BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFF034O10

Length=421
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_006351365.1|  PREDICTED: uncharacterized protein LOC102603072  74.3    2e-12   Solanum tuberosum [potatoes]
ref|XP_004249304.1|  PREDICTED: uncharacterized protein LOC101268442  72.8    6e-12   Solanum lycopersicum
ref|XP_009788026.1|  PREDICTED: uncharacterized protein LOC104235895  70.9    3e-11   Nicotiana sylvestris
ref|XP_011075041.1|  PREDICTED: uncharacterized protein LOC105159627  65.9    1e-09   Sesamum indicum [beniseed]
ref|XP_009621585.1|  PREDICTED: uncharacterized protein LOC104113184  63.9    5e-09   Nicotiana tomentosiformis
ref|XP_009771625.1|  PREDICTED: uncharacterized protein LOC104222130  63.9    6e-09   Nicotiana sylvestris
ref|XP_010088042.1|  Casein kinase I isoform delta                    62.0    3e-08   
ref|XP_003624626.1|  Casein kinase I isoform alpha                    60.8    7e-08   Medicago truncatula
gb|ABN09797.1|  Protein kinase                                        60.5    8e-08   Medicago truncatula
ref|XP_009615719.1|  PREDICTED: uncharacterized protein LOC104108400  59.3    2e-07   Nicotiana tomentosiformis
emb|CDP14324.1|  unnamed protein product                              58.5    3e-07   Coffea canephora [robusta coffee]
ref|XP_006479104.1|  PREDICTED: uncharacterized protein LOC102619...  58.2    5e-07   Citrus sinensis [apfelsine]
ref|XP_006443418.1|  hypothetical protein CICLE_v10019090mg           58.2    5e-07   Citrus clementina [clementine]
ref|XP_004493152.1|  PREDICTED: uncharacterized protein LOC101504...  58.2    5e-07   Cicer arietinum [garbanzo]
ref|XP_007161937.1|  hypothetical protein PHAVU_001G110300g           57.8    6e-07   Phaseolus vulgaris [French bean]
gb|KJB45108.1|  hypothetical protein B456_007G289500                  57.8    7e-07   Gossypium raimondii
gb|KHG17118.1|  Casein kinase I isoform delta                         57.4    7e-07   Gossypium arboreum [tree cotton]
gb|KJB80963.1|  hypothetical protein B456_013G123300                  57.4    8e-07   Gossypium raimondii
gb|KJB80965.1|  hypothetical protein B456_013G123300                  57.4    9e-07   Gossypium raimondii
gb|KHG27523.1|  hypothetical protein F383_15264                       57.0    1e-06   Gossypium arboreum [tree cotton]
ref|XP_011078778.1|  PREDICTED: uncharacterized protein LOC105162459  56.6    1e-06   Sesamum indicum [beniseed]
gb|KHG04306.1|  Casein kinase I-like protein                          56.6    1e-06   Gossypium arboreum [tree cotton]
gb|KJB82581.1|  hypothetical protein B456_013G203000                  56.6    1e-06   Gossypium raimondii
ref|XP_004157014.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...  56.6    2e-06   
gb|KJB82579.1|  hypothetical protein B456_013G203000                  56.6    2e-06   Gossypium raimondii
gb|KJB82583.1|  hypothetical protein B456_013G203000                  56.6    2e-06   Gossypium raimondii
gb|KJB82582.1|  hypothetical protein B456_013G203000                  56.2    2e-06   Gossypium raimondii
gb|KJB82580.1|  hypothetical protein B456_013G203000                  56.2    2e-06   Gossypium raimondii
ref|XP_002325416.1|  kinase family protein                            56.2    2e-06   
ref|XP_011021493.1|  PREDICTED: uncharacterized protein LOC105123555  56.2    2e-06   Populus euphratica
ref|XP_002281952.1|  PREDICTED: uncharacterized protein LOC100267624  55.8    3e-06   Vitis vinifera
gb|EPS68531.1|  hypothetical protein M569_06230                       55.8    3e-06   Genlisea aurea
ref|XP_007030718.1|  Kinase family protein                            55.8    3e-06   Theobroma cacao [chocolate]
ref|XP_010036218.1|  PREDICTED: uncharacterized protein LOC104425268  55.8    3e-06   Eucalyptus grandis [rose gum]
ref|XP_007204249.1|  hypothetical protein PRUPE_ppa002161mg           54.3    8e-06   Prunus persica
ref|XP_008240478.1|  PREDICTED: uncharacterized protein LOC103338977  54.3    8e-06   Prunus mume [ume]
ref|XP_009366444.1|  PREDICTED: uncharacterized protein LOC103956210  54.3    9e-06   Pyrus x bretschneideri [bai li]
ref|XP_008441978.1|  PREDICTED: uncharacterized protein LOC103485979  53.9    1e-05   Cucumis melo [Oriental melon]
ref|XP_004147533.1|  PREDICTED: uncharacterized protein LOC101221479  53.9    1e-05   Cucumis sativus [cucumbers]
gb|EYU20664.1|  hypothetical protein MIMGU_mgv1a002165mg              53.1    2e-05   Erythranthe guttata [common monkey flower]
ref|XP_003548750.1|  PREDICTED: uncharacterized protein LOC100801...  51.2    7e-05   Glycine max [soybeans]
ref|XP_010558719.1|  PREDICTED: uncharacterized protein LOC104827...  50.8    1e-04   Tarenaya hassleriana [spider flower]
ref|XP_010558720.1|  PREDICTED: uncharacterized protein LOC104827...  50.8    1e-04   
ref|XP_010672056.1|  PREDICTED: uncharacterized protein LOC104888...  50.4    1e-04   
ref|XP_010672054.1|  PREDICTED: uncharacterized protein LOC104888...  50.4    1e-04   Beta vulgaris subsp. vulgaris [field beet]
gb|KDP39706.1|  hypothetical protein JCGZ_02726                       49.3    4e-04   Jatropha curcas
ref|XP_010276388.1|  PREDICTED: uncharacterized protein LOC104611151  48.5    6e-04   



>ref|XP_006351365.1| PREDICTED: uncharacterized protein LOC102603072 [Solanum tuberosum]
Length=709

 Score = 74.3 bits (181),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 35/36 (97%), Positives = 35/36 (97%), Gaps = 0/36 (0%)
 Frame = +2

Query  287  MPELRSGARRSKRLGDLQPAPQPTGQEENLALPTQN  394
            MPELRSGARRSKRLGDLQPAPQP GQEENLALPTQN
Sbjct  1    MPELRSGARRSKRLGDLQPAPQPVGQEENLALPTQN  36



>ref|XP_004249304.1| PREDICTED: uncharacterized protein LOC101268442 [Solanum lycopersicum]
Length=709

 Score = 72.8 bits (177),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 34/36 (94%), Positives = 34/36 (94%), Gaps = 0/36 (0%)
 Frame = +2

Query  287  MPELRSGARRSKRLGDLQPAPQPTGQEENLALPTQN  394
            MPELRSGARRSKRLGDLQPAPQP GQEENL LPTQN
Sbjct  1    MPELRSGARRSKRLGDLQPAPQPVGQEENLVLPTQN  36



>ref|XP_009788026.1| PREDICTED: uncharacterized protein LOC104235895 [Nicotiana sylvestris]
 ref|XP_009788027.1| PREDICTED: uncharacterized protein LOC104235895 [Nicotiana sylvestris]
 ref|XP_009788028.1| PREDICTED: uncharacterized protein LOC104235895 [Nicotiana sylvestris]
 ref|XP_009788029.1| PREDICTED: uncharacterized protein LOC104235895 [Nicotiana sylvestris]
Length=708

 Score = 70.9 bits (172),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 32/36 (89%), Positives = 34/36 (94%), Gaps = 0/36 (0%)
 Frame = +2

Query  287  MPELRSGARRSKRLGDLQPAPQPTGQEENLALPTQN  394
            MPELRSGARRSKRLGDLQPAP+P+GQEEN  LPTQN
Sbjct  1    MPELRSGARRSKRLGDLQPAPEPSGQEENWVLPTQN  36



>ref|XP_011075041.1| PREDICTED: uncharacterized protein LOC105159627 [Sesamum indicum]
Length=705

 Score = 65.9 bits (159),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 31/36 (86%), Positives = 31/36 (86%), Gaps = 0/36 (0%)
 Frame = +2

Query  287  MPELRSGARRSKRLGDLQPAPQPTGQEENLALPTQN  394
            MPELRSGARRSKRLGDLQPAPQPT QEEN   P QN
Sbjct  1    MPELRSGARRSKRLGDLQPAPQPTNQEENFLAPAQN  36



>ref|XP_009621585.1| PREDICTED: uncharacterized protein LOC104113184 [Nicotiana tomentosiformis]
 ref|XP_009621586.1| PREDICTED: uncharacterized protein LOC104113184 [Nicotiana tomentosiformis]
 ref|XP_009621587.1| PREDICTED: uncharacterized protein LOC104113184 [Nicotiana tomentosiformis]
Length=714

 Score = 63.9 bits (154),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 34/38 (89%), Positives = 34/38 (89%), Gaps = 2/38 (5%)
 Frame = +2

Query  287  MPELRSGARRSKRLGDLQP-APQPTGQEENLAL-PTQN  394
            MPELRSGARRSKRLGDLQP APQP GQEENL L PTQN
Sbjct  2    MPELRSGARRSKRLGDLQPAAPQPVGQEENLVLPPTQN  39



>ref|XP_009771625.1| PREDICTED: uncharacterized protein LOC104222130 [Nicotiana sylvestris]
 ref|XP_009771626.1| PREDICTED: uncharacterized protein LOC104222130 [Nicotiana sylvestris]
 ref|XP_009771627.1| PREDICTED: uncharacterized protein LOC104222130 [Nicotiana sylvestris]
Length=714

 Score = 63.9 bits (154),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 34/38 (89%), Positives = 34/38 (89%), Gaps = 2/38 (5%)
 Frame = +2

Query  287  MPELRSGARRSKRLGDLQP-APQPTGQEENLAL-PTQN  394
            MPELRSGARRSKRLGDLQP APQP GQEENL L PTQN
Sbjct  2    MPELRSGARRSKRLGDLQPAAPQPVGQEENLVLPPTQN  39



>ref|XP_010088042.1| Casein kinase I isoform delta [Morus notabilis]
 gb|EXB31261.1| Casein kinase I isoform delta [Morus notabilis]
Length=706

 Score = 62.0 bits (149),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 29/36 (81%), Positives = 30/36 (83%), Gaps = 0/36 (0%)
 Frame = +2

Query  287  MPELRSGARRSKRLGDLQPAPQPTGQEENLALPTQN  394
            MPELRSG RRSKRLGDLQP+PQP GQ EN  LPT N
Sbjct  1    MPELRSGVRRSKRLGDLQPSPQPIGQAENWPLPTPN  36



>ref|XP_003624626.1| Casein kinase I isoform alpha [Medicago truncatula]
 gb|AES80844.1| casein kinase I-like protein [Medicago truncatula]
Length=708

 Score = 60.8 bits (146),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 29/36 (81%), Positives = 29/36 (81%), Gaps = 0/36 (0%)
 Frame = +2

Query  287  MPELRSGARRSKRLGDLQPAPQPTGQEENLALPTQN  394
            MPELRSGARRSKRLGDLQP PQP  Q EN A P QN
Sbjct  1    MPELRSGARRSKRLGDLQPGPQPVDQGENWAEPAQN  36



>gb|ABN09797.1| Protein kinase [Medicago truncatula]
Length=573

 Score = 60.5 bits (145),  Expect = 8e-08, Method: Compositional matrix adjust.
 Identities = 29/36 (81%), Positives = 29/36 (81%), Gaps = 0/36 (0%)
 Frame = +2

Query  287  MPELRSGARRSKRLGDLQPAPQPTGQEENLALPTQN  394
            MPELRSGARRSKRLGDLQP PQP  Q EN A P QN
Sbjct  1    MPELRSGARRSKRLGDLQPGPQPVDQGENWAEPAQN  36



>ref|XP_009615719.1| PREDICTED: uncharacterized protein LOC104108400 [Nicotiana tomentosiformis]
 ref|XP_009615725.1| PREDICTED: uncharacterized protein LOC104108400 [Nicotiana tomentosiformis]
 ref|XP_009615727.1| PREDICTED: uncharacterized protein LOC104108400 [Nicotiana tomentosiformis]
 ref|XP_009615731.1| PREDICTED: uncharacterized protein LOC104108400 [Nicotiana tomentosiformis]
Length=708

 Score = 59.3 bits (142),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 27/34 (79%), Positives = 30/34 (88%), Gaps = 0/34 (0%)
 Frame = +2

Query  287  MPELRSGARRSKRLGDLQPAPQPTGQEENLALPT  388
            MP+LR GARRSKRLGD QPAP+P+GQEEN  LPT
Sbjct  1    MPDLRRGARRSKRLGDPQPAPEPSGQEENWVLPT  34



>emb|CDP14324.1| unnamed protein product [Coffea canephora]
Length=709

 Score = 58.5 bits (140),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 30/38 (79%), Positives = 31/38 (82%), Gaps = 2/38 (5%)
 Frame = +2

Query  287  MPELRSGARRSKRLGDLQPAPQPTGQEENLAL--PTQN  394
            MPELRSGARRSKRLGDLQPA QP  QEEN  +  PTQN
Sbjct  1    MPELRSGARRSKRLGDLQPAAQPAFQEENWLVQQPTQN  38



>ref|XP_006479104.1| PREDICTED: uncharacterized protein LOC102619111 isoform X1 [Citrus 
sinensis]
 gb|KDO55048.1| hypothetical protein CISIN_1g005214mg [Citrus sinensis]
Length=708

 Score = 58.2 bits (139),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 28/36 (78%), Positives = 28/36 (78%), Gaps = 0/36 (0%)
 Frame = +2

Query  287  MPELRSGARRSKRLGDLQPAPQPTGQEENLALPTQN  394
            MPELRSGARRSKRL DLQP PQP  Q EN  LP QN
Sbjct  1    MPELRSGARRSKRLDDLQPPPQPVDQTENWLLPAQN  36



>ref|XP_006443418.1| hypothetical protein CICLE_v10019090mg [Citrus clementina]
 ref|XP_006479105.1| PREDICTED: uncharacterized protein LOC102619111 isoform X2 [Citrus 
sinensis]
 gb|ESR56658.1| hypothetical protein CICLE_v10019090mg [Citrus clementina]
 gb|KDO55047.1| hypothetical protein CISIN_1g005214mg [Citrus sinensis]
Length=704

 Score = 58.2 bits (139),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 28/36 (78%), Positives = 28/36 (78%), Gaps = 0/36 (0%)
 Frame = +2

Query  287  MPELRSGARRSKRLGDLQPAPQPTGQEENLALPTQN  394
            MPELRSGARRSKRL DLQP PQP  Q EN  LP QN
Sbjct  1    MPELRSGARRSKRLDDLQPPPQPVDQTENWLLPAQN  36



>ref|XP_004493152.1| PREDICTED: uncharacterized protein LOC101504885 isoform X1 [Cicer 
arietinum]
 ref|XP_004493153.1| PREDICTED: uncharacterized protein LOC101504885 isoform X2 [Cicer 
arietinum]
Length=708

 Score = 58.2 bits (139),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 28/36 (78%), Positives = 28/36 (78%), Gaps = 0/36 (0%)
 Frame = +2

Query  287  MPELRSGARRSKRLGDLQPAPQPTGQEENLALPTQN  394
            MPELRSGARRSKRLGDLQPAP P  Q EN   P QN
Sbjct  1    MPELRSGARRSKRLGDLQPAPLPVDQGENWTQPAQN  36



>ref|XP_007161937.1| hypothetical protein PHAVU_001G110300g [Phaseolus vulgaris]
 gb|ESW33931.1| hypothetical protein PHAVU_001G110300g [Phaseolus vulgaris]
Length=708

 Score = 57.8 bits (138),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 28/36 (78%), Positives = 28/36 (78%), Gaps = 0/36 (0%)
 Frame = +2

Query  287  MPELRSGARRSKRLGDLQPAPQPTGQEENLALPTQN  394
            MPELRSGARRSKRLGDLQP P P  Q EN A P QN
Sbjct  1    MPELRSGARRSKRLGDLQPGPLPIDQGENWAQPAQN  36



>gb|KJB45108.1| hypothetical protein B456_007G289500 [Gossypium raimondii]
Length=706

 Score = 57.8 bits (138),  Expect = 7e-07, Method: Composition-based stats.
 Identities = 27/36 (75%), Positives = 28/36 (78%), Gaps = 0/36 (0%)
 Frame = +2

Query  287  MPELRSGARRSKRLGDLQPAPQPTGQEENLALPTQN  394
            MPELRSGARRSKRLGDL+P  QP  Q EN  LP QN
Sbjct  1    MPELRSGARRSKRLGDLEPPSQPVVQAENWVLPAQN  36



>gb|KHG17118.1| Casein kinase I isoform delta [Gossypium arboreum]
 gb|KHG17119.1| Casein kinase I isoform delta [Gossypium arboreum]
Length=706

 Score = 57.4 bits (137),  Expect = 7e-07, Method: Composition-based stats.
 Identities = 27/36 (75%), Positives = 28/36 (78%), Gaps = 0/36 (0%)
 Frame = +2

Query  287  MPELRSGARRSKRLGDLQPAPQPTGQEENLALPTQN  394
            MPELRSGARRSKRLGDL+P  QP  Q EN  LP QN
Sbjct  1    MPELRSGARRSKRLGDLEPPSQPVVQAENWVLPAQN  36



>gb|KJB80963.1| hypothetical protein B456_013G123300 [Gossypium raimondii]
 gb|KJB80964.1| hypothetical protein B456_013G123300 [Gossypium raimondii]
 gb|KJB80966.1| hypothetical protein B456_013G123300 [Gossypium raimondii]
Length=706

 Score = 57.4 bits (137),  Expect = 8e-07, Method: Compositional matrix adjust.
 Identities = 27/36 (75%), Positives = 28/36 (78%), Gaps = 0/36 (0%)
 Frame = +2

Query  287  MPELRSGARRSKRLGDLQPAPQPTGQEENLALPTQN  394
            MPELRSGAR+SKRLGDLQP  QP  Q EN  LP QN
Sbjct  1    MPELRSGARKSKRLGDLQPPLQPVDQAENWVLPAQN  36



>gb|KJB80965.1| hypothetical protein B456_013G123300 [Gossypium raimondii]
Length=707

 Score = 57.4 bits (137),  Expect = 9e-07, Method: Compositional matrix adjust.
 Identities = 27/36 (75%), Positives = 28/36 (78%), Gaps = 0/36 (0%)
 Frame = +2

Query  287  MPELRSGARRSKRLGDLQPAPQPTGQEENLALPTQN  394
            MPELRSGAR+SKRLGDLQP  QP  Q EN  LP QN
Sbjct  1    MPELRSGARKSKRLGDLQPPLQPVDQAENWVLPAQN  36



>gb|KHG27523.1| hypothetical protein F383_15264 [Gossypium arboreum]
Length=706

 Score = 57.0 bits (136),  Expect = 1e-06, Method: Composition-based stats.
 Identities = 27/36 (75%), Positives = 28/36 (78%), Gaps = 0/36 (0%)
 Frame = +2

Query  287  MPELRSGARRSKRLGDLQPAPQPTGQEENLALPTQN  394
            MPELRSGAR+SKRLGDLQP  QP  Q EN  LP QN
Sbjct  1    MPELRSGARKSKRLGDLQPPFQPVDQAENWVLPAQN  36



>ref|XP_011078778.1| PREDICTED: uncharacterized protein LOC105162459 [Sesamum indicum]
Length=705

 Score = 56.6 bits (135),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 27/35 (77%), Positives = 27/35 (77%), Gaps = 0/35 (0%)
 Frame = +2

Query  287  MPELRSGARRSKRLGDLQPAPQPTGQEENLALPTQ  391
            MPELRSGARRSKRLGDLQPAPQ   QEE    P Q
Sbjct  1    MPELRSGARRSKRLGDLQPAPQTANQEEKFLAPAQ  35



>gb|KHG04306.1| Casein kinase I-like protein [Gossypium arboreum]
Length=706

 Score = 56.6 bits (135),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 27/36 (75%), Positives = 27/36 (75%), Gaps = 0/36 (0%)
 Frame = +2

Query  287  MPELRSGARRSKRLGDLQPAPQPTGQEENLALPTQN  394
            MPELRSGARRSK L DLQP PQP  Q EN  LP QN
Sbjct  1    MPELRSGARRSKHLDDLQPPPQPVEQAENWVLPAQN  36



>gb|KJB82581.1| hypothetical protein B456_013G203000 [Gossypium raimondii]
Length=654

 Score = 56.6 bits (135),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 27/36 (75%), Positives = 27/36 (75%), Gaps = 0/36 (0%)
 Frame = +2

Query  287  MPELRSGARRSKRLGDLQPAPQPTGQEENLALPTQN  394
            MPELRSGARRSK L DLQP PQP  Q EN  LP QN
Sbjct  1    MPELRSGARRSKHLDDLQPPPQPVEQAENWVLPAQN  36



>ref|XP_004157014.1| PREDICTED: LOW QUALITY PROTEIN: uncharacterized LOC101221479 
[Cucumis sativus]
Length=742

 Score = 56.6 bits (135),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 27/38 (71%), Positives = 30/38 (79%), Gaps = 0/38 (0%)
 Frame = +2

Query  281  VTMPELRSGARRSKRLGDLQPAPQPTGQEENLALPTQN  394
            +TMPELRSGARRS+RL DLQP  QP  Q ENLA+P  N
Sbjct  33   LTMPELRSGARRSRRLDDLQPCTQPLDQGENLAVPAPN  70



>gb|KJB82579.1| hypothetical protein B456_013G203000 [Gossypium raimondii]
Length=706

 Score = 56.6 bits (135),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 27/36 (75%), Positives = 27/36 (75%), Gaps = 0/36 (0%)
 Frame = +2

Query  287  MPELRSGARRSKRLGDLQPAPQPTGQEENLALPTQN  394
            MPELRSGARRSK L DLQP PQP  Q EN  LP QN
Sbjct  1    MPELRSGARRSKHLDDLQPPPQPVEQAENWVLPAQN  36



>gb|KJB82583.1| hypothetical protein B456_013G203000 [Gossypium raimondii]
Length=707

 Score = 56.6 bits (135),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 27/36 (75%), Positives = 27/36 (75%), Gaps = 0/36 (0%)
 Frame = +2

Query  287  MPELRSGARRSKRLGDLQPAPQPTGQEENLALPTQN  394
            MPELRSGARRSK L DLQP PQP  Q EN  LP QN
Sbjct  1    MPELRSGARRSKHLDDLQPPPQPVEQAENWVLPAQN  36



>gb|KJB82582.1| hypothetical protein B456_013G203000 [Gossypium raimondii]
Length=696

 Score = 56.2 bits (134),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 27/36 (75%), Positives = 27/36 (75%), Gaps = 0/36 (0%)
 Frame = +2

Query  287  MPELRSGARRSKRLGDLQPAPQPTGQEENLALPTQN  394
            MPELRSGARRSK L DLQP PQP  Q EN  LP QN
Sbjct  1    MPELRSGARRSKHLDDLQPPPQPVEQAENWVLPAQN  36



>gb|KJB82580.1| hypothetical protein B456_013G203000 [Gossypium raimondii]
Length=587

 Score = 56.2 bits (134),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 27/36 (75%), Positives = 27/36 (75%), Gaps = 0/36 (0%)
 Frame = +2

Query  287  MPELRSGARRSKRLGDLQPAPQPTGQEENLALPTQN  394
            MPELRSGARRSK L DLQP PQP  Q EN  LP QN
Sbjct  1    MPELRSGARRSKHLDDLQPPPQPVEQAENWVLPAQN  36



>ref|XP_002325416.1| kinase family protein [Populus trichocarpa]
 gb|EEE99797.1| kinase family protein [Populus trichocarpa]
Length=720

 Score = 56.2 bits (134),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 27/36 (75%), Positives = 28/36 (78%), Gaps = 0/36 (0%)
 Frame = +2

Query  287  MPELRSGARRSKRLGDLQPAPQPTGQEENLALPTQN  394
            MPELRSGARRSKRL DLQP  QP  Q ENL +P QN
Sbjct  1    MPELRSGARRSKRLDDLQPPQQPNNQAENLTVPVQN  36



>ref|XP_011021493.1| PREDICTED: uncharacterized protein LOC105123555 [Populus euphratica]
Length=707

 Score = 56.2 bits (134),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 27/36 (75%), Positives = 28/36 (78%), Gaps = 0/36 (0%)
 Frame = +2

Query  287  MPELRSGARRSKRLGDLQPAPQPTGQEENLALPTQN  394
            MPELRSGARRSKRL DLQP  QP  Q ENL +P QN
Sbjct  1    MPELRSGARRSKRLDDLQPPQQPNNQAENLTVPVQN  36



>ref|XP_002281952.1| PREDICTED: uncharacterized protein LOC100267624 [Vitis vinifera]
 emb|CAN59733.1| hypothetical protein VITISV_003914 [Vitis vinifera]
Length=708

 Score = 55.8 bits (133),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 27/36 (75%), Positives = 28/36 (78%), Gaps = 0/36 (0%)
 Frame = +2

Query  287  MPELRSGARRSKRLGDLQPAPQPTGQEENLALPTQN  394
            MPELRSG RRSKRL DLQP+PQP  Q EN  LP QN
Sbjct  1    MPELRSGPRRSKRLDDLQPSPQPGDQAENWLLPAQN  36



>gb|EPS68531.1| hypothetical protein M569_06230 [Genlisea aurea]
Length=704

 Score = 55.8 bits (133),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 27/36 (75%), Positives = 29/36 (81%), Gaps = 0/36 (0%)
 Frame = +2

Query  287  MPELRSGARRSKRLGDLQPAPQPTGQEENLALPTQN  394
            MPELRSGARRSKRLGDLQ APQP  QE++    TQN
Sbjct  1    MPELRSGARRSKRLGDLQSAPQPENQEQDFLPSTQN  36



>ref|XP_007030718.1| Kinase family protein [Theobroma cacao]
 gb|EOY11220.1| Kinase family protein [Theobroma cacao]
Length=705

 Score = 55.8 bits (133),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 28/36 (78%), Positives = 28/36 (78%), Gaps = 1/36 (3%)
 Frame = +2

Query  287  MPELRSGARRSKRLGDLQPAPQPTGQEENLALPTQN  394
            MPELRSGARRSKRL DLQP PQP  Q EN  LP QN
Sbjct  1    MPELRSGARRSKRLDDLQP-PQPVDQAENWVLPAQN  35



>ref|XP_010036218.1| PREDICTED: uncharacterized protein LOC104425268 [Eucalyptus grandis]
 ref|XP_010036219.1| PREDICTED: uncharacterized protein LOC104425268 [Eucalyptus grandis]
 ref|XP_010036220.1| PREDICTED: uncharacterized protein LOC104425268 [Eucalyptus grandis]
 ref|XP_010036222.1| PREDICTED: uncharacterized protein LOC104425268 [Eucalyptus grandis]
 gb|KCW47748.1| hypothetical protein EUGRSUZ_K01498 [Eucalyptus grandis]
 gb|KCW47749.1| hypothetical protein EUGRSUZ_K01498 [Eucalyptus grandis]
 gb|KCW47750.1| hypothetical protein EUGRSUZ_K01498 [Eucalyptus grandis]
Length=702

 Score = 55.8 bits (133),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 27/36 (75%), Positives = 29/36 (81%), Gaps = 0/36 (0%)
 Frame = +2

Query  287  MPELRSGARRSKRLGDLQPAPQPTGQEENLALPTQN  394
            MPELRSGARRSKRL +LQP PQ   Q +N ALPTQN
Sbjct  1    MPELRSGARRSKRLDNLQPNPQQIEQADNWALPTQN  36



>ref|XP_007204249.1| hypothetical protein PRUPE_ppa002161mg [Prunus persica]
 gb|EMJ05448.1| hypothetical protein PRUPE_ppa002161mg [Prunus persica]
Length=707

 Score = 54.3 bits (129),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 27/37 (73%), Positives = 28/37 (76%), Gaps = 1/37 (3%)
 Frame = +2

Query  287  MPELRSGARRSKRLGDLQPAPQ-PTGQEENLALPTQN  394
            MPELRSG RRSKRL DLQP+ Q P GQ EN  LP QN
Sbjct  1    MPELRSGVRRSKRLDDLQPSSQPPIGQAENCVLPAQN  37



>ref|XP_008240478.1| PREDICTED: uncharacterized protein LOC103338977 [Prunus mume]
Length=707

 Score = 54.3 bits (129),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 27/37 (73%), Positives = 28/37 (76%), Gaps = 1/37 (3%)
 Frame = +2

Query  287  MPELRSGARRSKRLGDLQPAPQ-PTGQEENLALPTQN  394
            MPELRSG RRSKRL DLQP+ Q P GQ EN  LP QN
Sbjct  1    MPELRSGVRRSKRLDDLQPSSQPPIGQAENCVLPAQN  37



>ref|XP_009366444.1| PREDICTED: uncharacterized protein LOC103956210 [Pyrus x bretschneideri]
Length=707

 Score = 54.3 bits (129),  Expect = 9e-06, Method: Compositional matrix adjust.
 Identities = 27/37 (73%), Positives = 28/37 (76%), Gaps = 1/37 (3%)
 Frame = +2

Query  287  MPELRSGARRSKRLGDLQPAPQ-PTGQEENLALPTQN  394
            MPELRSG RRSKRL DLQP+ Q P GQ EN  LP QN
Sbjct  1    MPELRSGVRRSKRLDDLQPSSQPPIGQAENCVLPAQN  37



>ref|XP_008441978.1| PREDICTED: uncharacterized protein LOC103485979 [Cucumis melo]
 ref|XP_008441979.1| PREDICTED: uncharacterized protein LOC103485979 [Cucumis melo]
Length=708

 Score = 53.9 bits (128),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 26/36 (72%), Positives = 28/36 (78%), Gaps = 0/36 (0%)
 Frame = +2

Query  287  MPELRSGARRSKRLGDLQPAPQPTGQEENLALPTQN  394
            MPELRSGARRS+RL DLQP  QP  Q ENLA+P  N
Sbjct  1    MPELRSGARRSRRLDDLQPCTQPLDQGENLAVPAPN  36



>ref|XP_004147533.1| PREDICTED: uncharacterized protein LOC101221479 [Cucumis sativus]
 gb|KGN53942.1| Casein kinase [Cucumis sativus]
Length=708

 Score = 53.9 bits (128),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 26/36 (72%), Positives = 28/36 (78%), Gaps = 0/36 (0%)
 Frame = +2

Query  287  MPELRSGARRSKRLGDLQPAPQPTGQEENLALPTQN  394
            MPELRSGARRS+RL DLQP  QP  Q ENLA+P  N
Sbjct  1    MPELRSGARRSRRLDDLQPCTQPLDQGENLAVPAPN  36



>gb|EYU20664.1| hypothetical protein MIMGU_mgv1a002165mg [Erythranthe guttata]
Length=706

 Score = 53.1 bits (126),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 25/35 (71%), Positives = 25/35 (71%), Gaps = 0/35 (0%)
 Frame = +2

Query  287  MPELRSGARRSKRLGDLQPAPQPTGQEENLALPTQ  391
            MPELRSGARRSKRLGDL P PQ   QEE    P Q
Sbjct  2    MPELRSGARRSKRLGDLHPTPQTANQEEEFLAPAQ  36



>ref|XP_003548750.1| PREDICTED: uncharacterized protein LOC100801967 isoform X1 [Glycine 
max]
 ref|XP_006598981.1| PREDICTED: uncharacterized protein LOC100801967 isoform X2 [Glycine 
max]
 gb|KHN46781.1| Casein kinase I like hhp1 [Glycine soja]
Length=709

 Score = 51.2 bits (121),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 25/33 (76%), Positives = 25/33 (76%), Gaps = 0/33 (0%)
 Frame = +2

Query  287  MPELRSGARRSKRLGDLQPAPQPTGQEENLALP  385
            MPELRSGARRSKRLGDLQP P P  Q EN   P
Sbjct  1    MPELRSGARRSKRLGDLQPGPLPVDQGENWQQP  33



>ref|XP_010558719.1| PREDICTED: uncharacterized protein LOC104827271 isoform X1 [Tarenaya 
hassleriana]
Length=703

 Score = 50.8 bits (120),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 25/35 (71%), Positives = 26/35 (74%), Gaps = 0/35 (0%)
 Frame = +2

Query  287  MPELRSGARRSKRLGDLQPAPQPTGQEENLALPTQ  391
            MPELRSGARRS+RL DLQP PQ   Q EN  LP Q
Sbjct  1    MPELRSGARRSRRLDDLQPNPQLIDQTENCVLPPQ  35



>ref|XP_010558720.1| PREDICTED: uncharacterized protein LOC104827271 isoform X2 [Tarenaya 
hassleriana]
Length=704

 Score = 50.8 bits (120),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 25/35 (71%), Positives = 26/35 (74%), Gaps = 0/35 (0%)
 Frame = +2

Query  287  MPELRSGARRSKRLGDLQPAPQPTGQEENLALPTQ  391
            MPELRSGARRS+RL DLQP PQ   Q EN  LP Q
Sbjct  1    MPELRSGARRSRRLDDLQPNPQLIDQTENCVLPPQ  35



>ref|XP_010672056.1| PREDICTED: uncharacterized protein LOC104888715 isoform X2 [Beta 
vulgaris subsp. vulgaris]
Length=711

 Score = 50.4 bits (119),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 27/37 (73%), Positives = 29/37 (78%), Gaps = 1/37 (3%)
 Frame = +2

Query  287  MPELRSGARRSKRLGDL-QPAPQPTGQEENLALPTQN  394
            MPELRSGARRSKRLGDL QP+P+   Q EN   PTQN
Sbjct  1    MPELRSGARRSKRLGDLQQPSPELNDQGENCHPPTQN  37



>ref|XP_010672054.1| PREDICTED: uncharacterized protein LOC104888715 isoform X1 [Beta 
vulgaris subsp. vulgaris]
Length=713

 Score = 50.4 bits (119),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 27/37 (73%), Positives = 29/37 (78%), Gaps = 1/37 (3%)
 Frame = +2

Query  287  MPELRSGARRSKRLGDL-QPAPQPTGQEENLALPTQN  394
            MPELRSGARRSKRLGDL QP+P+   Q EN   PTQN
Sbjct  1    MPELRSGARRSKRLGDLQQPSPELNDQGENCHPPTQN  37



>gb|KDP39706.1| hypothetical protein JCGZ_02726 [Jatropha curcas]
Length=705

 Score = 49.3 bits (116),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 25/36 (69%), Positives = 25/36 (69%), Gaps = 0/36 (0%)
 Frame = +2

Query  287  MPELRSGARRSKRLGDLQPAPQPTGQEENLALPTQN  394
            MPELRSGARRSKRL DLQ   QP    EN   PTQN
Sbjct  1    MPELRSGARRSKRLDDLQALQQPINPTENWIQPTQN  36



>ref|XP_010276388.1| PREDICTED: uncharacterized protein LOC104611151 [Nelumbo nucifera]
 ref|XP_010276389.1| PREDICTED: uncharacterized protein LOC104611151 [Nelumbo nucifera]
 ref|XP_010276390.1| PREDICTED: uncharacterized protein LOC104611151 [Nelumbo nucifera]
 ref|XP_010276391.1| PREDICTED: uncharacterized protein LOC104611151 [Nelumbo nucifera]
Length=714

 Score = 48.5 bits (114),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 26/40 (65%), Positives = 28/40 (70%), Gaps = 4/40 (10%)
 Frame = +2

Query  287  MPELRSGAR----RSKRLGDLQPAPQPTGQEENLALPTQN  394
            MPELRSGAR    RSKRL +LQP+PQP  Q EN  LP  N
Sbjct  1    MPELRSGARQARLRSKRLDELQPSPQPLDQAENCVLPAPN  40



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 557844602525