVAAYRTPLCKSKRGGFKDTYPDDLLASVLKALIEKT  326
            AS CAAGDSAAYQR+S +GDD+VIVAAYRTP+CK+KRGGFKDTYP+DLL  VLKA+++KT
Sbjct  36   ASACAAGDSAAYQRSSCFGDDVVIVAAYRTPICKAKRGGFKDTYPEDLLTPVLKAVLDKT  95

Query  327  NLNPSEVGDIIVGTVLAPGSIRASECRMAAFYAGFPETVPVRTVNRQCSSGLQavadvaa  506
             +NP+++GD++VGTVL PGS RA ECR A+  AG PETVPVRTVNRQCSSGLQAVADVAA
Sbjct  96   GINPAQIGDVVVGTVLGPGSQRAIECRTASLLAGIPETVPVRTVNRQCSSGLQAVADVAA  155

Query  507  aikaGFYDIGIGAGLESMTVN  569
            AIKAGFYDIGIGAGLESM+VN
Sbjct  156  AIKAGFYDIGIGAGLESMSVN  176



>ref|XP_008454504.1| PREDICTED: 3-ketoacyl-CoA thiolase 1, peroxisomal-like isoform 
X1 [Cucumis melo]
Length=502

 Score =   220 bits (561),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 124/172 (72%), Positives = 149/172 (87%), Gaps = 7/172 (4%)
 Frame = +3

Query  60   AIERQRVLLQHLRPTNAASSHDSIESSVSASVCAAGDSAA--YQRNSVYGDDIVIVAAYR  233
            A+ RQ+VLLQHL+P++++ S     +S+S SVCAAG+SA+  Y R + +GDDIVIVAA R
Sbjct  54   ALNRQKVLLQHLQPSSSSGS-----ASLSTSVCAAGESASNSYHRTAAFGDDIVIVAANR  108

Query  234  TPLCKSKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTVLAPGSIRASECRMA  413
            T +C++K+GGFKDT  +DLLASVLKA+IEKT LNP EVGDI+VGTVLAPGSIRASECRMA
Sbjct  109  TAICRAKKGGFKDTPAEDLLASVLKAVIEKTKLNPIEVGDIVVGTVLAPGSIRASECRMA  168

Query  414  AFYAGFPETVPVRTVNRQCSSGLQavadvaaaikaGFYDIGIGAGLESMTVN  569
            AF AGFP+TV +RTVNRQCSSGLQAVADVAAAIK G+YDIGIGAGLE M++N
Sbjct  169  AFCAGFPDTVSIRTVNRQCSSGLQAVADVAAAIKVGYYDIGIGAGLECMSIN  220



>ref|XP_007049827.1| Peroxisomal 3-ketoacyl-CoA thiolase 3 isoform 3 [Theobroma cacao]
 gb|EOX93984.1| Peroxisomal 3-ketoacyl-CoA thiolase 3 isoform 3 [Theobroma cacao]
Length=376

 Score =   216 bits (551),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 117/175 (67%), Positives = 141/175 (81%), Gaps = 5/175 (3%)
 Frame = +3

Query  60   AIERQRVLLQHLRPTNAASSHDSIESSVSA-----SVCAAGDSAAYQRNSVYGDDIVIVA  224
            A+ RQR+LL HLRP++++S      ++ +A     S+CAAGD +AY   + + +D+VIVA
Sbjct  4    ALNRQRILLHHLRPSSSSSHQSFDSAAAAAAALFPSICAAGDGSAYHGTAAFANDVVIVA  63

Query  225  AYRTPLCKSKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTVLAPGSIRASEC  404
            A RT +CK+KRGGFKDT  DDLLA VLKALI++T LNPSEVGDI+VGTVLAPGS R  EC
Sbjct  64   ACRTAICKAKRGGFKDTPADDLLAPVLKALIDRTKLNPSEVGDIVVGTVLAPGSQRGIEC  123

Query  405  RMAAFYAGFPETVPVRTVNRQCSSGLQavadvaaaikaGFYDIGIGAGLESMTVN  569
            RMAAFYAGFP+TVP++TVNRQCSSGLQAVADVA  IKAG YDIGI AGLESMT +
Sbjct  124  RMAAFYAGFPDTVPIKTVNRQCSSGLQAVADVALCIKAGLYDIGIAAGLESMTTD  178



>ref|XP_007049828.1| Peroxisomal 3-ketoacyl-CoA thiolase 3 isoform 4 [Theobroma cacao]
 gb|EOX93985.1| Peroxisomal 3-ketoacyl-CoA thiolase 3 isoform 4 [Theobroma cacao]
Length=374

 Score =   216 bits (551),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 117/175 (67%), Positives = 141/175 (81%), Gaps = 5/175 (3%)
 Frame = +3

Query  60   AIERQRVLLQHLRPTNAASSHDSIESSVSA-----SVCAAGDSAAYQRNSVYGDDIVIVA  224
            A+ RQR+LL HLRP++++S      ++ +A     S+CAAGD +AY   + + +D+VIVA
Sbjct  4    ALNRQRILLHHLRPSSSSSHQSFDSAAAAAAALFPSICAAGDGSAYHGTAAFANDVVIVA  63

Query  225  AYRTPLCKSKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTVLAPGSIRASEC  404
            A RT +CK+KRGGFKDT  DDLLA VLKALI++T LNPSEVGDI+VGTVLAPGS R  EC
Sbjct  64   ACRTAICKAKRGGFKDTPADDLLAPVLKALIDRTKLNPSEVGDIVVGTVLAPGSQRGIEC  123

Query  405  RMAAFYAGFPETVPVRTVNRQCSSGLQavadvaaaikaGFYDIGIGAGLESMTVN  569
            RMAAFYAGFP+TVP++TVNRQCSSGLQAVADVA  IKAG YDIGI AGLESMT +
Sbjct  124  RMAAFYAGFPDTVPIKTVNRQCSSGLQAVADVALCIKAGLYDIGIAAGLESMTTD  178



>gb|AFW74043.1| hypothetical protein ZEAMMB73_080325, partial [Zea mays]
Length=145

 Score =   208 bits (529),  Expect = 6e-65, Method: Compositional matrix adjust.
 Identities = 96/138 (70%), Positives = 120/138 (87%), Gaps = 3/138 (2%)
 Frame = +3

Query  60   AIERQRVLLQHLRPTNAASSHDSIESSVSASVCAAGDSAAYQRNSVYGDDIVIVAAYRTP  239
            AI+RQRVLL HL P+ +A+S    +  ++AS CAAGDSAAYQR+S +GDD+V+VAAYRTP
Sbjct  4    AIDRQRVLLAHLLPSPSAASS---QPQLAASACAAGDSAAYQRSSSFGDDVVVVAAYRTP  60

Query  240  LCKSKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTVLAPGSIRASECRMAAF  419
            +CK+KRGGFKDTYP+DLL  VLKA+++ T +NP+++GDI+VGTVL PGS RA+ECRMAA 
Sbjct  61   ICKAKRGGFKDTYPEDLLTVVLKAVLDNTRINPADIGDIVVGTVLGPGSQRANECRMAAL  120

Query  420  YAGFPETVPVRTVNRQCS  473
            +AGFPETVPVRTVNRQCS
Sbjct  121  FAGFPETVPVRTVNRQCS  138



>ref|XP_004152018.1| PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxisomal-like [Cucumis 
sativus]
 ref|XP_004163039.1| PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxisomal-like [Cucumis 
sativus]
 gb|KGN58339.1| hypothetical protein Csa_3G624070 [Cucumis sativus]
Length=452

 Score =   218 bits (554),  Expect = 6e-65, Method: Compositional matrix adjust.
 Identities = 123/172 (72%), Positives = 147/172 (85%), Gaps = 7/172 (4%)
 Frame = +3

Query  60   AIERQRVLLQHLRPTNAASSHDSIESSVSASVCAAGDSAA--YQRNSVYGDDIVIVAAYR  233
            A  RQ+VLLQHL+P++++ S     +S+S SVC AG+SA+  Y R + +GDDIVIVAA R
Sbjct  4    AFNRQKVLLQHLQPSSSSES-----ASLSTSVCVAGESASNSYHRTAAFGDDIVIVAANR  58

Query  234  TPLCKSKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTVLAPGSIRASECRMA  413
            T +C++K+GGFKDT  +DLLASVLKA+IEKT LNP EVGDI+VGTVLAPGSIRASECRMA
Sbjct  59   TAICRAKKGGFKDTPAEDLLASVLKAVIEKTKLNPIEVGDIVVGTVLAPGSIRASECRMA  118

Query  414  AFYAGFPETVPVRTVNRQCSSGLQavadvaaaikaGFYDIGIGAGLESMTVN  569
            AF AGFP+TV +RTVNRQCSSGLQAVADVAAAIK G+YDIGIGAGLE M++N
Sbjct  119  AFCAGFPDTVSIRTVNRQCSSGLQAVADVAAAIKVGYYDIGIGAGLECMSIN  170



>ref|XP_006280441.1| hypothetical protein CARUB_v10026373mg [Capsella rubella]
 gb|EOA13339.1| hypothetical protein CARUB_v10026373mg [Capsella rubella]
Length=457

 Score =   217 bits (552),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 115/170 (68%), Positives = 146/170 (86%), Gaps = 3/170 (2%)
 Frame = +3

Query  60   AIERQRVLLQHLRPTNAASSHDSIESSVSASVCAAGDSAAYQRNSVYGDDIVIVAAYRTP  239
            A ERQ++LL+HL P ++ SS  + E +V +SV  A + +     + +GDDIVIVAAYRT 
Sbjct  4    AAERQKILLRHLNPISSFSSSLNHEPTVLSSVNCASEVSPM---AAFGDDIVIVAAYRTA  60

Query  240  LCKSKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTVLAPGSIRASECRMAAF  419
            +CK+KRGGFKDT PDDLLASVLKA++E+T+L+PSEVGDI+VGTVLAPGS RA ECR+AA+
Sbjct  61   ICKAKRGGFKDTLPDDLLASVLKAVVERTSLDPSEVGDIVVGTVLAPGSQRAMECRVAAY  120

Query  420  YAGFPETVPVRTVNRQCSSGLQavadvaaaikaGFYDIGIGAGLESMTVN  569
            +AGFP++VP+RTVNRQCSSGLQAVADVAA+IKAG+YDIGIGAG+ESM+ +
Sbjct  121  FAGFPDSVPIRTVNRQCSSGLQAVADVAASIKAGYYDIGIGAGVESMSTD  170



>ref|XP_007049826.1| Peroxisomal 3-ketoacyl-CoA thiolase 3 isoform 2 [Theobroma cacao]
 gb|EOX93983.1| Peroxisomal 3-ketoacyl-CoA thiolase 3 isoform 2 [Theobroma cacao]
Length=472

 Score =   216 bits (550),  Expect = 4e-64, Method: Compositional matrix adjust.
 Identities = 117/175 (67%), Positives = 141/175 (81%), Gaps = 5/175 (3%)
 Frame = +3

Query  60   AIERQRVLLQHLRPTNAASSHDSIESSVSA-----SVCAAGDSAAYQRNSVYGDDIVIVA  224
            A+ RQR+LL HLRP++++S      ++ +A     S+CAAGD +AY   + + +D+VIVA
Sbjct  4    ALNRQRILLHHLRPSSSSSHQSFDSAAAAAAALFPSICAAGDGSAYHGTAAFANDVVIVA  63

Query  225  AYRTPLCKSKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTVLAPGSIRASEC  404
            A RT +CK+KRGGFKDT  DDLLA VLKALI++T LNPSEVGDI+VGTVLAPGS R  EC
Sbjct  64   ACRTAICKAKRGGFKDTPADDLLAPVLKALIDRTKLNPSEVGDIVVGTVLAPGSQRGIEC  123

Query  405  RMAAFYAGFPETVPVRTVNRQCSSGLQavadvaaaikaGFYDIGIGAGLESMTVN  569
            RMAAFYAGFP+TVP++TVNRQCSSGLQAVADVA  IKAG YDIGI AGLESMT +
Sbjct  124  RMAAFYAGFPDTVPIKTVNRQCSSGLQAVADVALCIKAGLYDIGIAAGLESMTTD  178



>ref|XP_007049825.1| Peroxisomal 3-ketoacyl-CoA thiolase 3 isoform 1 [Theobroma cacao]
 gb|EOX93982.1| Peroxisomal 3-ketoacyl-CoA thiolase 3 isoform 1 [Theobroma cacao]
Length=470

 Score =   216 bits (550),  Expect = 5e-64, Method: Compositional matrix adjust.
 Identities = 117/175 (67%), Positives = 141/175 (81%), Gaps = 5/175 (3%)
 Frame = +3

Query  60   AIERQRVLLQHLRPTNAASSHDSIESSVSA-----SVCAAGDSAAYQRNSVYGDDIVIVA  224
            A+ RQR+LL HLRP++++S      ++ +A     S+CAAGD +AY   + + +D+VIVA
Sbjct  4    ALNRQRILLHHLRPSSSSSHQSFDSAAAAAAALFPSICAAGDGSAYHGTAAFANDVVIVA  63

Query  225  AYRTPLCKSKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTVLAPGSIRASEC  404
            A RT +CK+KRGGFKDT  DDLLA VLKALI++T LNPSEVGDI+VGTVLAPGS R  EC
Sbjct  64   ACRTAICKAKRGGFKDTPADDLLAPVLKALIDRTKLNPSEVGDIVVGTVLAPGSQRGIEC  123

Query  405  RMAAFYAGFPETVPVRTVNRQCSSGLQavadvaaaikaGFYDIGIGAGLESMTVN  569
            RMAAFYAGFP+TVP++TVNRQCSSGLQAVADVA  IKAG YDIGI AGLESMT +
Sbjct  124  RMAAFYAGFPDTVPIKTVNRQCSSGLQAVADVALCIKAGLYDIGIAAGLESMTTD  178



>ref|XP_006395129.1| hypothetical protein EUTSA_v10004174mg [Eutrema salsugineum]
 gb|ESQ32415.1| hypothetical protein EUTSA_v10004174mg [Eutrema salsugineum]
Length=460

 Score =   215 bits (548),  Expect = 6e-64, Method: Compositional matrix adjust.
 Identities = 110/170 (65%), Positives = 145/170 (85%), Gaps = 0/170 (0%)
 Frame = +3

Query  60   AIERQRVLLQHLRPTNAASSHDSIESSVSASVCAAGDSAAYQRNSVYGDDIVIVAAYRTP  239
            A ERQ++LL+HL P  ++SS  ++     A + A   ++ +   + +GDDIVIVAAYRT 
Sbjct  4    ATERQKILLRHLNPIYSSSSSLTLIKDEPALLSAVNCASEFSPMAAFGDDIVIVAAYRTA  63

Query  240  LCKSKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTVLAPGSIRASECRMAAF  419
            +CK+KRGGFKDT PDDLLASVLKA++E+T+L+PSEVGDI+VGTV+APGS RA ECR+AA+
Sbjct  64   ICKAKRGGFKDTRPDDLLASVLKAVVERTSLDPSEVGDIVVGTVIAPGSQRAMECRVAAY  123

Query  420  YAGFPETVPVRTVNRQCSSGLQavadvaaaikaGFYDIGIGAGLESMTVN  569
            +AGFP+TVP+RTVNRQCSSGLQAVADVAA+I+AG+Y+IGIGAG+ESM+++
Sbjct  124  FAGFPDTVPIRTVNRQCSSGLQAVADVAASIRAGYYEIGIGAGVESMSID  173



>gb|KDO43600.1| hypothetical protein CISIN_1g012506mg [Citrus sinensis]
Length=438

 Score =   214 bits (546),  Expect = 7e-64, Method: Compositional matrix adjust.
 Identities = 125/170 (74%), Positives = 136/170 (80%), Gaps = 26/170 (15%)
 Frame = +3

Query  60   AIERQRVLLQHLRPTNAASSHDSIESSVSASVCAAGDSAAYQRNSVYGDDIVIVAAYRTP  239
            AI RQ+VLL+HLRP+N+ SSH+  ES +SAS CAAGDSAAY R SVYGDD+VIVAAYRT 
Sbjct  4    AINRQQVLLEHLRPSNS-SSHN-YESILSASACAAGDSAAYHRTSVYGDDVVIVAAYRTA  61

Query  240  LCKSKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTVLAPGSIRASECRMAAF  419
            LCKSKRGGFKDTYPDDLLA VLKA+IEKTN++PSEVGDI+V                   
Sbjct  62   LCKSKRGGFKDTYPDDLLAPVLKAVIEKTNVDPSEVGDIVV-------------------  102

Query  420  YAGFPETVPVRTVNRQCSSGLQavadvaaaikaGFYDIGIGAGLESMTVN  569
                 ETVPVRTVNRQCSSGLQAVADVAAAIKAGFYDIGIGAGLESMTVN
Sbjct  103  -----ETVPVRTVNRQCSSGLQAVADVAAAIKAGFYDIGIGAGLESMTVN  147



>ref|XP_002865685.1| KAT5/PKT1/PKT2 peroxisomal 3-keto-acyl-CoA thiolase [Arabidopsis 
lyrata subsp. lyrata]
 gb|EFH41944.1| KAT5/PKT1/PKT2 peroxisomal 3-keto-acyl-CoA thiolase [Arabidopsis 
lyrata subsp. lyrata]
Length=457

 Score =   214 bits (546),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 112/170 (66%), Positives = 146/170 (86%), Gaps = 3/170 (2%)
 Frame = +3

Query  60   AIERQRVLLQHLRPTNAASSHDSIESSVSASVCAAGDSAAYQRNSVYGDDIVIVAAYRTP  239
            A+ERQ++LL+HL P ++ +S  + E S+ + V  A + +     + +GDDIVIVAAYRT 
Sbjct  4    AVERQKILLRHLNPISSTNSSLNHEPSLFSLVNCASEVSPM---AAFGDDIVIVAAYRTA  60

Query  240  LCKSKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTVLAPGSIRASECRMAAF  419
            +CK++RGGFKDT PDDLLASVLKA++E+T+L+PSEVGDI+VGTV+APGS RA ECR+AA+
Sbjct  61   ICKARRGGFKDTLPDDLLASVLKAVVERTSLDPSEVGDIVVGTVIAPGSQRAMECRVAAY  120

Query  420  YAGFPETVPVRTVNRQCSSGLQavadvaaaikaGFYDIGIGAGLESMTVN  569
            +AGFP+TVPVRTVNRQCSSGLQAVADVAA+I+AG+YDIGIGAG+ESM+ +
Sbjct  121  FAGFPDTVPVRTVNRQCSSGLQAVADVAASIRAGYYDIGIGAGVESMSTD  170



>gb|EMS60447.1| 3-ketoacyl-CoA thiolase 2, peroxisomal [Triticum urartu]
Length=435

 Score =   212 bits (540),  Expect = 5e-63, Method: Compositional matrix adjust.
 Identities = 120/170 (71%), Positives = 138/170 (81%), Gaps = 3/170 (2%)
 Frame = +3

Query  60   AIERQRVLLQHLRPTNAASSHDSIESSVSASVCAAGDSAAYQRNSVYGDDIVIVAAYRTP  239
            A++RQR+LL+HL P   AS   S  S+   +   AGDSAAY R   + DD+VIVAAYRT 
Sbjct  4    ALDRQRILLRHLEPAAGASPAASAVSASVCA---AGDSAAYHRGPCFADDVVIVAAYRTA  60

Query  240  LCKSKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTVLAPGSIRASECRMAAF  419
            +CK+KRG FKDT P+DLL  V KAL++KT LNPSEVGDI+VGTVLAPGS RA ECRMAA 
Sbjct  61   ICKAKRGSFKDTLPEDLLVPVFKALVDKTKLNPSEVGDIVVGTVLAPGSQRAIECRMAAL  120

Query  420  YAGFPETVPVRTVNRQCSSGLQavadvaaaikaGFYDIGIGAGLESMTVN  569
            YAGFP+TVP++TVNRQCSSGLQAVADVAAAIKAG YDIGI AG+ESMTVN
Sbjct  121  YAGFPDTVPLKTVNRQCSSGLQAVADVAAAIKAGMYDIGIAAGVESMTVN  170



>ref|NP_568704.2| 3-keto-acyl-CoA thiolase 2 [Arabidopsis thaliana]
 ref|NP_001032037.1| 3-keto-acyl-CoA thiolase 2 [Arabidopsis thaliana]
 sp|Q570C8.2|THIK5_ARATH RecName: Full=3-ketoacyl-CoA thiolase 5, peroxisomal; AltName: 
Full=Acetyl-CoA acyltransferase 5; AltName: Full=Beta-ketothiolase 
5; AltName: Full=Peroxisomal 3-oxoacyl-CoA thiolase 
5; Flags: Precursor [Arabidopsis thaliana]
 gb|AAC17877.1| 3-keto-acyl-CoA thiolase 2 [Arabidopsis thaliana]
 gb|AAC23571.1| peroxisomal 3-keto-acyl-CoA thiolase 2 precursor [Arabidopsis 
thaliana]
 dbj|BAB09441.1| 3-keto-acyl-CoA thiolase 2 [Arabidopsis thaliana]
 gb|AAL84980.1| AT5g48880/K24G6_22 [Arabidopsis thaliana]
 gb|AED95737.1| 3-keto-acyl-CoA thiolase 2 [Arabidopsis thaliana]
 gb|AED95738.1| 3-keto-acyl-CoA thiolase 2 [Arabidopsis thaliana]
Length=457

 Score =   212 bits (540),  Expect = 8e-63, Method: Compositional matrix adjust.
 Identities = 110/170 (65%), Positives = 145/170 (85%), Gaps = 3/170 (2%)
 Frame = +3

Query  60   AIERQRVLLQHLRPTNAASSHDSIESSVSASVCAAGDSAAYQRNSVYGDDIVIVAAYRTP  239
            A+ERQ++LL+HL P ++++S    E S+ + V    + +     + +GDDIVIVAAYRT 
Sbjct  4    AMERQKILLRHLNPVSSSNSSLKHEPSLLSPVNCVSEVSPM---AAFGDDIVIVAAYRTA  60

Query  240  LCKSKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTVLAPGSIRASECRMAAF  419
            +CK++RGGFKDT PDDLLASVLKA++E+T+L+PSEVGDI+VGTV+APGS RA ECR+AA+
Sbjct  61   ICKARRGGFKDTLPDDLLASVLKAVVERTSLDPSEVGDIVVGTVIAPGSQRAMECRVAAY  120

Query  420  YAGFPETVPVRTVNRQCSSGLQavadvaaaikaGFYDIGIGAGLESMTVN  569
            +AGFP++VPVRTVNRQCSSGLQAVADVAA+I+AG+YDIGIGAG+ESM+ +
Sbjct  121  FAGFPDSVPVRTVNRQCSSGLQAVADVAASIRAGYYDIGIGAGVESMSTD  170



>ref|XP_010439766.1| PREDICTED: 3-ketoacyl-CoA thiolase 5, peroxisomal isoform X1 
[Camelina sativa]
Length=456

 Score =   211 bits (537),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 115/170 (68%), Positives = 144/170 (85%), Gaps = 4/170 (2%)
 Frame = +3

Query  60   AIERQRVLLQHLRPTNAASSHDSIESSVSASVCAAGDSAAYQRNSVYGDDIVIVAAYRTP  239
            A ERQ++LL+HL P  ++SS +   S +S   CA+  S      + +GDDIVIVAAYRT 
Sbjct  4    AAERQKILLRHLNPIPSSSSLNHESSVLSPVNCASEVSPM----AAFGDDIVIVAAYRTA  59

Query  240  LCKSKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTVLAPGSIRASECRMAAF  419
            +CK+KRGGFKDT PDDLLASVLKA++E+T+L+PSEVGDI+VGTVLAPGS RA ECR+AA+
Sbjct  60   ICKAKRGGFKDTLPDDLLASVLKAVVERTSLDPSEVGDIVVGTVLAPGSQRAMECRVAAY  119

Query  420  YAGFPETVPVRTVNRQCSSGLQavadvaaaikaGFYDIGIGAGLESMTVN  569
            +AGFP+TVP+RTVNRQCSSGLQAVADVAA+I+AG+YDIGIGAG+ESM+ +
Sbjct  120  FAGFPDTVPIRTVNRQCSSGLQAVADVAASIRAGYYDIGIGAGVESMSTD  169



>emb|CDY33940.1| BnaA02g30470D [Brassica napus]
Length=456

 Score =   209 bits (533),  Expect = 8e-62, Method: Compositional matrix adjust.
 Identities = 113/170 (66%), Positives = 144/170 (85%), Gaps = 5/170 (3%)
 Frame = +3

Query  60   AIERQRVLLQHLRPTNAASSHDSIESSVSASVCAAGDSAAYQRNSVYGDDIVIVAAYRTP  239
            A ERQ++LL+HL P ++ S      + +SA  CAA  S+     + +GDD+VIVAAYRT 
Sbjct  4    ATERQKILLRHLNPLSS-SPPPYKPTLLSAVNCAAELSSM----AAFGDDVVIVAAYRTA  58

Query  240  LCKSKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTVLAPGSIRASECRMAAF  419
            +CK+KRGGFKDT PDDLLASVLKA++E+T+L+PSEVGDI+VGTV+APGS RA ECR+AAF
Sbjct  59   ICKAKRGGFKDTLPDDLLASVLKAVVERTSLDPSEVGDIVVGTVIAPGSQRAMECRVAAF  118

Query  420  YAGFPETVPVRTVNRQCSSGLQavadvaaaikaGFYDIGIGAGLESMTVN  569
            +AGFP++VP+RTVNRQCSSGLQAVADVAA+I+AG+YDIGIGAG+ESM+ +
Sbjct  119  FAGFPDSVPIRTVNRQCSSGLQAVADVAASIRAGYYDIGIGAGVESMSTD  168



>ref|XP_009129750.1| PREDICTED: 3-ketoacyl-CoA thiolase 5, peroxisomal isoform X1 
[Brassica rapa]
Length=456

 Score =   207 bits (528),  Expect = 5e-61, Method: Compositional matrix adjust.
 Identities = 113/170 (66%), Positives = 143/170 (84%), Gaps = 5/170 (3%)
 Frame = +3

Query  60   AIERQRVLLQHLRPTNAASSHDSIESSVSASVCAAGDSAAYQRNSVYGDDIVIVAAYRTP  239
            A ERQ++LL+HL P ++ S      + +SA  CAA  S      + +GDD+VIVAAYRT 
Sbjct  4    ATERQKILLRHLYPLSS-SPPPYKPTLLSAVNCAAELSPM----ASFGDDVVIVAAYRTA  58

Query  240  LCKSKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTVLAPGSIRASECRMAAF  419
            +CK+KRGGFKDT PDDLLASVLKA++E+T+L+PSEVGDI+VGTV+APGS RA ECR+AA+
Sbjct  59   ICKAKRGGFKDTLPDDLLASVLKAVVERTSLDPSEVGDIVVGTVIAPGSQRAMECRVAAY  118

Query  420  YAGFPETVPVRTVNRQCSSGLQavadvaaaikaGFYDIGIGAGLESMTVN  569
            +AGFP+TVP+RTVNRQCSSGLQAVADVAA+I+AG+YDIGIGAG+ESM+ +
Sbjct  119  FAGFPDTVPIRTVNRQCSSGLQAVADVAASIRAGYYDIGIGAGVESMSTD  168



>ref|XP_007049829.1| Peroxisomal 3-ketoacyl-CoA thiolase 3 isoform 5, partial [Theobroma 
cacao]
 gb|EOX93986.1| Peroxisomal 3-ketoacyl-CoA thiolase 3 isoform 5, partial [Theobroma 
cacao]
Length=333

 Score =   203 bits (516),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 105/140 (75%), Positives = 120/140 (86%), Gaps = 0/140 (0%)
 Frame = +3

Query  150  SVCAAGDSAAYQRNSVYGDDIVIVAAYRTPLCKSKRGGFKDTYPDDLLASVLKALIEKTN  329
            S+CAAGD +AY   + + +D+VIVAA RT +CK+KRGGFKDT  DDLLA VLKALI++T 
Sbjct  9    SICAAGDGSAYHGTAAFANDVVIVAACRTAICKAKRGGFKDTPADDLLAPVLKALIDRTK  68

Query  330  LNPSEVGDIIVGTVLAPGSIRASECRMAAFYAGFPETVPVRTVNRQCSSGLQavadvaaa  509
            LNPSEVGDI+VGTVLAPGS R  ECRMAAFYAGFP+TVP++TVNRQCSSGLQAVADVA  
Sbjct  69   LNPSEVGDIVVGTVLAPGSQRGIECRMAAFYAGFPDTVPIKTVNRQCSSGLQAVADVALC  128

Query  510  ikaGFYDIGIGAGLESMTVN  569
            IKAG YDIGI AGLESMT +
Sbjct  129  IKAGLYDIGIAAGLESMTTD  148



>ref|XP_003574006.1| PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxisomal-like [Brachypodium 
distachyon]
Length=453

 Score =   206 bits (524),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 115/170 (68%), Positives = 135/170 (79%), Gaps = 11/170 (6%)
 Frame = +3

Query  60   AIERQRVLLQHLRPTNAASSHDSIESSVSASVCAAGDSAAYQRNSVYGDDIVIVAAYRTP  239
            A++RQR+LL+HL P  AA  + +  +  +++  A G          + DD+VIVAAYRT 
Sbjct  4    ALDRQRILLRHLEP--AAGPNPAASAISASACAAGG---------CFADDVVIVAAYRTA  52

Query  240  LCKSKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTVLAPGSIRASECRMAAF  419
            +CKSKRGGFKDT P+DLL  V KAL++KT LNPSE+GDI+VGTVLAPGS RA ECRMAA 
Sbjct  53   ICKSKRGGFKDTLPEDLLVPVFKALVDKTKLNPSEIGDIVVGTVLAPGSQRAIECRMAAL  112

Query  420  YAGFPETVPVRTVNRQCSSGLQavadvaaaikaGFYDIGIGAGLESMTVN  569
            YAGFP+TVP+RTVNRQCSSGLQAVADVAAAIKAG YDIGI AGLESMTVN
Sbjct  113  YAGFPDTVPLRTVNRQCSSGLQAVADVAAAIKAGMYDIGIAAGLESMTVN  162



>emb|CDY05657.1| BnaC02g38800D [Brassica napus]
Length=462

 Score =   205 bits (522),  Expect = 5e-60, Method: Compositional matrix adjust.
 Identities = 109/170 (64%), Positives = 144/170 (85%), Gaps = 0/170 (0%)
 Frame = +3

Query  60   AIERQRVLLQHLRPTNAASSHDSIESSVSASVCAAGDSAAYQRNSVYGDDIVIVAAYRTP  239
            A ERQ++L++HL P +++ S  SI  +    + A   +A     + +GDD+VIVAAYRT 
Sbjct  4    ATERQKILIRHLNPLSSSPSLPSINDNKPTLLSAVNCAAELSPMAAFGDDVVIVAAYRTA  63

Query  240  LCKSKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTVLAPGSIRASECRMAAF  419
            +CK+KRGGFKDT PDDLLASVLKA++E+T+L+PSEVGDI+VGTV+APGS RA ECR+AA+
Sbjct  64   ICKAKRGGFKDTLPDDLLASVLKAVVERTSLDPSEVGDIVVGTVIAPGSQRAMECRVAAY  123

Query  420  YAGFPETVPVRTVNRQCSSGLQavadvaaaikaGFYDIGIGAGLESMTVN  569
            +AGFP++VP+RTVNRQCSSGLQAVADVAA+I+AG+YDIGIGAG+ESM+++
Sbjct  124  FAGFPDSVPIRTVNRQCSSGLQAVADVAASIRAGYYDIGIGAGVESMSID  173



>ref|XP_010442336.1| PREDICTED: 3-ketoacyl-CoA thiolase 5, peroxisomal-like isoform 
X1 [Camelina sativa]
Length=458

 Score =   205 bits (521),  Expect = 5e-60, Method: Compositional matrix adjust.
 Identities = 114/172 (66%), Positives = 142/172 (83%), Gaps = 6/172 (3%)
 Frame = +3

Query  60   AIERQRVLLQHLRPTNAASSHDSIESS--VSASVCAAGDSAAYQRNSVYGDDIVIVAAYR  233
            A ERQ++ L+HL P  ++SS      S  +S   CA+  S      + +GDDIVIVAAYR
Sbjct  4    AAERQKIFLRHLNPIPSSSSSSLNHESSVLSPVNCASEVSPM----AAFGDDIVIVAAYR  59

Query  234  TPLCKSKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTVLAPGSIRASECRMA  413
            T +CK+KRGGFKDT PDDLLASVLKA++E+T+L+PSEVGDI+VGTVLAPGS RA ECR+A
Sbjct  60   TAICKAKRGGFKDTLPDDLLASVLKAVVERTSLDPSEVGDIVVGTVLAPGSQRAMECRVA  119

Query  414  AFYAGFPETVPVRTVNRQCSSGLQavadvaaaikaGFYDIGIGAGLESMTVN  569
            A++AGFP+TVP+RTVNRQCSSGLQAVADVAA+I+AG+YDIGIGAG+ESM+ +
Sbjct  120  AYFAGFPDTVPIRTVNRQCSSGLQAVADVAASIRAGYYDIGIGAGVESMSTD  171



>ref|XP_007225741.1| hypothetical protein PRUPE_ppa005421mg [Prunus persica]
 gb|EMJ26940.1| hypothetical protein PRUPE_ppa005421mg [Prunus persica]
Length=429

 Score =   204 bits (518),  Expect = 8e-60, Method: Compositional matrix adjust.
 Identities = 107/170 (63%), Positives = 121/170 (71%), Gaps = 34/170 (20%)
 Frame = +3

Query  60   AIERQRVLLQHLRPTNAASSHDSIESSVSASVCAAGDSAAYQRNSVYGDDIVIVAAYRTP  239
            A  RQRVLL HLRP+ ++S H +  SS+SAS C AGDSAAY R +V+GDD+VIVAAYRTP
Sbjct  4    AFNRQRVLLDHLRPS-SSSLHGTDPSSLSASACVAGDSAAYARKNVFGDDVVIVAAYRTP  62

Query  240  LCKSKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTVLAPGSIRASECRMAAF  419
            +CK+KRGGFKDT+ DDLLA VLKA+IEK+NLNPSEVGDI+VGTVLAPGS RASECRMAAF
Sbjct  63   ICKAKRGGFKDTHADDLLAPVLKAVIEKSNLNPSEVGDIVVGTVLAPGSQRASECRMAAF  122

Query  420  YAGFPETVPVRTVNRQCSSGLQavadvaaaikaGFYDIGIGAGLESMTVN  569
            YAGFP                                 GIGAGLESMT N
Sbjct  123  YAGFP---------------------------------GIGAGLESMTAN  139



>ref|XP_010482154.1| PREDICTED: 3-ketoacyl-CoA thiolase 5, peroxisomal-like isoform 
X1 [Camelina sativa]
Length=458

 Score =   204 bits (519),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 116/171 (68%), Positives = 145/171 (85%), Gaps = 4/171 (2%)
 Frame = +3

Query  60   AIERQRVLLQHLRPTN-AASSHDSIESSVSASVCAAGDSAAYQRNSVYGDDIVIVAAYRT  236
            A ERQ++LL+HL P   ++SS  + ESSV   V  A + +     + +GDDIVIVAAYRT
Sbjct  4    AAERQKILLRHLNPIPCSSSSSLNHESSVLYPVNCASEVSPM---AAFGDDIVIVAAYRT  60

Query  237  PLCKSKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTVLAPGSIRASECRMAA  416
             +CK+KRGGFKDT PDDLLASVLKA++E+T+L+PSEVGDI+VGTVLAPGS RA ECR+AA
Sbjct  61   AICKAKRGGFKDTLPDDLLASVLKAVVERTSLDPSEVGDIVVGTVLAPGSQRAMECRVAA  120

Query  417  FYAGFPETVPVRTVNRQCSSGLQavadvaaaikaGFYDIGIGAGLESMTVN  569
            ++AGFP+TVP+RTVNRQCSSGLQAVADVAA+I+AG+YDIGIGAG+ESM+ +
Sbjct  121  YFAGFPDTVPIRTVNRQCSSGLQAVADVAASIRAGYYDIGIGAGVESMSTD  171



>gb|ADE77908.1| unknown [Picea sitchensis]
Length=444

 Score =   200 bits (509),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 113/170 (66%), Positives = 133/170 (78%), Gaps = 8/170 (5%)
 Frame = +3

Query  69   RQRVLLQHLRPTNAAS--SHDSIESSVSASVCAAGDSA---AYQRNSVYGDDIVIVAAYR  233
            RQ+VL+ HL   + A   +H+ +   VS SVC  GDS    A    S   DD+VIVAAYR
Sbjct  2    RQQVLMGHLTGFSTAPLVAHNLL---VSPSVCMGGDSGIDHARAAESCNDDDVVIVAAYR  58

Query  234  TPLCKSKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTVLAPGSIRASECRMA  413
            TP C++KRGGFKDT P+DLL  VLKA++E+T + P EVGDI+VGTVLAPGS RA ECRMA
Sbjct  59   TPQCRAKRGGFKDTRPEDLLDPVLKAVVERTGIRPDEVGDIVVGTVLAPGSRRAMECRMA  118

Query  414  AFYAGFPETVPVRTVNRQCSSGLQavadvaaaikaGFYDIGIGAGLESMT  563
            AFYAGFPE+VP+RTVNRQCSSGLQAVADVA+AIK G+YDIGIGAGLE M+
Sbjct  119  AFYAGFPESVPIRTVNRQCSSGLQAVADVASAIKCGYYDIGIGAGLEFMS  168



>ref|XP_010439770.1| PREDICTED: 3-ketoacyl-CoA thiolase 5, peroxisomal isoform X2 
[Camelina sativa]
Length=414

 Score =   198 bits (503),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 99/126 (79%), Positives = 120/126 (95%), Gaps = 0/126 (0%)
 Frame = +3

Query  192  SVYGDDIVIVAAYRTPLCKSKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTV  371
            + +GDDIVIVAAYRT +CK+KRGGFKDT PDDLLASVLKA++E+T+L+PSEVGDI+VGTV
Sbjct  2    AAFGDDIVIVAAYRTAICKAKRGGFKDTLPDDLLASVLKAVVERTSLDPSEVGDIVVGTV  61

Query  372  LAPGSIRASECRMAAFYAGFPETVPVRTVNRQCSSGLQavadvaaaikaGFYDIGIGAGL  551
            LAPGS RA ECR+AA++AGFP+TVP+RTVNRQCSSGLQAVADVAA+I+AG+YDIGIGAG+
Sbjct  62   LAPGSQRAMECRVAAYFAGFPDTVPIRTVNRQCSSGLQAVADVAASIRAGYYDIGIGAGV  121

Query  552  ESMTVN  569
            ESM+ +
Sbjct  122  ESMSTD  127



>ref|XP_010482155.1| PREDICTED: 3-ketoacyl-CoA thiolase 5, peroxisomal-like isoform 
X2 [Camelina sativa]
Length=414

 Score =   198 bits (503),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 99/126 (79%), Positives = 120/126 (95%), Gaps = 0/126 (0%)
 Frame = +3

Query  192  SVYGDDIVIVAAYRTPLCKSKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTV  371
            + +GDDIVIVAAYRT +CK+KRGGFKDT PDDLLASVLKA++E+T+L+PSEVGDI+VGTV
Sbjct  2    AAFGDDIVIVAAYRTAICKAKRGGFKDTLPDDLLASVLKAVVERTSLDPSEVGDIVVGTV  61

Query  372  LAPGSIRASECRMAAFYAGFPETVPVRTVNRQCSSGLQavadvaaaikaGFYDIGIGAGL  551
            LAPGS RA ECR+AA++AGFP+TVP+RTVNRQCSSGLQAVADVAA+I+AG+YDIGIGAG+
Sbjct  62   LAPGSQRAMECRVAAYFAGFPDTVPIRTVNRQCSSGLQAVADVAASIRAGYYDIGIGAGV  121

Query  552  ESMTVN  569
            ESM+ +
Sbjct  122  ESMSTD  127



>ref|XP_010442338.1| PREDICTED: 3-ketoacyl-CoA thiolase 5, peroxisomal-like isoform 
X2 [Camelina sativa]
Length=414

 Score =   197 bits (502),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 99/126 (79%), Positives = 120/126 (95%), Gaps = 0/126 (0%)
 Frame = +3

Query  192  SVYGDDIVIVAAYRTPLCKSKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTV  371
            + +GDDIVIVAAYRT +CK+KRGGFKDT PDDLLASVLKA++E+T+L+PSEVGDI+VGTV
Sbjct  2    AAFGDDIVIVAAYRTAICKAKRGGFKDTLPDDLLASVLKAVVERTSLDPSEVGDIVVGTV  61

Query  372  LAPGSIRASECRMAAFYAGFPETVPVRTVNRQCSSGLQavadvaaaikaGFYDIGIGAGL  551
            LAPGS RA ECR+AA++AGFP+TVP+RTVNRQCSSGLQAVADVAA+I+AG+YDIGIGAG+
Sbjct  62   LAPGSQRAMECRVAAYFAGFPDTVPIRTVNRQCSSGLQAVADVAASIRAGYYDIGIGAGV  121

Query  552  ESMTVN  569
            ESM+ +
Sbjct  122  ESMSTD  127



>ref|XP_008349049.1| PREDICTED: 3-ketoacyl-CoA thiolase 2, peroxisomal-like [Malus 
domestica]
Length=129

 Score =   187 bits (476),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 89/126 (71%), Positives = 107/126 (85%), Gaps = 0/126 (0%)
 Frame = +3

Query  60   AIERQRVLLQHLRPTNAASSHDSIESSVSASVCAAGDSAAYQRNSVYGDDIVIVAAYRTP  239
            A+ RQRVLLQHLRP ++ SS +    ++SAS+CAAG+SAAY R + +GDD+VIVAAYRT 
Sbjct  4    AMNRQRVLLQHLRPNSSVSSSNFESVALSASICAAGNSAAYHRTAAFGDDVVIVAAYRTA  63

Query  240  LCKSKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTVLAPGSIRASECRMAAF  419
            +CK+KRGGFKDT PDDLLA VLK +IE+TNLNPSEVGDI+VGTV APGS+RA+ECRMAAF
Sbjct  64   ICKAKRGGFKDTLPDDLLAPVLKEVIERTNLNPSEVGDIVVGTVRAPGSLRATECRMAAF  123

Query  420  YAGFPE  437
            YA  P 
Sbjct  124  YASLPR  129



>ref|XP_006395130.1| hypothetical protein EUTSA_v10004174mg [Eutrema salsugineum]
 gb|ESQ32416.1| hypothetical protein EUTSA_v10004174mg [Eutrema salsugineum]
Length=414

 Score =   196 bits (497),  Expect = 7e-57, Method: Compositional matrix adjust.
 Identities = 97/126 (77%), Positives = 121/126 (96%), Gaps = 0/126 (0%)
 Frame = +3

Query  192  SVYGDDIVIVAAYRTPLCKSKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTV  371
            + +GDDIVIVAAYRT +CK+KRGGFKDT PDDLLASVLKA++E+T+L+PSEVGDI+VGTV
Sbjct  2    AAFGDDIVIVAAYRTAICKAKRGGFKDTRPDDLLASVLKAVVERTSLDPSEVGDIVVGTV  61

Query  372  LAPGSIRASECRMAAFYAGFPETVPVRTVNRQCSSGLQavadvaaaikaGFYDIGIGAGL  551
            +APGS RA ECR+AA++AGFP+TVP+RTVNRQCSSGLQAVADVAA+I+AG+Y+IGIGAG+
Sbjct  62   IAPGSQRAMECRVAAYFAGFPDTVPIRTVNRQCSSGLQAVADVAASIRAGYYEIGIGAGV  121

Query  552  ESMTVN  569
            ESM+++
Sbjct  122  ESMSID  127



>ref|XP_009129751.1| PREDICTED: 3-ketoacyl-CoA thiolase 5, peroxisomal isoform X2 
[Brassica rapa]
Length=415

 Score =   195 bits (495),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 97/124 (78%), Positives = 119/124 (96%), Gaps = 0/124 (0%)
 Frame = +3

Query  198  YGDDIVIVAAYRTPLCKSKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTVLA  377
            +GDD+VIVAAYRT +CK+KRGGFKDT PDDLLASVLKA++E+T+L+PSEVGDI+VGTV+A
Sbjct  4    FGDDVVIVAAYRTAICKAKRGGFKDTLPDDLLASVLKAVVERTSLDPSEVGDIVVGTVIA  63

Query  378  PGSIRASECRMAAFYAGFPETVPVRTVNRQCSSGLQavadvaaaikaGFYDIGIGAGLES  557
            PGS RA ECR+AA++AGFP+TVP+RTVNRQCSSGLQAVADVAA+I+AG+YDIGIGAG+ES
Sbjct  64   PGSQRAMECRVAAYFAGFPDTVPIRTVNRQCSSGLQAVADVAASIRAGYYDIGIGAGVES  123

Query  558  MTVN  569
            M+ +
Sbjct  124  MSTD  127



>dbj|BAF02017.1| peroxisomal-3-keto-acyl-CoA thiolase 1 [Arabidopsis thaliana]
Length=414

 Score =   194 bits (494),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 97/126 (77%), Positives = 120/126 (95%), Gaps = 0/126 (0%)
 Frame = +3

Query  192  SVYGDDIVIVAAYRTPLCKSKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTV  371
            + +GDDIVIVAAYRT +CK++RGGFKDT PDDLLASVLKA++E+T+L+PSEVGDI+VGTV
Sbjct  2    AAFGDDIVIVAAYRTAICKARRGGFKDTLPDDLLASVLKAVVERTSLDPSEVGDIVVGTV  61

Query  372  LAPGSIRASECRMAAFYAGFPETVPVRTVNRQCSSGLQavadvaaaikaGFYDIGIGAGL  551
            +APGS RA ECR+AA++AGFP++VPVRTVNRQCSSGLQAVADVAA+I+AG+YDIGIGAG+
Sbjct  62   IAPGSQRAMECRVAAYFAGFPDSVPVRTVNRQCSSGLQAVADVAASIRAGYYDIGIGAGV  121

Query  552  ESMTVN  569
            ESM+ +
Sbjct  122  ESMSTD  127



>ref|NP_851157.1| 3-keto-acyl-CoA thiolase 2 [Arabidopsis thaliana]
 gb|AAC17876.1| 3-keto-acyl-CoA-thiolase 1 [Arabidopsis thaliana]
 gb|AAC19122.1| peroxisomal-3-keto-acyl-CoA thiolase 1 [Arabidopsis thaliana]
 gb|AAM97120.1| 3-keto-acyl-CoA thiolase 2 [Arabidopsis thaliana]
 gb|AAO00954.1| 3-keto-acyl-CoA thiolase 2 [Arabidopsis thaliana]
 gb|AED95736.1| 3-keto-acyl-CoA thiolase 2 [Arabidopsis thaliana]
Length=414

 Score =   194 bits (494),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 97/126 (77%), Positives = 120/126 (95%), Gaps = 0/126 (0%)
 Frame = +3

Query  192  SVYGDDIVIVAAYRTPLCKSKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTV  371
            + +GDDIVIVAAYRT +CK++RGGFKDT PDDLLASVLKA++E+T+L+PSEVGDI+VGTV
Sbjct  2    AAFGDDIVIVAAYRTAICKARRGGFKDTLPDDLLASVLKAVVERTSLDPSEVGDIVVGTV  61

Query  372  LAPGSIRASECRMAAFYAGFPETVPVRTVNRQCSSGLQavadvaaaikaGFYDIGIGAGL  551
            +APGS RA ECR+AA++AGFP++VPVRTVNRQCSSGLQAVADVAA+I+AG+YDIGIGAG+
Sbjct  62   IAPGSQRAMECRVAAYFAGFPDSVPVRTVNRQCSSGLQAVADVAASIRAGYYDIGIGAGV  121

Query  552  ESMTVN  569
            ESM+ +
Sbjct  122  ESMSTD  127



>ref|XP_010547052.1| PREDICTED: 3-ketoacyl-CoA thiolase 5, peroxisomal isoform X3 
[Tarenaya hassleriana]
Length=426

 Score =   189 bits (481),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 95/126 (75%), Positives = 118/126 (94%), Gaps = 0/126 (0%)
 Frame = +3

Query  192  SVYGDDIVIVAAYRTPLCKSKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTV  371
            + +GDDIVIVAA+RT +CK++RGGFKDT  DDLLA+VLKA++E+T+L+PSEVGDI+VGTV
Sbjct  2    AAFGDDIVIVAAHRTAICKARRGGFKDTLADDLLATVLKAMVERTSLDPSEVGDIVVGTV  61

Query  372  LAPGSIRASECRMAAFYAGFPETVPVRTVNRQCSSGLQavadvaaaikaGFYDIGIGAGL  551
            +APGS RA ECR+AA+YAGFP++VP+RTVNRQCSSGLQAVADVAA+IKAGFYDIGI AG+
Sbjct  62   IAPGSQRAMECRVAAYYAGFPDSVPIRTVNRQCSSGLQAVADVAASIKAGFYDIGIAAGV  121

Query  552  ESMTVN  569
            ESM+ +
Sbjct  122  ESMSTD  127



>ref|XP_005646163.1| thiolase [Coccomyxa subellipsoidea C-169]
 gb|EIE21619.1| thiolase [Coccomyxa subellipsoidea C-169]
Length=470

 Score =   185 bits (469),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 95/168 (57%), Positives = 131/168 (78%), Gaps = 3/168 (2%)
 Frame = +3

Query  69   RQRVLLQHLRPT-NAASSHDSIESSVSASVCAAGDSAAYQRNSVYGDDIVIVAAYRTPLC  245
            RQ+VLL HLRP  N  ++ + ++  + AS CAAGDSAAY+R +   DD+VIV+A RTP+ 
Sbjct  13   RQQVLLNHLRPAGNTEAAFERMQ--LQASACAAGDSAAYERRASGPDDVVIVSALRTPIT  70

Query  246  KSKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTVLAPGSIRASECRMAAFYA  425
            K+KRGGFKDT PDDL+A+V +A +++T +NP+++GDI++G+VL   S RA + R+A F A
Sbjct  71   KAKRGGFKDTLPDDLMAAVFQATLDRTGINPADIGDIVIGSVLGDSSQRAIQVRIAGFLA  130

Query  426  GFPETVPVRTVNRQCSSGLQavadvaaaikaGFYDIGIGAGLESMTVN  569
            G PE V V TVNRQCSSGLQA+A VAAAI+AG+Y+IG+  G+E+M+ N
Sbjct  131  GIPENVAVHTVNRQCSSGLQAIASVAAAIQAGYYEIGLAGGVETMSTN  178



>gb|AIB06952.1| 3-ketoacyl-CoA thiolase [Vanda hybrid cultivar]
Length=450

 Score =   180 bits (456),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 124/170 (73%), Positives = 145/170 (85%), Gaps = 5/170 (3%)
 Frame = +3

Query  60   AIERQRVLLQHLRPTNAASSHDSIESSVSASVCAAGDSAAYQRNSVYGDDIVIVAAYRTP  239
            AI+RQ VL +HL+    +SS+D   +S+SASV AAGDS+AYQ+N  + DD+VIVAA RT 
Sbjct  4    AIDRQGVLRRHLQ----SSSYDH-PTSLSASVGAAGDSSAYQKNHGFDDDVVIVAACRTA  58

Query  240  LCKSKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTVLAPGSIRASECRMAAF  419
            + K+ RGGFKDT+ +DLLA +LKAL+EKT LNP EVGDI+VGTVLAPGS RA ECRMAAF
Sbjct  59   IGKANRGGFKDTHAEDLLAPLLKALLEKTKLNPYEVGDIVVGTVLAPGSQRAIECRMAAF  118

Query  420  YAGFPETVPVRTVNRQCSSGLQavadvaaaikaGFYDIGIGAGLESMTVN  569
            YAGFPETVP+RTVNRQCSSGLQAVADVAAAIKAG+Y IGIGAGLESM+ N
Sbjct  119  YAGFPETVPLRTVNRQCSSGLQAVADVAAAIKAGYYGIGIGAGLESMSSN  168



>ref|XP_002989683.1| hypothetical protein SELMODRAFT_447769 [Selaginella moellendorffii]
 gb|EFJ09160.1| hypothetical protein SELMODRAFT_447769 [Selaginella moellendorffii]
Length=408

 Score =   179 bits (453),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 89/122 (73%), Positives = 111/122 (91%), Gaps = 0/122 (0%)
 Frame = +3

Query  204  DDIVIVAAYRTPLCKSKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTVLAPG  383
            DD+VIVAA+RTP+CK+KRGGFKD++P+DLL  VLKA++  T + P+EVGDI+VGTV+APG
Sbjct  16   DDVVIVAAFRTPICKAKRGGFKDSFPEDLLVPVLKAVVAHTGVIPAEVGDIVVGTVIAPG  75

Query  384  SIRASECRMAAFYAGFPETVPVRTVNRQCSSGLQavadvaaaikaGFYDIGIGAGLESMT  563
            S RA+ECR+AA  AGFP+TVPVRTVNRQCSSGLQAV DVAAAIK+GFY+IGIGAG+E M+
Sbjct  76   SHRAAECRIAALLAGFPDTVPVRTVNRQCSSGLQAVGDVAAAIKSGFYEIGIGAGVECMS  135

Query  564  VN  569
            ++
Sbjct  136  ID  137



>ref|XP_002991797.1| hypothetical protein SELMODRAFT_236388 [Selaginella moellendorffii]
 gb|EFJ07201.1| hypothetical protein SELMODRAFT_236388 [Selaginella moellendorffii]
Length=395

 Score =   177 bits (450),  Expect = 4e-50, Method: Compositional matrix adjust.
 Identities = 88/122 (72%), Positives = 111/122 (91%), Gaps = 0/122 (0%)
 Frame = +3

Query  204  DDIVIVAAYRTPLCKSKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTVLAPG  383
            DD+VIVAA+RTP+CK+KRGGFKD++P+DLL  VLKA++  T + P++VGDI+VGTV+APG
Sbjct  6    DDVVIVAAFRTPICKAKRGGFKDSFPEDLLVPVLKAVVAHTGVIPADVGDIVVGTVIAPG  65

Query  384  SIRASECRMAAFYAGFPETVPVRTVNRQCSSGLQavadvaaaikaGFYDIGIGAGLESMT  563
            S RA+ECR+AA  AGFP+TVPVRTVNRQCSSGLQAV DVAAAIK+GFY+IGIGAG+E M+
Sbjct  66   SHRAAECRIAALLAGFPDTVPVRTVNRQCSSGLQAVGDVAAAIKSGFYEIGIGAGVECMS  125

Query  564  VN  569
            ++
Sbjct  126  ID  127



>ref|XP_002946078.1| hypothetical protein VOLCADRAFT_102696 [Volvox carteri f. nagariensis]
 gb|EFJ53073.1| hypothetical protein VOLCADRAFT_102696 [Volvox carteri f. nagariensis]
Length=462

 Score =   178 bits (452),  Expect = 8e-50, Method: Compositional matrix adjust.
 Identities = 94/167 (56%), Positives = 127/167 (76%), Gaps = 6/167 (4%)
 Frame = +3

Query  69   RQRVLLQHLRPTNAASSHDSIESSVSASVCAAGDSAAYQRNSVYGDDIVIVAAYRTPLCK  248
            R  VL +H+ P        S++       C+AGDSAAY+R++   DD+VIVAA RTPL K
Sbjct  10   RLSVLAKHICPVPNGVQGLSLQG------CSAGDSAAYERHNTADDDVVIVAALRTPLTK  63

Query  249  SKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTVLAPGSIRASECRMAAFYAG  428
            ++RGG KDT   DLLA+V KA++++T + P  +GDI++G+VL P S RA+ECR+A+F+AG
Sbjct  64   ARRGGLKDTDAVDLLATVFKAVLDRTGVEPQAIGDIVIGSVLGPSSQRANECRIASFFAG  123

Query  429  FPETVPVRTVNRQCSSGLQavadvaaaikaGFYDIGIGAGLESMTVN  569
             PETVPVRTVNRQCSSGLQA+ADVAAAI+AGFY +G+  G+E+M++N
Sbjct  124  IPETVPVRTVNRQCSSGLQAIADVAAAIRAGFYTVGLAGGVETMSLN  170



>ref|XP_001697225.1| acetyl-CoA acyltransferase [Chlamydomonas reinhardtii]
 gb|EDP00480.1| acetyl-CoA acyltransferase [Chlamydomonas reinhardtii]
Length=461

 Score =   173 bits (438),  Expect = 7e-48, Method: Compositional matrix adjust.
 Identities = 87/144 (60%), Positives = 117/144 (81%), Gaps = 0/144 (0%)
 Frame = +3

Query  138  SVSASVCAAGDSAAYQRNSVYGDDIVIVAAYRTPLCKSKRGGFKDTYPDDLLASVLKALI  317
            S+S   C+AGDSAAY+R +   DD+VIVA+ RTPL K+KRGG +DT   DLL+++ KA++
Sbjct  25   SLSLQTCSAGDSAAYERRNTADDDVVIVASLRTPLTKAKRGGLRDTDAADLLSTLFKAVL  84

Query  318  EKTNLNPSEVGDIIVGTVLAPGSIRASECRMAAFYAGFPETVPVRTVNRQCSSGLQavad  497
            E+T + P  +GDI++G+VL P S RA+ECR+A+F+AG P+ VPVRTVNRQCSSGLQA+AD
Sbjct  85   ERTGVEPQAIGDIVIGSVLGPSSQRANECRIASFFAGIPDVVPVRTVNRQCSSGLQAIAD  144

Query  498  vaaaikaGFYDIGIGAGLESMTVN  569
            VAAAIKAGFY +G+  G+E+M+ N
Sbjct  145  VAAAIKAGFYTVGLAGGVETMSSN  168



>dbj|BAA25250.1| mutated 3-ketoacyl-CoA thiolase [Arabidopsis thaliana]
Length=114

 Score =   161 bits (408),  Expect = 4e-47, Method: Compositional matrix adjust.
 Identities = 80/102 (78%), Positives = 92/102 (90%), Gaps = 2/102 (2%)
 Frame = +3

Query  60   AIERQRVLLQHLRPTNAASSHDSIESSVSASVCAAGDSAAYQRNSVYGDDIVIVAAYRTP  239
            AIERQRVLL+HLRP+ ++SSH+  E+S+SAS C AGDSAAYQR S+YGDD+VIVAA+RTP
Sbjct  4    AIERQRVLLEHLRPS-SSSSHN-YEASLSASACLAGDSAAYQRTSLYGDDVVIVAAHRTP  61

Query  240  LCKSKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVG  365
            LCKSKRG FKDTYPDDLLA VL+ALIEKTNLNPSEVGD+  G
Sbjct  62   LCKSKRGNFKDTYPDDLLAPVLRALIEKTNLNPSEVGDMGCG  103



>ref|XP_005845320.1| hypothetical protein CHLNCDRAFT_25846 [Chlorella variabilis]
 gb|EFN53218.1| hypothetical protein CHLNCDRAFT_25846 [Chlorella variabilis]
Length=354

 Score =   167 bits (423),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 95/171 (56%), Positives = 125/171 (73%), Gaps = 3/171 (2%)
 Frame = +3

Query  60   AIERQRVLLQHLRPTNAASSHDSIESSVSASVCAAGDSAAYQRNSVYGDDIVIVAAYRTP  239
            A  RQ+VLL HL    ++++      S   +  +AGDSAAY+R ++  DD+VIV+A RT 
Sbjct  4    AAHRQQVLLGHLEAAVSSAAPAPPPMSAHPT--SAGDSAAYERRNLACDDVVIVSACRTA  61

Query  240  LCKSKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTVLAPGSIRASECRMAAF  419
            LCK+KRGGFKDT  DDL+A+VLK  I ++ + P  VGD+  G+V+ P S RA+ECR+A F
Sbjct  62   LCKAKRGGFKDTPVDDLIATVLKETIRRSGVEPEAVGDVCFGSVMGPSSQRANECRIAMF  121

Query  420  YAGFPETVPVRTVNRQCSS-GLQavadvaaaikaGFYDIGIGAGLESMTVN  569
             AGFP +VPV TVNRQCSS GLQA+A VAA+IKAG+Y++GI  G+ESMT N
Sbjct  122  LAGFPTSVPVHTVNRQCSSAGLQAIAQVAASIKAGYYEVGIAGGVESMTTN  172



>gb|KIY92728.1| acetyl-CoA acyltransferase 1 [Monoraphidium neglectum]
Length=323

 Score =   162 bits (410),  Expect = 6e-45, Method: Compositional matrix adjust.
 Identities = 87/152 (57%), Positives = 120/152 (79%), Gaps = 1/152 (1%)
 Frame = +3

Query  114  SSHDSIESSVSASVCAAGDSAAYQRNSVYGDDIVIVAAYRTPLCKSKRGGFKDTYPDDLL  293
            ++H+S+ + +S   C+AGDS+AYQR     DD+VIV+A RTPL K++RGG +DT   DLL
Sbjct  17   TAHESM-AGLSLQSCSAGDSSAYQRQGAALDDVVIVSALRTPLTKARRGGLRDTDAVDLL  75

Query  294  ASVLKALIEKTNLNPSEVGDIIVGTVLAPGSIRASECRMAAFYAGFPETVPVRTVNRQCS  473
            A+V +A +++T + P+ +GD++VG+VL P S RA+E R+A F AG PETVPVRTVNRQCS
Sbjct  76   ATVYRATLDRTRVEPAALGDVVVGSVLGPSSQRANEARIAMFIAGIPETVPVRTVNRQCS  135

Query  474  SGLQavadvaaaikaGFYDIGIGAGLESMTVN  569
            SGLQAVADVAAAIKAG+Y +G+  G+E+M+ +
Sbjct  136  SGLQAVADVAAAIKAGYYSVGLACGVETMSAH  167



>gb|ACJ84675.1| unknown [Medicago truncatula]
Length=234

 Score =   154 bits (390),  Expect = 6e-43, Method: Compositional matrix adjust.
 Identities = 90/170 (53%), Positives = 106/170 (62%), Gaps = 47/170 (28%)
 Frame = +3

Query  60   AIERQRVLLQHLRPTNAASSHDSIESSVSASVCAAGDSAAYQRNSVYGDDIVIVAAYRTP  239
            AI RQ+VLLQHL P++ +S+  S  +S++AS C AGDSAAY R + +GDD+VIVAAYRT 
Sbjct  4    AINRQKVLLQHLNPSSFSSND-SSSTSLNASACLAGDSAAYHRTAAFGDDVVIVAAYRTA  62

Query  240  LCKSKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTVLAPGSIRASECRMAAF  419
            LCK KRGGFKDT+ DD+LA VLKA+IEKTNLNPSEVGDI+VG+VL               
Sbjct  63   LCKVKRGGFKDTHADDILAPVLKAVIEKTNLNPSEVGDIVVGSVLG--------------  108

Query  420  YAGFPETVPVRTVNRQCSSGLQavadvaaaikaGFYDIGIGAGLESMTVN  569
                                            AGFYDIGIGAGLESMT N
Sbjct  109  --------------------------------AGFYDIGIGAGLESMTTN  126



>ref|XP_011400620.1| 3-ketoacyl-CoA thiolase 2, peroxisomal [Auxenochlorella protothecoides]
 gb|KFM27633.1| 3-ketoacyl-CoA thiolase 2, peroxisomal [Auxenochlorella protothecoides]
Length=455

 Score =   153 bits (387),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 86/170 (51%), Positives = 117/170 (69%), Gaps = 10/170 (6%)
 Frame = +3

Query  60   AIERQRVLLQHLRPTNAASSHDSIESSVSASVCAAGDSAAYQRNSVYGDDIVIVAAYRTP  239
            A +RQ+VLL HL     AS+H + E +   +      + ++ R +   DD+VIV+  RT 
Sbjct  4    AAQRQKVLLSHL-----ASAHGTPEVAPQPT-----SAESHDRRAGDLDDVVIVSTCRTA  53

Query  240  LCKSKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTVLAPGSIRASECRMAAF  419
            LC+++RGGFKDT  DDL+A+VLK  + +T + P  VGDI+ G+V+ P S RA+E RMA  
Sbjct  54   LCRARRGGFKDTPVDDLIAAVLKDTLRRTGIEPEAVGDIVFGSVMGPSSQRANELRMAML  113

Query  420  YAGFPETVPVRTVNRQCSSGLQavadvaaaikaGFYDIGIGAGLESMTVN  569
            +AGFP TVPV T+NRQCSSGLQA+A VAA+IKAG+Y + I  G+E MT N
Sbjct  114  FAGFPHTVPVHTLNRQCSSGLQAMASVAASIKAGYYTMAIAGGVEHMTSN  163



>gb|KDO43604.1| hypothetical protein CISIN_1g012506mg [Citrus sinensis]
Length=388

 Score =   150 bits (380),  Expect = 6e-40, Method: Compositional matrix adjust.
 Identities = 83/89 (93%), Positives = 88/89 (99%), Gaps = 0/89 (0%)
 Frame = +3

Query  303  LKALIEKTNLNPSEVGDIIVGTVLAPGSIRASECRMAAFYAGFPETVPVRTVNRQCSSGL  482
            L+A+IEKTN++PSEVGDI+VGTVLAPGS RASECRMAAFYAGFPETVPVRTVNRQCSSGL
Sbjct  9    LQAVIEKTNVDPSEVGDIVVGTVLAPGSQRASECRMAAFYAGFPETVPVRTVNRQCSSGL  68

Query  483  QavadvaaaikaGFYDIGIGAGLESMTVN  569
            QAVADVAAAIKAGFYDIGIGAGLESMTVN
Sbjct  69   QAVADVAAAIKAGFYDIGIGAGLESMTVN  97



>emb|CEF98532.1| Thiolase-like, subgroup [Ostreococcus tauri]
Length=424

 Score =   150 bits (379),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 76/122 (62%), Positives = 100/122 (82%), Gaps = 0/122 (0%)
 Frame = +3

Query  204  DDIVIVAAYRTPLCKSKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTVLAPG  383
            DD+V+VAA RTP+ ++K+GG   T  DDL+A+VL+A   + N++PSEVGD++VG+VL   
Sbjct  41   DDVVVVAACRTPITRAKKGGLAKTPADDLVAAVLQAATRRANIDPSEVGDVVVGSVLGSS  100

Query  384  SIRASECRMAAFYAGFPETVPVRTVNRQCSSGLQavadvaaaikaGFYDIGIGAGLESMT  563
            S RA+ECR+A F AGFP+ VPVRT NRQCSSG+QA AD+AA IKAG+YD+GIGAG+E+MT
Sbjct  101  SQRANECRIAMFLAGFPKEVPVRTTNRQCSSGIQACADIAAGIKAGYYDVGIGAGVETMT  160

Query  564  VN  569
             N
Sbjct  161  SN  162



>gb|KDO65879.1| hypothetical protein CISIN_1g0125222mg, partial [Citrus sinensis]
Length=335

 Score =   144 bits (362),  Expect = 8e-38, Method: Compositional matrix adjust.
 Identities = 82/94 (87%), Positives = 86/94 (91%), Gaps = 1/94 (1%)
 Frame = +3

Query  288  LLASVLKALIEKTNLNPSEVGDIIVGTVLAPGSIRASECRMAAFYAGFPETVPVRTVNRQ  467
            LL SV +A+IEKT LNPSEVGDI+VGTVLAPGS RA ECRMAAFYAGFPETVP+RTVNRQ
Sbjct  16   LLFSV-QAVIEKTRLNPSEVGDIVVGTVLAPGSTRAMECRMAAFYAGFPETVPLRTVNRQ  74

Query  468  CSSGLQavadvaaaikaGFYDIGIGAGLESMTVN  569
            CSSGLQAVADVA AIKAG YDIGI AGLESMTVN
Sbjct  75   CSSGLQAVADVATAIKAGLYDIGIAAGLESMTVN  108



>ref|XP_003080093.1| Dynein 1-alpha heavy chain, flagellar inner arm (IC) [Ostreococcus 
tauri]
Length=5068

 Score =   149 bits (376),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 76/122 (62%), Positives = 100/122 (82%), Gaps = 0/122 (0%)
 Frame = +3

Query  204   DDIVIVAAYRTPLCKSKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTVLAPG  383
             DD+V+VAA RTP+ ++K+GG   T  DDL+A+VL+A   + N++PSEVGD++VG+VL   
Sbjct  4685  DDVVVVAACRTPITRAKKGGLAKTPADDLVAAVLQAATRRANIDPSEVGDVVVGSVLGSS  4744

Query  384   SIRASECRMAAFYAGFPETVPVRTVNRQCSSGLQavadvaaaikaGFYDIGIGAGLESMT  563
             S RA+ECR+A F AGFP+ VPVRT NRQCSSG+QA AD+AA IKAG+YD+GIGAG+E+MT
Sbjct  4745  SQRANECRIAMFLAGFPKEVPVRTTNRQCSSGIQACADIAAGIKAGYYDVGIGAGVETMT  4804

Query  564   VN  569
              N
Sbjct  4805  SN  4806



>gb|KJB42403.1| hypothetical protein B456_007G152600 [Gossypium raimondii]
Length=372

 Score =   142 bits (359),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 76/89 (85%), Positives = 84/89 (94%), Gaps = 0/89 (0%)
 Frame = +3

Query  303  LKALIEKTNLNPSEVGDIIVGTVLAPGSIRASECRMAAFYAGFPETVPVRTVNRQCSSGL  482
            ++A+I++T LNPSEVGDI+VGTVLAPGS RA ECRMAAFYAGFP+TVP+RTVNRQCSSGL
Sbjct  1    MQAVIDRTKLNPSEVGDIVVGTVLAPGSQRAMECRMAAFYAGFPDTVPIRTVNRQCSSGL  60

Query  483  QavadvaaaikaGFYDIGIGAGLESMTVN  569
            QAVADVAA IKAGFYDIGIGAGLESMT N
Sbjct  61   QAVADVAACIKAGFYDIGIGAGLESMTTN  89



>ref|XP_001418570.1| predicted protein [Ostreococcus lucimarinus CCE9901]
 gb|ABO96863.1| predicted protein [Ostreococcus lucimarinus CCE9901]
Length=417

 Score =   142 bits (359),  Expect = 8e-37, Method: Compositional matrix adjust.
 Identities = 74/122 (61%), Positives = 98/122 (80%), Gaps = 0/122 (0%)
 Frame = +3

Query  204  DDIVIVAAYRTPLCKSKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTVLAPG  383
            DD+VIV+A RTP+ ++KRGG   T  DDL+A+VL+A + +  ++ ++VGDI+VG+VL   
Sbjct  27   DDVVIVSACRTPITRAKRGGLAATPADDLIAAVLQASVARGKIDVNDVGDIVVGSVLGAS  86

Query  384  SIRASECRMAAFYAGFPETVPVRTVNRQCSSGLQavadvaaaikaGFYDIGIGAGLESMT  563
            S RA+ECR+  F AGFP+ VPVRT NRQCSSGLQA AD+AA IKAG+YD+GIGAG+E+MT
Sbjct  87   SQRANECRIGMFLAGFPKEVPVRTTNRQCSSGLQACADIAAGIKAGYYDMGIGAGVETMT  146

Query  564  VN  569
             N
Sbjct  147  AN  148



>ref|XP_643924.1| acetyl-CoA C-acyltransferase [Dictyostelium discoideum AX4]
 gb|EAL70062.1| acetyl-CoA C-acyltransferase [Dictyostelium discoideum AX4]
Length=416

 Score =   142 bits (359),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 74/123 (60%), Positives = 96/123 (78%), Gaps = 0/123 (0%)
 Frame = +3

Query  201  GDDIVIVAAYRTPLCKSKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTVLAP  380
            GDDIVIVA +RT +CK+KRG FK+T PDDLLA V+K +I+ T L+P  +GD+++G VL  
Sbjct  32   GDDIVIVAPFRTAICKAKRGAFKETAPDDLLAPVIKHIIKVTKLDPKLIGDVVMGAVLPR  91

Query  381  GSIRASECRMAAFYAGFPETVPVRTVNRQCSSGLQavadvaaaikaGFYDIGIGAGLESM  560
             S  A+E R+A   AG P+ VP  TVNRQCSSGLQA+A+ AAA+KAGFYDIG+  G+ESM
Sbjct  92   SSQGATEVRVATLLAGLPKEVPCYTVNRQCSSGLQAIANCAAAVKAGFYDIGLAGGVESM  151

Query  561  TVN  569
            ++N
Sbjct  152  SLN  154



>ref|XP_007513169.1| unknown [Bathycoccus prasinos]
 emb|CCO16727.1| unknown [Bathycoccus prasinos]
Length=448

 Score =   142 bits (359),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 74/125 (59%), Positives = 101/125 (81%), Gaps = 1/125 (1%)
 Frame = +3

Query  198  YGDDIVIVAAYRTPLCKSKRGGFKDTYPDDLLASVLKALIEKT-NLNPSEVGDIIVGTVL  374
            + DD+VIV A RTP+ ++++GG KDT  DDL+A+VL A + +T N+N +++GD++VG+VL
Sbjct  56   HPDDVVIVCALRTPITRARKGGLKDTTADDLVATVLAAALRETENINANDIGDVVVGSVL  115

Query  375  APGSIRASECRMAAFYAGFPETVPVRTVNRQCSSGLQavadvaaaikaGFYDIGIGAGLE  554
               S RA+ECR+  F AGFP  VPVRTVNRQCSSGLQA ADVA+AIKAG+Y++GI AG+E
Sbjct  116  GDSSQRANECRIGMFLAGFPVKVPVRTVNRQCSSGLQACADVASAIKAGYYEVGIAAGVE  175

Query  555  SMTVN  569
            +M+ N
Sbjct  176  TMSKN  180



>ref|XP_011328216.1| 3-ketoacyl-CoA thiolase [Fusarium graminearum PH-1]
 gb|ESU16100.1| 3-ketoacyl-CoA thiolase [Fusarium graminearum PH-1]
 gb|EYB31146.1| hypothetical protein FG05_09503 [Fusarium graminearum]
Length=418

 Score =   141 bits (355),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 79/147 (54%), Positives = 102/147 (69%), Gaps = 4/147 (3%)
 Frame = +3

Query  129  IESSVSASVCAAGDSAAYQRNSVYGDDIVIVAAYRTPLCKSKRGGFKDTYPDDLLASVLK  308
            I   +S +  A G     Q+N    DDIV+ AA R+   K  RGGFKDT+  DL+A VLK
Sbjct  10   IGGQISGNPTAGGREKILQKNP---DDIVVTAACRSAFTKGGRGGFKDTHAADLMAGVLK  66

Query  309  ALIEKTNLNPSEVGDIIVGTVLAPGSIRASECRMAAFYAGFPETVPVRTVNRQCSSGLQa  488
            A+++++ +NP+ V D+ VGTVLAPG   A+E R A+  AGFPE++ VRT+NRQCSSGLQA
Sbjct  67   AILDRSKINPALVEDLCVGTVLAPGG-GATEMRAASLVAGFPESIAVRTLNRQCSSGLQA  125

Query  489  vadvaaaikaGFYDIGIGAGLESMTVN  569
              DVA  IK G  DIGIGAG+ESM++N
Sbjct  126  TVDVANQIKTGMIDIGIGAGVESMSIN  152



>ref|XP_009262137.1| hypothetical protein FPSE_10745 [Fusarium pseudograminearum CS3096]
 gb|EKJ69076.1| hypothetical protein FPSE_10745 [Fusarium pseudograminearum CS3096]
Length=418

 Score =   141 bits (355),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 79/147 (54%), Positives = 102/147 (69%), Gaps = 4/147 (3%)
 Frame = +3

Query  129  IESSVSASVCAAGDSAAYQRNSVYGDDIVIVAAYRTPLCKSKRGGFKDTYPDDLLASVLK  308
            I   +S +  A G     Q+N    DDIV+ AA R+   K  RGGFKDT+  DL+A VLK
Sbjct  10   IGGQISGNPTAGGREKILQKNP---DDIVVTAACRSAFTKGGRGGFKDTHAADLMAGVLK  66

Query  309  ALIEKTNLNPSEVGDIIVGTVLAPGSIRASECRMAAFYAGFPETVPVRTVNRQCSSGLQa  488
            A+++++ +NP+ V D+ VGTVLAPG   A+E R A+  AGFPE++ VRT+NRQCSSGLQA
Sbjct  67   AILDRSKINPALVEDLCVGTVLAPGG-GATEMRAASLVAGFPESIAVRTLNRQCSSGLQA  125

Query  489  vadvaaaikaGFYDIGIGAGLESMTVN  569
              DVA  IK G  DIGIGAG+ESM++N
Sbjct  126  TVDVANQIKTGMIDIGIGAGVESMSIN  152



>gb|EIE80258.1| hypothetical protein RO3G_04963 [Rhizopus delemar RA 99-880]
Length=415

 Score =   140 bits (354),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 74/122 (61%), Positives = 94/122 (77%), Gaps = 1/122 (1%)
 Frame = +3

Query  204  DDIVIVAAYRTPLCKSKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTVLAPG  383
            +D+VIVAA RT + ++++GGFKDT P+++LA V K LIE+T ++P+ V DI VG VL PG
Sbjct  28   EDVVIVAALRTAITRARKGGFKDTLPEEMLAGVFKGLIEQTKIDPAIVNDIAVGNVLPPG  87

Query  384  SIRASECRMAAFYAGFPETVPVRTVNRQCSSGLQavadvaaaikaGFYDIGIGAGLESMT  563
               A+  RMAA YAGFPET  V TVNRQCSSGLQAV  +A AI+AG  ++GIGAG+ESMT
Sbjct  88   G-GATNARMAALYAGFPETSSVNTVNRQCSSGLQAVVQIATAIQAGLIEVGIGAGVESMT  146

Query  564  VN  569
             N
Sbjct  147  KN  148



>ref|XP_002591918.1| hypothetical protein BRAFLDRAFT_284464 [Branchiostoma floridae]
 gb|EEN47929.1| hypothetical protein BRAFLDRAFT_284464 [Branchiostoma floridae]
Length=430

 Score =   140 bits (354),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 84/167 (50%), Positives = 108/167 (65%), Gaps = 10/167 (6%)
 Frame = +3

Query  63   IERQRVLLQHLRPTNAASSHDSIESSVSASVCAAGDSAAYQRNSVYGDDIVIVAAYRTPL  242
            +ER + +  H+   N A +          S  +   +    R +   DD+VI++A RTP+
Sbjct  1    MERMQTIFGHISVPNRAQNQ---------SFSSLAQNEVKGRFAESEDDVVIISALRTPI  51

Query  243  CKSKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTVLAPGSIRASECRMAAFY  422
             K+ RG FKDT PDDLL SVLKA +E+TN+NPSE+GDI VG VL PG+  A   R+A F 
Sbjct  52   GKAARGSFKDTTPDDLLVSVLKATLERTNVNPSEIGDICVGNVLQPGAGPAV-FRIAQFA  110

Query  423  AGFPETVPVRTVNRQCSSGLQavadvaaaikaGFYDIGIGAGLESMT  563
            AG PETVP+   NRQCSSGLQAV  VA +IKAG  D+ IGAG+ESM+
Sbjct  111  AGIPETVPLSACNRQCSSGLQAVMHVANSIKAGVCDMAIGAGVESMS  157



>emb|CEF85217.1| unnamed protein product [Fusarium graminearum]
Length=439

 Score =   140 bits (354),  Expect = 5e-36, Method: Compositional matrix adjust.
 Identities = 79/147 (54%), Positives = 102/147 (69%), Gaps = 4/147 (3%)
 Frame = +3

Query  129  IESSVSASVCAAGDSAAYQRNSVYGDDIVIVAAYRTPLCKSKRGGFKDTYPDDLLASVLK  308
            I   +S +  A G     Q+N    DDIV+ AA R+   K  RGGFKDT+  DL+A VLK
Sbjct  31   IGGQISGNPTAGGREKILQKNP---DDIVVTAACRSAFTKGGRGGFKDTHAADLMAGVLK  87

Query  309  ALIEKTNLNPSEVGDIIVGTVLAPGSIRASECRMAAFYAGFPETVPVRTVNRQCSSGLQa  488
            A+++++ +NP+ V D+ VGTVLAPG   A+E R A+  AGFPE++ VRT+NRQCSSGLQA
Sbjct  88   AILDRSKINPALVEDLCVGTVLAPGG-GATEMRAASLVAGFPESIAVRTLNRQCSSGLQA  146

Query  489  vadvaaaikaGFYDIGIGAGLESMTVN  569
              DVA  IK G  DIGIGAG+ESM++N
Sbjct  147  TVDVANQIKTGMIDIGIGAGVESMSIN  173



>gb|KIL93411.1| hypothetical protein FAVG1_03392 [Fusarium avenaceum]
Length=418

 Score =   140 bits (352),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 78/147 (53%), Positives = 102/147 (69%), Gaps = 4/147 (3%)
 Frame = +3

Query  129  IESSVSASVCAAGDSAAYQRNSVYGDDIVIVAAYRTPLCKSKRGGFKDTYPDDLLASVLK  308
            I   +S +  A G     Q+N    DDIV+ AA R+   K  RGGFKDT+  D++A VLK
Sbjct  10   IGGQISGNPTAGGREKLLQKNP---DDIVVTAACRSAFTKGGRGGFKDTHAADIMAGVLK  66

Query  309  ALIEKTNLNPSEVGDIIVGTVLAPGSIRASECRMAAFYAGFPETVPVRTVNRQCSSGLQa  488
            A+++++ +NP+ V D+ VGTVLAPG   A+E R A+  AGFPE++ VRT+NRQCSSGLQA
Sbjct  67   AILDRSKINPALVEDLCVGTVLAPGG-GATEMRAASLAAGFPESIAVRTLNRQCSSGLQA  125

Query  489  vadvaaaikaGFYDIGIGAGLESMTVN  569
              DVA  IK G  DIGIGAG+ESM++N
Sbjct  126  TVDVANQIKTGMIDIGIGAGVESMSIN  152



>emb|CCF32753.1| acetyl-CoA acetyltransferase [Colletotrichum higginsianum]
Length=415

 Score =   139 bits (350),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 76/145 (52%), Positives = 96/145 (66%), Gaps = 4/145 (3%)
 Frame = +3

Query  135  SSVSASVCAAGDSAAYQRNSVYGDDIVIVAAYRTPLCKSKRGGFKDTYPDDLLASVLKAL  314
            + +     A G     Q+N+   DD+V+ AA RTP  K  +GGFKDT   DL+A  LKAL
Sbjct  8    TQLGGQFTAGGKDKILQKNA---DDVVVTAALRTPFTKGGKGGFKDTQAADLMAGALKAL  64

Query  315  IEKTNLNPSEVGDIIVGTVLAPGSIRASECRMAAFYAGFPETVPVRTVNRQCSSGLQava  494
            +E++ ++P+ V DI VGTVLAPG   A+E R AA  AGFP+T  VRT+NRQCSSGLQA  
Sbjct  65   LERSKIDPALVEDIAVGTVLAPGG-GATEMRAAALVAGFPQTTAVRTLNRQCSSGLQASV  123

Query  495  dvaaaikaGFYDIGIGAGLESMTVN  569
            D+   IK G  DIGIGAG+ESM+  
Sbjct  124  DIINQIKTGMIDIGIGAGVESMSTQ  148



>ref|XP_960422.1| 3-ketoacyl-CoA thiolase [Neurospora crassa OR74A]
 ref|XP_009854111.1| 3-ketoacyl-CoA thiolase [Neurospora tetrasperma FGSC 2508]
 gb|EAA31186.1| 3-ketoacyl-CoA thiolase [Neurospora crassa OR74A]
 gb|EGO54113.1| 3-ketoacyl-CoA thiolase [Neurospora tetrasperma FGSC 2508]
 gb|EGZ68464.1| 3-ketoacyl-CoA thiolase [Neurospora tetrasperma FGSC 2509]
 gb|KHE88997.1| hypothetical protein GE21DRAFT_8776 [Neurospora crassa]
Length=419

 Score =   139 bits (349),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 77/147 (52%), Positives = 101/147 (69%), Gaps = 4/147 (3%)
 Frame = +3

Query  129  IESSVSASVCAAGDSAAYQRNSVYGDDIVIVAAYRTPLCKSKRGGFKDTYPDDLLASVLK  308
            I + +SA V   G     Q+N+   DDIV+  A RTP  K  +GGFKDT+  DL+A  L+
Sbjct  10   IGNQISAGVTGGGRDQILQKNA---DDIVVTCALRTPFTKGGKGGFKDTHAADLMAGALR  66

Query  309  ALIEKTNLNPSEVGDIIVGTVLAPGSIRASECRMAAFYAGFPETVPVRTVNRQCSSGLQa  488
             LIE++ ++PS V DI VGTVLAPG   A+E R AA  AGFPE+  V T+NRQCSSGLQA
Sbjct  67   GLIERSKIDPSLVEDIKVGTVLAPGG-GATEMRAAALVAGFPESTAVHTLNRQCSSGLQA  125

Query  489  vadvaaaikaGFYDIGIGAGLESMTVN  569
              D+A AI++G  ++G+GAG+ESM+ N
Sbjct  126  CVDIANAIRSGMIEVGVGAGVESMSTN  152



>gb|KDD73648.1| beta-ketoacyl-ACP synthase, partial [Helicosporidium sp. ATCC 
50920]
Length=427

 Score =   139 bits (349),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 70/122 (57%), Positives = 95/122 (78%), Gaps = 0/122 (0%)
 Frame = +3

Query  204  DDIVIVAAYRTPLCKSKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTVLAPG  383
            DD+ IV+A RTPL KS RGG KDT   DL+A+VL   + +T ++P +VGD+++G+V+   
Sbjct  16   DDVCIVSACRTPLTKSNRGGLKDTPAHDLVAAVLAETVRRTGVDPKDVGDVVLGSVMGHS  75

Query  384  SIRASECRMAAFYAGFPETVPVRTVNRQCSSGLQavadvaaaikaGFYDIGIGAGLESMT  563
            S RA+ECR+  F AGFP+TVPV TVNRQCSSGLQA+A VAAAIK+G+Y +GI  G+E+M+
Sbjct  76   SQRANECRIGMFLAGFPDTVPVHTVNRQCSSGLQAIASVAAAIKSGYYSVGIAGGVETMS  135

Query  564  VN  569
             +
Sbjct  136  AD  137



>gb|EGU82326.1| hypothetical protein FOXB_07155 [Fusarium oxysporum Fo5176]
 emb|CCT65134.1| probable Acetyl-CoA acyltransferase [Fusarium fujikuroi IMI 58289]
 gb|EWY95746.1| acetyl-CoA acyltransferase [Fusarium oxysporum FOSC 3-a]
 gb|EWZ42455.1| acetyl-CoA acyltransferase [Fusarium oxysporum Fo47]
 gb|EXA00448.1| acetyl-CoA acyltransferase [Fusarium oxysporum f. sp. lycopersici 
MN25]
 gb|EXA47274.1| acetyl-CoA acyltransferase [Fusarium oxysporum f. sp. pisi HDV247]
 gb|EXK35591.1| acetyl-CoA acyltransferase [Fusarium oxysporum f. sp. melonis 
26406]
 gb|EXK94411.1| acetyl-CoA acyltransferase [Fusarium oxysporum f. sp. raphani 
54005]
 gb|EXL59127.1| acetyl-CoA acyltransferase [Fusarium oxysporum f. sp. radicis-lycopersici 
26381]
 gb|EXL88860.1| acetyl-CoA acyltransferase [Fusarium oxysporum f. sp. conglutinans 
race 2 54008]
 gb|EXM02957.1| acetyl-CoA acyltransferase [Fusarium oxysporum f. sp. cubense 
tropical race 4 54006]
 gb|EXM31955.1| acetyl-CoA acyltransferase [Fusarium oxysporum f. sp. vasinfectum 
25433]
Length=418

 Score =   138 bits (348),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 79/147 (54%), Positives = 101/147 (69%), Gaps = 4/147 (3%)
 Frame = +3

Query  129  IESSVSASVCAAGDSAAYQRNSVYGDDIVIVAAYRTPLCKSKRGGFKDTYPDDLLASVLK  308
            I   +S +  A G     Q+N    DDIV+ AA R+   K  RGGFKDT   DL+A VLK
Sbjct  10   IGGQISGNPTAGGREKILQKNP---DDIVVTAACRSAFTKGGRGGFKDTPAADLMAGVLK  66

Query  309  ALIEKTNLNPSEVGDIIVGTVLAPGSIRASECRMAAFYAGFPETVPVRTVNRQCSSGLQa  488
            A+++++ +NP+ V D+ VGTVLAPG   A+E R A+  AGFPE++ VRT+NRQCSSGLQA
Sbjct  67   AILDRSKINPALVEDLCVGTVLAPGG-GATEMRAASLVAGFPESIAVRTLNRQCSSGLQA  125

Query  489  vadvaaaikaGFYDIGIGAGLESMTVN  569
              DVA  IK G  DIGIGAG+ESM++N
Sbjct  126  TVDVANQIKTGMIDIGIGAGVESMSLN  152



>gb|EWG42127.1| acetyl-CoA acyltransferase [Fusarium verticillioides 7600]
Length=418

 Score =   138 bits (347),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 79/147 (54%), Positives = 101/147 (69%), Gaps = 4/147 (3%)
 Frame = +3

Query  129  IESSVSASVCAAGDSAAYQRNSVYGDDIVIVAAYRTPLCKSKRGGFKDTYPDDLLASVLK  308
            I   +S +  A G     Q+N    DDIV+ AA R+   K  RGGFKDT   DL+A VLK
Sbjct  10   IGGQISGNPTAGGRDKILQKNP---DDIVVTAACRSAFTKGGRGGFKDTPAADLMAGVLK  66

Query  309  ALIEKTNLNPSEVGDIIVGTVLAPGSIRASECRMAAFYAGFPETVPVRTVNRQCSSGLQa  488
            A+++++ +NP+ V D+ VGTVLAPG   A+E R A+  AGFPE++ VRT+NRQCSSGLQA
Sbjct  67   AILDRSKINPALVEDLCVGTVLAPGG-GATEMRAASLVAGFPESIAVRTLNRQCSSGLQA  125

Query  489  vadvaaaikaGFYDIGIGAGLESMTVN  569
              DVA  IK G  DIGIGAG+ESM++N
Sbjct  126  TVDVANQIKTGMIDIGIGAGVESMSLN  152



>ref|XP_004349337.1| peroxisomal 3-ketoacyl-CoA thiolase B [Capsaspora owczarzaki 
ATCC 30864]
 gb|KJE91455.1| peroxisomal 3-ketoacyl-CoA thiolase B [Capsaspora owczarzaki 
ATCC 30864]
Length=423

 Score =   138 bits (347),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 69/120 (58%), Positives = 94/120 (78%), Gaps = 1/120 (1%)
 Frame = +3

Query  204  DDIVIVAAYRTPLCKSKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTVLAPG  383
            DD+VIV+A RTP+ K+KRGGF+DT PDDLLA+ ++A +++ N++P  +GDI+VG VL PG
Sbjct  35   DDVVIVSAVRTPITKAKRGGFRDTPPDDLLAAAMQAAVQRANVDPKLIGDIVVGNVLQPG  94

Query  384  SIRASECRMAAFYAGFPETVPVRTVNRQCSSGLQavadvaaaikaGFYDIGIGAGLESMT  563
            +  A   R A F+AG PET P+  VNRQCSSGLQA A++A++I+ G  DIG+ AG+ESMT
Sbjct  95   A-GALTSRFAQFFAGIPETTPIVAVNRQCSSGLQACANIASSIRFGTIDIGLAAGVESMT  153



>ref|XP_003353115.1| hypothetical protein SMAC_03432 [Sordaria macrospora k-hell]
 emb|CCC09876.1| unnamed protein product [Sordaria macrospora k-hell]
Length=419

 Score =   137 bits (346),  Expect = 5e-35, Method: Compositional matrix adjust.
 Identities = 76/147 (52%), Positives = 100/147 (68%), Gaps = 4/147 (3%)
 Frame = +3

Query  129  IESSVSASVCAAGDSAAYQRNSVYGDDIVIVAAYRTPLCKSKRGGFKDTYPDDLLASVLK  308
            I + +SA V   G     Q+N+   DDIV+  A RTP  K  +GGFKDT+  DL+A  L+
Sbjct  10   IGNQISAGVTGGGRDKILQKNA---DDIVVTCALRTPFTKGGKGGFKDTHAADLMAGALR  66

Query  309  ALIEKTNLNPSEVGDIIVGTVLAPGSIRASECRMAAFYAGFPETVPVRTVNRQCSSGLQa  488
             LIE++ ++P+ V DI VGTVLAPG   A+E R AA  AGFPE+  V T+NRQCSSGLQA
Sbjct  67   GLIERSKIDPALVEDIKVGTVLAPGG-GATEMRAAALVAGFPESTAVHTLNRQCSSGLQA  125

Query  489  vadvaaaikaGFYDIGIGAGLESMTVN  569
              D+A  I+AG  ++G+GAG+ESM+ N
Sbjct  126  CVDIANQIRAGMIEVGVGAGVESMSTN  152



>emb|CDO68177.1| hypothetical protein BN946_scf184938.g29 [Trametes cinnabarina]
Length=415

 Score =   137 bits (346),  Expect = 6e-35, Method: Compositional matrix adjust.
 Identities = 74/134 (55%), Positives = 98/134 (73%), Gaps = 1/134 (1%)
 Frame = +3

Query  162  AGDSAAYQRNSVYGDDIVIVAAYRTPLCKSKRGGFKDTYPDDLLASVLKALIEKTNLNPS  341
            AG SA  +  + + DD+VIVAA R+ + K+K+GGFKDT P+++L+ VL+A+  K  +NP+
Sbjct  12   AGLSAKAKALAQHDDDVVIVAAVRSAITKAKKGGFKDTRPEEILSGVLRAVYTKAGINPA  71

Query  342  EVGDIIVGTVLAPGSIRASECRMAAFYAGFPETVPVRTVNRQCSSGLQavadvaaaikaG  521
             +GDI VG VL PG   A+  RMAA ++G P TVP+ TVNRQCSSGLQAV  +A  I +G
Sbjct  72   LIGDITVGNVLPPGG-GATASRMAALHSGIPNTVPISTVNRQCSSGLQAVNIIAGEIISG  130

Query  522  FYDIGIGAGLESMT  563
              DIGIGAG+ESMT
Sbjct  131  QIDIGIGAGVESMT  144



>ref|XP_003001876.1| 3-ketoacyl-CoA thiolase [Verticillium alfalfae VaMs.102]
 gb|EEY22025.1| 3-ketoacyl-CoA thiolase [Verticillium alfalfae VaMs.102]
Length=416

 Score =   137 bits (344),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 76/139 (55%), Positives = 95/139 (68%), Gaps = 4/139 (3%)
 Frame = +3

Query  153  VCAAGDSAAYQRNSVYGDDIVIVAAYRTPLCKSKRGGFKDTYPDDLLASVLKALIEKTNL  332
            V A+G     Q+N    DD+V+ AA RTP  K  +GGFKDT   DL+A  LKAL+E++ +
Sbjct  15   VGASGKEKLLQKNP---DDVVVTAALRTPFTKGGKGGFKDTQAADLMAGALKALLERSKI  71

Query  333  NPSEVGDIIVGTVLAPGSIRASECRMAAFYAGFPETVPVRTVNRQCSSGLQavadvaaai  512
            +P+ V DI VGTVLAPG   A+E R AA  AGFP T  VRT+NRQCSSGLQA  D+   I
Sbjct  72   DPALVEDIAVGTVLAPGG-GATEMRAAALVAGFPTTTAVRTLNRQCSSGLQASIDIINQI  130

Query  513  kaGFYDIGIGAGLESMTVN  569
            K+G  +IGIGAG+ESM+  
Sbjct  131  KSGMIEIGIGAGVESMSTQ  149



>ref|XP_005082434.1| PREDICTED: 3-ketoacyl-CoA thiolase B, peroxisomal-like [Mesocricetus 
auratus]
Length=286

 Score =   134 bits (337),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 79/171 (46%), Positives = 114/171 (67%), Gaps = 17/171 (10%)
 Frame = +3

Query  63   IERQRVLLQHL--RPTNAASSHDSIESSVSASVCAAGDSAAYQRNSVYGDDIVIVAAYRT  236
            + R +V+L HL  RP ++        S++ A+ C+AG   A+        D+V+V   RT
Sbjct  1    MHRLQVVLGHLAGRPESS--------SALQAAPCSAGFRQAW------ASDVVVVHGRRT  46

Query  237  PLCKSKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTVLAPGSIRASECRMAA  416
            P+ ++ RGGFKDT PD+LL++VL A+++   L P E+GDI VG VL PG+  A   R+A 
Sbjct  47   PIGRAGRGGFKDTTPDELLSAVLTAVLQDVKLKPEELGDISVGNVLQPGA-GAIMARIAQ  105

Query  417  FYAGFPETVPVRTVNRQCSSGLQavadvaaaikaGFYDIGIGAGLESMTVN  569
            F +G PETVP+ T+NRQCSSGLQAVA++A  I+ G YDIG+  G+ESM+++
Sbjct  106  FLSGIPETVPLSTINRQCSSGLQAVANIAGGIRNGSYDIGMACGVESMSLS  156



>ref|NP_001072686.1| 3-ketoacyl-CoA thiolase, peroxisomal [Xenopus (Silurana) tropicalis]
 gb|AAI24020.1| acetyl-Coenzyme A acyltransferase 1 [Xenopus (Silurana) tropicalis]
Length=419

 Score =   136 bits (343),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 79/168 (47%), Positives = 108/168 (64%), Gaps = 18/168 (11%)
 Frame = +3

Query  63   IERQRVLLQHLRPTNAASSHDSIESSVSASVCAAGDSAAYQRNSVYGDDIVIVAAYRTPL  242
            + R RV+L HL P N            S  + A   SAA  ++     DIVIVA  RTP+
Sbjct  1    MHRVRVVLGHL-PAN------------SRGIWAENSSAAADKS----QDIVIVAGRRTPI  43

Query  243  CKSKRGGFKDTYPDDLLASVLKALIEKTNLNPSEVGDIIVGTVLAPGSIRASECRMAAFY  422
            CK+KRGGFK+T PD+LL++V+ A++   NLNP  +GDI VG VL PG+  A   R+  F 
Sbjct  44   CKAKRGGFKETTPDELLSAVMTAVLNDVNLNPELLGDICVGNVLQPGA-GALVARIGQFL  102

Query  423  AGFPETVPVRTVNRQCSSGLQavadvaaaikaGFYDIGIGAGLESMTV  566
            +G PE+VP+  VNRQCSSGLQA+ ++A  I+ G YD+G+  G+ESM++
Sbjct  103  SGIPESVPLHVVNRQCSSGLQAIINIAGGIRNGSYDVGLACGVESMSL  150



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 669314531515