BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFF034O09

Length=511
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

gb|AAA34099.1|  plasma membrane H+ ATPase                               176   1e-49   Nicotiana plumbaginifolia [leadwort-leaved tobacco]
ref|XP_008239652.1|  PREDICTED: ATPase 11, plasma membrane-type         178   3e-48   Prunus mume [ume]
ref|XP_011087207.1|  PREDICTED: plasma membrane ATPase 3                177   4e-48   Sesamum indicum [beniseed]
ref|XP_007210395.1|  hypothetical protein PRUPE_ppa000934mg             177   4e-48   Prunus persica
ref|NP_001234775.1|  plasma membrane ATPase 1                           176   1e-47   Solanum lycopersicum
ref|XP_006367061.1|  PREDICTED: plasma membrane ATPase 1-like           176   1e-47   Solanum tuberosum [potatoes]
ref|XP_011071717.1|  PREDICTED: LOW QUALITY PROTEIN: plasma membr...    176   1e-47   Sesamum indicum [beniseed]
sp|Q08436.1|PMA3_NICPL  RecName: Full=Plasma membrane ATPase 3; A...    176   1e-47   Nicotiana plumbaginifolia [leadwort-leaved tobacco]
ref|XP_008374513.1|  PREDICTED: ATPase 11, plasma membrane-type         176   1e-47   
ref|XP_009369365.1|  PREDICTED: ATPase 11, plasma membrane-type         176   1e-47   Pyrus x bretschneideri [bai li]
ref|XP_009626987.1|  PREDICTED: plasma membrane ATPase 3                176   2e-47   Nicotiana tomentosiformis
gb|KCW49373.1|  hypothetical protein EUGRSUZ_K02916                     176   2e-47   Eucalyptus grandis [rose gum]
gb|KCW49372.1|  hypothetical protein EUGRSUZ_K02916                     176   2e-47   Eucalyptus grandis [rose gum]
ref|XP_010037634.1|  PREDICTED: ATPase 11, plasma membrane-type         176   2e-47   Eucalyptus grandis [rose gum]
ref|XP_009799220.1|  PREDICTED: plasma membrane ATPase 3                175   3e-47   Nicotiana sylvestris
ref|NP_001274861.1|  plasma membrane ATPase 1-like                      175   3e-47   Solanum tuberosum [potatoes]
ref|XP_006354801.1|  PREDICTED: plasma membrane ATPase 1-like           175   3e-47   Solanum tuberosum [potatoes]
ref|NP_001234477.1|  plasma membrane H+-ATPase                          175   3e-47   Solanum lycopersicum
ref|XP_002322127.1|  putative plasma membrane H+ ATPase family pr...    175   4e-47   
ref|XP_009343433.1|  PREDICTED: ATPase 11, plasma membrane-type-like    175   4e-47   Pyrus x bretschneideri [bai li]
gb|EYU35893.1|  hypothetical protein MIMGU_mgv1a0008591mg               172   4e-47   Erythranthe guttata [common monkey flower]
ref|XP_009793289.1|  PREDICTED: plasma membrane ATPase 2                174   5e-47   Nicotiana sylvestris
ref|XP_004299601.1|  PREDICTED: ATPase 11, plasma membrane-type         174   6e-47   Fragaria vesca subsp. vesca
gb|AAA34052.1|  H+-translocating ATPase                                 173   1e-46   Nicotiana plumbaginifolia [leadwort-leaved tobacco]
ref|XP_009610426.1|  PREDICTED: plasma membrane ATPase 2                173   1e-46   
ref|XP_002270344.1|  PREDICTED: plasma membrane ATPase 1 isoform X1     173   2e-46   Vitis vinifera
emb|CDP14881.1|  unnamed protein product                                173   2e-46   Coffea canephora [robusta coffee]
ref|XP_006838797.1|  hypothetical protein AMTR_s00002p00260210          172   2e-46   Amborella trichopoda
ref|XP_011028703.1|  PREDICTED: ATPase 11, plasma membrane-type-like    172   3e-46   Populus euphratica
ref|XP_008437674.1|  PREDICTED: ATPase 11, plasma membrane-type         172   4e-46   Cucumis melo [Oriental melon]
ref|XP_010256122.1|  PREDICTED: ATPase 11, plasma membrane-type i...    171   6e-46   Nelumbo nucifera [Indian lotus]
ref|XP_010256132.1|  PREDICTED: ATPase 11, plasma membrane-type i...    171   8e-46   Nelumbo nucifera [Indian lotus]
sp|Q08435.1|PMA1_NICPL  RecName: Full=Plasma membrane ATPase 1; A...    171   9e-46   Nicotiana plumbaginifolia [leadwort-leaved tobacco]
ref|XP_004152442.1|  PREDICTED: ATPase 11, plasma membrane-type-like    171   1e-45   
dbj|BAD16689.1|  plasma membrane H+-ATPase                              171   1e-45   Daucus carota [carrots]
gb|AAQ55291.1|  plasma membrane H+-ATPase                               170   1e-45   Juglans regia
dbj|BAC77532.1|  plasma membrane H+-ATPase                              170   2e-45   Sesbania rostrata
gb|KDO76027.1|  hypothetical protein CISIN_1g005866mg                   168   2e-45   Citrus sinensis [apfelsine]
gb|KDO76029.1|  hypothetical protein CISIN_1g005866mg                   168   2e-45   Citrus sinensis [apfelsine]
ref|XP_009607762.1|  PREDICTED: plasma membrane ATPase 1                169   3e-45   Nicotiana tomentosiformis
ref|XP_010550649.1|  PREDICTED: ATPase 11, plasma membrane-type         169   4e-45   Tarenaya hassleriana [spider flower]
ref|XP_002511508.1|  H(\+)-transporting atpase plant/fungi plasma...    168   5e-45   
ref|XP_008453171.1|  PREDICTED: plasma membrane ATPase 3                169   5e-45   Cucumis melo [Oriental melon]
ref|XP_007037195.1|  H(+)-transporting atpase plant/fungi plasma ...    170   5e-45   
gb|KJB19307.1|  hypothetical protein B456_003G094300                    168   5e-45   Gossypium raimondii
gb|KJB19302.1|  hypothetical protein B456_003G094300                    169   7e-45   Gossypium raimondii
gb|KJB19303.1|  hypothetical protein B456_003G094300                    168   7e-45   Gossypium raimondii
ref|XP_009798932.1|  PREDICTED: plasma membrane ATPase 1                168   8e-45   Nicotiana sylvestris
gb|KJB19305.1|  hypothetical protein B456_003G094300                    168   9e-45   Gossypium raimondii
gb|KJB19306.1|  hypothetical protein B456_003G094300                    168   9e-45   Gossypium raimondii
gb|AFC88896.1|  plasma membrane H+-ATPase                               168   1e-44   Melastoma malabathricum
ref|XP_010112580.1|  ATPase 11, plasma membrane-type                    168   1e-44   
ref|XP_006439665.1|  hypothetical protein CICLE_v10018737mg             168   1e-44   Citrus clementina [clementine]
gb|KGN64262.1|  hypothetical protein Csa_1G045600                       166   1e-44   Cucumis sativus [cucumbers]
ref|XP_006476664.1|  PREDICTED: ATPase 11, plasma membrane-type-like    167   1e-44   Citrus sinensis [apfelsine]
ref|XP_010678593.1|  PREDICTED: plasma membrane ATPase 1                167   2e-44   Beta vulgaris subsp. vulgaris [field beet]
gb|KGN63646.1|  hypothetical protein Csa_1G008520                       166   2e-44   Cucumis sativus [cucumbers]
ref|XP_002318614.1|  putative plasma membrane H+ ATPase family pr...    167   2e-44   
dbj|BAD16686.1|  plasma membrane H+-ATPase                              167   2e-44   Daucus carota [carrots]
ref|XP_011042618.1|  PREDICTED: ATPase 11, plasma membrane-type         167   2e-44   Populus euphratica
ref|XP_007138219.1|  hypothetical protein PHAVU_009G190500g             167   2e-44   Phaseolus vulgaris [French bean]
gb|KDP31195.1|  hypothetical protein JCGZ_11571                         167   2e-44   Jatropha curcas
ref|XP_006279959.1|  hypothetical protein CARUB_v10025825mg             166   4e-44   Capsella rubella
emb|CAB41144.1|  H+-transporting ATPase-like protein                    166   6e-44   Arabidopsis thaliana [mouse-ear cress]
ref|NP_190378.2|  H(+)-ATPase 4                                         166   6e-44   Arabidopsis thaliana [mouse-ear cress]
gb|KEH31901.1|  plasma membrane H+-ATPase                               166   7e-44   Medicago truncatula
gb|KHG12451.1|  ATPase 4, plasma membrane-type -like protein            164   7e-44   Gossypium arboreum [tree cotton]
ref|XP_003527056.1|  PREDICTED: ATPase 11, plasma membrane-type-l...    166   8e-44   Glycine max [soybeans]
ref|XP_002864812.1|  AHA11-ATPASE 11                                    166   8e-44   Arabidopsis lyrata subsp. lyrata
gb|KHN19372.1|  ATPase 11, plasma membrane-type                         166   8e-44   Glycine soja [wild soybean]
ref|XP_004138147.1|  PREDICTED: ATPase 4, plasma membrane-type-like     165   9e-44   
ref|XP_010459221.1|  PREDICTED: ATPase 11, plasma membrane-type-like    165   9e-44   
ref|XP_004171391.1|  PREDICTED: LOW QUALITY PROTEIN: ATPase 4, pl...    165   9e-44   
ref|XP_002282263.1|  PREDICTED: ATPase 4, plasma membrane-type          165   1e-43   Vitis vinifera
ref|XP_003523043.1|  PREDICTED: ATPase 11, plasma membrane-type-l...    165   2e-43   Glycine max [soybeans]
ref|NP_201073.1|  H(+)-ATPase 11                                        164   2e-43   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006394361.1|  hypothetical protein EUTSA_v10003603mg             164   2e-43   
ref|XP_010272214.1|  PREDICTED: ATPase 11, plasma membrane-type-like    164   2e-43   Nelumbo nucifera [Indian lotus]
ref|XP_009130229.1|  PREDICTED: ATPase 11, plasma membrane-type i...    164   3e-43   Brassica rapa
ref|XP_009130228.1|  PREDICTED: ATPase 11, plasma membrane-type i...    164   3e-43   Brassica rapa
ref|XP_004508789.1|  PREDICTED: ATPase 11, plasma membrane-type-l...    164   3e-43   Cicer arietinum [garbanzo]
ref|XP_009130230.1|  PREDICTED: ATPase 11, plasma membrane-type i...    164   4e-43   Brassica rapa
emb|CDY45757.1|  BnaC02g42250D                                          163   4e-43   Brassica napus [oilseed rape]
gb|EPS66977.1|  hypothetical protein M569_07799                         163   4e-43   Genlisea aurea
ref|XP_007155352.1|  hypothetical protein PHAVU_003G193800g             162   5e-43   Phaseolus vulgaris [French bean]
ref|XP_010444121.1|  PREDICTED: ATPase 11, plasma membrane-type i...    163   7e-43   
ref|XP_010444120.1|  PREDICTED: ATPase 11, plasma membrane-type i...    163   7e-43   
emb|CAC29435.1|  P-type H+-ATPase                                       162   1e-42   Vicia faba [broad bean]
ref|XP_007155353.1|  hypothetical protein PHAVU_003G193800g             162   1e-42   Phaseolus vulgaris [French bean]
ref|XP_008807875.1|  PREDICTED: ATPase 11, plasma membrane-type         162   1e-42   Phoenix dactylifera
gb|EEC69747.1|  hypothetical protein OsI_39279                          162   2e-42   Oryza sativa Indica Group [Indian rice]
ref|XP_009398400.1|  PREDICTED: plasma membrane ATPase 1 isoform X1     162   2e-42   Musa acuminata subsp. malaccensis [pisang utan]
gb|EAZ21357.1|  hypothetical protein OsJ_37014                          162   2e-42   Oryza sativa Japonica Group [Japonica rice]
ref|XP_006664787.1|  PREDICTED: plasma membrane ATPase 1-like           161   2e-42   Oryza brachyantha
ref|NP_001067382.1|  Os12g0638700                                       161   2e-42   
ref|XP_010923303.1|  PREDICTED: plasma membrane ATPase 3-like           161   4e-42   Elaeis guineensis
ref|XP_004963335.1|  PREDICTED: plasma membrane ATPase 1-like           160   4e-42   Setaria italica
ref|XP_004508788.1|  PREDICTED: ATPase 11, plasma membrane-type-l...    160   5e-42   
ref|XP_006290560.1|  hypothetical protein CARUB_v10016646mg             160   5e-42   Capsella rubella
ref|XP_004508787.1|  PREDICTED: ATPase 11, plasma membrane-type-l...    160   6e-42   
ref|XP_003549657.1|  PREDICTED: ATPase 11, plasma membrane-type-like    160   8e-42   Glycine max [soybeans]
ref|XP_003525017.1|  PREDICTED: ATPase 11, plasma membrane-type-l...    160   8e-42   Glycine max [soybeans]
gb|KGN52442.1|  hypothetical protein Csa_5G635370                       159   1e-41   Cucumis sativus [cucumbers]
ref|XP_010933786.1|  PREDICTED: plasma membrane ATPase 3                159   1e-41   Elaeis guineensis
ref|XP_004148685.1|  PREDICTED: ATPase 11, plasma membrane-type-like    159   1e-41   Cucumis sativus [cucumbers]
ref|XP_008796652.1|  PREDICTED: plasma membrane ATPase 3 isoform X1     159   1e-41   Phoenix dactylifera
ref|XP_002442618.1|  hypothetical protein SORBIDRAFT_08g023070          159   2e-41   Sorghum bicolor [broomcorn]
ref|XP_009398401.1|  PREDICTED: plasma membrane ATPase 1 isoform X2     159   2e-41   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009398402.1|  PREDICTED: plasma membrane ATPase 1-like           159   2e-41   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_007032427.1|  H(+)-ATPase 4 isoform 1                            158   4e-41   
tpg|DAA54787.1|  TPA: hypothetical protein ZEAMMB73_074525              157   5e-41   
gb|KHG14131.1|  ATPase 4, plasma membrane-type -like protein            156   5e-41   Gossypium arboreum [tree cotton]
ref|XP_007151191.1|  hypothetical protein PHAVU_004G025700g             157   5e-41   Phaseolus vulgaris [French bean]
gb|KHN13245.1|  Plasma membrane ATPase 1                                157   5e-41   Glycine soja [wild soybean]
ref|XP_003561110.1|  PREDICTED: plasma membrane ATPase 1-like           157   7e-41   Brachypodium distachyon [annual false brome]
ref|XP_008673350.1|  PREDICTED: uncharacterized protein LOC100502...    157   7e-41   
ref|XP_008459294.1|  PREDICTED: ATPase 11, plasma membrane-type-like    156   1e-40   Cucumis melo [Oriental melon]
gb|KJB33644.1|  hypothetical protein B456_006G023600                    155   2e-40   Gossypium raimondii
ref|XP_004982139.1|  PREDICTED: plasma membrane ATPase 1-like           155   2e-40   Setaria italica
gb|KJB33641.1|  hypothetical protein B456_006G023600                    155   3e-40   Gossypium raimondii
gb|KJB33642.1|  hypothetical protein B456_006G023600                    155   3e-40   Gossypium raimondii
ref|XP_006482527.1|  PREDICTED: plasma membrane ATPase 1-like           155   4e-40   Citrus sinensis [apfelsine]
ref|XP_008644894.1|  PREDICTED: uncharacterized protein LOC100383...    155   4e-40   
gb|KJB33643.1|  hypothetical protein B456_006G023600                    155   4e-40   Gossypium raimondii
ref|XP_010029279.1|  PREDICTED: ATPase 11, plasma membrane-type-like    155   4e-40   Eucalyptus grandis [rose gum]
gb|KCW56159.1|  hypothetical protein EUGRSUZ_I01911                     155   5e-40   Eucalyptus grandis [rose gum]
gb|KDO72462.1|  hypothetical protein CISIN_1g0021762mg                  154   5e-40   Citrus sinensis [apfelsine]
gb|KDP45466.1|  hypothetical protein JCGZ_09715                         155   5e-40   Jatropha curcas
ref|XP_006431062.1|  hypothetical protein CICLE_v10011000mg             155   5e-40   Citrus clementina [clementine]
ref|XP_003554288.1|  PREDICTED: plasma membrane ATPase 1-like           154   6e-40   Glycine max [soybeans]
gb|KHN34200.1|  ATPase 11, plasma membrane-type                         154   6e-40   Glycine soja [wild soybean]
gb|KDO72464.1|  hypothetical protein CISIN_1g0021762mg                  154   7e-40   Citrus sinensis [apfelsine]
ref|XP_007032428.1|  H(+)-ATPase 4 isoform 2                            154   7e-40   
gb|KEH24964.1|  plasma membrane H+-ATPase                               154   8e-40   Medicago truncatula
gb|KEH24965.1|  plasma membrane H+-ATPase                               154   8e-40   Medicago truncatula
gb|EMT26085.1|  Plasma membrane ATPase 1                                154   8e-40   
ref|XP_010228253.1|  PREDICTED: plasma membrane ATPase 3-like iso...    154   1e-39   Brachypodium distachyon [annual false brome]
ref|XP_010228254.1|  PREDICTED: plasma membrane ATPase 3-like iso...    154   1e-39   Brachypodium distachyon [annual false brome]
ref|XP_011466246.1|  PREDICTED: plasma membrane ATPase 1-like iso...    153   3e-39   Fragaria vesca subsp. vesca
ref|XP_004302360.1|  PREDICTED: plasma membrane ATPase 1-like iso...    152   3e-39   Fragaria vesca subsp. vesca
ref|XP_009417143.1|  PREDICTED: plasma membrane ATPase 1-like           152   3e-39   
ref|XP_003578172.1|  PREDICTED: plasma membrane ATPase 1                152   3e-39   Brachypodium distachyon [annual false brome]
ref|XP_011082991.1|  PREDICTED: LOW QUALITY PROTEIN: plasma membr...    152   4e-39   
dbj|BAA06629.1|  plasma membrane H+-ATPase                              152   5e-39   Oryza sativa Japonica Group [Japonica rice]
gb|EYU34115.1|  hypothetical protein MIMGU_mgv1a000867mg                152   6e-39   Erythranthe guttata [common monkey flower]
dbj|BAK04567.1|  predicted protein                                      152   6e-39   Hordeum vulgare subsp. vulgare [two-rowed barley]
dbj|BAJ92653.1|  predicted protein                                      152   6e-39   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_002517457.1|  H(\+)-transporting atpase plant/fungi plasma...    150   7e-39   
ref|XP_011098566.1|  PREDICTED: plasma membrane ATPase 1-like           151   7e-39   Sesamum indicum [beniseed]
ref|XP_006658357.1|  PREDICTED: plasma membrane ATPase 1-like           151   8e-39   Oryza brachyantha
ref|XP_004955721.1|  PREDICTED: plasma membrane ATPase 1-like           151   1e-38   Setaria italica
tpg|DAA50741.1|  TPA: hypothetical protein ZEAMMB73_722190              151   1e-38   
gb|EEC81667.1|  hypothetical protein OsI_25220                          150   1e-38   Oryza sativa Indica Group [Indian rice]
ref|NP_001059093.1|  Os07g0191200                                       150   2e-38   
dbj|BAA01058.1|  H-ATPase                                               150   2e-38   Oryza sativa Japonica Group [Japonica rice]
ref|XP_008230721.1|  PREDICTED: plasma membrane ATPase 1-like           150   2e-38   Prunus mume [ume]
gb|KCW83495.1|  hypothetical protein EUGRSUZ_B00400                     150   2e-38   Eucalyptus grandis [rose gum]
gb|AEQ27823.1|  PM H+-ATPase L                                          150   2e-38   Eichhornia crassipes
ref|XP_010028675.1|  PREDICTED: ATPase 11, plasma membrane-type         150   2e-38   Eucalyptus grandis [rose gum]
gb|EEC75974.1|  hypothetical protein OsI_13084                          150   2e-38   Oryza sativa Indica Group [Indian rice]
ref|NP_001050947.1|  Os03g0689300                                       150   2e-38   
gb|KCW83494.1|  hypothetical protein EUGRSUZ_B00400                     150   2e-38   Eucalyptus grandis [rose gum]
ref|XP_007214948.1|  hypothetical protein PRUPE_ppa000931mg             150   2e-38   
ref|XP_008650970.1|  PREDICTED: uncharacterized protein LOC100216...    149   3e-38   
gb|EMS45119.1|  Plasma membrane ATPase 1                                149   4e-38   Triticum urartu
emb|CDP02191.1|  unnamed protein product                                149   8e-38   Coffea canephora [robusta coffee]
ref|XP_002459489.1|  hypothetical protein SORBIDRAFT_02g005440          148   1e-37   Sorghum bicolor [broomcorn]
gb|KDP28822.1|  hypothetical protein JCGZ_14593                         148   2e-37   Jatropha curcas
ref|XP_010531800.1|  PREDICTED: ATPase 4, plasma membrane-type-like     147   3e-37   Tarenaya hassleriana [spider flower]
ref|XP_008341531.1|  PREDICTED: plasma membrane ATPase 1-like           147   3e-37   
emb|CDP09440.1|  unnamed protein product                                147   3e-37   Coffea canephora [robusta coffee]
dbj|BAM20990.1|  plasma membrane H+-ATPase                              145   1e-36   Marchantia polymorpha
ref|XP_010545150.1|  PREDICTED: ATPase 7, plasma membrane-type          145   1e-36   Tarenaya hassleriana [spider flower]
ref|XP_006837363.1|  hypothetical protein AMTR_s00111p00107570          144   2e-36   
ref|XP_010529048.1|  PREDICTED: ATPase 7, plasma membrane-type          144   3e-36   Tarenaya hassleriana [spider flower]
ref|XP_009335819.1|  PREDICTED: plasma membrane ATPase 1-like           144   4e-36   Pyrus x bretschneideri [bai li]
gb|AAN15220.1|  plasma membrane P-type proton pump ATPase               144   4e-36   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|EPS65442.1|  hypothetical protein M569_09334                         144   5e-36   Genlisea aurea
tpg|DAA42486.1|  TPA: H(+)-transporting ATPase                          143   6e-36   
ref|NP_001105360.1|  membrane H(+)-ATPase1                              143   6e-36   Zea mays [maize]
ref|XP_002263241.1|  PREDICTED: ATPase 8, plasma membrane-type          142   1e-35   Vitis vinifera
ref|XP_011031934.1|  PREDICTED: plasma membrane ATPase 1                142   1e-35   Populus euphratica
gb|KJB66333.1|  hypothetical protein B456_010G136300                    142   2e-35   Gossypium raimondii
dbj|BAM20989.1|  plasma membrane H+-ATPase                              140   5e-35   Marchantia polymorpha
gb|EPS73574.1|  hypothetical protein M569_01174                         139   7e-35   Genlisea aurea
gb|AFW59711.1|  plasma membrane H+-transporting ATPase-like protein     140   8e-35   
ref|XP_008663681.1|  PREDICTED: plasma membrane ATPase isoform X2       140   9e-35   
ref|XP_010430916.1|  PREDICTED: ATPase 8, plasma membrane-type-like     135   9e-35   Camelina sativa [gold-of-pleasure]
gb|EMS59303.1|  Plasma membrane ATPase                                  140   9e-35   Triticum urartu
ref|XP_008668762.1|  PREDICTED: plasma membrane ATPase                  140   1e-34   
gb|ACL54575.1|  unknown                                                 140   1e-34   Zea mays [maize]
ref|XP_008663679.1|  PREDICTED: plasma membrane ATPase isoform X1       140   1e-34   
ref|XP_010496530.1|  PREDICTED: ATPase 8, plasma membrane-type-like     135   1e-34   Camelina sativa [gold-of-pleasure]
gb|EYU31795.1|  hypothetical protein MIMGU_mgv1a000883mg                139   2e-34   Erythranthe guttata [common monkey flower]
ref|XP_010942146.1|  PREDICTED: plasma membrane ATPase 4-like           139   2e-34   Elaeis guineensis
ref|XP_001782121.1|  predicted protein                                  136   2e-34   
ref|XP_009610942.1|  PREDICTED: ATPase 9, plasma membrane-type-like     139   2e-34   Nicotiana tomentosiformis
gb|ABR26203.1|  plasma membrane atpase 1                                133   2e-34   Oryza sativa Indica Group [Indian rice]
ref|XP_008784793.1|  PREDICTED: plasma membrane ATPase 4-like iso...    139   2e-34   Phoenix dactylifera
ref|XP_006651704.1|  PREDICTED: plasma membrane ATPase 1-like           139   2e-34   
ref|XP_006375124.1|  H+-ATPase family protein                           139   3e-34   
ref|XP_008784794.1|  PREDICTED: plasma membrane ATPase 4-like iso...    138   3e-34   Phoenix dactylifera
ref|XP_006279360.1|  hypothetical protein CARUB_v10008027mg             138   3e-34   Capsella rubella
ref|XP_009396235.1|  PREDICTED: plasma membrane ATPase                  138   3e-34   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010928676.1|  PREDICTED: plasma membrane ATPase-like             138   4e-34   Elaeis guineensis
ref|XP_002447249.1|  hypothetical protein SORBIDRAFT_06g031240          138   4e-34   Sorghum bicolor [broomcorn]
ref|XP_007023381.1|  H(+)-ATPase 9                                      138   4e-34   
ref|XP_008781833.1|  PREDICTED: plasma membrane ATPase 4                137   5e-34   Phoenix dactylifera
ref|XP_006440236.1|  hypothetical protein CICLE_v10018727mg             137   6e-34   
ref|XP_006477127.1|  PREDICTED: ATPase 11, plasma membrane-type-like    137   7e-34   Citrus sinensis [apfelsine]
gb|KDO61318.1|  hypothetical protein CISIN_1g002151mg                   137   7e-34   Citrus sinensis [apfelsine]
gb|KJB70727.1|  hypothetical protein B456_011G089100                    137   7e-34   Gossypium raimondii
gb|EYU25317.1|  hypothetical protein MIMGU_mgv1a000893mg                137   7e-34   Erythranthe guttata [common monkey flower]
ref|XP_003610080.1|  Plasma membrane H+-ATPase                          137   8e-34   Medicago truncatula
ref|XP_002267501.1|  PREDICTED: plasma membrane ATPase 4                137   8e-34   Vitis vinifera
ref|XP_010929115.1|  PREDICTED: plasma membrane ATPase 4-like           137   8e-34   Elaeis guineensis
ref|XP_003610081.1|  Plasma membrane H+-ATPase                          137   8e-34   
ref|XP_006402592.1|  hypothetical protein EUTSA_v10005774mg             137   8e-34   Eutrema salsugineum [saltwater cress]
ref|XP_009398632.1|  PREDICTED: plasma membrane ATPase-like             137   9e-34   Musa acuminata subsp. malaccensis [pisang utan]
ref|NP_001105470.1|  plasma-membrane H+ATPase2                          137   9e-34   
emb|CAN64375.1|  hypothetical protein VITISV_014422                     137   9e-34   Vitis vinifera
ref|XP_010913679.1|  PREDICTED: plasma membrane ATPase                  137   9e-34   Elaeis guineensis
ref|XP_010520558.1|  PREDICTED: ATPase 8, plasma membrane-type-like     137   9e-34   Tarenaya hassleriana [spider flower]
ref|XP_006480483.1|  PREDICTED: ATPase 4, plasma membrane-type-li...    137   9e-34   
ref|XP_006480487.1|  PREDICTED: ATPase 4, plasma membrane-type-li...    137   1e-33   
ref|XP_010265488.1|  PREDICTED: plasma membrane ATPase 4                137   1e-33   Nelumbo nucifera [Indian lotus]
ref|XP_006597964.1|  PREDICTED: ATPase 8, plasma membrane-type-like     136   1e-33   Glycine max [soybeans]
ref|XP_004973040.1|  PREDICTED: plasma membrane ATPase-like             136   1e-33   Setaria italica
emb|CDY67606.1|  BnaAnng24780D                                          134   1e-33   Brassica napus [oilseed rape]
gb|EMT26270.1|  Plasma membrane ATPase                                  136   2e-33   
sp|P83970.1|PMA1_WHEAT  RecName: Full=Plasma membrane ATPase; Alt...    136   2e-33   Triticum aestivum [Canadian hard winter wheat]
gb|AAV71150.1|  plasma membrane H+-ATPase                               136   2e-33   Triticum aestivum [Canadian hard winter wheat]
gb|EMS60594.1|  Plasma membrane ATPase                                  136   2e-33   Triticum urartu
dbj|BAD19091.1|  putative H+-exporting ATPase                           136   2e-33   Oryza sativa Japonica Group [Japonica rice]
ref|XP_008443886.1|  PREDICTED: ATPase 8, plasma membrane-type          136   2e-33   Cucumis melo [Oriental melon]
ref|XP_002307856.1|  ATPase 6 family protein                            136   2e-33   Populus trichocarpa [western balsam poplar]
gb|KJB82864.1|  hypothetical protein B456_013G217900                    136   2e-33   Gossypium raimondii
ref|XP_007204519.1|  hypothetical protein PRUPE_ppa018171mg             136   2e-33   Prunus persica
ref|XP_003633895.1|  PREDICTED: plasma membrane ATPase 1                136   2e-33   Vitis vinifera
gb|KJB82762.1|  hypothetical protein B456_013G212200                    135   2e-33   Gossypium raimondii
emb|CDY69631.1|  BnaCnng64550D                                          133   2e-33   Brassica napus [oilseed rape]
ref|XP_010469197.1|  PREDICTED: ATPase 7, plasma membrane-type-like     136   2e-33   Camelina sativa [gold-of-pleasure]
ref|XP_010413571.1|  PREDICTED: ATPase 7, plasma membrane-type          136   2e-33   Camelina sativa [gold-of-pleasure]
emb|CAD29312.1|  plasma membrane H+-ATPase                              136   2e-33   Oryza sativa Japonica Group [Japonica rice]
gb|ABA18090.1|  putative plasma membrane ATPase                         136   2e-33   Olimarabidopsis pumila
ref|XP_006290558.1|  hypothetical protein CARUB_v10016644mg             136   2e-33   Capsella rubella
emb|CBI16656.3|  unnamed protein product                                136   2e-33   Vitis vinifera
dbj|BAL41366.1|  plasma membrane H+-ATPase                              135   2e-33   Aeluropus littoralis
gb|AEO22063.1|  plasma membrane H+-ATPase                               135   2e-33   Aeluropus littoralis
ref|XP_010094202.1|  Plasma membrane ATPase 4                           136   2e-33   Morus notabilis
ref|XP_010526353.1|  PREDICTED: ATPase 2, plasma membrane-type-like     135   2e-33   Tarenaya hassleriana [spider flower]
ref|XP_010512349.1|  PREDICTED: ATPase 7, plasma membrane-type-like     135   2e-33   Camelina sativa [gold-of-pleasure]
gb|KJB82763.1|  hypothetical protein B456_013G212200                    135   2e-33   Gossypium raimondii
emb|CDY42692.1|  BnaC04g22140D                                          135   3e-33   Brassica napus [oilseed rape]
ref|XP_011043940.1|  PREDICTED: LOW QUALITY PROTEIN: plasma membr...    135   3e-33   Populus euphratica
ref|XP_006419170.1|  hypothetical protein EUTSA_v10002391mg             135   3e-33   Eutrema salsugineum [saltwater cress]
ref|XP_002325038.1|  plasma membrane H+ ATPase family protein           135   3e-33   
ref|XP_009348377.1|  PREDICTED: plasma membrane ATPase 1-like           135   3e-33   Pyrus x bretschneideri [bai li]
ref|XP_004160843.1|  PREDICTED: LOW QUALITY PROTEIN: plasma membr...    135   3e-33   
ref|XP_008445089.1|  PREDICTED: plasma membrane ATPase 4-like           135   3e-33   Cucumis melo [Oriental melon]
ref|XP_002875581.1|  hypothetical protein ARALYDRAFT_323063             135   3e-33   Arabidopsis lyrata subsp. lyrata
ref|XP_002523524.1|  H(\+)-transporting atpase plant/fungi plasma...    135   3e-33   
ref|XP_004960134.1|  PREDICTED: plasma membrane ATPase-like             135   3e-33   Setaria italica
ref|XP_010425792.1|  PREDICTED: ATPase 8, plasma membrane-type-like     135   3e-33   Camelina sativa [gold-of-pleasure]
ref|XP_010514696.1|  PREDICTED: ATPase 8, plasma membrane-type          135   3e-33   
gb|ABA18112.1|  putative plasma membrane ATPase                         135   3e-33   Arabidopsis arenosa
ref|XP_008789658.1|  PREDICTED: plasma membrane ATPase 4-like           135   3e-33   Phoenix dactylifera
dbj|BAM20991.1|  plasma membrane H+-ATPase                              135   3e-33   Marchantia polymorpha
ref|XP_004507873.1|  PREDICTED: plasma membrane ATPase 4-like           135   4e-33   Cicer arietinum [garbanzo]
ref|XP_007012006.1|  H(+)-ATPase 8                                      135   4e-33   
ref|XP_011079289.1|  PREDICTED: plasma membrane ATPase 4-like           135   4e-33   Sesamum indicum [beniseed]
ref|XP_010048663.1|  PREDICTED: plasma membrane ATPase 4                135   4e-33   Eucalyptus grandis [rose gum]
ref|XP_009775735.1|  PREDICTED: ATPase 9, plasma membrane-type-like     135   4e-33   Nicotiana sylvestris
ref|NP_001048395.2|  Os02g0797300                                       135   4e-33   
gb|EAZ06139.1|  hypothetical protein OsI_28373                          135   4e-33   Oryza sativa Indica Group [Indian rice]
ref|XP_007134481.1|  hypothetical protein PHAVU_010G050900g             135   4e-33   Phaseolus vulgaris [French bean]
gb|AAV49159.1|  plasma membrane proton ATPase 5                         135   4e-33   Nicotiana plumbaginifolia [leadwort-leaved tobacco]
ref|XP_011069930.1|  PREDICTED: plasma membrane ATPase 4                135   5e-33   Sesamum indicum [beniseed]
gb|EMT31912.1|  Plasma membrane ATPase 1                                135   5e-33   
ref|XP_011017965.1|  PREDICTED: ATPase 8, plasma membrane-type-like     135   5e-33   
ref|XP_009384769.1|  PREDICTED: plasma membrane ATPase-like             135   5e-33   
ref|XP_008677658.1|  PREDICTED: uncharacterized protein LOC100383...    135   5e-33   
ref|XP_006428677.1|  hypothetical protein CICLE_v10011010mg             135   5e-33   
gb|KDP42000.1|  hypothetical protein JCGZ_27018                         135   6e-33   
ref|XP_008804905.1|  PREDICTED: plasma membrane ATPase-like             135   6e-33   
ref|XP_002324564.1|  ATPase 6 family protein                            135   6e-33   
ref|XP_009128001.1|  PREDICTED: ATPase 2, plasma membrane-type          135   6e-33   
emb|CDY67153.1|  BnaAnng23670D                                          134   6e-33   
gb|KFK33846.1|  hypothetical protein AALP_AA5G067500                    134   6e-33   
ref|XP_006652940.1|  PREDICTED: plasma membrane ATPase-like             134   6e-33   
gb|AAK31799.2|  plasma membrane H+ ATPase                               134   6e-33   
ref|XP_006848755.1|  hypothetical protein AMTR_s00026p00033380          134   6e-33   
ref|XP_010687728.1|  PREDICTED: ATPase 8, plasma membrane-type-like     134   7e-33   
ref|XP_008378468.1|  PREDICTED: plasma membrane ATPase 1-like           134   7e-33   
ref|XP_009381583.1|  PREDICTED: plasma membrane ATPase-like             134   8e-33   
ref|XP_009128205.1|  PREDICTED: ATPase 8, plasma membrane-type          134   8e-33   
ref|XP_002309321.1|  ATPase 6 family protein                            134   9e-33   
ref|XP_010103366.1|  ATPase 8, plasma membrane-type                     134   9e-33   
ref|XP_011084028.1|  PREDICTED: ATPase 8, plasma membrane-type-like     134   9e-33   
gb|AEQ27822.1|  PM H+-ATPase R                                          134   9e-33   
gb|ABO15469.2|  plasma membrane H+-ATPase LilHA2                        134   9e-33   
ref|XP_011084027.1|  PREDICTED: ATPase 8, plasma membrane-type-like     134   9e-33   
ref|XP_004146701.1|  PREDICTED: ATPase 8, plasma membrane-type-like     134   9e-33   
ref|XP_004303259.1|  PREDICTED: ATPase 9, plasma membrane-type          134   9e-33   
emb|CDX76809.1|  BnaC08g33950D                                          125   1e-32   
ref|XP_009401466.1|  PREDICTED: plasma membrane ATPase-like             134   1e-32   
ref|XP_008378243.1|  PREDICTED: plasma membrane ATPase 4-like           134   1e-32   
gb|EYU37313.1|  hypothetical protein MIMGU_mgv1a000870mg                134   1e-32   
ref|XP_006648053.1|  PREDICTED: ATPase 8, plasma membrane-type-like     134   1e-32   
ref|XP_011084025.1|  PREDICTED: ATPase 8, plasma membrane-type          134   1e-32   
ref|XP_010049874.1|  PREDICTED: ATPase 8, plasma membrane-type is...    134   1e-32   
ref|XP_008381054.1|  PREDICTED: ATPase 9, plasma membrane-type          134   1e-32   
ref|XP_010033995.1|  PREDICTED: ATPase 9, plasma membrane-type is...    134   1e-32   
ref|XP_002280201.1|  PREDICTED: plasma membrane ATPase-like             134   1e-32   
gb|AFW04239.1|  plasma membrane H+-ATPase                               134   1e-32   
ref|XP_002304716.2|  H+-ATPase family protein                           134   1e-32   
ref|XP_010929278.1|  PREDICTED: plasma membrane ATPase-like             134   1e-32   
ref|XP_010049873.1|  PREDICTED: ATPase 8, plasma membrane-type is...    134   1e-32   
ref|XP_010545412.1|  PREDICTED: ATPase 2, plasma membrane-type-like     134   1e-32   
ref|XP_011084023.1|  PREDICTED: ATPase 8, plasma membrane-type-like     134   1e-32   
ref|XP_006594226.1|  PREDICTED: ATPase 8, plasma membrane-type-li...    133   1e-32   
ref|XP_009138842.1|  PREDICTED: LOW QUALITY PROTEIN: ATPase 7, pl...    134   1e-32   
emb|CDY56993.1|  BnaA04g27340D                                          133   2e-32   
ref|XP_002886251.1|  hypothetical protein ARALYDRAFT_480836             133   2e-32   
ref|XP_003549696.1|  PREDICTED: ATPase 8, plasma membrane-type-li...    133   2e-32   
ref|XP_011033475.1|  PREDICTED: ATPase 8, plasma membrane-type          133   2e-32   
gb|AAY42948.1|  plasma membrane H+ ATPase                               133   2e-32   
emb|CDY41176.1|  BnaA09g38390D                                          133   2e-32   
gb|KGN62872.1|  hypothetical protein Csa_2G378540                       131   2e-32   
gb|KHN18583.1|  ATPase 8, plasma membrane-type                          133   2e-32   
ref|XP_003542615.1|  PREDICTED: ATPase 8, plasma membrane-type-li...    133   2e-32   
emb|CBI20766.3|  unnamed protein product                                133   2e-32   
gb|KCW80694.1|  hypothetical protein EUGRSUZ_C02092                     133   2e-32   
ref|NP_001054118.1|  Os04g0656100                                       133   2e-32   
ref|XP_002282619.1|  PREDICTED: plasma membrane ATPase 4                133   2e-32   
ref|XP_006845683.1|  hypothetical protein AMTR_s00019p00234460          133   2e-32   
ref|XP_001771404.1|  predicted protein                                  130   2e-32   
ref|XP_002527322.1|  H(\+)-transporting atpase plant/fungi plasma...    132   2e-32   
ref|XP_009116714.1|  PREDICTED: ATPase 7, plasma membrane-type          133   2e-32   
ref|NP_191592.5|  H(+)-ATPase 7                                         133   2e-32   
ref|XP_002511598.1|  H(\+)-transporting atpase plant/fungi plasma...    133   2e-32   
gb|AAB84202.2|  plasma membrane proton ATPase                           133   2e-32   
ref|XP_010033996.1|  PREDICTED: ATPase 9, plasma membrane-type is...    133   2e-32   
ref|XP_004242977.2|  PREDICTED: ATPase 8, plasma membrane-type-like     133   2e-32   
gb|KJB54894.1|  hypothetical protein B456_009G053500                    133   2e-32   
emb|CDX82608.1|  BnaC07g02580D                                          133   2e-32   
ref|XP_010429431.1|  PREDICTED: ATPase 5, plasma membrane-type-li...    132   2e-32   
ref|XP_007203995.1|  hypothetical protein PRUPE_ppa000965mg             133   2e-32   
sp|Q9SJB3.3|PMA5_ARATH  RecName: Full=ATPase 5, plasma membrane-t...    133   2e-32   
ref|XP_010033994.1|  PREDICTED: ATPase 9, plasma membrane-type is...    133   2e-32   
ref|XP_009102205.1|  PREDICTED: ATPase 1, plasma membrane-type          133   2e-32   
gb|KDO61837.1|  hypothetical protein CISIN_1g002208mg                   133   2e-32   
ref|XP_008451563.1|  PREDICTED: plasma membrane ATPase 4                133   2e-32   
gb|EYU20899.1|  hypothetical protein MIMGU_mgv1a000880mg                133   2e-32   
gb|KHN22097.1|  ATPase 8, plasma membrane-type                          133   2e-32   
ref|XP_007154926.1|  hypothetical protein PHAVU_003G159200g             133   2e-32   
dbj|BAJ33915.1|  unnamed protein product                                133   3e-32   
ref|XP_003570306.1|  PREDICTED: ATPase 8, plasma membrane-type-like     133   3e-32   
ref|XP_010451109.1|  PREDICTED: ATPase 2, plasma membrane-type-like     133   3e-32   
emb|CAN61424.1|  hypothetical protein VITISV_027272                     133   3e-32   
ref|XP_006409094.1|  hypothetical protein EUTSA_v10022531mg             133   3e-32   
ref|XP_010467735.1|  PREDICTED: ATPase 1, plasma membrane-type-like     133   3e-32   
emb|CDY64741.1|  BnaCnng44750D                                          133   3e-32   
ref|XP_010489446.1|  PREDICTED: ATPase 1, plasma membrane-type          133   3e-32   
ref|XP_009587248.1|  PREDICTED: ATPase 9, plasma membrane-type          133   3e-32   
ref|XP_010414918.1|  PREDICTED: ATPase 1, plasma membrane-type-li...    133   3e-32   
gb|KEH37844.1|  plasma membrane H+-ATPase                               132   3e-32   
ref|XP_004488894.1|  PREDICTED: ATPase 8, plasma membrane-type-like     132   3e-32   
ref|XP_009109000.1|  PREDICTED: ATPase 2, plasma membrane-type          132   3e-32   
gb|AAY42950.1|  plasma membrane H+ ATPase                               132   3e-32   
ref|XP_009112568.1|  PREDICTED: ATPase 1, plasma membrane-type          132   3e-32   
ref|XP_010688454.1|  PREDICTED: plasma membrane ATPase 4                132   3e-32   
ref|XP_006296920.1|  hypothetical protein CARUB_v10012913mg             132   3e-32   
ref|XP_003580730.1|  PREDICTED: plasma membrane ATPase                  132   3e-32   
ref|XP_010548606.1|  PREDICTED: ATPase 2, plasma membrane-type          132   3e-32   
ref|XP_008810004.1|  PREDICTED: plasma membrane ATPase                  132   3e-32   
ref|XP_010048446.1|  PREDICTED: plasma membrane ATPase 4                132   3e-32   
emb|CDY51650.1|  BnaAnng10900D                                          132   3e-32   
ref|XP_010525721.1|  PREDICTED: ATPase 2, plasma membrane-type-like     132   3e-32   
gb|EAZ32257.1|  hypothetical protein OsJ_16461                          132   3e-32   
dbj|BAC77531.1|  plasma membrane H+-ATPase                              132   3e-32   
emb|CDX72217.1|  BnaC07g42390D                                          132   3e-32   
ref|XP_010414912.1|  PREDICTED: ATPase 1, plasma membrane-type-li...    132   3e-32   
ref|XP_009137895.1|  PREDICTED: ATPase 2, plasma membrane-type-like     132   4e-32   
ref|XP_004954231.1|  PREDICTED: ATPase 8, plasma membrane-type-like     132   4e-32   
ref|XP_008456775.1|  PREDICTED: ATPase 8, plasma membrane-type-like     132   4e-32   
ref|XP_002452983.1|  hypothetical protein SORBIDRAFT_04g036040          132   4e-32   
emb|CDX72218.1|  BnaC07g42400D                                          132   4e-32   
ref|XP_010429432.1|  PREDICTED: ATPase 5, plasma membrane-type-li...    132   4e-32   
ref|XP_009334638.1|  PREDICTED: ATPase 9, plasma membrane-type          132   4e-32   
ref|XP_011082086.1|  PREDICTED: plasma membrane ATPase 4-like           132   4e-32   
ref|XP_002979990.1|  hypothetical protein SELMODRAFT_419690             132   4e-32   
ref|XP_004508383.1|  PREDICTED: ATPase 8, plasma membrane-type-li...    132   4e-32   
gb|KDO45595.1|  hypothetical protein CISIN_1g044543mg                   132   4e-32   
gb|KHN18251.1|  ATPase 8, plasma membrane-type                          132   5e-32   
ref|XP_006427547.1|  hypothetical protein CICLE_v10027127mg             132   5e-32   
ref|XP_006343689.1|  PREDICTED: ATPase 8, plasma membrane-type-like     132   5e-32   
ref|XP_009137897.1|  PREDICTED: ATPase 2, plasma membrane-type-li...    132   5e-32   
ref|XP_002304299.1|  H+-ATPase family protein                           132   5e-32   
ref|NP_001274848.1|  plasma membrane ATPase 4-like                      132   5e-32   
ref|XP_004508384.1|  PREDICTED: ATPase 8, plasma membrane-type-li...    132   5e-32   
ref|XP_006465284.1|  PREDICTED: ATPase 9, plasma membrane-type-like     132   5e-32   
ref|XP_007014221.1|  Plasma membrane ATPase 4 isoform 1                 132   5e-32   
gb|AFM52333.1|  plasma membrane H+-ATPase                               132   5e-32   
gb|KFK40274.1|  hypothetical protein AALP_AA3G353600                    132   5e-32   
dbj|BAA37150.1|  p-type H+-ATPase                                       132   5e-32   
ref|XP_003594954.1|  Plasma membrane ATPase                             132   5e-32   
gb|KEH32174.1|  plasma membrane H+-ATPase                               132   6e-32   
ref|XP_009137896.1|  PREDICTED: ATPase 2, plasma membrane-type-li...    132   6e-32   
ref|XP_007225350.1|  hypothetical protein PRUPE_ppa000977mg             132   6e-32   
ref|XP_007014222.1|  Plasma membrane ATPase 4 isoform 2                 132   6e-32   
ref|XP_010539423.1|  PREDICTED: ATPase 2, plasma membrane-type is...    132   6e-32   
ref|XP_010914190.1|  PREDICTED: plasma membrane ATPase-like             132   6e-32   
dbj|BAK05828.1|  predicted protein                                      132   6e-32   
ref|XP_006343688.1|  PREDICTED: ATPase 8, plasma membrane-type-like     132   6e-32   
ref|XP_010046966.1|  PREDICTED: plasma membrane ATPase 4 isoform X1     132   7e-32   
ref|XP_010533093.1|  PREDICTED: ATPase 6, plasma membrane-type          132   7e-32   
ref|XP_009363612.1|  PREDICTED: plasma membrane ATPase 4-like           132   7e-32   
ref|XP_008393957.1|  PREDICTED: plasma membrane ATPase 4                132   7e-32   
ref|NP_189850.1|  H(+)-ATPase 8                                         132   7e-32   
ref|XP_004242908.1|  PREDICTED: plasma membrane ATPase 4                132   7e-32   
emb|CAB69823.1|  plasma membrane H+ ATPase                              132   7e-32   
gb|AAB17186.1|  plasma membrane H+-ATPase                               132   7e-32   
ref|XP_011084026.1|  PREDICTED: ATPase 8, plasma membrane-type-like     132   7e-32   
ref|XP_009397034.1|  PREDICTED: plasma membrane ATPase-like             132   7e-32   
ref|XP_010535849.1|  PREDICTED: ATPase 8, plasma membrane-type is...    131   7e-32   
ref|XP_008219933.1|  PREDICTED: LOW QUALITY PROTEIN: plasma membr...    131   7e-32   
ref|XP_010046967.1|  PREDICTED: plasma membrane ATPase 4 isoform X2     131   7e-32   
dbj|BAJ34124.1|  unnamed protein product                                131   7e-32   
ref|XP_006282289.1|  hypothetical protein CARUB_v10028575mg             131   8e-32   
ref|XP_010433017.1|  PREDICTED: ATPase 2, plasma membrane-type          131   8e-32   
ref|XP_006282542.1|  hypothetical protein CARUB_v10004082mg             131   8e-32   
ref|XP_006300372.1|  hypothetical protein CARUB_v10022427mg             131   8e-32   
emb|CDX71820.1|  BnaC08g30540D                                          131   8e-32   
ref|NP_001190870.1|  H(+)-ATPase 2                                      131   9e-32   
ref|XP_006389820.1|  hypothetical protein EUTSA_v10018080mg             131   9e-32   
ref|XP_010438207.1|  PREDICTED: ATPase 2, plasma membrane-type-like     131   9e-32   
ref|NP_194748.1|  H(+)-ATPase 2                                         131   9e-32   
gb|KDP38637.1|  hypothetical protein JCGZ_03990                         131   9e-32   
ref|XP_004291218.1|  PREDICTED: plasma membrane ATPase 4-like iso...    131   9e-32   
dbj|BAD16684.1|  plasma membrane H+-ATPase                              131   9e-32   
ref|XP_004486623.1|  PREDICTED: plasma membrane ATPase 4-like           131   1e-31   
ref|XP_007039740.1|  H(+)-ATPase 11 isoform 1                           131   1e-31   
ref|XP_006412736.1|  hypothetical protein EUTSA_v10024335mg             131   1e-31   
dbj|BAD16685.1|  plasma membrane H+-ATPase                              131   1e-31   
ref|XP_011459045.1|  PREDICTED: plasma membrane ATPase 4-like iso...    131   1e-31   
ref|XP_004253510.2|  PREDICTED: ATPase 8, plasma membrane-type-like     131   1e-31   
ref|XP_008466309.1|  PREDICTED: plasma membrane ATPase 4                131   1e-31   
ref|XP_010472461.1|  PREDICTED: ATPase 5, plasma membrane-type          131   1e-31   
pdb|3B8C|A  Chain A, Crystal Structure Of A Plasma Membrane Proto...    131   1e-31   
ref|XP_009588974.1|  PREDICTED: plasma membrane ATPase 4                131   1e-31   
ref|XP_009347012.1|  PREDICTED: plasma membrane ATPase 4-like           131   1e-31   
ref|XP_010525880.1|  PREDICTED: ATPase 5, plasma membrane-type-like     131   1e-31   
ref|XP_006453324.1|  hypothetical protein CICLE_v10007368mg             131   1e-31   
ref|XP_011002373.1|  PREDICTED: ATPase 8, plasma membrane-type-like     131   1e-31   
ref|XP_007039741.1|  H(\\+)-transporting atpase plant/fungi plasm...    130   1e-31   
gb|ABR18001.1|  unknown                                                 131   1e-31   
ref|XP_008223752.1|  PREDICTED: plasma membrane ATPase 4                130   1e-31   
sp|Q03194.1|PMA4_NICPL  RecName: Full=Plasma membrane ATPase 4; A...    130   1e-31   
emb|CAB85494.1|  H+-ATPase                                              130   1e-31   
ref|XP_002324397.1|  H+-ATPase family protein                           130   1e-31   
ref|XP_003549363.1|  PREDICTED: plasma membrane ATPase 4-like iso...    130   1e-31   
gb|KHN17608.1|  Plasma membrane ATPase 4                                130   1e-31   
gb|KEH17835.1|  plasma membrane H+-ATPase                               130   1e-31   
emb|CAB85495.1|  H+-ATPase                                              130   2e-31   
emb|CDX67957.1|  BnaA07g19970D                                          130   2e-31   
gb|KJB22048.1|  hypothetical protein B456_004G027300                    130   2e-31   
ref|XP_008242930.1|  PREDICTED: ATPase 8, plasma membrane-type          130   2e-31   
ref|XP_007161308.1|  hypothetical protein PHAVU_001G058900g             130   2e-31   
gb|KDO67286.1|  hypothetical protein CISIN_1g002203mg                   129   2e-31   
dbj|BAD16688.1|  plasma membrane H+-ATPase                              130   2e-31   
ref|XP_009338824.1|  PREDICTED: plasma membrane ATPase 4 isoform X1     130   2e-31   
ref|XP_003546412.1|  PREDICTED: plasma membrane ATPase 4-like iso...    130   2e-31   
gb|KDP35383.1|  hypothetical protein JCGZ_10367                         130   2e-31   
gb|ACE77057.1|  plasma membrane proton pump                             130   2e-31   
emb|CAA59799.1|  H(+)-transporting ATPase                               130   2e-31   
ref|XP_009798265.1|  PREDICTED: plasma membrane ATPase 4                130   2e-31   
ref|XP_009338825.1|  PREDICTED: plasma membrane ATPase 4 isoform X2     130   2e-31   
ref|NP_178762.1|  H(+)-ATPase 6                                         130   2e-31   
dbj|BAA08134.1|  putative plasma membrane H+-ATPase                     130   2e-31   
ref|XP_011078614.1|  PREDICTED: ATPase 8, plasma membrane-type-li...    130   2e-31   
ref|XP_004136313.1|  PREDICTED: plasma membrane ATPase 4-like           130   2e-31   
gb|KHN22686.1|  Plasma membrane ATPase 4                                130   2e-31   
ref|XP_004168485.1|  PREDICTED: plasma membrane ATPase 4-like           130   2e-31   
ref|XP_010539421.1|  PREDICTED: ATPase 2, plasma membrane-type is...    130   2e-31   
gb|AAB35314.2|  plasma membrane H(+)-ATPase precursor                   130   2e-31   
ref|XP_011015389.1|  PREDICTED: plasma membrane ATPase-like             130   2e-31   
ref|XP_011078615.1|  PREDICTED: ATPase 8, plasma membrane-type-li...    130   2e-31   
emb|CDP02997.1|  unnamed protein product                                130   2e-31   
ref|XP_008677590.1|  PREDICTED: uncharacterized protein LOC100383...    130   2e-31   
gb|KGN60742.1|  hypothetical protein Csa_2G009310                       130   2e-31   
gb|KFK29576.1|  h(+)-atpase 2                                           130   2e-31   
ref|XP_009390572.1|  PREDICTED: ATPase 9, plasma membrane-type          130   2e-31   
gb|KJB65971.1|  hypothetical protein B456_010G123000                    130   2e-31   
ref|XP_006279406.1|  hypothetical protein CARUB_v10007959mg             130   2e-31   
ref|XP_010047150.1|  PREDICTED: ATPase 8, plasma membrane-type-like     130   2e-31   
emb|CDY34767.1|  BnaA09g41340D                                          130   2e-31   
ref|XP_004148326.1|  PREDICTED: plasma membrane ATPase 4-like           130   2e-31   
ref|NP_001169274.1|  uncharacterized protein LOC100383137               130   2e-31   
ref|XP_004296457.1|  PREDICTED: plasma membrane ATPase 4                130   2e-31   



>gb|AAA34099.1| plasma membrane H+ ATPase, partial [Nicotiana plumbaginifolia]
Length=388

 Score =   176 bits (445),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 135/142 (95%), Positives = 139/142 (98%), Gaps = 0/142 (0%)
 Frame = +2

Query  86   MAEKPEVLDAVLKETVDLENIPIEEVFENLRCTKDGLTSQAAQERLDIFGHNkleekkes  265
            M EKPEVLDAVLKETVDLENIPIEEVFENLRCTK+GLT+ AAQERL IFG+NKLEEKKES
Sbjct  1    MGEKPEVLDAVLKETVDLENIPIEEVFENLRCTKEGLTATAAQERLSIFGYNKLEEKKES  60

Query  266  kflkflgfMWNPLSWVMEaaaimaialaNGGGKPPDWQDFVGIITLLVINSTISFIEEnn  445
            KFLKFLGFMWNPLSWVMEAAAIMAIALANGGGKPPDWQDFVGIITLL+INSTISFIEENN
Sbjct  61   KFLKFLGFMWNPLSWVMEAAAIMAIALANGGGKPPDWQDFVGIITLLIINSTISFIEENN  120

Query  446  agnaaaalmarlapkaKVLRDG  511
            AGNAAAALMARLAPKAKVLRDG
Sbjct  121  AGNAAAALMARLAPKAKVLRDG  142



>ref|XP_008239652.1| PREDICTED: ATPase 11, plasma membrane-type [Prunus mume]
Length=956

 Score =   178 bits (451),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 135/142 (95%), Positives = 141/142 (99%), Gaps = 0/142 (0%)
 Frame = +2

Query  86   MAEKPEVLDAVLKETVDLENIPIEEVFENLRCTKDGLTSQAAQERLDIFGHNkleekkes  265
            MAEKPEVLDAVLKETVDLENIPIEEVFENLRC+K+GL+S+AA+ERL IFGHNKLEEK+ES
Sbjct  1    MAEKPEVLDAVLKETVDLENIPIEEVFENLRCSKEGLSSEAAEERLTIFGHNKLEEKQES  60

Query  266  kflkflgfMWNPLSWVMEaaaimaialaNGGGKPPDWQDFVGIITLLVINSTISFIEEnn  445
            KFLKFLGFMWNPLSWVMEAAAIMAIALANGGGKPPDWQDFVGIITLLVINSTISFIEENN
Sbjct  61   KFLKFLGFMWNPLSWVMEAAAIMAIALANGGGKPPDWQDFVGIITLLVINSTISFIEENN  120

Query  446  agnaaaalmarlapkaKVLRDG  511
            AGNAAAALMARLAPKAKVLRDG
Sbjct  121  AGNAAAALMARLAPKAKVLRDG  142



>ref|XP_011087207.1| PREDICTED: plasma membrane ATPase 3 [Sesamum indicum]
Length=956

 Score =   177 bits (450),  Expect = 4e-48, Method: Compositional matrix adjust.
 Identities = 136/142 (96%), Positives = 139/142 (98%), Gaps = 0/142 (0%)
 Frame = +2

Query  86   MAEKPEVLDAVLKETVDLENIPIEEVFENLRCTKDGLTSQAAQERLDIFGHNkleekkes  265
            M EKPEVLDAVLKETVDLENIPIEEVFENLRCT++GLT+ AAQERL IFGHNKLEEKKES
Sbjct  1    MGEKPEVLDAVLKETVDLENIPIEEVFENLRCTREGLTTAAAQERLAIFGHNKLEEKKES  60

Query  266  kflkflgfMWNPLSWVMEaaaimaialaNGGGKPPDWQDFVGIITLLVINSTISFIEEnn  445
            KFLKFLGFMWNPLSWVMEAAAIMAIALANGGGKPPDWQDFVGIITLLVINSTISFIEENN
Sbjct  61   KFLKFLGFMWNPLSWVMEAAAIMAIALANGGGKPPDWQDFVGIITLLVINSTISFIEENN  120

Query  446  agnaaaalmarlapkaKVLRDG  511
            AGNAAAALMARLAPKAKVLRDG
Sbjct  121  AGNAAAALMARLAPKAKVLRDG  142



>ref|XP_007210395.1| hypothetical protein PRUPE_ppa000934mg [Prunus persica]
 emb|CAB69824.1| plasma membrane H+ ATPase [Prunus persica]
 gb|EMJ11594.1| hypothetical protein PRUPE_ppa000934mg [Prunus persica]
Length=956

 Score =   177 bits (450),  Expect = 4e-48, Method: Compositional matrix adjust.
 Identities = 135/142 (95%), Positives = 141/142 (99%), Gaps = 0/142 (0%)
 Frame = +2

Query  86   MAEKPEVLDAVLKETVDLENIPIEEVFENLRCTKDGLTSQAAQERLDIFGHNkleekkes  265
            MAEKPEVLDAVLKETVDLENIPIEEVFENLRC+K+GL+S+AA+ERL IFGHNKLEEK+ES
Sbjct  1    MAEKPEVLDAVLKETVDLENIPIEEVFENLRCSKEGLSSEAAEERLTIFGHNKLEEKQES  60

Query  266  kflkflgfMWNPLSWVMEaaaimaialaNGGGKPPDWQDFVGIITLLVINSTISFIEEnn  445
            KFLKFLGFMWNPLSWVMEAAAIMAIALANGGGKPPDWQDFVGIITLLVINSTISFIEENN
Sbjct  61   KFLKFLGFMWNPLSWVMEAAAIMAIALANGGGKPPDWQDFVGIITLLVINSTISFIEENN  120

Query  446  agnaaaalmarlapkaKVLRDG  511
            AGNAAAALMARLAPKAKVLRDG
Sbjct  121  AGNAAAALMARLAPKAKVLRDG  142



>ref|NP_001234775.1| plasma membrane ATPase 1 [Solanum lycopersicum]
 sp|P22180.1|PMA1_SOLLC RecName: Full=Plasma membrane ATPase 1; AltName: Full=Proton 
pump 1 [Solanum lycopersicum]
 gb|AAA34173.1| H+-ATPase [Solanum lycopersicum]
 prf||1803518A H ATPase
Length=956

 Score =   176 bits (447),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 135/142 (95%), Positives = 140/142 (99%), Gaps = 0/142 (0%)
 Frame = +2

Query  86   MAEKPEVLDAVLKETVDLENIPIEEVFENLRCTKDGLTSQAAQERLDIFGHNkleekkes  265
            MAEKPEVLDAVLKETVDLENIPIEEVFENLRCT++GLT+ AAQERL IFG+NKLEEKKES
Sbjct  1    MAEKPEVLDAVLKETVDLENIPIEEVFENLRCTREGLTATAAQERLSIFGYNKLEEKKES  60

Query  266  kflkflgfMWNPLSWVMEaaaimaialaNGGGKPPDWQDFVGIITLLVINSTISFIEEnn  445
            KFLKFLGFMWNPLSWVMEAAAIMAIALANGGGKPPDWQDFVGIITLL+INSTISFIEENN
Sbjct  61   KFLKFLGFMWNPLSWVMEAAAIMAIALANGGGKPPDWQDFVGIITLLIINSTISFIEENN  120

Query  446  agnaaaalmarlapkaKVLRDG  511
            AGNAAAALMARLAPKAKVLRDG
Sbjct  121  AGNAAAALMARLAPKAKVLRDG  142



>ref|XP_006367061.1| PREDICTED: plasma membrane ATPase 1-like [Solanum tuberosum]
Length=956

 Score =   176 bits (447),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 135/142 (95%), Positives = 140/142 (99%), Gaps = 0/142 (0%)
 Frame = +2

Query  86   MAEKPEVLDAVLKETVDLENIPIEEVFENLRCTKDGLTSQAAQERLDIFGHNkleekkes  265
            MAEKPEVLDAVLKETVDLENIPIEEVFENLRCT++GLT+ AAQERL IFG+NKLEEKKES
Sbjct  1    MAEKPEVLDAVLKETVDLENIPIEEVFENLRCTREGLTTTAAQERLSIFGYNKLEEKKES  60

Query  266  kflkflgfMWNPLSWVMEaaaimaialaNGGGKPPDWQDFVGIITLLVINSTISFIEEnn  445
            KFLKFLGFMWNPLSWVMEAAAIMAIALANGGGKPPDWQDFVGIITLL+INSTISFIEENN
Sbjct  61   KFLKFLGFMWNPLSWVMEAAAIMAIALANGGGKPPDWQDFVGIITLLIINSTISFIEENN  120

Query  446  agnaaaalmarlapkaKVLRDG  511
            AGNAAAALMARLAPKAKVLRDG
Sbjct  121  AGNAAAALMARLAPKAKVLRDG  142



>ref|XP_011071717.1| PREDICTED: LOW QUALITY PROTEIN: plasma membrane ATPase 3 [Sesamum 
indicum]
Length=952

 Score =   176 bits (447),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 135/142 (95%), Positives = 140/142 (99%), Gaps = 0/142 (0%)
 Frame = +2

Query  86   MAEKPEVLDAVLKETVDLENIPIEEVFENLRCTKDGLTSQAAQERLDIFGHNkleekkes  265
            M E+PEVLDAVLKETVDLENIPIEEVFENLRCT++GLT++AAQERL IFGHNKLEEKKES
Sbjct  1    MGEEPEVLDAVLKETVDLENIPIEEVFENLRCTREGLTTEAAQERLAIFGHNKLEEKKES  60

Query  266  kflkflgfMWNPLSWVMEaaaimaialaNGGGKPPDWQDFVGIITLLVINSTISFIEEnn  445
            KFLKFLGFMWNPLSWVMEAAAIMAIALANGGGKPPDWQDFVGIITLLVINSTISFIEENN
Sbjct  61   KFLKFLGFMWNPLSWVMEAAAIMAIALANGGGKPPDWQDFVGIITLLVINSTISFIEENN  120

Query  446  agnaaaalmarlapkaKVLRDG  511
            AGNAAAALMARLAPKAKVLRDG
Sbjct  121  AGNAAAALMARLAPKAKVLRDG  142



>sp|Q08436.1|PMA3_NICPL RecName: Full=Plasma membrane ATPase 3; AltName: Full=Proton 
pump 3 [Nicotiana plumbaginifolia]
 gb|AAA34098.1| plasma membrane H+ ATPase [Nicotiana plumbaginifolia]
Length=956

 Score =   176 bits (447),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 134/142 (94%), Positives = 138/142 (97%), Gaps = 0/142 (0%)
 Frame = +2

Query  86   MAEKPEVLDAVLKETVDLENIPIEEVFENLRCTKDGLTSQAAQERLDIFGHNkleekkes  265
            M EKPEVLDAVLKETVDLENIPIEEVFENLRCTK+GLT+ AAQERL IFG+NKLEEKKES
Sbjct  1    MGEKPEVLDAVLKETVDLENIPIEEVFENLRCTKEGLTATAAQERLSIFGYNKLEEKKES  60

Query  266  kflkflgfMWNPLSWVMEaaaimaialaNGGGKPPDWQDFVGIITLLVINSTISFIEEnn  445
            KF KFLGFMWNPLSWVMEAAAIMAIALANGGGKPPDWQDFVGIITLL+INSTISFIEENN
Sbjct  61   KFSKFLGFMWNPLSWVMEAAAIMAIALANGGGKPPDWQDFVGIITLLIINSTISFIEENN  120

Query  446  agnaaaalmarlapkaKVLRDG  511
            AGNAAAALMARLAPKAKVLRDG
Sbjct  121  AGNAAAALMARLAPKAKVLRDG  142



>ref|XP_008374513.1| PREDICTED: ATPase 11, plasma membrane-type [Malus domestica]
Length=956

 Score =   176 bits (447),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 134/142 (94%), Positives = 140/142 (99%), Gaps = 0/142 (0%)
 Frame = +2

Query  86   MAEKPEVLDAVLKETVDLENIPIEEVFENLRCTKDGLTSQAAQERLDIFGHNkleekkes  265
            M EKPEVLDAVLKETVDLENIPIEEVFENLRC+K+GL+S+AA+ERL IFGHNKLEEK+ES
Sbjct  1    MGEKPEVLDAVLKETVDLENIPIEEVFENLRCSKEGLSSEAAEERLTIFGHNKLEEKQES  60

Query  266  kflkflgfMWNPLSWVMEaaaimaialaNGGGKPPDWQDFVGIITLLVINSTISFIEEnn  445
            KFLKFLGFMWNPLSWVMEAAAIMAIALANGGGKPPDWQDFVGIITLLVINSTISFIEENN
Sbjct  61   KFLKFLGFMWNPLSWVMEAAAIMAIALANGGGKPPDWQDFVGIITLLVINSTISFIEENN  120

Query  446  agnaaaalmarlapkaKVLRDG  511
            AGNAAAALMARLAPKAKVLRDG
Sbjct  121  AGNAAAALMARLAPKAKVLRDG  142



>ref|XP_009369365.1| PREDICTED: ATPase 11, plasma membrane-type [Pyrus x bretschneideri]
Length=956

 Score =   176 bits (447),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 134/142 (94%), Positives = 140/142 (99%), Gaps = 0/142 (0%)
 Frame = +2

Query  86   MAEKPEVLDAVLKETVDLENIPIEEVFENLRCTKDGLTSQAAQERLDIFGHNkleekkes  265
            M EKPEVLDAVLKETVDLENIPIEEVFENLRC+K+GL+S+AA+ERL IFGHNKLEEK+ES
Sbjct  1    MGEKPEVLDAVLKETVDLENIPIEEVFENLRCSKEGLSSEAAEERLTIFGHNKLEEKQES  60

Query  266  kflkflgfMWNPLSWVMEaaaimaialaNGGGKPPDWQDFVGIITLLVINSTISFIEEnn  445
            KFLKFLGFMWNPLSWVMEAAAIMAIALANGGGKPPDWQDFVGIITLLVINSTISFIEENN
Sbjct  61   KFLKFLGFMWNPLSWVMEAAAIMAIALANGGGKPPDWQDFVGIITLLVINSTISFIEENN  120

Query  446  agnaaaalmarlapkaKVLRDG  511
            AGNAAAALMARLAPKAKVLRDG
Sbjct  121  AGNAAAALMARLAPKAKVLRDG  142



>ref|XP_009626987.1| PREDICTED: plasma membrane ATPase 3 [Nicotiana tomentosiformis]
Length=956

 Score =   176 bits (446),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 135/142 (95%), Positives = 139/142 (98%), Gaps = 0/142 (0%)
 Frame = +2

Query  86   MAEKPEVLDAVLKETVDLENIPIEEVFENLRCTKDGLTSQAAQERLDIFGHNkleekkes  265
            M EKPEVLDAVLKETVDLENIPIEEVFENLRCTK+GLT+ AAQERL IFG+NKLEEKKES
Sbjct  1    MGEKPEVLDAVLKETVDLENIPIEEVFENLRCTKEGLTATAAQERLSIFGYNKLEEKKES  60

Query  266  kflkflgfMWNPLSWVMEaaaimaialaNGGGKPPDWQDFVGIITLLVINSTISFIEEnn  445
            KFLKFLGFMWNPLSWVMEAAAIMAIALANGGGKPPDWQDFVGIITLL+INSTISFIEENN
Sbjct  61   KFLKFLGFMWNPLSWVMEAAAIMAIALANGGGKPPDWQDFVGIITLLIINSTISFIEENN  120

Query  446  agnaaaalmarlapkaKVLRDG  511
            AGNAAAALMARLAPKAKVLRDG
Sbjct  121  AGNAAAALMARLAPKAKVLRDG  142



>gb|KCW49373.1| hypothetical protein EUGRSUZ_K02916 [Eucalyptus grandis]
Length=925

 Score =   176 bits (445),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 135/142 (95%), Positives = 140/142 (99%), Gaps = 0/142 (0%)
 Frame = +2

Query  86   MAEKPEVLDAVLKETVDLENIPIEEVFENLRCTKDGLTSQAAQERLDIFGHNkleekkes  265
            MAE+PEVL+AVLKETVDLENIPIEEVFENLRC+K+GLT+QAA ERL IFGHNKLEEKKES
Sbjct  1    MAEQPEVLEAVLKETVDLENIPIEEVFENLRCSKEGLTTQAAAERLAIFGHNKLEEKKES  60

Query  266  kflkflgfMWNPLSWVMEaaaimaialaNGGGKPPDWQDFVGIITLLVINSTISFIEEnn  445
            KFLKFLGFMWNPLSWVMEAAAIMAIALANGGGKPPDWQDFVGIITLLVINSTISFIEENN
Sbjct  61   KFLKFLGFMWNPLSWVMEAAAIMAIALANGGGKPPDWQDFVGIITLLVINSTISFIEENN  120

Query  446  agnaaaalmarlapkaKVLRDG  511
            AGNAAAALMARLAPKAKVLRDG
Sbjct  121  AGNAAAALMARLAPKAKVLRDG  142



>gb|KCW49372.1| hypothetical protein EUGRSUZ_K02916 [Eucalyptus grandis]
Length=920

 Score =   176 bits (445),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 135/142 (95%), Positives = 140/142 (99%), Gaps = 0/142 (0%)
 Frame = +2

Query  86   MAEKPEVLDAVLKETVDLENIPIEEVFENLRCTKDGLTSQAAQERLDIFGHNkleekkes  265
            MAE+PEVL+AVLKETVDLENIPIEEVFENLRC+K+GLT+QAA ERL IFGHNKLEEKKES
Sbjct  1    MAEQPEVLEAVLKETVDLENIPIEEVFENLRCSKEGLTTQAAAERLAIFGHNKLEEKKES  60

Query  266  kflkflgfMWNPLSWVMEaaaimaialaNGGGKPPDWQDFVGIITLLVINSTISFIEEnn  445
            KFLKFLGFMWNPLSWVMEAAAIMAIALANGGGKPPDWQDFVGIITLLVINSTISFIEENN
Sbjct  61   KFLKFLGFMWNPLSWVMEAAAIMAIALANGGGKPPDWQDFVGIITLLVINSTISFIEENN  120

Query  446  agnaaaalmarlapkaKVLRDG  511
            AGNAAAALMARLAPKAKVLRDG
Sbjct  121  AGNAAAALMARLAPKAKVLRDG  142



>ref|XP_010037634.1| PREDICTED: ATPase 11, plasma membrane-type [Eucalyptus grandis]
 gb|KCW49371.1| hypothetical protein EUGRSUZ_K02916 [Eucalyptus grandis]
Length=956

 Score =   176 bits (446),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 135/142 (95%), Positives = 140/142 (99%), Gaps = 0/142 (0%)
 Frame = +2

Query  86   MAEKPEVLDAVLKETVDLENIPIEEVFENLRCTKDGLTSQAAQERLDIFGHNkleekkes  265
            MAE+PEVL+AVLKETVDLENIPIEEVFENLRC+K+GLT+QAA ERL IFGHNKLEEKKES
Sbjct  1    MAEQPEVLEAVLKETVDLENIPIEEVFENLRCSKEGLTTQAAAERLAIFGHNKLEEKKES  60

Query  266  kflkflgfMWNPLSWVMEaaaimaialaNGGGKPPDWQDFVGIITLLVINSTISFIEEnn  445
            KFLKFLGFMWNPLSWVMEAAAIMAIALANGGGKPPDWQDFVGIITLLVINSTISFIEENN
Sbjct  61   KFLKFLGFMWNPLSWVMEAAAIMAIALANGGGKPPDWQDFVGIITLLVINSTISFIEENN  120

Query  446  agnaaaalmarlapkaKVLRDG  511
            AGNAAAALMARLAPKAKVLRDG
Sbjct  121  AGNAAAALMARLAPKAKVLRDG  142



>ref|XP_009799220.1| PREDICTED: plasma membrane ATPase 3 [Nicotiana sylvestris]
Length=956

 Score =   175 bits (444),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 134/142 (94%), Positives = 139/142 (98%), Gaps = 0/142 (0%)
 Frame = +2

Query  86   MAEKPEVLDAVLKETVDLENIPIEEVFENLRCTKDGLTSQAAQERLDIFGHNkleekkes  265
            M EKPEVLDAVLKETVDLENIP+EEVFENLRCTK+GLT+ AAQERL IFG+NKLEEKKES
Sbjct  1    MGEKPEVLDAVLKETVDLENIPVEEVFENLRCTKEGLTAAAAQERLSIFGYNKLEEKKES  60

Query  266  kflkflgfMWNPLSWVMEaaaimaialaNGGGKPPDWQDFVGIITLLVINSTISFIEEnn  445
            KFLKFLGFMWNPLSWVMEAAAIMAIALANGGGKPPDWQDFVGIITLL+INSTISFIEENN
Sbjct  61   KFLKFLGFMWNPLSWVMEAAAIMAIALANGGGKPPDWQDFVGIITLLIINSTISFIEENN  120

Query  446  agnaaaalmarlapkaKVLRDG  511
            AGNAAAALMARLAPKAKVLRDG
Sbjct  121  AGNAAAALMARLAPKAKVLRDG  142



>ref|NP_001274861.1| plasma membrane ATPase 1-like [Solanum tuberosum]
 emb|CAA54046.1| H(+)-transporting ATPase [Solanum tuberosum]
Length=956

 Score =   175 bits (443),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 136/142 (96%), Positives = 138/142 (97%), Gaps = 0/142 (0%)
 Frame = +2

Query  86   MAEKPEVLDAVLKETVDLENIPIEEVFENLRCTKDGLTSQAAQERLDIFGHNkleekkes  265
            M EKPEVLDAVLKETVDLENIPIEEVFENLRCTK+GLT  AAQERL IFG+NKLEEKKES
Sbjct  1    MGEKPEVLDAVLKETVDLENIPIEEVFENLRCTKEGLTGTAAQERLAIFGYNKLEEKKES  60

Query  266  kflkflgfMWNPLSWVMEaaaimaialaNGGGKPPDWQDFVGIITLLVINSTISFIEEnn  445
            KFLKFLGFMWNPLSWVMEAAAIMAIALANGGGKPPDWQDFVGIITLLVINSTISFIEENN
Sbjct  61   KFLKFLGFMWNPLSWVMEAAAIMAIALANGGGKPPDWQDFVGIITLLVINSTISFIEENN  120

Query  446  agnaaaalmarlapkaKVLRDG  511
            AGNAAAALMARLAPKAKVLRDG
Sbjct  121  AGNAAAALMARLAPKAKVLRDG  142



>ref|XP_006354801.1| PREDICTED: plasma membrane ATPase 1-like [Solanum tuberosum]
Length=956

 Score =   175 bits (443),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 136/142 (96%), Positives = 138/142 (97%), Gaps = 0/142 (0%)
 Frame = +2

Query  86   MAEKPEVLDAVLKETVDLENIPIEEVFENLRCTKDGLTSQAAQERLDIFGHNkleekkes  265
            M EKPEVLDAVLKETVDLENIPIEEVFENLRCTK+GLT  AAQERL IFG+NKLEEKKES
Sbjct  1    MGEKPEVLDAVLKETVDLENIPIEEVFENLRCTKEGLTGTAAQERLAIFGYNKLEEKKES  60

Query  266  kflkflgfMWNPLSWVMEaaaimaialaNGGGKPPDWQDFVGIITLLVINSTISFIEEnn  445
            KFLKFLGFMWNPLSWVMEAAAIMAIALANGGGKPPDWQDFVGIITLLVINSTISFIEENN
Sbjct  61   KFLKFLGFMWNPLSWVMEAAAIMAIALANGGGKPPDWQDFVGIITLLVINSTISFIEENN  120

Query  446  agnaaaalmarlapkaKVLRDG  511
            AGNAAAALMARLAPKAKVLRDG
Sbjct  121  AGNAAAALMARLAPKAKVLRDG  142



>ref|NP_001234477.1| plasma membrane H+-ATPase [Solanum lycopersicum]
 gb|AAD55399.1|AF179442_1 plasma membrane H+-ATPase isoform LHA2 [Solanum lycopersicum]
 gb|AAF98344.1|AF275745_1 plasma membrane H+-ATPase [Solanum lycopersicum]
Length=956

 Score =   175 bits (443),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 136/142 (96%), Positives = 138/142 (97%), Gaps = 0/142 (0%)
 Frame = +2

Query  86   MAEKPEVLDAVLKETVDLENIPIEEVFENLRCTKDGLTSQAAQERLDIFGHNkleekkes  265
            M EKPEVLDAVLKETVDLENIPIEEVFENLRCTK+GLT  AAQERL IFG+NKLEEKKES
Sbjct  1    MGEKPEVLDAVLKETVDLENIPIEEVFENLRCTKEGLTGTAAQERLAIFGYNKLEEKKES  60

Query  266  kflkflgfMWNPLSWVMEaaaimaialaNGGGKPPDWQDFVGIITLLVINSTISFIEEnn  445
            KFLKFLGFMWNPLSWVMEAAAIMAIALANGGGKPPDWQDFVGIITLLVINSTISFIEENN
Sbjct  61   KFLKFLGFMWNPLSWVMEAAAIMAIALANGGGKPPDWQDFVGIITLLVINSTISFIEENN  120

Query  446  agnaaaalmarlapkaKVLRDG  511
            AGNAAAALMARLAPKAKVLRDG
Sbjct  121  AGNAAAALMARLAPKAKVLRDG  142



>ref|XP_002322127.1| putative plasma membrane H+ ATPase family protein [Populus trichocarpa]
 gb|EEF06254.1| putative plasma membrane H+ ATPase family protein [Populus trichocarpa]
Length=967

 Score =   175 bits (443),  Expect = 4e-47, Method: Composition-based stats.
 Identities = 132/142 (93%), Positives = 137/142 (96%), Gaps = 0/142 (0%)
 Frame = +2

Query  86   MAEKPEVLDAVLKETVDLENIPIEEVFENLRCTKDGLTSQAAQERLDIFGHNkleekkes  265
            M EK EVL+AVLKETVDLENIPIEEVFENLRC+++GLTSQAA+ERL IFGHNKLEEKKE 
Sbjct  1    MGEKAEVLEAVLKETVDLENIPIEEVFENLRCSREGLTSQAAEERLSIFGHNKLEEKKER  60

Query  266  kflkflgfMWNPLSWVMEaaaimaialaNGGGKPPDWQDFVGIITLLVINSTISFIEEnn  445
            KFLKFLGFMWNPLSWVMEAAAIMAIALANGGGKPPDWQDFVGIITLL INSTISFIEENN
Sbjct  61   KFLKFLGFMWNPLSWVMEAAAIMAIALANGGGKPPDWQDFVGIITLLFINSTISFIEENN  120

Query  446  agnaaaalmarlapkaKVLRDG  511
            AGNAAAALMARLAPKAKVLRDG
Sbjct  121  AGNAAAALMARLAPKAKVLRDG  142



>ref|XP_009343433.1| PREDICTED: ATPase 11, plasma membrane-type-like [Pyrus x bretschneideri]
Length=956

 Score =   175 bits (443),  Expect = 4e-47, Method: Compositional matrix adjust.
 Identities = 133/142 (94%), Positives = 140/142 (99%), Gaps = 0/142 (0%)
 Frame = +2

Query  86   MAEKPEVLDAVLKETVDLENIPIEEVFENLRCTKDGLTSQAAQERLDIFGHNkleekkes  265
            M EKPEVLDAVLKETVDLENIPIEEVFENLRC+K+GL+S+AA+ERL IFGHNKLEEK+ES
Sbjct  1    MGEKPEVLDAVLKETVDLENIPIEEVFENLRCSKEGLSSEAAEERLTIFGHNKLEEKQES  60

Query  266  kflkflgfMWNPLSWVMEaaaimaialaNGGGKPPDWQDFVGIITLLVINSTISFIEEnn  445
            KFLKFLGFMWNPLSWVMEAAAIMAIALANGGGKPPDWQDFVGI+TLLVINSTISFIEENN
Sbjct  61   KFLKFLGFMWNPLSWVMEAAAIMAIALANGGGKPPDWQDFVGIMTLLVINSTISFIEENN  120

Query  446  agnaaaalmarlapkaKVLRDG  511
            AGNAAAALMARLAPKAKVLRDG
Sbjct  121  AGNAAAALMARLAPKAKVLRDG  142



>gb|EYU35893.1| hypothetical protein MIMGU_mgv1a0008591mg, partial [Erythranthe 
guttata]
Length=689

 Score =   172 bits (437),  Expect = 4e-47, Method: Compositional matrix adjust.
 Identities = 132/140 (94%), Positives = 139/140 (99%), Gaps = 0/140 (0%)
 Frame = +2

Query  92   EKPEVLDAVLKETVDLENIPIEEVFENLRCTKDGLTSQAAQERLDIFGHNkleekkeskf  271
            EKPEVLDAVLKETVDLENIPI+EVFENLRCT++GLTS+AA+ERL IFGHNKLEEK+ESKF
Sbjct  4    EKPEVLDAVLKETVDLENIPIDEVFENLRCTREGLTSEAAEERLAIFGHNKLEEKRESKF  63

Query  272  lkflgfMWNPLSWVMEaaaimaialaNGGGKPPDWQDFVGIITLLVINSTISFIEEnnag  451
            LKFLGFMWNPLSWVMEAAAIMAIALANGGGKPPDWQDFVGIITLLVINSTISFIEENNAG
Sbjct  64   LKFLGFMWNPLSWVMEAAAIMAIALANGGGKPPDWQDFVGIITLLVINSTISFIEENNAG  123

Query  452  naaaalmarlapkaKVLRDG  511
            NAAAALMARLAPKAK+LRDG
Sbjct  124  NAAAALMARLAPKAKILRDG  143



>ref|XP_009793289.1| PREDICTED: plasma membrane ATPase 2 [Nicotiana sylvestris]
Length=956

 Score =   174 bits (442),  Expect = 5e-47, Method: Compositional matrix adjust.
 Identities = 136/142 (96%), Positives = 138/142 (97%), Gaps = 0/142 (0%)
 Frame = +2

Query  86   MAEKPEVLDAVLKETVDLENIPIEEVFENLRCTKDGLTSQAAQERLDIFGHNkleekkes  265
            M EKPEVLDAVLKETVDLENIPIEEVFENLRCTK+GLT  AAQERL IFG+NKLEEKKES
Sbjct  1    MGEKPEVLDAVLKETVDLENIPIEEVFENLRCTKEGLTGPAAQERLAIFGYNKLEEKKES  60

Query  266  kflkflgfMWNPLSWVMEaaaimaialaNGGGKPPDWQDFVGIITLLVINSTISFIEEnn  445
            KFLKFLGFMWNPLSWVMEAAAIMAIALANGGGKPPDWQDFVGIITLLVINSTISFIEENN
Sbjct  61   KFLKFLGFMWNPLSWVMEAAAIMAIALANGGGKPPDWQDFVGIITLLVINSTISFIEENN  120

Query  446  agnaaaalmarlapkaKVLRDG  511
            AGNAAAALMARLAPKAKVLRDG
Sbjct  121  AGNAAAALMARLAPKAKVLRDG  142



>ref|XP_004299601.1| PREDICTED: ATPase 11, plasma membrane-type [Fragaria vesca subsp. 
vesca]
Length=957

 Score =   174 bits (441),  Expect = 6e-47, Method: Compositional matrix adjust.
 Identities = 133/140 (95%), Positives = 139/140 (99%), Gaps = 0/140 (0%)
 Frame = +2

Query  92   EKPEVLDAVLKETVDLENIPIEEVFENLRCTKDGLTSQAAQERLDIFGHNkleekkeskf  271
            EKPEVLDAVLKETVDLENIPIEEVFENLRC+K+GLTS+AA+ERL IFGHNKLEEK+ESKF
Sbjct  4    EKPEVLDAVLKETVDLENIPIEEVFENLRCSKEGLTSEAAEERLTIFGHNKLEEKQESKF  63

Query  272  lkflgfMWNPLSWVMEaaaimaialaNGGGKPPDWQDFVGIITLLVINSTISFIEEnnag  451
            +KFLGFMWNPLSWVMEAAAIMAIALANGGGKPPDWQDFVGIITLLVINSTISFIEENNAG
Sbjct  64   IKFLGFMWNPLSWVMEAAAIMAIALANGGGKPPDWQDFVGIITLLVINSTISFIEENNAG  123

Query  452  naaaalmarlapkaKVLRDG  511
            NAAAALMARLAPKAKVLRDG
Sbjct  124  NAAAALMARLAPKAKVLRDG  143



>gb|AAA34052.1| H+-translocating ATPase [Nicotiana plumbaginifolia]
Length=956

 Score =   173 bits (439),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 135/142 (95%), Positives = 138/142 (97%), Gaps = 0/142 (0%)
 Frame = +2

Query  86   MAEKPEVLDAVLKETVDLENIPIEEVFENLRCTKDGLTSQAAQERLDIFGHNkleekkes  265
            M EKPEVLDAVLKETVDLENIPIEEVFENLRCTK+GL+  AAQERL IFG+NKLEEKKES
Sbjct  1    MGEKPEVLDAVLKETVDLENIPIEEVFENLRCTKEGLSGPAAQERLAIFGYNKLEEKKES  60

Query  266  kflkflgfMWNPLSWVMEaaaimaialaNGGGKPPDWQDFVGIITLLVINSTISFIEEnn  445
            KFLKFLGFMWNPLSWVMEAAAIMAIALANGGGKPPDWQDFVGIITLLVINSTISFIEENN
Sbjct  61   KFLKFLGFMWNPLSWVMEAAAIMAIALANGGGKPPDWQDFVGIITLLVINSTISFIEENN  120

Query  446  agnaaaalmarlapkaKVLRDG  511
            AGNAAAALMARLAPKAKVLRDG
Sbjct  121  AGNAAAALMARLAPKAKVLRDG  142



>ref|XP_009610426.1| PREDICTED: plasma membrane ATPase 2 [Nicotiana tomentosiformis]
Length=956

 Score =   173 bits (439),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 135/142 (95%), Positives = 138/142 (97%), Gaps = 0/142 (0%)
 Frame = +2

Query  86   MAEKPEVLDAVLKETVDLENIPIEEVFENLRCTKDGLTSQAAQERLDIFGHNkleekkes  265
            M EKPEVLDAVLKETVDLENIPIEEVFENLRCTK+GL+  AAQERL IFG+NKLEEKKES
Sbjct  1    MGEKPEVLDAVLKETVDLENIPIEEVFENLRCTKEGLSGPAAQERLAIFGYNKLEEKKES  60

Query  266  kflkflgfMWNPLSWVMEaaaimaialaNGGGKPPDWQDFVGIITLLVINSTISFIEEnn  445
            KFLKFLGFMWNPLSWVMEAAAIMAIALANGGGKPPDWQDFVGIITLLVINSTISFIEENN
Sbjct  61   KFLKFLGFMWNPLSWVMEAAAIMAIALANGGGKPPDWQDFVGIITLLVINSTISFIEENN  120

Query  446  agnaaaalmarlapkaKVLRDG  511
            AGNAAAALMARLAPKAKVLRDG
Sbjct  121  AGNAAAALMARLAPKAKVLRDG  142



>ref|XP_002270344.1| PREDICTED: plasma membrane ATPase 1 isoform X1 [Vitis vinifera]
 ref|XP_010663416.1| PREDICTED: plasma membrane ATPase 1 isoform X2 [Vitis vinifera]
 emb|CBI15286.3| unnamed protein product [Vitis vinifera]
Length=956

 Score =   173 bits (438),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 132/142 (93%), Positives = 141/142 (99%), Gaps = 0/142 (0%)
 Frame = +2

Query  86   MAEKPEVLDAVLKETVDLENIPIEEVFENLRCTKDGLTSQAAQERLDIFGHNkleekkes  265
            MA+KPEVL+AVLKETVDLENIPIEEVFENLRC+++GLTS+AAQERL IFG+N+LEEKKES
Sbjct  1    MADKPEVLEAVLKETVDLENIPIEEVFENLRCSREGLTSEAAQERLAIFGYNRLEEKKES  60

Query  266  kflkflgfMWNPLSWVMEaaaimaialaNGGGKPPDWQDFVGIITLLVINSTISFIEEnn  445
            KFLKFLGFMWNPLSWVMEAAAIMAIALANGGGKPPDWQDFVGIITLL+INSTISFIEENN
Sbjct  61   KFLKFLGFMWNPLSWVMEAAAIMAIALANGGGKPPDWQDFVGIITLLLINSTISFIEENN  120

Query  446  agnaaaalmarlapkaKVLRDG  511
            AGNAAAALMARLAPKAKVLRDG
Sbjct  121  AGNAAAALMARLAPKAKVLRDG  142



>emb|CDP14881.1| unnamed protein product [Coffea canephora]
Length=950

 Score =   173 bits (438),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 131/142 (92%), Positives = 139/142 (98%), Gaps = 0/142 (0%)
 Frame = +2

Query  86   MAEKPEVLDAVLKETVDLENIPIEEVFENLRCTKDGLTSQAAQERLDIFGHNkleekkes  265
            MA+KPEVL+AV+KETVDLENIPIEEVFENLRCTK+GLTS+ AQERL IFG+NKLEEKKES
Sbjct  1    MADKPEVLEAVVKETVDLENIPIEEVFENLRCTKEGLTSEGAQERLAIFGYNKLEEKKES  60

Query  266  kflkflgfMWNPLSWVMEaaaimaialaNGGGKPPDWQDFVGIITLLVINSTISFIEEnn  445
            K LK+LGFMWNPLSWVMEAAAIMAIALANGGGKPPDWQDFVGIITLL+INSTISFIEENN
Sbjct  61   KLLKYLGFMWNPLSWVMEAAAIMAIALANGGGKPPDWQDFVGIITLLLINSTISFIEENN  120

Query  446  agnaaaalmarlapkaKVLRDG  511
            AGNAAAALMARLAPKAKVLRDG
Sbjct  121  AGNAAAALMARLAPKAKVLRDG  142



>ref|XP_006838797.1| hypothetical protein AMTR_s00002p00260210 [Amborella trichopoda]
 gb|ERN01366.1| hypothetical protein AMTR_s00002p00260210 [Amborella trichopoda]
Length=956

 Score =   172 bits (437),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 133/142 (94%), Positives = 136/142 (96%), Gaps = 0/142 (0%)
 Frame = +2

Query  86   MAEKPEVLDAVLKETVDLENIPIEEVFENLRCTKDGLTSQAAQERLDIFGHNkleekkes  265
            M EK EVL+AVLKE VDLENIPIEEVFENLRCTK+GLTS AAQERL IFGHNKLEEKKES
Sbjct  1    MGEKAEVLEAVLKEAVDLENIPIEEVFENLRCTKEGLTSDAAQERLGIFGHNKLEEKKES  60

Query  266  kflkflgfMWNPLSWVMEaaaimaialaNGGGKPPDWQDFVGIITLLVINSTISFIEEnn  445
            K LKFLGFMWNPLSWVMEAAAIMAIALANGGGKPPDWQDFVGIITLL+INSTISFIEENN
Sbjct  61   KVLKFLGFMWNPLSWVMEAAAIMAIALANGGGKPPDWQDFVGIITLLIINSTISFIEENN  120

Query  446  agnaaaalmarlapkaKVLRDG  511
            AGNAAAALMARLAPKAKVLRDG
Sbjct  121  AGNAAAALMARLAPKAKVLRDG  142



>ref|XP_011028703.1| PREDICTED: ATPase 11, plasma membrane-type-like [Populus euphratica]
 ref|XP_011028704.1| PREDICTED: ATPase 11, plasma membrane-type-like [Populus euphratica]
Length=956

 Score =   172 bits (437),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 132/142 (93%), Positives = 138/142 (97%), Gaps = 0/142 (0%)
 Frame = +2

Query  86   MAEKPEVLDAVLKETVDLENIPIEEVFENLRCTKDGLTSQAAQERLDIFGHNkleekkes  265
            M EK EVL+AVLKETVDLENIPIEEVFENLRC+++GLTSQAA+ERL IFGHNKLEEKKE 
Sbjct  1    MGEKAEVLEAVLKETVDLENIPIEEVFENLRCSREGLTSQAAEERLAIFGHNKLEEKKER  60

Query  266  kflkflgfMWNPLSWVMEaaaimaialaNGGGKPPDWQDFVGIITLLVINSTISFIEEnn  445
            KFLKFLGFMWNPLSWVMEAAAIMAIALANGGGKPPDWQDFVGIITLL+INSTISFIEENN
Sbjct  61   KFLKFLGFMWNPLSWVMEAAAIMAIALANGGGKPPDWQDFVGIITLLIINSTISFIEENN  120

Query  446  agnaaaalmarlapkaKVLRDG  511
            AGNAAAALMARLAPKAKVLRDG
Sbjct  121  AGNAAAALMARLAPKAKVLRDG  142



>ref|XP_008437674.1| PREDICTED: ATPase 11, plasma membrane-type [Cucumis melo]
Length=956

 Score =   172 bits (436),  Expect = 4e-46, Method: Compositional matrix adjust.
 Identities = 132/142 (93%), Positives = 139/142 (98%), Gaps = 0/142 (0%)
 Frame = +2

Query  86   MAEKPEVLDAVLKETVDLENIPIEEVFENLRCTKDGLTSQAAQERLDIFGHNkleekkes  265
            M EKPEVL+AVLKE VDLENIPI+EVFENLRC+K+GLTS+AA+ERL IFGHNKLEEKKES
Sbjct  1    MGEKPEVLEAVLKEAVDLENIPIDEVFENLRCSKEGLTSEAAEERLKIFGHNKLEEKKES  60

Query  266  kflkflgfMWNPLSWVMEaaaimaialaNGGGKPPDWQDFVGIITLLVINSTISFIEEnn  445
            KFLKFLGFMWNPLSWVMEAAAIMAIALANGGGKPPDWQDFVGIITLL+INSTISFIEENN
Sbjct  61   KFLKFLGFMWNPLSWVMEAAAIMAIALANGGGKPPDWQDFVGIITLLIINSTISFIEENN  120

Query  446  agnaaaalmarlapkaKVLRDG  511
            AGNAAAALMARLAPKAKVLRDG
Sbjct  121  AGNAAAALMARLAPKAKVLRDG  142



>ref|XP_010256122.1| PREDICTED: ATPase 11, plasma membrane-type isoform X1 [Nelumbo 
nucifera]
Length=970

 Score =   171 bits (434),  Expect = 6e-46, Method: Compositional matrix adjust.
 Identities = 131/142 (92%), Positives = 137/142 (96%), Gaps = 0/142 (0%)
 Frame = +2

Query  86   MAEKPEVLDAVLKETVDLENIPIEEVFENLRCTKDGLTSQAAQERLDIFGHNkleekkes  265
            M +K E+L+AVLKE VDLENIPIEEVFENLRC+KDGLT++AAQERL IFGHNKLEEKKES
Sbjct  1    MGDKAEILEAVLKEAVDLENIPIEEVFENLRCSKDGLTTEAAQERLAIFGHNKLEEKKES  60

Query  266  kflkflgfMWNPLSWVMEaaaimaialaNGGGKPPDWQDFVGIITLLVINSTISFIEEnn  445
            K LKFLGFMWNPLSWVMEAAAIMAIALANGGGKPPDWQDFVGIITLLVINSTISFIEENN
Sbjct  61   KVLKFLGFMWNPLSWVMEAAAIMAIALANGGGKPPDWQDFVGIITLLVINSTISFIEENN  120

Query  446  agnaaaalmarlapkaKVLRDG  511
            AGNAAAALMARLAPKAKVLRDG
Sbjct  121  AGNAAAALMARLAPKAKVLRDG  142



>ref|XP_010256132.1| PREDICTED: ATPase 11, plasma membrane-type isoform X2 [Nelumbo 
nucifera]
Length=956

 Score =   171 bits (433),  Expect = 8e-46, Method: Compositional matrix adjust.
 Identities = 131/142 (92%), Positives = 137/142 (96%), Gaps = 0/142 (0%)
 Frame = +2

Query  86   MAEKPEVLDAVLKETVDLENIPIEEVFENLRCTKDGLTSQAAQERLDIFGHNkleekkes  265
            M +K E+L+AVLKE VDLENIPIEEVFENLRC+KDGLT++AAQERL IFGHNKLEEKKES
Sbjct  1    MGDKAEILEAVLKEAVDLENIPIEEVFENLRCSKDGLTTEAAQERLAIFGHNKLEEKKES  60

Query  266  kflkflgfMWNPLSWVMEaaaimaialaNGGGKPPDWQDFVGIITLLVINSTISFIEEnn  445
            K LKFLGFMWNPLSWVMEAAAIMAIALANGGGKPPDWQDFVGIITLLVINSTISFIEENN
Sbjct  61   KVLKFLGFMWNPLSWVMEAAAIMAIALANGGGKPPDWQDFVGIITLLVINSTISFIEENN  120

Query  446  agnaaaalmarlapkaKVLRDG  511
            AGNAAAALMARLAPKAKVLRDG
Sbjct  121  AGNAAAALMARLAPKAKVLRDG  142



>sp|Q08435.1|PMA1_NICPL RecName: Full=Plasma membrane ATPase 1; AltName: Full=Proton 
pump 1 [Nicotiana plumbaginifolia]
 gb|AAA34094.1| plasma membrane H+ ATPase [Nicotiana plumbaginifolia]
Length=957

 Score =   171 bits (433),  Expect = 9e-46, Method: Compositional matrix adjust.
 Identities = 131/140 (94%), Positives = 136/140 (97%), Gaps = 0/140 (0%)
 Frame = +2

Query  92   EKPEVLDAVLKETVDLENIPIEEVFENLRCTKDGLTSQAAQERLDIFGHNkleekkeskf  271
            EKPEVLDAVLKE VDLENIPIEEVFENLRCTK+GLT+ AAQERL IFG+NKLEEKK+SK 
Sbjct  4    EKPEVLDAVLKEAVDLENIPIEEVFENLRCTKEGLTATAAQERLAIFGYNKLEEKKDSKL  63

Query  272  lkflgfMWNPLSWVMEaaaimaialaNGGGKPPDWQDFVGIITLLVINSTISFIEEnnag  451
            LKFLGFMWNPLSWVMEAAAIMAIALANGGGKPPDWQDFVGIITLL+INSTISFIEENNAG
Sbjct  64   LKFLGFMWNPLSWVMEAAAIMAIALANGGGKPPDWQDFVGIITLLIINSTISFIEENNAG  123

Query  452  naaaalmarlapkaKVLRDG  511
            NAAAALMARLAPKAKVLRDG
Sbjct  124  NAAAALMARLAPKAKVLRDG  143



>ref|XP_004152442.1| PREDICTED: ATPase 11, plasma membrane-type-like [Cucumis sativus]
 ref|XP_004157811.1| PREDICTED: ATPase 11, plasma membrane-type-like [Cucumis sativus]
Length=956

 Score =   171 bits (432),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 130/142 (92%), Positives = 137/142 (96%), Gaps = 0/142 (0%)
 Frame = +2

Query  86   MAEKPEVLDAVLKETVDLENIPIEEVFENLRCTKDGLTSQAAQERLDIFGHNkleekkes  265
            M EKPEVL+AVLKE VDLENIPI+EVFENLRC+K+GLTS+ A+ERL IFGHNKLEEKKES
Sbjct  1    MGEKPEVLEAVLKEAVDLENIPIDEVFENLRCSKEGLTSEGAEERLKIFGHNKLEEKKES  60

Query  266  kflkflgfMWNPLSWVMEaaaimaialaNGGGKPPDWQDFVGIITLLVINSTISFIEEnn  445
            K LKFLGFMWNPLSWVMEAAAIMAIALANGGGKPPDWQDFVGIITLL+INSTISFIEENN
Sbjct  61   KVLKFLGFMWNPLSWVMEAAAIMAIALANGGGKPPDWQDFVGIITLLIINSTISFIEENN  120

Query  446  agnaaaalmarlapkaKVLRDG  511
            AGNAAAALMARLAPKAKVLRDG
Sbjct  121  AGNAAAALMARLAPKAKVLRDG  142



>dbj|BAD16689.1| plasma membrane H+-ATPase [Daucus carota]
Length=956

 Score =   171 bits (432),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 131/142 (92%), Positives = 135/142 (95%), Gaps = 0/142 (0%)
 Frame = +2

Query  86   MAEKPEVLDAVLKETVDLENIPIEEVFENLRCTKDGLTSQAAQERLDIFGHNkleekkes  265
            M +KPEVL+AVLKETVDLE+IPIEEVFENLRC+KDGLTS  A ERL IFGHNKLEE KE 
Sbjct  1    MEDKPEVLEAVLKETVDLESIPIEEVFENLRCSKDGLTSSGAAERLTIFGHNKLEEVKER  60

Query  266  kflkflgfMWNPLSWVMEaaaimaialaNGGGKPPDWQDFVGIITLLVINSTISFIEEnn  445
            KFLKFLGFMWNPLSWVMEAAAIMAIALANGGGKPPDWQDFVGIITLLVINSTISFIEENN
Sbjct  61   KFLKFLGFMWNPLSWVMEAAAIMAIALANGGGKPPDWQDFVGIITLLVINSTISFIEENN  120

Query  446  agnaaaalmarlapkaKVLRDG  511
            AGNAAAALMARLAPKAKVLRDG
Sbjct  121  AGNAAAALMARLAPKAKVLRDG  142



>gb|AAQ55291.1| plasma membrane H+-ATPase [Juglans regia]
Length=956

 Score =   170 bits (431),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 132/142 (93%), Positives = 137/142 (96%), Gaps = 0/142 (0%)
 Frame = +2

Query  86   MAEKPEVLDAVLKETVDLENIPIEEVFENLRCTKDGLTSQAAQERLDIFGHNkleekkes  265
            MAEKPEVLDAVLKE VDLENIPIEEVFENLRC+K+GLT+ AA+ERL IFGHNKLEEKK+S
Sbjct  1    MAEKPEVLDAVLKEVVDLENIPIEEVFENLRCSKEGLTTVAAEERLAIFGHNKLEEKKDS  60

Query  266  kflkflgfMWNPLSWVMEaaaimaialaNGGGKPPDWQDFVGIITLLVINSTISFIEEnn  445
            KFLKFLGFMWNPLSWVMEAAAIMAIALANGGGKPPDWQDFVGII LL INSTISFIEENN
Sbjct  61   KFLKFLGFMWNPLSWVMEAAAIMAIALANGGGKPPDWQDFVGIIVLLFINSTISFIEENN  120

Query  446  agnaaaalmarlapkaKVLRDG  511
            AGNAAAALMARLAPKAKVLRDG
Sbjct  121  AGNAAAALMARLAPKAKVLRDG  142



>dbj|BAC77532.1| plasma membrane H+-ATPase [Sesbania rostrata]
Length=956

 Score =   170 bits (431),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 132/142 (93%), Positives = 139/142 (98%), Gaps = 0/142 (0%)
 Frame = +2

Query  86   MAEKPEVLDAVLKETVDLENIPIEEVFENLRCTKDGLTSQAAQERLDIFGHNkleekkes  265
            M EKPEVL+AVLKETVDLENIPIEEVFENLRC+++GLTS+AA+ERL IFGHNKLEEKKES
Sbjct  1    MGEKPEVLEAVLKETVDLENIPIEEVFENLRCSREGLTSEAAEERLAIFGHNKLEEKKES  60

Query  266  kflkflgfMWNPLSWVMEaaaimaialaNGGGKPPDWQDFVGIITLLVINSTISFIEEnn  445
            KFLKFLGFMWNPLSWVMEAAAIMAIALANGGGK PDWQDFVGIITLL+INSTISFIEENN
Sbjct  61   KFLKFLGFMWNPLSWVMEAAAIMAIALANGGGKAPDWQDFVGIITLLLINSTISFIEENN  120

Query  446  agnaaaalmarlapkaKVLRDG  511
            AGNAAAALMARLAPKAKVLRDG
Sbjct  121  AGNAAAALMARLAPKAKVLRDG  142



>gb|KDO76027.1| hypothetical protein CISIN_1g005866mg [Citrus sinensis]
 gb|KDO76028.1| hypothetical protein CISIN_1g005866mg [Citrus sinensis]
Length=672

 Score =   168 bits (425),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 130/142 (92%), Positives = 138/142 (97%), Gaps = 0/142 (0%)
 Frame = +2

Query  86   MAEKPEVLDAVLKETVDLENIPIEEVFENLRCTKDGLTSQAAQERLDIFGHNkleekkes  265
            M +K EVL+AVLKETVDLENIPIEEVFENLRC+++GL+SQAA+ERL IFG+NKLEEKKES
Sbjct  1    MGDKEEVLEAVLKETVDLENIPIEEVFENLRCSREGLSSQAAEERLSIFGYNKLEEKKES  60

Query  266  kflkflgfMWNPLSWVMEaaaimaialaNGGGKPPDWQDFVGIITLLVINSTISFIEEnn  445
            KFLKFLGFMWNPLSWVMEAAAIMAIALANGGGKPPDWQDFVGIITLLVINSTISFIEENN
Sbjct  61   KFLKFLGFMWNPLSWVMEAAAIMAIALANGGGKPPDWQDFVGIITLLVINSTISFIEENN  120

Query  446  agnaaaalmarlapkaKVLRDG  511
            AGNAAAALMARLAPK KVLRDG
Sbjct  121  AGNAAAALMARLAPKGKVLRDG  142



>gb|KDO76029.1| hypothetical protein CISIN_1g005866mg [Citrus sinensis]
Length=673

 Score =   168 bits (425),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 130/142 (92%), Positives = 138/142 (97%), Gaps = 0/142 (0%)
 Frame = +2

Query  86   MAEKPEVLDAVLKETVDLENIPIEEVFENLRCTKDGLTSQAAQERLDIFGHNkleekkes  265
            M +K EVL+AVLKETVDLENIPIEEVFENLRC+++GL+SQAA+ERL IFG+NKLEEKKES
Sbjct  1    MGDKEEVLEAVLKETVDLENIPIEEVFENLRCSREGLSSQAAEERLSIFGYNKLEEKKES  60

Query  266  kflkflgfMWNPLSWVMEaaaimaialaNGGGKPPDWQDFVGIITLLVINSTISFIEEnn  445
            KFLKFLGFMWNPLSWVMEAAAIMAIALANGGGKPPDWQDFVGIITLLVINSTISFIEENN
Sbjct  61   KFLKFLGFMWNPLSWVMEAAAIMAIALANGGGKPPDWQDFVGIITLLVINSTISFIEENN  120

Query  446  agnaaaalmarlapkaKVLRDG  511
            AGNAAAALMARLAPK KVLRDG
Sbjct  121  AGNAAAALMARLAPKGKVLRDG  142



>ref|XP_009607762.1| PREDICTED: plasma membrane ATPase 1 [Nicotiana tomentosiformis]
Length=957

 Score =   169 bits (429),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 133/140 (95%), Positives = 136/140 (97%), Gaps = 0/140 (0%)
 Frame = +2

Query  92   EKPEVLDAVLKETVDLENIPIEEVFENLRCTKDGLTSQAAQERLDIFGHNkleekkeskf  271
            EKPEVLDAVLKE VDLENIPIEEVFENLRCTK+GLT  AAQERL IFG+NKLEEKKESKF
Sbjct  4    EKPEVLDAVLKEAVDLENIPIEEVFENLRCTKEGLTVTAAQERLAIFGYNKLEEKKESKF  63

Query  272  lkflgfMWNPLSWVMEaaaimaialaNGGGKPPDWQDFVGIITLLVINSTISFIEEnnag  451
            LKFLGFMWNPLSWVMEAAAIMAIALANGGGKPPDWQDFVGIITLL+INSTISFIEENNAG
Sbjct  64   LKFLGFMWNPLSWVMEAAAIMAIALANGGGKPPDWQDFVGIITLLIINSTISFIEENNAG  123

Query  452  naaaalmarlapkaKVLRDG  511
            NAAAALMARLAPKAKVLRDG
Sbjct  124  NAAAALMARLAPKAKVLRDG  143



>ref|XP_010550649.1| PREDICTED: ATPase 11, plasma membrane-type [Tarenaya hassleriana]
Length=956

 Score =   169 bits (428),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 131/142 (92%), Positives = 137/142 (96%), Gaps = 0/142 (0%)
 Frame = +2

Query  86   MAEKPEVLDAVLKETVDLENIPIEEVFENLRCTKDGLTSQAAQERLDIFGHNkleekkes  265
            M +K EVL+AVLKE VDLEN+PIEEVFENLRC+KDGLT+QAA ERL +FGHNKLEEKKES
Sbjct  1    MGDKTEVLEAVLKEAVDLENVPIEEVFENLRCSKDGLTTQAADERLALFGHNKLEEKKES  60

Query  266  kflkflgfMWNPLSWVMEaaaimaialaNGGGKPPDWQDFVGIITLLVINSTISFIEEnn  445
            KFLKFLGFMWNPLSWVMEAAAIMAIALANGGGKPPDWQDFVGIITLLVINSTISFIEENN
Sbjct  61   KFLKFLGFMWNPLSWVMEAAAIMAIALANGGGKPPDWQDFVGIITLLVINSTISFIEENN  120

Query  446  agnaaaalmarlapkaKVLRDG  511
            AGNAAAALMARLAPKAKVLRDG
Sbjct  121  AGNAAAALMARLAPKAKVLRDG  142



>ref|XP_002511508.1| H(\+)-transporting atpase plant/fungi plasma membrane type, putative 
[Ricinus communis]
 gb|EEF52110.1| H(\+)-transporting atpase plant/fungi plasma membrane type, putative 
[Ricinus communis]
Length=801

 Score =   168 bits (425),  Expect = 5e-45, Method: Compositional matrix adjust.
 Identities = 130/142 (92%), Positives = 139/142 (98%), Gaps = 0/142 (0%)
 Frame = +2

Query  86   MAEKPEVLDAVLKETVDLENIPIEEVFENLRCTKDGLTSQAAQERLDIFGHNkleekkes  265
            M EK EVL+AVLKETVDLENIPIEEVFENLRC+++GLT++AA+ERL IFGHNKLEEKKES
Sbjct  1    MGEKGEVLEAVLKETVDLENIPIEEVFENLRCSREGLTTEAAEERLTIFGHNKLEEKKES  60

Query  266  kflkflgfMWNPLSWVMEaaaimaialaNGGGKPPDWQDFVGIITLLVINSTISFIEEnn  445
            KFLKFLGFMWNPLSWVMEAAAIMAIALANGGGKPPDWQDFVGIITLL+INSTISFIEENN
Sbjct  61   KFLKFLGFMWNPLSWVMEAAAIMAIALANGGGKPPDWQDFVGIITLLLINSTISFIEENN  120

Query  446  agnaaaalmarlapkaKVLRDG  511
            AGNAAAALMARLAPKAK+LRDG
Sbjct  121  AGNAAAALMARLAPKAKILRDG  142



>ref|XP_008453171.1| PREDICTED: plasma membrane ATPase 3 [Cucumis melo]
Length=959

 Score =   169 bits (428),  Expect = 5e-45, Method: Composition-based stats.
 Identities = 126/141 (89%), Positives = 135/141 (96%), Gaps = 0/141 (0%)
 Frame = +2

Query  89   AEKPEVLDAVLKETVDLENIPIEEVFENLRCTKDGLTSQAAQERLDIFGHNkleekkesk  268
             EKPEVL+AVLKETVDLENIPIEEVF+NLRC+K+GLT+ AA+ERL IFGHNKLEEKKESK
Sbjct  5    GEKPEVLEAVLKETVDLENIPIEEVFDNLRCSKEGLTTAAAEERLVIFGHNKLEEKKESK  64

Query  269  flkflgfMWNPLSWVMEaaaimaialaNGGGKPPDWQDFVGIITLLVINSTISFIEEnna  448
             LKFLGFMWNPLSWVMEAAAIMAIALANGGGKPPDWQDFVGII LL+INSTISFIEENNA
Sbjct  65   ILKFLGFMWNPLSWVMEAAAIMAIALANGGGKPPDWQDFVGIIALLLINSTISFIEENNA  124

Query  449  gnaaaalmarlapkaKVLRDG  511
            GNAAAALMA LAP+AK+LRDG
Sbjct  125  GNAAAALMASLAPQAKILRDG  145



>ref|XP_007037195.1| H(+)-transporting atpase plant/fungi plasma membrane type [Theobroma 
cacao]
 gb|EOY21696.1| H(+)-transporting atpase plant/fungi plasma membrane type [Theobroma 
cacao]
Length=1607

 Score =   170 bits (430),  Expect = 5e-45, Method: Compositional matrix adjust.
 Identities = 129/142 (91%), Positives = 139/142 (98%), Gaps = 0/142 (0%)
 Frame = +2

Query  86   MAEKPEVLDAVLKETVDLENIPIEEVFENLRCTKDGLTSQAAQERLDIFGHNkleekkes  265
            M +K EVLDAVLKETVDLENIPIEEVFENLRC+++GLT++AA+ERL IFGHNKLEEKKES
Sbjct  1    MGDKNEVLDAVLKETVDLENIPIEEVFENLRCSREGLTTEAAEERLVIFGHNKLEEKKES  60

Query  266  kflkflgfMWNPLSWVMEaaaimaialaNGGGKPPDWQDFVGIITLLVINSTISFIEEnn  445
            KFLK+LGFMWNPLSWVME+AAIMAIALANGGGKPPDWQDFVGIITLL+INSTISFIEENN
Sbjct  61   KFLKYLGFMWNPLSWVMESAAIMAIALANGGGKPPDWQDFVGIITLLLINSTISFIEENN  120

Query  446  agnaaaalmarlapkaKVLRDG  511
            AGNAAAALMARLAPKAKVLRDG
Sbjct  121  AGNAAAALMARLAPKAKVLRDG  142



>gb|KJB19307.1| hypothetical protein B456_003G094300 [Gossypium raimondii]
Length=879

 Score =   168 bits (426),  Expect = 5e-45, Method: Compositional matrix adjust.
 Identities = 131/142 (92%), Positives = 139/142 (98%), Gaps = 0/142 (0%)
 Frame = +2

Query  86   MAEKPEVLDAVLKETVDLENIPIEEVFENLRCTKDGLTSQAAQERLDIFGHNkleekkes  265
            M +K EVL+AVLKETVDLENIPIEEVFENLRC+++GLT++AA+ERL IFGHNKLEEKKES
Sbjct  1    MGDKNEVLEAVLKETVDLENIPIEEVFENLRCSREGLTTEAAEERLTIFGHNKLEEKKES  60

Query  266  kflkflgfMWNPLSWVMEaaaimaialaNGGGKPPDWQDFVGIITLLVINSTISFIEEnn  445
            KFLKFLGFMWNPLSWVMEAAAIMAIALANGGGKPPDWQDFVGIITLLVINSTISFIEENN
Sbjct  61   KFLKFLGFMWNPLSWVMEAAAIMAIALANGGGKPPDWQDFVGIITLLVINSTISFIEENN  120

Query  446  agnaaaalmarlapkaKVLRDG  511
            AGNAAAALMARLAPKAKVLRDG
Sbjct  121  AGNAAAALMARLAPKAKVLRDG  142



>gb|KJB19302.1| hypothetical protein B456_003G094300 [Gossypium raimondii]
Length=956

 Score =   169 bits (427),  Expect = 7e-45, Method: Compositional matrix adjust.
 Identities = 131/142 (92%), Positives = 139/142 (98%), Gaps = 0/142 (0%)
 Frame = +2

Query  86   MAEKPEVLDAVLKETVDLENIPIEEVFENLRCTKDGLTSQAAQERLDIFGHNkleekkes  265
            M +K EVL+AVLKETVDLENIPIEEVFENLRC+++GLT++AA+ERL IFGHNKLEEKKES
Sbjct  1    MGDKNEVLEAVLKETVDLENIPIEEVFENLRCSREGLTTEAAEERLTIFGHNKLEEKKES  60

Query  266  kflkflgfMWNPLSWVMEaaaimaialaNGGGKPPDWQDFVGIITLLVINSTISFIEEnn  445
            KFLKFLGFMWNPLSWVMEAAAIMAIALANGGGKPPDWQDFVGIITLLVINSTISFIEENN
Sbjct  61   KFLKFLGFMWNPLSWVMEAAAIMAIALANGGGKPPDWQDFVGIITLLVINSTISFIEENN  120

Query  446  agnaaaalmarlapkaKVLRDG  511
            AGNAAAALMARLAPKAKVLRDG
Sbjct  121  AGNAAAALMARLAPKAKVLRDG  142



>gb|KJB19303.1| hypothetical protein B456_003G094300 [Gossypium raimondii]
 gb|KJB19304.1| hypothetical protein B456_003G094300 [Gossypium raimondii]
Length=925

 Score =   168 bits (426),  Expect = 7e-45, Method: Compositional matrix adjust.
 Identities = 131/142 (92%), Positives = 139/142 (98%), Gaps = 0/142 (0%)
 Frame = +2

Query  86   MAEKPEVLDAVLKETVDLENIPIEEVFENLRCTKDGLTSQAAQERLDIFGHNkleekkes  265
            M +K EVL+AVLKETVDLENIPIEEVFENLRC+++GLT++AA+ERL IFGHNKLEEKKES
Sbjct  1    MGDKNEVLEAVLKETVDLENIPIEEVFENLRCSREGLTTEAAEERLTIFGHNKLEEKKES  60

Query  266  kflkflgfMWNPLSWVMEaaaimaialaNGGGKPPDWQDFVGIITLLVINSTISFIEEnn  445
            KFLKFLGFMWNPLSWVMEAAAIMAIALANGGGKPPDWQDFVGIITLLVINSTISFIEENN
Sbjct  61   KFLKFLGFMWNPLSWVMEAAAIMAIALANGGGKPPDWQDFVGIITLLVINSTISFIEENN  120

Query  446  agnaaaalmarlapkaKVLRDG  511
            AGNAAAALMARLAPKAKVLRDG
Sbjct  121  AGNAAAALMARLAPKAKVLRDG  142



>ref|XP_009798932.1| PREDICTED: plasma membrane ATPase 1 [Nicotiana sylvestris]
Length=957

 Score =   168 bits (426),  Expect = 8e-45, Method: Compositional matrix adjust.
 Identities = 132/140 (94%), Positives = 136/140 (97%), Gaps = 0/140 (0%)
 Frame = +2

Query  92   EKPEVLDAVLKETVDLENIPIEEVFENLRCTKDGLTSQAAQERLDIFGHNkleekkeskf  271
            EKPEVLDAVLKE VDLENIPIEEVFENLRCTK+GLT  AA+ERL IFG+NKLEEKK+SKF
Sbjct  4    EKPEVLDAVLKEAVDLENIPIEEVFENLRCTKEGLTVTAAEERLAIFGYNKLEEKKDSKF  63

Query  272  lkflgfMWNPLSWVMEaaaimaialaNGGGKPPDWQDFVGIITLLVINSTISFIEEnnag  451
            LKFLGFMWNPLSWVMEAAAIMAIALANGGGKPPDWQDFVGIITLLVINSTISFIEENNAG
Sbjct  64   LKFLGFMWNPLSWVMEAAAIMAIALANGGGKPPDWQDFVGIITLLVINSTISFIEENNAG  123

Query  452  naaaalmarlapkaKVLRDG  511
            NAAAALMARLAPKAKVLRDG
Sbjct  124  NAAAALMARLAPKAKVLRDG  143



>gb|KJB19305.1| hypothetical protein B456_003G094300 [Gossypium raimondii]
Length=956

 Score =   168 bits (426),  Expect = 9e-45, Method: Compositional matrix adjust.
 Identities = 131/142 (92%), Positives = 139/142 (98%), Gaps = 0/142 (0%)
 Frame = +2

Query  86   MAEKPEVLDAVLKETVDLENIPIEEVFENLRCTKDGLTSQAAQERLDIFGHNkleekkes  265
            M +K EVL+AVLKETVDLENIPIEEVFENLRC+++GLT++AA+ERL IFGHNKLEEKKES
Sbjct  1    MGDKNEVLEAVLKETVDLENIPIEEVFENLRCSREGLTTEAAEERLTIFGHNKLEEKKES  60

Query  266  kflkflgfMWNPLSWVMEaaaimaialaNGGGKPPDWQDFVGIITLLVINSTISFIEEnn  445
            KFLKFLGFMWNPLSWVMEAAAIMAIALANGGGKPPDWQDFVGIITLLVINSTISFIEENN
Sbjct  61   KFLKFLGFMWNPLSWVMEAAAIMAIALANGGGKPPDWQDFVGIITLLVINSTISFIEENN  120

Query  446  agnaaaalmarlapkaKVLRDG  511
            AGNAAAALMARLAPKAKVLRDG
Sbjct  121  AGNAAAALMARLAPKAKVLRDG  142



>gb|KJB19306.1| hypothetical protein B456_003G094300 [Gossypium raimondii]
Length=987

 Score =   168 bits (426),  Expect = 9e-45, Method: Compositional matrix adjust.
 Identities = 131/142 (92%), Positives = 139/142 (98%), Gaps = 0/142 (0%)
 Frame = +2

Query  86   MAEKPEVLDAVLKETVDLENIPIEEVFENLRCTKDGLTSQAAQERLDIFGHNkleekkes  265
            M +K EVL+AVLKETVDLENIPIEEVFENLRC+++GLT++AA+ERL IFGHNKLEEKKES
Sbjct  1    MGDKNEVLEAVLKETVDLENIPIEEVFENLRCSREGLTTEAAEERLTIFGHNKLEEKKES  60

Query  266  kflkflgfMWNPLSWVMEaaaimaialaNGGGKPPDWQDFVGIITLLVINSTISFIEEnn  445
            KFLKFLGFMWNPLSWVMEAAAIMAIALANGGGKPPDWQDFVGIITLLVINSTISFIEENN
Sbjct  61   KFLKFLGFMWNPLSWVMEAAAIMAIALANGGGKPPDWQDFVGIITLLVINSTISFIEENN  120

Query  446  agnaaaalmarlapkaKVLRDG  511
            AGNAAAALMARLAPKAKVLRDG
Sbjct  121  AGNAAAALMARLAPKAKVLRDG  142



>gb|AFC88896.1| plasma membrane H+-ATPase [Melastoma malabathricum]
Length=956

 Score =   168 bits (425),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 131/142 (92%), Positives = 137/142 (96%), Gaps = 0/142 (0%)
 Frame = +2

Query  86   MAEKPEVLDAVLKETVDLENIPIEEVFENLRCTKDGLTSQAAQERLDIFGHNkleekkes  265
            M EKPEVL+AVLKE VDLENIPIEEVFENLRC+K+GLT+Q+A+ERL IFG NKLEEKKES
Sbjct  1    MGEKPEVLEAVLKEAVDLENIPIEEVFENLRCSKEGLTTQSAEERLAIFGQNKLEEKKES  60

Query  266  kflkflgfMWNPLSWVMEaaaimaialaNGGGKPPDWQDFVGIITLLVINSTISFIEEnn  445
            KFLKFLGFMWNPLSWVMEAAAIMAIALANGGGKPPDWQDFVGIITLL INSTISFIEENN
Sbjct  61   KFLKFLGFMWNPLSWVMEAAAIMAIALANGGGKPPDWQDFVGIITLLFINSTISFIEENN  120

Query  446  agnaaaalmarlapkaKVLRDG  511
            AGNAAAALMARLAPKAKVLRDG
Sbjct  121  AGNAAAALMARLAPKAKVLRDG  142



>ref|XP_010112580.1| ATPase 11, plasma membrane-type [Morus notabilis]
 gb|EXC34215.1| ATPase 11, plasma membrane-type [Morus notabilis]
Length=950

 Score =   168 bits (425),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 130/142 (92%), Positives = 138/142 (97%), Gaps = 0/142 (0%)
 Frame = +2

Query  86   MAEKPEVLDAVLKETVDLENIPIEEVFENLRCTKDGLTSQAAQERLDIFGHNkleekkes  265
            M EKPE L+AVLKETVDLENIPIEEVFENLRC+K+GLT++AA++RL IFG+NKLEEKKES
Sbjct  1    MGEKPEALEAVLKETVDLENIPIEEVFENLRCSKEGLTTEAAEQRLTIFGYNKLEEKKES  60

Query  266  kflkflgfMWNPLSWVMEaaaimaialaNGGGKPPDWQDFVGIITLLVINSTISFIEEnn  445
            KFLKFLGFMWNPLSWVMEAAAIMAIALANGGGKPPDWQDFVGIITLL INSTISFIEENN
Sbjct  61   KFLKFLGFMWNPLSWVMEAAAIMAIALANGGGKPPDWQDFVGIITLLFINSTISFIEENN  120

Query  446  agnaaaalmarlapkaKVLRDG  511
            AGNAAAALMARLAPKAKVLRDG
Sbjct  121  AGNAAAALMARLAPKAKVLRDG  142



>ref|XP_006439665.1| hypothetical protein CICLE_v10018737mg [Citrus clementina]
 gb|ESR52905.1| hypothetical protein CICLE_v10018737mg [Citrus clementina]
Length=954

 Score =   168 bits (425),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 130/142 (92%), Positives = 138/142 (97%), Gaps = 0/142 (0%)
 Frame = +2

Query  86   MAEKPEVLDAVLKETVDLENIPIEEVFENLRCTKDGLTSQAAQERLDIFGHNkleekkes  265
            M +K EVL+AVLKETVDLENIPIEEVFENLRC+++GL+SQAA+ERL IFG+NKLEEKKES
Sbjct  1    MGDKEEVLEAVLKETVDLENIPIEEVFENLRCSREGLSSQAAEERLSIFGYNKLEEKKES  60

Query  266  kflkflgfMWNPLSWVMEaaaimaialaNGGGKPPDWQDFVGIITLLVINSTISFIEEnn  445
            KFLKFLGFMWNPLSWVMEAAAIMAIALANGGGKPPDWQDFVGIITLLVINSTISFIEENN
Sbjct  61   KFLKFLGFMWNPLSWVMEAAAIMAIALANGGGKPPDWQDFVGIITLLVINSTISFIEENN  120

Query  446  agnaaaalmarlapkaKVLRDG  511
            AGNAAAALMARLAPK KVLRDG
Sbjct  121  AGNAAAALMARLAPKGKVLRDG  142



>gb|KGN64262.1| hypothetical protein Csa_1G045600 [Cucumis sativus]
Length=762

 Score =   166 bits (421),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 106/118 (90%), Positives = 113/118 (96%), Gaps = 0/118 (0%)
 Frame = +2

Query  86   MAEKPEVLDAVLKETVDLENIPIEEVFENLRCTKDGLTSQAAQERLDIFGHNkleekkes  265
            M EKPEVL+AVLKE VDLENIPI+EVFENLRC+K+GLTS+ A+ERL IFGHNKLEEKKES
Sbjct  1    MGEKPEVLEAVLKEAVDLENIPIDEVFENLRCSKEGLTSEGAEERLKIFGHNKLEEKKES  60

Query  266  kflkflgfMWNPLSWVMEaaaimaialaNGGGKPPDWQDFVGIITLLVINSTISFIEE  439
            K LKFLGFMWNPLSWVMEAAAIMAIALANGGGKPPDWQDFVGIITLL+INSTISFIEE
Sbjct  61   KVLKFLGFMWNPLSWVMEAAAIMAIALANGGGKPPDWQDFVGIITLLIINSTISFIEE  118



>ref|XP_006476664.1| PREDICTED: ATPase 11, plasma membrane-type-like [Citrus sinensis]
Length=954

 Score =   167 bits (424),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 130/142 (92%), Positives = 138/142 (97%), Gaps = 0/142 (0%)
 Frame = +2

Query  86   MAEKPEVLDAVLKETVDLENIPIEEVFENLRCTKDGLTSQAAQERLDIFGHNkleekkes  265
            M +K EVL+AVLKETVDLENIPIEEVFENLRC+++GL+SQAA+ERL IFG+NKLEEKKES
Sbjct  1    MGDKEEVLEAVLKETVDLENIPIEEVFENLRCSREGLSSQAAEERLSIFGYNKLEEKKES  60

Query  266  kflkflgfMWNPLSWVMEaaaimaialaNGGGKPPDWQDFVGIITLLVINSTISFIEEnn  445
            KFLKFLGFMWNPLSWVMEAAAIMAIALANGGGKPPDWQDFVGIITLLVINSTISFIEENN
Sbjct  61   KFLKFLGFMWNPLSWVMEAAAIMAIALANGGGKPPDWQDFVGIITLLVINSTISFIEENN  120

Query  446  agnaaaalmarlapkaKVLRDG  511
            AGNAAAALMARLAPK KVLRDG
Sbjct  121  AGNAAAALMARLAPKGKVLRDG  142



>ref|XP_010678593.1| PREDICTED: plasma membrane ATPase 1 [Beta vulgaris subsp. vulgaris]
Length=963

 Score =   167 bits (424),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 130/142 (92%), Positives = 135/142 (95%), Gaps = 0/142 (0%)
 Frame = +2

Query  86   MAEKPEVLDAVLKETVDLENIPIEEVFENLRCTKDGLTSQAAQERLDIFGHNkleekkes  265
            MAEK EVL+AVLKE VDLENIP+EEVFENLRC+K+GLTS AAQERL IFG NKLEEKKES
Sbjct  1    MAEKSEVLEAVLKEAVDLENIPLEEVFENLRCSKEGLTSDAAQERLAIFGPNKLEEKKES  60

Query  266  kflkflgfMWNPLSWVMEaaaimaialaNGGGKPPDWQDFVGIITLLVINSTISFIEEnn  445
            K LKFLGFMWNPLSWVMEAAAIMAIALANGGGKPPDWQDFVGIITLLVINSTISFIEENN
Sbjct  61   KVLKFLGFMWNPLSWVMEAAAIMAIALANGGGKPPDWQDFVGIITLLVINSTISFIEENN  120

Query  446  agnaaaalmarlapkaKVLRDG  511
            AGNAAAALMA LAPKAK+LRDG
Sbjct  121  AGNAAAALMASLAPKAKILRDG  142



>gb|KGN63646.1| hypothetical protein Csa_1G008520 [Cucumis sativus]
Length=801

 Score =   166 bits (421),  Expect = 2e-44, Method: Composition-based stats.
 Identities = 105/117 (90%), Positives = 112/117 (96%), Gaps = 0/117 (0%)
 Frame = +2

Query  89   AEKPEVLDAVLKETVDLENIPIEEVFENLRCTKDGLTSQAAQERLDIFGHNkleekkesk  268
             EKPEVL+AVLKETVDLENIPIEEVF+NLRC+K+GLT+ AA+ERL IFGHNKLEEKKESK
Sbjct  5    GEKPEVLEAVLKETVDLENIPIEEVFDNLRCSKEGLTTAAAEERLVIFGHNKLEEKKESK  64

Query  269  flkflgfMWNPLSWVMEaaaimaialaNGGGKPPDWQDFVGIITLLVINSTISFIEE  439
             LKFLGFMWNPLSWVMEAAAIMAIALANGGGKPPDWQDFVGII LL+INSTISFIEE
Sbjct  65   VLKFLGFMWNPLSWVMEAAAIMAIALANGGGKPPDWQDFVGIIALLLINSTISFIEE  121



>ref|XP_002318614.1| putative plasma membrane H+ ATPase family protein [Populus trichocarpa]
 gb|EEE96834.1| putative plasma membrane H+ ATPase family protein [Populus trichocarpa]
Length=966

 Score =   167 bits (423),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 130/142 (92%), Positives = 137/142 (96%), Gaps = 0/142 (0%)
 Frame = +2

Query  86   MAEKPEVLDAVLKETVDLENIPIEEVFENLRCTKDGLTSQAAQERLDIFGHNkleekkes  265
            M +K EVL+AVLKETVDLENIPIEEV ENLRC+++GLT+QAA+ERL IFGHNKLEEKKE 
Sbjct  1    MGDKGEVLEAVLKETVDLENIPIEEVLENLRCSREGLTTQAAEERLAIFGHNKLEEKKER  60

Query  266  kflkflgfMWNPLSWVMEaaaimaialaNGGGKPPDWQDFVGIITLLVINSTISFIEEnn  445
            KFLKFLGFMWNPLSWVMEAAAIMAIALANGGGKPPDWQDFVGIITLLVINSTISFIEENN
Sbjct  61   KFLKFLGFMWNPLSWVMEAAAIMAIALANGGGKPPDWQDFVGIITLLVINSTISFIEENN  120

Query  446  agnaaaalmarlapkaKVLRDG  511
            AGNAAAALMARLAPKAKVLRDG
Sbjct  121  AGNAAAALMARLAPKAKVLRDG  142



>dbj|BAD16686.1| plasma membrane H+-ATPase [Daucus carota]
Length=956

 Score =   167 bits (423),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 132/142 (93%), Positives = 136/142 (96%), Gaps = 0/142 (0%)
 Frame = +2

Query  86   MAEKPEVLDAVLKETVDLENIPIEEVFENLRCTKDGLTSQAAQERLDIFGHNkleekkes  265
            M +K EVL+AVLKETVDLE+IPIEEVFENLRC+KDGLTS  A ERL IFGHNKLEEKKES
Sbjct  1    MEDKSEVLEAVLKETVDLESIPIEEVFENLRCSKDGLTSSGALERLTIFGHNKLEEKKES  60

Query  266  kflkflgfMWNPLSWVMEaaaimaialaNGGGKPPDWQDFVGIITLLVINSTISFIEEnn  445
            KFLKFLGFMWNPLSWVMEAAAIMAIALANGGGKPPDWQDFVGIITLLVINSTISFIEENN
Sbjct  61   KFLKFLGFMWNPLSWVMEAAAIMAIALANGGGKPPDWQDFVGIITLLVINSTISFIEENN  120

Query  446  agnaaaalmarlapkaKVLRDG  511
            AGNAAAALMARLAPKAKVLRDG
Sbjct  121  AGNAAAALMARLAPKAKVLRDG  142



>ref|XP_011042618.1| PREDICTED: ATPase 11, plasma membrane-type [Populus euphratica]
 ref|XP_011042619.1| PREDICTED: ATPase 11, plasma membrane-type [Populus euphratica]
Length=956

 Score =   167 bits (423),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 130/142 (92%), Positives = 137/142 (96%), Gaps = 0/142 (0%)
 Frame = +2

Query  86   MAEKPEVLDAVLKETVDLENIPIEEVFENLRCTKDGLTSQAAQERLDIFGHNkleekkes  265
            M +K EVL+AVLKETVDLENIPIEEV ENLRC+++GLT+QAA+ERL IFGHNKLEEKKE 
Sbjct  1    MGDKGEVLEAVLKETVDLENIPIEEVLENLRCSREGLTTQAAEERLAIFGHNKLEEKKER  60

Query  266  kflkflgfMWNPLSWVMEaaaimaialaNGGGKPPDWQDFVGIITLLVINSTISFIEEnn  445
            KFLKFLGFMWNPLSWVMEAAAIMAIALANGGGKPPDWQDFVGIITLLVINSTISFIEENN
Sbjct  61   KFLKFLGFMWNPLSWVMEAAAIMAIALANGGGKPPDWQDFVGIITLLVINSTISFIEENN  120

Query  446  agnaaaalmarlapkaKVLRDG  511
            AGNAAAALMARLAPKAKVLRDG
Sbjct  121  AGNAAAALMARLAPKAKVLRDG  142



>ref|XP_007138219.1| hypothetical protein PHAVU_009G190500g [Phaseolus vulgaris]
 gb|ESW10213.1| hypothetical protein PHAVU_009G190500g [Phaseolus vulgaris]
Length=956

 Score =   167 bits (423),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 129/142 (91%), Positives = 138/142 (97%), Gaps = 0/142 (0%)
 Frame = +2

Query  86   MAEKPEVLDAVLKETVDLENIPIEEVFENLRCTKDGLTSQAAQERLDIFGHNkleekkes  265
            M +K +VL+AVLKETVDLENIP+EEVFENLRC+K+GL+S+AA+ERL IFGHNKLEEKKE 
Sbjct  1    MGDKSQVLEAVLKETVDLENIPVEEVFENLRCSKEGLSSEAAEERLVIFGHNKLEEKKER  60

Query  266  kflkflgfMWNPLSWVMEaaaimaialaNGGGKPPDWQDFVGIITLLVINSTISFIEEnn  445
            KFLKFLGFMWNPLSWVMEAAAIMAIALANGGGKPPDWQDFVGIITLLVINSTISFIEENN
Sbjct  61   KFLKFLGFMWNPLSWVMEAAAIMAIALANGGGKPPDWQDFVGIITLLVINSTISFIEENN  120

Query  446  agnaaaalmarlapkaKVLRDG  511
            AGNAAAALMARLAPKAKVLRDG
Sbjct  121  AGNAAAALMARLAPKAKVLRDG  142



>gb|KDP31195.1| hypothetical protein JCGZ_11571 [Jatropha curcas]
Length=956

 Score =   167 bits (423),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 129/142 (91%), Positives = 138/142 (97%), Gaps = 0/142 (0%)
 Frame = +2

Query  86   MAEKPEVLDAVLKETVDLENIPIEEVFENLRCTKDGLTSQAAQERLDIFGHNkleekkes  265
            M +K EVL+AVLKE VDLENIPIEEVFENLRC+K+GLT++AA+ERL IFGHNKLEEK+ES
Sbjct  1    MGDKSEVLEAVLKEAVDLENIPIEEVFENLRCSKEGLTTEAAEERLAIFGHNKLEEKQES  60

Query  266  kflkflgfMWNPLSWVMEaaaimaialaNGGGKPPDWQDFVGIITLLVINSTISFIEEnn  445
            KFLKFLGFMWNPLSWVMEAAAIMAIALANGGGKPPDWQDFVGIITLL+INSTISFIEENN
Sbjct  61   KFLKFLGFMWNPLSWVMEAAAIMAIALANGGGKPPDWQDFVGIITLLLINSTISFIEENN  120

Query  446  agnaaaalmarlapkaKVLRDG  511
            AGNAAAALMARLAPKAKVLRDG
Sbjct  121  AGNAAAALMARLAPKAKVLRDG  142



>ref|XP_006279959.1| hypothetical protein CARUB_v10025825mg [Capsella rubella]
 gb|EOA12857.1| hypothetical protein CARUB_v10025825mg [Capsella rubella]
Length=956

 Score =   166 bits (421),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 127/142 (89%), Positives = 137/142 (96%), Gaps = 0/142 (0%)
 Frame = +2

Query  86   MAEKPEVLDAVLKETVDLENIPIEEVFENLRCTKDGLTSQAAQERLDIFGHNkleekkes  265
            M +K EVL+AVLKETVDLEN+PIEEVFE+LRC+++GLT++AA ERL +FGHNKLEEKKES
Sbjct  1    MGDKEEVLEAVLKETVDLENVPIEEVFESLRCSREGLTTEAADERLALFGHNKLEEKKES  60

Query  266  kflkflgfMWNPLSWVMEaaaimaialaNGGGKPPDWQDFVGIITLLVINSTISFIEEnn  445
            KFLKFLGFMWNPLSWVMEAAAIMAI LANGGGKPPDWQDFVGIITLLVINSTISFIEENN
Sbjct  61   KFLKFLGFMWNPLSWVMEAAAIMAIVLANGGGKPPDWQDFVGIITLLVINSTISFIEENN  120

Query  446  agnaaaalmarlapkaKVLRDG  511
            AGNAAAALMARLAPKAKVLRDG
Sbjct  121  AGNAAAALMARLAPKAKVLRDG  142



>emb|CAB41144.1| H+-transporting ATPase-like protein [Arabidopsis thaliana]
Length=960

 Score =   166 bits (420),  Expect = 6e-44, Method: Composition-based stats.
 Identities = 128/137 (93%), Positives = 134/137 (98%), Gaps = 0/137 (0%)
 Frame = +2

Query  101  EVLDAVLKETVDLENIPIEEVFENLRCTKDGLTSQAAQERLDIFGHNkleekkeskflkf  280
            EVL+AVLKE VDLEN+PIEEVFENLRC+K+GLT+QAA ERL +FGHNKLEEKKESKFLKF
Sbjct  10   EVLEAVLKEAVDLENVPIEEVFENLRCSKEGLTTQAADERLALFGHNKLEEKKESKFLKF  69

Query  281  lgfMWNPLSWVMEaaaimaialaNGGGKPPDWQDFVGIITLLVINSTISFIEEnnagnaa  460
            LGFMWNPLSWVMEAAAIMAIALANGGGKPPDWQDFVGIITLLVINSTISFIEENNAGNAA
Sbjct  70   LGFMWNPLSWVMEAAAIMAIALANGGGKPPDWQDFVGIITLLVINSTISFIEENNAGNAA  129

Query  461  aalmarlapkaKVLRDG  511
            AALMARLAPKAKVLRDG
Sbjct  130  AALMARLAPKAKVLRDG  146



>ref|NP_190378.2| H(+)-ATPase 4 [Arabidopsis thaliana]
 sp|Q9SU58.2|PMA4_ARATH RecName: Full=ATPase 4, plasma membrane-type; AltName: Full=Proton 
pump 4 [Arabidopsis thaliana]
 dbj|BAC42716.1| putative H+-transporting ATPase [Arabidopsis thaliana]
 gb|AEE78350.1| H(+)-ATPase 4 [Arabidopsis thaliana]
Length=960

 Score =   166 bits (419),  Expect = 6e-44, Method: Composition-based stats.
 Identities = 128/137 (93%), Positives = 134/137 (98%), Gaps = 0/137 (0%)
 Frame = +2

Query  101  EVLDAVLKETVDLENIPIEEVFENLRCTKDGLTSQAAQERLDIFGHNkleekkeskflkf  280
            EVL+AVLKE VDLEN+PIEEVFENLRC+K+GLT+QAA ERL +FGHNKLEEKKESKFLKF
Sbjct  10   EVLEAVLKEAVDLENVPIEEVFENLRCSKEGLTTQAADERLALFGHNKLEEKKESKFLKF  69

Query  281  lgfMWNPLSWVMEaaaimaialaNGGGKPPDWQDFVGIITLLVINSTISFIEEnnagnaa  460
            LGFMWNPLSWVMEAAAIMAIALANGGGKPPDWQDFVGIITLLVINSTISFIEENNAGNAA
Sbjct  70   LGFMWNPLSWVMEAAAIMAIALANGGGKPPDWQDFVGIITLLVINSTISFIEENNAGNAA  129

Query  461  aalmarlapkaKVLRDG  511
            AALMARLAPKAKVLRDG
Sbjct  130  AALMARLAPKAKVLRDG  146



>gb|KEH31901.1| plasma membrane H+-ATPase [Medicago truncatula]
Length=958

 Score =   166 bits (419),  Expect = 7e-44, Method: Compositional matrix adjust.
 Identities = 128/140 (91%), Positives = 137/140 (98%), Gaps = 0/140 (0%)
 Frame = +2

Query  92   EKPEVLDAVLKETVDLENIPIEEVFENLRCTKDGLTSQAAQERLDIFGHNkleekkeskf  271
            EKPE L+AVLKETVDLENIPIEEVFENLRC+++GLTS+AA++RL IFGHNKLEEK+ESKF
Sbjct  5    EKPETLEAVLKETVDLENIPIEEVFENLRCSREGLTSEAAEQRLTIFGHNKLEEKRESKF  64

Query  272  lkflgfMWNPLSWVMEaaaimaialaNGGGKPPDWQDFVGIITLLVINSTISFIEEnnag  451
            LKFLGFMWNPLSWVMEAAAIMAIALANGGGK PDWQDFVGIITLL+INSTISFIEENNAG
Sbjct  65   LKFLGFMWNPLSWVMEAAAIMAIALANGGGKAPDWQDFVGIITLLIINSTISFIEENNAG  124

Query  452  naaaalmarlapkaKVLRDG  511
            NAAAALMARLAPKAKVLRDG
Sbjct  125  NAAAALMARLAPKAKVLRDG  144



>gb|KHG12451.1| ATPase 4, plasma membrane-type -like protein [Gossypium arboreum]
Length=693

 Score =   164 bits (414),  Expect = 7e-44, Method: Compositional matrix adjust.
 Identities = 107/118 (91%), Positives = 115/118 (97%), Gaps = 0/118 (0%)
 Frame = +2

Query  86   MAEKPEVLDAVLKETVDLENIPIEEVFENLRCTKDGLTSQAAQERLDIFGHNkleekkes  265
            M +K EVL+AVLKETVDLENIPIEEVFENLRC+++GLT++AA+ERL IFGHNKLEEKKES
Sbjct  1    MGDKNEVLEAVLKETVDLENIPIEEVFENLRCSREGLTTEAAEERLTIFGHNKLEEKKES  60

Query  266  kflkflgfMWNPLSWVMEaaaimaialaNGGGKPPDWQDFVGIITLLVINSTISFIEE  439
            KFLKFLGFMWNPLSWVMEAAAIMAIALANGGGKPPDWQDFVGIITLLVINSTISFIEE
Sbjct  61   KFLKFLGFMWNPLSWVMEAAAIMAIALANGGGKPPDWQDFVGIITLLVINSTISFIEE  118



>ref|XP_003527056.1| PREDICTED: ATPase 11, plasma membrane-type-like isoform 1 [Glycine 
max]
Length=956

 Score =   166 bits (419),  Expect = 8e-44, Method: Compositional matrix adjust.
 Identities = 129/142 (91%), Positives = 138/142 (97%), Gaps = 0/142 (0%)
 Frame = +2

Query  86   MAEKPEVLDAVLKETVDLENIPIEEVFENLRCTKDGLTSQAAQERLDIFGHNkleekkes  265
            M +K +VL+AVLKE VDLENIPIEEVFENLRC+K+GL+S+AA+ERL IFGHNKLEEKKES
Sbjct  1    MGDKSQVLEAVLKEAVDLENIPIEEVFENLRCSKEGLSSEAAEERLVIFGHNKLEEKKES  60

Query  266  kflkflgfMWNPLSWVMEaaaimaialaNGGGKPPDWQDFVGIITLLVINSTISFIEEnn  445
            KFLKFLGFMWNPLSWVMEAAAIMAIALANGGGKPPDWQDFVGIITLL+INSTISFIEENN
Sbjct  61   KFLKFLGFMWNPLSWVMEAAAIMAIALANGGGKPPDWQDFVGIITLLIINSTISFIEENN  120

Query  446  agnaaaalmarlapkaKVLRDG  511
            AGNAAAALMARLAPKAKVLRDG
Sbjct  121  AGNAAAALMARLAPKAKVLRDG  142



>ref|XP_002864812.1| AHA11-ATPASE 11 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH41071.1| AHA11-ATPASE 11 [Arabidopsis lyrata subsp. lyrata]
Length=956

 Score =   166 bits (419),  Expect = 8e-44, Method: Compositional matrix adjust.
 Identities = 126/142 (89%), Positives = 137/142 (96%), Gaps = 0/142 (0%)
 Frame = +2

Query  86   MAEKPEVLDAVLKETVDLENIPIEEVFENLRCTKDGLTSQAAQERLDIFGHNkleekkes  265
            M +K EVL+A+LKETVDLEN+PIEEVFE+LRC+++GLT++AA ERL +FGHNKLEEKKES
Sbjct  1    MGDKEEVLEAILKETVDLENVPIEEVFESLRCSREGLTTEAADERLALFGHNKLEEKKES  60

Query  266  kflkflgfMWNPLSWVMEaaaimaialaNGGGKPPDWQDFVGIITLLVINSTISFIEEnn  445
            KFLKFLGFMWNPLSWVMEAAAIMAI LANGGGKPPDWQDFVGIITLLVINSTISFIEENN
Sbjct  61   KFLKFLGFMWNPLSWVMEAAAIMAIVLANGGGKPPDWQDFVGIITLLVINSTISFIEENN  120

Query  446  agnaaaalmarlapkaKVLRDG  511
            AGNAAAALMARLAPKAKVLRDG
Sbjct  121  AGNAAAALMARLAPKAKVLRDG  142



>gb|KHN19372.1| ATPase 11, plasma membrane-type [Glycine soja]
Length=956

 Score =   166 bits (419),  Expect = 8e-44, Method: Compositional matrix adjust.
 Identities = 129/142 (91%), Positives = 138/142 (97%), Gaps = 0/142 (0%)
 Frame = +2

Query  86   MAEKPEVLDAVLKETVDLENIPIEEVFENLRCTKDGLTSQAAQERLDIFGHNkleekkes  265
            M +K +VL+AVLKE VDLENIPIEEVFENLRC+K+GL+S+AA+ERL IFGHNKLEEKKES
Sbjct  1    MGDKSQVLEAVLKEAVDLENIPIEEVFENLRCSKEGLSSEAAEERLVIFGHNKLEEKKES  60

Query  266  kflkflgfMWNPLSWVMEaaaimaialaNGGGKPPDWQDFVGIITLLVINSTISFIEEnn  445
            KFLKFLGFMWNPLSWVMEAAAIMAIALANGGGKPPDWQDFVGIITLL+INSTISFIEENN
Sbjct  61   KFLKFLGFMWNPLSWVMEAAAIMAIALANGGGKPPDWQDFVGIITLLIINSTISFIEENN  120

Query  446  agnaaaalmarlapkaKVLRDG  511
            AGNAAAALMARLAPKAKVLRDG
Sbjct  121  AGNAAAALMARLAPKAKVLRDG  142



>ref|XP_004138147.1| PREDICTED: ATPase 4, plasma membrane-type-like [Cucumis sativus]
Length=959

 Score =   165 bits (418),  Expect = 9e-44, Method: Compositional matrix adjust.
 Identities = 126/140 (90%), Positives = 135/140 (96%), Gaps = 0/140 (0%)
 Frame = +2

Query  92   EKPEVLDAVLKETVDLENIPIEEVFENLRCTKDGLTSQAAQERLDIFGHNkleekkeskf  271
            EKPEVL+AVLKETVDLENIPIEEVF+NLRC+K+GLT+ AA+ERL IFGHNKLEEKKESK 
Sbjct  6    EKPEVLEAVLKETVDLENIPIEEVFDNLRCSKEGLTTAAAEERLVIFGHNKLEEKKESKV  65

Query  272  lkflgfMWNPLSWVMEaaaimaialaNGGGKPPDWQDFVGIITLLVINSTISFIEEnnag  451
            LKFLGFMWNPLSWVMEAAAIMAIALANGGGKPPDWQDFVGII LL+INSTISFIEENNAG
Sbjct  66   LKFLGFMWNPLSWVMEAAAIMAIALANGGGKPPDWQDFVGIIALLLINSTISFIEENNAG  125

Query  452  naaaalmarlapkaKVLRDG  511
            NAAAALMA LAP+AK+LRDG
Sbjct  126  NAAAALMASLAPQAKILRDG  145



>ref|XP_010459221.1| PREDICTED: ATPase 11, plasma membrane-type-like [Camelina sativa]
Length=956

 Score =   165 bits (418),  Expect = 9e-44, Method: Compositional matrix adjust.
 Identities = 129/142 (91%), Positives = 138/142 (97%), Gaps = 0/142 (0%)
 Frame = +2

Query  86   MAEKPEVLDAVLKETVDLENIPIEEVFENLRCTKDGLTSQAAQERLDIFGHNkleekkes  265
            M +K EVL+AVLKETVDLEN+PIEEVFE+LRC+++GLTS+AA ERL +FGHNKLEEKKES
Sbjct  1    MGDKEEVLEAVLKETVDLENVPIEEVFESLRCSREGLTSEAADERLALFGHNKLEEKKES  60

Query  266  kflkflgfMWNPLSWVMEaaaimaialaNGGGKPPDWQDFVGIITLLVINSTISFIEEnn  445
            KFLKFLGFMWNPLSWVMEAAAIMAIALANGGGKPPDWQDFVGIITLLVINSTISFIEENN
Sbjct  61   KFLKFLGFMWNPLSWVMEAAAIMAIALANGGGKPPDWQDFVGIITLLVINSTISFIEENN  120

Query  446  agnaaaalmarlapkaKVLRDG  511
            AGNAAAALMARLAPKAKVLRDG
Sbjct  121  AGNAAAALMARLAPKAKVLRDG  142



>ref|XP_004171391.1| PREDICTED: LOW QUALITY PROTEIN: ATPase 4, plasma membrane-type-like 
[Cucumis sativus]
Length=959

 Score =   165 bits (418),  Expect = 9e-44, Method: Compositional matrix adjust.
 Identities = 126/140 (90%), Positives = 135/140 (96%), Gaps = 0/140 (0%)
 Frame = +2

Query  92   EKPEVLDAVLKETVDLENIPIEEVFENLRCTKDGLTSQAAQERLDIFGHNkleekkeskf  271
            EKPEVL+AVLKETVDLENIPIEEVF+NLRC+K+GLT+ AA+ERL IFGHNKLEEKKESK 
Sbjct  6    EKPEVLEAVLKETVDLENIPIEEVFDNLRCSKEGLTTAAAEERLVIFGHNKLEEKKESKV  65

Query  272  lkflgfMWNPLSWVMEaaaimaialaNGGGKPPDWQDFVGIITLLVINSTISFIEEnnag  451
            LKFLGFMWNPLSWVMEAAAIMAIALANGGGKPPDWQDFVGII LL+INSTISFIEENNAG
Sbjct  66   LKFLGFMWNPLSWVMEAAAIMAIALANGGGKPPDWQDFVGIIALLLINSTISFIEENNAG  125

Query  452  naaaalmarlapkaKVLRDG  511
            NAAAALMA LAP+AK+LRDG
Sbjct  126  NAAAALMASLAPQAKILRDG  145



>ref|XP_002282263.1| PREDICTED: ATPase 4, plasma membrane-type [Vitis vinifera]
 ref|XP_010661009.1| PREDICTED: ATPase 4, plasma membrane-type [Vitis vinifera]
 emb|CBI35033.3| unnamed protein product [Vitis vinifera]
Length=955

 Score =   165 bits (418),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 127/142 (89%), Positives = 135/142 (95%), Gaps = 0/142 (0%)
 Frame = +2

Query  86   MAEKPEVLDAVLKETVDLENIPIEEVFENLRCTKDGLTSQAAQERLDIFGHNkleekkes  265
            MA+KPEVL+AVLKE VDLENIPIEEVF+NLRC  +GL+++AA ERL IFGHNKLEEK+ES
Sbjct  1    MADKPEVLEAVLKEAVDLENIPIEEVFQNLRCNANGLSTEAANERLAIFGHNKLEEKEES  60

Query  266  kflkflgfMWNPLSWVMEaaaimaialaNGGGKPPDWQDFVGIITLLVINSTISFIEEnn  445
            K LKFLGFMWNPLSWVMEAAAIMAIALANGGGKPPDWQDFVGIITLL INSTISFIEENN
Sbjct  61   KVLKFLGFMWNPLSWVMEAAAIMAIALANGGGKPPDWQDFVGIITLLFINSTISFIEENN  120

Query  446  agnaaaalmarlapkaKVLRDG  511
            AGNAAAALMARLAPKAKVLRDG
Sbjct  121  AGNAAAALMARLAPKAKVLRDG  142



>ref|XP_003523043.1| PREDICTED: ATPase 11, plasma membrane-type-like isoform 1 [Glycine 
max]
 gb|KHN08862.1| ATPase 11, plasma membrane-type [Glycine soja]
Length=956

 Score =   165 bits (417),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 129/142 (91%), Positives = 138/142 (97%), Gaps = 0/142 (0%)
 Frame = +2

Query  86   MAEKPEVLDAVLKETVDLENIPIEEVFENLRCTKDGLTSQAAQERLDIFGHNkleekkes  265
            M +K +VL+AVLKE VDLENIPIEEVFENLRC+K+GL+S+AA+ERL IFGHNKLEEKKES
Sbjct  1    MGDKSQVLEAVLKEAVDLENIPIEEVFENLRCSKEGLSSEAAEERLVIFGHNKLEEKKES  60

Query  266  kflkflgfMWNPLSWVMEaaaimaialaNGGGKPPDWQDFVGIITLLVINSTISFIEEnn  445
            KFLKFLGFMWNPLSWVMEAAAIMAIALANGGGKPPDWQDFVGIITLL+INSTISFIEENN
Sbjct  61   KFLKFLGFMWNPLSWVMEAAAIMAIALANGGGKPPDWQDFVGIITLLLINSTISFIEENN  120

Query  446  agnaaaalmarlapkaKVLRDG  511
            AGNAAAALMARLAPKAKVLRDG
Sbjct  121  AGNAAAALMARLAPKAKVLRDG  142



>ref|NP_201073.1| H(+)-ATPase 11 [Arabidopsis thaliana]
 sp|Q9LV11.1|PMA11_ARATH RecName: Full=ATPase 11, plasma membrane-type; AltName: Full=Proton 
pump 11 [Arabidopsis thaliana]
 dbj|BAA97214.1| plasma membrane proton ATPase-like [Arabidopsis thaliana]
 gb|AAM78085.1| AT5g62670/MRG21_9 [Arabidopsis thaliana]
 gb|AAR23718.1| At5g62670/MRG21_9 [Arabidopsis thaliana]
 gb|AED97641.1| H(+)-ATPase 11 [Arabidopsis thaliana]
Length=956

 Score =   164 bits (416),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 128/142 (90%), Positives = 138/142 (97%), Gaps = 0/142 (0%)
 Frame = +2

Query  86   MAEKPEVLDAVLKETVDLENIPIEEVFENLRCTKDGLTSQAAQERLDIFGHNkleekkes  265
            M +K EVL+AVLKETVDLEN+PIEEVFE+LRC+++GLT++AA ERL +FGHNKLEEKKES
Sbjct  1    MGDKEEVLEAVLKETVDLENVPIEEVFESLRCSREGLTTEAADERLALFGHNKLEEKKES  60

Query  266  kflkflgfMWNPLSWVMEaaaimaialaNGGGKPPDWQDFVGIITLLVINSTISFIEEnn  445
            KFLKFLGFMWNPLSWVMEAAAIMAIALANGGGKPPDWQDFVGIITLLVINSTISFIEENN
Sbjct  61   KFLKFLGFMWNPLSWVMEAAAIMAIALANGGGKPPDWQDFVGIITLLVINSTISFIEENN  120

Query  446  agnaaaalmarlapkaKVLRDG  511
            AGNAAAALMARLAPKAKVLRDG
Sbjct  121  AGNAAAALMARLAPKAKVLRDG  142



>ref|XP_006394361.1| hypothetical protein EUTSA_v10003603mg [Eutrema salsugineum]
 dbj|BAJ34039.1| unnamed protein product [Thellungiella halophila]
 gb|ESQ31647.1| hypothetical protein EUTSA_v10003603mg [Eutrema salsugineum]
Length=956

 Score =   164 bits (416),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 128/142 (90%), Positives = 138/142 (97%), Gaps = 0/142 (0%)
 Frame = +2

Query  86   MAEKPEVLDAVLKETVDLENIPIEEVFENLRCTKDGLTSQAAQERLDIFGHNkleekkes  265
            M +K EVL+AVLKETVDLEN+PIEEVFE+LRC+++GLT++AA ERL +FGHNKLEEKKES
Sbjct  1    MGDKEEVLEAVLKETVDLENVPIEEVFESLRCSREGLTTEAADERLALFGHNKLEEKKES  60

Query  266  kflkflgfMWNPLSWVMEaaaimaialaNGGGKPPDWQDFVGIITLLVINSTISFIEEnn  445
            KFLKFLGFMWNPLSWVMEAAAIMAIALANGGGKPPDWQDFVGIITLLVINSTISFIEENN
Sbjct  61   KFLKFLGFMWNPLSWVMEAAAIMAIALANGGGKPPDWQDFVGIITLLVINSTISFIEENN  120

Query  446  agnaaaalmarlapkaKVLRDG  511
            AGNAAAALMARLAPKAKVLRDG
Sbjct  121  AGNAAAALMARLAPKAKVLRDG  142



>ref|XP_010272214.1| PREDICTED: ATPase 11, plasma membrane-type-like [Nelumbo nucifera]
Length=955

 Score =   164 bits (415),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 126/142 (89%), Positives = 134/142 (94%), Gaps = 0/142 (0%)
 Frame = +2

Query  86   MAEKPEVLDAVLKETVDLENIPIEEVFENLRCTKDGLTSQAAQERLDIFGHNkleekkes  265
            M +K  +L+AVLKE VDLENIPIEEVFENLRC K+GLT++AAQERL IFGHNKLEEK+ES
Sbjct  1    MGDKATILEAVLKEAVDLENIPIEEVFENLRCNKEGLTTEAAQERLVIFGHNKLEEKQES  60

Query  266  kflkflgfMWNPLSWVMEaaaimaialaNGGGKPPDWQDFVGIITLLVINSTISFIEEnn  445
            K LKFLGFMWNPLSWVMEAAAIMAIALANGGGKPPDWQDFVGIITLL+INSTISFIEENN
Sbjct  61   KILKFLGFMWNPLSWVMEAAAIMAIALANGGGKPPDWQDFVGIITLLLINSTISFIEENN  120

Query  446  agnaaaalmarlapkaKVLRDG  511
            AGNAAAALMARLAPK KVLRDG
Sbjct  121  AGNAAAALMARLAPKGKVLRDG  142



>ref|XP_009130229.1| PREDICTED: ATPase 11, plasma membrane-type isoform X2 [Brassica 
rapa]
Length=956

 Score =   164 bits (415),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 128/142 (90%), Positives = 137/142 (96%), Gaps = 0/142 (0%)
 Frame = +2

Query  86   MAEKPEVLDAVLKETVDLENIPIEEVFENLRCTKDGLTSQAAQERLDIFGHNkleekkes  265
            M +K EVL+AVLKETVDLEN+PIEEVFE+LRC+++GLT+ AA ERL +FGHNKLEEKKES
Sbjct  1    MGDKEEVLEAVLKETVDLENVPIEEVFESLRCSREGLTTAAADERLALFGHNKLEEKKES  60

Query  266  kflkflgfMWNPLSWVMEaaaimaialaNGGGKPPDWQDFVGIITLLVINSTISFIEEnn  445
            KFLKFLGFMWNPLSWVMEAAAIMAIALANGGGKPPDWQDFVGIITLLVINSTISFIEENN
Sbjct  61   KFLKFLGFMWNPLSWVMEAAAIMAIALANGGGKPPDWQDFVGIITLLVINSTISFIEENN  120

Query  446  agnaaaalmarlapkaKVLRDG  511
            AGNAAAALMARLAPKAKVLRDG
Sbjct  121  AGNAAAALMARLAPKAKVLRDG  142



>ref|XP_009130228.1| PREDICTED: ATPase 11, plasma membrane-type isoform X1 [Brassica 
rapa]
Length=979

 Score =   164 bits (415),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 128/142 (90%), Positives = 137/142 (96%), Gaps = 0/142 (0%)
 Frame = +2

Query  86   MAEKPEVLDAVLKETVDLENIPIEEVFENLRCTKDGLTSQAAQERLDIFGHNkleekkes  265
            M +K EVL+AVLKETVDLEN+PIEEVFE+LRC+++GLT+ AA ERL +FGHNKLEEKKES
Sbjct  1    MGDKEEVLEAVLKETVDLENVPIEEVFESLRCSREGLTTAAADERLALFGHNKLEEKKES  60

Query  266  kflkflgfMWNPLSWVMEaaaimaialaNGGGKPPDWQDFVGIITLLVINSTISFIEEnn  445
            KFLKFLGFMWNPLSWVMEAAAIMAIALANGGGKPPDWQDFVGIITLLVINSTISFIEENN
Sbjct  61   KFLKFLGFMWNPLSWVMEAAAIMAIALANGGGKPPDWQDFVGIITLLVINSTISFIEENN  120

Query  446  agnaaaalmarlapkaKVLRDG  511
            AGNAAAALMARLAPKAKVLRDG
Sbjct  121  AGNAAAALMARLAPKAKVLRDG  142



>ref|XP_004508789.1| PREDICTED: ATPase 11, plasma membrane-type-like isoform X3 [Cicer 
arietinum]
Length=958

 Score =   164 bits (414),  Expect = 3e-43, Method: Composition-based stats.
 Identities = 125/140 (89%), Positives = 137/140 (98%), Gaps = 0/140 (0%)
 Frame = +2

Query  92   EKPEVLDAVLKETVDLENIPIEEVFENLRCTKDGLTSQAAQERLDIFGHNkleekkeskf  271
            +KPE+L+AVLKETVDLENIPIEEVFENLRC+++GLTS+ A++RL IFG+NKLEEK+ESKF
Sbjct  5    DKPEMLEAVLKETVDLENIPIEEVFENLRCSREGLTSEGAEQRLTIFGYNKLEEKRESKF  64

Query  272  lkflgfMWNPLSWVMEaaaimaialaNGGGKPPDWQDFVGIITLLVINSTISFIEEnnag  451
            LKFLGFMWNPLSWVMEAAAIMAIALANGGGK PDWQDFVGIITLL+INSTISFIEENNAG
Sbjct  65   LKFLGFMWNPLSWVMEAAAIMAIALANGGGKAPDWQDFVGIITLLIINSTISFIEENNAG  124

Query  452  naaaalmarlapkaKVLRDG  511
            NAAAALMARLAPKAKVLRDG
Sbjct  125  NAAAALMARLAPKAKVLRDG  144



>ref|XP_009130230.1| PREDICTED: ATPase 11, plasma membrane-type isoform X3 [Brassica 
rapa]
Length=939

 Score =   164 bits (414),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 128/142 (90%), Positives = 137/142 (96%), Gaps = 0/142 (0%)
 Frame = +2

Query  86   MAEKPEVLDAVLKETVDLENIPIEEVFENLRCTKDGLTSQAAQERLDIFGHNkleekkes  265
            M +K EVL+AVLKETVDLEN+PIEEVFE+LRC+++GLT+ AA ERL +FGHNKLEEKKES
Sbjct  1    MGDKEEVLEAVLKETVDLENVPIEEVFESLRCSREGLTTAAADERLALFGHNKLEEKKES  60

Query  266  kflkflgfMWNPLSWVMEaaaimaialaNGGGKPPDWQDFVGIITLLVINSTISFIEEnn  445
            KFLKFLGFMWNPLSWVMEAAAIMAIALANGGGKPPDWQDFVGIITLLVINSTISFIEENN
Sbjct  61   KFLKFLGFMWNPLSWVMEAAAIMAIALANGGGKPPDWQDFVGIITLLVINSTISFIEENN  120

Query  446  agnaaaalmarlapkaKVLRDG  511
            AGNAAAALMARLAPKAKVLRDG
Sbjct  121  AGNAAAALMARLAPKAKVLRDG  142



>emb|CDY45757.1| BnaC02g42250D [Brassica napus]
Length=962

 Score =   163 bits (413),  Expect = 4e-43, Method: Composition-based stats.
 Identities = 127/142 (89%), Positives = 136/142 (96%), Gaps = 0/142 (0%)
 Frame = +2

Query  86   MAEKPEVLDAVLKETVDLENIPIEEVFENLRCTKDGLTSQAAQERLDIFGHNkleekkes  265
            M +K EVL+AVLKETVDLEN+ IEEVFE+LRC+++GLT+ AA ERL +FGHNKLEEKKES
Sbjct  1    MGDKEEVLEAVLKETVDLENVAIEEVFESLRCSREGLTTAAADERLALFGHNKLEEKKES  60

Query  266  kflkflgfMWNPLSWVMEaaaimaialaNGGGKPPDWQDFVGIITLLVINSTISFIEEnn  445
            KFLKFLGFMWNPLSWVMEAAAIMAIALANGGGKPPDWQDFVGIITLLVINSTISFIEENN
Sbjct  61   KFLKFLGFMWNPLSWVMEAAAIMAIALANGGGKPPDWQDFVGIITLLVINSTISFIEENN  120

Query  446  agnaaaalmarlapkaKVLRDG  511
            AGNAAAALMARLAPKAKVLRDG
Sbjct  121  AGNAAAALMARLAPKAKVLRDG  142



>gb|EPS66977.1| hypothetical protein M569_07799, partial [Genlisea aurea]
Length=922

 Score =   163 bits (413),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 128/139 (92%), Positives = 136/139 (98%), Gaps = 0/139 (0%)
 Frame = +2

Query  95   KPEVLDAVLKETVDLENIPIEEVFENLRCTKDGLTSQAAQERLDIFGHNkleekkeskfl  274
            KPEVLDAVLKETVDLENIPI+EV ENLRC+++GL+S++AQERL IFGHNKLEEKKESKFL
Sbjct  1    KPEVLDAVLKETVDLENIPIDEVLENLRCSREGLSSESAQERLAIFGHNKLEEKKESKFL  60

Query  275  kflgfMWNPLSWVMEaaaimaialaNGGGKPPDWQDFVGIITLLVINSTISFIEEnnagn  454
            KFLGFMWNPLSWVMEAAAIMAIALANGG KPPDWQDFVGIITLL+INSTISFIEENNAGN
Sbjct  61   KFLGFMWNPLSWVMEAAAIMAIALANGGNKPPDWQDFVGIITLLMINSTISFIEENNAGN  120

Query  455  aaaalmarlapkaKVLRDG  511
            AAAALMARLAPKAKVLRDG
Sbjct  121  AAAALMARLAPKAKVLRDG  139



>ref|XP_007155352.1| hypothetical protein PHAVU_003G193800g [Phaseolus vulgaris]
 gb|ESW27346.1| hypothetical protein PHAVU_003G193800g [Phaseolus vulgaris]
Length=810

 Score =   162 bits (411),  Expect = 5e-43, Method: Compositional matrix adjust.
 Identities = 127/142 (89%), Positives = 137/142 (96%), Gaps = 0/142 (0%)
 Frame = +2

Query  86   MAEKPEVLDAVLKETVDLENIPIEEVFENLRCTKDGLTSQAAQERLDIFGHNkleekkes  265
            M +K +VL+AVLKETVDLENIPIEEV ENLRC+++GL+S+AA+ERL IFGHNKLEEK+ES
Sbjct  1    MGDKSQVLEAVLKETVDLENIPIEEVLENLRCSREGLSSEAAEERLTIFGHNKLEEKRES  60

Query  266  kflkflgfMWNPLSWVMEaaaimaialaNGGGKPPDWQDFVGIITLLVINSTISFIEEnn  445
            KFLKFLGFMWNPLSWVMEAAAIMAIALANGGGK PDWQDFVGIITLLVINSTISFIEENN
Sbjct  61   KFLKFLGFMWNPLSWVMEAAAIMAIALANGGGKAPDWQDFVGIITLLVINSTISFIEENN  120

Query  446  agnaaaalmarlapkaKVLRDG  511
            AGNAAAALMARLAPKAKVLRDG
Sbjct  121  AGNAAAALMARLAPKAKVLRDG  142



>ref|XP_010444121.1| PREDICTED: ATPase 11, plasma membrane-type isoform X2 [Camelina 
sativa]
Length=956

 Score =   163 bits (412),  Expect = 7e-43, Method: Compositional matrix adjust.
 Identities = 127/142 (89%), Positives = 138/142 (97%), Gaps = 0/142 (0%)
 Frame = +2

Query  86   MAEKPEVLDAVLKETVDLENIPIEEVFENLRCTKDGLTSQAAQERLDIFGHNkleekkes  265
            M +K EVL+AVLKETVDLEN+PI+EVFE+LRC+++GLT++AA ERL +FGHNKLEEKKES
Sbjct  1    MGDKEEVLEAVLKETVDLENVPIDEVFESLRCSREGLTTEAADERLALFGHNKLEEKKES  60

Query  266  kflkflgfMWNPLSWVMEaaaimaialaNGGGKPPDWQDFVGIITLLVINSTISFIEEnn  445
            KFLKFLGFMWNPLSWVMEAAAIMAIALANGGGKPPDWQDFVGIITLLVINSTISFIEENN
Sbjct  61   KFLKFLGFMWNPLSWVMEAAAIMAIALANGGGKPPDWQDFVGIITLLVINSTISFIEENN  120

Query  446  agnaaaalmarlapkaKVLRDG  511
            AGNAAAALMARLAPKAKVLRDG
Sbjct  121  AGNAAAALMARLAPKAKVLRDG  142



>ref|XP_010444120.1| PREDICTED: ATPase 11, plasma membrane-type isoform X1 [Camelina 
sativa]
Length=959

 Score =   163 bits (412),  Expect = 7e-43, Method: Compositional matrix adjust.
 Identities = 127/142 (89%), Positives = 138/142 (97%), Gaps = 0/142 (0%)
 Frame = +2

Query  86   MAEKPEVLDAVLKETVDLENIPIEEVFENLRCTKDGLTSQAAQERLDIFGHNkleekkes  265
            M +K EVL+AVLKETVDLEN+PI+EVFE+LRC+++GLT++AA ERL +FGHNKLEEKKES
Sbjct  1    MGDKEEVLEAVLKETVDLENVPIDEVFESLRCSREGLTTEAADERLALFGHNKLEEKKES  60

Query  266  kflkflgfMWNPLSWVMEaaaimaialaNGGGKPPDWQDFVGIITLLVINSTISFIEEnn  445
            KFLKFLGFMWNPLSWVMEAAAIMAIALANGGGKPPDWQDFVGIITLLVINSTISFIEENN
Sbjct  61   KFLKFLGFMWNPLSWVMEAAAIMAIALANGGGKPPDWQDFVGIITLLVINSTISFIEENN  120

Query  446  agnaaaalmarlapkaKVLRDG  511
            AGNAAAALMARLAPKAKVLRDG
Sbjct  121  AGNAAAALMARLAPKAKVLRDG  142



>emb|CAC29435.1| P-type H+-ATPase [Vicia faba]
Length=958

 Score =   162 bits (410),  Expect = 1e-42, Method: Composition-based stats.
 Identities = 123/144 (85%), Positives = 134/144 (93%), Gaps = 2/144 (1%)
 Frame = +2

Query  86   MAE--KPEVLDAVLKETVDLENIPIEEVFENLRCTKDGLTSQAAQERLDIFGHNkleekk  259
            MAE  KPE L AVLKETVDLENIPI+EVFENLRC+++GLTS+AA++RL IFGHNKLEEK+
Sbjct  1    MAEEQKPETLQAVLKETVDLENIPIDEVFENLRCSREGLTSEAAEQRLTIFGHNKLEEKR  60

Query  260  eskflkflgfMWNPLSWVMEaaaimaialaNGGGKPPDWQDFVGIITLLVINSTISFIEE  439
            ESK LKFLGFMWNPLSWVMEAA IMAIALANGG K PDWQDFVGIITLL+INSTISFI++
Sbjct  61   ESKLLKFLGFMWNPLSWVMEAARIMAIALANGGNKAPDWQDFVGIITLLIINSTISFIDQ  120

Query  440  nnagnaaaalmarlapkaKVLRDG  511
            NNAGNAAAALMA LAPKAKVLRDG
Sbjct  121  NNAGNAAAALMASLAPKAKVLRDG  144



>ref|XP_007155353.1| hypothetical protein PHAVU_003G193800g [Phaseolus vulgaris]
 gb|ESW27347.1| hypothetical protein PHAVU_003G193800g [Phaseolus vulgaris]
Length=955

 Score =   162 bits (410),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 127/142 (89%), Positives = 137/142 (96%), Gaps = 0/142 (0%)
 Frame = +2

Query  86   MAEKPEVLDAVLKETVDLENIPIEEVFENLRCTKDGLTSQAAQERLDIFGHNkleekkes  265
            M +K +VL+AVLKETVDLENIPIEEV ENLRC+++GL+S+AA+ERL IFGHNKLEEK+ES
Sbjct  1    MGDKSQVLEAVLKETVDLENIPIEEVLENLRCSREGLSSEAAEERLTIFGHNKLEEKRES  60

Query  266  kflkflgfMWNPLSWVMEaaaimaialaNGGGKPPDWQDFVGIITLLVINSTISFIEEnn  445
            KFLKFLGFMWNPLSWVMEAAAIMAIALANGGGK PDWQDFVGIITLLVINSTISFIEENN
Sbjct  61   KFLKFLGFMWNPLSWVMEAAAIMAIALANGGGKAPDWQDFVGIITLLVINSTISFIEENN  120

Query  446  agnaaaalmarlapkaKVLRDG  511
            AGNAAAALMARLAPKAKVLRDG
Sbjct  121  AGNAAAALMARLAPKAKVLRDG  142



>ref|XP_008807875.1| PREDICTED: ATPase 11, plasma membrane-type [Phoenix dactylifera]
 ref|XP_008807876.1| PREDICTED: ATPase 11, plasma membrane-type [Phoenix dactylifera]
 ref|XP_008807878.1| PREDICTED: ATPase 11, plasma membrane-type [Phoenix dactylifera]
 ref|XP_008807879.1| PREDICTED: ATPase 11, plasma membrane-type [Phoenix dactylifera]
Length=956

 Score =   162 bits (410),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 125/142 (88%), Positives = 134/142 (94%), Gaps = 0/142 (0%)
 Frame = +2

Query  86   MAEKPEVLDAVLKETVDLENIPIEEVFENLRCTKDGLTSQAAQERLDIFGHNkleekkes  265
            M +K   LDAVLKE VDLENIP+EEVF+NLRCT++GLT++ A+ERL IFGHNKLEEK+ES
Sbjct  1    MGDKAATLDAVLKEAVDLENIPLEEVFDNLRCTREGLTTEQAEERLAIFGHNKLEEKEES  60

Query  266  kflkflgfMWNPLSWVMEaaaimaialaNGGGKPPDWQDFVGIITLLVINSTISFIEEnn  445
            K LKFLGFMWNPLSWVMEAAAIMAIALANGGGKPPDWQDFVGIITLLVINSTISFIEENN
Sbjct  61   KILKFLGFMWNPLSWVMEAAAIMAIALANGGGKPPDWQDFVGIITLLVINSTISFIEENN  120

Query  446  agnaaaalmarlapkaKVLRDG  511
            AGNAAAALMARLAPKAKVLRDG
Sbjct  121  AGNAAAALMARLAPKAKVLRDG  142



>gb|EEC69747.1| hypothetical protein OsI_39279 [Oryza sativa Indica Group]
Length=931

 Score =   162 bits (409),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 128/142 (90%), Positives = 136/142 (96%), Gaps = 0/142 (0%)
 Frame = +2

Query  86   MAEKPEVLDAVLKETVDLENIPIEEVFENLRCTKDGLTSQAAQERLDIFGHNkleekkes  265
            MAEK   LDAVLKE VDLENIP+EEVFENLRC+++GLT+Q AQ+RL+IFG NKLEEK+ES
Sbjct  1    MAEKEGNLDAVLKEAVDLENIPLEEVFENLRCSREGLTTQQAQQRLEIFGPNKLEEKEES  60

Query  266  kflkflgfMWNPLSWVMEaaaimaialaNGGGKPPDWQDFVGIITLLVINSTISFIEEnn  445
            KFLKFLGFMWNPLSWVMEAAAIMAIALANGGGKPPDWQDFVGIITLLVINSTISFIEENN
Sbjct  61   KFLKFLGFMWNPLSWVMEAAAIMAIALANGGGKPPDWQDFVGIITLLVINSTISFIEENN  120

Query  446  agnaaaalmarlapkaKVLRDG  511
            AGNAAAALMARLAPKAKVLRDG
Sbjct  121  AGNAAAALMARLAPKAKVLRDG  142



>ref|XP_009398400.1| PREDICTED: plasma membrane ATPase 1 isoform X1 [Musa acuminata 
subsp. malaccensis]
Length=989

 Score =   162 bits (409),  Expect = 2e-42, Method: Composition-based stats.
 Identities = 123/135 (91%), Positives = 131/135 (97%), Gaps = 0/135 (0%)
 Frame = +2

Query  107  LDAVLKETVDLENIPIEEVFENLRCTKDGLTSQAAQERLDIFGHNkleekkeskflkflg  286
            +DA+LKE VDLENIP+EEVFENLRCT++GLT+Q A+ERL IFGHNKLEEKKESK LKFLG
Sbjct  13   MDALLKEAVDLENIPLEEVFENLRCTREGLTTQQAEERLAIFGHNKLEEKKESKILKFLG  72

Query  287  fMWNPLSWVMEaaaimaialaNGGGKPPDWQDFVGIITLLVINSTISFIEEnnagnaaaa  466
            FMWNPLSWVMEAAA+MAIALANGGGKPPDWQDFVGIITLLVINSTISFIEENNAGNAAAA
Sbjct  73   FMWNPLSWVMEAAAVMAIALANGGGKPPDWQDFVGIITLLVINSTISFIEENNAGNAAAA  132

Query  467  lmarlapkaKVLRDG  511
            LMARLAPKAKVLRDG
Sbjct  133  LMARLAPKAKVLRDG  147



>gb|EAZ21357.1| hypothetical protein OsJ_37014 [Oryza sativa Japonica Group]
Length=931

 Score =   162 bits (409),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 128/142 (90%), Positives = 136/142 (96%), Gaps = 0/142 (0%)
 Frame = +2

Query  86   MAEKPEVLDAVLKETVDLENIPIEEVFENLRCTKDGLTSQAAQERLDIFGHNkleekkes  265
            MAEK   LDAVLKE VDLENIP+EEVFENLRC+++GLT+Q AQ+RL+IFG NKLEEK+ES
Sbjct  1    MAEKEGNLDAVLKEAVDLENIPLEEVFENLRCSREGLTTQQAQQRLEIFGPNKLEEKEES  60

Query  266  kflkflgfMWNPLSWVMEaaaimaialaNGGGKPPDWQDFVGIITLLVINSTISFIEEnn  445
            KFLKFLGFMWNPLSWVMEAAAIMAIALANGGGKPPDWQDFVGIITLLVINSTISFIEENN
Sbjct  61   KFLKFLGFMWNPLSWVMEAAAIMAIALANGGGKPPDWQDFVGIITLLVINSTISFIEENN  120

Query  446  agnaaaalmarlapkaKVLRDG  511
            AGNAAAALMARLAPKAKVLRDG
Sbjct  121  AGNAAAALMARLAPKAKVLRDG  142



>ref|XP_006664787.1| PREDICTED: plasma membrane ATPase 1-like [Oryza brachyantha]
Length=956

 Score =   161 bits (408),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 128/142 (90%), Positives = 136/142 (96%), Gaps = 0/142 (0%)
 Frame = +2

Query  86   MAEKPEVLDAVLKETVDLENIPIEEVFENLRCTKDGLTSQAAQERLDIFGHNkleekkes  265
            MAEK   LDAVLKE VDLENIP+EEVFENLRC+++GLT+Q AQ+RL+IFG NKLEEK+ES
Sbjct  1    MAEKEGNLDAVLKEAVDLENIPLEEVFENLRCSREGLTTQQAQQRLEIFGPNKLEEKEES  60

Query  266  kflkflgfMWNPLSWVMEaaaimaialaNGGGKPPDWQDFVGIITLLVINSTISFIEEnn  445
            KFLKFLGFMWNPLSWVMEAAAIMAIALANGGGKPPDWQDFVGIITLLVINSTISFIEENN
Sbjct  61   KFLKFLGFMWNPLSWVMEAAAIMAIALANGGGKPPDWQDFVGIITLLVINSTISFIEENN  120

Query  446  agnaaaalmarlapkaKVLRDG  511
            AGNAAAALMARLAPKAKVLRDG
Sbjct  121  AGNAAAALMARLAPKAKVLRDG  142



>ref|NP_001067382.1| Os12g0638700 [Oryza sativa Japonica Group]
 emb|CAD29296.1| plasma membrane H+ ATPase [Oryza sativa Japonica Group]
 gb|ABA99607.1| Plasma membrane ATPase 1, putative, expressed [Oryza sativa Japonica 
Group]
 dbj|BAF30401.1| Os12g0638700 [Oryza sativa Japonica Group]
Length=956

 Score =   161 bits (408),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 128/142 (90%), Positives = 136/142 (96%), Gaps = 0/142 (0%)
 Frame = +2

Query  86   MAEKPEVLDAVLKETVDLENIPIEEVFENLRCTKDGLTSQAAQERLDIFGHNkleekkes  265
            MAEK   LDAVLKE VDLENIP+EEVFENLRC+++GLT+Q AQ+RL+IFG NKLEEK+ES
Sbjct  1    MAEKEGNLDAVLKEAVDLENIPLEEVFENLRCSREGLTTQQAQQRLEIFGPNKLEEKEES  60

Query  266  kflkflgfMWNPLSWVMEaaaimaialaNGGGKPPDWQDFVGIITLLVINSTISFIEEnn  445
            KFLKFLGFMWNPLSWVMEAAAIMAIALANGGGKPPDWQDFVGIITLLVINSTISFIEENN
Sbjct  61   KFLKFLGFMWNPLSWVMEAAAIMAIALANGGGKPPDWQDFVGIITLLVINSTISFIEENN  120

Query  446  agnaaaalmarlapkaKVLRDG  511
            AGNAAAALMARLAPKAKVLRDG
Sbjct  121  AGNAAAALMARLAPKAKVLRDG  142



>ref|XP_010923303.1| PREDICTED: plasma membrane ATPase 3-like [Elaeis guineensis]
Length=956

 Score =   161 bits (407),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 125/142 (88%), Positives = 134/142 (94%), Gaps = 0/142 (0%)
 Frame = +2

Query  86   MAEKPEVLDAVLKETVDLENIPIEEVFENLRCTKDGLTSQAAQERLDIFGHNkleekkes  265
            M +K   L+AVLKE VDLENIP+EEVFENLRCT++GLT++ A+ERL IFGHNKLEEKKES
Sbjct  1    MGDKAATLEAVLKEAVDLENIPLEEVFENLRCTREGLTTEQAEERLAIFGHNKLEEKKES  60

Query  266  kflkflgfMWNPLSWVMEaaaimaialaNGGGKPPDWQDFVGIITLLVINSTISFIEEnn  445
            K LKFLGFMWNPLSWVMEAAAIMAIALANGGGKPPDWQDFVGIITLL+INSTISFIEENN
Sbjct  61   KILKFLGFMWNPLSWVMEAAAIMAIALANGGGKPPDWQDFVGIITLLLINSTISFIEENN  120

Query  446  agnaaaalmarlapkaKVLRDG  511
            AGNAAAALMARLAPKAKVLRDG
Sbjct  121  AGNAAAALMARLAPKAKVLRDG  142



>ref|XP_004963335.1| PREDICTED: plasma membrane ATPase 1-like [Setaria italica]
Length=956

 Score =   160 bits (406),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 127/142 (89%), Positives = 136/142 (96%), Gaps = 0/142 (0%)
 Frame = +2

Query  86   MAEKPEVLDAVLKETVDLENIPIEEVFENLRCTKDGLTSQAAQERLDIFGHNkleekkes  265
            MAEK   LDAVLKE VDLENIP+EEVFENLRC+++GL++Q AQ+RL+IFG NKLEEK+ES
Sbjct  1    MAEKEGNLDAVLKEAVDLENIPLEEVFENLRCSREGLSTQQAQQRLEIFGPNKLEEKEES  60

Query  266  kflkflgfMWNPLSWVMEaaaimaialaNGGGKPPDWQDFVGIITLLVINSTISFIEEnn  445
            KFLKFLGFMWNPLSWVMEAAAIMAIALANGGGKPPDWQDFVGIITLLVINSTISFIEENN
Sbjct  61   KFLKFLGFMWNPLSWVMEAAAIMAIALANGGGKPPDWQDFVGIITLLVINSTISFIEENN  120

Query  446  agnaaaalmarlapkaKVLRDG  511
            AGNAAAALMARLAPKAKVLRDG
Sbjct  121  AGNAAAALMARLAPKAKVLRDG  142



>ref|XP_004508788.1| PREDICTED: ATPase 11, plasma membrane-type-like isoform X2 [Cicer 
arietinum]
Length=960

 Score =   160 bits (405),  Expect = 5e-42, Method: Compositional matrix adjust.
 Identities = 125/140 (89%), Positives = 137/140 (98%), Gaps = 0/140 (0%)
 Frame = +2

Query  92   EKPEVLDAVLKETVDLENIPIEEVFENLRCTKDGLTSQAAQERLDIFGHNkleekkeskf  271
            +KPE+L+AVLKETVDLENIPIEEVFENLRC+++GLTS+ A++RL IFG+NKLEEK+ESKF
Sbjct  5    DKPEMLEAVLKETVDLENIPIEEVFENLRCSREGLTSEGAEQRLTIFGYNKLEEKRESKF  64

Query  272  lkflgfMWNPLSWVMEaaaimaialaNGGGKPPDWQDFVGIITLLVINSTISFIEEnnag  451
            LKFLGFMWNPLSWVMEAAAIMAIALANGGGK PDWQDFVGIITLL+INSTISFIEENNAG
Sbjct  65   LKFLGFMWNPLSWVMEAAAIMAIALANGGGKAPDWQDFVGIITLLIINSTISFIEENNAG  124

Query  452  naaaalmarlapkaKVLRDG  511
            NAAAALMARLAPKAKVLRDG
Sbjct  125  NAAAALMARLAPKAKVLRDG  144



>ref|XP_006290560.1| hypothetical protein CARUB_v10016646mg [Capsella rubella]
 gb|EOA23458.1| hypothetical protein CARUB_v10016646mg [Capsella rubella]
Length=956

 Score =   160 bits (405),  Expect = 5e-42, Method: Compositional matrix adjust.
 Identities = 127/142 (89%), Positives = 135/142 (95%), Gaps = 0/142 (0%)
 Frame = +2

Query  86   MAEKPEVLDAVLKETVDLENIPIEEVFENLRCTKDGLTSQAAQERLDIFGHNkleekkes  265
            M +  EVL+AVLKE VDLEN+PIEEVFE LRC+K+GLT+QAA +RL +FGHNKLEEKKES
Sbjct  1    MEDNNEVLEAVLKEAVDLENVPIEEVFETLRCSKEGLTTQAADDRLALFGHNKLEEKKES  60

Query  266  kflkflgfMWNPLSWVMEaaaimaialaNGGGKPPDWQDFVGIITLLVINSTISFIEEnn  445
            KFLKFLGFMWNPLSWVMEAAAIMAIALANGGGKPPDWQDFVGIITLLVINSTISFIEENN
Sbjct  61   KFLKFLGFMWNPLSWVMEAAAIMAIALANGGGKPPDWQDFVGIITLLVINSTISFIEENN  120

Query  446  agnaaaalmarlapkaKVLRDG  511
            AGNAAAALMARLAPKAKVLRDG
Sbjct  121  AGNAAAALMARLAPKAKVLRDG  142



>ref|XP_004508787.1| PREDICTED: ATPase 11, plasma membrane-type-like isoform X1 [Cicer 
arietinum]
Length=979

 Score =   160 bits (405),  Expect = 6e-42, Method: Compositional matrix adjust.
 Identities = 125/140 (89%), Positives = 137/140 (98%), Gaps = 0/140 (0%)
 Frame = +2

Query  92   EKPEVLDAVLKETVDLENIPIEEVFENLRCTKDGLTSQAAQERLDIFGHNkleekkeskf  271
            +KPE+L+AVLKETVDLENIPIEEVFENLRC+++GLTS+ A++RL IFG+NKLEEK+ESKF
Sbjct  5    DKPEMLEAVLKETVDLENIPIEEVFENLRCSREGLTSEGAEQRLTIFGYNKLEEKRESKF  64

Query  272  lkflgfMWNPLSWVMEaaaimaialaNGGGKPPDWQDFVGIITLLVINSTISFIEEnnag  451
            LKFLGFMWNPLSWVMEAAAIMAIALANGGGK PDWQDFVGIITLL+INSTISFIEENNAG
Sbjct  65   LKFLGFMWNPLSWVMEAAAIMAIALANGGGKAPDWQDFVGIITLLIINSTISFIEENNAG  124

Query  452  naaaalmarlapkaKVLRDG  511
            NAAAALMARLAPKAKVLRDG
Sbjct  125  NAAAALMARLAPKAKVLRDG  144



>ref|XP_003549657.1| PREDICTED: ATPase 11, plasma membrane-type-like [Glycine max]
 gb|KHN18516.1| ATPase 11, plasma membrane-type [Glycine soja]
Length=955

 Score =   160 bits (404),  Expect = 8e-42, Method: Compositional matrix adjust.
 Identities = 127/142 (89%), Positives = 136/142 (96%), Gaps = 0/142 (0%)
 Frame = +2

Query  86   MAEKPEVLDAVLKETVDLENIPIEEVFENLRCTKDGLTSQAAQERLDIFGHNkleekkes  265
            M +K +VL+AVLKETVDLENIPIEEV ENLRC ++GL+S+AA+ERL IFGHNKLEEKKES
Sbjct  1    MGDKSQVLEAVLKETVDLENIPIEEVLENLRCGREGLSSEAAEERLTIFGHNKLEEKKES  60

Query  266  kflkflgfMWNPLSWVMEaaaimaialaNGGGKPPDWQDFVGIITLLVINSTISFIEEnn  445
            KFLKFLGFMWNPLSWVMEAAAIMAIALANGGGK PDWQDFVGIITLL+INSTISFIEENN
Sbjct  61   KFLKFLGFMWNPLSWVMEAAAIMAIALANGGGKAPDWQDFVGIITLLLINSTISFIEENN  120

Query  446  agnaaaalmarlapkaKVLRDG  511
            AGNAAAALMARLAPKAKVLRDG
Sbjct  121  AGNAAAALMARLAPKAKVLRDG  142



>ref|XP_003525017.1| PREDICTED: ATPase 11, plasma membrane-type-like isoform 1 [Glycine 
max]
 gb|KHN48653.1| ATPase 11, plasma membrane-type [Glycine soja]
Length=955

 Score =   160 bits (404),  Expect = 8e-42, Method: Compositional matrix adjust.
 Identities = 127/142 (89%), Positives = 136/142 (96%), Gaps = 0/142 (0%)
 Frame = +2

Query  86   MAEKPEVLDAVLKETVDLENIPIEEVFENLRCTKDGLTSQAAQERLDIFGHNkleekkes  265
            M +K +VL+AVLKETVDLENIPIEEV ENLRC ++GL+S+AA+ERL IFGHNKLEEKKES
Sbjct  1    MGDKSQVLEAVLKETVDLENIPIEEVLENLRCGREGLSSEAAEERLTIFGHNKLEEKKES  60

Query  266  kflkflgfMWNPLSWVMEaaaimaialaNGGGKPPDWQDFVGIITLLVINSTISFIEEnn  445
            KFLKFLGFMWNPLSWVMEAAAIMAIALANGGGK PDWQDFVGIITLL+INSTISFIEENN
Sbjct  61   KFLKFLGFMWNPLSWVMEAAAIMAIALANGGGKAPDWQDFVGIITLLLINSTISFIEENN  120

Query  446  agnaaaalmarlapkaKVLRDG  511
            AGNAAAALMARLAPKAKVLRDG
Sbjct  121  AGNAAAALMARLAPKAKVLRDG  142



>gb|KGN52442.1| hypothetical protein Csa_5G635370 [Cucumis sativus]
Length=802

 Score =   159 bits (401),  Expect = 1e-41, Method: Composition-based stats.
 Identities = 100/118 (85%), Positives = 110/118 (93%), Gaps = 0/118 (0%)
 Frame = +2

Query  86   MAEKPEVLDAVLKETVDLENIPIEEVFENLRCTKDGLTSQAAQERLDIFGHNkleekkes  265
            M +K EVL+AV+KE VDLEN+P+EEVF+ LRC K+GLT++AA ERL IFGHNKLEEKKES
Sbjct  1    MGDKDEVLEAVVKEAVDLENVPLEEVFQTLRCNKNGLTTEAAHERLAIFGHNKLEEKKES  60

Query  266  kflkflgfMWNPLSWVMEaaaimaialaNGGGKPPDWQDFVGIITLLVINSTISFIEE  439
            K LKFLGFMWNPLSWVMEAAAIMAIALANGGGKPPDWQDFVGIITLL+INSTISFIEE
Sbjct  61   KLLKFLGFMWNPLSWVMEAAAIMAIALANGGGKPPDWQDFVGIITLLLINSTISFIEE  118



>ref|XP_010933786.1| PREDICTED: plasma membrane ATPase 3 [Elaeis guineensis]
Length=956

 Score =   159 bits (403),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 125/142 (88%), Positives = 134/142 (94%), Gaps = 0/142 (0%)
 Frame = +2

Query  86   MAEKPEVLDAVLKETVDLENIPIEEVFENLRCTKDGLTSQAAQERLDIFGHNkleekkes  265
            M +K   LDAVLKE VDLENIP+EEVF+NLRCT++GLT++ A+ERL IFGHNKLEEKKES
Sbjct  1    MGDKATNLDAVLKEVVDLENIPLEEVFDNLRCTREGLTTEQAEERLAIFGHNKLEEKKES  60

Query  266  kflkflgfMWNPLSWVMEaaaimaialaNGGGKPPDWQDFVGIITLLVINSTISFIEEnn  445
            K LKFLGFMWNPLSWVMEAAAIMAIALANGGGKPPDWQDFVGIITLL+INSTISFIEENN
Sbjct  61   KILKFLGFMWNPLSWVMEAAAIMAIALANGGGKPPDWQDFVGIITLLLINSTISFIEENN  120

Query  446  agnaaaalmarlapkaKVLRDG  511
            AGNAAAALMARLAPKAKVLRDG
Sbjct  121  AGNAAAALMARLAPKAKVLRDG  142



>ref|XP_004148685.1| PREDICTED: ATPase 11, plasma membrane-type-like [Cucumis sativus]
 ref|XP_004162585.1| PREDICTED: ATPase 11, plasma membrane-type-like [Cucumis sativus]
Length=956

 Score =   159 bits (403),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 123/142 (87%), Positives = 133/142 (94%), Gaps = 0/142 (0%)
 Frame = +2

Query  86   MAEKPEVLDAVLKETVDLENIPIEEVFENLRCTKDGLTSQAAQERLDIFGHNkleekkes  265
            M +K EVL+AV+KE VDLEN+P+EEVF+ LRC K+GLT++AA ERL IFGHNKLEEKKES
Sbjct  1    MGDKDEVLEAVVKEAVDLENVPLEEVFQTLRCNKNGLTTEAAHERLAIFGHNKLEEKKES  60

Query  266  kflkflgfMWNPLSWVMEaaaimaialaNGGGKPPDWQDFVGIITLLVINSTISFIEEnn  445
            K LKFLGFMWNPLSWVMEAAAIMAIALANGGGKPPDWQDFVGIITLL+INSTISFIEENN
Sbjct  61   KLLKFLGFMWNPLSWVMEAAAIMAIALANGGGKPPDWQDFVGIITLLLINSTISFIEENN  120

Query  446  agnaaaalmarlapkaKVLRDG  511
            AGNAAAALMA LAPKAKVLRDG
Sbjct  121  AGNAAAALMAHLAPKAKVLRDG  142



>ref|XP_008796652.1| PREDICTED: plasma membrane ATPase 3 isoform X1 [Phoenix dactylifera]
 ref|XP_008796653.1| PREDICTED: plasma membrane ATPase 3 isoform X2 [Phoenix dactylifera]
Length=956

 Score =   159 bits (402),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 125/142 (88%), Positives = 135/142 (95%), Gaps = 0/142 (0%)
 Frame = +2

Query  86   MAEKPEVLDAVLKETVDLENIPIEEVFENLRCTKDGLTSQAAQERLDIFGHNkleekkes  265
            M +K   L+AVLKE VDLENIP+EEVF+NLRCT++GLT++ A+ERL IFGHNKLEEKKES
Sbjct  1    MGDKAATLEAVLKEAVDLENIPLEEVFDNLRCTREGLTTEQAEERLAIFGHNKLEEKKES  60

Query  266  kflkflgfMWNPLSWVMEaaaimaialaNGGGKPPDWQDFVGIITLLVINSTISFIEEnn  445
            KFLKFLGFMWNPLSWVMEAAAIMAIALANGGGKPPDWQDFVGIITLL+INSTISFIEENN
Sbjct  61   KFLKFLGFMWNPLSWVMEAAAIMAIALANGGGKPPDWQDFVGIITLLLINSTISFIEENN  120

Query  446  agnaaaalmarlapkaKVLRDG  511
            AGNAAAALMARLAPKAKVLRDG
Sbjct  121  AGNAAAALMARLAPKAKVLRDG  142



>ref|XP_002442618.1| hypothetical protein SORBIDRAFT_08g023070 [Sorghum bicolor]
 gb|EES16456.1| hypothetical protein SORBIDRAFT_08g023070 [Sorghum bicolor]
Length=956

 Score =   159 bits (401),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 126/142 (89%), Positives = 136/142 (96%), Gaps = 0/142 (0%)
 Frame = +2

Query  86   MAEKPEVLDAVLKETVDLENIPIEEVFENLRCTKDGLTSQAAQERLDIFGHNkleekkes  265
            MAEK   L+AVLKE VDLENIP+EEVFENLRC+++GL++Q AQ+RL+IFG NKLEEK+ES
Sbjct  1    MAEKEGNLEAVLKEAVDLENIPLEEVFENLRCSREGLSTQQAQQRLEIFGPNKLEEKEES  60

Query  266  kflkflgfMWNPLSWVMEaaaimaialaNGGGKPPDWQDFVGIITLLVINSTISFIEEnn  445
            KFLKFLGFMWNPLSWVMEAAAIMAIALANGGGKPPDWQDFVGIITLLVINSTISFIEENN
Sbjct  61   KFLKFLGFMWNPLSWVMEAAAIMAIALANGGGKPPDWQDFVGIITLLVINSTISFIEENN  120

Query  446  agnaaaalmarlapkaKVLRDG  511
            AGNAAAALMARLAPKAKVLRDG
Sbjct  121  AGNAAAALMARLAPKAKVLRDG  142



>ref|XP_009398401.1| PREDICTED: plasma membrane ATPase 1 isoform X2 [Musa acuminata 
subsp. malaccensis]
Length=961

 Score =   159 bits (401),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 123/135 (91%), Positives = 131/135 (97%), Gaps = 0/135 (0%)
 Frame = +2

Query  107  LDAVLKETVDLENIPIEEVFENLRCTKDGLTSQAAQERLDIFGHNkleekkeskflkflg  286
            +DA+LKE VDLENIP+EEVFENLRCT++GLT+Q A+ERL IFGHNKLEEKKESK LKFLG
Sbjct  13   MDALLKEAVDLENIPLEEVFENLRCTREGLTTQQAEERLAIFGHNKLEEKKESKILKFLG  72

Query  287  fMWNPLSWVMEaaaimaialaNGGGKPPDWQDFVGIITLLVINSTISFIEEnnagnaaaa  466
            FMWNPLSWVMEAAA+MAIALANGGGKPPDWQDFVGIITLLVINSTISFIEENNAGNAAAA
Sbjct  73   FMWNPLSWVMEAAAVMAIALANGGGKPPDWQDFVGIITLLVINSTISFIEENNAGNAAAA  132

Query  467  lmarlapkaKVLRDG  511
            LMARLAPKAKVLRDG
Sbjct  133  LMARLAPKAKVLRDG  147



>ref|XP_009398402.1| PREDICTED: plasma membrane ATPase 1-like [Musa acuminata subsp. 
malaccensis]
Length=961

 Score =   159 bits (401),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 123/135 (91%), Positives = 131/135 (97%), Gaps = 0/135 (0%)
 Frame = +2

Query  107  LDAVLKETVDLENIPIEEVFENLRCTKDGLTSQAAQERLDIFGHNkleekkeskflkflg  286
            +DA+LKE VDLENIP+EEVFENLRCT++GLT+Q A+ERL IFGHNKLEEKKESK LKFLG
Sbjct  13   MDALLKEAVDLENIPLEEVFENLRCTREGLTTQQAEERLAIFGHNKLEEKKESKILKFLG  72

Query  287  fMWNPLSWVMEaaaimaialaNGGGKPPDWQDFVGIITLLVINSTISFIEEnnagnaaaa  466
            FMWNPLSWVMEAAA+MAIALANGGGKPPDWQDFVGIITLLVINSTISFIEENNAGNAAAA
Sbjct  73   FMWNPLSWVMEAAAVMAIALANGGGKPPDWQDFVGIITLLVINSTISFIEENNAGNAAAA  132

Query  467  lmarlapkaKVLRDG  511
            LMARLAPKAKVLRDG
Sbjct  133  LMARLAPKAKVLRDG  147



>ref|XP_007032427.1| H(+)-ATPase 4 isoform 1 [Theobroma cacao]
 gb|EOY03353.1| H(+)-ATPase 4 isoform 1 [Theobroma cacao]
Length=994

 Score =   158 bits (399),  Expect = 4e-41, Method: Composition-based stats.
 Identities = 122/142 (86%), Positives = 130/142 (92%), Gaps = 0/142 (0%)
 Frame = +2

Query  86   MAEKPEVLDAVLKETVDLENIPIEEVFENLRCTKDGLTSQAAQERLDIFGHNkleekkes  265
            M    E LDAVLKE VDLEN+P+EEVF+ LRC KDGLT++AA++RL IFG+NKLEEKKES
Sbjct  1    MENNNETLDAVLKEAVDLENVPLEEVFQTLRCNKDGLTTEAAEQRLAIFGYNKLEEKKES  60

Query  266  kflkflgfMWNPLSWVMEaaaimaialaNGGGKPPDWQDFVGIITLLVINSTISFIEEnn  445
            K LKFLGFMWNPLSWVMEAAAIMAIALANGGGKPPDWQDFVGIITLL INSTISFIEENN
Sbjct  61   KILKFLGFMWNPLSWVMEAAAIMAIALANGGGKPPDWQDFVGIITLLFINSTISFIEENN  120

Query  446  agnaaaalmarlapkaKVLRDG  511
            AGNAAAALMARLAPKAKV RDG
Sbjct  121  AGNAAAALMARLAPKAKVFRDG  142



>tpg|DAA54787.1| TPA: hypothetical protein ZEAMMB73_074525 [Zea mays]
Length=812

 Score =   157 bits (397),  Expect = 5e-41, Method: Compositional matrix adjust.
 Identities = 125/142 (88%), Positives = 136/142 (96%), Gaps = 0/142 (0%)
 Frame = +2

Query  86   MAEKPEVLDAVLKETVDLENIPIEEVFENLRCTKDGLTSQAAQERLDIFGHNkleekkes  265
            MAEK   L+AVLKE VDLENIP+EEVFENLRC+++GL+++ AQ+RL+IFG NKLEEK+ES
Sbjct  1    MAEKEGNLEAVLKEAVDLENIPLEEVFENLRCSREGLSTEQAQQRLEIFGPNKLEEKEES  60

Query  266  kflkflgfMWNPLSWVMEaaaimaialaNGGGKPPDWQDFVGIITLLVINSTISFIEEnn  445
            KFLKFLGFMWNPLSWVMEAAAIMAIALANGGGKPPDWQDFVGIITLLVINSTISFIEENN
Sbjct  61   KFLKFLGFMWNPLSWVMEAAAIMAIALANGGGKPPDWQDFVGIITLLVINSTISFIEENN  120

Query  446  agnaaaalmarlapkaKVLRDG  511
            AGNAAAALMARLAPKAKVLRDG
Sbjct  121  AGNAAAALMARLAPKAKVLRDG  142



>gb|KHG14131.1| ATPase 4, plasma membrane-type -like protein [Gossypium arboreum]
Length=721

 Score =   156 bits (394),  Expect = 5e-41, Method: Composition-based stats.
 Identities = 97/118 (82%), Positives = 109/118 (92%), Gaps = 0/118 (0%)
 Frame = +2

Query  86   MAEKPEVLDAVLKETVDLENIPIEEVFENLRCTKDGLTSQAAQERLDIFGHNkleekkes  265
            M  K E LDAVLKE VDLEN+P+EEV++ LRC +DGLT++AA++RL IFG+NKLEEK+ES
Sbjct  1    MENKDETLDAVLKEAVDLENVPLEEVYQTLRCNRDGLTTEAAEQRLSIFGYNKLEEKQES  60

Query  266  kflkflgfMWNPLSWVMEaaaimaialaNGGGKPPDWQDFVGIITLLVINSTISFIEE  439
            K LKFLGFMWNPLSWVMEAAAIMAIALANGGGKPPDWQDFVGIITLL+INSTISFIEE
Sbjct  61   KILKFLGFMWNPLSWVMEAAAIMAIALANGGGKPPDWQDFVGIITLLIINSTISFIEE  118



>ref|XP_007151191.1| hypothetical protein PHAVU_004G025700g [Phaseolus vulgaris]
 gb|ESW23185.1| hypothetical protein PHAVU_004G025700g [Phaseolus vulgaris]
Length=956

 Score =   157 bits (398),  Expect = 5e-41, Method: Compositional matrix adjust.
 Identities = 121/142 (85%), Positives = 133/142 (94%), Gaps = 0/142 (0%)
 Frame = +2

Query  86   MAEKPEVLDAVLKETVDLENIPIEEVFENLRCTKDGLTSQAAQERLDIFGHNkleekkes  265
            MA+K E + AVLKE VDLEN+P+EEVF+ LRC  +GLT+++A+ERL IFGHNKLEEK+ES
Sbjct  1    MADKEEAMHAVLKEAVDLENVPLEEVFQTLRCDSNGLTTKSAEERLSIFGHNKLEEKQES  60

Query  266  kflkflgfMWNPLSWVMEaaaimaialaNGGGKPPDWQDFVGIITLLVINSTISFIEEnn  445
            K LKFLGFMWNPLSWVMEAAAIMAIALANGGGKPPDWQDFVGIITLL+INSTISFIEENN
Sbjct  61   KVLKFLGFMWNPLSWVMEAAAIMAIALANGGGKPPDWQDFVGIITLLIINSTISFIEENN  120

Query  446  agnaaaalmarlapkaKVLRDG  511
            AGNAAAALMARLAPKAKVLRDG
Sbjct  121  AGNAAAALMARLAPKAKVLRDG  142



>gb|KHN13245.1| Plasma membrane ATPase 1 [Glycine soja]
Length=956

 Score =   157 bits (398),  Expect = 5e-41, Method: Compositional matrix adjust.
 Identities = 121/142 (85%), Positives = 132/142 (93%), Gaps = 0/142 (0%)
 Frame = +2

Query  86   MAEKPEVLDAVLKETVDLENIPIEEVFENLRCTKDGLTSQAAQERLDIFGHNkleekkes  265
            MAEK E + AVLKE VDLEN+P+EEVF+ LRC  +GLT+++A+ERL IFGHNKLEEKKES
Sbjct  1    MAEKEEAMHAVLKEAVDLENVPLEEVFQTLRCDSNGLTTESAEERLVIFGHNKLEEKKES  60

Query  266  kflkflgfMWNPLSWVMEaaaimaialaNGGGKPPDWQDFVGIITLLVINSTISFIEEnn  445
            K LKFLGFMWNPLSWVMEAAAIM+IALANGGGKPPDWQDFVGIITLL+INSTISFIEENN
Sbjct  61   KVLKFLGFMWNPLSWVMEAAAIMSIALANGGGKPPDWQDFVGIITLLIINSTISFIEENN  120

Query  446  agnaaaalmarlapkaKVLRDG  511
            AGNAAAALMARLAPKAK LRDG
Sbjct  121  AGNAAAALMARLAPKAKFLRDG  142



>ref|XP_003561110.1| PREDICTED: plasma membrane ATPase 1-like [Brachypodium distachyon]
Length=956

 Score =   157 bits (397),  Expect = 7e-41, Method: Compositional matrix adjust.
 Identities = 126/142 (89%), Positives = 134/142 (94%), Gaps = 0/142 (0%)
 Frame = +2

Query  86   MAEKPEVLDAVLKETVDLENIPIEEVFENLRCTKDGLTSQAAQERLDIFGHNkleekkes  265
            MA+K   LDAVLKE VDLENIP++EVFENLRC ++GLTSQ AQ+RL IFG NKLEEK+ES
Sbjct  1    MADKEGNLDAVLKEVVDLENIPVDEVFENLRCGREGLTSQQAQQRLQIFGPNKLEEKEES  60

Query  266  kflkflgfMWNPLSWVMEaaaimaialaNGGGKPPDWQDFVGIITLLVINSTISFIEEnn  445
            KFLKFLGFMWNPLSWVMEAAAIMAIALANGGGKPPDWQDFVGIITLL+INSTISFIEENN
Sbjct  61   KFLKFLGFMWNPLSWVMEAAAIMAIALANGGGKPPDWQDFVGIITLLLINSTISFIEENN  120

Query  446  agnaaaalmarlapkaKVLRDG  511
            AGNAAAALMARLAPKAKVLRDG
Sbjct  121  AGNAAAALMARLAPKAKVLRDG  142



>ref|XP_008673350.1| PREDICTED: uncharacterized protein LOC100502231 isoform X1 [Zea 
mays]
 tpg|DAA54786.1| TPA: hypothetical protein ZEAMMB73_074525 [Zea mays]
Length=956

 Score =   157 bits (397),  Expect = 7e-41, Method: Compositional matrix adjust.
 Identities = 125/142 (88%), Positives = 136/142 (96%), Gaps = 0/142 (0%)
 Frame = +2

Query  86   MAEKPEVLDAVLKETVDLENIPIEEVFENLRCTKDGLTSQAAQERLDIFGHNkleekkes  265
            MAEK   L+AVLKE VDLENIP+EEVFENLRC+++GL+++ AQ+RL+IFG NKLEEK+ES
Sbjct  1    MAEKEGNLEAVLKEAVDLENIPLEEVFENLRCSREGLSTEQAQQRLEIFGPNKLEEKEES  60

Query  266  kflkflgfMWNPLSWVMEaaaimaialaNGGGKPPDWQDFVGIITLLVINSTISFIEEnn  445
            KFLKFLGFMWNPLSWVMEAAAIMAIALANGGGKPPDWQDFVGIITLLVINSTISFIEENN
Sbjct  61   KFLKFLGFMWNPLSWVMEAAAIMAIALANGGGKPPDWQDFVGIITLLVINSTISFIEENN  120

Query  446  agnaaaalmarlapkaKVLRDG  511
            AGNAAAALMARLAPKAKVLRDG
Sbjct  121  AGNAAAALMARLAPKAKVLRDG  142



>ref|XP_008459294.1| PREDICTED: ATPase 11, plasma membrane-type-like [Cucumis melo]
Length=956

 Score =   156 bits (395),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 122/142 (86%), Positives = 132/142 (93%), Gaps = 0/142 (0%)
 Frame = +2

Query  86   MAEKPEVLDAVLKETVDLENIPIEEVFENLRCTKDGLTSQAAQERLDIFGHNkleekkes  265
            M +K EVL+AV+KE VDLEN+P+EEVF+ LRC K+GLT++AA ERL IFG NKLEEKKES
Sbjct  1    MGDKDEVLEAVVKEAVDLENVPLEEVFQTLRCNKNGLTTEAAHERLAIFGQNKLEEKKES  60

Query  266  kflkflgfMWNPLSWVMEaaaimaialaNGGGKPPDWQDFVGIITLLVINSTISFIEEnn  445
            K LKFLGFMWNPLSWVMEAAAIMAIALANGGGKPPDWQDFVGIITLL+INSTISFIEENN
Sbjct  61   KVLKFLGFMWNPLSWVMEAAAIMAIALANGGGKPPDWQDFVGIITLLLINSTISFIEENN  120

Query  446  agnaaaalmarlapkaKVLRDG  511
            AGNAAAALMA LAPKAKVLRDG
Sbjct  121  AGNAAAALMAHLAPKAKVLRDG  142



>gb|KJB33644.1| hypothetical protein B456_006G023600 [Gossypium raimondii]
Length=811

 Score =   155 bits (392),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 120/142 (85%), Positives = 131/142 (92%), Gaps = 0/142 (0%)
 Frame = +2

Query  86   MAEKPEVLDAVLKETVDLENIPIEEVFENLRCTKDGLTSQAAQERLDIFGHNkleekkes  265
            M  K E +DAVLKE VDLEN+P+EEVF+ LRC +DGLT++AA++RL IFG+NKLEEK+ES
Sbjct  1    MENKDETMDAVLKEAVDLENVPLEEVFQTLRCNRDGLTTEAAEQRLSIFGYNKLEEKQES  60

Query  266  kflkflgfMWNPLSWVMEaaaimaialaNGGGKPPDWQDFVGIITLLVINSTISFIEEnn  445
            K LKFLGFMWNPLSWVMEAAAIMAIALANGGGKPPDWQDFVGIITLL INSTISFIEENN
Sbjct  61   KILKFLGFMWNPLSWVMEAAAIMAIALANGGGKPPDWQDFVGIITLLTINSTISFIEENN  120

Query  446  agnaaaalmarlapkaKVLRDG  511
            AGNAAAALMARLAPKAKV RDG
Sbjct  121  AGNAAAALMARLAPKAKVFRDG  142



>ref|XP_004982139.1| PREDICTED: plasma membrane ATPase 1-like [Setaria italica]
Length=954

 Score =   155 bits (393),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 126/142 (89%), Positives = 133/142 (94%), Gaps = 0/142 (0%)
 Frame = +2

Query  86   MAEKPEVLDAVLKETVDLENIPIEEVFENLRCTKDGLTSQAAQERLDIFGHNkleekkes  265
            MA+K   LDAVLKE VDLENIP+EEVFENLRC+  GLTS+ AQ+RL IFG NKLEEK+ES
Sbjct  1    MADKEGNLDAVLKEAVDLENIPLEEVFENLRCSHGGLTSEQAQQRLQIFGPNKLEEKEES  60

Query  266  kflkflgfMWNPLSWVMEaaaimaialaNGGGKPPDWQDFVGIITLLVINSTISFIEEnn  445
            KFLKFLGFMWNPLSWVMEAAAIMAIALANGGGKPPDWQDFVGIITLL+INSTISFIEENN
Sbjct  61   KFLKFLGFMWNPLSWVMEAAAIMAIALANGGGKPPDWQDFVGIITLLLINSTISFIEENN  120

Query  446  agnaaaalmarlapkaKVLRDG  511
            AGNAAAALMARLAPKAKVLRDG
Sbjct  121  AGNAAAALMARLAPKAKVLRDG  142



>gb|KJB33641.1| hypothetical protein B456_006G023600 [Gossypium raimondii]
Length=956

 Score =   155 bits (393),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 120/142 (85%), Positives = 131/142 (92%), Gaps = 0/142 (0%)
 Frame = +2

Query  86   MAEKPEVLDAVLKETVDLENIPIEEVFENLRCTKDGLTSQAAQERLDIFGHNkleekkes  265
            M  K E +DAVLKE VDLEN+P+EEVF+ LRC +DGLT++AA++RL IFG+NKLEEK+ES
Sbjct  1    MENKDETMDAVLKEAVDLENVPLEEVFQTLRCNRDGLTTEAAEQRLSIFGYNKLEEKQES  60

Query  266  kflkflgfMWNPLSWVMEaaaimaialaNGGGKPPDWQDFVGIITLLVINSTISFIEEnn  445
            K LKFLGFMWNPLSWVMEAAAIMAIALANGGGKPPDWQDFVGIITLL INSTISFIEENN
Sbjct  61   KILKFLGFMWNPLSWVMEAAAIMAIALANGGGKPPDWQDFVGIITLLTINSTISFIEENN  120

Query  446  agnaaaalmarlapkaKVLRDG  511
            AGNAAAALMARLAPKAKV RDG
Sbjct  121  AGNAAAALMARLAPKAKVFRDG  142



>gb|KJB33642.1| hypothetical protein B456_006G023600 [Gossypium raimondii]
Length=946

 Score =   155 bits (393),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 120/142 (85%), Positives = 131/142 (92%), Gaps = 0/142 (0%)
 Frame = +2

Query  86   MAEKPEVLDAVLKETVDLENIPIEEVFENLRCTKDGLTSQAAQERLDIFGHNkleekkes  265
            M  K E +DAVLKE VDLEN+P+EEVF+ LRC +DGLT++AA++RL IFG+NKLEEK+ES
Sbjct  1    MENKDETMDAVLKEAVDLENVPLEEVFQTLRCNRDGLTTEAAEQRLSIFGYNKLEEKQES  60

Query  266  kflkflgfMWNPLSWVMEaaaimaialaNGGGKPPDWQDFVGIITLLVINSTISFIEEnn  445
            K LKFLGFMWNPLSWVMEAAAIMAIALANGGGKPPDWQDFVGIITLL INSTISFIEENN
Sbjct  61   KILKFLGFMWNPLSWVMEAAAIMAIALANGGGKPPDWQDFVGIITLLTINSTISFIEENN  120

Query  446  agnaaaalmarlapkaKVLRDG  511
            AGNAAAALMARLAPKAKV RDG
Sbjct  121  AGNAAAALMARLAPKAKVFRDG  142



>ref|XP_006482527.1| PREDICTED: plasma membrane ATPase 1-like [Citrus sinensis]
Length=956

 Score =   155 bits (392),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 119/142 (84%), Positives = 132/142 (93%), Gaps = 0/142 (0%)
 Frame = +2

Query  86   MAEKPEVLDAVLKETVDLENIPIEEVFENLRCTKDGLTSQAAQERLDIFGHNkleekkes  265
            M  K E ++AVLKE VDLEN+P+EEVFE LRC K+GL+++AA+ERL IFG+NKLEEK+ES
Sbjct  1    MDSKAETMEAVLKEAVDLENVPMEEVFETLRCNKEGLSTEAAEERLTIFGYNKLEEKQES  60

Query  266  kflkflgfMWNPLSWVMEaaaimaialaNGGGKPPDWQDFVGIITLLVINSTISFIEEnn  445
            K LKFLGFMWNPLSWVMEAAAIMAIALANGGGKPPDWQDFVGIITLL+INSTISFIEENN
Sbjct  61   KILKFLGFMWNPLSWVMEAAAIMAIALANGGGKPPDWQDFVGIITLLLINSTISFIEENN  120

Query  446  agnaaaalmarlapkaKVLRDG  511
            AGNAAAALMA LAPK+KVLRDG
Sbjct  121  AGNAAAALMASLAPKSKVLRDG  142



>ref|XP_008644894.1| PREDICTED: uncharacterized protein LOC100383411 isoform X1 [Zea 
mays]
Length=954

 Score =   155 bits (392),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 124/142 (87%), Positives = 133/142 (94%), Gaps = 0/142 (0%)
 Frame = +2

Query  86   MAEKPEVLDAVLKETVDLENIPIEEVFENLRCTKDGLTSQAAQERLDIFGHNkleekkes  265
            MA+    LDAVLKE VDLENIP+EEVFENLRC++ GLTS+ AQ+RL +FG NKLEEK+ES
Sbjct  1    MADNEGTLDAVLKEAVDLENIPLEEVFENLRCSRGGLTSEQAQQRLQLFGPNKLEEKEES  60

Query  266  kflkflgfMWNPLSWVMEaaaimaialaNGGGKPPDWQDFVGIITLLVINSTISFIEEnn  445
            KFLKFLGFMWNPLSWVMEAAAIMAIALANGGGKPPDWQDFVGIITLL+INSTISFIEENN
Sbjct  61   KFLKFLGFMWNPLSWVMEAAAIMAIALANGGGKPPDWQDFVGIITLLLINSTISFIEENN  120

Query  446  agnaaaalmarlapkaKVLRDG  511
            AGNAAAALMARLAPKAKVLRDG
Sbjct  121  AGNAAAALMARLAPKAKVLRDG  142



>gb|KJB33643.1| hypothetical protein B456_006G023600 [Gossypium raimondii]
Length=871

 Score =   155 bits (391),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 120/142 (85%), Positives = 131/142 (92%), Gaps = 0/142 (0%)
 Frame = +2

Query  86   MAEKPEVLDAVLKETVDLENIPIEEVFENLRCTKDGLTSQAAQERLDIFGHNkleekkes  265
            M  K E +DAVLKE VDLEN+P+EEVF+ LRC +DGLT++AA++RL IFG+NKLEEK+ES
Sbjct  1    MENKDETMDAVLKEAVDLENVPLEEVFQTLRCNRDGLTTEAAEQRLSIFGYNKLEEKQES  60

Query  266  kflkflgfMWNPLSWVMEaaaimaialaNGGGKPPDWQDFVGIITLLVINSTISFIEEnn  445
            K LKFLGFMWNPLSWVMEAAAIMAIALANGGGKPPDWQDFVGIITLL INSTISFIEENN
Sbjct  61   KILKFLGFMWNPLSWVMEAAAIMAIALANGGGKPPDWQDFVGIITLLTINSTISFIEENN  120

Query  446  agnaaaalmarlapkaKVLRDG  511
            AGNAAAALMARLAPKAKV RDG
Sbjct  121  AGNAAAALMARLAPKAKVFRDG  142



>ref|XP_010029279.1| PREDICTED: ATPase 11, plasma membrane-type-like [Eucalyptus grandis]
 ref|XP_010029280.1| PREDICTED: ATPase 11, plasma membrane-type-like [Eucalyptus grandis]
 gb|KCW56160.1| hypothetical protein EUGRSUZ_I01911 [Eucalyptus grandis]
Length=954

 Score =   155 bits (391),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 123/142 (87%), Positives = 131/142 (92%), Gaps = 0/142 (0%)
 Frame = +2

Query  86   MAEKPEVLDAVLKETVDLENIPIEEVFENLRCTKDGLTSQAAQERLDIFGHNkleekkes  265
            M +K   L+AVLKE VDLEN+PI EVF+ LRC  +GLTS+AAQERL IFGHNKLEEK+ES
Sbjct  1    MGDKDVTLEAVLKEAVDLENVPIAEVFQTLRCQPNGLTSEAAQERLAIFGHNKLEEKEES  60

Query  266  kflkflgfMWNPLSWVMEaaaimaialaNGGGKPPDWQDFVGIITLLVINSTISFIEEnn  445
            KFLKFLGFMWNPLSWVMEAAAIMAIA+ANGGGKPPDWQDFVGIITLL INSTISFIEENN
Sbjct  61   KFLKFLGFMWNPLSWVMEAAAIMAIAMANGGGKPPDWQDFVGIITLLFINSTISFIEENN  120

Query  446  agnaaaalmarlapkaKVLRDG  511
            AGNAAAALMARLAPKAKVLRDG
Sbjct  121  AGNAAAALMARLAPKAKVLRDG  142



>gb|KCW56159.1| hypothetical protein EUGRSUZ_I01911 [Eucalyptus grandis]
Length=963

 Score =   155 bits (391),  Expect = 5e-40, Method: Compositional matrix adjust.
 Identities = 123/142 (87%), Positives = 131/142 (92%), Gaps = 0/142 (0%)
 Frame = +2

Query  86   MAEKPEVLDAVLKETVDLENIPIEEVFENLRCTKDGLTSQAAQERLDIFGHNkleekkes  265
            M +K   L+AVLKE VDLEN+PI EVF+ LRC  +GLTS+AAQERL IFGHNKLEEK+ES
Sbjct  1    MGDKDVTLEAVLKEAVDLENVPIAEVFQTLRCQPNGLTSEAAQERLAIFGHNKLEEKEES  60

Query  266  kflkflgfMWNPLSWVMEaaaimaialaNGGGKPPDWQDFVGIITLLVINSTISFIEEnn  445
            KFLKFLGFMWNPLSWVMEAAAIMAIA+ANGGGKPPDWQDFVGIITLL INSTISFIEENN
Sbjct  61   KFLKFLGFMWNPLSWVMEAAAIMAIAMANGGGKPPDWQDFVGIITLLFINSTISFIEENN  120

Query  446  agnaaaalmarlapkaKVLRDG  511
            AGNAAAALMARLAPKAKVLRDG
Sbjct  121  AGNAAAALMARLAPKAKVLRDG  142



>gb|KDO72462.1| hypothetical protein CISIN_1g0021762mg, partial [Citrus sinensis]
 gb|KDO72463.1| hypothetical protein CISIN_1g0021762mg, partial [Citrus sinensis]
Length=924

 Score =   154 bits (390),  Expect = 5e-40, Method: Compositional matrix adjust.
 Identities = 118/142 (83%), Positives = 132/142 (93%), Gaps = 0/142 (0%)
 Frame = +2

Query  86   MAEKPEVLDAVLKETVDLENIPIEEVFENLRCTKDGLTSQAAQERLDIFGHNkleekkes  265
            M  K E ++AVLKE VDLEN+P+EEVFE LRC K+GL+++AA+ERL IFG+NKLEEK+ES
Sbjct  1    MDSKAETMEAVLKEAVDLENVPMEEVFETLRCNKEGLSTEAAEERLTIFGYNKLEEKQES  60

Query  266  kflkflgfMWNPLSWVMEaaaimaialaNGGGKPPDWQDFVGIITLLVINSTISFIEEnn  445
            K LKFLGFMWNPLSWVMEAAAIMAIALANGGGKPPDWQDFVGI+TLL+INSTISFIEENN
Sbjct  61   KILKFLGFMWNPLSWVMEAAAIMAIALANGGGKPPDWQDFVGIVTLLLINSTISFIEENN  120

Query  446  agnaaaalmarlapkaKVLRDG  511
            AGNAAAALMA LAPK+KVLRDG
Sbjct  121  AGNAAAALMASLAPKSKVLRDG  142



>gb|KDP45466.1| hypothetical protein JCGZ_09715 [Jatropha curcas]
Length=956

 Score =   155 bits (391),  Expect = 5e-40, Method: Compositional matrix adjust.
 Identities = 122/141 (87%), Positives = 133/141 (94%), Gaps = 0/141 (0%)
 Frame = +2

Query  86   MAEKPEVLDAVLKETVDLENIPIEEVFENLRCTKDGLTSQAAQERLDIFGHNkleekkes  265
            M EK E L+AVLKE VDLEN+PIEEVF+ LRC  +GLT++AA++RL IFG+NKLEEK+ES
Sbjct  1    MVEKAETLEAVLKEVVDLENVPIEEVFQTLRCNSNGLTTEAAEQRLTIFGYNKLEEKQES  60

Query  266  kflkflgfMWNPLSWVMEaaaimaialaNGGGKPPDWQDFVGIITLLVINSTISFIEEnn  445
            KFLKFLGFMWNPLSWVMEAAAIMAIALANGGGKPPDWQDFVGIITLL+INSTISFIEENN
Sbjct  61   KFLKFLGFMWNPLSWVMEAAAIMAIALANGGGKPPDWQDFVGIITLLLINSTISFIEENN  120

Query  446  agnaaaalmarlapkaKVLRD  508
            AGNAAAALMARLAPKAKVLRD
Sbjct  121  AGNAAAALMARLAPKAKVLRD  141



>ref|XP_006431062.1| hypothetical protein CICLE_v10011000mg [Citrus clementina]
 gb|ESR44302.1| hypothetical protein CICLE_v10011000mg [Citrus clementina]
Length=956

 Score =   155 bits (391),  Expect = 5e-40, Method: Compositional matrix adjust.
 Identities = 118/142 (83%), Positives = 132/142 (93%), Gaps = 0/142 (0%)
 Frame = +2

Query  86   MAEKPEVLDAVLKETVDLENIPIEEVFENLRCTKDGLTSQAAQERLDIFGHNkleekkes  265
            M  K E ++AVLKE VDLEN+P+EEVFE LRC K+GL+++AA+ERL IFG+NKLEEK+ES
Sbjct  1    MDSKAETMEAVLKEAVDLENVPMEEVFETLRCNKEGLSTEAAEERLTIFGYNKLEEKQES  60

Query  266  kflkflgfMWNPLSWVMEaaaimaialaNGGGKPPDWQDFVGIITLLVINSTISFIEEnn  445
            K LKFLGFMWNPLSWVMEAAAIMAIALANGGGKPPDWQDFVGI+TLL+INSTISFIEENN
Sbjct  61   KILKFLGFMWNPLSWVMEAAAIMAIALANGGGKPPDWQDFVGIVTLLLINSTISFIEENN  120

Query  446  agnaaaalmarlapkaKVLRDG  511
            AGNAAAALMA LAPK+KVLRDG
Sbjct  121  AGNAAAALMASLAPKSKVLRDG  142



>ref|XP_003554288.1| PREDICTED: plasma membrane ATPase 1-like [Glycine max]
Length=956

 Score =   154 bits (390),  Expect = 6e-40, Method: Compositional matrix adjust.
 Identities = 121/142 (85%), Positives = 131/142 (92%), Gaps = 0/142 (0%)
 Frame = +2

Query  86   MAEKPEVLDAVLKETVDLENIPIEEVFENLRCTKDGLTSQAAQERLDIFGHNkleekkes  265
            MAEK E +  VLKE VDLEN+P+EEVF+ LRC  +GLT+++A+ERL IFGHNKLEEKKES
Sbjct  1    MAEKEEAMRVVLKEAVDLENVPLEEVFQTLRCDSNGLTTESAEERLAIFGHNKLEEKKES  60

Query  266  kflkflgfMWNPLSWVMEaaaimaialaNGGGKPPDWQDFVGIITLLVINSTISFIEEnn  445
            K LKFLGFMWNPLSWVMEAAAIMAIALANGGGKPPDWQDFVGIITLL+INSTISFIEENN
Sbjct  61   KVLKFLGFMWNPLSWVMEAAAIMAIALANGGGKPPDWQDFVGIITLLIINSTISFIEENN  120

Query  446  agnaaaalmarlapkaKVLRDG  511
            AGNAAAALMARLAPKAK LRDG
Sbjct  121  AGNAAAALMARLAPKAKFLRDG  142



>gb|KHN34200.1| ATPase 11, plasma membrane-type [Glycine soja]
Length=956

 Score =   154 bits (390),  Expect = 6e-40, Method: Compositional matrix adjust.
 Identities = 121/142 (85%), Positives = 131/142 (92%), Gaps = 0/142 (0%)
 Frame = +2

Query  86   MAEKPEVLDAVLKETVDLENIPIEEVFENLRCTKDGLTSQAAQERLDIFGHNkleekkes  265
            MAEK E +  VLKE VDLEN+P+EEVF+ LRC  +GLT+++A+ERL IFGHNKLEEKKES
Sbjct  1    MAEKEEAMRVVLKEAVDLENVPLEEVFQTLRCDSNGLTTESAEERLAIFGHNKLEEKKES  60

Query  266  kflkflgfMWNPLSWVMEaaaimaialaNGGGKPPDWQDFVGIITLLVINSTISFIEEnn  445
            K LKFLGFMWNPLSWVMEAAAIMAIALANGGGKPPDWQDFVGIITLL+INSTISFIEENN
Sbjct  61   KVLKFLGFMWNPLSWVMEAAAIMAIALANGGGKPPDWQDFVGIITLLIINSTISFIEENN  120

Query  446  agnaaaalmarlapkaKVLRDG  511
            AGNAAAALMARLAPKAK LRDG
Sbjct  121  AGNAAAALMARLAPKAKFLRDG  142



>gb|KDO72464.1| hypothetical protein CISIN_1g0021762mg [Citrus sinensis]
Length=875

 Score =   154 bits (389),  Expect = 7e-40, Method: Compositional matrix adjust.
 Identities = 118/142 (83%), Positives = 132/142 (93%), Gaps = 0/142 (0%)
 Frame = +2

Query  86   MAEKPEVLDAVLKETVDLENIPIEEVFENLRCTKDGLTSQAAQERLDIFGHNkleekkes  265
            M  K E ++AVLKE VDLEN+P+EEVFE LRC K+GL+++AA+ERL IFG+NKLEEK+ES
Sbjct  1    MDSKAETMEAVLKEAVDLENVPMEEVFETLRCNKEGLSTEAAEERLTIFGYNKLEEKQES  60

Query  266  kflkflgfMWNPLSWVMEaaaimaialaNGGGKPPDWQDFVGIITLLVINSTISFIEEnn  445
            K LKFLGFMWNPLSWVMEAAAIMAIALANGGGKPPDWQDFVGI+TLL+INSTISFIEENN
Sbjct  61   KILKFLGFMWNPLSWVMEAAAIMAIALANGGGKPPDWQDFVGIVTLLLINSTISFIEENN  120

Query  446  agnaaaalmarlapkaKVLRDG  511
            AGNAAAALMA LAPK+KVLRDG
Sbjct  121  AGNAAAALMASLAPKSKVLRDG  142



>ref|XP_007032428.1| H(+)-ATPase 4 isoform 2 [Theobroma cacao]
 gb|EOY03354.1| H(+)-ATPase 4 isoform 2 [Theobroma cacao]
Length=956

 Score =   154 bits (390),  Expect = 7e-40, Method: Compositional matrix adjust.
 Identities = 122/142 (86%), Positives = 130/142 (92%), Gaps = 0/142 (0%)
 Frame = +2

Query  86   MAEKPEVLDAVLKETVDLENIPIEEVFENLRCTKDGLTSQAAQERLDIFGHNkleekkes  265
            M    E LDAVLKE VDLEN+P+EEVF+ LRC KDGLT++AA++RL IFG+NKLEEKKES
Sbjct  1    MENNNETLDAVLKEAVDLENVPLEEVFQTLRCNKDGLTTEAAEQRLAIFGYNKLEEKKES  60

Query  266  kflkflgfMWNPLSWVMEaaaimaialaNGGGKPPDWQDFVGIITLLVINSTISFIEEnn  445
            K LKFLGFMWNPLSWVMEAAAIMAIALANGGGKPPDWQDFVGIITLL INSTISFIEENN
Sbjct  61   KILKFLGFMWNPLSWVMEAAAIMAIALANGGGKPPDWQDFVGIITLLFINSTISFIEENN  120

Query  446  agnaaaalmarlapkaKVLRDG  511
            AGNAAAALMARLAPKAKV RDG
Sbjct  121  AGNAAAALMARLAPKAKVFRDG  142



>gb|KEH24964.1| plasma membrane H+-ATPase [Medicago truncatula]
Length=956

 Score =   154 bits (389),  Expect = 8e-40, Method: Compositional matrix adjust.
 Identities = 122/142 (86%), Positives = 132/142 (93%), Gaps = 0/142 (0%)
 Frame = +2

Query  86   MAEKPEVLDAVLKETVDLENIPIEEVFENLRCTKDGLTSQAAQERLDIFGHNkleekkes  265
            MA+K E + AVL E VDLEN+PIEEVF+ LRC  +GLT++AA+ERL IFGHNKLEEK+ES
Sbjct  1    MADKEEAMHAVLTEAVDLENVPIEEVFQTLRCDSNGLTTKAAEERLAIFGHNKLEEKQES  60

Query  266  kflkflgfMWNPLSWVMEaaaimaialaNGGGKPPDWQDFVGIITLLVINSTISFIEEnn  445
            KFLKFLGFMWNPLSWVMEAAAIMAIALANGG KPPDWQDFVGIITLL+INSTISFIEENN
Sbjct  61   KFLKFLGFMWNPLSWVMEAAAIMAIALANGGNKPPDWQDFVGIITLLIINSTISFIEENN  120

Query  446  agnaaaalmarlapkaKVLRDG  511
            AGNAAAALMARLAPKAKVLRDG
Sbjct  121  AGNAAAALMARLAPKAKVLRDG  142



>gb|KEH24965.1| plasma membrane H+-ATPase [Medicago truncatula]
Length=951

 Score =   154 bits (389),  Expect = 8e-40, Method: Compositional matrix adjust.
 Identities = 122/142 (86%), Positives = 132/142 (93%), Gaps = 0/142 (0%)
 Frame = +2

Query  86   MAEKPEVLDAVLKETVDLENIPIEEVFENLRCTKDGLTSQAAQERLDIFGHNkleekkes  265
            MA+K E + AVL E VDLEN+PIEEVF+ LRC  +GLT++AA+ERL IFGHNKLEEK+ES
Sbjct  1    MADKEEAMHAVLTEAVDLENVPIEEVFQTLRCDSNGLTTKAAEERLAIFGHNKLEEKQES  60

Query  266  kflkflgfMWNPLSWVMEaaaimaialaNGGGKPPDWQDFVGIITLLVINSTISFIEEnn  445
            KFLKFLGFMWNPLSWVMEAAAIMAIALANGG KPPDWQDFVGIITLL+INSTISFIEENN
Sbjct  61   KFLKFLGFMWNPLSWVMEAAAIMAIALANGGNKPPDWQDFVGIITLLIINSTISFIEENN  120

Query  446  agnaaaalmarlapkaKVLRDG  511
            AGNAAAALMARLAPKAKVLRDG
Sbjct  121  AGNAAAALMARLAPKAKVLRDG  142



>gb|EMT26085.1| Plasma membrane ATPase 1 [Aegilops tauschii]
Length=969

 Score =   154 bits (389),  Expect = 8e-40, Method: Composition-based stats.
 Identities = 125/143 (87%), Positives = 133/143 (93%), Gaps = 1/143 (1%)
 Frame = +2

Query  86   MAEKPE-VLDAVLKETVDLENIPIEEVFENLRCTKDGLTSQAAQERLDIFGHNkleekke  262
            MA + E  LDAVLKE VDLE+IPI+EVFENLRC+  GLTS+ AQ+RL IFG NKLEEK+E
Sbjct  1    MASRQEGNLDAVLKEAVDLEHIPIDEVFENLRCSHQGLTSEQAQQRLQIFGPNKLEEKEE  60

Query  263  skflkflgfMWNPLSWVMEaaaimaialaNGGGKPPDWQDFVGIITLLVINSTISFIEEn  442
            SKFLKFLGFMWNPLSWVMEAAAIMAIALANGGGKPPDWQDFVGIITLL+INSTISFIEEN
Sbjct  61   SKFLKFLGFMWNPLSWVMEAAAIMAIALANGGGKPPDWQDFVGIITLLLINSTISFIEEN  120

Query  443  nagnaaaalmarlapkaKVLRDG  511
            NAGNAAAALMARLAPKAKVLRDG
Sbjct  121  NAGNAAAALMARLAPKAKVLRDG  143



>ref|XP_010228253.1| PREDICTED: plasma membrane ATPase 3-like isoform X1 [Brachypodium 
distachyon]
Length=991

 Score =   154 bits (388),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 124/142 (87%), Positives = 134/142 (94%), Gaps = 0/142 (0%)
 Frame = +2

Query  86   MAEKPEVLDAVLKETVDLENIPIEEVFENLRCTKDGLTSQAAQERLDIFGHNkleekkes  265
            M EK   LDAVLKE+VDLENIP+EEVFENLRC+++GL+S  A++RL IFG NKLEEKKES
Sbjct  1    MDEKASNLDAVLKESVDLENIPLEEVFENLRCSREGLSSTQAEQRLAIFGPNKLEEKKES  60

Query  266  kflkflgfMWNPLSWVMEaaaimaialaNGGGKPPDWQDFVGIITLLVINSTISFIEEnn  445
            KFLKFLGFMWNPLSWVMEAAAIMAIALANGGGKPPDWQDFVGIITLL+INSTISFIEENN
Sbjct  61   KFLKFLGFMWNPLSWVMEAAAIMAIALANGGGKPPDWQDFVGIITLLIINSTISFIEENN  120

Query  446  agnaaaalmarlapkaKVLRDG  511
            AGNAAAALMARLAPKAKVLR+G
Sbjct  121  AGNAAAALMARLAPKAKVLRNG  142



>ref|XP_010228254.1| PREDICTED: plasma membrane ATPase 3-like isoform X2 [Brachypodium 
distachyon]
Length=956

 Score =   154 bits (388),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 124/142 (87%), Positives = 134/142 (94%), Gaps = 0/142 (0%)
 Frame = +2

Query  86   MAEKPEVLDAVLKETVDLENIPIEEVFENLRCTKDGLTSQAAQERLDIFGHNkleekkes  265
            M EK   LDAVLKE+VDLENIP+EEVFENLRC+++GL+S  A++RL IFG NKLEEKKES
Sbjct  1    MDEKASNLDAVLKESVDLENIPLEEVFENLRCSREGLSSTQAEQRLAIFGPNKLEEKKES  60

Query  266  kflkflgfMWNPLSWVMEaaaimaialaNGGGKPPDWQDFVGIITLLVINSTISFIEEnn  445
            KFLKFLGFMWNPLSWVMEAAAIMAIALANGGGKPPDWQDFVGIITLL+INSTISFIEENN
Sbjct  61   KFLKFLGFMWNPLSWVMEAAAIMAIALANGGGKPPDWQDFVGIITLLIINSTISFIEENN  120

Query  446  agnaaaalmarlapkaKVLRDG  511
            AGNAAAALMARLAPKAKVLR+G
Sbjct  121  AGNAAAALMARLAPKAKVLRNG  142



>ref|XP_011466246.1| PREDICTED: plasma membrane ATPase 1-like isoform X2 [Fragaria 
vesca subsp. vesca]
Length=966

 Score =   153 bits (386),  Expect = 3e-39, Method: Composition-based stats.
 Identities = 121/142 (85%), Positives = 130/142 (92%), Gaps = 0/142 (0%)
 Frame = +2

Query  86   MAEKPEVLDAVLKETVDLENIPIEEVFENLRCTKDGLTSQAAQERLDIFGHNkleekkes  265
            M EK E L+ V+KE VDLE++PIEEVF  LRC + GLTS+AAQ+RL +FG+NKLEEKKES
Sbjct  1    MDEKAEGLEVVVKEAVDLEHVPIEEVFLTLRCDEHGLTSEAAQQRLALFGYNKLEEKKES  60

Query  266  kflkflgfMWNPLSWVMEaaaimaialaNGGGKPPDWQDFVGIITLLVINSTISFIEEnn  445
            K LKFLGFMWNPLSWVMEAAAIMAIALANGGGKPPDWQDFVGIITLLVINSTISFIEENN
Sbjct  61   KVLKFLGFMWNPLSWVMEAAAIMAIALANGGGKPPDWQDFVGIITLLVINSTISFIEENN  120

Query  446  agnaaaalmarlapkaKVLRDG  511
            AGNAAAALMARLAP AKVLRDG
Sbjct  121  AGNAAAALMARLAPTAKVLRDG  142



>ref|XP_004302360.1| PREDICTED: plasma membrane ATPase 1-like isoform X1 [Fragaria 
vesca subsp. vesca]
Length=956

 Score =   152 bits (385),  Expect = 3e-39, Method: Composition-based stats.
 Identities = 121/142 (85%), Positives = 130/142 (92%), Gaps = 0/142 (0%)
 Frame = +2

Query  86   MAEKPEVLDAVLKETVDLENIPIEEVFENLRCTKDGLTSQAAQERLDIFGHNkleekkes  265
            M EK E L+ V+KE VDLE++PIEEVF  LRC + GLTS+AAQ+RL +FG+NKLEEKKES
Sbjct  1    MDEKAEGLEVVVKEAVDLEHVPIEEVFLTLRCDEHGLTSEAAQQRLALFGYNKLEEKKES  60

Query  266  kflkflgfMWNPLSWVMEaaaimaialaNGGGKPPDWQDFVGIITLLVINSTISFIEEnn  445
            K LKFLGFMWNPLSWVMEAAAIMAIALANGGGKPPDWQDFVGIITLLVINSTISFIEENN
Sbjct  61   KVLKFLGFMWNPLSWVMEAAAIMAIALANGGGKPPDWQDFVGIITLLVINSTISFIEENN  120

Query  446  agnaaaalmarlapkaKVLRDG  511
            AGNAAAALMARLAP AKVLRDG
Sbjct  121  AGNAAAALMARLAPTAKVLRDG  142



>ref|XP_009417143.1| PREDICTED: plasma membrane ATPase 1-like [Musa acuminata subsp. 
malaccensis]
Length=955

 Score =   152 bits (385),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 123/142 (87%), Positives = 133/142 (94%), Gaps = 0/142 (0%)
 Frame = +2

Query  86   MAEKPEVLDAVLKETVDLENIPIEEVFENLRCTKDGLTSQAAQERLDIFGHNkleekkes  265
            MA+K   ++AVLKE VDLENIP+EEVFENLRC ++GLT++ AQ+RL+IFG NKLEEKKES
Sbjct  1    MADKSVDMEAVLKEAVDLENIPLEEVFENLRCGREGLTAEQAQQRLEIFGPNKLEEKKES  60

Query  266  kflkflgfMWNPLSWVMEaaaimaialaNGGGKPPDWQDFVGIITLLVINSTISFIEEnn  445
            K LKFLGFMWNPLSWVMEAAAIMAIALANGGGKPPDWQDFVGIITLLVINSTISFIEENN
Sbjct  61   KVLKFLGFMWNPLSWVMEAAAIMAIALANGGGKPPDWQDFVGIITLLVINSTISFIEENN  120

Query  446  agnaaaalmarlapkaKVLRDG  511
            AGNAAAALMARLAPKAKVLR G
Sbjct  121  AGNAAAALMARLAPKAKVLRGG  142



>ref|XP_003578172.1| PREDICTED: plasma membrane ATPase 1 [Brachypodium distachyon]
Length=959

 Score =   152 bits (385),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 120/135 (89%), Positives = 132/135 (98%), Gaps = 0/135 (0%)
 Frame = +2

Query  107  LDAVLKETVDLENIPIEEVFENLRCTKDGLTSQAAQERLDIFGHNkleekkeskflkflg  286
            L+AVLKE+VDLENIP+EEVFENLRC++ GL++Q AQ+RL+IFG NKLEE++ESKFLKFLG
Sbjct  11   LEAVLKESVDLENIPLEEVFENLRCSRQGLSAQQAQQRLEIFGPNKLEEEEESKFLKFLG  70

Query  287  fMWNPLSWVMEaaaimaialaNGGGKPPDWQDFVGIITLLVINSTISFIEEnnagnaaaa  466
            FMWNPLSWVMEAAAIMAIALANGGGKPPDWQDFVGIITLLVINSTISFIEENNAGNAAAA
Sbjct  71   FMWNPLSWVMEAAAIMAIALANGGGKPPDWQDFVGIITLLVINSTISFIEENNAGNAAAA  130

Query  467  lmarlapkaKVLRDG  511
            LMARLAPKAK+LRDG
Sbjct  131  LMARLAPKAKILRDG  145



>ref|XP_011082991.1| PREDICTED: LOW QUALITY PROTEIN: plasma membrane ATPase 1-like 
[Sesamum indicum]
Length=951

 Score =   152 bits (384),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 120/142 (85%), Positives = 132/142 (93%), Gaps = 0/142 (0%)
 Frame = +2

Query  86   MAEKPEVLDAVLKETVDLENIPIEEVFENLRCTKDGLTSQAAQERLDIFGHNkleekkes  265
            MA K E ++A+ +E VDLENIP+EEVFENLRCT++GL+S+ A  RL+IFG NKLEEK+ES
Sbjct  1    MAAKDEAMEALKREAVDLENIPLEEVFENLRCTREGLSSEDANRRLEIFGQNKLEEKEES  60

Query  266  kflkflgfMWNPLSWVMEaaaimaialaNGGGKPPDWQDFVGIITLLVINSTISFIEEnn  445
            K LKFLGFMWNPLSWVMEAAAIMAIALANGGG+PPDWQDFVGIITLLVINSTISFIEENN
Sbjct  61   KILKFLGFMWNPLSWVMEAAAIMAIALANGGGRPPDWQDFVGIITLLVINSTISFIEENN  120

Query  446  agnaaaalmarlapkaKVLRDG  511
            AGNAAAALMARLAPKAKVLRDG
Sbjct  121  AGNAAAALMARLAPKAKVLRDG  142



>dbj|BAA06629.1| plasma membrane H+-ATPase [Oryza sativa Japonica Group]
Length=957

 Score =   152 bits (383),  Expect = 5e-39, Method: Compositional matrix adjust.
 Identities = 120/142 (85%), Positives = 134/142 (94%), Gaps = 0/142 (0%)
 Frame = +2

Query  86   MAEKPEVLDAVLKETVDLENIPIEEVFENLRCTKDGLTSQAAQERLDIFGHNkleekkes  265
            MAEK + L+AVL E+VDLENIP+EEVFE+LRC ++GLTS  A++RL++FG N+LEEKKES
Sbjct  1    MAEKGDNLEAVLNESVDLENIPLEEVFEHLRCNREGLTSANAEQRLNLFGLNRLEEKKES  60

Query  266  kflkflgfMWNPLSWVMEaaaimaialaNGGGKPPDWQDFVGIITLLVINSTISFIEEnn  445
            KFLKFLGFMWNPLSWVMEAAAIMAI LANGGGKPPDWQDFVGIITLL+INSTISFIEENN
Sbjct  61   KFLKFLGFMWNPLSWVMEAAAIMAIVLANGGGKPPDWQDFVGIITLLIINSTISFIEENN  120

Query  446  agnaaaalmarlapkaKVLRDG  511
            AGNAAAALMARLAPKAKVLR+G
Sbjct  121  AGNAAAALMARLAPKAKVLRNG  142



>gb|EYU34115.1| hypothetical protein MIMGU_mgv1a000867mg [Erythranthe guttata]
Length=955

 Score =   152 bits (383),  Expect = 6e-39, Method: Compositional matrix adjust.
 Identities = 121/142 (85%), Positives = 132/142 (93%), Gaps = 0/142 (0%)
 Frame = +2

Query  86   MAEKPEVLDAVLKETVDLENIPIEEVFENLRCTKDGLTSQAAQERLDIFGHNkleekkes  265
            MA   E ++A+ +E VDLENIPIEEVF+NLRCTK+GL+S+ A  RL+IFG+NKLEEK+ES
Sbjct  1    MAANDEAMEALKREAVDLENIPIEEVFDNLRCTKEGLSSEDAIRRLEIFGYNKLEEKEES  60

Query  266  kflkflgfMWNPLSWVMEaaaimaialaNGGGKPPDWQDFVGIITLLVINSTISFIEEnn  445
            K LKFLGFMWNPLSWVMEAAAIMAIALANGGGKPPDWQDFVGIITLLVINSTISFIEENN
Sbjct  61   KVLKFLGFMWNPLSWVMEAAAIMAIALANGGGKPPDWQDFVGIITLLVINSTISFIEENN  120

Query  446  agnaaaalmarlapkaKVLRDG  511
            AGNAAAALMARLAPKAKVLRDG
Sbjct  121  AGNAAAALMARLAPKAKVLRDG  142



>dbj|BAK04567.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=958

 Score =   152 bits (383),  Expect = 6e-39, Method: Composition-based stats.
 Identities = 119/135 (88%), Positives = 130/135 (96%), Gaps = 0/135 (0%)
 Frame = +2

Query  107  LDAVLKETVDLENIPIEEVFENLRCTKDGLTSQAAQERLDIFGHNkleekkeskflkflg  286
            L+AVLKE VDLENIP+EEV +NLRC+++GLT++ AQ+RL IFG NKLEEK+ESKFLKFLG
Sbjct  9    LEAVLKEVVDLENIPLEEVLDNLRCSREGLTAEQAQQRLQIFGPNKLEEKEESKFLKFLG  68

Query  287  fMWNPLSWVMEaaaimaialaNGGGKPPDWQDFVGIITLLVINSTISFIEEnnagnaaaa  466
            FMWNPLSWVMEAAAIMAIALANGGGKPPDWQDFVGIITLLVINSTISFIEENNAGNAAAA
Sbjct  69   FMWNPLSWVMEAAAIMAIALANGGGKPPDWQDFVGIITLLVINSTISFIEENNAGNAAAA  128

Query  467  lmarlapkaKVLRDG  511
            LMARLAPKAK+LRDG
Sbjct  129  LMARLAPKAKILRDG  143



>dbj|BAJ92653.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=958

 Score =   152 bits (383),  Expect = 6e-39, Method: Composition-based stats.
 Identities = 119/135 (88%), Positives = 130/135 (96%), Gaps = 0/135 (0%)
 Frame = +2

Query  107  LDAVLKETVDLENIPIEEVFENLRCTKDGLTSQAAQERLDIFGHNkleekkeskflkflg  286
            L+AVLKE VDLENIP+EEV +NLRC+++GLT++ AQ+RL IFG NKLEEK+ESKFLKFLG
Sbjct  9    LEAVLKEVVDLENIPLEEVLDNLRCSREGLTAEQAQQRLQIFGPNKLEEKEESKFLKFLG  68

Query  287  fMWNPLSWVMEaaaimaialaNGGGKPPDWQDFVGIITLLVINSTISFIEEnnagnaaaa  466
            FMWNPLSWVMEAAAIMAIALANGGGKPPDWQDFVGIITLLVINSTISFIEENNAGNAAAA
Sbjct  69   FMWNPLSWVMEAAAIMAIALANGGGKPPDWQDFVGIITLLVINSTISFIEENNAGNAAAA  128

Query  467  lmarlapkaKVLRDG  511
            LMARLAPKAK+LRDG
Sbjct  129  LMARLAPKAKILRDG  143



>ref|XP_002517457.1| H(\+)-transporting atpase plant/fungi plasma membrane type, putative 
[Ricinus communis]
 gb|EEF44999.1| H(\+)-transporting atpase plant/fungi plasma membrane type, putative 
[Ricinus communis]
Length=762

 Score =   150 bits (380),  Expect = 7e-39, Method: Composition-based stats.
 Identities = 97/118 (82%), Positives = 108/118 (92%), Gaps = 0/118 (0%)
 Frame = +2

Query  86   MAEKPEVLDAVLKETVDLENIPIEEVFENLRCTKDGLTSQAAQERLDIFGHNkleekkes  265
            M +K E L+AVLKE VDLEN+PIEEVF+ LRC  +GLT++AA++RL IFG+NKLEEK+ES
Sbjct  1    MDDKSETLEAVLKEAVDLENVPIEEVFQTLRCNSNGLTTEAAEQRLTIFGYNKLEEKQES  60

Query  266  kflkflgfMWNPLSWVMEaaaimaialaNGGGKPPDWQDFVGIITLLVINSTISFIEE  439
            KFLKFLGFMWNPLSWVMEAAAIMAIALANGGGKPPDWQDFVGII LL INSTISFIEE
Sbjct  61   KFLKFLGFMWNPLSWVMEAAAIMAIALANGGGKPPDWQDFVGIIILLFINSTISFIEE  118



>ref|XP_011098566.1| PREDICTED: plasma membrane ATPase 1-like [Sesamum indicum]
 ref|XP_011098567.1| PREDICTED: plasma membrane ATPase 1-like [Sesamum indicum]
Length=955

 Score =   151 bits (382),  Expect = 7e-39, Method: Compositional matrix adjust.
 Identities = 119/142 (84%), Positives = 132/142 (93%), Gaps = 0/142 (0%)
 Frame = +2

Query  86   MAEKPEVLDAVLKETVDLENIPIEEVFENLRCTKDGLTSQAAQERLDIFGHNkleekkes  265
            MA K E ++A+ +E VDLEN+P+EEVFENLRCT++GL+S+ A  RL+IFG NKLEEK+ES
Sbjct  1    MAAKDEAMEALKREAVDLENVPLEEVFENLRCTREGLSSEDANRRLEIFGQNKLEEKEES  60

Query  266  kflkflgfMWNPLSWVMEaaaimaialaNGGGKPPDWQDFVGIITLLVINSTISFIEEnn  445
            K LKFLGFMWNPLSWVMEAAAIMAIALANGGG+PPDWQDFVGIITLLVINSTISFIEENN
Sbjct  61   KILKFLGFMWNPLSWVMEAAAIMAIALANGGGRPPDWQDFVGIITLLVINSTISFIEENN  120

Query  446  agnaaaalmarlapkaKVLRDG  511
            AGNAAAALMARLAPKAKVLRDG
Sbjct  121  AGNAAAALMARLAPKAKVLRDG  142



>ref|XP_006658357.1| PREDICTED: plasma membrane ATPase 1-like [Oryza brachyantha]
Length=957

 Score =   151 bits (382),  Expect = 8e-39, Method: Compositional matrix adjust.
 Identities = 121/142 (85%), Positives = 135/142 (95%), Gaps = 0/142 (0%)
 Frame = +2

Query  86   MAEKPEVLDAVLKETVDLENIPIEEVFENLRCTKDGLTSQAAQERLDIFGHNkleekkes  265
            MAEK + L+AVL E+VDLENIP+EEVFE+LRC ++GLTS  A++RL++FG N+LEEKKES
Sbjct  1    MAEKADNLEAVLNESVDLENIPLEEVFEHLRCNREGLTSANAEQRLNLFGPNRLEEKKES  60

Query  266  kflkflgfMWNPLSWVMEaaaimaialaNGGGKPPDWQDFVGIITLLVINSTISFIEEnn  445
            KFLKFLGFMWNPLSWVMEAAAIMAIALANGGGKPPDWQDFVGIITLL+INSTISFIEENN
Sbjct  61   KFLKFLGFMWNPLSWVMEAAAIMAIALANGGGKPPDWQDFVGIITLLIINSTISFIEENN  120

Query  446  agnaaaalmarlapkaKVLRDG  511
            AGNAAAALMARLAPKAKVLR+G
Sbjct  121  AGNAAAALMARLAPKAKVLRNG  142



>ref|XP_004955721.1| PREDICTED: plasma membrane ATPase 1-like [Setaria italica]
Length=956

 Score =   151 bits (381),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 121/142 (85%), Positives = 131/142 (92%), Gaps = 0/142 (0%)
 Frame = +2

Query  86   MAEKPEVLDAVLKETVDLENIPIEEVFENLRCTKDGLTSQAAQERLDIFGHNkleekkes  265
            M +K   LDAVLKE VDLENIPIEEVFENLRC+  GL+++ A++RL IFG NKLEEK+ES
Sbjct  1    MEDKAANLDAVLKEAVDLENIPIEEVFENLRCSPQGLSTEQAEQRLAIFGPNKLEEKQES  60

Query  266  kflkflgfMWNPLSWVMEaaaimaialaNGGGKPPDWQDFVGIITLLVINSTISFIEEnn  445
            K LKFLGFMWNPLSWVMEAAAIMAIALANGGGKPPDWQDFVGIITLL+INSTISFIEENN
Sbjct  61   KVLKFLGFMWNPLSWVMEAAAIMAIALANGGGKPPDWQDFVGIITLLIINSTISFIEENN  120

Query  446  agnaaaalmarlapkaKVLRDG  511
            AGNAAAALMARLAPKAKVLR+G
Sbjct  121  AGNAAAALMARLAPKAKVLRNG  142



>tpg|DAA50741.1| TPA: hypothetical protein ZEAMMB73_722190 [Zea mays]
Length=1149

 Score =   151 bits (382),  Expect = 1e-38, Method: Composition-based stats.
 Identities = 124/149 (83%), Positives = 133/149 (89%), Gaps = 7/149 (5%)
 Frame = +2

Query  86   MAEKPEVLDAVLKETVDLENIPIEEVFENLRCTKDGLTSQAAQERLDIFGHNkleekk--  259
            MA+    LDAVLKE VDLENIP+EEVFENLRC++ GLTS+ AQ+RL +FG NKLEEK+  
Sbjct  195  MADNEGTLDAVLKEAVDLENIPLEEVFENLRCSRGGLTSEQAQQRLQLFGPNKLEEKELN  254

Query  260  -----eskflkflgfMWNPLSWVMEaaaimaialaNGGGKPPDWQDFVGIITLLVINSTI  424
                 ESKFLKFLGFMWNPLSWVMEAAAIMAIALANGGGKPPDWQDFVGIITLL+INSTI
Sbjct  255  WPWLQESKFLKFLGFMWNPLSWVMEAAAIMAIALANGGGKPPDWQDFVGIITLLLINSTI  314

Query  425  SFIEEnnagnaaaalmarlapkaKVLRDG  511
            SFIEENNAGNAAAALMARLAPKAKVLRDG
Sbjct  315  SFIEENNAGNAAAALMARLAPKAKVLRDG  343



>gb|EEC81667.1| hypothetical protein OsI_25220 [Oryza sativa Indica Group]
 gb|EEE66722.1| hypothetical protein OsJ_23404 [Oryza sativa Japonica Group]
Length=951

 Score =   150 bits (380),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 121/142 (85%), Positives = 135/142 (95%), Gaps = 0/142 (0%)
 Frame = +2

Query  86   MAEKPEVLDAVLKETVDLENIPIEEVFENLRCTKDGLTSQAAQERLDIFGHNkleekkes  265
            MAEK + L+AVL E+VDLENIP+EEVFE+LRC ++GLTS  A++RL++FG N+LEEKKES
Sbjct  1    MAEKGDNLEAVLNESVDLENIPLEEVFEHLRCNREGLTSANAEQRLNLFGPNRLEEKKES  60

Query  266  kflkflgfMWNPLSWVMEaaaimaialaNGGGKPPDWQDFVGIITLLVINSTISFIEEnn  445
            KFLKFLGFMWNPLSWVMEAAAIMAIALANGGGKPPDWQDFVGIITLL+INSTISFIEENN
Sbjct  61   KFLKFLGFMWNPLSWVMEAAAIMAIALANGGGKPPDWQDFVGIITLLIINSTISFIEENN  120

Query  446  agnaaaalmarlapkaKVLRDG  511
            AGNAAAALMARLAPKAKVLR+G
Sbjct  121  AGNAAAALMARLAPKAKVLRNG  142



>ref|NP_001059093.1| Os07g0191200 [Oryza sativa Japonica Group]
 emb|CAD29295.1| plasma membrane H+ ATPase [Oryza sativa Japonica Group]
 dbj|BAC83861.1| plasma membrane H+ ATPase [Oryza sativa Japonica Group]
 dbj|BAF21007.1| Os07g0191200 [Oryza sativa Japonica Group]
Length=957

 Score =   150 bits (380),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 121/142 (85%), Positives = 135/142 (95%), Gaps = 0/142 (0%)
 Frame = +2

Query  86   MAEKPEVLDAVLKETVDLENIPIEEVFENLRCTKDGLTSQAAQERLDIFGHNkleekkes  265
            MAEK + L+AVL E+VDLENIP+EEVFE+LRC ++GLTS  A++RL++FG N+LEEKKES
Sbjct  1    MAEKGDNLEAVLNESVDLENIPLEEVFEHLRCNREGLTSANAEQRLNLFGPNRLEEKKES  60

Query  266  kflkflgfMWNPLSWVMEaaaimaialaNGGGKPPDWQDFVGIITLLVINSTISFIEEnn  445
            KFLKFLGFMWNPLSWVMEAAAIMAIALANGGGKPPDWQDFVGIITLL+INSTISFIEENN
Sbjct  61   KFLKFLGFMWNPLSWVMEAAAIMAIALANGGGKPPDWQDFVGIITLLIINSTISFIEENN  120

Query  446  agnaaaalmarlapkaKVLRDG  511
            AGNAAAALMARLAPKAKVLR+G
Sbjct  121  AGNAAAALMARLAPKAKVLRNG  142



>dbj|BAA01058.1| H-ATPase [Oryza sativa Japonica Group]
 prf||1906387A H ATPase
Length=956

 Score =   150 bits (379),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 123/142 (87%), Positives = 132/142 (93%), Gaps = 0/142 (0%)
 Frame = +2

Query  86   MAEKPEVLDAVLKETVDLENIPIEEVFENLRCTKDGLTSQAAQERLDIFGHNkleekkes  265
            MAE    LDAVLKE+VDLENIPIEEVF+NL+C + GLTS+ AQ RL +FG NKLEEK+ES
Sbjct  1    MAEDKGGLDAVLKESVDLENIPIEEVFQNLKCCRQGLTSEEAQLRLQLFGPNKLEEKEES  60

Query  266  kflkflgfMWNPLSWVMEaaaimaialaNGGGKPPDWQDFVGIITLLVINSTISFIEEnn  445
            KFLKFLGFMWNPLSWVMEAAAIMAIALANGGGKPPDWQDFVGIITLL+INSTISFIEENN
Sbjct  61   KFLKFLGFMWNPLSWVMEAAAIMAIALANGGGKPPDWQDFVGIITLLLINSTISFIEENN  120

Query  446  agnaaaalmarlapkaKVLRDG  511
            AGNAAAALMARLAPKAKVLR+G
Sbjct  121  AGNAAAALMARLAPKAKVLRNG  142



>ref|XP_008230721.1| PREDICTED: plasma membrane ATPase 1-like [Prunus mume]
Length=959

 Score =   150 bits (379),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 120/142 (85%), Positives = 128/142 (90%), Gaps = 0/142 (0%)
 Frame = +2

Query  86   MAEKPEVLDAVLKETVDLENIPIEEVFENLRCTKDGLTSQAAQERLDIFGHNkleekkes  265
            M  K   LDAVLKE VDLEN+P+EEVF  LRC + GLTS+AA++RL IFG+NKLEEKKES
Sbjct  4    MDGKSGALDAVLKEAVDLENVPLEEVFLTLRCNRHGLTSEAAEQRLVIFGYNKLEEKKES  63

Query  266  kflkflgfMWNPLSWVMEaaaimaialaNGGGKPPDWQDFVGIITLLVINSTISFIEEnn  445
            K LKFLGFMWNPLSWVMEAAAIMAIALANGGGKPPDWQDFVGIITLL+INSTISFIEENN
Sbjct  64   KVLKFLGFMWNPLSWVMEAAAIMAIALANGGGKPPDWQDFVGIITLLIINSTISFIEENN  123

Query  446  agnaaaalmarlapkaKVLRDG  511
            AGNAAAALMA LAPKAKV RDG
Sbjct  124  AGNAAAALMAHLAPKAKVFRDG  145



>gb|KCW83495.1| hypothetical protein EUGRSUZ_B00400 [Eucalyptus grandis]
Length=924

 Score =   150 bits (379),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 117/142 (82%), Positives = 128/142 (90%), Gaps = 0/142 (0%)
 Frame = +2

Query  86   MAEKPEVLDAVLKETVDLENIPIEEVFENLRCTKDGLTSQAAQERLDIFGHNkleekkes  265
            M EK  VL+AVL E VDLEN+PIEEVF++L C + GLT  AA++RL++FGHNKLEEKKES
Sbjct  1    MEEKAPVLEAVLNEAVDLENVPIEEVFQSLVCNRGGLTLAAAEQRLELFGHNKLEEKKES  60

Query  266  kflkflgfMWNPLSWVMEaaaimaialaNGGGKPPDWQDFVGIITLLVINSTISFIEEnn  445
            KF KFLGFMWNPLSWVME AAIMAIAL NGGGKPPDWQDF+GI+TLL INSTISFIEENN
Sbjct  61   KFFKFLGFMWNPLSWVMELAAIMAIALTNGGGKPPDWQDFIGIVTLLFINSTISFIEENN  120

Query  446  agnaaaalmarlapkaKVLRDG  511
            AGNAAAALMARLAPKAKVLRDG
Sbjct  121  AGNAAAALMARLAPKAKVLRDG  142



>gb|AEQ27823.1| PM H+-ATPase L [Eichhornia crassipes]
Length=956

 Score =   150 bits (379),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 123/142 (87%), Positives = 131/142 (92%), Gaps = 0/142 (0%)
 Frame = +2

Query  86   MAEKPEVLDAVLKETVDLENIPIEEVFENLRCTKDGLTSQAAQERLDIFGHNkleekkes  265
            M EK   ++AVLKE VDLENI +EEVF+NLRC ++GLTSQ AQERL IFG NKLEEKKES
Sbjct  1    MGEKAVEMEAVLKEVVDLENISLEEVFDNLRCNREGLTSQQAQERLTIFGQNKLEEKKES  60

Query  266  kflkflgfMWNPLSWVMEaaaimaialaNGGGKPPDWQDFVGIITLLVINSTISFIEEnn  445
            KFLKFLGFMWNPLSWVMEAAAIMAIALANGGG+PPDWQDFVGII LL+INSTISFIEENN
Sbjct  61   KFLKFLGFMWNPLSWVMEAAAIMAIALANGGGEPPDWQDFVGIIALLMINSTISFIEENN  120

Query  446  agnaaaalmarlapkaKVLRDG  511
            AGNAAAALMARLAPKAKVLRDG
Sbjct  121  AGNAAAALMARLAPKAKVLRDG  142



>ref|XP_010028675.1| PREDICTED: ATPase 11, plasma membrane-type [Eucalyptus grandis]
 gb|KCW83493.1| hypothetical protein EUGRSUZ_B00400 [Eucalyptus grandis]
Length=955

 Score =   150 bits (379),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 117/142 (82%), Positives = 128/142 (90%), Gaps = 0/142 (0%)
 Frame = +2

Query  86   MAEKPEVLDAVLKETVDLENIPIEEVFENLRCTKDGLTSQAAQERLDIFGHNkleekkes  265
            M EK  VL+AVL E VDLEN+PIEEVF++L C + GLT  AA++RL++FGHNKLEEKKES
Sbjct  1    MEEKAPVLEAVLNEAVDLENVPIEEVFQSLVCNRGGLTLAAAEQRLELFGHNKLEEKKES  60

Query  266  kflkflgfMWNPLSWVMEaaaimaialaNGGGKPPDWQDFVGIITLLVINSTISFIEEnn  445
            KF KFLGFMWNPLSWVME AAIMAIAL NGGGKPPDWQDF+GI+TLL INSTISFIEENN
Sbjct  61   KFFKFLGFMWNPLSWVMELAAIMAIALTNGGGKPPDWQDFIGIVTLLFINSTISFIEENN  120

Query  446  agnaaaalmarlapkaKVLRDG  511
            AGNAAAALMARLAPKAKVLRDG
Sbjct  121  AGNAAAALMARLAPKAKVLRDG  142



>gb|EEC75974.1| hypothetical protein OsI_13084 [Oryza sativa Indica Group]
 gb|EEE59727.1| hypothetical protein OsJ_12166 [Oryza sativa Japonica Group]
Length=966

 Score =   150 bits (379),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 123/142 (87%), Positives = 132/142 (93%), Gaps = 0/142 (0%)
 Frame = +2

Query  86   MAEKPEVLDAVLKETVDLENIPIEEVFENLRCTKDGLTSQAAQERLDIFGHNkleekkes  265
            MAE    LDAVLKE+VDLENIPIEEVF+NL+C + GLTS+ AQ RL +FG NKLEEK+ES
Sbjct  1    MAEDKGGLDAVLKESVDLENIPIEEVFQNLKCCRQGLTSEEAQLRLQLFGPNKLEEKEES  60

Query  266  kflkflgfMWNPLSWVMEaaaimaialaNGGGKPPDWQDFVGIITLLVINSTISFIEEnn  445
            KFLKFLGFMWNPLSWVMEAAAIMAIALANGGGKPPDWQDFVGIITLL+INSTISFIEENN
Sbjct  61   KFLKFLGFMWNPLSWVMEAAAIMAIALANGGGKPPDWQDFVGIITLLLINSTISFIEENN  120

Query  446  agnaaaalmarlapkaKVLRDG  511
            AGNAAAALMARLAPKAKVLR+G
Sbjct  121  AGNAAAALMARLAPKAKVLRNG  142



>ref|NP_001050947.1| Os03g0689300 [Oryza sativa Japonica Group]
 emb|CAD29294.1| plasma membrane H+ ATPase [Oryza sativa Japonica Group]
 gb|AAT81733.1| H-ATPase [Oryza sativa Japonica Group]
 gb|ABF98274.1| Plasma membrane ATPase 3, putative, expressed [Oryza sativa Japonica 
Group]
 dbj|BAF12861.1| Os03g0689300 [Oryza sativa Japonica Group]
Length=956

 Score =   150 bits (379),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 123/142 (87%), Positives = 132/142 (93%), Gaps = 0/142 (0%)
 Frame = +2

Query  86   MAEKPEVLDAVLKETVDLENIPIEEVFENLRCTKDGLTSQAAQERLDIFGHNkleekkes  265
            MAE    LDAVLKE+VDLENIPIEEVF+NL+C + GLTS+ AQ RL +FG NKLEEK+ES
Sbjct  1    MAEDKGGLDAVLKESVDLENIPIEEVFQNLKCCRQGLTSEEAQLRLQLFGPNKLEEKEES  60

Query  266  kflkflgfMWNPLSWVMEaaaimaialaNGGGKPPDWQDFVGIITLLVINSTISFIEEnn  445
            KFLKFLGFMWNPLSWVMEAAAIMAIALANGGGKPPDWQDFVGIITLL+INSTISFIEENN
Sbjct  61   KFLKFLGFMWNPLSWVMEAAAIMAIALANGGGKPPDWQDFVGIITLLLINSTISFIEENN  120

Query  446  agnaaaalmarlapkaKVLRDG  511
            AGNAAAALMARLAPKAKVLR+G
Sbjct  121  AGNAAAALMARLAPKAKVLRNG  142



>gb|KCW83494.1| hypothetical protein EUGRSUZ_B00400 [Eucalyptus grandis]
Length=954

 Score =   150 bits (379),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 117/142 (82%), Positives = 128/142 (90%), Gaps = 0/142 (0%)
 Frame = +2

Query  86   MAEKPEVLDAVLKETVDLENIPIEEVFENLRCTKDGLTSQAAQERLDIFGHNkleekkes  265
            M EK  VL+AVL E VDLEN+PIEEVF++L C + GLT  AA++RL++FGHNKLEEKKES
Sbjct  1    MEEKAPVLEAVLNEAVDLENVPIEEVFQSLVCNRGGLTLAAAEQRLELFGHNKLEEKKES  60

Query  266  kflkflgfMWNPLSWVMEaaaimaialaNGGGKPPDWQDFVGIITLLVINSTISFIEEnn  445
            KF KFLGFMWNPLSWVME AAIMAIAL NGGGKPPDWQDF+GI+TLL INSTISFIEENN
Sbjct  61   KFFKFLGFMWNPLSWVMELAAIMAIALTNGGGKPPDWQDFIGIVTLLFINSTISFIEENN  120

Query  446  agnaaaalmarlapkaKVLRDG  511
            AGNAAAALMARLAPKAKVLRDG
Sbjct  121  AGNAAAALMARLAPKAKVLRDG  142



>ref|XP_007214948.1| hypothetical protein PRUPE_ppa000931mg [Prunus persica]
 gb|EMJ16147.1| hypothetical protein PRUPE_ppa000931mg [Prunus persica]
Length=956

 Score =   150 bits (379),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 120/142 (85%), Positives = 128/142 (90%), Gaps = 0/142 (0%)
 Frame = +2

Query  86   MAEKPEVLDAVLKETVDLENIPIEEVFENLRCTKDGLTSQAAQERLDIFGHNkleekkes  265
            M  K E LDAVLKE VDLEN+P+EEVF  LRC + GLTS+AA++RL IFG+NKLEEKKES
Sbjct  1    MDGKSETLDAVLKEAVDLENVPLEEVFLTLRCNRHGLTSEAAEQRLVIFGYNKLEEKKES  60

Query  266  kflkflgfMWNPLSWVMEaaaimaialaNGGGKPPDWQDFVGIITLLVINSTISFIEEnn  445
            K LKFLGFMWNPLSWVMEAAAIMAIALANGGGKPPDWQDFVGIITLL+INSTISFIEENN
Sbjct  61   KVLKFLGFMWNPLSWVMEAAAIMAIALANGGGKPPDWQDFVGIITLLIINSTISFIEENN  120

Query  446  agnaaaalmarlapkaKVLRDG  511
            AGNAAAALMA LAPKAKV R G
Sbjct  121  AGNAAAALMAHLAPKAKVFRGG  142



>ref|XP_008650970.1| PREDICTED: uncharacterized protein LOC100216710 isoform X1 [Zea 
mays]
 tpg|DAA59903.1| TPA: membrane H(+)-ATPase1 [Zea mays]
Length=956

 Score =   149 bits (377),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 122/142 (86%), Positives = 131/142 (92%), Gaps = 0/142 (0%)
 Frame = +2

Query  86   MAEKPEVLDAVLKETVDLENIPIEEVFENLRCTKDGLTSQAAQERLDIFGHNkleekkes  265
            M +K   LDAVLKE VDLENIPIEEVFENLRC+  GLT++ A++RL IFG NKLEEK+ES
Sbjct  1    MEDKASNLDAVLKEAVDLENIPIEEVFENLRCSPQGLTTEQAEQRLAIFGPNKLEEKQES  60

Query  266  kflkflgfMWNPLSWVMEaaaimaialaNGGGKPPDWQDFVGIITLLVINSTISFIEEnn  445
            KFLKFLGFMWNPLSWVMEAAAIMAIALANGG KPPDWQDFVGIITLL+INSTISFIEENN
Sbjct  61   KFLKFLGFMWNPLSWVMEAAAIMAIALANGGNKPPDWQDFVGIITLLIINSTISFIEENN  120

Query  446  agnaaaalmarlapkaKVLRDG  511
            AGNAAAALMARLAPKAKVLR+G
Sbjct  121  AGNAAAALMARLAPKAKVLRNG  142



>gb|EMS45119.1| Plasma membrane ATPase 1 [Triticum urartu]
Length=973

 Score =   149 bits (377),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 124/144 (86%), Positives = 133/144 (92%), Gaps = 1/144 (1%)
 Frame = +2

Query  83   VMAEKPE-VLDAVLKETVDLENIPIEEVFENLRCTKDGLTSQAAQERLDIFGHNkleekk  259
             MA + E  LDAVLKE VDLE+IPI+EVFENLRC+ +GLTS+ AQ+RL IFG NKLEEK+
Sbjct  2    AMASRQEGSLDAVLKEAVDLEHIPIDEVFENLRCSHEGLTSEQAQQRLQIFGPNKLEEKE  61

Query  260  eskflkflgfMWNPLSWVMEaaaimaialaNGGGKPPDWQDFVGIITLLVINSTISFIEE  439
            ESKFLKFLGFMWNPLSWVMEAAAIMAIALANGGGKP DWQDFVGIITLL+INSTISFIEE
Sbjct  62   ESKFLKFLGFMWNPLSWVMEAAAIMAIALANGGGKPSDWQDFVGIITLLLINSTISFIEE  121

Query  440  nnagnaaaalmarlapkaKVLRDG  511
            NNAGNAAAALMARLAPKAKVLRDG
Sbjct  122  NNAGNAAAALMARLAPKAKVLRDG  145



>emb|CDP02191.1| unnamed protein product [Coffea canephora]
Length=967

 Score =   149 bits (375),  Expect = 8e-38, Method: Compositional matrix adjust.
 Identities = 116/142 (82%), Positives = 130/142 (92%), Gaps = 0/142 (0%)
 Frame = +2

Query  86   MAEKPEVLDAVLKETVDLENIPIEEVFENLRCTKDGLTSQAAQERLDIFGHNkleekkes  265
            MA + E ++A+ KE VDLENIP+EEVFENLRCTK+GL+S+ AQ RL IFG+NKLEEK+ES
Sbjct  1    MAAQDEAMEALKKEAVDLENIPLEEVFENLRCTKEGLSSEDAQRRLQIFGYNKLEEKEES  60

Query  266  kflkflgfMWNPLSWVMEaaaimaialaNGGGKPPDWQDFVGIITLLVINSTISFIEEnn  445
            K LKFLGFMWNPLSWVMEAAA+MAIALANGGGKPPDWQDFVGI  LL+INS+ISF EENN
Sbjct  61   KVLKFLGFMWNPLSWVMEAAAVMAIALANGGGKPPDWQDFVGITILLLINSSISFYEENN  120

Query  446  agnaaaalmarlapkaKVLRDG  511
            AGNAAAALMARL+PKAKVLRDG
Sbjct  121  AGNAAAALMARLSPKAKVLRDG  142



>ref|XP_002459489.1| hypothetical protein SORBIDRAFT_02g005440 [Sorghum bicolor]
 gb|EER96010.1| hypothetical protein SORBIDRAFT_02g005440 [Sorghum bicolor]
Length=956

 Score =   148 bits (373),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 119/142 (84%), Positives = 129/142 (91%), Gaps = 0/142 (0%)
 Frame = +2

Query  86   MAEKPEVLDAVLKETVDLENIPIEEVFENLRCTKDGLTSQAAQERLDIFGHNkleekkes  265
            M +K   LDAVLKE VDLENIPIEEVFENLRC+  GL+++ A++RL IFG NKLEEK+ES
Sbjct  1    MEDKASNLDAVLKEAVDLENIPIEEVFENLRCSPQGLSTEQAEQRLAIFGPNKLEEKQES  60

Query  266  kflkflgfMWNPLSWVMEaaaimaialaNGGGKPPDWQDFVGIITLLVINSTISFIEEnn  445
            K  KFLGFMWNPLSWVMEAAAIMAIALANGG KPPDWQDFVGIITLL+INSTISFIEENN
Sbjct  61   KIFKFLGFMWNPLSWVMEAAAIMAIALANGGNKPPDWQDFVGIITLLIINSTISFIEENN  120

Query  446  agnaaaalmarlapkaKVLRDG  511
            AGNAAAALMARLAPKAKVLR+G
Sbjct  121  AGNAAAALMARLAPKAKVLRNG  142



>gb|KDP28822.1| hypothetical protein JCGZ_14593 [Jatropha curcas]
Length=966

 Score =   148 bits (373),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 118/142 (83%), Positives = 131/142 (92%), Gaps = 0/142 (0%)
 Frame = +2

Query  86   MAEKPEVLDAVLKETVDLENIPIEEVFENLRCTKDGLTSQAAQERLDIFGHNkleekkes  265
            M ++   LDAV+KE VDLENIP+EEVF++L+CTK+GL+S A QERLD+FGHNKLEEKKES
Sbjct  1    MVDESVALDAVIKEAVDLENIPLEEVFDHLKCTKNGLSSDAVQERLDLFGHNKLEEKKES  60

Query  266  kflkflgfMWNPLSWVMEaaaimaialaNGGGKPPDWQDFVGIITLLVINSTISFIEEnn  445
            K LKFLGFMWNPLSWVMEAAAIMAIALA+GGGK PD+ DFVGI+ LLVINSTISFIEENN
Sbjct  61   KILKFLGFMWNPLSWVMEAAAIMAIALAHGGGKSPDYHDFVGIVILLVINSTISFIEENN  120

Query  446  agnaaaalmarlapkaKVLRDG  511
            AGNAAAALMARLAPKAKVLRDG
Sbjct  121  AGNAAAALMARLAPKAKVLRDG  142



>ref|XP_010531800.1| PREDICTED: ATPase 4, plasma membrane-type-like [Tarenaya hassleriana]
Length=954

 Score =   147 bits (371),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 115/135 (85%), Positives = 126/135 (93%), Gaps = 0/135 (0%)
 Frame = +2

Query  107  LDAVLKETVDLENIPIEEVFENLRCTKDGLTSQAAQERLDIFGHNkleekkeskflkflg  286
            +DAVLKE VDLEN+P+ EVFE LRC  +GL+++AA++RL IFGHNKLEEK+ESKFLKFLG
Sbjct  7    MDAVLKEAVDLENVPMAEVFETLRCDTNGLSTKAAEQRLAIFGHNKLEEKQESKFLKFLG  66

Query  287  fMWNPLSWVMEaaaimaialaNGGGKPPDWQDFVGIITLLVINSTISFIEEnnagnaaaa  466
            FMWNPLSWVMEAAAIMAIALANGGGKPPDWQDFVGII LL+INSTISFIEENNAGNAAAA
Sbjct  67   FMWNPLSWVMEAAAIMAIALANGGGKPPDWQDFVGIIVLLLINSTISFIEENNAGNAAAA  126

Query  467  lmarlapkaKVLRDG  511
            LMA LAPK KVLRDG
Sbjct  127  LMAHLAPKTKVLRDG  141



>ref|XP_008341531.1| PREDICTED: plasma membrane ATPase 1-like [Malus domestica]
Length=956

 Score =   147 bits (370),  Expect = 3e-37, Method: Composition-based stats.
 Identities = 118/142 (83%), Positives = 127/142 (89%), Gaps = 0/142 (0%)
 Frame = +2

Query  86   MAEKPEVLDAVLKETVDLENIPIEEVFENLRCTKDGLTSQAAQERLDIFGHNkleekkes  265
            M EK   LDAVLKE VDLE++P+EEVF  LRC K GLTS+A ++RL IFG NKLEEKKES
Sbjct  1    MDEKAVDLDAVLKEAVDLEHVPLEEVFVTLRCNKHGLTSEAVEQRLAIFGFNKLEEKKES  60

Query  266  kflkflgfMWNPLSWVMEaaaimaialaNGGGKPPDWQDFVGIITLLVINSTISFIEEnn  445
            K LKFLGFMWNPL+WVMEAAAIMAIALANGGGKPPDWQDF+GII LL+INSTISFIEENN
Sbjct  61   KVLKFLGFMWNPLAWVMEAAAIMAIALANGGGKPPDWQDFIGIIALLIINSTISFIEENN  120

Query  446  agnaaaalmarlapkaKVLRDG  511
            AGNAAAALMARLAPKAKV RDG
Sbjct  121  AGNAAAALMARLAPKAKVFRDG  142



>emb|CDP09440.1| unnamed protein product [Coffea canephora]
Length=966

 Score =   147 bits (370),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 118/142 (83%), Positives = 129/142 (91%), Gaps = 0/142 (0%)
 Frame = +2

Query  86   MAEKPEVLDAVLKETVDLENIPIEEVFENLRCTKDGLTSQAAQERLDIFGHNkleekkes  265
            M EK   LDAV+KE VDLENIP+EEVF+NL+CT+ GL+S A +ERLD+FG NKLEEKKES
Sbjct  1    MYEKSVALDAVIKEAVDLENIPLEEVFDNLKCTRKGLSSDAVKERLDLFGFNKLEEKKES  60

Query  266  kflkflgfMWNPLSWVMEaaaimaialaNGGGKPPDWQDFVGIITLLVINSTISFIEEnn  445
            K LKFLGFMWNPLSWVMEAAAIM+IALANGGGK PD QDFVGI+ LL+INSTISFIEENN
Sbjct  61   KVLKFLGFMWNPLSWVMEAAAIMSIALANGGGKGPDIQDFVGILLLLIINSTISFIEENN  120

Query  446  agnaaaalmarlapkaKVLRDG  511
            AGNAAAALMARLAPKAKVLRDG
Sbjct  121  AGNAAAALMARLAPKAKVLRDG  142



>dbj|BAM20990.1| plasma membrane H+-ATPase [Marchantia polymorpha]
Length=954

 Score =   145 bits (366),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 117/140 (84%), Positives = 126/140 (90%), Gaps = 0/140 (0%)
 Frame = +2

Query  92   EKPEVLDAVLKETVDLENIPIEEVFENLRCTKDGLTSQAAQERLDIFGHNkleekkeskf  271
            EK    +++  ETVDLE+IP+EEVFE LRCT+ GLTS   +ERL IFGHNKLEEK ESK 
Sbjct  5    EKMSKFESINNETVDLEHIPLEEVFEQLRCTRQGLTSAEGEERLVIFGHNKLEEKSESKV  64

Query  272  lkflgfMWNPLSWVMEaaaimaialaNGGGKPPDWQDFVGIITLLVINSTISFIEEnnag  451
            LKFLGFMWNPLSWVMEAAAIMAIALANGGG+PPDWQDFVGIITLLVINSTISFIEENNAG
Sbjct  65   LKFLGFMWNPLSWVMEAAAIMAIALANGGGRPPDWQDFVGIITLLVINSTISFIEENNAG  124

Query  452  naaaalmarlapkaKVLRDG  511
            NAAAALMARLAPK+KVLRDG
Sbjct  125  NAAAALMARLAPKSKVLRDG  144



>ref|XP_010545150.1| PREDICTED: ATPase 7, plasma membrane-type [Tarenaya hassleriana]
Length=1175

 Score =   145 bits (367),  Expect = 1e-36, Method: Composition-based stats.
 Identities = 113/142 (80%), Positives = 131/142 (92%), Gaps = 0/142 (0%)
 Frame = +2

Query  86   MAEKPEVLDAVLKETVDLENIPIEEVFENLRCTKDGLTSQAAQERLDIFGHNkleekkes  265
            MAEK E L A+ KE++DLEN+P+EEVF++L+CT++GL+S  AQERL +FG+NKLEEK+ES
Sbjct  1    MAEKSETLQAISKESIDLENVPLEEVFDHLKCTREGLSSNEAQERLSLFGYNKLEEKRES  60

Query  266  kflkflgfMWNPLSWVMEaaaimaialaNGGGKPPDWQDFVGIITLLVINSTISFIEEnn  445
            K LKFLGFMWNPLSWVMEAAAIMAIALA+GGGKPPD+ DFVGI+ LL+INSTISFIEENN
Sbjct  61   KILKFLGFMWNPLSWVMEAAAIMAIALAHGGGKPPDYHDFVGIVILLLINSTISFIEENN  120

Query  446  agnaaaalmarlapkaKVLRDG  511
            AGNAAAALMARLAPKAKV RDG
Sbjct  121  AGNAAAALMARLAPKAKVSRDG  142



>ref|XP_006837363.1| hypothetical protein AMTR_s00111p00107570 [Amborella trichopoda]
 gb|ERN00217.1| hypothetical protein AMTR_s00111p00107570 [Amborella trichopoda]
Length=1007

 Score =   144 bits (364),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 119/142 (84%), Positives = 129/142 (91%), Gaps = 0/142 (0%)
 Frame = +2

Query  86   MAEKPEVLDAVLKETVDLENIPIEEVFENLRCTKDGLTSQAAQERLDIFGHNkleekkes  265
            M EK   LDAV KE VDLENIPIEEVFE+L CT++GLTS+A QERL++FG+NKLEEKKES
Sbjct  45   MDEKSIALDAVNKEAVDLENIPIEEVFESLECTQEGLTSEAVQERLELFGYNKLEEKKES  104

Query  266  kflkflgfMWNPLSWVMEaaaimaialaNGGGKPPDWQDFVGIITLLVINSTISFIEEnn  445
            K LKFLGFMWNPLSWVME+AAIMAIALANGGGK PD+ DF GI+ LLVINSTISFIEENN
Sbjct  105  KLLKFLGFMWNPLSWVMESAAIMAIALANGGGKDPDYIDFCGIVILLVINSTISFIEENN  164

Query  446  agnaaaalmarlapkaKVLRDG  511
            AGNAAAALMARLAPKAKVLRDG
Sbjct  165  AGNAAAALMARLAPKAKVLRDG  186



>ref|XP_010529048.1| PREDICTED: ATPase 7, plasma membrane-type [Tarenaya hassleriana]
Length=960

 Score =   144 bits (363),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 113/142 (80%), Positives = 131/142 (92%), Gaps = 0/142 (0%)
 Frame = +2

Query  86   MAEKPEVLDAVLKETVDLENIPIEEVFENLRCTKDGLTSQAAQERLDIFGHNkleekkes  265
            MAEK E L A+ KE++DLEN+P+EEVF++L+CT++GL+S  AQERL +FG+NKLEEK+ES
Sbjct  1    MAEKSETLQAISKESIDLENVPLEEVFDHLKCTREGLSSNEAQERLSLFGYNKLEEKRES  60

Query  266  kflkflgfMWNPLSWVMEaaaimaialaNGGGKPPDWQDFVGIITLLVINSTISFIEEnn  445
            K LKFLGFMWNPLSWVMEAAAIMAIALA+GGGKPPD+ DFVGI+ LL+INSTISFIEENN
Sbjct  61   KILKFLGFMWNPLSWVMEAAAIMAIALAHGGGKPPDYHDFVGIVILLLINSTISFIEENN  120

Query  446  agnaaaalmarlapkaKVLRDG  511
            AGNAAAALMARLAPKAKV RDG
Sbjct  121  AGNAAAALMARLAPKAKVSRDG  142



>ref|XP_009335819.1| PREDICTED: plasma membrane ATPase 1-like [Pyrus x bretschneideri]
Length=956

 Score =   144 bits (362),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 117/142 (82%), Positives = 127/142 (89%), Gaps = 0/142 (0%)
 Frame = +2

Query  86   MAEKPEVLDAVLKETVDLENIPIEEVFENLRCTKDGLTSQAAQERLDIFGHNkleekkes  265
            M EK   LDAVLKE VDLE++P+EEV+  LRC K GLTS+A ++RL IFG NKLEEKKES
Sbjct  1    MDEKAVDLDAVLKEAVDLEHVPLEEVYVTLRCNKHGLTSEAVEQRLAIFGFNKLEEKKES  60

Query  266  kflkflgfMWNPLSWVMEaaaimaialaNGGGKPPDWQDFVGIITLLVINSTISFIEEnn  445
            K LKFLGFMWNPL+WVMEAAAIMAIALANGGGKPPDWQDF+GII LL+INSTISFIEENN
Sbjct  61   KVLKFLGFMWNPLAWVMEAAAIMAIALANGGGKPPDWQDFIGIIALLIINSTISFIEENN  120

Query  446  agnaaaalmarlapkaKVLRDG  511
            AGNAAAALMARLAPKAKV RDG
Sbjct  121  AGNAAAALMARLAPKAKVFRDG  142



>gb|AAN15220.1| plasma membrane P-type proton pump ATPase [Hordeum vulgare subsp. 
vulgare]
Length=956

 Score =   144 bits (362),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 114/135 (84%), Positives = 125/135 (93%), Gaps = 0/135 (0%)
 Frame = +2

Query  107  LDAVLKETVDLENIPIEEVFENLRCTKDGLTSQAAQERLDIFGHNkleekkeskflkflg  286
            L+AVLKE VDLENIP+EEV +NLRC+++GLT++ AQ+RL I G NKLEEK+ESKFLKFLG
Sbjct  9    LEAVLKEVVDLENIPLEEVLDNLRCSREGLTAEQAQQRLQILGPNKLEEKEESKFLKFLG  68

Query  287  fMWNPLSWVMEaaaimaialaNGGGKPPDWQDFVGIITLLVINSTISFIEEnnagnaaaa  466
            FMWNPLSWVME AAIMAIALANGGGKPPDWQDFVGII LLVINST+SFIEENNAGNAAAA
Sbjct  69   FMWNPLSWVMEMAAIMAIALANGGGKPPDWQDFVGIIVLLVINSTVSFIEENNAGNAAAA  128

Query  467  lmarlapkaKVLRDG  511
            LMA LAPK KVLRDG
Sbjct  129  LMANLAPKTKVLRDG  143



>gb|EPS65442.1| hypothetical protein M569_09334 [Genlisea aurea]
Length=954

 Score =   144 bits (362),  Expect = 5e-36, Method: Compositional matrix adjust.
 Identities = 118/143 (83%), Positives = 127/143 (89%), Gaps = 1/143 (1%)
 Frame = +2

Query  86   MAEKPEV-LDAVLKETVDLENIPIEEVFENLRCTKDGLTSQAAQERLDIFGHNkleekke  262
            MAEK  + L+ +  ETVDLE IPIEEVFENLRCT++GL+S+  + RL IFG NKLEEKKE
Sbjct  1    MAEKASISLEEIKNETVDLEKIPIEEVFENLRCTREGLSSEEGETRLQIFGPNKLEEKKE  60

Query  263  skflkflgfMWNPLSWVMEaaaimaialaNGGGKPPDWQDFVGIITLLVINSTISFIEEn  442
            SK LKFLGFMWNPLSWVMEAAAIMAIALANGGGKPPDWQDFVGII LL+INSTISFIEEN
Sbjct  61   SKILKFLGFMWNPLSWVMEAAAIMAIALANGGGKPPDWQDFVGIICLLLINSTISFIEEN  120

Query  443  nagnaaaalmarlapkaKVLRDG  511
            NAGNAAAALMA LAPK KVLRDG
Sbjct  121  NAGNAAAALMAGLAPKTKVLRDG  143



>tpg|DAA42486.1| TPA: H(+)-transporting ATPase [Zea mays]
Length=949

 Score =   143 bits (361),  Expect = 6e-36, Method: Composition-based stats.
 Identities = 117/140 (84%), Positives = 129/140 (92%), Gaps = 0/140 (0%)
 Frame = +2

Query  92   EKPEVLDAVLKETVDLENIPIEEVFENLRCTKDGLTSQAAQERLDIFGHNkleekkeskf  271
            +K   LDAVLKE VDLENI I+EVFE+LRC+  GL+++ A++RL IFG NKLEEK+ESKF
Sbjct  6    DKASNLDAVLKEAVDLENIAIQEVFESLRCSPQGLSTEQAEQRLAIFGPNKLEEKQESKF  65

Query  272  lkflgfMWNPLSWVMEaaaimaialaNGGGKPPDWQDFVGIITLLVINSTISFIEEnnag  451
            LKFLGFMWNPLSWVMEAAAIMAIALANGG KPPDWQDFVGIITLL+INSTISFIEENNAG
Sbjct  66   LKFLGFMWNPLSWVMEAAAIMAIALANGGNKPPDWQDFVGIITLLIINSTISFIEENNAG  125

Query  452  naaaalmarlapkaKVLRDG  511
            NAAAALMARLAPKAKVLR+G
Sbjct  126  NAAAALMARLAPKAKVLRNG  145



>ref|NP_001105360.1| membrane H(+)-ATPase1 [Zea mays]
 gb|AAB60276.1| H(+)-transporting ATPase [Zea mays]
Length=949

 Score =   143 bits (360),  Expect = 6e-36, Method: Composition-based stats.
 Identities = 117/140 (84%), Positives = 129/140 (92%), Gaps = 0/140 (0%)
 Frame = +2

Query  92   EKPEVLDAVLKETVDLENIPIEEVFENLRCTKDGLTSQAAQERLDIFGHNkleekkeskf  271
            +K   LDAVLKE VDLENI I+EVFE+LRC+  GL+++ A++RL IFG NKLEEK+ESKF
Sbjct  6    DKASNLDAVLKEAVDLENIAIQEVFESLRCSPQGLSTEQAEQRLAIFGPNKLEEKQESKF  65

Query  272  lkflgfMWNPLSWVMEaaaimaialaNGGGKPPDWQDFVGIITLLVINSTISFIEEnnag  451
            LKFLGFMWNPLSWVMEAAAIMAIALANGG KPPDWQDFVGIITLL+INSTISFIEENNAG
Sbjct  66   LKFLGFMWNPLSWVMEAAAIMAIALANGGNKPPDWQDFVGIITLLIINSTISFIEENNAG  125

Query  452  naaaalmarlapkaKVLRDG  511
            NAAAALMARLAPKAKVLR+G
Sbjct  126  NAAAALMARLAPKAKVLRNG  145



>ref|XP_002263241.1| PREDICTED: ATPase 8, plasma membrane-type [Vitis vinifera]
 emb|CBI25616.3| unnamed protein product [Vitis vinifera]
Length=952

 Score =   142 bits (359),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 112/135 (83%), Positives = 119/135 (88%), Gaps = 0/135 (0%)
 Frame = +2

Query  107  LDAVLKETVDLENIPIEEVFENLRCTKDGLTSQAAQERLDIFGHNkleekkeskflkflg  286
            L+ +  E+VDLE IPIEEVFE L+CTKDGLTS+  + RL IFGHNKLEEKKESK LKFLG
Sbjct  7    LEEIKNESVDLERIPIEEVFEQLKCTKDGLTSEEGEHRLQIFGHNKLEEKKESKILKFLG  66

Query  287  fMWNPLSWVMEaaaimaialaNGGGKPPDWQDFVGIITLLVINSTISFIEEnnagnaaaa  466
            FMWNPLSWVME AAIMAI LANGGGKPPDWQDFVGI  LL+INSTISFIEENNAGNAAAA
Sbjct  67   FMWNPLSWVMECAAIMAIVLANGGGKPPDWQDFVGITVLLIINSTISFIEENNAGNAAAA  126

Query  467  lmarlapkaKVLRDG  511
            LMA LAPK KVLRDG
Sbjct  127  LMAGLAPKTKVLRDG  141



>ref|XP_011031934.1| PREDICTED: plasma membrane ATPase 1 [Populus euphratica]
Length=965

 Score =   142 bits (358),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 113/142 (80%), Positives = 126/142 (89%), Gaps = 0/142 (0%)
 Frame = +2

Query  86   MAEKPEVLDAVLKETVDLENIPIEEVFENLRCTKDGLTSQAAQERLDIFGHNkleekkes  265
            M E    LDA+ KE VDLENIP+EEVFENLRCT++GLT+   +ERLD+FG+NKLEE+KE+
Sbjct  1    MVENSTALDAINKEAVDLENIPLEEVFENLRCTREGLTANEVRERLDLFGYNKLEEQKEN  60

Query  266  kflkflgfMWNPLSWVMEaaaimaialaNGGGKPPDWQDFVGIITLLVINSTISFIEEnn  445
            K LKFLGFMWNPLSWVMEAAAIMAI LA+GG K  D+ DFVGIITLL+INSTISFIEENN
Sbjct  61   KLLKFLGFMWNPLSWVMEAAAIMAIGLAHGGNKSADYHDFVGIITLLIINSTISFIEENN  120

Query  446  agnaaaalmarlapkaKVLRDG  511
            AGNAAAALMARLAPKAKVLRDG
Sbjct  121  AGNAAAALMARLAPKAKVLRDG  142



>gb|KJB66333.1| hypothetical protein B456_010G136300 [Gossypium raimondii]
Length=949

 Score =   142 bits (357),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 111/142 (78%), Positives = 125/142 (88%), Gaps = 0/142 (0%)
 Frame = +2

Query  86   MAEKPEVLDAVLKETVDLENIPIEEVFENLRCTKDGLTSQAAQERLDIFGHNkleekkes  265
            MA+K   L+ +  ETVDLE IP+EEVF+ L+CT++GLTS+  Q+RL IFG NKLEEKKE+
Sbjct  1    MADKSISLEEIKNETVDLERIPVEEVFQQLKCTRNGLTSEEGQKRLQIFGPNKLEEKKEN  60

Query  266  kflkflgfMWNPLSWVMEaaaimaialaNGGGKPPDWQDFVGIITLLVINSTISFIEEnn  445
            K LKFLGFMWNPLSWVME AAIMAIALANGGGKPPDWQDF+GI++LL INSTISFIEENN
Sbjct  61   KLLKFLGFMWNPLSWVMEFAAIMAIALANGGGKPPDWQDFIGIVSLLFINSTISFIEENN  120

Query  446  agnaaaalmarlapkaKVLRDG  511
            AGNAAAALMA LAPK KVLRDG
Sbjct  121  AGNAAAALMAGLAPKTKVLRDG  142



>dbj|BAM20989.1| plasma membrane H+-ATPase [Marchantia polymorpha]
Length=957

 Score =   140 bits (354),  Expect = 5e-35, Method: Compositional matrix adjust.
 Identities = 113/135 (84%), Positives = 120/135 (89%), Gaps = 0/135 (0%)
 Frame = +2

Query  107  LDAVLKETVDLENIPIEEVFENLRCTKDGLTSQAAQERLDIFGHNkleekkeskflkflg  286
             +++  ETVDLE IPIEEVF  LRCTK+GLTS   + RL IFG NKLEEK ESK LKFLG
Sbjct  11   FESLTDETVDLERIPIEEVFAQLRCTKEGLTSTEGETRLQIFGFNKLEEKSESKILKFLG  70

Query  287  fMWNPLSWVMEaaaimaialaNGGGKPPDWQDFVGIITLLVINSTISFIEEnnagnaaaa  466
            FMWNPLSWVMEAAAIMAIALANGGGKPPDWQDF+GIITLLVINSTISFIEENNAGNAAA+
Sbjct  71   FMWNPLSWVMEAAAIMAIALANGGGKPPDWQDFIGIITLLVINSTISFIEENNAGNAAAS  130

Query  467  lmarlapkaKVLRDG  511
            LMARLAPK KVLRDG
Sbjct  131  LMARLAPKTKVLRDG  145



>gb|EPS73574.1| hypothetical protein M569_01174, partial [Genlisea aurea]
Length=743

 Score =   139 bits (351),  Expect = 7e-35, Method: Compositional matrix adjust.
 Identities = 115/143 (80%), Positives = 126/143 (88%), Gaps = 1/143 (1%)
 Frame = +2

Query  86   MAEKPEV-LDAVLKETVDLENIPIEEVFENLRCTKDGLTSQAAQERLDIFGHNkleekke  262
            MAEK  + L+ +  ETVDLE +PIEEVFE LRCT++GL+S+  + RL IFG NKLEEKKE
Sbjct  1    MAEKESISLEEIKNETVDLEKVPIEEVFEKLRCTREGLSSEEGETRLHIFGPNKLEEKKE  60

Query  263  skflkflgfMWNPLSWVMEaaaimaialaNGGGKPPDWQDFVGIITLLVINSTISFIEEn  442
            SK LKFLGFMWNPLSWVMEAAAIMAIALANGGGKPPDWQDF+GII LL+INSTISFIEEN
Sbjct  61   SKILKFLGFMWNPLSWVMEAAAIMAIALANGGGKPPDWQDFMGIICLLIINSTISFIEEN  120

Query  443  nagnaaaalmarlapkaKVLRDG  511
            NAGNAAAALMA LAPK KVLRDG
Sbjct  121  NAGNAAAALMAGLAPKTKVLRDG  143



>gb|AFW59711.1| plasma membrane H+-transporting ATPase-like protein [Zea mays]
Length=961

 Score =   140 bits (353),  Expect = 8e-35, Method: Compositional matrix adjust.
 Identities = 110/135 (81%), Positives = 121/135 (90%), Gaps = 0/135 (0%)
 Frame = +2

Query  107  LDAVLKETVDLENIPIEEVFENLRCTKDGLTSQAAQERLDIFGHNkleekkeskflkflg  286
            L+ +  E VDLENIPIEEVFE L+CT++GL+S   Q+RL+IFG N+LEEKKESK LKFLG
Sbjct  14   LEEIKNEAVDLENIPIEEVFEQLKCTREGLSSSEGQQRLEIFGPNRLEEKKESKILKFLG  73

Query  287  fMWNPLSWVMEaaaimaialaNGGGKPPDWQDFVGIITLLVINSTISFIEEnnagnaaaa  466
            FMWNPLSWVME AA+MAIALANGGGKPPDW+DFVGII LLVINSTISFIEENNAGNAAAA
Sbjct  74   FMWNPLSWVMEMAAVMAIALANGGGKPPDWEDFVGIIVLLVINSTISFIEENNAGNAAAA  133

Query  467  lmarlapkaKVLRDG  511
            LMA LAPK KVLRDG
Sbjct  134  LMANLAPKTKVLRDG  148



>ref|XP_008663681.1| PREDICTED: plasma membrane ATPase isoform X2 [Zea mays]
 gb|AFW59712.1| plasma membrane H+-transporting ATPase-like protein [Zea mays]
Length=951

 Score =   140 bits (352),  Expect = 9e-35, Method: Compositional matrix adjust.
 Identities = 110/135 (81%), Positives = 121/135 (90%), Gaps = 0/135 (0%)
 Frame = +2

Query  107  LDAVLKETVDLENIPIEEVFENLRCTKDGLTSQAAQERLDIFGHNkleekkeskflkflg  286
            L+ +  E VDLENIPIEEVFE L+CT++GL+S   Q+RL+IFG N+LEEKKESK LKFLG
Sbjct  4    LEEIKNEAVDLENIPIEEVFEQLKCTREGLSSSEGQQRLEIFGPNRLEEKKESKILKFLG  63

Query  287  fMWNPLSWVMEaaaimaialaNGGGKPPDWQDFVGIITLLVINSTISFIEEnnagnaaaa  466
            FMWNPLSWVME AA+MAIALANGGGKPPDW+DFVGII LLVINSTISFIEENNAGNAAAA
Sbjct  64   FMWNPLSWVMEMAAVMAIALANGGGKPPDWEDFVGIIVLLVINSTISFIEENNAGNAAAA  123

Query  467  lmarlapkaKVLRDG  511
            LMA LAPK KVLRDG
Sbjct  124  LMANLAPKTKVLRDG  138



>ref|XP_010430916.1| PREDICTED: ATPase 8, plasma membrane-type-like [Camelina sativa]
Length=334

 Score =   135 bits (339),  Expect = 9e-35, Method: Compositional matrix adjust.
 Identities = 106/134 (79%), Positives = 120/134 (90%), Gaps = 0/134 (0%)
 Frame = +2

Query  110  DAVLKETVDLENIPIEEVFENLRCTKDGLTSQAAQERLDIFGHNkleekkeskflkflgf  289
            D + KE VDLE IP+EEVFE L+C+K+GL+S   ++RL+IFG NKLEEK E+KFLKFLGF
Sbjct  8    DEIKKENVDLERIPVEEVFEQLKCSKEGLSSDEGKKRLEIFGANKLEEKSENKFLKFLGF  67

Query  290  MWNPLSWVMEaaaimaialaNGGGKPPDWQDFVGIITLLVINSTISFIEEnnagnaaaal  469
            MWNPLSWVME+AAIMAI LANGGGKPPDWQDF+GI+ LL+INSTISFIEENNAGNAAAAL
Sbjct  68   MWNPLSWVMESAAIMAIVLANGGGKPPDWQDFIGIMVLLIINSTISFIEENNAGNAAAAL  127

Query  470  marlapkaKVLRDG  511
            MA LAPK KVLRDG
Sbjct  128  MANLAPKTKVLRDG  141



>gb|EMS59303.1| Plasma membrane ATPase [Triticum urartu]
Length=1039

 Score =   140 bits (352),  Expect = 9e-35, Method: Composition-based stats.
 Identities = 104/141 (74%), Positives = 121/141 (86%), Gaps = 0/141 (0%)
 Frame = +2

Query  89   AEKPEVLDAVLKETVDLENIPIEEVFENLRCTKDGLTSQAAQERLDIFGHNkleekkesk  268
            A   E L+ +  E VDLENIP+EEVFENL+C+  GLTS+  Q+R+ +FG NKLEEKKES+
Sbjct  3    AAAAEGLERIKNEAVDLENIPVEEVFENLQCSSAGLTSKDGQDRIAVFGPNKLEEKKESE  62

Query  269  flkflgfMWNPLSWVMEaaaimaialaNGGGKPPDWQDFVGIITLLVINSTISFIEEnna  448
             LKFLGFMWNPLSWVME AAIMAIALANGGG+PPDWQDFVGII LL++NSTIS+IEE+NA
Sbjct  63   ILKFLGFMWNPLSWVMEVAAIMAIALANGGGRPPDWQDFVGIIALLLLNSTISYIEESNA  122

Query  449  gnaaaalmarlapkaKVLRDG  511
            G++A ALMA LAPK KVLRDG
Sbjct  123  GSSAKALMANLAPKTKVLRDG  143



>ref|XP_008668762.1| PREDICTED: plasma membrane ATPase [Zea mays]
 tpg|DAA35606.1| TPA: plasma-membrane H+ATPase2 isoform 1 [Zea mays]
 tpg|DAA35607.1| TPA: plasma-membrane H+ATPase2 isoform 2 [Zea mays]
Length=951

 Score =   140 bits (352),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 112/135 (83%), Positives = 121/135 (90%), Gaps = 0/135 (0%)
 Frame = +2

Query  107  LDAVLKETVDLENIPIEEVFENLRCTKDGLTSQAAQERLDIFGHNkleekkeskflkflg  286
            L+ +  E VDLENIPIEEVFE L+CT++GL+S   Q+RL+IFG N+LEEKKESK LKFLG
Sbjct  4    LEEIKNEAVDLENIPIEEVFEQLKCTREGLSSSEGQQRLEIFGPNRLEEKKESKVLKFLG  63

Query  287  fMWNPLSWVMEaaaimaialaNGGGKPPDWQDFVGIITLLVINSTISFIEEnnagnaaaa  466
            FMWNPLSWVME AAIMAIALANGGGKPPDWQDFVGII LLVINSTISFIEENNAGNAAAA
Sbjct  64   FMWNPLSWVMEMAAIMAIALANGGGKPPDWQDFVGIIVLLVINSTISFIEENNAGNAAAA  123

Query  467  lmarlapkaKVLRDG  511
            LMA LAPK KVLRDG
Sbjct  124  LMANLAPKTKVLRDG  138



>gb|ACL54575.1| unknown [Zea mays]
Length=951

 Score =   140 bits (352),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 112/135 (83%), Positives = 121/135 (90%), Gaps = 0/135 (0%)
 Frame = +2

Query  107  LDAVLKETVDLENIPIEEVFENLRCTKDGLTSQAAQERLDIFGHNkleekkeskflkflg  286
            L+ +  E VDLENIPIEEVFE L+CT++GL+S   Q+RL+IFG N+LEEKKESK LKFLG
Sbjct  4    LEEIKNEAVDLENIPIEEVFEQLKCTREGLSSSEGQQRLEIFGPNRLEEKKESKVLKFLG  63

Query  287  fMWNPLSWVMEaaaimaialaNGGGKPPDWQDFVGIITLLVINSTISFIEEnnagnaaaa  466
            FMWNPLSWVME AAIMAIALANGGGKPPDWQDFVGII LLVINSTISFIEENNAGNAAAA
Sbjct  64   FMWNPLSWVMEMAAIMAIALANGGGKPPDWQDFVGIIVLLVINSTISFIEENNAGNAAAA  123

Query  467  lmarlapkaKVLRDG  511
            LMA LAPK KVLRDG
Sbjct  124  LMANLAPKTKVLRDG  138



>ref|XP_008663679.1| PREDICTED: plasma membrane ATPase isoform X1 [Zea mays]
Length=982

 Score =   140 bits (352),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 110/135 (81%), Positives = 121/135 (90%), Gaps = 0/135 (0%)
 Frame = +2

Query  107  LDAVLKETVDLENIPIEEVFENLRCTKDGLTSQAAQERLDIFGHNkleekkeskflkflg  286
            L+ +  E VDLENIPIEEVFE L+CT++GL+S   Q+RL+IFG N+LEEKKESK LKFLG
Sbjct  4    LEEIKNEAVDLENIPIEEVFEQLKCTREGLSSSEGQQRLEIFGPNRLEEKKESKILKFLG  63

Query  287  fMWNPLSWVMEaaaimaialaNGGGKPPDWQDFVGIITLLVINSTISFIEEnnagnaaaa  466
            FMWNPLSWVME AA+MAIALANGGGKPPDW+DFVGII LLVINSTISFIEENNAGNAAAA
Sbjct  64   FMWNPLSWVMEMAAVMAIALANGGGKPPDWEDFVGIIVLLVINSTISFIEENNAGNAAAA  123

Query  467  lmarlapkaKVLRDG  511
            LMA LAPK KVLRDG
Sbjct  124  LMANLAPKTKVLRDG  138



>ref|XP_010496530.1| PREDICTED: ATPase 8, plasma membrane-type-like, partial [Camelina 
sativa]
Length=400

 Score =   135 bits (341),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 106/134 (79%), Positives = 120/134 (90%), Gaps = 0/134 (0%)
 Frame = +2

Query  110  DAVLKETVDLENIPIEEVFENLRCTKDGLTSQAAQERLDIFGHNkleekkeskflkflgf  289
            D + KE VDLE IP+EEVFE L+C+K+GL+S   ++RL+IFG NKLEEK E+KFLKFLGF
Sbjct  8    DEIKKENVDLERIPVEEVFEQLKCSKEGLSSDEGKKRLEIFGANKLEEKSENKFLKFLGF  67

Query  290  MWNPLSWVMEaaaimaialaNGGGKPPDWQDFVGIITLLVINSTISFIEEnnagnaaaal  469
            MWNPLSWVME+AAIMAI LANGGGKPPDWQDF+GI+ LL+INSTISFIEENNAGNAAAAL
Sbjct  68   MWNPLSWVMESAAIMAIVLANGGGKPPDWQDFIGIMVLLIINSTISFIEENNAGNAAAAL  127

Query  470  marlapkaKVLRDG  511
            MA LAPK KVLRDG
Sbjct  128  MANLAPKTKVLRDG  141



>gb|EYU31795.1| hypothetical protein MIMGU_mgv1a000883mg [Erythranthe guttata]
Length=951

 Score =   139 bits (350),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 109/135 (81%), Positives = 123/135 (91%), Gaps = 0/135 (0%)
 Frame = +2

Query  107  LDAVLKETVDLENIPIEEVFENLRCTKDGLTSQAAQERLDIFGHNkleekkeskflkflg  286
            L+A+  ET+DLE++PIEEVF  L+CT++GLTS+   +RLDIFG NKLEEK+ESKFLKFLG
Sbjct  7    LEAIKNETIDLEHMPIEEVFAELKCTREGLTSEEGAKRLDIFGPNKLEEKQESKFLKFLG  66

Query  287  fMWNPLSWVMEaaaimaialaNGGGKPPDWQDFVGIITLLVINSTISFIEEnnagnaaaa  466
            FMWNPLSWVME+AAIMAI LANGGGKPPDWQDFVGI+ LL+INSTISFIEENNAGNAAAA
Sbjct  67   FMWNPLSWVMESAAIMAIVLANGGGKPPDWQDFVGILVLLIINSTISFIEENNAGNAAAA  126

Query  467  lmarlapkaKVLRDG  511
            LMA LAPK KVLRDG
Sbjct  127  LMAGLAPKTKVLRDG  141



>ref|XP_010942146.1| PREDICTED: plasma membrane ATPase 4-like [Elaeis guineensis]
Length=950

 Score =   139 bits (350),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 109/135 (81%), Positives = 120/135 (89%), Gaps = 0/135 (0%)
 Frame = +2

Query  107  LDAVLKETVDLENIPIEEVFENLRCTKDGLTSQAAQERLDIFGHNkleekkeskflkflg  286
            L+ +  ETVDLENIP+EEVFE L+C+++GLTS   ++RL IFG NKLEEKKESK LKFLG
Sbjct  6    LEQIKNETVDLENIPVEEVFEQLKCSREGLTSAEGEQRLQIFGPNKLEEKKESKLLKFLG  65

Query  287  fMWNPLSWVMEaaaimaialaNGGGKPPDWQDFVGIITLLVINSTISFIEEnnagnaaaa  466
            FMWNPLSWVME AAIMAI LANGGGKPPDWQDFVGI+ LL+INSTISFIEENNAGNAAAA
Sbjct  66   FMWNPLSWVMEIAAIMAIVLANGGGKPPDWQDFVGIVVLLIINSTISFIEENNAGNAAAA  125

Query  467  lmarlapkaKVLRDG  511
            LMA LAPK KVLRDG
Sbjct  126  LMAGLAPKTKVLRDG  140



>ref|XP_001782121.1| predicted protein [Physcomitrella patens]
 gb|EDQ53065.1| predicted protein, partial [Physcomitrella patens]
Length=465

 Score =   136 bits (342),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 108/137 (79%), Positives = 119/137 (87%), Gaps = 0/137 (0%)
 Frame = +2

Query  101  EVLDAVLKETVDLENIPIEEVFENLRCTKDGLTSQAAQERLDIFGHNkleekkeskflkf  280
            E L A+  ETVDLE+IP+EEVFE LRCT+ GLT    ++R+ I G NKLEEK ESK LKF
Sbjct  2    EALQALNNETVDLEHIPVEEVFEQLRCTRQGLTDAEGEQRIKICGPNKLEEKSESKILKF  61

Query  281  lgfMWNPLSWVMEaaaimaialaNGGGKPPDWQDFVGIITLLVINSTISFIEEnnagnaa  460
            LGFMWNPLSWVMEAAAIMAIALANGGG+PPDWQDFVGII LL+INSTISFIEENNAG AA
Sbjct  62   LGFMWNPLSWVMEAAAIMAIALANGGGRPPDWQDFVGIIVLLIINSTISFIEENNAGQAA  121

Query  461  aalmarlapkaKVLRDG  511
            A+LMARLAP+ KVLRDG
Sbjct  122  ASLMARLAPQTKVLRDG  138



>ref|XP_009610942.1| PREDICTED: ATPase 9, plasma membrane-type-like [Nicotiana tomentosiformis]
Length=926

 Score =   139 bits (349),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 107/142 (75%), Positives = 124/142 (87%), Gaps = 0/142 (0%)
 Frame = +2

Query  86   MAEKPEVLDAVLKETVDLENIPIEEVFENLRCTKDGLTSQAAQERLDIFGHNkleekkes  265
            MA    +L+ +  E VDLENIP+EEVF+ L+C+++GLT++  Q RL IFGHNKLEEKKE+
Sbjct  1    MASNLSLLEDIRNEQVDLENIPVEEVFQCLKCSREGLTNEEGQNRLQIFGHNKLEEKKEN  60

Query  266  kflkflgfMWNPLSWVMEaaaimaialaNGGGKPPDWQDFVGIITLLVINSTISFIEEnn  445
            K LKFLGFMWNPLSWVMEAAA+M+IALANGGGKPPDW DFVGI+ LL+INSTISFIEENN
Sbjct  61   KVLKFLGFMWNPLSWVMEAAAVMSIALANGGGKPPDWPDFVGIVVLLIINSTISFIEENN  120

Query  446  agnaaaalmarlapkaKVLRDG  511
            AGNAAAALMA LAPK K+LRDG
Sbjct  121  AGNAAAALMANLAPKTKILRDG  142



>gb|ABR26203.1| plasma membrane atpase 1 [Oryza sativa Indica Group]
Length=279

 Score =   133 bits (334),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 112/122 (92%), Positives = 120/122 (98%), Gaps = 0/122 (0%)
 Frame = +2

Query  146  IPIEEVFENLRCTKDGLTSQAAQERLDIFGHNkleekkeskflkflgfMWNPLSWVMEaa  325
            IP+EEVFENLRC+++GLT+Q AQ+RL+IFG NKLEEK+ESKFLKFLGFMWNPLSWVMEAA
Sbjct  1    IPLEEVFENLRCSREGLTTQQAQQRLEIFGPNKLEEKEESKFLKFLGFMWNPLSWVMEAA  60

Query  326  aimaialaNGGGKPPDWQDFVGIITLLVINSTISFIEEnnagnaaaalmarlapkaKVLR  505
            AIMAIALANGGGKPPDWQDFVGIITLLVINSTISFIEENNAGNAAAALMARLAPKAKVLR
Sbjct  61   AIMAIALANGGGKPPDWQDFVGIITLLVINSTISFIEENNAGNAAAALMARLAPKAKVLR  120

Query  506  DG  511
            DG
Sbjct  121  DG  122



>ref|XP_008784793.1| PREDICTED: plasma membrane ATPase 4-like isoform X1 [Phoenix 
dactylifera]
Length=979

 Score =   139 bits (349),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 108/135 (80%), Positives = 119/135 (88%), Gaps = 0/135 (0%)
 Frame = +2

Query  107  LDAVLKETVDLENIPIEEVFENLRCTKDGLTSQAAQERLDIFGHNkleekkeskflkflg  286
            L+ +  ETVDLENIP+EEVFE L+C+++GLTS   ++RL IFG NKLEEKKE K LKFLG
Sbjct  6    LEQIKNETVDLENIPVEEVFEQLKCSREGLTSAEGEQRLQIFGPNKLEEKKECKLLKFLG  65

Query  287  fMWNPLSWVMEaaaimaialaNGGGKPPDWQDFVGIITLLVINSTISFIEEnnagnaaaa  466
            FMWNPLSWVME AAIMAI LANGGGKPPDWQDFVGI+ LL+INSTISFIEENNAGNAAAA
Sbjct  66   FMWNPLSWVMEIAAIMAIVLANGGGKPPDWQDFVGIVVLLIINSTISFIEENNAGNAAAA  125

Query  467  lmarlapkaKVLRDG  511
            LMA LAPK KVLRDG
Sbjct  126  LMAGLAPKTKVLRDG  140



>ref|XP_006651704.1| PREDICTED: plasma membrane ATPase 1-like [Oryza brachyantha]
Length=997

 Score =   139 bits (349),  Expect = 2e-34, Method: Composition-based stats.
 Identities = 125/183 (68%), Positives = 135/183 (74%), Gaps = 41/183 (22%)
 Frame = +2

Query  86   MAEKPEVLDAVLKETVDL-----------------------------------------E  142
            MAEK   LDAVLKE+VDL                                         E
Sbjct  1    MAEKEGGLDAVLKESVDLVTHASSWDGSCRVQCGFQFRVTVSARDDWSPSCAAAVRRILE  60

Query  143  NIPIEEVFENLRCTKDGLTSQAAQERLDIFGHNkleekkeskflkflgfMWNPLSWVMEa  322
            NIPIEEVF+NLRC++ GLTS+ A+ RL++FG NKLEEK+ESKFLKFLGFMWNPLSWVMEA
Sbjct  61   NIPIEEVFQNLRCSRHGLTSEEAKLRLELFGPNKLEEKEESKFLKFLGFMWNPLSWVMEA  120

Query  323  aaimaialaNGGGKPPDWQDFVGIITLLVINSTISFIEEnnagnaaaalmarlapkaKVL  502
            AAIMAIALANGGGKPPDWQDFVGIITLL+INSTISFIEENNAGNAAAALMARLAPKAKVL
Sbjct  121  AAIMAIALANGGGKPPDWQDFVGIITLLLINSTISFIEENNAGNAAAALMARLAPKAKVL  180

Query  503  RDG  511
            RDG
Sbjct  181  RDG  183



>ref|XP_006375124.1| H+-ATPase family protein [Populus trichocarpa]
 gb|ERP52921.1| H+-ATPase family protein [Populus trichocarpa]
Length=965

 Score =   139 bits (349),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 113/142 (80%), Positives = 126/142 (89%), Gaps = 0/142 (0%)
 Frame = +2

Query  86   MAEKPEVLDAVLKETVDLENIPIEEVFENLRCTKDGLTSQAAQERLDIFGHNkleekkes  265
            M E    LDA+ KE VDLENIP+EEVF+NL+CT++GLT+   +ERLD+FG+NKLEEKKES
Sbjct  1    MVENSIALDAINKEAVDLENIPLEEVFDNLKCTREGLTANEVRERLDLFGYNKLEEKKES  60

Query  266  kflkflgfMWNPLSWVMEaaaimaialaNGGGKPPDWQDFVGIITLLVINSTISFIEEnn  445
            K LKFLGFMWNPLSWVMEAAAIMAI LA+GG K  D+ DFVGIITLL+INSTISFIEENN
Sbjct  61   KLLKFLGFMWNPLSWVMEAAAIMAIGLAHGGNKSADYHDFVGIITLLIINSTISFIEENN  120

Query  446  agnaaaalmarlapkaKVLRDG  511
            AGNAAAALMARLAPKAKVLRDG
Sbjct  121  AGNAAAALMARLAPKAKVLRDG  142



>ref|XP_008784794.1| PREDICTED: plasma membrane ATPase 4-like isoform X2 [Phoenix 
dactylifera]
Length=950

 Score =   138 bits (348),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 108/135 (80%), Positives = 119/135 (88%), Gaps = 0/135 (0%)
 Frame = +2

Query  107  LDAVLKETVDLENIPIEEVFENLRCTKDGLTSQAAQERLDIFGHNkleekkeskflkflg  286
            L+ +  ETVDLENIP+EEVFE L+C+++GLTS   ++RL IFG NKLEEKKE K LKFLG
Sbjct  6    LEQIKNETVDLENIPVEEVFEQLKCSREGLTSAEGEQRLQIFGPNKLEEKKECKLLKFLG  65

Query  287  fMWNPLSWVMEaaaimaialaNGGGKPPDWQDFVGIITLLVINSTISFIEEnnagnaaaa  466
            FMWNPLSWVME AAIMAI LANGGGKPPDWQDFVGI+ LL+INSTISFIEENNAGNAAAA
Sbjct  66   FMWNPLSWVMEIAAIMAIVLANGGGKPPDWQDFVGIVVLLIINSTISFIEENNAGNAAAA  125

Query  467  lmarlapkaKVLRDG  511
            LMA LAPK KVLRDG
Sbjct  126  LMAGLAPKTKVLRDG  140



>ref|XP_006279360.1| hypothetical protein CARUB_v10008027mg [Capsella rubella]
 gb|ABA18104.1| putative plasma membrane ATPase [Capsella rubella]
 gb|EOA12258.1| hypothetical protein CARUB_v10008027mg [Capsella rubella]
Length=948

 Score =   138 bits (348),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 106/134 (79%), Positives = 120/134 (90%), Gaps = 0/134 (0%)
 Frame = +2

Query  110  DAVLKETVDLENIPIEEVFENLRCTKDGLTSQAAQERLDIFGHNkleekkeskflkflgf  289
            D + KE VDLE IP+EEVFE L+CTK+GL+S   ++RL+IFG NKLEEK E+KFLKFLGF
Sbjct  8    DEIKKENVDLERIPVEEVFEQLKCTKEGLSSDEGKKRLEIFGANKLEEKSENKFLKFLGF  67

Query  290  MWNPLSWVMEaaaimaialaNGGGKPPDWQDFVGIITLLVINSTISFIEEnnagnaaaal  469
            MWNPLSWVME+AAIMAI LANGGGKPPDWQDF+GI+ LL+INSTISFIEENNAGNAA+AL
Sbjct  68   MWNPLSWVMESAAIMAIVLANGGGKPPDWQDFIGIMVLLIINSTISFIEENNAGNAASAL  127

Query  470  marlapkaKVLRDG  511
            MA LAPK KVLRDG
Sbjct  128  MANLAPKTKVLRDG  141



>ref|XP_009396235.1| PREDICTED: plasma membrane ATPase [Musa acuminata subsp. malaccensis]
Length=954

 Score =   138 bits (348),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 111/135 (82%), Positives = 118/135 (87%), Gaps = 0/135 (0%)
 Frame = +2

Query  107  LDAVLKETVDLENIPIEEVFENLRCTKDGLTSQAAQERLDIFGHNkleekkeskflkflg  286
            L+ +  E VDLE +PIEEVFE L+CT++GLTSQ    RL IFG NKLEEKKESK LKFLG
Sbjct  9    LEEIKNENVDLERVPIEEVFEQLKCTREGLTSQEGANRLQIFGPNKLEEKKESKVLKFLG  68

Query  287  fMWNPLSWVMEaaaimaialaNGGGKPPDWQDFVGIITLLVINSTISFIEEnnagnaaaa  466
            FMWNPLSWVME AA+MAIALANGGGKPPDWQDFVGII LLVINSTISFIEENNAGNAAAA
Sbjct  69   FMWNPLSWVMEMAAVMAIALANGGGKPPDWQDFVGIIVLLVINSTISFIEENNAGNAAAA  128

Query  467  lmarlapkaKVLRDG  511
            LMA LAPK KVLRDG
Sbjct  129  LMAGLAPKTKVLRDG  143



>ref|XP_010928676.1| PREDICTED: plasma membrane ATPase-like [Elaeis guineensis]
Length=954

 Score =   138 bits (347),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 112/135 (83%), Positives = 121/135 (90%), Gaps = 0/135 (0%)
 Frame = +2

Query  107  LDAVLKETVDLENIPIEEVFENLRCTKDGLTSQAAQERLDIFGHNkleekkeskflkflg  286
            L+ +  ETVDLENIPIEEVF+ L+CT++GLTS     RL +FG NKLEEKKESKFLKFLG
Sbjct  9    LEEIKNETVDLENIPIEEVFQQLKCTREGLTSDEGAHRLQLFGPNKLEEKKESKFLKFLG  68

Query  287  fMWNPLSWVMEaaaimaialaNGGGKPPDWQDFVGIITLLVINSTISFIEEnnagnaaaa  466
            FMWNPLSWVME+AAIMAIALANGGGKPPDWQDFVGI+ LLVINSTISFIEENNAGNAAAA
Sbjct  69   FMWNPLSWVMESAAIMAIALANGGGKPPDWQDFVGIVVLLVINSTISFIEENNAGNAAAA  128

Query  467  lmarlapkaKVLRDG  511
            LMA LAPK KVLRDG
Sbjct  129  LMAGLAPKTKVLRDG  143



>ref|XP_002447249.1| hypothetical protein SORBIDRAFT_06g031240 [Sorghum bicolor]
 gb|EES11577.1| hypothetical protein SORBIDRAFT_06g031240 [Sorghum bicolor]
Length=951

 Score =   138 bits (347),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 112/135 (83%), Positives = 121/135 (90%), Gaps = 0/135 (0%)
 Frame = +2

Query  107  LDAVLKETVDLENIPIEEVFENLRCTKDGLTSQAAQERLDIFGHNkleekkeskflkflg  286
            L+ +  E VDLENIPIEEVFE L+CT++GL+S   Q+RL+IFG NKLEEKKESK LKFLG
Sbjct  4    LEEIKNEAVDLENIPIEEVFEQLKCTREGLSSSEGQQRLEIFGPNKLEEKKESKILKFLG  63

Query  287  fMWNPLSWVMEaaaimaialaNGGGKPPDWQDFVGIITLLVINSTISFIEEnnagnaaaa  466
            FMWNPLSWVME AAIMAIALANGGGKPPDW+DFVGII LLVINSTISFIEENNAGNAAAA
Sbjct  64   FMWNPLSWVMEMAAIMAIALANGGGKPPDWEDFVGIIVLLVINSTISFIEENNAGNAAAA  123

Query  467  lmarlapkaKVLRDG  511
            LMA LAPK KVLRDG
Sbjct  124  LMANLAPKTKVLRDG  138



>ref|XP_007023381.1| H(+)-ATPase 9 [Theobroma cacao]
 gb|EOY26003.1| H(+)-ATPase 9 [Theobroma cacao]
Length=953

 Score =   138 bits (347),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 112/142 (79%), Positives = 121/142 (85%), Gaps = 0/142 (0%)
 Frame = +2

Query  86   MAEKPEVLDAVLKETVDLENIPIEEVFENLRCTKDGLTSQAAQERLDIFGHNkleekkes  265
            M +K   L  +  E VDLE IPIEEVFE L+CTK+GLTS+   +RL IFG NKLEEKKES
Sbjct  1    MVDKENSLQEIKSENVDLERIPIEEVFEQLKCTKEGLTSEEGHKRLQIFGPNKLEEKKES  60

Query  266  kflkflgfMWNPLSWVMEaaaimaialaNGGGKPPDWQDFVGIITLLVINSTISFIEEnn  445
            KFLKFLGFMWNPLSWVME AAIMAI LANGGGKPPDWQDF+GI+ LL+INSTISFIEENN
Sbjct  61   KFLKFLGFMWNPLSWVMEIAAIMAICLANGGGKPPDWQDFLGIVVLLLINSTISFIEENN  120

Query  446  agnaaaalmarlapkaKVLRDG  511
            AGNAAAALMA LAPK KVLRDG
Sbjct  121  AGNAAAALMAGLAPKTKVLRDG  142



>ref|XP_008781833.1| PREDICTED: plasma membrane ATPase 4 [Phoenix dactylifera]
 ref|XP_008781834.1| PREDICTED: plasma membrane ATPase 4 [Phoenix dactylifera]
Length=954

 Score =   137 bits (346),  Expect = 5e-34, Method: Compositional matrix adjust.
 Identities = 112/135 (83%), Positives = 119/135 (88%), Gaps = 0/135 (0%)
 Frame = +2

Query  107  LDAVLKETVDLENIPIEEVFENLRCTKDGLTSQAAQERLDIFGHNkleekkeskflkflg  286
            L+ +  ETVDLE IPIEEVFE L+CTK+GLTS+    RL IFG NKLEEKKESK LKFLG
Sbjct  9    LEEIKNETVDLERIPIEEVFEQLKCTKEGLTSEEGANRLQIFGPNKLEEKKESKILKFLG  68

Query  287  fMWNPLSWVMEaaaimaialaNGGGKPPDWQDFVGIITLLVINSTISFIEEnnagnaaaa  466
            FMWNPLSWVME+AA+MAIALANG GKPPDWQDFVGII LLVINSTISFIEENNAGNAAAA
Sbjct  69   FMWNPLSWVMESAAVMAIALANGSGKPPDWQDFVGIIVLLVINSTISFIEENNAGNAAAA  128

Query  467  lmarlapkaKVLRDG  511
            LMA LAPK KVLRDG
Sbjct  129  LMAGLAPKTKVLRDG  143



>ref|XP_006440236.1| hypothetical protein CICLE_v10018727mg [Citrus clementina]
 gb|ESR53476.1| hypothetical protein CICLE_v10018727mg [Citrus clementina]
Length=959

 Score =   137 bits (346),  Expect = 6e-34, Method: Composition-based stats.
 Identities = 110/135 (81%), Positives = 121/135 (90%), Gaps = 0/135 (0%)
 Frame = +2

Query  107  LDAVLKETVDLENIPIEEVFENLRCTKDGLTSQAAQERLDIFGHNkleekkeskflkflg  286
            L+A+ KE VDLENIPIEEVFENL+CT DGL+S   Q RL++FGHNKLEEKKE+K LKFLG
Sbjct  8    LEAISKEAVDLENIPIEEVFENLKCTSDGLSSDEVQSRLEVFGHNKLEEKKENKILKFLG  67

Query  287  fMWNPLSWVMEaaaimaialaNGGGKPPDWQDFVGIITLLVINSTISFIEEnnagnaaaa  466
            FMWNPLSWVMEAAA+MAI LA GGGK  D+ DFVGI+ LL+INSTISFIEENNAGNAAAA
Sbjct  68   FMWNPLSWVMEAAALMAITLARGGGKDVDYHDFVGILALLIINSTISFIEENNAGNAAAA  127

Query  467  lmarlapkaKVLRDG  511
            LMARLAPKAKVLRDG
Sbjct  128  LMARLAPKAKVLRDG  142



>ref|XP_006477127.1| PREDICTED: ATPase 11, plasma membrane-type-like [Citrus sinensis]
Length=958

 Score =   137 bits (346),  Expect = 7e-34, Method: Composition-based stats.
 Identities = 110/135 (81%), Positives = 121/135 (90%), Gaps = 0/135 (0%)
 Frame = +2

Query  107  LDAVLKETVDLENIPIEEVFENLRCTKDGLTSQAAQERLDIFGHNkleekkeskflkflg  286
            L+A+ KE VDLENIPIEEVFENL+CT DGL+S   Q RL++FGHNKLEEKKE+K LKFLG
Sbjct  8    LEAISKEAVDLENIPIEEVFENLKCTSDGLSSDEVQSRLEVFGHNKLEEKKENKILKFLG  67

Query  287  fMWNPLSWVMEaaaimaialaNGGGKPPDWQDFVGIITLLVINSTISFIEEnnagnaaaa  466
            FMWNPLSWVMEAAA+MAI LA GGGK  D+ DFVGI+ LL+INSTISFIEENNAGNAAAA
Sbjct  68   FMWNPLSWVMEAAALMAITLARGGGKDVDYHDFVGILALLIINSTISFIEENNAGNAAAA  127

Query  467  lmarlapkaKVLRDG  511
            LMARLAPKAKVLRDG
Sbjct  128  LMARLAPKAKVLRDG  142



>gb|KDO61318.1| hypothetical protein CISIN_1g002151mg [Citrus sinensis]
Length=959

 Score =   137 bits (346),  Expect = 7e-34, Method: Composition-based stats.
 Identities = 110/135 (81%), Positives = 121/135 (90%), Gaps = 0/135 (0%)
 Frame = +2

Query  107  LDAVLKETVDLENIPIEEVFENLRCTKDGLTSQAAQERLDIFGHNkleekkeskflkflg  286
            L+A+ KE VDLENIPIEEVFENL+CT DGL+S   Q RL++FGHNKLEEKKE+K LKFLG
Sbjct  8    LEAISKEAVDLENIPIEEVFENLKCTSDGLSSDEVQSRLEVFGHNKLEEKKENKILKFLG  67

Query  287  fMWNPLSWVMEaaaimaialaNGGGKPPDWQDFVGIITLLVINSTISFIEEnnagnaaaa  466
            FMWNPLSWVMEAAA+MAI LA GGGK  D+ DFVGI+ LL+INSTISFIEENNAGNAAAA
Sbjct  68   FMWNPLSWVMEAAALMAITLARGGGKDVDYHDFVGILALLIINSTISFIEENNAGNAAAA  127

Query  467  lmarlapkaKVLRDG  511
            LMARLAPKAKVLRDG
Sbjct  128  LMARLAPKAKVLRDG  142



>gb|KJB70727.1| hypothetical protein B456_011G089100 [Gossypium raimondii]
Length=953

 Score =   137 bits (345),  Expect = 7e-34, Method: Compositional matrix adjust.
 Identities = 109/142 (77%), Positives = 122/142 (86%), Gaps = 0/142 (0%)
 Frame = +2

Query  86   MAEKPEVLDAVLKETVDLENIPIEEVFENLRCTKDGLTSQAAQERLDIFGHNkleekkes  265
            MAE    L+ +  ET+DLE IP+ EVF+ L+CT+DGL+S+  Q+RL IFG NKLEEK+ES
Sbjct  1    MAETSVGLEDIKNETIDLERIPVHEVFQKLKCTRDGLSSEEGQKRLHIFGPNKLEEKQES  60

Query  266  kflkflgfMWNPLSWVMEaaaimaialaNGGGKPPDWQDFVGIITLLVINSTISFIEEnn  445
            K LKFLGFMWNPLSWVME AAIMAIALANGGGKPPDWQDF+GI+ LL INSTISFIEENN
Sbjct  61   KVLKFLGFMWNPLSWVMEIAAIMAIALANGGGKPPDWQDFIGIVALLFINSTISFIEENN  120

Query  446  agnaaaalmarlapkaKVLRDG  511
            AGNAAAALMA LAPK KVLRDG
Sbjct  121  AGNAAAALMAGLAPKTKVLRDG  142



>gb|EYU25317.1| hypothetical protein MIMGU_mgv1a000893mg [Erythranthe guttata]
Length=949

 Score =   137 bits (345),  Expect = 7e-34, Method: Compositional matrix adjust.
 Identities = 112/135 (83%), Positives = 121/135 (90%), Gaps = 0/135 (0%)
 Frame = +2

Query  107  LDAVLKETVDLENIPIEEVFENLRCTKDGLTSQAAQERLDIFGHNkleekkeskflkflg  286
            L+ +  ETVDLE IPIEEVF  L+C+K+GLTS    +RL+IFG NKLEEKKESKFLKFLG
Sbjct  5    LEDIRNETVDLETIPIEEVFTQLKCSKEGLTSDEGAKRLEIFGPNKLEEKKESKFLKFLG  64

Query  287  fMWNPLSWVMEaaaimaialaNGGGKPPDWQDFVGIITLLVINSTISFIEEnnagnaaaa  466
            FMWNPLSWVME+AAIMAI LANGGGKPPDWQDFVGI+TLLVINSTISFIEENNAGNAAAA
Sbjct  65   FMWNPLSWVMESAAIMAIVLANGGGKPPDWQDFVGIMTLLVINSTISFIEENNAGNAAAA  124

Query  467  lmarlapkaKVLRDG  511
            LMA LAPK KVLRDG
Sbjct  125  LMAGLAPKTKVLRDG  139



>ref|XP_003610080.1| Plasma membrane H+-ATPase [Medicago truncatula]
 gb|AES92277.1| plasma membrane H+-ATPase [Medicago truncatula]
Length=952

 Score =   137 bits (345),  Expect = 8e-34, Method: Compositional matrix adjust.
 Identities = 112/143 (78%), Positives = 122/143 (85%), Gaps = 1/143 (1%)
 Frame = +2

Query  86   MAEKPEV-LDAVLKETVDLENIPIEEVFENLRCTKDGLTSQAAQERLDIFGHNkleekke  262
            MAE   + L+ +  ETVDLE IP+EEVFE L+CTK+GL+S+    RL IFG NKLEEKK+
Sbjct  1    MAESKSISLEQIKNETVDLERIPVEEVFEQLKCTKEGLSSEEGANRLQIFGPNKLEEKKD  60

Query  263  skflkflgfMWNPLSWVMEaaaimaialaNGGGKPPDWQDFVGIITLLVINSTISFIEEn  442
            SK LKFLGFMWNPLSWVMEAAA+MAI LANG GKPPDWQDFVGII LLVINSTISFIEEN
Sbjct  61   SKILKFLGFMWNPLSWVMEAAALMAIGLANGNGKPPDWQDFVGIICLLVINSTISFIEEN  120

Query  443  nagnaaaalmarlapkaKVLRDG  511
            NAGNAAAALMA LAPK KVLRDG
Sbjct  121  NAGNAAAALMAGLAPKTKVLRDG  143



>ref|XP_002267501.1| PREDICTED: plasma membrane ATPase 4 [Vitis vinifera]
 emb|CBI17862.3| unnamed protein product [Vitis vinifera]
Length=954

 Score =   137 bits (345),  Expect = 8e-34, Method: Compositional matrix adjust.
 Identities = 113/140 (81%), Positives = 122/140 (87%), Gaps = 0/140 (0%)
 Frame = +2

Query  92   EKPEVLDAVLKETVDLENIPIEEVFENLRCTKDGLTSQAAQERLDIFGHNkleekkeskf  271
            +K   L+ +  ETVDLE IPIEEVFE L+CTK+GLTSQ  + RL IFG NKLEEKKESKF
Sbjct  4    DKSISLEEIKNETVDLEKIPIEEVFEQLKCTKEGLTSQEGEARLQIFGPNKLEEKKESKF  63

Query  272  lkflgfMWNPLSWVMEaaaimaialaNGGGKPPDWQDFVGIITLLVINSTISFIEEnnag  451
            LKFLGFMWNPLSWVMEAAA+MAI LANG G+PPDWQDFVGI+ LLVINSTISFIEENNAG
Sbjct  64   LKFLGFMWNPLSWVMEAAALMAIVLANGDGQPPDWQDFVGIVCLLVINSTISFIEENNAG  123

Query  452  naaaalmarlapkaKVLRDG  511
            NAAAALMA LAPK KVLRDG
Sbjct  124  NAAAALMAGLAPKTKVLRDG  143



>ref|XP_010929115.1| PREDICTED: plasma membrane ATPase 4-like [Elaeis guineensis]
Length=950

 Score =   137 bits (345),  Expect = 8e-34, Method: Compositional matrix adjust.
 Identities = 108/135 (80%), Positives = 120/135 (89%), Gaps = 0/135 (0%)
 Frame = +2

Query  107  LDAVLKETVDLENIPIEEVFENLRCTKDGLTSQAAQERLDIFGHNkleekkeskflkflg  286
            L+ +  ETVDLENIP++EVFE L+C+++GLTS   ++RL IFG NKLEEKKESK LKFLG
Sbjct  6    LEQIKNETVDLENIPVDEVFEQLKCSREGLTSADGEQRLQIFGPNKLEEKKESKLLKFLG  65

Query  287  fMWNPLSWVMEaaaimaialaNGGGKPPDWQDFVGIITLLVINSTISFIEEnnagnaaaa  466
            FMWNPLSWVME AAIMAI LANGGGKPPDWQDFVGI+ LL+INSTISFIEENNAGNAAAA
Sbjct  66   FMWNPLSWVMEIAAIMAIVLANGGGKPPDWQDFVGIVVLLIINSTISFIEENNAGNAAAA  125

Query  467  lmarlapkaKVLRDG  511
            LMA LAPK KVLRDG
Sbjct  126  LMAGLAPKTKVLRDG  140



>ref|XP_003610081.1| Plasma membrane H+-ATPase [Medicago truncatula]
 gb|AES92278.1| plasma membrane H+-ATPase [Medicago truncatula]
Length=947

 Score =   137 bits (345),  Expect = 8e-34, Method: Compositional matrix adjust.
 Identities = 112/143 (78%), Positives = 122/143 (85%), Gaps = 1/143 (1%)
 Frame = +2

Query  86   MAEKPEV-LDAVLKETVDLENIPIEEVFENLRCTKDGLTSQAAQERLDIFGHNkleekke  262
            MAE   + L+ +  ETVDLE IP+EEVFE L+CTK+GL+S+    RL IFG NKLEEKK+
Sbjct  1    MAESKSISLEQIKNETVDLERIPVEEVFEQLKCTKEGLSSEEGANRLQIFGPNKLEEKKD  60

Query  263  skflkflgfMWNPLSWVMEaaaimaialaNGGGKPPDWQDFVGIITLLVINSTISFIEEn  442
            SK LKFLGFMWNPLSWVMEAAA+MAI LANG GKPPDWQDFVGII LLVINSTISFIEEN
Sbjct  61   SKILKFLGFMWNPLSWVMEAAALMAIGLANGNGKPPDWQDFVGIICLLVINSTISFIEEN  120

Query  443  nagnaaaalmarlapkaKVLRDG  511
            NAGNAAAALMA LAPK KVLRDG
Sbjct  121  NAGNAAAALMAGLAPKTKVLRDG  143



>ref|XP_006402592.1| hypothetical protein EUTSA_v10005774mg [Eutrema salsugineum]
 gb|ESQ44045.1| hypothetical protein EUTSA_v10005774mg [Eutrema salsugineum]
Length=962

 Score =   137 bits (345),  Expect = 8e-34, Method: Compositional matrix adjust.
 Identities = 106/142 (75%), Positives = 126/142 (89%), Gaps = 0/142 (0%)
 Frame = +2

Query  86   MAEKPEVLDAVLKETVDLENIPIEEVFENLRCTKDGLTSQAAQERLDIFGHNkleekkes  265
            M E  E L A+  E++DLEN+P+EEVF++L+CTK+GL+S   QERL +FG+NKLEEKKES
Sbjct  1    MTEISESLKAITTESIDLENVPVEEVFQHLKCTKEGLSSNDVQERLTLFGYNKLEEKKES  60

Query  266  kflkflgfMWNPLSWVMEaaaimaialaNGGGKPPDWQDFVGIITLLVINSTISFIEEnn  445
            K LKFLGFMWNPLSWVMEAAA+MAI LA+GGGKPPD+ DFVGI+ LL+INSTISF+EENN
Sbjct  61   KILKFLGFMWNPLSWVMEAAALMAIGLAHGGGKPPDYHDFVGIVVLLLINSTISFVEENN  120

Query  446  agnaaaalmarlapkaKVLRDG  511
            AGNAAAALMA+LAPKAK +RDG
Sbjct  121  AGNAAAALMAQLAPKAKAIRDG  142



>ref|XP_009398632.1| PREDICTED: plasma membrane ATPase-like [Musa acuminata subsp. 
malaccensis]
Length=952

 Score =   137 bits (345),  Expect = 9e-34, Method: Compositional matrix adjust.
 Identities = 112/135 (83%), Positives = 120/135 (89%), Gaps = 0/135 (0%)
 Frame = +2

Query  107  LDAVLKETVDLENIPIEEVFENLRCTKDGLTSQAAQERLDIFGHNkleekkeskflkflg  286
            L+A+  ETVDLE +PIEEVFE L+CTKDGLT+    +RL IFG NKLEEKKESK LKFLG
Sbjct  7    LEAIKNETVDLERVPIEEVFEQLKCTKDGLTTGEGDKRLQIFGPNKLEEKKESKVLKFLG  66

Query  287  fMWNPLSWVMEaaaimaialaNGGGKPPDWQDFVGIITLLVINSTISFIEEnnagnaaaa  466
            FMWNPLSWVME AAIMAIALANGGG+PPDWQDFVGII LL+INSTISFIEENNAGNAAAA
Sbjct  67   FMWNPLSWVMEMAAIMAIALANGGGQPPDWQDFVGIIVLLLINSTISFIEENNAGNAAAA  126

Query  467  lmarlapkaKVLRDG  511
            LMA LAPK KVLRDG
Sbjct  127  LMAGLAPKTKVLRDG  141



>ref|NP_001105470.1| plasma-membrane H+ATPase2 [Zea mays]
 emb|CAA59800.1| H(+)-transporting ATPase [Zea mays]
Length=948

 Score =   137 bits (345),  Expect = 9e-34, Method: Compositional matrix adjust.
 Identities = 111/135 (82%), Positives = 120/135 (89%), Gaps = 0/135 (0%)
 Frame = +2

Query  107  LDAVLKETVDLENIPIEEVFENLRCTKDGLTSQAAQERLDIFGHNkleekkeskflkflg  286
            L+ +  E VDLENIPIEEVFE L+CT++GL+S   Q+RL+IFG N+LEEKKESK LKFLG
Sbjct  4    LEEIKNEAVDLENIPIEEVFEQLKCTREGLSSSEGQQRLEIFGPNRLEEKKESKVLKFLG  63

Query  287  fMWNPLSWVMEaaaimaialaNGGGKPPDWQDFVGIITLLVINSTISFIEEnnagnaaaa  466
            FMWNPLSWVME AAIMAIALAN GGKPPDWQDFVGII LLVINSTISFIEENNAGNAAAA
Sbjct  64   FMWNPLSWVMEMAAIMAIALANSGGKPPDWQDFVGIIVLLVINSTISFIEENNAGNAAAA  123

Query  467  lmarlapkaKVLRDG  511
            LMA LAPK KVLRDG
Sbjct  124  LMANLAPKTKVLRDG  138



>emb|CAN64375.1| hypothetical protein VITISV_014422 [Vitis vinifera]
Length=954

 Score =   137 bits (345),  Expect = 9e-34, Method: Compositional matrix adjust.
 Identities = 113/140 (81%), Positives = 122/140 (87%), Gaps = 0/140 (0%)
 Frame = +2

Query  92   EKPEVLDAVLKETVDLENIPIEEVFENLRCTKDGLTSQAAQERLDIFGHNkleekkeskf  271
            +K   L+ +  ETVDLE IPIEEVFE L+CTK+GLTSQ  + RL IFG NKLEEKKESKF
Sbjct  4    DKSISLEEIKNETVDLEKIPIEEVFEQLKCTKEGLTSQEGEARLQIFGPNKLEEKKESKF  63

Query  272  lkflgfMWNPLSWVMEaaaimaialaNGGGKPPDWQDFVGIITLLVINSTISFIEEnnag  451
            LKFLGFMWNPLSWVMEAAA+MAI LANG G+PPDWQDFVGI+ LLVINSTISFIEENNAG
Sbjct  64   LKFLGFMWNPLSWVMEAAALMAIVLANGDGQPPDWQDFVGIVCLLVINSTISFIEENNAG  123

Query  452  naaaalmarlapkaKVLRDG  511
            NAAAALMA LAPK KVLRDG
Sbjct  124  NAAAALMAGLAPKTKVLRDG  143



>ref|XP_010913679.1| PREDICTED: plasma membrane ATPase [Elaeis guineensis]
Length=954

 Score =   137 bits (345),  Expect = 9e-34, Method: Compositional matrix adjust.
 Identities = 113/135 (84%), Positives = 119/135 (88%), Gaps = 0/135 (0%)
 Frame = +2

Query  107  LDAVLKETVDLENIPIEEVFENLRCTKDGLTSQAAQERLDIFGHNkleekkeskflkflg  286
            L+ +  ETVDLE IPIEEVFE L+CT++GLTS+    RL IFG NKLEEKKESK LKFLG
Sbjct  9    LEEIKNETVDLERIPIEEVFEQLKCTQEGLTSEEGANRLQIFGPNKLEEKKESKILKFLG  68

Query  287  fMWNPLSWVMEaaaimaialaNGGGKPPDWQDFVGIITLLVINSTISFIEEnnagnaaaa  466
            FMWNPLSWVME AAIMAIALANGGGKPPDWQDFVGII LLVINSTISFIEENNAGNAAAA
Sbjct  69   FMWNPLSWVMEMAAIMAIALANGGGKPPDWQDFVGIIALLVINSTISFIEENNAGNAAAA  128

Query  467  lmarlapkaKVLRDG  511
            LMA LAPK KVLRDG
Sbjct  129  LMAGLAPKTKVLRDG  143



>ref|XP_010520558.1| PREDICTED: ATPase 8, plasma membrane-type-like [Tarenaya hassleriana]
Length=948

 Score =   137 bits (344),  Expect = 9e-34, Method: Compositional matrix adjust.
 Identities = 107/134 (80%), Positives = 121/134 (90%), Gaps = 0/134 (0%)
 Frame = +2

Query  110  DAVLKETVDLENIPIEEVFENLRCTKDGLTSQAAQERLDIFGHNkleekkeskflkflgf  289
            D + KE VDLENIP+EEVFE L+C+++GL+S+  ++RL+IFG NKLEEK E+KFLKFLGF
Sbjct  8    DELKKENVDLENIPVEEVFEQLKCSREGLSSEEGRKRLEIFGANKLEEKSENKFLKFLGF  67

Query  290  MWNPLSWVMEaaaimaialaNGGGKPPDWQDFVGIITLLVINSTISFIEEnnagnaaaal  469
            MWNPLSWVME+AAIMAI LANGGGKPPDWQDFVGI  LL+INSTISFIEENNAGNAAAAL
Sbjct  68   MWNPLSWVMESAAIMAIVLANGGGKPPDWQDFVGITVLLIINSTISFIEENNAGNAAAAL  127

Query  470  marlapkaKVLRDG  511
            MA LAPK KVLRDG
Sbjct  128  MANLAPKTKVLRDG  141



>ref|XP_006480483.1| PREDICTED: ATPase 4, plasma membrane-type-like isoform X1 [Citrus 
sinensis]
Length=938

 Score =   137 bits (344),  Expect = 9e-34, Method: Composition-based stats.
 Identities = 101/135 (75%), Positives = 124/135 (92%), Gaps = 0/135 (0%)
 Frame = +2

Query  107  LDAVLKETVDLENIPIEEVFENLRCTKDGLTSQAAQERLDIFGHNkleekkeskflkflg  286
            ++++  E VDLEN+P+EEVFE L+C+++GL+++AA++RL IFG+NKL+EK+ESK LKFLG
Sbjct  1    MESITNEAVDLENVPMEEVFETLKCSQEGLSTEAAEQRLSIFGYNKLQEKRESKILKFLG  60

Query  287  fMWNPLSWVMEaaaimaialaNGGGKPPDWQDFVGIITLLVINSTISFIEEnnagnaaaa  466
            FMWNPLSWVMEAAAIMAI LANGGGKPP+WQDF GI TLL+INST+ FI+ENNAG A+AA
Sbjct  61   FMWNPLSWVMEAAAIMAIVLANGGGKPPEWQDFTGIATLLLINSTVCFIQENNAGAASAA  120

Query  467  lmarlapkaKVLRDG  511
            LMARLAPKAKVLRDG
Sbjct  121  LMARLAPKAKVLRDG  135



>ref|XP_006480487.1| PREDICTED: ATPase 4, plasma membrane-type-like isoform X5 [Citrus 
sinensis]
Length=949

 Score =   137 bits (344),  Expect = 1e-33, Method: Composition-based stats.
 Identities = 101/135 (75%), Positives = 124/135 (92%), Gaps = 0/135 (0%)
 Frame = +2

Query  107  LDAVLKETVDLENIPIEEVFENLRCTKDGLTSQAAQERLDIFGHNkleekkeskflkflg  286
            ++++  E VDLEN+P+EEVFE L+C+++GL+++AA++RL IFG+NKL+EK+ESK LKFLG
Sbjct  1    MESITNEAVDLENVPMEEVFETLKCSQEGLSTEAAEQRLSIFGYNKLQEKRESKILKFLG  60

Query  287  fMWNPLSWVMEaaaimaialaNGGGKPPDWQDFVGIITLLVINSTISFIEEnnagnaaaa  466
            FMWNPLSWVMEAAAIMAI LANGGGKPP+WQDF GI TLL+INST+ FI+ENNAG A+AA
Sbjct  61   FMWNPLSWVMEAAAIMAIVLANGGGKPPEWQDFTGIATLLLINSTVCFIQENNAGAASAA  120

Query  467  lmarlapkaKVLRDG  511
            LMARLAPKAKVLRDG
Sbjct  121  LMARLAPKAKVLRDG  135



>ref|XP_010265488.1| PREDICTED: plasma membrane ATPase 4 [Nelumbo nucifera]
Length=954

 Score =   137 bits (344),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 113/141 (80%), Positives = 122/141 (87%), Gaps = 0/141 (0%)
 Frame = +2

Query  89   AEKPEVLDAVLKETVDLENIPIEEVFENLRCTKDGLTSQAAQERLDIFGHNkleekkesk  268
             +K   L+ +  E+VDLE IPIEEVFE L+CTK+GLTS+    RL IFG NKLEEKKESK
Sbjct  3    GDKAISLEEIKNESVDLERIPIEEVFEQLKCTKEGLTSEEGANRLQIFGPNKLEEKKESK  62

Query  269  flkflgfMWNPLSWVMEaaaimaialaNGGGKPPDWQDFVGIITLLVINSTISFIEEnna  448
             LKFLGFMWNPLSWVMEAAA+MAIALANGGGKPPDWQDFVGI+ LLVINSTISFIEENNA
Sbjct  63   LLKFLGFMWNPLSWVMEAAALMAIALANGGGKPPDWQDFVGIVCLLVINSTISFIEENNA  122

Query  449  gnaaaalmarlapkaKVLRDG  511
            GNAAAALMA LAPK KVLRDG
Sbjct  123  GNAAAALMAGLAPKTKVLRDG  143



>ref|XP_006597964.1| PREDICTED: ATPase 8, plasma membrane-type-like [Glycine max]
Length=862

 Score =   136 bits (343),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 105/130 (81%), Positives = 115/130 (88%), Gaps = 0/130 (0%)
 Frame = +2

Query  122  KETVDLENIPIEEVFENLRCTKDGLTSQAAQERLDIFGHNkleekkeskflkflgfMWNP  301
            KE +DLENIP+EEVFE L+CT++GLTS   ++RL IFG NKLEEKK+SK  KFLGFMWNP
Sbjct  13   KENIDLENIPVEEVFEKLKCTREGLTSAEGEKRLQIFGPNKLEEKKDSKLRKFLGFMWNP  72

Query  302  LSWVMEaaaimaialaNGGGKPPDWQDFVGIITLLVINSTISFIEEnnagnaaaalmarl  481
            LSWVME AAIMAI LANGGGKPPDWQDF GI+ LL+INSTISFIEENNAGNAAAALMA L
Sbjct  73   LSWVMECAAIMAIVLANGGGKPPDWQDFTGIVVLLIINSTISFIEENNAGNAAAALMAGL  132

Query  482  apkaKVLRDG  511
            APK KVLRDG
Sbjct  133  APKTKVLRDG  142



>ref|XP_004973040.1| PREDICTED: plasma membrane ATPase-like [Setaria italica]
Length=950

 Score =   136 bits (343),  Expect = 1e-33, Method: Composition-based stats.
 Identities = 104/135 (77%), Positives = 120/135 (89%), Gaps = 0/135 (0%)
 Frame = +2

Query  107  LDAVLKETVDLENIPIEEVFENLRCTKDGLTSQAAQERLDIFGHNkleekkeskflkflg  286
            L+ +  E VDLENIP+EEVF+ L+CT  GL+S+ AQ R+D+FG NKLEEKKESK LKFLG
Sbjct  4    LEEIKNEAVDLENIPVEEVFQTLKCTNKGLSSEEAQARIDVFGPNKLEEKKESKILKFLG  63

Query  287  fMWNPLSWVMEaaaimaialaNGGGKPPDWQDFVGIITLLVINSTISFIEEnnagnaaaa  466
            FMWNPLSWVMEAAAIMAIALANGGG+PPDWQDFVGI+ LL+INS IS++EE+NAG+AA A
Sbjct  64   FMWNPLSWVMEAAAIMAIALANGGGRPPDWQDFVGIVVLLIINSLISYMEESNAGSAAQA  123

Query  467  lmarlapkaKVLRDG  511
            LMA LAPKAKVLRDG
Sbjct  124  LMANLAPKAKVLRDG  138



>emb|CDY67606.1| BnaAnng24780D, partial [Brassica napus]
Length=507

 Score =   134 bits (336),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 106/134 (79%), Positives = 119/134 (89%), Gaps = 0/134 (0%)
 Frame = +2

Query  110  DAVLKETVDLENIPIEEVFENLRCTKDGLTSQAAQERLDIFGHNkleekkeskflkflgf  289
            D +  E VDLE IP+EEVF+ L+CTK+GL+S   ++RL+IFG NKLEEK E+KFLKFLGF
Sbjct  8    DEIKNENVDLERIPVEEVFQQLKCTKEGLSSDEGKKRLEIFGANKLEEKSENKFLKFLGF  67

Query  290  MWNPLSWVMEaaaimaialaNGGGKPPDWQDFVGIITLLVINSTISFIEEnnagnaaaal  469
            MWNPLSWVME+AAIMAI LANGGGKPPDWQDF+GI+ LLVINSTISFIEENNAGNAAAAL
Sbjct  68   MWNPLSWVMESAAIMAIVLANGGGKPPDWQDFIGIMVLLVINSTISFIEENNAGNAAAAL  127

Query  470  marlapkaKVLRDG  511
            MA LAPK KVLRDG
Sbjct  128  MANLAPKTKVLRDG  141



>gb|EMT26270.1| Plasma membrane ATPase [Aegilops tauschii]
Length=951

 Score =   136 bits (343),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 112/135 (83%), Positives = 119/135 (88%), Gaps = 0/135 (0%)
 Frame = +2

Query  107  LDAVLKETVDLENIPIEEVFENLRCTKDGLTSQAAQERLDIFGHNkleekkeskflkflg  286
            L+ +  E VDLENIPIEEVFE L+CT+ GLTS    +R++IFG NKLEEKKESK LKFLG
Sbjct  4    LEEIRNEAVDLENIPIEEVFEQLKCTRQGLTSDEGAQRVEIFGLNKLEEKKESKVLKFLG  63

Query  287  fMWNPLSWVMEaaaimaialaNGGGKPPDWQDFVGIITLLVINSTISFIEEnnagnaaaa  466
            FMWNPLSWVME AAIMAIALANGGGKPPDWQDFVGII LLVINSTISFIEENNAGNAAAA
Sbjct  64   FMWNPLSWVMEMAAIMAIALANGGGKPPDWQDFVGIIVLLVINSTISFIEENNAGNAAAA  123

Query  467  lmarlapkaKVLRDG  511
            LMA LAPK KVLRDG
Sbjct  124  LMANLAPKTKVLRDG  138



>sp|P83970.1|PMA1_WHEAT RecName: Full=Plasma membrane ATPase; AltName: Full=Proton pump 
[Triticum aestivum]
 gb|AAS55889.1| plasma membrane H+-ATPase [Triticum aestivum]
Length=951

 Score =   136 bits (343),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 112/135 (83%), Positives = 119/135 (88%), Gaps = 0/135 (0%)
 Frame = +2

Query  107  LDAVLKETVDLENIPIEEVFENLRCTKDGLTSQAAQERLDIFGHNkleekkeskflkflg  286
            L+ +  E VDLENIPIEEVFE L+CT+ GLTS    +R++IFG NKLEEKKESK LKFLG
Sbjct  4    LEEIRNEAVDLENIPIEEVFEQLKCTRQGLTSDEGAQRVEIFGLNKLEEKKESKVLKFLG  63

Query  287  fMWNPLSWVMEaaaimaialaNGGGKPPDWQDFVGIITLLVINSTISFIEEnnagnaaaa  466
            FMWNPLSWVME AAIMAIALANGGGKPPDWQDFVGII LLVINSTISFIEENNAGNAAAA
Sbjct  64   FMWNPLSWVMEMAAIMAIALANGGGKPPDWQDFVGIIVLLVINSTISFIEENNAGNAAAA  123

Query  467  lmarlapkaKVLRDG  511
            LMA LAPK KVLRDG
Sbjct  124  LMANLAPKTKVLRDG  138



>gb|AAV71150.1| plasma membrane H+-ATPase [Triticum aestivum]
Length=951

 Score =   136 bits (343),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 112/135 (83%), Positives = 119/135 (88%), Gaps = 0/135 (0%)
 Frame = +2

Query  107  LDAVLKETVDLENIPIEEVFENLRCTKDGLTSQAAQERLDIFGHNkleekkeskflkflg  286
            L+ +  E VDLENIPIEEVFE L+CT+ GLTS    +R++IFG NKLEEKKESK LKFLG
Sbjct  4    LEEIRNEAVDLENIPIEEVFEQLKCTRQGLTSDEGAQRVEIFGLNKLEEKKESKVLKFLG  63

Query  287  fMWNPLSWVMEaaaimaialaNGGGKPPDWQDFVGIITLLVINSTISFIEEnnagnaaaa  466
            FMWNPLSWVME AAIMAIALANGGGKPPDWQDFVGII LLVINSTISFIEENNAGNAAAA
Sbjct  64   FMWNPLSWVMEMAAIMAIALANGGGKPPDWQDFVGIIVLLVINSTISFIEENNAGNAAAA  123

Query  467  lmarlapkaKVLRDG  511
            LMA LAPK KVLRDG
Sbjct  124  LMANLAPKTKVLRDG  138



>gb|EMS60594.1| Plasma membrane ATPase [Triticum urartu]
Length=953

 Score =   136 bits (343),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 112/135 (83%), Positives = 119/135 (88%), Gaps = 0/135 (0%)
 Frame = +2

Query  107  LDAVLKETVDLENIPIEEVFENLRCTKDGLTSQAAQERLDIFGHNkleekkeskflkflg  286
            L+ +  E VDLENIPIEEVFE L+CT+ GLTS    +R++IFG NKLEEKKESK LKFLG
Sbjct  4    LEEIRNEAVDLENIPIEEVFEQLKCTRQGLTSDEGAQRVEIFGLNKLEEKKESKVLKFLG  63

Query  287  fMWNPLSWVMEaaaimaialaNGGGKPPDWQDFVGIITLLVINSTISFIEEnnagnaaaa  466
            FMWNPLSWVME AAIMAIALANGGGKPPDWQDFVGII LLVINSTISFIEENNAGNAAAA
Sbjct  64   FMWNPLSWVMEMAAIMAIALANGGGKPPDWQDFVGIIVLLVINSTISFIEENNAGNAAAA  123

Query  467  lmarlapkaKVLRDG  511
            LMA LAPK KVLRDG
Sbjct  124  LMANLAPKTKVLRDG  138



>dbj|BAD19091.1| putative H+-exporting ATPase [Oryza sativa Japonica Group]
 gb|EAY87868.1| hypothetical protein OsI_09289 [Oryza sativa Indica Group]
 gb|EAZ24947.1| hypothetical protein OsJ_08728 [Oryza sativa Japonica Group]
Length=950

 Score =   136 bits (343),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 108/135 (80%), Positives = 119/135 (88%), Gaps = 0/135 (0%)
 Frame = +2

Query  107  LDAVLKETVDLENIPIEEVFENLRCTKDGLTSQAAQERLDIFGHNkleekkeskflkflg  286
            L+ V  ETVDLE IP+EEVF++L+C+K GL++   Q RL+IFG NKLEEK ESK LKFLG
Sbjct  6    LEDVRNETVDLETIPVEEVFQHLKCSKQGLSAAEGQNRLNIFGPNKLEEKTESKLLKFLG  65

Query  287  fMWNPLSWVMEaaaimaialaNGGGKPPDWQDFVGIITLLVINSTISFIEEnnagnaaaa  466
            FMWNPLSWVMEAAAIMAI LANGGG+PPDWQDFVGI+ LLVINSTISFIEENNAGNAAAA
Sbjct  66   FMWNPLSWVMEAAAIMAIVLANGGGRPPDWQDFVGIVVLLVINSTISFIEENNAGNAAAA  125

Query  467  lmarlapkaKVLRDG  511
            LMA LAPK KVLRDG
Sbjct  126  LMAGLAPKTKVLRDG  140



>ref|XP_008443886.1| PREDICTED: ATPase 8, plasma membrane-type [Cucumis melo]
Length=948

 Score =   136 bits (343),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 110/135 (81%), Positives = 119/135 (88%), Gaps = 0/135 (0%)
 Frame = +2

Query  107  LDAVLKETVDLENIPIEEVFENLRCTKDGLTSQAAQERLDIFGHNkleekkeskflkflg  286
            L+ V  E +DLE IPIEEVFE L+CTK+GLT+   ++RL IFG NKLEEKKESK LKFLG
Sbjct  6    LEDVKNENIDLERIPIEEVFEQLKCTKEGLTTAEGEKRLQIFGPNKLEEKKESKLLKFLG  65

Query  287  fMWNPLSWVMEaaaimaialaNGGGKPPDWQDFVGIITLLVINSTISFIEEnnagnaaaa  466
            FMWNPLSWVME+AAIMAI LANGGGKPPDWQDFVGII LL+INSTISFIEENNAGNAAAA
Sbjct  66   FMWNPLSWVMESAAIMAIVLANGGGKPPDWQDFVGIIVLLIINSTISFIEENNAGNAAAA  125

Query  467  lmarlapkaKVLRDG  511
            LMA LAPK KVLRDG
Sbjct  126  LMAGLAPKTKVLRDG  140



>ref|XP_002307856.1| ATPase 6 family protein [Populus trichocarpa]
 gb|EEE91379.1| ATPase 6 family protein [Populus trichocarpa]
Length=944

 Score =   136 bits (342),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 108/129 (84%), Positives = 116/129 (90%), Gaps = 0/129 (0%)
 Frame = +2

Query  125  ETVDLENIPIEEVFENLRCTKDGLTSQAAQERLDIFGHNkleekkeskflkflgfMWNPL  304
            E++DLE IPIEEVFE L+CTK+GL +   +ERL IFG NKLEEKKESK LKFLGFMWNPL
Sbjct  7    ESIDLEKIPIEEVFEKLKCTKEGLRTTEGEERLRIFGPNKLEEKKESKILKFLGFMWNPL  66

Query  305  SWVMEaaaimaialaNGGGKPPDWQDFVGIITLLVINSTISFIEEnnagnaaaalmarla  484
            SWVMEAAAIMAI LANGGGKPPDWQDFVGII LL+INSTISFIEENNAGNAAA+LMA LA
Sbjct  67   SWVMEAAAIMAIVLANGGGKPPDWQDFVGIIVLLIINSTISFIEENNAGNAAASLMAGLA  126

Query  485  pkaKVLRDG  511
            PK KVLRDG
Sbjct  127  PKTKVLRDG  135



>gb|KJB82864.1| hypothetical protein B456_013G217900 [Gossypium raimondii]
Length=899

 Score =   136 bits (342),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 107/135 (79%), Positives = 120/135 (89%), Gaps = 0/135 (0%)
 Frame = +2

Query  107  LDAVLKETVDLENIPIEEVFENLRCTKDGLTSQAAQERLDIFGHNkleekkeskflkflg  286
            L+ +  E VDLENIP+EEVF+ L+CTK+GLT+   + RL IFGHNKLEEKK++K LKFLG
Sbjct  9    LEQIKNEIVDLENIPVEEVFKLLKCTKEGLTTAEGETRLSIFGHNKLEEKKDNKVLKFLG  68

Query  287  fMWNPLSWVMEaaaimaialaNGGGKPPDWQDFVGIITLLVINSTISFIEEnnagnaaaa  466
            FMWNPLSWVMEAAAIMAI LANGGGKPPDW DFVGI+TLL+INSTISFIEEN+AGNAAAA
Sbjct  69   FMWNPLSWVMEAAAIMAIVLANGGGKPPDWPDFVGIVTLLLINSTISFIEENSAGNAAAA  128

Query  467  lmarlapkaKVLRDG  511
            LMA LAPK KVLRDG
Sbjct  129  LMAGLAPKTKVLRDG  143



>ref|XP_007204519.1| hypothetical protein PRUPE_ppa018171mg [Prunus persica]
 gb|EMJ05718.1| hypothetical protein PRUPE_ppa018171mg [Prunus persica]
Length=965

 Score =   136 bits (342),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 110/142 (77%), Positives = 124/142 (87%), Gaps = 0/142 (0%)
 Frame = +2

Query  86   MAEKPEVLDAVLKETVDLENIPIEEVFENLRCTKDGLTSQAAQERLDIFGHNkleekkes  265
            M      LDA++KE VDLEN+P+EEVF++L+CT+DGL+S   QERLD+FG+NKLEEKKES
Sbjct  1    MVADSIALDAIIKEAVDLENVPLEEVFDHLKCTRDGLSSDEVQERLDLFGYNKLEEKKES  60

Query  266  kflkflgfMWNPLSWVMEaaaimaialaNGGGKPPDWQDFVGIITLLVINSTISFIEEnn  445
            KFLKFLGFMWNPLSWVMEAAAI+AIA   GG KP D+ DF GI+ LLVINSTISFIEENN
Sbjct  61   KFLKFLGFMWNPLSWVMEAAAIIAIAFTQGGSKPADYHDFFGILVLLVINSTISFIEENN  120

Query  446  agnaaaalmarlapkaKVLRDG  511
            AGNAAAALMARLAPKAKVLRDG
Sbjct  121  AGNAAAALMARLAPKAKVLRDG  142



>ref|XP_003633895.1| PREDICTED: plasma membrane ATPase 1 [Vitis vinifera]
Length=968

 Score =   136 bits (342),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 111/143 (78%), Positives = 129/143 (90%), Gaps = 1/143 (1%)
 Frame = +2

Query  86   MAEKPEVLD-AVLKETVDLENIPIEEVFENLRCTKDGLTSQAAQERLDIFGHNkleekke  262
            M EK   LD A+ KE VDLENIP+EEVFE+L+CT++GL+ +A Q+RLD+FG+NKLEE KE
Sbjct  1    MDEKSIALDEAINKEAVDLENIPLEEVFEHLKCTREGLSHEAFQQRLDLFGYNKLEEIKE  60

Query  263  skflkflgfMWNPLSWVMEaaaimaialaNGGGKPPDWQDFVGIITLLVINSTISFIEEn  442
            +K LKFLGFMWNPLSWVMEAAA+MAIALA+GGGKP D+ DFVGII LL++NSTISF+EEN
Sbjct  61   NKILKFLGFMWNPLSWVMEAAAVMAIALAHGGGKPTDYHDFVGIIILLIVNSTISFVEEN  120

Query  443  nagnaaaalmarlapkaKVLRDG  511
            NAGNAAAALMARLAPKAKVLRDG
Sbjct  121  NAGNAAAALMARLAPKAKVLRDG  143



>gb|KJB82762.1| hypothetical protein B456_013G212200 [Gossypium raimondii]
Length=758

 Score =   135 bits (340),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 112/135 (83%), Positives = 121/135 (90%), Gaps = 0/135 (0%)
 Frame = +2

Query  107  LDAVLKETVDLENIPIEEVFENLRCTKDGLTSQAAQERLDIFGHNkleekkeskflkflg  286
            LD +  E+VDLE IPIEEVFE L+CT++GL++Q    RL +FG NKLEEKKESKFLKFLG
Sbjct  9    LDEIKNESVDLERIPIEEVFEQLKCTREGLSTQEGNNRLQVFGPNKLEEKKESKFLKFLG  68

Query  287  fMWNPLSWVMEaaaimaialaNGGGKPPDWQDFVGIITLLVINSTISFIEEnnagnaaaa  466
            FMWNPLSWVMEAAAIMAIALANGGG+PPDWQDFVGII LLVINSTISFIEENNAGNAAAA
Sbjct  69   FMWNPLSWVMEAAAIMAIALANGGGRPPDWQDFVGIIVLLVINSTISFIEENNAGNAAAA  128

Query  467  lmarlapkaKVLRDG  511
            LMA LAPK KVLRDG
Sbjct  129  LMANLAPKTKVLRDG  143



>emb|CDY69631.1| BnaCnng64550D, partial [Brassica napus]
Length=524

 Score =   133 bits (335),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 106/134 (79%), Positives = 119/134 (89%), Gaps = 0/134 (0%)
 Frame = +2

Query  110  DAVLKETVDLENIPIEEVFENLRCTKDGLTSQAAQERLDIFGHNkleekkeskflkflgf  289
            D +  E VDLE IP+EEVF+ L+CTK+GL+S   ++RL+IFG NKLEEK E+KFLKFLGF
Sbjct  8    DEIKNENVDLERIPVEEVFKQLKCTKEGLSSDEGKKRLEIFGANKLEEKSENKFLKFLGF  67

Query  290  MWNPLSWVMEaaaimaialaNGGGKPPDWQDFVGIITLLVINSTISFIEEnnagnaaaal  469
            MWNPLSWVME+AAIMAI LANGGGKPPDWQDF+GI+ LLVINSTISFIEENNAGNAAAAL
Sbjct  68   MWNPLSWVMESAAIMAIVLANGGGKPPDWQDFIGIMVLLVINSTISFIEENNAGNAAAAL  127

Query  470  marlapkaKVLRDG  511
            MA LAPK KVLRDG
Sbjct  128  MANLAPKTKVLRDG  141



>ref|XP_010469197.1| PREDICTED: ATPase 7, plasma membrane-type-like [Camelina sativa]
Length=962

 Score =   136 bits (342),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 106/142 (75%), Positives = 126/142 (89%), Gaps = 0/142 (0%)
 Frame = +2

Query  86   MAEKPEVLDAVLKETVDLENIPIEEVFENLRCTKDGLTSQAAQERLDIFGHNkleekkes  265
            M +  E L A+  E+VDLEN+P+EEVF++L+CTK+GLT+   QERL +FG+NKLEEKKES
Sbjct  1    MTDISESLKAITTESVDLENVPVEEVFQHLKCTKEGLTTNEVQERLTLFGYNKLEEKKES  60

Query  266  kflkflgfMWNPLSWVMEaaaimaialaNGGGKPPDWQDFVGIITLLVINSTISFIEEnn  445
            K LKFLGFMWNPLSWVMEAAA+MAI LA+GGGKPPD+ DFVGI+ LL+INSTISF+EENN
Sbjct  61   KILKFLGFMWNPLSWVMEAAALMAIGLAHGGGKPPDYHDFVGIVVLLLINSTISFVEENN  120

Query  446  agnaaaalmarlapkaKVLRDG  511
            AGNAAAALMA+LAPKAK +RDG
Sbjct  121  AGNAAAALMAQLAPKAKSIRDG  142



>ref|XP_010413571.1| PREDICTED: ATPase 7, plasma membrane-type [Camelina sativa]
Length=962

 Score =   136 bits (342),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 106/142 (75%), Positives = 126/142 (89%), Gaps = 0/142 (0%)
 Frame = +2

Query  86   MAEKPEVLDAVLKETVDLENIPIEEVFENLRCTKDGLTSQAAQERLDIFGHNkleekkes  265
            M +  E L A+  E+VDLEN+P+EEVF++L+CTK+GLT+   QERL +FG+NKLEEKKES
Sbjct  1    MTDISESLKAITTESVDLENVPVEEVFQHLKCTKEGLTTNEVQERLTLFGYNKLEEKKES  60

Query  266  kflkflgfMWNPLSWVMEaaaimaialaNGGGKPPDWQDFVGIITLLVINSTISFIEEnn  445
            K LKFLGFMWNPLSWVMEAAA+MAI LA+GGGKPPD+ DFVGI+ LL+INSTISF+EENN
Sbjct  61   KILKFLGFMWNPLSWVMEAAALMAIGLAHGGGKPPDYHDFVGIVVLLLINSTISFVEENN  120

Query  446  agnaaaalmarlapkaKVLRDG  511
            AGNAAAALMA+LAPKAK +RDG
Sbjct  121  AGNAAAALMAQLAPKAKSIRDG  142



>emb|CAD29312.1| plasma membrane H+-ATPase [Oryza sativa Japonica Group]
Length=942

 Score =   136 bits (342),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 108/135 (80%), Positives = 119/135 (88%), Gaps = 0/135 (0%)
 Frame = +2

Query  107  LDAVLKETVDLENIPIEEVFENLRCTKDGLTSQAAQERLDIFGHNkleekkeskflkflg  286
            L+ V  ETVDLE IP+EEVF++L+C+K GL++   Q RL+IFG NKLEEK ESK LKFLG
Sbjct  6    LEDVRNETVDLETIPVEEVFQHLKCSKQGLSAAEGQNRLNIFGPNKLEEKTESKLLKFLG  65

Query  287  fMWNPLSWVMEaaaimaialaNGGGKPPDWQDFVGIITLLVINSTISFIEEnnagnaaaa  466
            FMWNPLSWVMEAAAIMAI LANGGG+PPDWQDFVGI+ LLVINSTISFIEENNAGNAAAA
Sbjct  66   FMWNPLSWVMEAAAIMAIVLANGGGRPPDWQDFVGIVVLLVINSTISFIEENNAGNAAAA  125

Query  467  lmarlapkaKVLRDG  511
            LMA LAPK KVLRDG
Sbjct  126  LMAGLAPKTKVLRDG  140



>gb|ABA18090.1| putative plasma membrane ATPase [Olimarabidopsis pumila]
Length=948

 Score =   136 bits (342),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 107/134 (80%), Positives = 120/134 (90%), Gaps = 0/134 (0%)
 Frame = +2

Query  110  DAVLKETVDLENIPIEEVFENLRCTKDGLTSQAAQERLDIFGHNkleekkeskflkflgf  289
            D + KE VDLE IP+EEVFE L+C+K+GL+S   ++RL+IFG NKLEEK E+KFLKFLGF
Sbjct  8    DEIKKENVDLERIPVEEVFEQLKCSKEGLSSDEGKKRLEIFGANKLEEKSENKFLKFLGF  67

Query  290  MWNPLSWVMEaaaimaialaNGGGKPPDWQDFVGIITLLVINSTISFIEEnnagnaaaal  469
            MWNPLSWVME+AAIMAI LANGGGKPPDWQDF+GI+ LLVINSTISFIEENNAGNAAAAL
Sbjct  68   MWNPLSWVMESAAIMAIVLANGGGKPPDWQDFIGIMVLLVINSTISFIEENNAGNAAAAL  127

Query  470  marlapkaKVLRDG  511
            MA LAPK KVLRDG
Sbjct  128  MANLAPKTKVLRDG  141



>ref|XP_006290558.1| hypothetical protein CARUB_v10016644mg [Capsella rubella]
 gb|EOA23456.1| hypothetical protein CARUB_v10016644mg [Capsella rubella]
Length=962

 Score =   136 bits (342),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 105/142 (74%), Positives = 126/142 (89%), Gaps = 0/142 (0%)
 Frame = +2

Query  86   MAEKPEVLDAVLKETVDLENIPIEEVFENLRCTKDGLTSQAAQERLDIFGHNkleekkes  265
            M +  E L A+  E++DLEN+P+EEVF++L+CTK+GLT+   QERL +FG+NKLEEKKES
Sbjct  1    MTDISESLKAITTESIDLENVPVEEVFQHLKCTKEGLTTNEVQERLTLFGYNKLEEKKES  60

Query  266  kflkflgfMWNPLSWVMEaaaimaialaNGGGKPPDWQDFVGIITLLVINSTISFIEEnn  445
            K LKFLGFMWNPLSWVMEAAA+MAI LA+GGGKPPD+ DFVGI+ LL+INSTISF+EENN
Sbjct  61   KILKFLGFMWNPLSWVMEAAALMAIGLAHGGGKPPDYHDFVGIVILLLINSTISFVEENN  120

Query  446  agnaaaalmarlapkaKVLRDG  511
            AGNAAAALMA+LAPKAK +RDG
Sbjct  121  AGNAAAALMAQLAPKAKAIRDG  142



>emb|CBI16656.3| unnamed protein product [Vitis vinifera]
Length=958

 Score =   136 bits (342),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 111/143 (78%), Positives = 129/143 (90%), Gaps = 1/143 (1%)
 Frame = +2

Query  86   MAEKPEVLD-AVLKETVDLENIPIEEVFENLRCTKDGLTSQAAQERLDIFGHNkleekke  262
            M EK   LD A+ KE VDLENIP+EEVFE+L+CT++GL+ +A Q+RLD+FG+NKLEE KE
Sbjct  1    MDEKSIALDEAINKEAVDLENIPLEEVFEHLKCTREGLSHEAFQQRLDLFGYNKLEEIKE  60

Query  263  skflkflgfMWNPLSWVMEaaaimaialaNGGGKPPDWQDFVGIITLLVINSTISFIEEn  442
            +K LKFLGFMWNPLSWVMEAAA+MAIALA+GGGKP D+ DFVGII LL++NSTISF+EEN
Sbjct  61   NKILKFLGFMWNPLSWVMEAAAVMAIALAHGGGKPTDYHDFVGIIILLIVNSTISFVEEN  120

Query  443  nagnaaaalmarlapkaKVLRDG  511
            NAGNAAAALMARLAPKAKVLRDG
Sbjct  121  NAGNAAAALMARLAPKAKVLRDG  143



>dbj|BAL41366.1| plasma membrane H+-ATPase [Aeluropus littoralis]
Length=951

 Score =   135 bits (341),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 110/135 (81%), Positives = 121/135 (90%), Gaps = 0/135 (0%)
 Frame = +2

Query  107  LDAVLKETVDLENIPIEEVFENLRCTKDGLTSQAAQERLDIFGHNkleekkeskflkflg  286
            L+ +  E+VDLENIP+EEVFE L+CT++GL+S+   +RL +FG NKLEEKKESK LKFLG
Sbjct  4    LEEIKNESVDLENIPMEEVFEQLKCTREGLSSEEGTQRLQVFGPNKLEEKKESKVLKFLG  63

Query  287  fMWNPLSWVMEaaaimaialaNGGGKPPDWQDFVGIITLLVINSTISFIEEnnagnaaaa  466
            FMWNPLSWVME AAIMAIALANGGGKPPDWQDFVGII LLVINSTISFIEENNAGNAAAA
Sbjct  64   FMWNPLSWVMEMAAIMAIALANGGGKPPDWQDFVGIIVLLVINSTISFIEENNAGNAAAA  123

Query  467  lmarlapkaKVLRDG  511
            LMA LAPK KVLRDG
Sbjct  124  LMANLAPKTKVLRDG  138



>gb|AEO22063.1| plasma membrane H+-ATPase [Aeluropus littoralis]
Length=951

 Score =   135 bits (341),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 110/135 (81%), Positives = 120/135 (89%), Gaps = 0/135 (0%)
 Frame = +2

Query  107  LDAVLKETVDLENIPIEEVFENLRCTKDGLTSQAAQERLDIFGHNkleekkeskflkflg  286
            L+ +  E VDLENIP+EEVFE L+CT++GL+S+   +RL +FG NKLEEKKESK LKFLG
Sbjct  4    LEEIKNEAVDLENIPMEEVFEQLKCTREGLSSEEGTQRLQVFGPNKLEEKKESKVLKFLG  63

Query  287  fMWNPLSWVMEaaaimaialaNGGGKPPDWQDFVGIITLLVINSTISFIEEnnagnaaaa  466
            FMWNPLSWVME AAIMAIALANGGGKPPDWQDFVGII LLVINSTISFIEENNAGNAAAA
Sbjct  64   FMWNPLSWVMEMAAIMAIALANGGGKPPDWQDFVGIIVLLVINSTISFIEENNAGNAAAA  123

Query  467  lmarlapkaKVLRDG  511
            LMA LAPK KVLRDG
Sbjct  124  LMANLAPKTKVLRDG  138



>ref|XP_010094202.1| Plasma membrane ATPase 4 [Morus notabilis]
 gb|EXB55378.1| Plasma membrane ATPase 4 [Morus notabilis]
Length=957

 Score =   136 bits (342),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 111/140 (79%), Positives = 120/140 (86%), Gaps = 0/140 (0%)
 Frame = +2

Query  92   EKPEVLDAVLKETVDLENIPIEEVFENLRCTKDGLTSQAAQERLDIFGHNkleekkeskf  271
            +K   L+ +  ETVDLE IPIEEVFE L+CT++GLTS+    RL IFG NKLEEKKESK 
Sbjct  4    DKAISLEEIKNETVDLERIPIEEVFEQLKCTREGLTSEEGASRLQIFGPNKLEEKKESKL  63

Query  272  lkflgfMWNPLSWVMEaaaimaialaNGGGKPPDWQDFVGIITLLVINSTISFIEEnnag  451
            LKFLGFMWNPLSWVMEAAA+MAI LANG GKPPDWQDFVGI+ LLVINSTISFIEENNAG
Sbjct  64   LKFLGFMWNPLSWVMEAAALMAIVLANGDGKPPDWQDFVGIVCLLVINSTISFIEENNAG  123

Query  452  naaaalmarlapkaKVLRDG  511
            NAAAALMA LAPK KVLRDG
Sbjct  124  NAAAALMAGLAPKTKVLRDG  143



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 557408213115